data_2FD6
# 
_entry.id   2FD6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FD6         
RCSB  RCSB035735   
WWPDB D_1000035735 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2fat 
_pdbx_database_related.details        'Crystal Structure of ATN-615' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FD6 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huang, M.' 1 
'Huai, Q.'  2 
'Li, Y.'    3 
# 
_citation.id                        primary 
_citation.title                     'Structure of human urokinase plasminogen activator in complex with its receptor' 
_citation.journal_abbrev            Science 
_citation.journal_volume            311 
_citation.page_first                656 
_citation.page_last                 659 
_citation.year                      2006 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16456079 
_citation.pdbx_database_id_DOI      10.1126/science.1121143 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Huai, Q.'     1  
primary 'Mazar, A.P.'  2  
primary 'Kuo, A.'      3  
primary 'Parry, G.C.'  4  
primary 'Shaw, D.E.'   5  
primary 'Callahan, J.' 6  
primary 'Li, Y.'       7  
primary 'Yuan, C.'     8  
primary 'Bian, C.'     9  
primary 'Chen, L.'     10 
primary 'Furie, B.'    11 
primary 'Furie, B.C.'  12 
primary 'Cines, D.B.'  13 
primary 'Huang, M.'    14 
# 
_cell.entry_id           2FD6 
_cell.length_a           51.792 
_cell.length_b           86.805 
_cell.length_c           124.690 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.54 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2FD6 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Urokinase-type plasminogen activator'             13892.803 1   3.4.21.73 ? 'Amino terminal residues 31-152' ? 
2  polymer     nat 'L chain of Fab of ATN-615 anti-uPAR antibody'     23437.885 1   ?         ? ?                                ? 
3  polymer     nat 'H chain of Fab of ATN-615 anti-uPAR antibody'     22984.684 1   ?         ? ?                                ? 
4  polymer     man 'Urokinase plasminogen activator surface receptor' 30668.418 1   ?         ? 'residues 23-297'                ? 
5  non-polymer syn 'SULFATE ION'                                      96.063    1   ?         ? ?                                ? 
6  non-polymer syn 2-ETHOXYETHANOL                                    90.121    3   ?         ? ?                                ? 
7  non-polymer syn 1,2-ETHANEDIOL                                     62.068    2   ?         ? ?                                ? 
8  non-polymer syn 'TRIETHYLENE GLYCOL'                               150.173   1   ?         ? ?                                ? 
9  non-polymer man N-ACETYL-D-GLUCOSAMINE                             221.208   3   ?         ? ?                                ? 
10 non-polymer man ALPHA-L-FUCOSE                                     164.156   1   ?         ? ?                                ? 
11 non-polymer man '2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE'        221.208   1   ?         ? ?                                ? 
12 non-polymer syn 'TETRAETHYLENE GLYCOL'                             194.226   1   ?         ? ?                                ? 
13 water       nat water                                              18.015    336 ?         ? ?                                ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        'uPAR, U-PAR, Monocyte activation antigen Mo3, CD87 antigen' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;CDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSD
ALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCA
;
;CDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSD
ALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCA
;
A ? 
2 'polypeptide(L)' no no 
;DIVLTQSPDITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIFEISKLASGVPARFSGSGSGTSYSLTISSMEAE
DAAIYYCQQWNYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNS
WTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEAKA
;
;DIVLTQSPDITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIFEISKLASGVPARFSGSGSGTSYSLTISSMEAE
DAAIYYCQQWNYPFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNS
WTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEAKA
;
L ? 
3 'polypeptide(L)' no no 
;GVKLQQSGPEVVKPGASVKISCKASGYSFTNFYIHWVKQRPGQGLEWIGWIFHGSDNTEYNEKFKDKATLTADTSSSTAY
MQLSSLTSEDSAVYFCARWGPHWYFDVWGQGTTVTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLS
SGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIAAA
;
;GVKLQQSGPEVVKPGASVKISCKASGYSFTNFYIHWVKQRPGQGLEWIGWIFHGSDNTEYNEKFKDKATLTADTSSSTAY
MQLSSLTSEDSAVYFCARWGPHWYFDVWGQGTTVTVSSAKTTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLS
SGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIAAA
;
H ? 
4 'polypeptide(L)' no no 
;SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQG
NSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGF
HNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVR
GCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPD
;
;SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQG
NSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGF
HNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVR
GCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPD
;
U ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   ASP n 
1 3   CYS n 
1 4   LEU n 
1 5   ASN n 
1 6   GLY n 
1 7   GLY n 
1 8   THR n 
1 9   CYS n 
1 10  VAL n 
1 11  SER n 
1 12  ASN n 
1 13  LYS n 
1 14  TYR n 
1 15  PHE n 
1 16  SER n 
1 17  ASN n 
1 18  ILE n 
1 19  HIS n 
1 20  TRP n 
1 21  CYS n 
1 22  ASN n 
1 23  CYS n 
1 24  PRO n 
1 25  LYS n 
1 26  LYS n 
1 27  PHE n 
1 28  GLY n 
1 29  GLY n 
1 30  GLN n 
1 31  HIS n 
1 32  CYS n 
1 33  GLU n 
1 34  ILE n 
1 35  ASP n 
1 36  LYS n 
1 37  SER n 
1 38  LYS n 
1 39  THR n 
1 40  CYS n 
1 41  TYR n 
1 42  GLU n 
1 43  GLY n 
1 44  ASN n 
1 45  GLY n 
1 46  HIS n 
1 47  PHE n 
1 48  TYR n 
1 49  ARG n 
1 50  GLY n 
1 51  LYS n 
1 52  ALA n 
1 53  SER n 
1 54  THR n 
1 55  ASP n 
1 56  THR n 
1 57  MET n 
1 58  GLY n 
1 59  ARG n 
1 60  PRO n 
1 61  CYS n 
1 62  LEU n 
1 63  PRO n 
1 64  TRP n 
1 65  ASN n 
1 66  SER n 
1 67  ALA n 
1 68  THR n 
1 69  VAL n 
1 70  LEU n 
1 71  GLN n 
1 72  GLN n 
1 73  THR n 
1 74  TYR n 
1 75  HIS n 
1 76  ALA n 
1 77  HIS n 
1 78  ARG n 
1 79  SER n 
1 80  ASP n 
1 81  ALA n 
1 82  LEU n 
1 83  GLN n 
1 84  LEU n 
1 85  GLY n 
1 86  LEU n 
1 87  GLY n 
1 88  LYS n 
1 89  HIS n 
1 90  ASN n 
1 91  TYR n 
1 92  CYS n 
1 93  ARG n 
1 94  ASN n 
1 95  PRO n 
1 96  ASP n 
1 97  ASN n 
1 98  ARG n 
1 99  ARG n 
1 100 ARG n 
1 101 PRO n 
1 102 TRP n 
1 103 CYS n 
1 104 TYR n 
1 105 VAL n 
1 106 GLN n 
1 107 VAL n 
1 108 GLY n 
1 109 LEU n 
1 110 LYS n 
1 111 PRO n 
1 112 LEU n 
1 113 VAL n 
1 114 GLN n 
1 115 GLU n 
1 116 CYS n 
1 117 MET n 
1 118 VAL n 
1 119 HIS n 
1 120 ASP n 
1 121 CYS n 
1 122 ALA n 
2 1   ASP n 
2 2   ILE n 
2 3   VAL n 
2 4   LEU n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   ASP n 
2 10  ILE n 
2 11  THR n 
2 12  ALA n 
2 13  ALA n 
2 14  SER n 
2 15  LEU n 
2 16  GLY n 
2 17  GLN n 
2 18  LYS n 
2 19  VAL n 
2 20  THR n 
2 21  ILE n 
2 22  THR n 
2 23  CYS n 
2 24  SER n 
2 25  ALA n 
2 26  SER n 
2 27  SER n 
2 28  SER n 
2 29  VAL n 
2 30  SER n 
2 31  TYR n 
2 32  MET n 
2 33  HIS n 
2 34  TRP n 
2 35  TYR n 
2 36  GLN n 
2 37  GLN n 
2 38  LYS n 
2 39  SER n 
2 40  GLY n 
2 41  THR n 
2 42  SER n 
2 43  PRO n 
2 44  LYS n 
2 45  PRO n 
2 46  TRP n 
2 47  ILE n 
2 48  PHE n 
2 49  GLU n 
2 50  ILE n 
2 51  SER n 
2 52  LYS n 
2 53  LEU n 
2 54  ALA n 
2 55  SER n 
2 56  GLY n 
2 57  VAL n 
2 58  PRO n 
2 59  ALA n 
2 60  ARG n 
2 61  PHE n 
2 62  SER n 
2 63  GLY n 
2 64  SER n 
2 65  GLY n 
2 66  SER n 
2 67  GLY n 
2 68  THR n 
2 69  SER n 
2 70  TYR n 
2 71  SER n 
2 72  LEU n 
2 73  THR n 
2 74  ILE n 
2 75  SER n 
2 76  SER n 
2 77  MET n 
2 78  GLU n 
2 79  ALA n 
2 80  GLU n 
2 81  ASP n 
2 82  ALA n 
2 83  ALA n 
2 84  ILE n 
2 85  TYR n 
2 86  TYR n 
2 87  CYS n 
2 88  GLN n 
2 89  GLN n 
2 90  TRP n 
2 91  ASN n 
2 92  TYR n 
2 93  PRO n 
2 94  PHE n 
2 95  THR n 
2 96  PHE n 
2 97  GLY n 
2 98  GLY n 
2 99  GLY n 
2 100 THR n 
2 101 LYS n 
2 102 LEU n 
2 103 GLU n 
2 104 ILE n 
2 105 LYS n 
2 106 ARG n 
2 107 ALA n 
2 108 ASP n 
2 109 ALA n 
2 110 ALA n 
2 111 PRO n 
2 112 THR n 
2 113 VAL n 
2 114 SER n 
2 115 ILE n 
2 116 PHE n 
2 117 PRO n 
2 118 PRO n 
2 119 SER n 
2 120 SER n 
2 121 GLU n 
2 122 GLN n 
2 123 LEU n 
2 124 THR n 
2 125 SER n 
2 126 GLY n 
2 127 GLY n 
2 128 ALA n 
2 129 SER n 
2 130 VAL n 
2 131 VAL n 
2 132 CYS n 
2 133 PHE n 
2 134 LEU n 
2 135 ASN n 
2 136 ASN n 
2 137 PHE n 
2 138 TYR n 
2 139 PRO n 
2 140 LYS n 
2 141 ASP n 
2 142 ILE n 
2 143 ASN n 
2 144 VAL n 
2 145 LYS n 
2 146 TRP n 
2 147 LYS n 
2 148 ILE n 
2 149 ASP n 
2 150 GLY n 
2 151 SER n 
2 152 GLU n 
2 153 ARG n 
2 154 GLN n 
2 155 ASN n 
2 156 GLY n 
2 157 VAL n 
2 158 LEU n 
2 159 ASN n 
2 160 SER n 
2 161 TRP n 
2 162 THR n 
2 163 ASP n 
2 164 GLN n 
2 165 ASP n 
2 166 SER n 
2 167 LYS n 
2 168 ASP n 
2 169 SER n 
2 170 THR n 
2 171 TYR n 
2 172 SER n 
2 173 MET n 
2 174 SER n 
2 175 SER n 
2 176 THR n 
2 177 LEU n 
2 178 THR n 
2 179 LEU n 
2 180 THR n 
2 181 LYS n 
2 182 ASP n 
2 183 GLU n 
2 184 TYR n 
2 185 GLU n 
2 186 ARG n 
2 187 HIS n 
2 188 ASN n 
2 189 SER n 
2 190 TYR n 
2 191 THR n 
2 192 CYS n 
2 193 GLU n 
2 194 ALA n 
2 195 THR n 
2 196 HIS n 
2 197 LYS n 
2 198 THR n 
2 199 SER n 
2 200 THR n 
2 201 SER n 
2 202 PRO n 
2 203 ILE n 
2 204 VAL n 
2 205 LYS n 
2 206 SER n 
2 207 PHE n 
2 208 ASN n 
2 209 ARG n 
2 210 ASN n 
2 211 GLU n 
2 212 ALA n 
2 213 LYS n 
2 214 ALA n 
3 1   GLY n 
3 2   VAL n 
3 3   LYS n 
3 4   LEU n 
3 5   GLN n 
3 6   GLN n 
3 7   SER n 
3 8   GLY n 
3 9   PRO n 
3 10  GLU n 
3 11  VAL n 
3 12  VAL n 
3 13  LYS n 
3 14  PRO n 
3 15  GLY n 
3 16  ALA n 
3 17  SER n 
3 18  VAL n 
3 19  LYS n 
3 20  ILE n 
3 21  SER n 
3 22  CYS n 
3 23  LYS n 
3 24  ALA n 
3 25  SER n 
3 26  GLY n 
3 27  TYR n 
3 28  SER n 
3 29  PHE n 
3 30  THR n 
3 31  ASN n 
3 32  PHE n 
3 33  TYR n 
3 34  ILE n 
3 35  HIS n 
3 36  TRP n 
3 37  VAL n 
3 38  LYS n 
3 39  GLN n 
3 40  ARG n 
3 41  PRO n 
3 42  GLY n 
3 43  GLN n 
3 44  GLY n 
3 45  LEU n 
3 46  GLU n 
3 47  TRP n 
3 48  ILE n 
3 49  GLY n 
3 50  TRP n 
3 51  ILE n 
3 52  PHE n 
3 53  HIS n 
3 54  GLY n 
3 55  SER n 
3 56  ASP n 
3 57  ASN n 
3 58  THR n 
3 59  GLU n 
3 60  TYR n 
3 61  ASN n 
3 62  GLU n 
3 63  LYS n 
3 64  PHE n 
3 65  LYS n 
3 66  ASP n 
3 67  LYS n 
3 68  ALA n 
3 69  THR n 
3 70  LEU n 
3 71  THR n 
3 72  ALA n 
3 73  ASP n 
3 74  THR n 
3 75  SER n 
3 76  SER n 
3 77  SER n 
3 78  THR n 
3 79  ALA n 
3 80  TYR n 
3 81  MET n 
3 82  GLN n 
3 83  LEU n 
3 84  SER n 
3 85  SER n 
3 86  LEU n 
3 87  THR n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  SER n 
3 92  ALA n 
3 93  VAL n 
3 94  TYR n 
3 95  PHE n 
3 96  CYS n 
3 97  ALA n 
3 98  ARG n 
3 99  TRP n 
3 100 GLY n 
3 101 PRO n 
3 102 HIS n 
3 103 TRP n 
3 104 TYR n 
3 105 PHE n 
3 106 ASP n 
3 107 VAL n 
3 108 TRP n 
3 109 GLY n 
3 110 GLN n 
3 111 GLY n 
3 112 THR n 
3 113 THR n 
3 114 VAL n 
3 115 THR n 
3 116 VAL n 
3 117 SER n 
3 118 SER n 
3 119 ALA n 
3 120 LYS n 
3 121 THR n 
3 122 THR n 
3 123 PRO n 
3 124 PRO n 
3 125 SER n 
3 126 VAL n 
3 127 TYR n 
3 128 PRO n 
3 129 LEU n 
3 130 ALA n 
3 131 PRO n 
3 132 GLY n 
3 133 ASN n 
3 134 SER n 
3 135 MET n 
3 136 VAL n 
3 137 THR n 
3 138 LEU n 
3 139 GLY n 
3 140 CYS n 
3 141 LEU n 
3 142 VAL n 
3 143 LYS n 
3 144 GLY n 
3 145 TYR n 
3 146 PHE n 
3 147 PRO n 
3 148 GLU n 
3 149 PRO n 
3 150 VAL n 
3 151 THR n 
3 152 VAL n 
3 153 THR n 
3 154 TRP n 
3 155 ASN n 
3 156 SER n 
3 157 GLY n 
3 158 SER n 
3 159 LEU n 
3 160 SER n 
3 161 SER n 
3 162 GLY n 
3 163 VAL n 
3 164 HIS n 
3 165 THR n 
3 166 PHE n 
3 167 PRO n 
3 168 ALA n 
3 169 VAL n 
3 170 LEU n 
3 171 GLN n 
3 172 SER n 
3 173 ASP n 
3 174 LEU n 
3 175 TYR n 
3 176 THR n 
3 177 LEU n 
3 178 SER n 
3 179 SER n 
3 180 SER n 
3 181 VAL n 
3 182 THR n 
3 183 VAL n 
3 184 PRO n 
3 185 SER n 
3 186 SER n 
3 187 THR n 
3 188 TRP n 
3 189 PRO n 
3 190 SER n 
3 191 GLU n 
3 192 THR n 
3 193 VAL n 
3 194 THR n 
3 195 CYS n 
3 196 ASN n 
3 197 VAL n 
3 198 ALA n 
3 199 HIS n 
3 200 PRO n 
3 201 ALA n 
3 202 SER n 
3 203 SER n 
3 204 THR n 
3 205 LYS n 
3 206 VAL n 
3 207 ASP n 
3 208 LYS n 
3 209 LYS n 
3 210 ILE n 
3 211 ALA n 
3 212 ALA n 
3 213 ALA n 
4 1   SER n 
4 2   LEU n 
4 3   ARG n 
4 4   CYS n 
4 5   MET n 
4 6   GLN n 
4 7   CYS n 
4 8   LYS n 
4 9   THR n 
4 10  ASN n 
4 11  GLY n 
4 12  ASP n 
4 13  CYS n 
4 14  ARG n 
4 15  VAL n 
4 16  GLU n 
4 17  GLU n 
4 18  CYS n 
4 19  ALA n 
4 20  LEU n 
4 21  GLY n 
4 22  GLN n 
4 23  ASP n 
4 24  LEU n 
4 25  CYS n 
4 26  ARG n 
4 27  THR n 
4 28  THR n 
4 29  ILE n 
4 30  VAL n 
4 31  ARG n 
4 32  LEU n 
4 33  TRP n 
4 34  GLU n 
4 35  GLU n 
4 36  GLY n 
4 37  GLU n 
4 38  GLU n 
4 39  LEU n 
4 40  GLU n 
4 41  LEU n 
4 42  VAL n 
4 43  GLU n 
4 44  LYS n 
4 45  SER n 
4 46  CYS n 
4 47  THR n 
4 48  HIS n 
4 49  SER n 
4 50  GLU n 
4 51  LYS n 
4 52  THR n 
4 53  ASN n 
4 54  ARG n 
4 55  THR n 
4 56  LEU n 
4 57  SER n 
4 58  TYR n 
4 59  ARG n 
4 60  THR n 
4 61  GLY n 
4 62  LEU n 
4 63  LYS n 
4 64  ILE n 
4 65  THR n 
4 66  SER n 
4 67  LEU n 
4 68  THR n 
4 69  GLU n 
4 70  VAL n 
4 71  VAL n 
4 72  CYS n 
4 73  GLY n 
4 74  LEU n 
4 75  ASP n 
4 76  LEU n 
4 77  CYS n 
4 78  ASN n 
4 79  GLN n 
4 80  GLY n 
4 81  ASN n 
4 82  SER n 
4 83  GLY n 
4 84  ARG n 
4 85  ALA n 
4 86  VAL n 
4 87  THR n 
4 88  TYR n 
4 89  SER n 
4 90  ARG n 
4 91  SER n 
4 92  ARG n 
4 93  TYR n 
4 94  LEU n 
4 95  GLU n 
4 96  CYS n 
4 97  ILE n 
4 98  SER n 
4 99  CYS n 
4 100 GLY n 
4 101 SER n 
4 102 SER n 
4 103 ASP n 
4 104 MET n 
4 105 SER n 
4 106 CYS n 
4 107 GLU n 
4 108 ARG n 
4 109 GLY n 
4 110 ARG n 
4 111 HIS n 
4 112 GLN n 
4 113 SER n 
4 114 LEU n 
4 115 GLN n 
4 116 CYS n 
4 117 ARG n 
4 118 SER n 
4 119 PRO n 
4 120 GLU n 
4 121 GLU n 
4 122 GLN n 
4 123 CYS n 
4 124 LEU n 
4 125 ASP n 
4 126 VAL n 
4 127 VAL n 
4 128 THR n 
4 129 HIS n 
4 130 TRP n 
4 131 ILE n 
4 132 GLN n 
4 133 GLU n 
4 134 GLY n 
4 135 GLU n 
4 136 GLU n 
4 137 GLY n 
4 138 ARG n 
4 139 PRO n 
4 140 LYS n 
4 141 ASP n 
4 142 ASP n 
4 143 ARG n 
4 144 HIS n 
4 145 LEU n 
4 146 ARG n 
4 147 GLY n 
4 148 CYS n 
4 149 GLY n 
4 150 TYR n 
4 151 LEU n 
4 152 PRO n 
4 153 GLY n 
4 154 CYS n 
4 155 PRO n 
4 156 GLY n 
4 157 SER n 
4 158 ASN n 
4 159 GLY n 
4 160 PHE n 
4 161 HIS n 
4 162 ASN n 
4 163 ASN n 
4 164 ASP n 
4 165 THR n 
4 166 PHE n 
4 167 HIS n 
4 168 PHE n 
4 169 LEU n 
4 170 LYS n 
4 171 CYS n 
4 172 CYS n 
4 173 ASN n 
4 174 THR n 
4 175 THR n 
4 176 LYS n 
4 177 CYS n 
4 178 ASN n 
4 179 GLU n 
4 180 GLY n 
4 181 PRO n 
4 182 ILE n 
4 183 LEU n 
4 184 GLU n 
4 185 LEU n 
4 186 GLU n 
4 187 ASN n 
4 188 LEU n 
4 189 PRO n 
4 190 GLN n 
4 191 ASN n 
4 192 GLY n 
4 193 ARG n 
4 194 GLN n 
4 195 CYS n 
4 196 TYR n 
4 197 SER n 
4 198 CYS n 
4 199 LYS n 
4 200 GLY n 
4 201 ASN n 
4 202 SER n 
4 203 THR n 
4 204 HIS n 
4 205 GLY n 
4 206 CYS n 
4 207 SER n 
4 208 SER n 
4 209 GLU n 
4 210 GLU n 
4 211 THR n 
4 212 PHE n 
4 213 LEU n 
4 214 ILE n 
4 215 ASP n 
4 216 CYS n 
4 217 ARG n 
4 218 GLY n 
4 219 PRO n 
4 220 MET n 
4 221 ASN n 
4 222 GLN n 
4 223 CYS n 
4 224 LEU n 
4 225 VAL n 
4 226 ALA n 
4 227 THR n 
4 228 GLY n 
4 229 THR n 
4 230 HIS n 
4 231 GLU n 
4 232 PRO n 
4 233 LYS n 
4 234 ASN n 
4 235 GLN n 
4 236 SER n 
4 237 TYR n 
4 238 MET n 
4 239 VAL n 
4 240 ARG n 
4 241 GLY n 
4 242 CYS n 
4 243 ALA n 
4 244 THR n 
4 245 ALA n 
4 246 SER n 
4 247 MET n 
4 248 CYS n 
4 249 GLN n 
4 250 HIS n 
4 251 ALA n 
4 252 HIS n 
4 253 LEU n 
4 254 GLY n 
4 255 ASP n 
4 256 ALA n 
4 257 PHE n 
4 258 SER n 
4 259 MET n 
4 260 ASN n 
4 261 HIS n 
4 262 ILE n 
4 263 ASP n 
4 264 VAL n 
4 265 SER n 
4 266 CYS n 
4 267 CYS n 
4 268 THR n 
4 269 LYS n 
4 270 SER n 
4 271 GLY n 
4 272 CYS n 
4 273 ASN n 
4 274 HIS n 
4 275 PRO n 
4 276 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fruit flies' Drosophila 7215 Drosophila ? ? ? ? ? ? ? 
'S2 cells' ? ? ? ? ? ? pMT-Bip-V5-His ? ? ? ? ? 
4 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fruit flies' Drosophila 7215 Drosophila ? ? ? ? ? ? ? 
'S2 cells' ? ? ? ? ? ? pMT-Bip-V5-His ? ? ? ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
2 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? 'ascite liquid' ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? 'ascite liquid' ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP UROK_HUMAN   P00749 1 31 ? ? 
2 UNP Q52L64_MOUSE Q52L64 2 46 ? ? 
3 UNP Q4V9V8_MOUSE Q4V9V8 3 21 ? ? 
4 UNP UPAR_HUMAN   Q03405 4 23 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2FD6 A 1  ? 122 ? P00749 31 ? 152 ? 11 132 
2 2 2FD6 L 26 ? 211 ? Q52L64 46 ? 239 ? 26 212 
3 3 2FD6 H 2  ? 197 ? Q4V9V8 21 ? 223 ? 2  192 
4 4 2FD6 U 3  ? 276 ? Q03405 23 ? 297 ? 2  275 
# 
_struct_ref_seq_dif.align_id                     4 
_struct_ref_seq_dif.pdbx_pdb_id_code             2FD6 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           U 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            A 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q03405 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'CLONING ARTIFACT' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                     ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                    ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                              'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
ETX non-polymer         . 2-ETHOXYETHANOL                             ?                 'C4 H10 O2'      90.121  
FUC saccharide          . ALPHA-L-FUCOSE                              ?                 'C6 H12 O5'      164.156 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                       ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                      ?                 'C8 H15 N O6'    221.208 
NDG D-saccharide        . '2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE' ?                 'C8 H15 N O6'    221.208 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL'                      ?                 'C8 H18 O5'      194.226 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'                        ?                 'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                      ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                               ?                 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                                   ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                    ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                      ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2FD6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.07 
_exptl_crystal.density_percent_sol   59.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          MICRODIALYSIS 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'4% PEG4000, 5% ethylene glycol, 5% methanol, 0.05% sodium azide, 50 mM cacodylate, pH 6.5, MICRODIALYSIS, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 90 ? 1 
2 ?  ? 1 
3 ?  ? 1 
4 ?  ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD MARRESEARCH 2005-04-09 ? 
2 CCD ?           ?          ? 
3 CCD ?           ?          ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.00 1.0 
2 1.0  1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'APS BEAMLINE 22-ID' APS  22-ID ? 1.00 
2 SYNCHROTRON 'NSLS BEAMLINE X25'  NSLS X25   ? 1.00 
3 SYNCHROTRON 'NSLS BEAMLINE X12C' NSLS X12C  ? 1.0  
4 SYNCHROTRON 'APS BEAMLINE 17-ID' APS  17-ID ? ?    
# 
_reflns.entry_id                     2FD6 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             41.36 
_reflns.d_resolution_high            1.85 
_reflns.number_obs                   86852 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.5 
_reflns.pdbx_Rmerge_I_obs            0.064 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.1 
_reflns.B_iso_Wilson_estimate        21.0 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              2.08 
_reflns_shell.percent_possible_all   77.5 
_reflns_shell.Rmerge_I_obs           0.338 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.97 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2FD6 
_refine.ls_number_reflns_obs                     83101 
_refine.ls_number_reflns_all                     86852 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1755432.42 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.36 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    95.8 
_refine.ls_R_factor_obs                          0.239 
_refine.ls_R_factor_all                          0.239 
_refine.ls_R_factor_R_work                       0.239 
_refine.ls_R_factor_R_free                       0.276 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  4228 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               32.9 
_refine.aniso_B[1][1]                            -0.31 
_refine.aniso_B[2][2]                            4.95 
_refine.aniso_B[3][3]                            -4.64 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -3.70 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.429597 
_refine.solvent_model_param_bsol                 300 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2FAT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2FD6 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             0.36 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6139 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         125 
_refine_hist.number_atoms_solvent             336 
_refine_hist.number_atoms_total               6600 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        41.36 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.90  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        ?     1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       ?     2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        ?     2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       ?     2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             10624 
_refine_ls_shell.R_factor_R_work                  0.403 
_refine_ls_shell.percent_reflns_obs               77.6 
_refine_ls_shell.R_factor_R_free                  0.41 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             559 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param  protein.top 'X-RAY DIFFRACTION' 
2 temp.dummy         ?           'X-RAY DIFFRACTION' 
3 carbohydrate.param ?           'X-RAY DIFFRACTION' 
4 water_rep.param    ?           'X-RAY DIFFRACTION' 
5 ion.param          ?           'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2FD6 
_struct.title                     
'Structure of Human Urokinase Plasminogen Activator in Complex with Urokinase Receptor and an anti-upar antibody at 1.9 A' 
_struct.pdbx_descriptor           
;Urokinase-type plasminogen activator (EC 3.4.21.73) (uPA) (U-plasminogen activator) [Contains: Urokinase-type plasminogen activator long chain A; Urokinase-type plasminogen activator short chain A; Urokinase-type plasminogen activator chain B], L chain of Fab of ATN-615 anti-uPAR antibody   
, H chain of Fab of ATN-615 anti-uPAR antibody   
, Urokinase plasminogen activator surface receptor
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FD6 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM, HYDROLASE' 
_struct_keywords.text            'uPAR, ATF, ATN-615 antibody, Fab, ternary complex, IMMUNE SYSTEM, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 6  ? 
I N N 6  ? 
J N N 7  ? 
K N N 8  ? 
L N N 9  ? 
M N N 10 ? 
N N N 9  ? 
O N N 9  ? 
P N N 11 ? 
Q N N 12 ? 
R N N 13 ? 
S N N 13 ? 
T N N 13 ? 
U N N 13 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 68  ? GLN A 72  ? THR A 78  GLN A 82  5 ? 5 
HELX_P HELX_P2  2  ASP A 80  ? GLY A 85  ? ASP A 90  GLY A 95  1 ? 6 
HELX_P HELX_P3  3  GLU B 78  ? ALA B 82  ? GLU L 79  ALA L 83  5 ? 5 
HELX_P HELX_P4  4  SER B 119 ? SER B 125 ? SER L 120 SER L 126 1 ? 7 
HELX_P HELX_P5  5  LYS B 181 ? ARG B 186 ? LYS L 182 ARG L 187 1 ? 6 
HELX_P HELX_P6  6  SER C 28  ? ASN C 31  ? SER H 28  ASN H 31  5 ? 4 
HELX_P HELX_P7  7  GLU C 62  ? LYS C 65  ? GLU H 61  LYS H 64  5 ? 4 
HELX_P HELX_P8  8  THR C 74  ? SER C 76  ? THR H 73  SER H 75  5 ? 3 
HELX_P HELX_P9  9  THR C 87  ? SER C 91  ? THR H 83  SER H 87  5 ? 5 
HELX_P HELX_P10 10 SER C 156 ? SER C 158 ? SER H 151 SER H 153 5 ? 3 
HELX_P HELX_P11 11 PRO C 200 ? SER C 203 ? PRO H 195 SER H 198 5 ? 4 
HELX_P HELX_P12 12 GLU D 184 ? LEU D 188 ? GLU U 183 LEU U 187 5 ? 5 
HELX_P HELX_P13 13 ALA D 245 ? CYS D 248 ? ALA U 244 CYS U 247 5 ? 4 
HELX_P HELX_P14 14 LEU D 253 ? SER D 258 ? LEU U 252 SER U 257 5 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 3   SG  ? ? ? 1_555 A CYS 21  SG ? ? A CYS 13  A CYS 31  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2  disulf ? ? A CYS 23  SG  ? ? ? 1_555 A CYS 32  SG ? ? A CYS 33  A CYS 42  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3  disulf ? ? A CYS 40  SG  ? ? ? 1_555 A CYS 121 SG ? ? A CYS 50  A CYS 131 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf4  disulf ? ? A CYS 61  SG  ? ? ? 1_555 A CYS 103 SG ? ? A CYS 71  A CYS 113 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf5  disulf ? ? A CYS 92  SG  ? ? ? 1_555 A CYS 116 SG ? ? A CYS 102 A CYS 126 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf6  disulf ? ? B CYS 23  SG  ? ? ? 1_555 B CYS 87  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf7  disulf ? ? B CYS 132 SG  ? ? ? 1_555 B CYS 192 SG ? ? L CYS 133 L CYS 193 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf8  disulf ? ? C CYS 22  SG  ? ? ? 1_555 C CYS 96  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf9  disulf ? ? C CYS 140 SG  ? ? ? 1_555 C CYS 195 SG ? ? H CYS 135 H CYS 190 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf10 disulf ? ? D CYS 4   SG  ? ? ? 1_555 D CYS 25  SG ? ? U CYS 3   U CYS 24  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf11 disulf ? ? D CYS 7   SG  ? ? ? 1_555 D CYS 13  SG ? ? U CYS 6   U CYS 12  1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf12 disulf ? ? D CYS 18  SG  ? ? ? 1_555 D CYS 46  SG ? ? U CYS 17  U CYS 45  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf13 disulf ? ? D CYS 72  SG  ? ? ? 1_555 D CYS 77  SG ? ? U CYS 71  U CYS 76  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf14 disulf ? ? D CYS 96  SG  ? ? ? 1_555 D CYS 123 SG ? ? U CYS 95  U CYS 122 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf15 disulf ? ? D CYS 99  SG  ? ? ? 1_555 D CYS 106 SG ? ? U CYS 98  U CYS 105 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf16 disulf ? ? D CYS 116 SG  ? ? ? 1_555 D CYS 148 SG ? ? U CYS 115 U CYS 147 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf17 disulf ? ? D CYS 154 SG  ? ? ? 1_555 D CYS 171 SG ? ? U CYS 153 U CYS 170 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf18 disulf ? ? D CYS 172 SG  ? ? ? 1_555 D CYS 177 SG ? ? U CYS 171 U CYS 176 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf19 disulf ? ? D CYS 195 SG  ? ? ? 1_555 D CYS 223 SG ? ? U CYS 194 U CYS 222 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf20 disulf ? ? D CYS 198 SG  ? ? ? 1_555 D CYS 206 SG ? ? U CYS 197 U CYS 205 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf21 disulf ? ? D CYS 216 SG  ? ? ? 1_555 D CYS 242 SG ? ? U CYS 215 U CYS 241 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf22 disulf ? ? D CYS 248 SG  ? ? ? 1_555 D CYS 266 SG ? ? U CYS 247 U CYS 265 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf23 disulf ? ? D CYS 267 SG  ? ? ? 1_555 D CYS 272 SG ? ? U CYS 266 U CYS 271 1_555 ? ? ? ? ? ? ? 2.026 ? 
covale1  covale ? ? D ASN 53  ND2 ? ? ? 1_555 L NAG .   C1 ? ? U ASN 52  U NAG 452 1_555 ? ? ? ? ? ? ? 1.679 ? 
covale2  covale ? ? N NAG .   O4  ? ? ? 1_555 O NAG .   C1 ? ? U NAG 472 U NAG 473 1_555 ? ? ? ? ? ? ? 1.554 ? 
covale3  covale ? ? D ASN 173 ND2 ? ? ? 1_555 N NAG .   C1 ? ? U ASN 172 U NAG 472 1_555 ? ? ? ? ? ? ? 1.991 ? 
covale4  covale ? ? L NAG .   O6  ? ? ? 1_555 M FUC .   C1 ? ? U NAG 452 U FUC 453 1_555 ? ? ? ? ? ? ? 1.137 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7   B . ? SER 7   L PRO 8   B ? PRO 8   L 1 0.04  
2 TYR 138 B . ? TYR 139 L PRO 139 B ? PRO 140 L 1 0.00  
3 PHE 146 C . ? PHE 141 H PRO 147 C ? PRO 142 H 1 -0.04 
4 GLU 148 C . ? GLU 143 H PRO 149 C ? PRO 144 H 1 -0.41 
5 TRP 188 C . ? TRP 183 H PRO 189 C ? PRO 184 H 1 -0.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2  ? 
B ? 2  ? 
C ? 2  ? 
D ? 4  ? 
E ? 6  ? 
F ? 4  ? 
G ? 4  ? 
H ? 4  ? 
I ? 6  ? 
J ? 4  ? 
K ? 4  ? 
L ? 4  ? 
M ? 3  ? 
N ? 2  ? 
O ? 11 ? 
P ? 9  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
B 1  2  ? anti-parallel 
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
E 1  2  ? parallel      
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? anti-parallel 
I 1  2  ? parallel      
I 2  3  ? anti-parallel 
I 3  4  ? anti-parallel 
I 4  5  ? anti-parallel 
I 5  6  ? anti-parallel 
J 1  2  ? parallel      
J 2  3  ? anti-parallel 
J 3  4  ? anti-parallel 
K 1  2  ? anti-parallel 
K 2  3  ? anti-parallel 
K 3  4  ? anti-parallel 
L 1  2  ? anti-parallel 
L 2  3  ? anti-parallel 
L 3  4  ? anti-parallel 
M 1  2  ? anti-parallel 
M 2  3  ? anti-parallel 
N 1  2  ? anti-parallel 
O 1  2  ? anti-parallel 
O 2  3  ? anti-parallel 
O 3  4  ? anti-parallel 
O 4  5  ? anti-parallel 
O 5  6  ? anti-parallel 
O 6  7  ? anti-parallel 
O 7  8  ? anti-parallel 
O 8  9  ? anti-parallel 
O 9  10 ? anti-parallel 
O 10 11 ? anti-parallel 
P 1  2  ? anti-parallel 
P 2  3  ? anti-parallel 
P 3  4  ? anti-parallel 
P 4  5  ? anti-parallel 
P 5  6  ? anti-parallel 
P 6  7  ? anti-parallel 
P 7  8  ? anti-parallel 
P 8  9  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  THR A 8   ? SER A 11  ? THR A 18  SER A 21  
A 2  HIS A 19  ? ASN A 22  ? HIS A 29  ASN A 32  
B 1  PHE A 27  ? GLY A 28  ? PHE A 37  GLY A 38  
B 2  ILE A 34  ? ASP A 35  ? ILE A 44  ASP A 45  
C 1  TRP A 102 ? VAL A 107 ? TRP A 112 VAL A 117 
C 2  LYS A 110 ? GLU A 115 ? LYS A 120 GLU A 125 
D 1  LEU B 4   ? SER B 7   ? LEU L 4   SER L 7   
D 2  VAL B 19  ? ALA B 25  ? VAL L 19  ALA L 25  
D 3  SER B 69  ? ILE B 74  ? SER L 70  ILE L 75  
D 4  PHE B 61  ? SER B 66  ? PHE L 62  SER L 67  
E 1  ILE B 10  ? ALA B 13  ? ILE L 10  ALA L 13  
E 2  THR B 100 ? ILE B 104 ? THR L 102 ILE L 106 
E 3  ALA B 83  ? GLN B 89  ? ALA L 84  GLN L 90  
E 4  MET B 32  ? GLN B 37  ? MET L 33  GLN L 38  
E 5  LYS B 44  ? PHE B 48  ? LYS L 45  PHE L 49  
E 6  LYS B 52  ? LEU B 53  ? LYS L 53  LEU L 54  
F 1  THR B 112 ? PHE B 116 ? THR L 113 PHE L 117 
F 2  GLY B 127 ? PHE B 137 ? GLY L 128 PHE L 138 
F 3  TYR B 171 ? THR B 180 ? TYR L 172 THR L 181 
F 4  VAL B 157 ? TRP B 161 ? VAL L 158 TRP L 162 
G 1  SER B 151 ? ARG B 153 ? SER L 152 ARG L 154 
G 2  ASN B 143 ? ILE B 148 ? ASN L 144 ILE L 149 
G 3  SER B 189 ? THR B 195 ? SER L 190 THR L 196 
G 4  ILE B 203 ? ASN B 208 ? ILE L 204 ASN L 209 
H 1  LYS C 3   ? GLN C 6   ? LYS H 3   GLN H 6   
H 2  VAL C 18  ? SER C 25  ? VAL H 18  SER H 25  
H 3  THR C 78  ? LEU C 83  ? THR H 77  LEU H 82  
H 4  ALA C 68  ? ASP C 73  ? ALA H 67  ASP H 72  
I 1  GLU C 10  ? VAL C 12  ? GLU H 10  VAL H 12  
I 2  THR C 112 ? VAL C 116 ? THR H 107 VAL H 111 
I 3  ALA C 92  ? TRP C 99  ? ALA H 88  TRP H 95  
I 4  TYR C 33  ? GLN C 39  ? TYR H 33  GLN H 39  
I 5  GLU C 46  ? PHE C 52  ? GLU H 46  PHE H 52  
I 6  THR C 58  ? TYR C 60  ? THR H 57  TYR H 59  
J 1  GLU C 10  ? VAL C 12  ? GLU H 10  VAL H 12  
J 2  THR C 112 ? VAL C 116 ? THR H 107 VAL H 111 
J 3  ALA C 92  ? TRP C 99  ? ALA H 88  TRP H 95  
J 4  PHE C 105 A TRP C 108 ? PHE H 100 TRP H 103 
K 1  SER C 125 ? PRO C 128 ? SER H 120 PRO H 123 
K 2  CYS C 140 ? TYR C 145 ? CYS H 135 TYR H 140 
K 3  LEU C 174 ? VAL C 181 ? LEU H 169 VAL H 176 
K 4  VAL C 163 ? THR C 165 ? VAL H 158 THR H 160 
L 1  SER C 125 ? PRO C 128 ? SER H 120 PRO H 123 
L 2  CYS C 140 ? TYR C 145 ? CYS H 135 TYR H 140 
L 3  LEU C 174 ? VAL C 181 ? LEU H 169 VAL H 176 
L 4  VAL C 169 ? GLN C 171 ? VAL H 164 GLN H 166 
M 1  THR C 151 ? TRP C 154 ? THR H 146 TRP H 149 
M 2  THR C 194 ? HIS C 199 ? THR H 189 HIS H 194 
M 3  THR C 204 ? LYS C 209 ? THR H 199 LYS H 204 
N 1  ARG D 3   ? CYS D 7   ? ARG U 2   CYS U 6   
N 2  CYS D 13  ? GLU D 17  ? CYS U 12  GLU U 16  
O 1  LEU D 39  ? THR D 47  ? LEU U 38  THR U 46  
O 2  LEU D 24  ? TRP D 33  ? LEU U 23  TRP U 32  
O 3  LYS D 63  ? CYS D 72  ? LYS U 62  CYS U 71  
O 4  ARG D 54  ? THR D 60  ? ARG U 53  THR U 59  
O 5  HIS D 144 ? TYR D 150 ? HIS U 143 TYR U 149 
O 6  GLN D 122 ? HIS D 129 ? GLN U 121 HIS U 128 
O 7  THR D 165 ? CYS D 172 ? THR U 164 CYS U 171 
O 8  GLY D 156 ? ASN D 162 ? GLY U 155 ASN U 161 
O 9  GLN D 235 ? ALA D 243 ? GLN U 234 ALA U 242 
O 10 GLN D 190 ? GLY D 200 ? GLN U 189 GLY U 199 
O 11 PHE D 212 ? ARG D 217 ? PHE U 211 ARG U 216 
P 1  GLN D 112 ? GLN D 115 ? GLN U 111 GLN U 114 
P 2  GLU D 95  ? GLY D 100 ? GLU U 94  GLY U 99  
P 3  HIS D 144 ? TYR D 150 ? HIS U 143 TYR U 149 
P 4  GLN D 122 ? HIS D 129 ? GLN U 121 HIS U 128 
P 5  THR D 165 ? CYS D 172 ? THR U 164 CYS U 171 
P 6  GLY D 156 ? ASN D 162 ? GLY U 155 ASN U 161 
P 7  GLN D 235 ? ALA D 243 ? GLN U 234 ALA U 242 
P 8  GLN D 222 ? HIS D 230 ? GLN U 221 HIS U 229 
P 9  ASP D 263 ? CYS D 267 ? ASP U 262 CYS U 266 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N THR A 8   ? N THR A 18  O ASN A 22  ? O ASN A 32  
B 1  2  N GLY A 28  ? N GLY A 38  O ILE A 34  ? O ILE A 44  
C 1  2  N VAL A 105 ? N VAL A 115 O LEU A 112 ? O LEU A 122 
D 1  2  N THR B 5   ? N THR L 5   O SER B 24  ? O SER L 24  
D 2  3  N CYS B 23  ? N CYS L 23  O TYR B 70  ? O TYR L 71  
D 3  4  O THR B 73  ? O THR L 74  N SER B 62  ? N SER L 63  
E 1  2  N THR B 11  ? N THR L 11  O GLU B 103 ? O GLU L 105 
E 2  3  O LEU B 102 ? O LEU L 104 N ALA B 83  ? N ALA L 84  
E 3  4  O ILE B 84  ? O ILE L 85  N GLN B 37  ? N GLN L 38  
E 4  5  N TRP B 34  ? N TRP L 35  O ILE B 47  ? O ILE L 48  
E 5  6  N PHE B 48  ? N PHE L 49  O LYS B 52  ? O LYS L 53  
F 1  2  N PHE B 116 ? N PHE L 117 O VAL B 131 ? O VAL L 132 
F 2  3  N VAL B 130 ? N VAL L 131 O LEU B 177 ? O LEU L 178 
F 3  4  O THR B 176 ? O THR L 177 N LEU B 158 ? N LEU L 159 
G 1  2  O SER B 151 ? O SER L 152 N ILE B 148 ? N ILE L 149 
G 2  3  N ASN B 143 ? N ASN L 144 O THR B 195 ? O THR L 196 
G 3  4  N CYS B 192 ? N CYS L 193 O LYS B 205 ? O LYS L 206 
H 1  2  N GLN C 5   ? N GLN H 5   O LYS C 23  ? O LYS H 23  
H 2  3  N VAL C 18  ? N VAL H 18  O LEU C 83  ? O LEU H 82  
H 3  4  O THR C 78  ? O THR H 77  N ASP C 73  ? N ASP H 72  
I 1  2  N GLU C 10  ? N GLU H 10  O THR C 115 ? O THR H 110 
I 2  3  O VAL C 114 ? O VAL H 109 N ALA C 92  ? N ALA H 88  
I 3  4  O ALA C 97  ? O ALA H 93  N HIS C 35  ? N HIS H 35  
I 4  5  N TRP C 36  ? N TRP H 36  O ILE C 48  ? O ILE H 48  
I 5  6  N TRP C 50  ? N TRP H 50  O GLU C 59  ? O GLU H 58  
J 1  2  N GLU C 10  ? N GLU H 10  O THR C 115 ? O THR H 110 
J 2  3  O VAL C 114 ? O VAL H 109 N ALA C 92  ? N ALA H 88  
J 3  4  N ARG C 98  ? N ARG H 94  O VAL C 107 ? O VAL H 102 
K 1  2  N TYR C 127 ? N TYR H 122 O LEU C 141 ? O LEU H 136 
K 2  3  N VAL C 142 ? N VAL H 137 O LEU C 177 ? O LEU H 172 
K 3  4  O SER C 180 ? O SER H 175 N HIS C 164 ? N HIS H 159 
L 1  2  N TYR C 127 ? N TYR H 122 O LEU C 141 ? O LEU H 136 
L 2  3  N VAL C 142 ? N VAL H 137 O LEU C 177 ? O LEU H 172 
L 3  4  O LEU C 174 ? O LEU H 169 N GLN C 171 ? N GLN H 166 
M 1  2  N THR C 153 ? N THR H 148 O ASN C 196 ? O ASN H 191 
M 2  3  N VAL C 197 ? N VAL H 192 O VAL C 206 ? O VAL H 201 
N 1  2  N GLN D 6   ? N GLN U 5   O ARG D 14  ? O ARG U 13  
O 1  2  O THR D 47  ? O THR U 46  N LEU D 24  ? N LEU U 23  
O 2  3  N CYS D 25  ? N CYS U 24  O CYS D 72  ? O CYS U 71  
O 3  4  O LEU D 67  ? O LEU U 66  N LEU D 56  ? N LEU U 55  
O 4  5  N SER D 57  ? N SER U 56  O CYS D 148 ? O CYS U 147 
O 5  6  O GLY D 149 ? O GLY U 148 N GLN D 122 ? N GLN U 121 
O 6  7  N VAL D 127 ? N VAL U 126 O PHE D 168 ? O PHE U 167 
O 7  8  O CYS D 171 ? O CYS U 170 N GLY D 156 ? N GLY U 155 
O 8  9  N HIS D 161 ? N HIS U 160 O CYS D 242 ? O CYS U 241 
O 9  10 O MET D 238 ? O MET U 237 N GLY D 200 ? N GLY U 199 
O 10 11 N ARG D 193 ? N ARG U 192 O CYS D 216 ? O CYS U 215 
P 1  2  O GLN D 112 ? O GLN U 111 N SER D 98  ? N SER U 97  
P 2  3  N CYS D 99  ? N CYS U 98  O ARG D 146 ? O ARG U 145 
P 3  4  O GLY D 149 ? O GLY U 148 N GLN D 122 ? N GLN U 121 
P 4  5  N VAL D 127 ? N VAL U 126 O PHE D 168 ? O PHE U 167 
P 5  6  O CYS D 171 ? O CYS U 170 N GLY D 156 ? N GLY U 155 
P 6  7  N HIS D 161 ? N HIS U 160 O CYS D 242 ? O CYS U 241 
P 7  8  O VAL D 239 ? O VAL U 238 N ALA D 226 ? N ALA U 225 
P 8  9  N CYS D 223 ? N CYS U 222 O CYS D 267 ? O CYS U 266 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 501' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ETX L 401' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO L 405' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ETX L 407' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ETX H 403' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO H 404' 
AC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PGE H 406' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NAG U 452' 
AC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE FUC U 453' 
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NAG U 472' 
BC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NAG U 473' 
BC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NDG U 400' 
BC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PG4 U 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASP A 2   ? ASP A 12  . ? 1_555 ? 
2  AC1 6  HIS A 19  ? HIS A 29  . ? 1_555 ? 
3  AC1 6  HIS A 31  ? HIS A 41  . ? 1_555 ? 
4  AC1 6  HOH R .   ? HOH A 511 . ? 1_555 ? 
5  AC1 6  HOH R .   ? HOH A 523 . ? 1_555 ? 
6  AC1 6  HOH U .   ? HOH U 501 . ? 1_555 ? 
7  AC2 6  ASP B 1   ? ASP L 1   . ? 1_555 ? 
8  AC2 6  ILE B 2   ? ILE L 2   . ? 1_555 ? 
9  AC2 6  GLN B 89  ? GLN L 90  . ? 1_555 ? 
10 AC2 6  ASN B 91  ? ASN L 92  . ? 1_555 ? 
11 AC2 6  PRO B 93  ? PRO L 94  . ? 1_555 ? 
12 AC2 6  HOH S .   ? HOH L 444 . ? 1_555 ? 
13 AC3 2  PRO B 45  ? PRO L 46  . ? 1_555 ? 
14 AC3 2  SER B 55  ? SER L 56  . ? 1_555 ? 
15 AC4 4  TYR B 92  ? TYR L 93  . ? 1_555 ? 
16 AC4 4  HOH S .   ? HOH L 489 . ? 1_555 ? 
17 AC4 4  GLY D 192 ? GLY U 191 . ? 1_555 ? 
18 AC4 4  GLN D 194 ? GLN U 193 . ? 1_555 ? 
19 AC5 5  LYS C 23  ? LYS H 23  . ? 1_555 ? 
20 AC5 5  SER C 76  ? SER H 75  . ? 1_555 ? 
21 AC5 5  THR C 78  ? THR H 77  . ? 1_555 ? 
22 AC5 5  HOH T .   ? HOH H 410 . ? 1_555 ? 
23 AC5 5  HOH T .   ? HOH H 427 . ? 1_555 ? 
24 AC6 3  LYS C 19  ? LYS H 19  . ? 1_555 ? 
25 AC6 3  THR C 71  ? THR H 70  . ? 1_555 ? 
26 AC6 3  ALA C 72  ? ALA H 71  . ? 1_555 ? 
27 AC7 8  ASN C 31  ? ASN H 31  . ? 1_555 ? 
28 AC7 8  PHE C 32  ? PHE H 32  . ? 1_555 ? 
29 AC7 8  TYR C 33  ? TYR H 33  . ? 1_555 ? 
30 AC7 8  TRP C 99  ? TRP H 95  . ? 1_555 ? 
31 AC7 8  TRP C 103 ? TRP H 99  . ? 1_555 ? 
32 AC7 8  LEU D 188 ? LEU U 187 . ? 1_555 ? 
33 AC7 8  PRO D 219 ? PRO U 218 . ? 1_555 ? 
34 AC7 8  PG4 Q .   ? PG4 U 402 . ? 1_555 ? 
35 AC8 4  ASN D 53  ? ASN U 52  . ? 1_555 ? 
36 AC8 4  VAL D 71  ? VAL U 70  . ? 1_555 ? 
37 AC8 4  FUC M .   ? FUC U 453 . ? 1_555 ? 
38 AC8 4  HOH U .   ? HOH U 530 . ? 1_555 ? 
39 AC9 1  NAG L .   ? NAG U 452 . ? 1_555 ? 
40 BC1 2  ASN D 173 ? ASN U 172 . ? 1_555 ? 
41 BC1 2  NAG O .   ? NAG U 473 . ? 1_555 ? 
42 BC2 1  NAG N .   ? NAG U 472 . ? 1_555 ? 
43 BC3 3  ASN D 201 ? ASN U 200 . ? 1_555 ? 
44 BC3 3  THR D 203 ? THR U 202 . ? 1_555 ? 
45 BC3 3  HIS D 204 ? HIS U 203 . ? 1_555 ? 
46 BC4 12 ASN C 31  ? ASN H 31  . ? 1_555 ? 
47 BC4 12 PHE C 52  ? PHE H 52  . ? 1_555 ? 
48 BC4 12 HIS C 53  A HIS H 52  . ? 1_555 ? 
49 BC4 12 ASN C 57  ? ASN H 56  . ? 1_555 ? 
50 BC4 12 PGE K .   ? PGE H 406 . ? 1_555 ? 
51 BC4 12 PRO D 219 ? PRO U 218 . ? 1_555 ? 
52 BC4 12 ASN D 221 ? ASN U 220 . ? 1_555 ? 
53 BC4 12 GLN D 222 ? GLN U 221 . ? 1_555 ? 
54 BC4 12 THR D 244 ? THR U 243 . ? 1_555 ? 
55 BC4 12 ALA D 245 ? ALA U 244 . ? 1_555 ? 
56 BC4 12 HOH U .   ? HOH U 475 . ? 1_555 ? 
57 BC4 12 HOH U .   ? HOH U 486 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FD6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FD6 
_atom_sites.fract_transf_matrix[1][1]   0.019308 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001533 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011520 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008045 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1  1   ? 33.742 -24.210 68.310  1.00 69.08  ? 11  CYS A N   1 
ATOM   2    C CA  . CYS A 1  1   ? 35.001 -24.783 67.745  1.00 68.63  ? 11  CYS A CA  1 
ATOM   3    C C   . CYS A 1  1   ? 35.849 -25.380 68.860  1.00 67.42  ? 11  CYS A C   1 
ATOM   4    O O   . CYS A 1  1   ? 36.335 -24.653 69.724  1.00 68.19  ? 11  CYS A O   1 
ATOM   5    C CB  . CYS A 1  1   ? 35.795 -23.690 67.027  1.00 69.27  ? 11  CYS A CB  1 
ATOM   6    S SG  . CYS A 1  1   ? 37.423 -24.209 66.432  1.00 70.79  ? 11  CYS A SG  1 
ATOM   7    N N   . ASP A 1  2   ? 36.029 -26.699 68.844  1.00 65.84  ? 12  ASP A N   1 
ATOM   8    C CA  . ASP A 1  2   ? 36.818 -27.355 69.877  1.00 63.78  ? 12  ASP A CA  1 
ATOM   9    C C   . ASP A 1  2   ? 38.218 -27.787 69.443  1.00 61.44  ? 12  ASP A C   1 
ATOM   10   O O   . ASP A 1  2   ? 38.744 -28.778 69.945  1.00 60.55  ? 12  ASP A O   1 
ATOM   11   C CB  . ASP A 1  2   ? 36.055 -28.558 70.470  1.00 65.41  ? 12  ASP A CB  1 
ATOM   12   C CG  . ASP A 1  2   ? 35.541 -29.526 69.415  1.00 66.41  ? 12  ASP A CG  1 
ATOM   13   O OD1 . ASP A 1  2   ? 36.218 -29.728 68.392  1.00 65.80  ? 12  ASP A OD1 1 
ATOM   14   O OD2 . ASP A 1  2   ? 34.457 -30.109 69.619  1.00 68.70  ? 12  ASP A OD2 1 
ATOM   15   N N   . CYS A 1  3   ? 38.828 -27.035 68.528  1.00 59.42  ? 13  CYS A N   1 
ATOM   16   C CA  . CYS A 1  3   ? 40.179 -27.349 68.056  1.00 60.70  ? 13  CYS A CA  1 
ATOM   17   C C   . CYS A 1  3   ? 41.229 -26.816 69.030  1.00 61.82  ? 13  CYS A C   1 
ATOM   18   O O   . CYS A 1  3   ? 40.976 -25.869 69.772  1.00 62.33  ? 13  CYS A O   1 
ATOM   19   C CB  . CYS A 1  3   ? 40.428 -26.735 66.681  1.00 60.33  ? 13  CYS A CB  1 
ATOM   20   S SG  . CYS A 1  3   ? 39.181 -27.172 65.435  1.00 60.22  ? 13  CYS A SG  1 
ATOM   21   N N   . LEU A 1  4   ? 42.414 -27.414 69.013  1.00 61.44  ? 14  LEU A N   1 
ATOM   22   C CA  . LEU A 1  4   ? 43.481 -26.998 69.914  1.00 62.08  ? 14  LEU A CA  1 
ATOM   23   C C   . LEU A 1  4   ? 44.673 -26.429 69.150  1.00 64.71  ? 14  LEU A C   1 
ATOM   24   O O   . LEU A 1  4   ? 44.836 -26.691 67.953  1.00 64.05  ? 14  LEU A O   1 
ATOM   25   C CB  . LEU A 1  4   ? 43.927 -28.190 70.766  1.00 59.98  ? 14  LEU A CB  1 
ATOM   26   C CG  . LEU A 1  4   ? 42.804 -28.936 71.488  1.00 56.58  ? 14  LEU A CG  1 
ATOM   27   C CD1 . LEU A 1  4   ? 43.368 -30.168 72.161  1.00 57.01  ? 14  LEU A CD1 1 
ATOM   28   C CD2 . LEU A 1  4   ? 42.137 -28.019 72.497  1.00 57.40  ? 14  LEU A CD2 1 
ATOM   29   N N   . ASN A 1  5   ? 45.502 -25.657 69.855  1.00 67.48  ? 15  ASN A N   1 
ATOM   30   C CA  . ASN A 1  5   ? 46.687 -25.030 69.268  1.00 70.11  ? 15  ASN A CA  1 
ATOM   31   C C   . ASN A 1  5   ? 46.281 -24.066 68.151  1.00 70.68  ? 15  ASN A C   1 
ATOM   32   O O   . ASN A 1  5   ? 45.457 -23.174 68.362  1.00 72.26  ? 15  ASN A O   1 
ATOM   33   C CB  . ASN A 1  5   ? 47.640 -26.104 68.727  1.00 69.62  ? 15  ASN A CB  1 
ATOM   34   C CG  . ASN A 1  5   ? 48.313 -26.895 69.834  1.00 70.32  ? 15  ASN A CG  1 
ATOM   35   O OD1 . ASN A 1  5   ? 49.128 -26.358 70.588  1.00 70.99  ? 15  ASN A OD1 1 
ATOM   36   N ND2 . ASN A 1  5   ? 47.974 -28.175 69.941  1.00 68.25  ? 15  ASN A ND2 1 
ATOM   37   N N   . GLY A 1  6   ? 46.865 -24.238 66.971  1.00 69.52  ? 16  GLY A N   1 
ATOM   38   C CA  . GLY A 1  6   ? 46.509 -23.383 65.855  1.00 70.54  ? 16  GLY A CA  1 
ATOM   39   C C   . GLY A 1  6   ? 45.537 -24.137 64.969  1.00 70.20  ? 16  GLY A C   1 
ATOM   40   O O   . GLY A 1  6   ? 45.891 -24.549 63.863  1.00 72.33  ? 16  GLY A O   1 
ATOM   41   N N   . GLY A 1  7   ? 44.309 -24.314 65.449  1.00 67.86  ? 17  GLY A N   1 
ATOM   42   C CA  . GLY A 1  7   ? 43.329 -25.064 64.684  1.00 65.68  ? 17  GLY A CA  1 
ATOM   43   C C   . GLY A 1  7   ? 42.140 -24.321 64.113  1.00 62.64  ? 17  GLY A C   1 
ATOM   44   O O   . GLY A 1  7   ? 41.449 -23.578 64.816  1.00 61.10  ? 17  GLY A O   1 
ATOM   45   N N   . THR A 1  8   ? 41.901 -24.549 62.824  1.00 60.17  ? 18  THR A N   1 
ATOM   46   C CA  . THR A 1  8   ? 40.791 -23.937 62.098  1.00 58.82  ? 18  THR A CA  1 
ATOM   47   C C   . THR A 1  8   ? 39.707 -25.005 61.909  1.00 55.84  ? 18  THR A C   1 
ATOM   48   O O   . THR A 1  8   ? 39.944 -26.034 61.273  1.00 54.41  ? 18  THR A O   1 
ATOM   49   C CB  . THR A 1  8   ? 41.249 -23.439 60.714  1.00 59.50  ? 18  THR A CB  1 
ATOM   50   O OG1 . THR A 1  8   ? 42.433 -22.642 60.860  1.00 60.81  ? 18  THR A OG1 1 
ATOM   51   C CG2 . THR A 1  8   ? 40.151 -22.608 60.059  1.00 61.05  ? 18  THR A CG2 1 
ATOM   52   N N   . CYS A 1  9   ? 38.522 -24.749 62.456  1.00 52.87  ? 19  CYS A N   1 
ATOM   53   C CA  . CYS A 1  9   ? 37.411 -25.694 62.383  1.00 51.04  ? 19  CYS A CA  1 
ATOM   54   C C   . CYS A 1  9   ? 36.718 -25.733 61.028  1.00 49.95  ? 19  CYS A C   1 
ATOM   55   O O   . CYS A 1  9   ? 36.657 -24.733 60.316  1.00 49.43  ? 19  CYS A O   1 
ATOM   56   C CB  . CYS A 1  9   ? 36.382 -25.366 63.473  1.00 51.05  ? 19  CYS A CB  1 
ATOM   57   S SG  . CYS A 1  9   ? 35.096 -26.615 63.728  1.00 58.63  ? 19  CYS A SG  1 
ATOM   58   N N   . VAL A 1  10  ? 36.193 -26.905 60.686  1.00 49.62  ? 20  VAL A N   1 
ATOM   59   C CA  . VAL A 1  10  ? 35.484 -27.105 59.431  1.00 48.21  ? 20  VAL A CA  1 
ATOM   60   C C   . VAL A 1  10  ? 34.491 -28.252 59.555  1.00 47.56  ? 20  VAL A C   1 
ATOM   61   O O   . VAL A 1  10  ? 34.690 -29.179 60.335  1.00 48.04  ? 20  VAL A O   1 
ATOM   62   C CB  . VAL A 1  10  ? 36.448 -27.432 58.284  1.00 47.09  ? 20  VAL A CB  1 
ATOM   63   C CG1 . VAL A 1  10  ? 37.284 -28.630 58.648  1.00 48.16  ? 20  VAL A CG1 1 
ATOM   64   C CG2 . VAL A 1  10  ? 35.668 -27.714 57.013  1.00 47.70  ? 20  VAL A CG2 1 
ATOM   65   N N   . SER A 1  11  ? 33.414 -28.178 58.785  1.00 46.70  ? 21  SER A N   1 
ATOM   66   C CA  . SER A 1  11  ? 32.400 -29.218 58.790  1.00 46.10  ? 21  SER A CA  1 
ATOM   67   C C   . SER A 1  11  ? 31.730 -29.266 57.422  1.00 47.39  ? 21  SER A C   1 
ATOM   68   O O   . SER A 1  11  ? 32.063 -28.482 56.532  1.00 47.56  ? 21  SER A O   1 
ATOM   69   C CB  . SER A 1  11  ? 31.361 -28.947 59.879  1.00 46.84  ? 21  SER A CB  1 
ATOM   70   O OG  . SER A 1  11  ? 30.668 -27.736 59.643  1.00 51.53  ? 21  SER A OG  1 
ATOM   71   N N   . ASN A 1  12  ? 30.793 -30.193 57.257  1.00 48.00  ? 22  ASN A N   1 
ATOM   72   C CA  . ASN A 1  12  ? 30.086 -30.341 55.995  1.00 46.12  ? 22  ASN A CA  1 
ATOM   73   C C   . ASN A 1  12  ? 28.600 -30.607 56.231  1.00 45.69  ? 22  ASN A C   1 
ATOM   74   O O   . ASN A 1  12  ? 28.228 -31.602 56.853  1.00 45.82  ? 22  ASN A O   1 
ATOM   75   C CB  . ASN A 1  12  ? 30.703 -31.481 55.190  1.00 44.61  ? 22  ASN A CB  1 
ATOM   76   C CG  . ASN A 1  12  ? 30.291 -31.446 53.735  1.00 45.12  ? 22  ASN A CG  1 
ATOM   77   O OD1 . ASN A 1  12  ? 31.125 -31.256 52.844  1.00 45.90  ? 22  ASN A OD1 1 
ATOM   78   N ND2 . ASN A 1  12  ? 28.998 -31.617 53.482  1.00 42.26  ? 22  ASN A ND2 1 
ATOM   79   N N   . LYS A 1  13  ? 27.762 -29.708 55.719  1.00 44.52  ? 23  LYS A N   1 
ATOM   80   C CA  . LYS A 1  13  ? 26.310 -29.798 55.866  1.00 43.68  ? 23  LYS A CA  1 
ATOM   81   C C   . LYS A 1  13  ? 25.699 -31.079 55.321  1.00 42.88  ? 23  LYS A C   1 
ATOM   82   O O   . LYS A 1  13  ? 24.623 -31.491 55.758  1.00 42.28  ? 23  LYS A O   1 
ATOM   83   C CB  . LYS A 1  13  ? 25.635 -28.606 55.179  1.00 44.78  ? 23  LYS A CB  1 
ATOM   84   C CG  . LYS A 1  13  ? 25.817 -28.562 53.663  1.00 48.62  ? 23  LYS A CG  1 
ATOM   85   C CD  . LYS A 1  13  ? 25.153 -27.327 53.045  1.00 48.76  ? 23  LYS A CD  1 
ATOM   86   C CE  . LYS A 1  13  ? 25.442 -27.206 51.544  1.00 46.90  ? 23  LYS A CE  1 
ATOM   87   N NZ  . LYS A 1  13  ? 24.957 -25.906 50.981  1.00 44.32  ? 23  LYS A NZ  1 
ATOM   88   N N   . TYR A 1  14  ? 26.377 -31.700 54.362  1.00 41.07  ? 24  TYR A N   1 
ATOM   89   C CA  . TYR A 1  14  ? 25.879 -32.922 53.752  1.00 42.76  ? 24  TYR A CA  1 
ATOM   90   C C   . TYR A 1  14  ? 26.234 -34.184 54.529  1.00 42.01  ? 24  TYR A C   1 
ATOM   91   O O   . TYR A 1  14  ? 25.628 -35.242 54.317  1.00 39.79  ? 24  TYR A O   1 
ATOM   92   C CB  . TYR A 1  14  ? 26.409 -33.057 52.320  1.00 45.47  ? 24  TYR A CB  1 
ATOM   93   C CG  . TYR A 1  14  ? 25.728 -32.178 51.286  1.00 48.69  ? 24  TYR A CG  1 
ATOM   94   C CD1 . TYR A 1  14  ? 26.333 -31.009 50.826  1.00 49.54  ? 24  TYR A CD1 1 
ATOM   95   C CD2 . TYR A 1  14  ? 24.504 -32.550 50.723  1.00 49.85  ? 24  TYR A CD2 1 
ATOM   96   C CE1 . TYR A 1  14  ? 25.738 -30.234 49.820  1.00 53.47  ? 24  TYR A CE1 1 
ATOM   97   C CE2 . TYR A 1  14  ? 23.903 -31.784 49.723  1.00 50.77  ? 24  TYR A CE2 1 
ATOM   98   C CZ  . TYR A 1  14  ? 24.526 -30.629 49.271  1.00 52.99  ? 24  TYR A CZ  1 
ATOM   99   O OH  . TYR A 1  14  ? 23.952 -29.889 48.258  1.00 51.25  ? 24  TYR A OH  1 
ATOM   100  N N   . PHE A 1  15  ? 27.209 -34.079 55.429  1.00 42.09  ? 25  PHE A N   1 
ATOM   101  C CA  . PHE A 1  15  ? 27.637 -35.241 56.209  1.00 41.81  ? 25  PHE A CA  1 
ATOM   102  C C   . PHE A 1  15  ? 27.442 -35.147 57.720  1.00 41.87  ? 25  PHE A C   1 
ATOM   103  O O   . PHE A 1  15  ? 28.401 -35.230 58.490  1.00 40.88  ? 25  PHE A O   1 
ATOM   104  C CB  . PHE A 1  15  ? 29.096 -35.567 55.891  1.00 37.74  ? 25  PHE A CB  1 
ATOM   105  C CG  . PHE A 1  15  ? 29.321 -35.938 54.458  1.00 37.60  ? 25  PHE A CG  1 
ATOM   106  C CD1 . PHE A 1  15  ? 29.390 -34.955 53.475  1.00 36.36  ? 25  PHE A CD1 1 
ATOM   107  C CD2 . PHE A 1  15  ? 29.412 -37.275 54.081  1.00 38.02  ? 25  PHE A CD2 1 
ATOM   108  C CE1 . PHE A 1  15  ? 29.543 -35.297 52.141  1.00 36.88  ? 25  PHE A CE1 1 
ATOM   109  C CE2 . PHE A 1  15  ? 29.565 -37.631 52.747  1.00 36.58  ? 25  PHE A CE2 1 
ATOM   110  C CZ  . PHE A 1  15  ? 29.630 -36.639 51.773  1.00 38.58  ? 25  PHE A CZ  1 
ATOM   111  N N   . SER A 1  16  ? 26.188 -34.989 58.130  1.00 42.85  ? 26  SER A N   1 
ATOM   112  C CA  . SER A 1  16  ? 25.830 -34.898 59.539  1.00 45.02  ? 26  SER A CA  1 
ATOM   113  C C   . SER A 1  16  ? 26.608 -33.808 60.271  1.00 46.49  ? 26  SER A C   1 
ATOM   114  O O   . SER A 1  16  ? 26.618 -33.756 61.503  1.00 46.54  ? 26  SER A O   1 
ATOM   115  C CB  . SER A 1  16  ? 26.053 -36.257 60.213  1.00 46.66  ? 26  SER A CB  1 
ATOM   116  O OG  . SER A 1  16  ? 25.293 -37.270 59.571  1.00 45.84  ? 26  SER A OG  1 
ATOM   117  N N   . ASN A 1  17  ? 27.256 -32.940 59.501  1.00 49.27  ? 27  ASN A N   1 
ATOM   118  C CA  . ASN A 1  17  ? 28.032 -31.838 60.057  1.00 53.39  ? 27  ASN A CA  1 
ATOM   119  C C   . ASN A 1  17  ? 29.205 -32.267 60.935  1.00 52.85  ? 27  ASN A C   1 
ATOM   120  O O   . ASN A 1  17  ? 29.665 -31.503 61.791  1.00 52.42  ? 27  ASN A O   1 
ATOM   121  C CB  . ASN A 1  17  ? 27.115 -30.890 60.840  1.00 57.57  ? 27  ASN A CB  1 
ATOM   122  C CG  . ASN A 1  17  ? 26.284 -29.997 59.928  1.00 61.99  ? 27  ASN A CG  1 
ATOM   123  O OD1 . ASN A 1  17  ? 26.822 -29.194 59.155  1.00 61.70  ? 27  ASN A OD1 1 
ATOM   124  N ND2 . ASN A 1  17  ? 24.967 -30.133 60.014  1.00 66.58  ? 27  ASN A ND2 1 
ATOM   125  N N   . ILE A 1  18  ? 29.682 -33.490 60.730  1.00 51.44  ? 28  ILE A N   1 
ATOM   126  C CA  . ILE A 1  18  ? 30.825 -33.983 61.487  1.00 48.93  ? 28  ILE A CA  1 
ATOM   127  C C   . ILE A 1  18  ? 31.894 -32.901 61.304  1.00 50.03  ? 28  ILE A C   1 
ATOM   128  O O   . ILE A 1  18  ? 31.995 -32.305 60.229  1.00 50.37  ? 28  ILE A O   1 
ATOM   129  C CB  . ILE A 1  18  ? 31.323 -35.338 60.914  1.00 47.75  ? 28  ILE A CB  1 
ATOM   130  C CG1 . ILE A 1  18  ? 32.555 -35.816 61.686  1.00 48.80  ? 28  ILE A CG1 1 
ATOM   131  C CG2 . ILE A 1  18  ? 31.641 -35.195 59.428  1.00 44.86  ? 28  ILE A CG2 1 
ATOM   132  C CD1 . ILE A 1  18  ? 33.105 -37.151 61.208  1.00 49.74  ? 28  ILE A CD1 1 
ATOM   133  N N   . HIS A 1  19  ? 32.679 -32.627 62.341  1.00 48.67  ? 29  HIS A N   1 
ATOM   134  C CA  . HIS A 1  19  ? 33.701 -31.591 62.237  1.00 44.48  ? 29  HIS A CA  1 
ATOM   135  C C   . HIS A 1  19  ? 35.109 -32.091 62.505  1.00 43.54  ? 29  HIS A C   1 
ATOM   136  O O   . HIS A 1  19  ? 35.310 -33.144 63.112  1.00 42.60  ? 29  HIS A O   1 
ATOM   137  C CB  . HIS A 1  19  ? 33.421 -30.474 63.227  1.00 46.23  ? 29  HIS A CB  1 
ATOM   138  C CG  . HIS A 1  19  ? 33.640 -30.880 64.647  1.00 46.12  ? 29  HIS A CG  1 
ATOM   139  N ND1 . HIS A 1  19  ? 32.684 -31.540 65.388  1.00 46.15  ? 29  HIS A ND1 1 
ATOM   140  C CD2 . HIS A 1  19  ? 34.734 -30.788 65.439  1.00 45.81  ? 29  HIS A CD2 1 
ATOM   141  C CE1 . HIS A 1  19  ? 33.180 -31.839 66.575  1.00 45.62  ? 29  HIS A CE1 1 
ATOM   142  N NE2 . HIS A 1  19  ? 34.422 -31.394 66.631  1.00 46.61  ? 29  HIS A NE2 1 
ATOM   143  N N   . TRP A 1  20  ? 36.077 -31.303 62.052  1.00 42.97  ? 30  TRP A N   1 
ATOM   144  C CA  . TRP A 1  20  ? 37.490 -31.584 62.239  1.00 43.99  ? 30  TRP A CA  1 
ATOM   145  C C   . TRP A 1  20  ? 38.241 -30.258 62.143  1.00 45.94  ? 30  TRP A C   1 
ATOM   146  O O   . TRP A 1  20  ? 37.612 -29.198 62.169  1.00 45.57  ? 30  TRP A O   1 
ATOM   147  C CB  . TRP A 1  20  ? 37.990 -32.597 61.209  1.00 45.26  ? 30  TRP A CB  1 
ATOM   148  C CG  . TRP A 1  20  ? 37.833 -32.190 59.794  1.00 48.04  ? 30  TRP A CG  1 
ATOM   149  C CD1 . TRP A 1  20  ? 38.806 -31.708 58.967  1.00 49.40  ? 30  TRP A CD1 1 
ATOM   150  C CD2 . TRP A 1  20  ? 36.636 -32.252 59.014  1.00 47.11  ? 30  TRP A CD2 1 
ATOM   151  N NE1 . TRP A 1  20  ? 38.288 -31.469 57.717  1.00 50.79  ? 30  TRP A NE1 1 
ATOM   152  C CE2 . TRP A 1  20  ? 36.957 -31.794 57.720  1.00 48.89  ? 30  TRP A CE2 1 
ATOM   153  C CE3 . TRP A 1  20  ? 35.324 -32.650 59.283  1.00 44.82  ? 30  TRP A CE3 1 
ATOM   154  C CZ2 . TRP A 1  20  ? 36.012 -31.723 56.698  1.00 47.72  ? 30  TRP A CZ2 1 
ATOM   155  C CZ3 . TRP A 1  20  ? 34.389 -32.578 58.270  1.00 43.59  ? 30  TRP A CZ3 1 
ATOM   156  C CH2 . TRP A 1  20  ? 34.737 -32.118 56.992  1.00 45.09  ? 30  TRP A CH2 1 
ATOM   157  N N   . CYS A 1  21  ? 39.566 -30.293 62.035  1.00 47.70  ? 31  CYS A N   1 
ATOM   158  C CA  . CYS A 1  21  ? 40.318 -29.045 62.000  1.00 49.06  ? 31  CYS A CA  1 
ATOM   159  C C   . CYS A 1  21  ? 41.482 -29.004 61.024  1.00 49.97  ? 31  CYS A C   1 
ATOM   160  O O   . CYS A 1  21  ? 41.992 -30.035 60.591  1.00 48.29  ? 31  CYS A O   1 
ATOM   161  C CB  . CYS A 1  21  ? 40.868 -28.729 63.402  1.00 51.38  ? 31  CYS A CB  1 
ATOM   162  S SG  . CYS A 1  21  ? 39.735 -29.024 64.806  1.00 57.09  ? 31  CYS A SG  1 
ATOM   163  N N   . ASN A 1  22  ? 41.891 -27.783 60.692  1.00 52.40  ? 32  ASN A N   1 
ATOM   164  C CA  . ASN A 1  22  ? 43.029 -27.534 59.821  1.00 54.93  ? 32  ASN A CA  1 
ATOM   165  C C   . ASN A 1  22  ? 44.114 -27.150 60.813  1.00 56.02  ? 32  ASN A C   1 
ATOM   166  O O   . ASN A 1  22  ? 43.982 -26.149 61.519  1.00 54.06  ? 32  ASN A O   1 
ATOM   167  C CB  . ASN A 1  22  ? 42.744 -26.361 58.889  1.00 59.18  ? 32  ASN A CB  1 
ATOM   168  C CG  . ASN A 1  22  ? 41.668 -26.673 57.884  1.00 62.57  ? 32  ASN A CG  1 
ATOM   169  O OD1 . ASN A 1  22  ? 41.846 -27.534 57.027  1.00 67.94  ? 32  ASN A OD1 1 
ATOM   170  N ND2 . ASN A 1  22  ? 40.537 -25.981 57.983  1.00 62.33  ? 32  ASN A ND2 1 
ATOM   171  N N   . CYS A 1  23  ? 45.175 -27.947 60.876  1.00 58.13  ? 33  CYS A N   1 
ATOM   172  C CA  . CYS A 1  23  ? 46.258 -27.698 61.826  1.00 60.08  ? 33  CYS A CA  1 
ATOM   173  C C   . CYS A 1  23  ? 47.567 -27.311 61.165  1.00 61.31  ? 33  CYS A C   1 
ATOM   174  O O   . CYS A 1  23  ? 47.802 -27.631 59.999  1.00 63.90  ? 33  CYS A O   1 
ATOM   175  C CB  . CYS A 1  23  ? 46.520 -28.953 62.662  1.00 60.73  ? 33  CYS A CB  1 
ATOM   176  S SG  . CYS A 1  23  ? 45.052 -29.866 63.236  1.00 63.25  ? 33  CYS A SG  1 
ATOM   177  N N   . PRO A 1  24  ? 48.448 -26.619 61.905  1.00 61.36  ? 34  PRO A N   1 
ATOM   178  C CA  . PRO A 1  24  ? 49.725 -26.247 61.297  1.00 63.52  ? 34  PRO A CA  1 
ATOM   179  C C   . PRO A 1  24  ? 50.455 -27.540 60.951  1.00 66.42  ? 34  PRO A C   1 
ATOM   180  O O   . PRO A 1  24  ? 50.035 -28.615 61.374  1.00 66.79  ? 34  PRO A O   1 
ATOM   181  C CB  . PRO A 1  24  ? 50.414 -25.449 62.401  1.00 61.34  ? 34  PRO A CB  1 
ATOM   182  C CG  . PRO A 1  24  ? 49.802 -25.987 63.648  1.00 58.66  ? 34  PRO A CG  1 
ATOM   183  C CD  . PRO A 1  24  ? 48.358 -26.122 63.285  1.00 58.84  ? 34  PRO A CD  1 
ATOM   184  N N   . LYS A 1  25  ? 51.531 -27.447 60.179  1.00 70.06  ? 35  LYS A N   1 
ATOM   185  C CA  . LYS A 1  25  ? 52.278 -28.641 59.782  1.00 74.44  ? 35  LYS A CA  1 
ATOM   186  C C   . LYS A 1  25  ? 52.739 -29.508 60.962  1.00 74.21  ? 35  LYS A C   1 
ATOM   187  O O   . LYS A 1  25  ? 52.861 -30.732 60.831  1.00 73.89  ? 35  LYS A O   1 
ATOM   188  C CB  . LYS A 1  25  ? 53.507 -28.249 58.944  1.00 77.33  ? 35  LYS A CB  1 
ATOM   189  C CG  . LYS A 1  25  ? 54.364 -29.439 58.507  1.00 80.41  ? 35  LYS A CG  1 
ATOM   190  C CD  . LYS A 1  25  ? 55.772 -29.014 58.108  1.00 82.62  ? 35  LYS A CD  1 
ATOM   191  C CE  . LYS A 1  25  ? 56.646 -30.229 57.811  1.00 84.43  ? 35  LYS A CE  1 
ATOM   192  N NZ  . LYS A 1  25  ? 58.068 -29.861 57.546  1.00 84.83  ? 35  LYS A NZ  1 
ATOM   193  N N   . LYS A 1  26  ? 52.977 -28.882 62.113  1.00 72.27  ? 36  LYS A N   1 
ATOM   194  C CA  . LYS A 1  26  ? 53.468 -29.615 63.274  1.00 71.00  ? 36  LYS A CA  1 
ATOM   195  C C   . LYS A 1  26  ? 52.412 -30.156 64.244  1.00 68.34  ? 36  LYS A C   1 
ATOM   196  O O   . LYS A 1  26  ? 52.752 -30.608 65.338  1.00 69.37  ? 36  LYS A O   1 
ATOM   197  C CB  . LYS A 1  26  ? 54.476 -28.743 64.032  1.00 72.21  ? 36  LYS A CB  1 
ATOM   198  C CG  . LYS A 1  26  ? 55.508 -28.040 63.133  1.00 74.57  ? 36  LYS A CG  1 
ATOM   199  C CD  . LYS A 1  26  ? 56.346 -29.001 62.269  1.00 72.47  ? 36  LYS A CD  1 
ATOM   200  C CE  . LYS A 1  26  ? 57.244 -28.214 61.295  1.00 72.37  ? 36  LYS A CE  1 
ATOM   201  N NZ  . LYS A 1  26  ? 58.098 -29.062 60.407  1.00 69.10  ? 36  LYS A NZ  1 
ATOM   202  N N   . PHE A 1  27  ? 51.142 -30.125 63.849  1.00 64.59  ? 37  PHE A N   1 
ATOM   203  C CA  . PHE A 1  27  ? 50.067 -30.629 64.702  1.00 60.42  ? 37  PHE A CA  1 
ATOM   204  C C   . PHE A 1  27  ? 49.133 -31.577 63.956  1.00 57.10  ? 37  PHE A C   1 
ATOM   205  O O   . PHE A 1  27  ? 48.662 -31.261 62.867  1.00 58.03  ? 37  PHE A O   1 
ATOM   206  C CB  . PHE A 1  27  ? 49.261 -29.465 65.280  1.00 61.39  ? 37  PHE A CB  1 
ATOM   207  C CG  . PHE A 1  27  ? 49.947 -28.758 66.411  1.00 64.28  ? 37  PHE A CG  1 
ATOM   208  C CD1 . PHE A 1  27  ? 50.039 -29.350 67.662  1.00 64.97  ? 37  PHE A CD1 1 
ATOM   209  C CD2 . PHE A 1  27  ? 50.511 -27.504 66.225  1.00 65.79  ? 37  PHE A CD2 1 
ATOM   210  C CE1 . PHE A 1  27  ? 50.681 -28.701 68.710  1.00 65.47  ? 37  PHE A CE1 1 
ATOM   211  C CE2 . PHE A 1  27  ? 51.155 -26.847 67.265  1.00 63.81  ? 37  PHE A CE2 1 
ATOM   212  C CZ  . PHE A 1  27  ? 51.240 -27.446 68.508  1.00 64.03  ? 37  PHE A CZ  1 
ATOM   213  N N   . GLY A 1  28  ? 48.869 -32.738 64.551  1.00 53.42  ? 38  GLY A N   1 
ATOM   214  C CA  . GLY A 1  28  ? 47.989 -33.719 63.934  1.00 47.52  ? 38  GLY A CA  1 
ATOM   215  C C   . GLY A 1  28  ? 46.779 -34.065 64.790  1.00 44.70  ? 38  GLY A C   1 
ATOM   216  O O   . GLY A 1  28  ? 46.615 -33.532 65.891  1.00 43.75  ? 38  GLY A O   1 
ATOM   217  N N   . GLY A 1  29  ? 45.928 -34.954 64.284  1.00 41.37  ? 39  GLY A N   1 
ATOM   218  C CA  . GLY A 1  29  ? 44.739 -35.351 65.022  1.00 41.30  ? 39  GLY A CA  1 
ATOM   219  C C   . GLY A 1  29  ? 43.502 -34.517 64.721  1.00 40.68  ? 39  GLY A C   1 
ATOM   220  O O   . GLY A 1  29  ? 43.611 -33.338 64.387  1.00 41.89  ? 39  GLY A O   1 
ATOM   221  N N   . GLN A 1  30  ? 42.322 -35.122 64.851  1.00 39.70  ? 40  GLN A N   1 
ATOM   222  C CA  . GLN A 1  30  ? 41.067 -34.423 64.581  1.00 40.40  ? 40  GLN A CA  1 
ATOM   223  C C   . GLN A 1  30  ? 40.991 -33.009 65.160  1.00 42.48  ? 40  GLN A C   1 
ATOM   224  O O   . GLN A 1  30  ? 40.371 -32.127 64.560  1.00 44.80  ? 40  GLN A O   1 
ATOM   225  C CB  . GLN A 1  30  ? 39.866 -35.219 65.107  1.00 40.45  ? 40  GLN A CB  1 
ATOM   226  C CG  . GLN A 1  30  ? 38.526 -34.554 64.796  1.00 38.82  ? 40  GLN A CG  1 
ATOM   227  C CD  . GLN A 1  30  ? 37.347 -35.182 65.516  1.00 41.44  ? 40  GLN A CD  1 
ATOM   228  O OE1 . GLN A 1  30  ? 36.193 -34.826 65.266  1.00 40.44  ? 40  GLN A OE1 1 
ATOM   229  N NE2 . GLN A 1  30  ? 37.628 -36.111 66.419  1.00 43.69  ? 40  GLN A NE2 1 
ATOM   230  N N   . HIS A 1  31  ? 41.609 -32.788 66.319  1.00 42.02  ? 41  HIS A N   1 
ATOM   231  C CA  . HIS A 1  31  ? 41.566 -31.471 66.951  1.00 43.46  ? 41  HIS A CA  1 
ATOM   232  C C   . HIS A 1  31  ? 42.921 -30.782 67.097  1.00 44.42  ? 41  HIS A C   1 
ATOM   233  O O   . HIS A 1  31  ? 43.049 -29.831 67.868  1.00 41.50  ? 41  HIS A O   1 
ATOM   234  C CB  . HIS A 1  31  ? 40.911 -31.569 68.332  1.00 41.76  ? 41  HIS A CB  1 
ATOM   235  C CG  . HIS A 1  31  ? 39.478 -31.998 68.296  1.00 40.74  ? 41  HIS A CG  1 
ATOM   236  N ND1 . HIS A 1  31  ? 39.089 -33.292 68.017  1.00 43.32  ? 41  HIS A ND1 1 
ATOM   237  C CD2 . HIS A 1  31  ? 38.338 -31.299 68.498  1.00 38.27  ? 41  HIS A CD2 1 
ATOM   238  C CE1 . HIS A 1  31  ? 37.770 -33.368 68.050  1.00 41.94  ? 41  HIS A CE1 1 
ATOM   239  N NE2 . HIS A 1  31  ? 37.291 -32.172 68.339  1.00 41.37  ? 41  HIS A NE2 1 
ATOM   240  N N   . CYS A 1  32  ? 43.925 -31.252 66.363  1.00 48.46  ? 42  CYS A N   1 
ATOM   241  C CA  . CYS A 1  32  ? 45.260 -30.662 66.451  1.00 54.64  ? 42  CYS A CA  1 
ATOM   242  C C   . CYS A 1  32  ? 45.793 -30.874 67.868  1.00 56.73  ? 42  CYS A C   1 
ATOM   243  O O   . CYS A 1  32  ? 46.535 -30.039 68.396  1.00 59.38  ? 42  CYS A O   1 
ATOM   244  C CB  . CYS A 1  32  ? 45.203 -29.156 66.166  1.00 57.69  ? 42  CYS A CB  1 
ATOM   245  S SG  . CYS A 1  32  ? 44.273 -28.665 64.677  1.00 61.11  ? 42  CYS A SG  1 
ATOM   246  N N   . GLU A 1  33  ? 45.401 -31.990 68.482  1.00 56.84  ? 43  GLU A N   1 
ATOM   247  C CA  . GLU A 1  33  ? 45.814 -32.316 69.843  1.00 54.57  ? 43  GLU A CA  1 
ATOM   248  C C   . GLU A 1  33  ? 47.196 -32.962 69.892  1.00 53.99  ? 43  GLU A C   1 
ATOM   249  O O   . GLU A 1  33  ? 47.897 -32.849 70.892  1.00 53.12  ? 43  GLU A O   1 
ATOM   250  C CB  . GLU A 1  33  ? 44.792 -33.255 70.499  1.00 53.53  ? 43  GLU A CB  1 
ATOM   251  C CG  . GLU A 1  33  ? 44.779 -34.678 69.934  1.00 50.51  ? 43  GLU A CG  1 
ATOM   252  C CD  . GLU A 1  33  ? 43.864 -34.844 68.731  1.00 49.18  ? 43  GLU A CD  1 
ATOM   253  O OE1 . GLU A 1  33  ? 43.498 -33.826 68.112  1.00 48.41  ? 43  GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1  33  ? 43.519 -35.998 68.399  1.00 45.72  ? 43  GLU A OE2 1 
ATOM   255  N N   . ILE A 1  34  ? 47.582 -33.642 68.816  1.00 53.81  ? 44  ILE A N   1 
ATOM   256  C CA  . ILE A 1  34  ? 48.884 -34.297 68.762  1.00 54.93  ? 44  ILE A CA  1 
ATOM   257  C C   . ILE A 1  34  ? 49.978 -33.330 68.287  1.00 59.16  ? 44  ILE A C   1 
ATOM   258  O O   . ILE A 1  34  ? 49.834 -32.648 67.272  1.00 59.18  ? 44  ILE A O   1 
ATOM   259  C CB  . ILE A 1  34  ? 48.833 -35.556 67.851  1.00 51.49  ? 44  ILE A CB  1 
ATOM   260  C CG1 . ILE A 1  34  ? 47.862 -36.584 68.448  1.00 49.07  ? 44  ILE A CG1 1 
ATOM   261  C CG2 . ILE A 1  34  ? 50.222 -36.169 67.719  1.00 50.59  ? 44  ILE A CG2 1 
ATOM   262  C CD1 . ILE A 1  34  ? 47.783 -37.892 67.681  1.00 46.78  ? 44  ILE A CD1 1 
ATOM   263  N N   . ASP A 1  35  ? 51.067 -33.276 69.050  1.00 62.36  ? 45  ASP A N   1 
ATOM   264  C CA  . ASP A 1  35  ? 52.209 -32.401 68.776  1.00 63.94  ? 45  ASP A CA  1 
ATOM   265  C C   . ASP A 1  35  ? 53.372 -33.237 68.221  1.00 65.68  ? 45  ASP A C   1 
ATOM   266  O O   . ASP A 1  35  ? 54.284 -33.613 68.957  1.00 65.93  ? 45  ASP A O   1 
ATOM   267  C CB  . ASP A 1  35  ? 52.614 -31.721 70.088  1.00 64.00  ? 45  ASP A CB  1 
ATOM   268  C CG  . ASP A 1  35  ? 53.661 -30.652 69.902  1.00 65.04  ? 45  ASP A CG  1 
ATOM   269  O OD1 . ASP A 1  35  ? 54.693 -30.932 69.257  1.00 66.22  ? 45  ASP A OD1 1 
ATOM   270  O OD2 . ASP A 1  35  ? 53.454 -29.531 70.417  1.00 64.93  ? 45  ASP A OD2 1 
ATOM   271  N N   . LYS A 1  36  ? 53.342 -33.515 66.921  1.00 68.41  ? 46  LYS A N   1 
ATOM   272  C CA  . LYS A 1  36  ? 54.368 -34.340 66.280  1.00 72.08  ? 46  LYS A CA  1 
ATOM   273  C C   . LYS A 1  36  ? 55.803 -33.798 66.290  1.00 73.58  ? 46  LYS A C   1 
ATOM   274  O O   . LYS A 1  36  ? 56.722 -34.466 65.808  1.00 73.99  ? 46  LYS A O   1 
ATOM   275  C CB  . LYS A 1  36  ? 53.961 -34.653 64.831  1.00 73.55  ? 46  LYS A CB  1 
ATOM   276  C CG  . LYS A 1  36  ? 54.901 -35.638 64.129  1.00 78.54  ? 46  LYS A CG  1 
ATOM   277  C CD  . LYS A 1  36  ? 54.586 -35.787 62.645  1.00 83.97  ? 46  LYS A CD  1 
ATOM   278  C CE  . LYS A 1  36  ? 55.606 -36.687 61.942  1.00 85.37  ? 46  LYS A CE  1 
ATOM   279  N NZ  . LYS A 1  36  ? 55.358 -36.804 60.471  1.00 85.95  ? 46  LYS A NZ  1 
ATOM   280  N N   . SER A 1  37  ? 56.011 -32.604 66.837  1.00 74.77  ? 47  SER A N   1 
ATOM   281  C CA  . SER A 1  37  ? 57.357 -32.032 66.870  1.00 75.54  ? 47  SER A CA  1 
ATOM   282  C C   . SER A 1  37  ? 58.076 -32.253 68.203  1.00 75.27  ? 47  SER A C   1 
ATOM   283  O O   . SER A 1  37  ? 59.200 -32.757 68.221  1.00 75.10  ? 47  SER A O   1 
ATOM   284  C CB  . SER A 1  37  ? 57.306 -30.533 66.552  1.00 76.26  ? 47  SER A CB  1 
ATOM   285  O OG  . SER A 1  37  ? 58.611 -29.981 66.485  1.00 75.67  ? 47  SER A OG  1 
ATOM   286  N N   . LYS A 1  38  ? 57.426 -31.883 69.308  1.00 74.17  ? 48  LYS A N   1 
ATOM   287  C CA  . LYS A 1  38  ? 57.999 -32.027 70.650  1.00 73.12  ? 48  LYS A CA  1 
ATOM   288  C C   . LYS A 1  38  ? 58.727 -33.344 70.917  1.00 73.97  ? 48  LYS A C   1 
ATOM   289  O O   . LYS A 1  38  ? 58.153 -34.435 70.799  1.00 73.24  ? 48  LYS A O   1 
ATOM   290  C CB  . LYS A 1  38  ? 56.921 -31.840 71.723  1.00 69.97  ? 48  LYS A CB  1 
ATOM   291  C CG  . LYS A 1  38  ? 56.953 -30.489 72.413  1.00 68.10  ? 48  LYS A CG  1 
ATOM   292  C CD  . LYS A 1  38  ? 55.887 -30.412 73.497  1.00 67.93  ? 48  LYS A CD  1 
ATOM   293  C CE  . LYS A 1  38  ? 55.873 -29.052 74.192  1.00 67.97  ? 48  LYS A CE  1 
ATOM   294  N NZ  . LYS A 1  38  ? 54.839 -28.966 75.271  1.00 63.35  ? 48  LYS A NZ  1 
ATOM   295  N N   . THR A 1  39  ? 59.998 -33.215 71.291  1.00 74.16  ? 49  THR A N   1 
ATOM   296  C CA  . THR A 1  39  ? 60.853 -34.353 71.604  1.00 73.51  ? 49  THR A CA  1 
ATOM   297  C C   . THR A 1  39  ? 61.009 -34.468 73.120  1.00 73.60  ? 49  THR A C   1 
ATOM   298  O O   . THR A 1  39  ? 61.041 -35.566 73.672  1.00 72.20  ? 49  THR A O   1 
ATOM   299  C CB  . THR A 1  39  ? 62.253 -34.189 70.970  1.00 73.55  ? 49  THR A CB  1 
ATOM   300  O OG1 . THR A 1  39  ? 63.093 -35.270 71.393  1.00 76.95  ? 49  THR A OG1 1 
ATOM   301  C CG2 . THR A 1  39  ? 62.885 -32.860 71.382  1.00 70.11  ? 49  THR A CG2 1 
ATOM   302  N N   . CYS A 1  40  ? 61.107 -33.319 73.780  1.00 73.79  ? 50  CYS A N   1 
ATOM   303  C CA  . CYS A 1  40  ? 61.248 -33.259 75.230  1.00 74.12  ? 50  CYS A CA  1 
ATOM   304  C C   . CYS A 1  40  ? 59.947 -32.724 75.824  1.00 72.17  ? 50  CYS A C   1 
ATOM   305  O O   . CYS A 1  40  ? 59.080 -32.240 75.097  1.00 71.88  ? 50  CYS A O   1 
ATOM   306  C CB  . CYS A 1  40  ? 62.428 -32.347 75.613  1.00 77.31  ? 50  CYS A CB  1 
ATOM   307  S SG  . CYS A 1  40  ? 62.338 -30.668 74.906  1.00 80.45  ? 50  CYS A SG  1 
ATOM   308  N N   . TYR A 1  41  ? 59.809 -32.813 77.141  1.00 71.80  ? 51  TYR A N   1 
ATOM   309  C CA  . TYR A 1  41  ? 58.596 -32.346 77.798  1.00 72.30  ? 51  TYR A CA  1 
ATOM   310  C C   . TYR A 1  41  ? 58.840 -31.043 78.549  1.00 74.02  ? 51  TYR A C   1 
ATOM   311  O O   . TYR A 1  41  ? 59.974 -30.588 78.654  1.00 73.24  ? 51  TYR A O   1 
ATOM   312  C CB  . TYR A 1  41  ? 58.069 -33.430 78.752  1.00 70.67  ? 51  TYR A CB  1 
ATOM   313  C CG  . TYR A 1  41  ? 58.750 -33.491 80.104  1.00 68.53  ? 51  TYR A CG  1 
ATOM   314  C CD1 . TYR A 1  41  ? 58.288 -32.717 81.170  1.00 66.29  ? 51  TYR A CD1 1 
ATOM   315  C CD2 . TYR A 1  41  ? 59.855 -34.317 80.317  1.00 67.28  ? 51  TYR A CD2 1 
ATOM   316  C CE1 . TYR A 1  41  ? 58.906 -32.762 82.414  1.00 65.66  ? 51  TYR A CE1 1 
ATOM   317  C CE2 . TYR A 1  41  ? 60.483 -34.370 81.561  1.00 68.45  ? 51  TYR A CE2 1 
ATOM   318  C CZ  . TYR A 1  41  ? 60.001 -33.590 82.607  1.00 68.10  ? 51  TYR A CZ  1 
ATOM   319  O OH  . TYR A 1  41  ? 60.602 -33.639 83.848  1.00 68.31  ? 51  TYR A OH  1 
ATOM   320  N N   . GLU A 1  42  ? 57.770 -30.447 79.065  1.00 78.37  ? 52  GLU A N   1 
ATOM   321  C CA  . GLU A 1  42  ? 57.860 -29.190 79.805  1.00 82.24  ? 52  GLU A CA  1 
ATOM   322  C C   . GLU A 1  42  ? 58.658 -29.398 81.081  1.00 83.68  ? 52  GLU A C   1 
ATOM   323  O O   . GLU A 1  42  ? 59.704 -30.047 81.078  1.00 86.77  ? 52  GLU A O   1 
ATOM   324  C CB  . GLU A 1  42  ? 56.471 -28.705 80.200  1.00 83.87  ? 52  GLU A CB  1 
ATOM   325  C CG  . GLU A 1  42  ? 55.400 -28.917 79.166  1.00 86.86  ? 52  GLU A CG  1 
ATOM   326  C CD  . GLU A 1  42  ? 54.035 -28.625 79.737  1.00 88.33  ? 52  GLU A CD  1 
ATOM   327  O OE1 . GLU A 1  42  ? 53.617 -29.341 80.673  1.00 88.08  ? 52  GLU A OE1 1 
ATOM   328  O OE2 . GLU A 1  42  ? 53.386 -27.672 79.262  1.00 91.96  ? 52  GLU A OE2 1 
ATOM   329  N N   . GLY A 1  43  ? 58.148 -28.833 82.172  1.00 83.25  ? 53  GLY A N   1 
ATOM   330  C CA  . GLY A 1  43  ? 58.789 -28.980 83.466  1.00 82.02  ? 53  GLY A CA  1 
ATOM   331  C C   . GLY A 1  43  ? 57.974 -29.974 84.267  1.00 80.20  ? 53  GLY A C   1 
ATOM   332  O O   . GLY A 1  43  ? 58.514 -30.840 84.956  1.00 81.24  ? 53  GLY A O   1 
ATOM   333  N N   . ASN A 1  44  ? 56.656 -29.841 84.154  1.00 78.22  ? 54  ASN A N   1 
ATOM   334  C CA  . ASN A 1  44  ? 55.709 -30.709 84.836  1.00 75.61  ? 54  ASN A CA  1 
ATOM   335  C C   . ASN A 1  44  ? 55.274 -31.806 83.869  1.00 74.25  ? 54  ASN A C   1 
ATOM   336  O O   . ASN A 1  44  ? 55.012 -32.940 84.269  1.00 73.80  ? 54  ASN A O   1 
ATOM   337  C CB  . ASN A 1  44  ? 54.497 -29.886 85.286  1.00 76.50  ? 54  ASN A CB  1 
ATOM   338  C CG  . ASN A 1  44  ? 53.481 -30.707 86.053  1.00 76.90  ? 54  ASN A CG  1 
ATOM   339  O OD1 . ASN A 1  44  ? 53.837 -31.486 86.935  1.00 81.04  ? 54  ASN A OD1 1 
ATOM   340  N ND2 . ASN A 1  44  ? 52.207 -30.524 85.733  1.00 75.92  ? 54  ASN A ND2 1 
ATOM   341  N N   . GLY A 1  45  ? 55.214 -31.458 82.587  1.00 73.37  ? 55  GLY A N   1 
ATOM   342  C CA  . GLY A 1  45  ? 54.808 -32.412 81.571  1.00 70.45  ? 55  GLY A CA  1 
ATOM   343  C C   . GLY A 1  45  ? 53.297 -32.552 81.493  1.00 69.14  ? 55  GLY A C   1 
ATOM   344  O O   . GLY A 1  45  ? 52.781 -33.374 80.731  1.00 69.25  ? 55  GLY A O   1 
ATOM   345  N N   . HIS A 1  46  ? 52.587 -31.745 82.280  1.00 65.48  ? 56  HIS A N   1 
ATOM   346  C CA  . HIS A 1  46  ? 51.127 -31.778 82.316  1.00 62.33  ? 56  HIS A CA  1 
ATOM   347  C C   . HIS A 1  46  ? 50.540 -31.466 80.947  1.00 61.68  ? 56  HIS A C   1 
ATOM   348  O O   . HIS A 1  46  ? 49.658 -32.176 80.455  1.00 61.92  ? 56  HIS A O   1 
ATOM   349  C CB  . HIS A 1  46  ? 50.602 -30.755 83.328  1.00 61.94  ? 56  HIS A CB  1 
ATOM   350  C CG  . HIS A 1  46  ? 49.138 -30.880 83.615  1.00 61.67  ? 56  HIS A CG  1 
ATOM   351  N ND1 . HIS A 1  46  ? 48.441 -29.938 84.340  1.00 65.07  ? 56  HIS A ND1 1 
ATOM   352  C CD2 . HIS A 1  46  ? 48.240 -31.838 83.284  1.00 62.03  ? 56  HIS A CD2 1 
ATOM   353  C CE1 . HIS A 1  46  ? 47.177 -30.309 84.442  1.00 63.08  ? 56  HIS A CE1 1 
ATOM   354  N NE2 . HIS A 1  46  ? 47.029 -31.459 83.810  1.00 61.24  ? 56  HIS A NE2 1 
ATOM   355  N N   . PHE A 1  47  ? 51.042 -30.394 80.338  1.00 59.27  ? 57  PHE A N   1 
ATOM   356  C CA  . PHE A 1  47  ? 50.570 -29.953 79.029  1.00 55.40  ? 57  PHE A CA  1 
ATOM   357  C C   . PHE A 1  47  ? 51.418 -30.505 77.888  1.00 52.84  ? 57  PHE A C   1 
ATOM   358  O O   . PHE A 1  47  ? 51.360 -30.010 76.764  1.00 53.73  ? 57  PHE A O   1 
ATOM   359  C CB  . PHE A 1  47  ? 50.555 -28.420 78.963  1.00 55.87  ? 57  PHE A CB  1 
ATOM   360  C CG  . PHE A 1  47  ? 49.842 -27.767 80.118  1.00 56.89  ? 57  PHE A CG  1 
ATOM   361  C CD1 . PHE A 1  47  ? 50.492 -27.571 81.334  1.00 58.04  ? 57  PHE A CD1 1 
ATOM   362  C CD2 . PHE A 1  47  ? 48.515 -27.365 79.997  1.00 58.09  ? 57  PHE A CD2 1 
ATOM   363  C CE1 . PHE A 1  47  ? 49.830 -26.982 82.411  1.00 60.36  ? 57  PHE A CE1 1 
ATOM   364  C CE2 . PHE A 1  47  ? 47.844 -26.776 81.066  1.00 59.18  ? 57  PHE A CE2 1 
ATOM   365  C CZ  . PHE A 1  47  ? 48.502 -26.583 82.275  1.00 59.85  ? 57  PHE A CZ  1 
ATOM   366  N N   . TYR A 1  48  ? 52.208 -31.529 78.178  1.00 49.11  ? 58  TYR A N   1 
ATOM   367  C CA  . TYR A 1  48  ? 53.049 -32.133 77.160  1.00 46.89  ? 58  TYR A CA  1 
ATOM   368  C C   . TYR A 1  48  ? 52.252 -33.012 76.213  1.00 48.70  ? 58  TYR A C   1 
ATOM   369  O O   . TYR A 1  48  ? 51.491 -33.876 76.650  1.00 50.96  ? 58  TYR A O   1 
ATOM   370  C CB  . TYR A 1  48  ? 54.125 -32.998 77.796  1.00 42.85  ? 58  TYR A CB  1 
ATOM   371  C CG  . TYR A 1  48  ? 54.775 -33.934 76.801  1.00 39.99  ? 58  TYR A CG  1 
ATOM   372  C CD1 . TYR A 1  48  ? 55.754 -33.476 75.923  1.00 41.31  ? 58  TYR A CD1 1 
ATOM   373  C CD2 . TYR A 1  48  ? 54.403 -35.277 76.727  1.00 37.21  ? 58  TYR A CD2 1 
ATOM   374  C CE1 . TYR A 1  48  ? 56.352 -34.333 75.001  1.00 39.78  ? 58  TYR A CE1 1 
ATOM   375  C CE2 . TYR A 1  48  ? 54.990 -36.137 75.809  1.00 33.96  ? 58  TYR A CE2 1 
ATOM   376  C CZ  . TYR A 1  48  ? 55.966 -35.657 74.954  1.00 36.47  ? 58  TYR A CZ  1 
ATOM   377  O OH  . TYR A 1  48  ? 56.588 -36.504 74.071  1.00 40.70  ? 58  TYR A OH  1 
ATOM   378  N N   . ARG A 1  49  ? 52.445 -32.796 74.917  1.00 49.27  ? 59  ARG A N   1 
ATOM   379  C CA  . ARG A 1  49  ? 51.790 -33.593 73.888  1.00 51.31  ? 59  ARG A CA  1 
ATOM   380  C C   . ARG A 1  49  ? 52.921 -34.172 73.043  1.00 52.96  ? 59  ARG A C   1 
ATOM   381  O O   . ARG A 1  49  ? 54.056 -33.713 73.130  1.00 57.06  ? 59  ARG A O   1 
ATOM   382  C CB  . ARG A 1  49  ? 50.864 -32.713 73.049  1.00 51.67  ? 59  ARG A CB  1 
ATOM   383  C CG  . ARG A 1  49  ? 49.751 -32.081 73.871  1.00 53.29  ? 59  ARG A CG  1 
ATOM   384  C CD  . ARG A 1  49  ? 48.844 -33.156 74.459  1.00 54.10  ? 59  ARG A CD  1 
ATOM   385  N NE  . ARG A 1  49  ? 48.582 -32.950 75.881  1.00 57.60  ? 59  ARG A NE  1 
ATOM   386  C CZ  . ARG A 1  49  ? 47.474 -32.410 76.380  1.00 59.19  ? 59  ARG A CZ  1 
ATOM   387  N NH1 . ARG A 1  49  ? 46.498 -32.010 75.570  1.00 57.04  ? 59  ARG A NH1 1 
ATOM   388  N NH2 . ARG A 1  49  ? 47.345 -32.272 77.695  1.00 62.10  ? 59  ARG A NH2 1 
ATOM   389  N N   . GLY A 1  50  ? 52.643 -35.184 72.239  1.00 53.92  ? 60  GLY A N   1 
ATOM   390  C CA  . GLY A 1  50  ? 53.716 -35.749 71.442  1.00 55.68  ? 60  GLY A CA  1 
ATOM   391  C C   . GLY A 1  50  ? 53.862 -37.223 71.723  1.00 55.08  ? 60  GLY A C   1 
ATOM   392  O O   . GLY A 1  50  ? 53.258 -37.730 72.660  1.00 54.17  ? 60  GLY A O   1 
ATOM   393  N N   . LYS A 1  51  ? 54.651 -37.923 70.918  1.00 56.30  ? 61  LYS A N   1 
ATOM   394  C CA  . LYS A 1  51  ? 54.820 -39.353 71.130  1.00 61.13  ? 61  LYS A CA  1 
ATOM   395  C C   . LYS A 1  51  ? 55.819 -39.655 72.236  1.00 64.91  ? 61  LYS A C   1 
ATOM   396  O O   . LYS A 1  51  ? 56.597 -38.793 72.645  1.00 65.48  ? 61  LYS A O   1 
ATOM   397  C CB  . LYS A 1  51  ? 55.259 -40.044 69.841  1.00 60.69  ? 61  LYS A CB  1 
ATOM   398  C CG  . LYS A 1  51  ? 55.344 -41.558 69.961  1.00 61.97  ? 61  LYS A CG  1 
ATOM   399  C CD  . LYS A 1  51  ? 55.664 -42.183 68.623  1.00 67.85  ? 61  LYS A CD  1 
ATOM   400  C CE  . LYS A 1  51  ? 55.534 -43.697 68.661  1.00 69.74  ? 61  LYS A CE  1 
ATOM   401  N NZ  . LYS A 1  51  ? 55.731 -44.298 67.306  1.00 70.51  ? 61  LYS A NZ  1 
ATOM   402  N N   . ALA A 1  52  ? 55.777 -40.893 72.716  1.00 69.19  ? 62  ALA A N   1 
ATOM   403  C CA  . ALA A 1  52  ? 56.660 -41.363 73.772  1.00 71.67  ? 62  ALA A CA  1 
ATOM   404  C C   . ALA A 1  52  ? 56.106 -42.693 74.260  1.00 73.54  ? 62  ALA A C   1 
ATOM   405  O O   . ALA A 1  52  ? 55.914 -42.905 75.458  1.00 76.57  ? 62  ALA A O   1 
ATOM   406  C CB  . ALA A 1  52  ? 56.707 -40.355 74.914  1.00 71.62  ? 62  ALA A CB  1 
ATOM   407  N N   . SER A 1  53  ? 55.845 -43.587 73.316  1.00 73.69  ? 63  SER A N   1 
ATOM   408  C CA  . SER A 1  53  ? 55.306 -44.904 73.626  1.00 74.32  ? 63  SER A CA  1 
ATOM   409  C C   . SER A 1  53  ? 56.155 -45.674 74.640  1.00 74.67  ? 63  SER A C   1 
ATOM   410  O O   . SER A 1  53  ? 55.695 -46.663 75.208  1.00 73.58  ? 63  SER A O   1 
ATOM   411  C CB  . SER A 1  53  ? 55.207 -45.725 72.341  1.00 73.40  ? 63  SER A CB  1 
ATOM   412  O OG  . SER A 1  53  ? 54.701 -44.931 71.284  1.00 77.10  ? 63  SER A OG  1 
ATOM   413  N N   . THR A 1  54  ? 57.382 -45.211 74.874  1.00 75.73  ? 64  THR A N   1 
ATOM   414  C CA  . THR A 1  54  ? 58.300 -45.895 75.780  1.00 75.52  ? 64  THR A CA  1 
ATOM   415  C C   . THR A 1  54  ? 58.374 -45.456 77.239  1.00 75.05  ? 64  THR A C   1 
ATOM   416  O O   . THR A 1  54  ? 58.134 -44.300 77.590  1.00 72.30  ? 64  THR A O   1 
ATOM   417  C CB  . THR A 1  54  ? 59.727 -45.876 75.221  1.00 76.92  ? 64  THR A CB  1 
ATOM   418  O OG1 . THR A 1  54  ? 60.624 -46.424 76.195  1.00 79.61  ? 64  THR A OG1 1 
ATOM   419  C CG2 . THR A 1  54  ? 60.146 -44.453 74.879  1.00 76.62  ? 64  THR A CG2 1 
ATOM   420  N N   . ASP A 1  55  ? 58.753 -46.421 78.070  1.00 78.13  ? 65  ASP A N   1 
ATOM   421  C CA  . ASP A 1  55  ? 58.884 -46.268 79.512  1.00 80.12  ? 65  ASP A CA  1 
ATOM   422  C C   . ASP A 1  55  ? 60.353 -46.178 79.936  1.00 80.36  ? 65  ASP A C   1 
ATOM   423  O O   . ASP A 1  55  ? 61.249 -46.510 79.161  1.00 81.13  ? 65  ASP A O   1 
ATOM   424  C CB  . ASP A 1  55  ? 58.206 -47.469 80.186  1.00 82.26  ? 65  ASP A CB  1 
ATOM   425  C CG  . ASP A 1  55  ? 58.435 -47.516 81.676  1.00 86.18  ? 65  ASP A CG  1 
ATOM   426  O OD1 . ASP A 1  55  ? 58.121 -46.517 82.358  1.00 88.09  ? 65  ASP A OD1 1 
ATOM   427  O OD2 . ASP A 1  55  ? 58.926 -48.559 82.165  1.00 88.76  ? 65  ASP A OD2 1 
ATOM   428  N N   . THR A 1  56  ? 60.582 -45.731 81.170  1.00 80.89  ? 66  THR A N   1 
ATOM   429  C CA  . THR A 1  56  ? 61.926 -45.582 81.734  1.00 80.36  ? 66  THR A CA  1 
ATOM   430  C C   . THR A 1  56  ? 62.867 -46.712 81.342  1.00 79.26  ? 66  THR A C   1 
ATOM   431  O O   . THR A 1  56  ? 64.029 -46.476 81.012  1.00 80.27  ? 66  THR A O   1 
ATOM   432  C CB  . THR A 1  56  ? 61.878 -45.514 83.273  1.00 80.87  ? 66  THR A CB  1 
ATOM   433  O OG1 . THR A 1  56  ? 61.054 -44.415 83.674  1.00 84.70  ? 66  THR A OG1 1 
ATOM   434  C CG2 . THR A 1  56  ? 63.278 -45.326 83.848  1.00 80.17  ? 66  THR A CG2 1 
ATOM   435  N N   . MET A 1  57  ? 62.377 -47.944 81.398  1.00 76.76  ? 67  MET A N   1 
ATOM   436  C CA  . MET A 1  57  ? 63.207 -49.073 81.019  1.00 74.73  ? 67  MET A CA  1 
ATOM   437  C C   . MET A 1  57  ? 62.692 -49.716 79.743  1.00 73.34  ? 67  MET A C   1 
ATOM   438  O O   . MET A 1  57  ? 62.431 -50.923 79.685  1.00 71.03  ? 67  MET A O   1 
ATOM   439  C CB  . MET A 1  57  ? 63.306 -50.097 82.160  1.00 77.08  ? 67  MET A CB  1 
ATOM   440  C CG  . MET A 1  57  ? 62.032 -50.379 82.929  1.00 75.70  ? 67  MET A CG  1 
ATOM   441  S SD  . MET A 1  57  ? 62.411 -51.362 84.412  1.00 75.46  ? 67  MET A SD  1 
ATOM   442  C CE  . MET A 1  57  ? 62.260 -53.034 83.744  1.00 73.84  ? 67  MET A CE  1 
ATOM   443  N N   . GLY A 1  58  ? 62.563 -48.874 78.719  1.00 72.54  ? 68  GLY A N   1 
ATOM   444  C CA  . GLY A 1  58  ? 62.099 -49.317 77.419  1.00 72.02  ? 68  GLY A CA  1 
ATOM   445  C C   . GLY A 1  58  ? 60.934 -50.271 77.514  1.00 70.82  ? 68  GLY A C   1 
ATOM   446  O O   . GLY A 1  58  ? 61.101 -51.490 77.439  1.00 73.33  ? 68  GLY A O   1 
ATOM   447  N N   . ARG A 1  59  ? 59.745 -49.712 77.678  1.00 67.34  ? 69  ARG A N   1 
ATOM   448  C CA  . ARG A 1  59  ? 58.549 -50.523 77.795  1.00 63.52  ? 69  ARG A CA  1 
ATOM   449  C C   . ARG A 1  59  ? 57.403 -49.793 77.092  1.00 61.03  ? 69  ARG A C   1 
ATOM   450  O O   . ARG A 1  59  ? 57.206 -48.592 77.287  1.00 60.23  ? 69  ARG A O   1 
ATOM   451  C CB  . ARG A 1  59  ? 58.251 -50.749 79.282  1.00 62.43  ? 69  ARG A CB  1 
ATOM   452  C CG  . ARG A 1  59  ? 57.657 -52.111 79.609  1.00 63.60  ? 69  ARG A CG  1 
ATOM   453  C CD  . ARG A 1  59  ? 58.015 -52.533 81.025  1.00 62.70  ? 69  ARG A CD  1 
ATOM   454  N NE  . ARG A 1  59  ? 57.908 -51.415 81.957  1.00 66.63  ? 69  ARG A NE  1 
ATOM   455  C CZ  . ARG A 1  59  ? 58.113 -51.506 83.267  1.00 69.31  ? 69  ARG A CZ  1 
ATOM   456  N NH1 . ARG A 1  59  ? 58.437 -52.671 83.813  1.00 70.93  ? 69  ARG A NH1 1 
ATOM   457  N NH2 . ARG A 1  59  ? 57.999 -50.428 84.032  1.00 68.38  ? 69  ARG A NH2 1 
ATOM   458  N N   . PRO A 1  60  ? 56.649 -50.508 76.240  1.00 58.52  ? 70  PRO A N   1 
ATOM   459  C CA  . PRO A 1  60  ? 55.525 -49.917 75.505  1.00 58.41  ? 70  PRO A CA  1 
ATOM   460  C C   . PRO A 1  60  ? 54.334 -49.479 76.362  1.00 58.42  ? 70  PRO A C   1 
ATOM   461  O O   . PRO A 1  60  ? 53.800 -50.263 77.152  1.00 59.88  ? 70  PRO A O   1 
ATOM   462  C CB  . PRO A 1  60  ? 55.145 -51.018 74.516  1.00 56.61  ? 70  PRO A CB  1 
ATOM   463  C CG  . PRO A 1  60  ? 55.475 -52.262 75.267  1.00 56.31  ? 70  PRO A CG  1 
ATOM   464  C CD  . PRO A 1  60  ? 56.826 -51.922 75.866  1.00 57.70  ? 70  PRO A CD  1 
ATOM   465  N N   . CYS A 1  61  ? 53.928 -48.221 76.204  1.00 56.25  ? 71  CYS A N   1 
ATOM   466  C CA  . CYS A 1  61  ? 52.782 -47.696 76.932  1.00 52.99  ? 71  CYS A CA  1 
ATOM   467  C C   . CYS A 1  61  ? 51.551 -48.378 76.350  1.00 51.49  ? 71  CYS A C   1 
ATOM   468  O O   . CYS A 1  61  ? 51.598 -48.894 75.236  1.00 50.52  ? 71  CYS A O   1 
ATOM   469  C CB  . CYS A 1  61  ? 52.639 -46.194 76.711  1.00 53.44  ? 71  CYS A CB  1 
ATOM   470  S SG  . CYS A 1  61  ? 53.905 -45.110 77.440  1.00 60.21  ? 71  CYS A SG  1 
ATOM   471  N N   . LEU A 1  62  ? 50.453 -48.381 77.098  1.00 50.69  ? 72  LEU A N   1 
ATOM   472  C CA  . LEU A 1  62  ? 49.205 -48.980 76.625  1.00 48.91  ? 72  LEU A CA  1 
ATOM   473  C C   . LEU A 1  62  ? 48.372 -47.874 75.979  1.00 45.09  ? 72  LEU A C   1 
ATOM   474  O O   . LEU A 1  62  ? 48.425 -46.719 76.405  1.00 42.59  ? 72  LEU A O   1 
ATOM   475  C CB  . LEU A 1  62  ? 48.416 -49.589 77.795  1.00 51.58  ? 72  LEU A CB  1 
ATOM   476  C CG  . LEU A 1  62  ? 48.957 -50.824 78.527  1.00 53.31  ? 72  LEU A CG  1 
ATOM   477  C CD1 . LEU A 1  62  ? 48.237 -50.993 79.859  1.00 51.32  ? 72  LEU A CD1 1 
ATOM   478  C CD2 . LEU A 1  62  ? 48.772 -52.058 77.654  1.00 52.96  ? 72  LEU A CD2 1 
ATOM   479  N N   . PRO A 1  63  ? 47.602 -48.207 74.931  1.00 44.91  ? 73  PRO A N   1 
ATOM   480  C CA  . PRO A 1  63  ? 46.777 -47.186 74.278  1.00 43.91  ? 73  PRO A CA  1 
ATOM   481  C C   . PRO A 1  63  ? 45.735 -46.673 75.269  1.00 42.78  ? 73  PRO A C   1 
ATOM   482  O O   . PRO A 1  63  ? 45.017 -47.464 75.876  1.00 44.76  ? 73  PRO A O   1 
ATOM   483  C CB  . PRO A 1  63  ? 46.130 -47.950 73.121  1.00 43.57  ? 73  PRO A CB  1 
ATOM   484  C CG  . PRO A 1  63  ? 47.117 -49.032 72.816  1.00 44.62  ? 73  PRO A CG  1 
ATOM   485  C CD  . PRO A 1  63  ? 47.531 -49.484 74.199  1.00 45.38  ? 73  PRO A CD  1 
ATOM   486  N N   . TRP A 1  64  ? 45.649 -45.359 75.437  1.00 39.26  ? 74  TRP A N   1 
ATOM   487  C CA  . TRP A 1  64  ? 44.679 -44.788 76.358  1.00 38.41  ? 74  TRP A CA  1 
ATOM   488  C C   . TRP A 1  64  ? 43.255 -45.239 76.061  1.00 36.79  ? 74  TRP A C   1 
ATOM   489  O O   . TRP A 1  64  ? 42.327 -44.925 76.813  1.00 35.56  ? 74  TRP A O   1 
ATOM   490  C CB  . TRP A 1  64  ? 44.745 -43.266 76.316  1.00 41.64  ? 74  TRP A CB  1 
ATOM   491  C CG  . TRP A 1  64  ? 46.079 -42.743 76.684  1.00 46.36  ? 74  TRP A CG  1 
ATOM   492  C CD1 . TRP A 1  64  ? 47.112 -42.469 75.840  1.00 46.82  ? 74  TRP A CD1 1 
ATOM   493  C CD2 . TRP A 1  64  ? 46.550 -42.460 78.005  1.00 47.36  ? 74  TRP A CD2 1 
ATOM   494  N NE1 . TRP A 1  64  ? 48.202 -42.028 76.552  1.00 48.11  ? 74  TRP A NE1 1 
ATOM   495  C CE2 . TRP A 1  64  ? 47.885 -42.013 77.884  1.00 48.28  ? 74  TRP A CE2 1 
ATOM   496  C CE3 . TRP A 1  64  ? 45.973 -42.540 79.280  1.00 47.61  ? 74  TRP A CE3 1 
ATOM   497  C CZ2 . TRP A 1  64  ? 48.657 -41.645 78.992  1.00 48.13  ? 74  TRP A CZ2 1 
ATOM   498  C CZ3 . TRP A 1  64  ? 46.739 -42.174 80.381  1.00 50.98  ? 74  TRP A CZ3 1 
ATOM   499  C CH2 . TRP A 1  64  ? 48.069 -41.731 80.228  1.00 50.05  ? 74  TRP A CH2 1 
ATOM   500  N N   . ASN A 1  65  ? 43.082 -45.969 74.963  1.00 36.03  ? 75  ASN A N   1 
ATOM   501  C CA  . ASN A 1  65  ? 41.763 -46.457 74.581  1.00 36.72  ? 75  ASN A CA  1 
ATOM   502  C C   . ASN A 1  65  ? 41.695 -47.977 74.530  1.00 35.65  ? 75  ASN A C   1 
ATOM   503  O O   . ASN A 1  65  ? 40.730 -48.539 74.030  1.00 35.58  ? 75  ASN A O   1 
ATOM   504  C CB  . ASN A 1  65  ? 41.334 -45.862 73.231  1.00 38.08  ? 75  ASN A CB  1 
ATOM   505  C CG  . ASN A 1  65  ? 42.166 -46.369 72.070  1.00 39.81  ? 75  ASN A CG  1 
ATOM   506  O OD1 . ASN A 1  65  ? 43.391 -46.256 72.072  1.00 44.57  ? 75  ASN A OD1 1 
ATOM   507  N ND2 . ASN A 1  65  ? 41.498 -46.922 71.064  1.00 40.04  ? 75  ASN A ND2 1 
ATOM   508  N N   . SER A 1  66  ? 42.725 -48.636 75.049  1.00 35.45  ? 76  SER A N   1 
ATOM   509  C CA  . SER A 1  66  ? 42.764 -50.092 75.090  1.00 34.88  ? 76  SER A CA  1 
ATOM   510  C C   . SER A 1  66  ? 41.741 -50.543 76.124  1.00 35.71  ? 76  SER A C   1 
ATOM   511  O O   . SER A 1  66  ? 41.475 -49.828 77.089  1.00 37.93  ? 76  SER A O   1 
ATOM   512  C CB  . SER A 1  66  ? 44.150 -50.571 75.509  1.00 35.64  ? 76  SER A CB  1 
ATOM   513  O OG  . SER A 1  66  ? 44.497 -50.037 76.776  1.00 36.91  ? 76  SER A OG  1 
ATOM   514  N N   . ALA A 1  67  ? 41.169 -51.725 75.923  1.00 34.18  ? 77  ALA A N   1 
ATOM   515  C CA  . ALA A 1  67  ? 40.164 -52.247 76.834  1.00 34.01  ? 77  ALA A CA  1 
ATOM   516  C C   . ALA A 1  67  ? 40.603 -52.081 78.278  1.00 36.44  ? 77  ALA A C   1 
ATOM   517  O O   . ALA A 1  67  ? 39.802 -51.745 79.148  1.00 37.14  ? 77  ALA A O   1 
ATOM   518  C CB  . ALA A 1  67  ? 39.913 -53.712 76.532  1.00 33.97  ? 77  ALA A CB  1 
ATOM   519  N N   . THR A 1  68  ? 41.892 -52.314 78.508  1.00 39.27  ? 78  THR A N   1 
ATOM   520  C CA  . THR A 1  68  ? 42.515 -52.226 79.827  1.00 37.77  ? 78  THR A CA  1 
ATOM   521  C C   . THR A 1  68  ? 42.477 -50.831 80.429  1.00 39.35  ? 78  THR A C   1 
ATOM   522  O O   . THR A 1  68  ? 41.917 -50.624 81.510  1.00 40.64  ? 78  THR A O   1 
ATOM   523  C CB  . THR A 1  68  ? 43.998 -52.654 79.764  1.00 39.05  ? 78  THR A CB  1 
ATOM   524  O OG1 . THR A 1  68  ? 44.082 -54.037 79.402  1.00 41.34  ? 78  THR A OG1 1 
ATOM   525  C CG2 . THR A 1  68  ? 44.690 -52.417 81.108  1.00 37.82  ? 78  THR A CG2 1 
ATOM   526  N N   . VAL A 1  69  ? 43.098 -49.882 79.737  1.00 36.40  ? 79  VAL A N   1 
ATOM   527  C CA  . VAL A 1  69  ? 43.151 -48.517 80.221  1.00 34.79  ? 79  VAL A CA  1 
ATOM   528  C C   . VAL A 1  69  ? 41.770 -47.891 80.318  1.00 34.25  ? 79  VAL A C   1 
ATOM   529  O O   . VAL A 1  69  ? 41.568 -46.947 81.081  1.00 36.48  ? 79  VAL A O   1 
ATOM   530  C CB  . VAL A 1  69  ? 44.066 -47.659 79.333  1.00 35.84  ? 79  VAL A CB  1 
ATOM   531  C CG1 . VAL A 1  69  ? 44.044 -46.204 79.797  1.00 37.25  ? 79  VAL A CG1 1 
ATOM   532  C CG2 . VAL A 1  69  ? 45.484 -48.207 79.397  1.00 36.68  ? 79  VAL A CG2 1 
ATOM   533  N N   . LEU A 1  70  ? 40.812 -48.414 79.560  1.00 33.94  ? 80  LEU A N   1 
ATOM   534  C CA  . LEU A 1  70  ? 39.460 -47.877 79.627  1.00 34.28  ? 80  LEU A CA  1 
ATOM   535  C C   . LEU A 1  70  ? 38.853 -48.189 80.988  1.00 36.66  ? 80  LEU A C   1 
ATOM   536  O O   . LEU A 1  70  ? 37.821 -47.632 81.359  1.00 38.73  ? 80  LEU A O   1 
ATOM   537  C CB  . LEU A 1  70  ? 38.580 -48.457 78.519  1.00 30.19  ? 80  LEU A CB  1 
ATOM   538  C CG  . LEU A 1  70  ? 38.806 -47.869 77.122  1.00 31.55  ? 80  LEU A CG  1 
ATOM   539  C CD1 . LEU A 1  70  ? 37.841 -48.501 76.136  1.00 27.06  ? 80  LEU A CD1 1 
ATOM   540  C CD2 . LEU A 1  70  ? 38.607 -46.358 77.168  1.00 29.48  ? 80  LEU A CD2 1 
ATOM   541  N N   . GLN A 1  71  ? 39.493 -49.083 81.737  1.00 38.29  ? 81  GLN A N   1 
ATOM   542  C CA  . GLN A 1  71  ? 38.994 -49.438 83.064  1.00 39.92  ? 81  GLN A CA  1 
ATOM   543  C C   . GLN A 1  71  ? 39.822 -48.794 84.190  1.00 40.74  ? 81  GLN A C   1 
ATOM   544  O O   . GLN A 1  71  ? 39.557 -49.023 85.373  1.00 43.96  ? 81  GLN A O   1 
ATOM   545  C CB  . GLN A 1  71  ? 38.952 -50.962 83.237  1.00 38.12  ? 81  GLN A CB  1 
ATOM   546  C CG  . GLN A 1  71  ? 37.970 -51.695 82.326  1.00 36.35  ? 81  GLN A CG  1 
ATOM   547  C CD  . GLN A 1  71  ? 36.533 -51.226 82.481  1.00 38.13  ? 81  GLN A CD  1 
ATOM   548  O OE1 . GLN A 1  71  ? 36.084 -50.929 83.580  1.00 39.26  ? 81  GLN A OE1 1 
ATOM   549  N NE2 . GLN A 1  71  ? 35.800 -51.178 81.374  1.00 36.37  ? 81  GLN A NE2 1 
ATOM   550  N N   . GLN A 1  72  ? 40.816 -47.989 83.814  1.00 39.05  ? 82  GLN A N   1 
ATOM   551  C CA  . GLN A 1  72  ? 41.659 -47.285 84.778  1.00 39.72  ? 82  GLN A CA  1 
ATOM   552  C C   . GLN A 1  72  ? 41.079 -45.889 85.020  1.00 40.72  ? 82  GLN A C   1 
ATOM   553  O O   . GLN A 1  72  ? 40.021 -45.548 84.479  1.00 43.14  ? 82  GLN A O   1 
ATOM   554  C CB  . GLN A 1  72  ? 43.090 -47.165 84.245  1.00 39.89  ? 82  GLN A CB  1 
ATOM   555  C CG  . GLN A 1  72  ? 43.749 -48.501 84.004  1.00 42.60  ? 82  GLN A CG  1 
ATOM   556  C CD  . GLN A 1  72  ? 43.929 -49.294 85.284  1.00 45.64  ? 82  GLN A CD  1 
ATOM   557  O OE1 . GLN A 1  72  ? 44.026 -50.519 85.255  1.00 46.96  ? 82  GLN A OE1 1 
ATOM   558  N NE2 . GLN A 1  72  ? 43.982 -48.595 86.416  1.00 45.43  ? 82  GLN A NE2 1 
ATOM   559  N N   . THR A 1  73  ? 41.764 -45.082 85.826  1.00 40.23  ? 83  THR A N   1 
ATOM   560  C CA  . THR A 1  73  ? 41.288 -43.730 86.118  1.00 40.32  ? 83  THR A CA  1 
ATOM   561  C C   . THR A 1  73  ? 41.287 -42.854 84.870  1.00 40.05  ? 83  THR A C   1 
ATOM   562  O O   . THR A 1  73  ? 40.269 -42.262 84.515  1.00 40.09  ? 83  THR A O   1 
ATOM   563  C CB  . THR A 1  73  ? 42.157 -43.032 87.192  1.00 39.75  ? 83  THR A CB  1 
ATOM   564  O OG1 . THR A 1  73  ? 42.165 -43.817 88.388  1.00 45.88  ? 83  THR A OG1 1 
ATOM   565  C CG2 . THR A 1  73  ? 41.596 -41.648 87.521  1.00 37.12  ? 83  THR A CG2 1 
ATOM   566  N N   . TYR A 1  74  ? 42.435 -42.773 84.209  1.00 40.12  ? 84  TYR A N   1 
ATOM   567  C CA  . TYR A 1  74  ? 42.565 -41.956 83.016  1.00 39.95  ? 84  TYR A CA  1 
ATOM   568  C C   . TYR A 1  74  ? 42.557 -42.780 81.737  1.00 40.21  ? 84  TYR A C   1 
ATOM   569  O O   . TYR A 1  74  ? 43.365 -43.691 81.558  1.00 37.23  ? 84  TYR A O   1 
ATOM   570  C CB  . TYR A 1  74  ? 43.842 -41.125 83.106  1.00 39.79  ? 84  TYR A CB  1 
ATOM   571  C CG  . TYR A 1  74  ? 43.839 -40.199 84.295  1.00 43.29  ? 84  TYR A CG  1 
ATOM   572  C CD1 . TYR A 1  74  ? 44.754 -40.358 85.333  1.00 44.87  ? 84  TYR A CD1 1 
ATOM   573  C CD2 . TYR A 1  74  ? 42.894 -39.180 84.402  1.00 45.50  ? 84  TYR A CD2 1 
ATOM   574  C CE1 . TYR A 1  74  ? 44.724 -39.520 86.455  1.00 45.09  ? 84  TYR A CE1 1 
ATOM   575  C CE2 . TYR A 1  74  ? 42.857 -38.338 85.520  1.00 44.86  ? 84  TYR A CE2 1 
ATOM   576  C CZ  . TYR A 1  74  ? 43.773 -38.514 86.538  1.00 44.91  ? 84  TYR A CZ  1 
ATOM   577  O OH  . TYR A 1  74  ? 43.744 -37.678 87.630  1.00 47.26  ? 84  TYR A OH  1 
ATOM   578  N N   . HIS A 1  75  ? 41.624 -42.453 80.850  1.00 42.20  ? 85  HIS A N   1 
ATOM   579  C CA  . HIS A 1  75  ? 41.497 -43.145 79.572  1.00 41.34  ? 85  HIS A CA  1 
ATOM   580  C C   . HIS A 1  75  ? 40.954 -42.213 78.486  1.00 41.77  ? 85  HIS A C   1 
ATOM   581  O O   . HIS A 1  75  ? 40.512 -41.093 78.765  1.00 39.88  ? 85  HIS A O   1 
ATOM   582  C CB  . HIS A 1  75  ? 40.584 -44.362 79.703  1.00 38.75  ? 85  HIS A CB  1 
ATOM   583  C CG  . HIS A 1  75  ? 39.221 -44.037 80.223  1.00 40.55  ? 85  HIS A CG  1 
ATOM   584  N ND1 . HIS A 1  75  ? 38.957 -43.872 81.566  1.00 41.39  ? 85  HIS A ND1 1 
ATOM   585  C CD2 . HIS A 1  75  ? 38.054 -43.808 79.579  1.00 39.10  ? 85  HIS A CD2 1 
ATOM   586  C CE1 . HIS A 1  75  ? 37.686 -43.554 81.727  1.00 38.47  ? 85  HIS A CE1 1 
ATOM   587  N NE2 . HIS A 1  75  ? 37.115 -43.509 80.537  1.00 41.51  ? 85  HIS A NE2 1 
ATOM   588  N N   . ALA A 1  76  ? 40.984 -42.700 77.249  1.00 40.03  ? 86  ALA A N   1 
ATOM   589  C CA  . ALA A 1  76  ? 40.538 -41.934 76.095  1.00 41.41  ? 86  ALA A CA  1 
ATOM   590  C C   . ALA A 1  76  ? 39.074 -41.498 76.116  1.00 41.72  ? 86  ALA A C   1 
ATOM   591  O O   . ALA A 1  76  ? 38.732 -40.451 75.572  1.00 44.31  ? 86  ALA A O   1 
ATOM   592  C CB  . ALA A 1  76  ? 40.824 -42.729 74.810  1.00 39.87  ? 86  ALA A CB  1 
ATOM   593  N N   . HIS A 1  77  ? 38.212 -42.279 76.752  1.00 39.93  ? 87  HIS A N   1 
ATOM   594  C CA  . HIS A 1  77  ? 36.797 -41.953 76.760  1.00 38.60  ? 87  HIS A CA  1 
ATOM   595  C C   . HIS A 1  77  ? 36.267 -41.011 77.832  1.00 40.93  ? 87  HIS A C   1 
ATOM   596  O O   . HIS A 1  77  ? 35.059 -40.783 77.891  1.00 40.75  ? 87  HIS A O   1 
ATOM   597  C CB  . HIS A 1  77  ? 35.985 -43.245 76.783  1.00 36.24  ? 87  HIS A CB  1 
ATOM   598  C CG  . HIS A 1  77  ? 36.202 -44.107 75.583  1.00 34.11  ? 87  HIS A CG  1 
ATOM   599  N ND1 . HIS A 1  77  ? 35.568 -45.317 75.410  1.00 37.75  ? 87  HIS A ND1 1 
ATOM   600  C CD2 . HIS A 1  77  ? 36.977 -43.928 74.486  1.00 36.93  ? 87  HIS A CD2 1 
ATOM   601  C CE1 . HIS A 1  77  ? 35.942 -45.848 74.257  1.00 38.26  ? 87  HIS A CE1 1 
ATOM   602  N NE2 . HIS A 1  77  ? 36.797 -45.025 73.677  1.00 36.02  ? 87  HIS A NE2 1 
ATOM   603  N N   . ARG A 1  78  ? 37.129 -40.452 78.678  1.00 43.56  ? 88  ARG A N   1 
ATOM   604  C CA  . ARG A 1  78  ? 36.609 -39.562 79.708  1.00 46.97  ? 88  ARG A CA  1 
ATOM   605  C C   . ARG A 1  78  ? 36.227 -38.209 79.136  1.00 47.65  ? 88  ARG A C   1 
ATOM   606  O O   . ARG A 1  78  ? 36.827 -37.745 78.161  1.00 48.37  ? 88  ARG A O   1 
ATOM   607  C CB  . ARG A 1  78  ? 37.593 -39.402 80.876  1.00 51.21  ? 88  ARG A CB  1 
ATOM   608  C CG  . ARG A 1  78  ? 39.042 -39.175 80.516  1.00 56.88  ? 88  ARG A CG  1 
ATOM   609  C CD  . ARG A 1  78  ? 39.772 -38.538 81.699  1.00 59.82  ? 88  ARG A CD  1 
ATOM   610  N NE  . ARG A 1  78  ? 39.588 -39.282 82.942  1.00 57.63  ? 88  ARG A NE  1 
ATOM   611  C CZ  . ARG A 1  78  ? 39.576 -38.725 84.151  1.00 58.04  ? 88  ARG A CZ  1 
ATOM   612  N NH1 . ARG A 1  78  ? 39.732 -37.417 84.288  1.00 57.27  ? 88  ARG A NH1 1 
ATOM   613  N NH2 . ARG A 1  78  ? 39.418 -39.480 85.229  1.00 58.42  ? 88  ARG A NH2 1 
ATOM   614  N N   . SER A 1  79  ? 35.214 -37.593 79.747  1.00 46.22  ? 89  SER A N   1 
ATOM   615  C CA  . SER A 1  79  ? 34.692 -36.306 79.303  1.00 45.93  ? 89  SER A CA  1 
ATOM   616  C C   . SER A 1  79  ? 35.748 -35.241 79.070  1.00 46.51  ? 89  SER A C   1 
ATOM   617  O O   . SER A 1  79  ? 35.541 -34.333 78.270  1.00 49.16  ? 89  SER A O   1 
ATOM   618  C CB  . SER A 1  79  ? 33.662 -35.777 80.297  1.00 45.03  ? 89  SER A CB  1 
ATOM   619  O OG  . SER A 1  79  ? 34.288 -35.283 81.464  1.00 46.42  ? 89  SER A OG  1 
ATOM   620  N N   . ASP A 1  80  ? 36.879 -35.350 79.757  1.00 45.93  ? 90  ASP A N   1 
ATOM   621  C CA  . ASP A 1  80  ? 37.955 -34.373 79.615  1.00 45.56  ? 90  ASP A CA  1 
ATOM   622  C C   . ASP A 1  80  ? 39.158 -34.891 78.823  1.00 44.01  ? 90  ASP A C   1 
ATOM   623  O O   . ASP A 1  80  ? 40.205 -34.241 78.773  1.00 44.18  ? 90  ASP A O   1 
ATOM   624  C CB  . ASP A 1  80  ? 38.416 -33.920 80.999  1.00 49.91  ? 90  ASP A CB  1 
ATOM   625  C CG  . ASP A 1  80  ? 38.690 -35.090 81.932  1.00 54.88  ? 90  ASP A CG  1 
ATOM   626  O OD1 . ASP A 1  80  ? 37.741 -35.855 82.219  1.00 59.24  ? 90  ASP A OD1 1 
ATOM   627  O OD2 . ASP A 1  80  ? 39.850 -35.248 82.377  1.00 54.35  ? 90  ASP A OD2 1 
ATOM   628  N N   . ALA A 1  81  ? 39.003 -36.055 78.202  1.00 40.38  ? 91  ALA A N   1 
ATOM   629  C CA  . ALA A 1  81  ? 40.074 -36.666 77.426  1.00 38.16  ? 91  ALA A CA  1 
ATOM   630  C C   . ALA A 1  81  ? 40.778 -35.717 76.462  1.00 39.41  ? 91  ALA A C   1 
ATOM   631  O O   . ALA A 1  81  ? 41.977 -35.847 76.230  1.00 40.72  ? 91  ALA A O   1 
ATOM   632  C CB  . ALA A 1  81  ? 39.533 -37.854 76.665  1.00 35.67  ? 91  ALA A CB  1 
ATOM   633  N N   . LEU A 1  82  ? 40.043 -34.767 75.896  1.00 41.03  ? 92  LEU A N   1 
ATOM   634  C CA  . LEU A 1  82  ? 40.644 -33.835 74.946  1.00 43.99  ? 92  LEU A CA  1 
ATOM   635  C C   . LEU A 1  82  ? 41.522 -32.793 75.625  1.00 45.27  ? 92  LEU A C   1 
ATOM   636  O O   . LEU A 1  82  ? 42.537 -32.371 75.062  1.00 47.10  ? 92  LEU A O   1 
ATOM   637  C CB  . LEU A 1  82  ? 39.565 -33.136 74.108  1.00 42.50  ? 92  LEU A CB  1 
ATOM   638  C CG  . LEU A 1  82  ? 40.069 -32.114 73.081  1.00 39.64  ? 92  LEU A CG  1 
ATOM   639  C CD1 . LEU A 1  82  ? 41.041 -32.787 72.110  1.00 37.03  ? 92  LEU A CD1 1 
ATOM   640  C CD2 . LEU A 1  82  ? 38.878 -31.496 72.344  1.00 38.02  ? 92  LEU A CD2 1 
ATOM   641  N N   . GLN A 1  83  ? 41.131 -32.373 76.826  1.00 46.80  ? 93  GLN A N   1 
ATOM   642  C CA  . GLN A 1  83  ? 41.913 -31.391 77.573  1.00 48.14  ? 93  GLN A CA  1 
ATOM   643  C C   . GLN A 1  83  ? 43.191 -32.019 78.126  1.00 48.08  ? 93  GLN A C   1 
ATOM   644  O O   . GLN A 1  83  ? 44.213 -31.345 78.254  1.00 46.18  ? 93  GLN A O   1 
ATOM   645  C CB  . GLN A 1  83  ? 41.099 -30.808 78.736  1.00 51.43  ? 93  GLN A CB  1 
ATOM   646  C CG  . GLN A 1  83  ? 39.907 -29.967 78.311  1.00 59.15  ? 93  GLN A CG  1 
ATOM   647  C CD  . GLN A 1  83  ? 38.643 -30.786 78.136  1.00 65.00  ? 93  GLN A CD  1 
ATOM   648  O OE1 . GLN A 1  83  ? 37.893 -30.995 79.089  1.00 69.73  ? 93  GLN A OE1 1 
ATOM   649  N NE2 . GLN A 1  83  ? 38.407 -31.262 76.919  1.00 66.63  ? 93  GLN A NE2 1 
ATOM   650  N N   . LEU A 1  84  ? 43.128 -33.310 78.447  1.00 47.61  ? 94  LEU A N   1 
ATOM   651  C CA  . LEU A 1  84  ? 44.269 -34.031 79.003  1.00 45.71  ? 94  LEU A CA  1 
ATOM   652  C C   . LEU A 1  84  ? 45.169 -34.625 77.934  1.00 43.89  ? 94  LEU A C   1 
ATOM   653  O O   . LEU A 1  84  ? 46.294 -35.037 78.221  1.00 45.98  ? 94  LEU A O   1 
ATOM   654  C CB  . LEU A 1  84  ? 43.787 -35.147 79.937  1.00 47.62  ? 94  LEU A CB  1 
ATOM   655  C CG  . LEU A 1  84  ? 43.250 -34.742 81.315  1.00 50.03  ? 94  LEU A CG  1 
ATOM   656  C CD1 . LEU A 1  84  ? 42.128 -33.745 81.169  1.00 53.43  ? 94  LEU A CD1 1 
ATOM   657  C CD2 . LEU A 1  84  ? 42.754 -35.971 82.047  1.00 51.01  ? 94  LEU A CD2 1 
ATOM   658  N N   . GLY A 1  85  ? 44.678 -34.672 76.701  1.00 40.99  ? 95  GLY A N   1 
ATOM   659  C CA  . GLY A 1  85  ? 45.477 -35.226 75.626  1.00 38.40  ? 95  GLY A CA  1 
ATOM   660  C C   . GLY A 1  85  ? 45.430 -36.737 75.625  1.00 38.36  ? 95  GLY A C   1 
ATOM   661  O O   . GLY A 1  85  ? 46.361 -37.408 75.167  1.00 37.45  ? 95  GLY A O   1 
ATOM   662  N N   . LEU A 1  86  ? 44.333 -37.276 76.145  1.00 38.74  ? 96  LEU A N   1 
ATOM   663  C CA  . LEU A 1  86  ? 44.139 -38.718 76.205  1.00 38.29  ? 96  LEU A CA  1 
ATOM   664  C C   . LEU A 1  86  ? 43.227 -39.117 75.049  1.00 36.28  ? 96  LEU A C   1 
ATOM   665  O O   . LEU A 1  86  ? 42.047 -38.774 75.042  1.00 34.97  ? 96  LEU A O   1 
ATOM   666  C CB  . LEU A 1  86  ? 43.496 -39.103 77.544  1.00 40.41  ? 96  LEU A CB  1 
ATOM   667  C CG  . LEU A 1  86  ? 44.062 -38.426 78.808  1.00 41.19  ? 96  LEU A CG  1 
ATOM   668  C CD1 . LEU A 1  86  ? 43.298 -38.913 80.039  1.00 39.53  ? 96  LEU A CD1 1 
ATOM   669  C CD2 . LEU A 1  86  ? 45.556 -38.716 78.948  1.00 39.17  ? 96  LEU A CD2 1 
ATOM   670  N N   . GLY A 1  87  ? 43.788 -39.826 74.073  1.00 36.82  ? 97  GLY A N   1 
ATOM   671  C CA  . GLY A 1  87  ? 43.023 -40.258 72.917  1.00 37.82  ? 97  GLY A CA  1 
ATOM   672  C C   . GLY A 1  87  ? 43.486 -41.609 72.399  1.00 40.03  ? 97  GLY A C   1 
ATOM   673  O O   . GLY A 1  87  ? 44.180 -42.338 73.102  1.00 41.23  ? 97  GLY A O   1 
ATOM   674  N N   . LYS A 1  88  ? 43.115 -41.943 71.167  1.00 39.75  ? 98  LYS A N   1 
ATOM   675  C CA  . LYS A 1  88  ? 43.489 -43.220 70.580  1.00 41.07  ? 98  LYS A CA  1 
ATOM   676  C C   . LYS A 1  88  ? 44.961 -43.272 70.165  1.00 44.31  ? 98  LYS A C   1 
ATOM   677  O O   . LYS A 1  88  ? 45.303 -43.231 68.979  1.00 45.56  ? 98  LYS A O   1 
ATOM   678  C CB  . LYS A 1  88  ? 42.579 -43.525 69.390  1.00 40.26  ? 98  LYS A CB  1 
ATOM   679  C CG  . LYS A 1  88  ? 41.106 -43.586 69.769  1.00 41.32  ? 98  LYS A CG  1 
ATOM   680  C CD  . LYS A 1  88  ? 40.227 -44.012 68.603  1.00 43.20  ? 98  LYS A CD  1 
ATOM   681  C CE  . LYS A 1  88  ? 40.146 -42.934 67.550  1.00 45.51  ? 98  LYS A CE  1 
ATOM   682  N NZ  . LYS A 1  88  ? 39.369 -43.391 66.372  1.00 47.29  ? 98  LYS A NZ  1 
ATOM   683  N N   . HIS A 1  89  ? 45.825 -43.371 71.172  1.00 45.49  ? 99  HIS A N   1 
ATOM   684  C CA  . HIS A 1  89  ? 47.270 -43.436 70.993  1.00 44.53  ? 99  HIS A CA  1 
ATOM   685  C C   . HIS A 1  89  ? 47.839 -43.833 72.353  1.00 46.40  ? 99  HIS A C   1 
ATOM   686  O O   . HIS A 1  89  ? 47.092 -43.919 73.330  1.00 45.14  ? 99  HIS A O   1 
ATOM   687  C CB  . HIS A 1  89  ? 47.820 -42.065 70.598  1.00 42.22  ? 99  HIS A CB  1 
ATOM   688  C CG  . HIS A 1  89  ? 47.678 -41.028 71.671  1.00 43.35  ? 99  HIS A CG  1 
ATOM   689  N ND1 . HIS A 1  89  ? 46.861 -39.926 71.539  1.00 43.69  ? 99  HIS A ND1 1 
ATOM   690  C CD2 . HIS A 1  89  ? 48.253 -40.924 72.894  1.00 42.20  ? 99  HIS A CD2 1 
ATOM   691  C CE1 . HIS A 1  89  ? 46.941 -39.188 72.632  1.00 43.93  ? 99  HIS A CE1 1 
ATOM   692  N NE2 . HIS A 1  89  ? 47.779 -39.772 73.470  1.00 45.37  ? 99  HIS A NE2 1 
ATOM   693  N N   . ASN A 1  90  ? 49.154 -44.042 72.421  1.00 47.39  ? 100 ASN A N   1 
ATOM   694  C CA  . ASN A 1  90  ? 49.808 -44.422 73.670  1.00 47.12  ? 100 ASN A CA  1 
ATOM   695  C C   . ASN A 1  90  ? 50.947 -43.465 74.021  1.00 48.02  ? 100 ASN A C   1 
ATOM   696  O O   . ASN A 1  90  ? 52.003 -43.880 74.502  1.00 48.69  ? 100 ASN A O   1 
ATOM   697  C CB  . ASN A 1  90  ? 50.357 -45.841 73.566  1.00 46.26  ? 100 ASN A CB  1 
ATOM   698  C CG  . ASN A 1  90  ? 51.498 -45.949 72.581  1.00 49.20  ? 100 ASN A CG  1 
ATOM   699  O OD1 . ASN A 1  90  ? 52.190 -46.965 72.528  1.00 52.14  ? 100 ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1  90  ? 51.702 -44.900 71.788  1.00 51.13  ? 100 ASN A ND2 1 
ATOM   701  N N   . TYR A 1  91  ? 50.728 -42.181 73.785  1.00 49.20  ? 101 TYR A N   1 
ATOM   702  C CA  . TYR A 1  91  ? 51.748 -41.182 74.065  1.00 52.93  ? 101 TYR A CA  1 
ATOM   703  C C   . TYR A 1  91  ? 51.714 -40.755 75.527  1.00 54.08  ? 101 TYR A C   1 
ATOM   704  O O   . TYR A 1  91  ? 50.640 -40.600 76.114  1.00 57.33  ? 101 TYR A O   1 
ATOM   705  C CB  . TYR A 1  91  ? 51.554 -39.964 73.148  1.00 53.39  ? 101 TYR A CB  1 
ATOM   706  C CG  . TYR A 1  91  ? 51.410 -40.324 71.680  1.00 53.57  ? 101 TYR A CG  1 
ATOM   707  C CD1 . TYR A 1  91  ? 52.109 -41.406 71.137  1.00 53.42  ? 101 TYR A CD1 1 
ATOM   708  C CD2 . TYR A 1  91  ? 50.578 -39.584 70.833  1.00 53.31  ? 101 TYR A CD2 1 
ATOM   709  C CE1 . TYR A 1  91  ? 51.983 -41.747 69.792  1.00 53.80  ? 101 TYR A CE1 1 
ATOM   710  C CE2 . TYR A 1  91  ? 50.444 -39.915 69.480  1.00 52.03  ? 101 TYR A CE2 1 
ATOM   711  C CZ  . TYR A 1  91  ? 51.152 -40.999 68.967  1.00 54.46  ? 101 TYR A CZ  1 
ATOM   712  O OH  . TYR A 1  91  ? 51.038 -41.340 67.635  1.00 53.37  ? 101 TYR A OH  1 
ATOM   713  N N   . CYS A 1  92  ? 52.898 -40.569 76.107  1.00 53.55  ? 102 CYS A N   1 
ATOM   714  C CA  . CYS A 1  92  ? 53.032 -40.161 77.502  1.00 54.16  ? 102 CYS A CA  1 
ATOM   715  C C   . CYS A 1  92  ? 52.281 -38.882 77.816  1.00 51.62  ? 102 CYS A C   1 
ATOM   716  O O   . CYS A 1  92  ? 52.417 -37.882 77.117  1.00 53.59  ? 102 CYS A O   1 
ATOM   717  C CB  . CYS A 1  92  ? 54.498 -39.941 77.850  1.00 60.32  ? 102 CYS A CB  1 
ATOM   718  S SG  . CYS A 1  92  ? 55.518 -41.439 77.959  1.00 69.59  ? 102 CYS A SG  1 
ATOM   719  N N   . ARG A 1  93  ? 51.500 -38.910 78.883  1.00 47.64  ? 103 ARG A N   1 
ATOM   720  C CA  . ARG A 1  93  ? 50.739 -37.740 79.289  1.00 48.69  ? 103 ARG A CA  1 
ATOM   721  C C   . ARG A 1  93  ? 50.794 -37.646 80.809  1.00 49.02  ? 103 ARG A C   1 
ATOM   722  O O   . ARG A 1  93  ? 51.195 -38.596 81.483  1.00 51.66  ? 103 ARG A O   1 
ATOM   723  C CB  . ARG A 1  93  ? 49.286 -37.860 78.809  1.00 48.10  ? 103 ARG A CB  1 
ATOM   724  C CG  . ARG A 1  93  ? 49.119 -37.896 77.282  1.00 49.64  ? 103 ARG A CG  1 
ATOM   725  C CD  . ARG A 1  93  ? 49.350 -36.524 76.661  1.00 49.06  ? 103 ARG A CD  1 
ATOM   726  N NE  . ARG A 1  93  ? 49.134 -36.515 75.214  1.00 46.88  ? 103 ARG A NE  1 
ATOM   727  C CZ  . ARG A 1  93  ? 50.052 -36.837 74.305  1.00 46.96  ? 103 ARG A CZ  1 
ATOM   728  N NH1 . ARG A 1  93  ? 51.268 -37.197 74.683  1.00 46.09  ? 103 ARG A NH1 1 
ATOM   729  N NH2 . ARG A 1  93  ? 49.756 -36.796 73.012  1.00 45.15  ? 103 ARG A NH2 1 
ATOM   730  N N   . ASN A 1  94  ? 50.401 -36.501 81.351  1.00 48.42  ? 104 ASN A N   1 
ATOM   731  C CA  . ASN A 1  94  ? 50.421 -36.314 82.793  1.00 46.83  ? 104 ASN A CA  1 
ATOM   732  C C   . ASN A 1  94  ? 49.124 -35.654 83.255  1.00 45.42  ? 104 ASN A C   1 
ATOM   733  O O   . ASN A 1  94  ? 49.135 -34.557 83.824  1.00 43.85  ? 104 ASN A O   1 
ATOM   734  C CB  . ASN A 1  94  ? 51.639 -35.469 83.190  1.00 48.41  ? 104 ASN A CB  1 
ATOM   735  C CG  . ASN A 1  94  ? 51.868 -35.445 84.686  1.00 50.34  ? 104 ASN A CG  1 
ATOM   736  O OD1 . ASN A 1  94  ? 51.836 -36.487 85.343  1.00 51.02  ? 104 ASN A OD1 1 
ATOM   737  N ND2 . ASN A 1  94  ? 52.110 -34.258 85.233  1.00 51.86  ? 104 ASN A ND2 1 
ATOM   738  N N   . PRO A 1  95  ? 47.980 -36.324 83.013  1.00 44.04  ? 105 PRO A N   1 
ATOM   739  C CA  . PRO A 1  95  ? 46.661 -35.812 83.398  1.00 46.03  ? 105 PRO A CA  1 
ATOM   740  C C   . PRO A 1  95  ? 46.614 -35.402 84.867  1.00 50.00  ? 105 PRO A C   1 
ATOM   741  O O   . PRO A 1  95  ? 46.079 -34.346 85.209  1.00 50.43  ? 105 PRO A O   1 
ATOM   742  C CB  . PRO A 1  95  ? 45.725 -36.977 83.065  1.00 41.73  ? 105 PRO A CB  1 
ATOM   743  C CG  . PRO A 1  95  ? 46.613 -38.171 83.167  1.00 40.72  ? 105 PRO A CG  1 
ATOM   744  C CD  . PRO A 1  95  ? 47.870 -37.698 82.497  1.00 41.93  ? 105 PRO A CD  1 
ATOM   745  N N   . ASP A 1  96  ? 47.161 -36.254 85.730  1.00 56.61  ? 106 ASP A N   1 
ATOM   746  C CA  . ASP A 1  96  ? 47.234 -35.970 87.160  1.00 60.55  ? 106 ASP A CA  1 
ATOM   747  C C   . ASP A 1  96  ? 48.568 -35.241 87.305  1.00 65.05  ? 106 ASP A C   1 
ATOM   748  O O   . ASP A 1  96  ? 49.569 -35.641 86.704  1.00 65.72  ? 106 ASP A O   1 
ATOM   749  C CB  . ASP A 1  96  ? 47.230 -37.271 87.975  1.00 59.04  ? 106 ASP A CB  1 
ATOM   750  C CG  . ASP A 1  96  ? 48.111 -38.352 87.361  1.00 60.21  ? 106 ASP A CG  1 
ATOM   751  O OD1 . ASP A 1  96  ? 49.265 -38.056 86.988  1.00 61.43  ? 106 ASP A OD1 1 
ATOM   752  O OD2 . ASP A 1  96  ? 47.653 -39.507 87.254  1.00 60.83  ? 106 ASP A OD2 1 
ATOM   753  N N   . ASN A 1  97  ? 48.589 -34.167 88.082  1.00 68.33  ? 107 ASN A N   1 
ATOM   754  C CA  . ASN A 1  97  ? 49.816 -33.400 88.232  1.00 72.92  ? 107 ASN A CA  1 
ATOM   755  C C   . ASN A 1  97  ? 50.945 -34.097 88.969  1.00 73.88  ? 107 ASN A C   1 
ATOM   756  O O   . ASN A 1  97  ? 51.058 -34.020 90.189  1.00 76.47  ? 107 ASN A O   1 
ATOM   757  C CB  . ASN A 1  97  ? 49.511 -32.058 88.889  1.00 75.37  ? 107 ASN A CB  1 
ATOM   758  C CG  . ASN A 1  97  ? 48.710 -31.150 87.983  1.00 77.42  ? 107 ASN A CG  1 
ATOM   759  O OD1 . ASN A 1  97  ? 49.139 -30.832 86.869  1.00 76.72  ? 107 ASN A OD1 1 
ATOM   760  N ND2 . ASN A 1  97  ? 47.536 -30.729 88.451  1.00 77.71  ? 107 ASN A ND2 1 
ATOM   761  N N   . ARG A 1  98  ? 51.776 -34.785 88.198  1.00 74.04  ? 108 ARG A N   1 
ATOM   762  C CA  . ARG A 1  98  ? 52.934 -35.486 88.721  1.00 75.14  ? 108 ARG A CA  1 
ATOM   763  C C   . ARG A 1  98  ? 54.100 -34.795 88.035  1.00 77.76  ? 108 ARG A C   1 
ATOM   764  O O   . ARG A 1  98  ? 54.106 -34.668 86.815  1.00 80.42  ? 108 ARG A O   1 
ATOM   765  C CB  . ARG A 1  98  ? 52.873 -36.967 88.335  1.00 73.86  ? 108 ARG A CB  1 
ATOM   766  C CG  . ARG A 1  98  ? 51.624 -37.660 88.861  1.00 75.40  ? 108 ARG A CG  1 
ATOM   767  C CD  . ARG A 1  98  ? 51.630 -39.172 88.649  1.00 75.72  ? 108 ARG A CD  1 
ATOM   768  N NE  . ARG A 1  98  ? 50.555 -39.811 89.415  1.00 77.53  ? 108 ARG A NE  1 
ATOM   769  C CZ  . ARG A 1  98  ? 50.359 -41.124 89.503  1.00 76.22  ? 108 ARG A CZ  1 
ATOM   770  N NH1 . ARG A 1  98  ? 51.164 -41.965 88.869  1.00 77.42  ? 108 ARG A NH1 1 
ATOM   771  N NH2 . ARG A 1  98  ? 49.360 -41.598 90.236  1.00 71.84  ? 108 ARG A NH2 1 
ATOM   772  N N   . ARG A 1  99  ? 55.067 -34.326 88.816  1.00 79.99  ? 109 ARG A N   1 
ATOM   773  C CA  . ARG A 1  99  ? 56.235 -33.618 88.285  1.00 81.02  ? 109 ARG A CA  1 
ATOM   774  C C   . ARG A 1  99  ? 56.898 -34.293 87.086  1.00 78.99  ? 109 ARG A C   1 
ATOM   775  O O   . ARG A 1  99  ? 57.960 -33.865 86.637  1.00 78.55  ? 109 ARG A O   1 
ATOM   776  C CB  . ARG A 1  99  ? 57.289 -33.433 89.388  1.00 84.76  ? 109 ARG A CB  1 
ATOM   777  C CG  . ARG A 1  99  ? 57.013 -32.315 90.400  1.00 88.44  ? 109 ARG A CG  1 
ATOM   778  C CD  . ARG A 1  99  ? 55.813 -32.596 91.303  1.00 90.30  ? 109 ARG A CD  1 
ATOM   779  N NE  . ARG A 1  99  ? 54.533 -32.498 90.603  1.00 92.65  ? 109 ARG A NE  1 
ATOM   780  C CZ  . ARG A 1  99  ? 54.106 -31.415 89.959  1.00 92.41  ? 109 ARG A CZ  1 
ATOM   781  N NH1 . ARG A 1  99  ? 54.857 -30.320 89.913  1.00 92.80  ? 109 ARG A NH1 1 
ATOM   782  N NH2 . ARG A 1  99  ? 52.918 -31.423 89.366  1.00 91.21  ? 109 ARG A NH2 1 
ATOM   783  N N   . ARG A 1  100 ? 56.270 -35.336 86.559  1.00 76.93  ? 110 ARG A N   1 
ATOM   784  C CA  . ARG A 1  100 ? 56.841 -36.062 85.441  1.00 74.59  ? 110 ARG A CA  1 
ATOM   785  C C   . ARG A 1  100 ? 55.791 -36.779 84.594  1.00 72.72  ? 110 ARG A C   1 
ATOM   786  O O   . ARG A 1  100 ? 54.932 -37.485 85.124  1.00 73.01  ? 110 ARG A O   1 
ATOM   787  C CB  . ARG A 1  100 ? 57.839 -37.073 85.992  1.00 76.84  ? 110 ARG A CB  1 
ATOM   788  C CG  . ARG A 1  100 ? 59.251 -36.865 85.526  1.00 80.13  ? 110 ARG A CG  1 
ATOM   789  C CD  . ARG A 1  100 ? 59.368 -37.291 84.096  1.00 86.70  ? 110 ARG A CD  1 
ATOM   790  N NE  . ARG A 1  100 ? 60.746 -37.250 83.634  1.00 94.43  ? 110 ARG A NE  1 
ATOM   791  C CZ  . ARG A 1  100 ? 61.145 -37.767 82.480  1.00 98.72  ? 110 ARG A CZ  1 
ATOM   792  N NH1 . ARG A 1  100 ? 60.259 -38.360 81.688  1.00 99.30  ? 110 ARG A NH1 1 
ATOM   793  N NH2 . ARG A 1  100 ? 62.420 -37.692 82.122  1.00 102.55 ? 110 ARG A NH2 1 
ATOM   794  N N   . PRO A 1  101 ? 55.844 -36.605 83.261  1.00 69.88  ? 111 PRO A N   1 
ATOM   795  C CA  . PRO A 1  101 ? 54.875 -37.268 82.381  1.00 66.42  ? 111 PRO A CA  1 
ATOM   796  C C   . PRO A 1  101 ? 55.028 -38.790 82.441  1.00 62.43  ? 111 PRO A C   1 
ATOM   797  O O   . PRO A 1  101 ? 56.143 -39.311 82.519  1.00 59.99  ? 111 PRO A O   1 
ATOM   798  C CB  . PRO A 1  101 ? 55.205 -36.691 81.001  1.00 66.62  ? 111 PRO A CB  1 
ATOM   799  C CG  . PRO A 1  101 ? 56.662 -36.390 81.100  1.00 69.12  ? 111 PRO A CG  1 
ATOM   800  C CD  . PRO A 1  101 ? 56.773 -35.772 82.478  1.00 69.69  ? 111 PRO A CD  1 
ATOM   801  N N   . TRP A 1  102 ? 53.898 -39.490 82.400  1.00 58.81  ? 112 TRP A N   1 
ATOM   802  C CA  . TRP A 1  102 ? 53.875 -40.949 82.474  1.00 52.80  ? 112 TRP A CA  1 
ATOM   803  C C   . TRP A 1  102 ? 52.926 -41.589 81.471  1.00 51.89  ? 112 TRP A C   1 
ATOM   804  O O   . TRP A 1  102 ? 52.562 -40.988 80.460  1.00 49.71  ? 112 TRP A O   1 
ATOM   805  C CB  . TRP A 1  102 ? 53.445 -41.386 83.870  1.00 46.95  ? 112 TRP A CB  1 
ATOM   806  C CG  . TRP A 1  102 ? 52.137 -40.781 84.292  1.00 40.40  ? 112 TRP A CG  1 
ATOM   807  C CD1 . TRP A 1  102 ? 51.938 -39.526 84.802  1.00 39.04  ? 112 TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1  102 ? 50.845 -41.398 84.228  1.00 36.82  ? 112 TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1  102 ? 50.603 -39.327 85.063  1.00 36.30  ? 112 TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1  102 ? 49.909 -40.458 84.718  1.00 36.41  ? 112 TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1  102 ? 50.386 -42.652 83.803  1.00 34.44  ? 112 TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1  102 ? 48.535 -40.734 84.794  1.00 37.09  ? 112 TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1  102 ? 49.020 -42.928 83.878  1.00 34.57  ? 112 TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1  102 ? 48.111 -41.971 84.371  1.00 34.30  ? 112 TRP A CH2 1 
ATOM   815  N N   . CYS A 1  103 ? 52.526 -42.820 81.784  1.00 53.22  ? 113 CYS A N   1 
ATOM   816  C CA  . CYS A 1  103 ? 51.603 -43.601 80.964  1.00 52.77  ? 113 CYS A CA  1 
ATOM   817  C C   . CYS A 1  103 ? 51.384 -44.972 81.621  1.00 52.00  ? 113 CYS A C   1 
ATOM   818  O O   . CYS A 1  103 ? 52.161 -45.385 82.484  1.00 51.82  ? 113 CYS A O   1 
ATOM   819  C CB  . CYS A 1  103 ? 52.173 -43.783 79.554  1.00 52.60  ? 113 CYS A CB  1 
ATOM   820  S SG  . CYS A 1  103 ? 53.441 -45.082 79.422  1.00 56.05  ? 113 CYS A SG  1 
ATOM   821  N N   . TYR A 1  104 ? 50.323 -45.669 81.225  1.00 50.91  ? 114 TYR A N   1 
ATOM   822  C CA  . TYR A 1  104 ? 50.045 -46.996 81.773  1.00 51.01  ? 114 TYR A CA  1 
ATOM   823  C C   . TYR A 1  104 ? 50.860 -48.042 81.033  1.00 51.13  ? 114 TYR A C   1 
ATOM   824  O O   . TYR A 1  104 ? 50.855 -48.100 79.805  1.00 50.68  ? 114 TYR A O   1 
ATOM   825  C CB  . TYR A 1  104 ? 48.564 -47.351 81.650  1.00 49.39  ? 114 TYR A CB  1 
ATOM   826  C CG  . TYR A 1  104 ? 47.670 -46.576 82.575  1.00 49.24  ? 114 TYR A CG  1 
ATOM   827  C CD1 . TYR A 1  104 ? 47.759 -46.736 83.955  1.00 47.91  ? 114 TYR A CD1 1 
ATOM   828  C CD2 . TYR A 1  104 ? 46.726 -45.680 82.074  1.00 49.24  ? 114 TYR A CD2 1 
ATOM   829  C CE1 . TYR A 1  104 ? 46.926 -46.020 84.815  1.00 48.20  ? 114 TYR A CE1 1 
ATOM   830  C CE2 . TYR A 1  104 ? 45.891 -44.961 82.924  1.00 47.52  ? 114 TYR A CE2 1 
ATOM   831  C CZ  . TYR A 1  104 ? 45.996 -45.136 84.289  1.00 46.38  ? 114 TYR A CZ  1 
ATOM   832  O OH  . TYR A 1  104 ? 45.174 -44.428 85.126  1.00 46.54  ? 114 TYR A OH  1 
ATOM   833  N N   . VAL A 1  105 ? 51.560 -48.873 81.788  1.00 53.79  ? 115 VAL A N   1 
ATOM   834  C CA  . VAL A 1  105 ? 52.375 -49.914 81.193  1.00 56.51  ? 115 VAL A CA  1 
ATOM   835  C C   . VAL A 1  105 ? 51.899 -51.255 81.726  1.00 56.49  ? 115 VAL A C   1 
ATOM   836  O O   . VAL A 1  105 ? 51.679 -51.414 82.926  1.00 55.04  ? 115 VAL A O   1 
ATOM   837  C CB  . VAL A 1  105 ? 53.876 -49.718 81.539  1.00 57.79  ? 115 VAL A CB  1 
ATOM   838  C CG1 . VAL A 1  105 ? 54.723 -50.752 80.810  1.00 57.48  ? 115 VAL A CG1 1 
ATOM   839  C CG2 . VAL A 1  105 ? 54.319 -48.313 81.161  1.00 56.68  ? 115 VAL A CG2 1 
ATOM   840  N N   . GLN A 1  106 ? 51.722 -52.212 80.825  1.00 57.47  ? 116 GLN A N   1 
ATOM   841  C CA  . GLN A 1  106 ? 51.280 -53.533 81.221  1.00 60.07  ? 116 GLN A CA  1 
ATOM   842  C C   . GLN A 1  106 ? 52.452 -54.315 81.783  1.00 63.38  ? 116 GLN A C   1 
ATOM   843  O O   . GLN A 1  106 ? 53.515 -54.391 81.166  1.00 65.89  ? 116 GLN A O   1 
ATOM   844  C CB  . GLN A 1  106 ? 50.704 -54.291 80.027  1.00 61.31  ? 116 GLN A CB  1 
ATOM   845  C CG  . GLN A 1  106 ? 50.191 -55.675 80.388  1.00 66.04  ? 116 GLN A CG  1 
ATOM   846  C CD  . GLN A 1  106 ? 49.052 -55.628 81.403  1.00 70.69  ? 116 GLN A CD  1 
ATOM   847  O OE1 . GLN A 1  106 ? 47.978 -55.092 81.121  1.00 74.02  ? 116 GLN A OE1 1 
ATOM   848  N NE2 . GLN A 1  106 ? 49.286 -56.185 82.591  1.00 70.60  ? 116 GLN A NE2 1 
ATOM   849  N N   . VAL A 1  107 ? 52.262 -54.881 82.967  1.00 63.91  ? 117 VAL A N   1 
ATOM   850  C CA  . VAL A 1  107 ? 53.297 -55.686 83.593  1.00 62.81  ? 117 VAL A CA  1 
ATOM   851  C C   . VAL A 1  107 ? 52.656 -56.974 84.108  1.00 63.54  ? 117 VAL A C   1 
ATOM   852  O O   . VAL A 1  107 ? 51.986 -56.993 85.146  1.00 63.47  ? 117 VAL A O   1 
ATOM   853  C CB  . VAL A 1  107 ? 54.011 -54.921 84.749  1.00 60.43  ? 117 VAL A CB  1 
ATOM   854  C CG1 . VAL A 1  107 ? 54.789 -53.745 84.181  1.00 57.59  ? 117 VAL A CG1 1 
ATOM   855  C CG2 . VAL A 1  107 ? 53.005 -54.431 85.778  1.00 59.86  ? 117 VAL A CG2 1 
ATOM   856  N N   . GLY A 1  108 ? 52.845 -58.047 83.347  1.00 63.87  ? 118 GLY A N   1 
ATOM   857  C CA  . GLY A 1  108 ? 52.285 -59.328 83.730  1.00 66.31  ? 118 GLY A CA  1 
ATOM   858  C C   . GLY A 1  108 ? 50.776 -59.358 83.601  1.00 67.42  ? 118 GLY A C   1 
ATOM   859  O O   . GLY A 1  108 ? 50.250 -59.425 82.494  1.00 67.63  ? 118 GLY A O   1 
ATOM   860  N N   . LEU A 1  109 ? 50.074 -59.302 84.728  1.00 69.49  ? 119 LEU A N   1 
ATOM   861  C CA  . LEU A 1  109 ? 48.618 -59.337 84.700  1.00 70.88  ? 119 LEU A CA  1 
ATOM   862  C C   . LEU A 1  109 ? 47.959 -57.976 84.880  1.00 71.00  ? 119 LEU A C   1 
ATOM   863  O O   . LEU A 1  109 ? 46.846 -57.759 84.404  1.00 72.32  ? 119 LEU A O   1 
ATOM   864  C CB  . LEU A 1  109 ? 48.083 -60.299 85.767  1.00 70.71  ? 119 LEU A CB  1 
ATOM   865  C CG  . LEU A 1  109 ? 48.221 -61.807 85.522  1.00 70.97  ? 119 LEU A CG  1 
ATOM   866  C CD1 . LEU A 1  109 ? 47.611 -62.560 86.697  1.00 71.27  ? 119 LEU A CD1 1 
ATOM   867  C CD2 . LEU A 1  109 ? 47.517 -62.202 84.227  1.00 69.82  ? 119 LEU A CD2 1 
ATOM   868  N N   . LYS A 1  110 ? 48.638 -57.055 85.552  1.00 70.70  ? 120 LYS A N   1 
ATOM   869  C CA  . LYS A 1  110 ? 48.053 -55.740 85.785  1.00 70.79  ? 120 LYS A CA  1 
ATOM   870  C C   . LYS A 1  110 ? 48.841 -54.577 85.191  1.00 68.54  ? 120 LYS A C   1 
ATOM   871  O O   . LYS A 1  110 ? 50.065 -54.635 85.077  1.00 70.77  ? 120 LYS A O   1 
ATOM   872  C CB  . LYS A 1  110 ? 47.882 -55.510 87.290  1.00 73.06  ? 120 LYS A CB  1 
ATOM   873  C CG  . LYS A 1  110 ? 47.045 -56.571 87.999  1.00 75.61  ? 120 LYS A CG  1 
ATOM   874  C CD  . LYS A 1  110 ? 47.009 -56.328 89.503  1.00 78.03  ? 120 LYS A CD  1 
ATOM   875  C CE  . LYS A 1  110 ? 46.213 -57.407 90.227  1.00 80.01  ? 120 LYS A CE  1 
ATOM   876  N NZ  . LYS A 1  110 ? 46.148 -57.152 91.699  1.00 80.41  ? 120 LYS A NZ  1 
ATOM   877  N N   . PRO A 1  111 ? 48.138 -53.505 84.791  1.00 63.59  ? 121 PRO A N   1 
ATOM   878  C CA  . PRO A 1  111 ? 48.755 -52.309 84.209  1.00 59.81  ? 121 PRO A CA  1 
ATOM   879  C C   . PRO A 1  111 ? 49.126 -51.336 85.319  1.00 59.11  ? 121 PRO A C   1 
ATOM   880  O O   . PRO A 1  111 ? 48.311 -51.068 86.193  1.00 60.93  ? 121 PRO A O   1 
ATOM   881  C CB  . PRO A 1  111 ? 47.649 -51.761 83.324  1.00 58.81  ? 121 PRO A CB  1 
ATOM   882  C CG  . PRO A 1  111 ? 46.430 -52.062 84.131  1.00 58.40  ? 121 PRO A CG  1 
ATOM   883  C CD  . PRO A 1  111 ? 46.675 -53.480 84.600  1.00 59.42  ? 121 PRO A CD  1 
ATOM   884  N N   . LEU A 1  112 ? 50.345 -50.806 85.293  1.00 58.23  ? 122 LEU A N   1 
ATOM   885  C CA  . LEU A 1  112 ? 50.768 -49.867 86.331  1.00 57.29  ? 122 LEU A CA  1 
ATOM   886  C C   . LEU A 1  112 ? 51.352 -48.569 85.782  1.00 54.42  ? 122 LEU A C   1 
ATOM   887  O O   . LEU A 1  112 ? 51.958 -48.553 84.719  1.00 54.39  ? 122 LEU A O   1 
ATOM   888  C CB  . LEU A 1  112 ? 51.787 -50.538 87.263  1.00 61.27  ? 122 LEU A CB  1 
ATOM   889  C CG  . LEU A 1  112 ? 52.375 -49.670 88.390  1.00 64.05  ? 122 LEU A CG  1 
ATOM   890  C CD1 . LEU A 1  112 ? 51.258 -48.918 89.143  1.00 61.10  ? 122 LEU A CD1 1 
ATOM   891  C CD2 . LEU A 1  112 ? 53.175 -50.563 89.339  1.00 62.70  ? 122 LEU A CD2 1 
ATOM   892  N N   . VAL A 1  113 ? 51.171 -47.476 86.511  1.00 52.29  ? 123 VAL A N   1 
ATOM   893  C CA  . VAL A 1  113 ? 51.695 -46.198 86.064  1.00 54.98  ? 123 VAL A CA  1 
ATOM   894  C C   . VAL A 1  113 ? 53.224 -46.177 86.110  1.00 58.31  ? 123 VAL A C   1 
ATOM   895  O O   . VAL A 1  113 ? 53.827 -46.331 87.172  1.00 63.12  ? 123 VAL A O   1 
ATOM   896  C CB  . VAL A 1  113 ? 51.140 -45.050 86.923  1.00 52.41  ? 123 VAL A CB  1 
ATOM   897  C CG1 . VAL A 1  113 ? 49.643 -44.954 86.742  1.00 50.48  ? 123 VAL A CG1 1 
ATOM   898  C CG2 . VAL A 1  113 ? 51.463 -45.291 88.381  1.00 59.48  ? 123 VAL A CG2 1 
ATOM   899  N N   . GLN A 1  114 ? 53.846 -45.992 84.948  1.00 60.64  ? 124 GLN A N   1 
ATOM   900  C CA  . GLN A 1  114 ? 55.303 -45.948 84.842  1.00 60.97  ? 124 GLN A CA  1 
ATOM   901  C C   . GLN A 1  114 ? 55.791 -44.586 84.364  1.00 62.86  ? 124 GLN A C   1 
ATOM   902  O O   . GLN A 1  114 ? 55.191 -43.991 83.469  1.00 64.03  ? 124 GLN A O   1 
ATOM   903  C CB  . GLN A 1  114 ? 55.785 -47.016 83.866  1.00 59.08  ? 124 GLN A CB  1 
ATOM   904  C CG  . GLN A 1  114 ? 55.537 -48.424 84.336  1.00 59.26  ? 124 GLN A CG  1 
ATOM   905  C CD  . GLN A 1  114 ? 56.130 -48.680 85.705  1.00 58.85  ? 124 GLN A CD  1 
ATOM   906  O OE1 . GLN A 1  114 ? 57.333 -48.518 85.914  1.00 56.34  ? 124 GLN A OE1 1 
ATOM   907  N NE2 . GLN A 1  114 ? 55.285 -49.079 86.649  1.00 60.69  ? 124 GLN A NE2 1 
ATOM   908  N N   . GLU A 1  115 ? 56.880 -44.094 84.953  1.00 64.45  ? 125 GLU A N   1 
ATOM   909  C CA  . GLU A 1  115 ? 57.425 -42.799 84.551  1.00 66.81  ? 125 GLU A CA  1 
ATOM   910  C C   . GLU A 1  115 ? 57.828 -42.869 83.072  1.00 67.55  ? 125 GLU A C   1 
ATOM   911  O O   . GLU A 1  115 ? 58.229 -43.926 82.579  1.00 66.52  ? 125 GLU A O   1 
ATOM   912  C CB  . GLU A 1  115 ? 58.632 -42.426 85.423  1.00 66.55  ? 125 GLU A CB  1 
ATOM   913  C CG  . GLU A 1  115 ? 58.833 -40.922 85.570  1.00 66.66  ? 125 GLU A CG  1 
ATOM   914  C CD  . GLU A 1  115 ? 59.950 -40.555 86.532  1.00 67.42  ? 125 GLU A CD  1 
ATOM   915  O OE1 . GLU A 1  115 ? 61.122 -40.818 86.204  1.00 69.15  ? 125 GLU A OE1 1 
ATOM   916  O OE2 . GLU A 1  115 ? 59.658 -40.001 87.617  1.00 68.23  ? 125 GLU A OE2 1 
ATOM   917  N N   . CYS A 1  116 ? 57.722 -41.745 82.368  1.00 69.00  ? 126 CYS A N   1 
ATOM   918  C CA  . CYS A 1  116 ? 58.042 -41.710 80.944  1.00 70.63  ? 126 CYS A CA  1 
ATOM   919  C C   . CYS A 1  116 ? 59.513 -41.565 80.582  1.00 71.61  ? 126 CYS A C   1 
ATOM   920  O O   . CYS A 1  116 ? 60.318 -41.051 81.360  1.00 72.72  ? 126 CYS A O   1 
ATOM   921  C CB  . CYS A 1  116 ? 57.275 -40.585 80.259  1.00 72.06  ? 126 CYS A CB  1 
ATOM   922  S SG  . CYS A 1  116 ? 57.337 -40.668 78.438  1.00 74.96  ? 126 CYS A SG  1 
ATOM   923  N N   . MET A 1  117 ? 59.831 -42.013 79.368  1.00 72.70  ? 127 MET A N   1 
ATOM   924  C CA  . MET A 1  117 ? 61.177 -41.958 78.809  1.00 72.90  ? 127 MET A CA  1 
ATOM   925  C C   . MET A 1  117 ? 61.578 -40.518 78.476  1.00 72.68  ? 127 MET A C   1 
ATOM   926  O O   . MET A 1  117 ? 62.702 -40.103 78.751  1.00 71.22  ? 127 MET A O   1 
ATOM   927  C CB  . MET A 1  117 ? 61.233 -42.811 77.540  1.00 72.76  ? 127 MET A CB  1 
ATOM   928  C CG  . MET A 1  117 ? 62.570 -42.793 76.829  1.00 73.18  ? 127 MET A CG  1 
ATOM   929  S SD  . MET A 1  117 ? 63.882 -43.541 77.804  1.00 74.65  ? 127 MET A SD  1 
ATOM   930  C CE  . MET A 1  117 ? 63.831 -45.254 77.212  1.00 70.50  ? 127 MET A CE  1 
ATOM   931  N N   . VAL A 1  118 ? 60.648 -39.768 77.888  1.00 73.34  ? 128 VAL A N   1 
ATOM   932  C CA  . VAL A 1  118 ? 60.868 -38.372 77.497  1.00 74.13  ? 128 VAL A CA  1 
ATOM   933  C C   . VAL A 1  118 ? 61.690 -37.553 78.494  1.00 76.24  ? 128 VAL A C   1 
ATOM   934  O O   . VAL A 1  118 ? 61.372 -37.496 79.678  1.00 76.62  ? 128 VAL A O   1 
ATOM   935  C CB  . VAL A 1  118 ? 59.520 -37.636 77.268  1.00 71.79  ? 128 VAL A CB  1 
ATOM   936  C CG1 . VAL A 1  118 ? 58.770 -37.478 78.590  1.00 69.68  ? 128 VAL A CG1 1 
ATOM   937  C CG2 . VAL A 1  118 ? 59.768 -36.278 76.632  1.00 70.38  ? 128 VAL A CG2 1 
ATOM   938  N N   . HIS A 1  119 ? 62.738 -36.904 77.997  1.00 78.38  ? 129 HIS A N   1 
ATOM   939  C CA  . HIS A 1  119 ? 63.607 -36.082 78.835  1.00 81.12  ? 129 HIS A CA  1 
ATOM   940  C C   . HIS A 1  119 ? 63.066 -34.668 79.010  1.00 81.05  ? 129 HIS A C   1 
ATOM   941  O O   . HIS A 1  119 ? 62.190 -34.231 78.265  1.00 81.42  ? 129 HIS A O   1 
ATOM   942  C CB  . HIS A 1  119 ? 65.012 -36.015 78.229  1.00 85.04  ? 129 HIS A CB  1 
ATOM   943  C CG  . HIS A 1  119 ? 65.786 -37.291 78.349  1.00 89.39  ? 129 HIS A CG  1 
ATOM   944  N ND1 . HIS A 1  119 ? 66.989 -37.495 77.708  1.00 90.55  ? 129 HIS A ND1 1 
ATOM   945  C CD2 . HIS A 1  119 ? 65.537 -38.424 79.049  1.00 91.18  ? 129 HIS A CD2 1 
ATOM   946  C CE1 . HIS A 1  119 ? 67.447 -38.697 78.006  1.00 92.13  ? 129 HIS A CE1 1 
ATOM   947  N NE2 . HIS A 1  119 ? 66.585 -39.282 78.819  1.00 92.68  ? 129 HIS A NE2 1 
ATOM   948  N N   . ASP A 1  120 ? 63.598 -33.959 80.003  1.00 81.30  ? 130 ASP A N   1 
ATOM   949  C CA  . ASP A 1  120 ? 63.184 -32.587 80.284  1.00 81.72  ? 130 ASP A CA  1 
ATOM   950  C C   . ASP A 1  120 ? 63.903 -31.655 79.311  1.00 83.48  ? 130 ASP A C   1 
ATOM   951  O O   . ASP A 1  120 ? 65.063 -31.889 78.956  1.00 83.81  ? 130 ASP A O   1 
ATOM   952  C CB  . ASP A 1  120 ? 63.541 -32.217 81.732  1.00 79.69  ? 130 ASP A CB  1 
ATOM   953  C CG  . ASP A 1  120 ? 62.897 -30.915 82.187  1.00 78.18  ? 130 ASP A CG  1 
ATOM   954  O OD1 . ASP A 1  120 ? 63.174 -29.857 81.589  1.00 79.55  ? 130 ASP A OD1 1 
ATOM   955  O OD2 . ASP A 1  120 ? 62.111 -30.948 83.155  1.00 76.18  ? 130 ASP A OD2 1 
ATOM   956  N N   . CYS A 1  121 ? 63.210 -30.605 78.874  1.00 85.31  ? 131 CYS A N   1 
ATOM   957  C CA  . CYS A 1  121 ? 63.785 -29.636 77.941  1.00 85.85  ? 131 CYS A CA  1 
ATOM   958  C C   . CYS A 1  121 ? 64.803 -28.726 78.639  1.00 85.77  ? 131 CYS A C   1 
ATOM   959  O O   . CYS A 1  121 ? 65.076 -27.616 78.176  1.00 85.41  ? 131 CYS A O   1 
ATOM   960  C CB  . CYS A 1  121 ? 62.690 -28.765 77.308  1.00 85.11  ? 131 CYS A CB  1 
ATOM   961  S SG  . CYS A 1  121 ? 61.374 -29.585 76.332  1.00 84.27  ? 131 CYS A SG  1 
ATOM   962  N N   . ALA A 1  122 ? 65.351 -29.201 79.755  1.00 85.44  ? 132 ALA A N   1 
ATOM   963  C CA  . ALA A 1  122 ? 66.342 -28.450 80.519  1.00 83.21  ? 132 ALA A CA  1 
ATOM   964  C C   . ALA A 1  122 ? 67.540 -29.351 80.809  1.00 81.94  ? 132 ALA A C   1 
ATOM   965  O O   . ALA A 1  122 ? 68.627 -29.071 80.260  1.00 81.10  ? 132 ALA A O   1 
ATOM   966  C CB  . ALA A 1  122 ? 65.730 -27.948 81.825  1.00 82.18  ? 132 ALA A CB  1 
ATOM   967  O OXT . ALA A 1  122 ? 67.373 -30.333 81.568  1.00 80.54  ? 132 ALA A OXT 1 
ATOM   968  N N   . ASP B 2  1   ? 15.230 3.565   36.606  1.00 68.83  ? 1   ASP L N   1 
ATOM   969  C CA  . ASP B 2  1   ? 15.605 2.648   35.489  1.00 67.51  ? 1   ASP L CA  1 
ATOM   970  C C   . ASP B 2  1   ? 16.969 3.045   34.915  1.00 63.87  ? 1   ASP L C   1 
ATOM   971  O O   . ASP B 2  1   ? 17.085 4.064   34.238  1.00 65.01  ? 1   ASP L O   1 
ATOM   972  C CB  . ASP B 2  1   ? 14.529 2.701   34.392  1.00 70.35  ? 1   ASP L CB  1 
ATOM   973  C CG  . ASP B 2  1   ? 14.746 1.660   33.299  1.00 73.63  ? 1   ASP L CG  1 
ATOM   974  O OD1 . ASP B 2  1   ? 14.824 0.456   33.625  1.00 76.48  ? 1   ASP L OD1 1 
ATOM   975  O OD2 . ASP B 2  1   ? 14.831 2.043   32.111  1.00 74.52  ? 1   ASP L OD2 1 
ATOM   976  N N   . ILE B 2  2   ? 17.997 2.244   35.195  1.00 57.38  ? 2   ILE L N   1 
ATOM   977  C CA  . ILE B 2  2   ? 19.342 2.526   34.700  1.00 52.71  ? 2   ILE L CA  1 
ATOM   978  C C   . ILE B 2  2   ? 19.306 2.971   33.246  1.00 52.66  ? 2   ILE L C   1 
ATOM   979  O O   . ILE B 2  2   ? 18.927 2.197   32.371  1.00 53.14  ? 2   ILE L O   1 
ATOM   980  C CB  . ILE B 2  2   ? 20.257 1.288   34.804  1.00 48.28  ? 2   ILE L CB  1 
ATOM   981  C CG1 . ILE B 2  2   ? 20.538 0.970   36.267  1.00 49.82  ? 2   ILE L CG1 1 
ATOM   982  C CG2 . ILE B 2  2   ? 21.568 1.542   34.092  1.00 46.69  ? 2   ILE L CG2 1 
ATOM   983  C CD1 . ILE B 2  2   ? 21.560 -0.121  36.470  1.00 48.43  ? 2   ILE L CD1 1 
ATOM   984  N N   . VAL B 2  3   ? 19.690 4.222   32.994  1.00 54.32  ? 3   VAL L N   1 
ATOM   985  C CA  . VAL B 2  3   ? 19.712 4.763   31.632  1.00 53.64  ? 3   VAL L CA  1 
ATOM   986  C C   . VAL B 2  3   ? 21.086 4.595   31.003  1.00 53.15  ? 3   VAL L C   1 
ATOM   987  O O   . VAL B 2  3   ? 22.109 4.918   31.618  1.00 52.08  ? 3   VAL L O   1 
ATOM   988  C CB  . VAL B 2  3   ? 19.378 6.266   31.594  1.00 53.62  ? 3   VAL L CB  1 
ATOM   989  C CG1 . VAL B 2  3   ? 19.559 6.803   30.164  1.00 51.71  ? 3   VAL L CG1 1 
ATOM   990  C CG2 . VAL B 2  3   ? 17.959 6.493   32.076  1.00 53.19  ? 3   VAL L CG2 1 
ATOM   991  N N   . LEU B 2  4   ? 21.109 4.091   29.775  1.00 49.81  ? 4   LEU L N   1 
ATOM   992  C CA  . LEU B 2  4   ? 22.372 3.898   29.086  1.00 47.00  ? 4   LEU L CA  1 
ATOM   993  C C   . LEU B 2  4   ? 22.495 4.924   27.985  1.00 46.02  ? 4   LEU L C   1 
ATOM   994  O O   . LEU B 2  4   ? 21.626 5.037   27.124  1.00 44.75  ? 4   LEU L O   1 
ATOM   995  C CB  . LEU B 2  4   ? 22.464 2.487   28.507  1.00 42.91  ? 4   LEU L CB  1 
ATOM   996  C CG  . LEU B 2  4   ? 22.378 1.383   29.554  1.00 40.23  ? 4   LEU L CG  1 
ATOM   997  C CD1 . LEU B 2  4   ? 22.663 0.052   28.889  1.00 39.63  ? 4   LEU L CD1 1 
ATOM   998  C CD2 . LEU B 2  4   ? 23.378 1.641   30.666  1.00 40.50  ? 4   LEU L CD2 1 
ATOM   999  N N   . THR B 2  5   ? 23.571 5.694   28.033  1.00 47.73  ? 5   THR L N   1 
ATOM   1000 C CA  . THR B 2  5   ? 23.795 6.705   27.022  1.00 49.49  ? 5   THR L CA  1 
ATOM   1001 C C   . THR B 2  5   ? 25.062 6.389   26.255  1.00 48.00  ? 5   THR L C   1 
ATOM   1002 O O   . THR B 2  5   ? 26.150 6.258   26.827  1.00 44.74  ? 5   THR L O   1 
ATOM   1003 C CB  . THR B 2  5   ? 23.884 8.109   27.638  1.00 51.69  ? 5   THR L CB  1 
ATOM   1004 O OG1 . THR B 2  5   ? 24.764 8.080   28.771  1.00 54.85  ? 5   THR L OG1 1 
ATOM   1005 C CG2 . THR B 2  5   ? 22.493 8.584   28.067  1.00 52.34  ? 5   THR L CG2 1 
ATOM   1006 N N   . GLN B 2  6   ? 24.887 6.239   24.948  1.00 48.29  ? 6   GLN L N   1 
ATOM   1007 C CA  . GLN B 2  6   ? 25.977 5.932   24.052  1.00 46.59  ? 6   GLN L CA  1 
ATOM   1008 C C   . GLN B 2  6   ? 26.474 7.188   23.380  1.00 49.31  ? 6   GLN L C   1 
ATOM   1009 O O   . GLN B 2  6   ? 25.696 8.080   23.037  1.00 49.46  ? 6   GLN L O   1 
ATOM   1010 C CB  . GLN B 2  6   ? 25.518 4.937   22.997  1.00 43.15  ? 6   GLN L CB  1 
ATOM   1011 C CG  . GLN B 2  6   ? 26.018 3.544   23.249  1.00 38.21  ? 6   GLN L CG  1 
ATOM   1012 C CD  . GLN B 2  6   ? 25.525 2.573   22.218  1.00 35.59  ? 6   GLN L CD  1 
ATOM   1013 O OE1 . GLN B 2  6   ? 24.440 2.007   22.350  1.00 32.40  ? 6   GLN L OE1 1 
ATOM   1014 N NE2 . GLN B 2  6   ? 26.311 2.384   21.166  1.00 33.65  ? 6   GLN L NE2 1 
ATOM   1015 N N   . SER B 2  7   ? 27.787 7.256   23.211  1.00 52.26  ? 7   SER L N   1 
ATOM   1016 C CA  . SER B 2  7   ? 28.413 8.394   22.564  1.00 53.12  ? 7   SER L CA  1 
ATOM   1017 C C   . SER B 2  7   ? 29.727 7.930   21.961  1.00 52.83  ? 7   SER L C   1 
ATOM   1018 O O   . SER B 2  7   ? 30.411 7.066   22.517  1.00 54.86  ? 7   SER L O   1 
ATOM   1019 C CB  . SER B 2  7   ? 28.652 9.537   23.566  1.00 52.80  ? 7   SER L CB  1 
ATOM   1020 O OG  . SER B 2  7   ? 29.529 9.155   24.613  1.00 51.93  ? 7   SER L OG  1 
ATOM   1021 N N   . PRO B 2  8   ? 30.086 8.482   20.795  1.00 51.93  ? 8   PRO L N   1 
ATOM   1022 C CA  . PRO B 2  8   ? 29.300 9.490   20.080  1.00 51.69  ? 8   PRO L CA  1 
ATOM   1023 C C   . PRO B 2  8   ? 27.995 8.951   19.522  1.00 52.10  ? 8   PRO L C   1 
ATOM   1024 O O   . PRO B 2  8   ? 27.737 7.749   19.548  1.00 53.58  ? 8   PRO L O   1 
ATOM   1025 C CB  . PRO B 2  8   ? 30.242 9.932   18.969  1.00 50.69  ? 8   PRO L CB  1 
ATOM   1026 C CG  . PRO B 2  8   ? 30.977 8.671   18.665  1.00 51.70  ? 8   PRO L CG  1 
ATOM   1027 C CD  . PRO B 2  8   ? 31.309 8.151   20.046  1.00 52.41  ? 8   PRO L CD  1 
ATOM   1028 N N   . ASP B 2  9   ? 27.178 9.864   19.019  1.00 51.09  ? 9   ASP L N   1 
ATOM   1029 C CA  . ASP B 2  9   ? 25.899 9.520   18.429  1.00 50.33  ? 9   ASP L CA  1 
ATOM   1030 C C   . ASP B 2  9   ? 26.202 8.842   17.099  1.00 45.96  ? 9   ASP L C   1 
ATOM   1031 O O   . ASP B 2  9   ? 25.833 7.695   16.856  1.00 43.41  ? 9   ASP L O   1 
ATOM   1032 C CB  . ASP B 2  9   ? 25.099 10.798  18.193  1.00 57.53  ? 9   ASP L CB  1 
ATOM   1033 C CG  . ASP B 2  9   ? 23.624 10.537  18.021  1.00 64.66  ? 9   ASP L CG  1 
ATOM   1034 O OD1 . ASP B 2  9   ? 22.887 11.510  17.746  1.00 71.39  ? 9   ASP L OD1 1 
ATOM   1035 O OD2 . ASP B 2  9   ? 23.202 9.367   18.166  1.00 70.01  ? 9   ASP L OD2 1 
ATOM   1036 N N   . ILE B 2  10  ? 26.881 9.581   16.236  1.00 44.03  ? 10  ILE L N   1 
ATOM   1037 C CA  . ILE B 2  10  ? 27.281 9.084   14.933  1.00 43.20  ? 10  ILE L CA  1 
ATOM   1038 C C   . ILE B 2  10  ? 28.628 9.706   14.629  1.00 44.30  ? 10  ILE L C   1 
ATOM   1039 O O   . ILE B 2  10  ? 28.824 10.898  14.841  1.00 45.99  ? 10  ILE L O   1 
ATOM   1040 C CB  . ILE B 2  10  ? 26.289 9.485   13.837  1.00 40.85  ? 10  ILE L CB  1 
ATOM   1041 C CG1 . ILE B 2  10  ? 26.871 9.131   12.461  1.00 39.02  ? 10  ILE L CG1 1 
ATOM   1042 C CG2 . ILE B 2  10  ? 25.969 10.958  13.956  1.00 42.76  ? 10  ILE L CG2 1 
ATOM   1043 C CD1 . ILE B 2  10  ? 25.862 9.138   11.321  1.00 39.56  ? 10  ILE L CD1 1 
ATOM   1044 N N   . THR B 2  11  ? 29.559 8.892   14.147  1.00 44.39  ? 11  THR L N   1 
ATOM   1045 C CA  . THR B 2  11  ? 30.889 9.380   13.827  1.00 44.11  ? 11  THR L CA  1 
ATOM   1046 C C   . THR B 2  11  ? 31.437 8.750   12.574  1.00 41.86  ? 11  THR L C   1 
ATOM   1047 O O   . THR B 2  11  ? 31.141 7.592   12.258  1.00 39.05  ? 11  THR L O   1 
ATOM   1048 C CB  . THR B 2  11  ? 31.896 9.095   14.961  1.00 47.39  ? 11  THR L CB  1 
ATOM   1049 O OG1 . THR B 2  11  ? 31.565 9.888   16.102  1.00 59.43  ? 11  THR L OG1 1 
ATOM   1050 C CG2 . THR B 2  11  ? 33.313 9.447   14.522  1.00 49.79  ? 11  THR L CG2 1 
ATOM   1051 N N   . ALA B 2  12  ? 32.235 9.543   11.865  1.00 40.28  ? 12  ALA L N   1 
ATOM   1052 C CA  . ALA B 2  12  ? 32.901 9.109   10.649  1.00 39.08  ? 12  ALA L CA  1 
ATOM   1053 C C   . ALA B 2  12  ? 34.366 8.979   11.051  1.00 39.61  ? 12  ALA L C   1 
ATOM   1054 O O   . ALA B 2  12  ? 34.953 9.910   11.611  1.00 41.21  ? 12  ALA L O   1 
ATOM   1055 C CB  . ALA B 2  12  ? 32.741 10.149  9.543   1.00 38.98  ? 12  ALA L CB  1 
ATOM   1056 N N   . ALA B 2  13  ? 34.938 7.809   10.802  1.00 37.51  ? 13  ALA L N   1 
ATOM   1057 C CA  . ALA B 2  13  ? 36.322 7.562   11.142  1.00 35.92  ? 13  ALA L CA  1 
ATOM   1058 C C   . ALA B 2  13  ? 37.047 7.226   9.858   1.00 37.79  ? 13  ALA L C   1 
ATOM   1059 O O   . ALA B 2  13  ? 36.543 6.463   9.032   1.00 34.91  ? 13  ALA L O   1 
ATOM   1060 C CB  . ALA B 2  13  ? 36.424 6.404   12.124  1.00 31.76  ? 13  ALA L CB  1 
ATOM   1061 N N   . SER B 2  14  ? 38.221 7.820   9.683   1.00 38.97  ? 14  SER L N   1 
ATOM   1062 C CA  . SER B 2  14  ? 39.019 7.564   8.501   1.00 39.97  ? 14  SER L CA  1 
ATOM   1063 C C   . SER B 2  14  ? 39.661 6.201   8.710   1.00 40.09  ? 14  SER L C   1 
ATOM   1064 O O   . SER B 2  14  ? 39.942 5.817   9.850   1.00 37.92  ? 14  SER L O   1 
ATOM   1065 C CB  . SER B 2  14  ? 40.091 8.639   8.363   1.00 43.20  ? 14  SER L CB  1 
ATOM   1066 O OG  . SER B 2  14  ? 39.513 9.930   8.459   1.00 47.28  ? 14  SER L OG  1 
ATOM   1067 N N   . LEU B 2  15  ? 39.874 5.461   7.623   1.00 40.18  ? 15  LEU L N   1 
ATOM   1068 C CA  . LEU B 2  15  ? 40.492 4.142   7.722   1.00 40.03  ? 15  LEU L CA  1 
ATOM   1069 C C   . LEU B 2  15  ? 41.800 4.253   8.507   1.00 40.12  ? 15  LEU L C   1 
ATOM   1070 O O   . LEU B 2  15  ? 42.549 5.215   8.344   1.00 42.73  ? 15  LEU L O   1 
ATOM   1071 C CB  . LEU B 2  15  ? 40.750 3.571   6.323   1.00 38.16  ? 15  LEU L CB  1 
ATOM   1072 C CG  . LEU B 2  15  ? 39.475 3.312   5.510   1.00 39.97  ? 15  LEU L CG  1 
ATOM   1073 C CD1 . LEU B 2  15  ? 39.806 2.809   4.110   1.00 39.30  ? 15  LEU L CD1 1 
ATOM   1074 C CD2 . LEU B 2  15  ? 38.629 2.293   6.252   1.00 40.31  ? 15  LEU L CD2 1 
ATOM   1075 N N   . GLY B 2  16  ? 42.059 3.279   9.375   1.00 36.83  ? 16  GLY L N   1 
ATOM   1076 C CA  . GLY B 2  16  ? 43.271 3.302   10.170  1.00 36.96  ? 16  GLY L CA  1 
ATOM   1077 C C   . GLY B 2  16  ? 43.171 4.193   11.397  1.00 38.09  ? 16  GLY L C   1 
ATOM   1078 O O   . GLY B 2  16  ? 44.079 4.214   12.215  1.00 40.63  ? 16  GLY L O   1 
ATOM   1079 N N   . GLN B 2  17  ? 42.073 4.928   11.530  1.00 40.01  ? 17  GLN L N   1 
ATOM   1080 C CA  . GLN B 2  17  ? 41.861 5.820   12.672  1.00 41.32  ? 17  GLN L CA  1 
ATOM   1081 C C   . GLN B 2  17  ? 41.385 5.066   13.915  1.00 41.34  ? 17  GLN L C   1 
ATOM   1082 O O   . GLN B 2  17  ? 40.722 4.036   13.819  1.00 39.37  ? 17  GLN L O   1 
ATOM   1083 C CB  . GLN B 2  17  ? 40.852 6.913   12.282  1.00 44.11  ? 17  GLN L CB  1 
ATOM   1084 C CG  . GLN B 2  17  ? 40.239 7.716   13.419  1.00 50.99  ? 17  GLN L CG  1 
ATOM   1085 C CD  . GLN B 2  17  ? 39.634 9.026   12.926  1.00 54.60  ? 17  GLN L CD  1 
ATOM   1086 O OE1 . GLN B 2  17  ? 39.120 9.109   11.807  1.00 55.11  ? 17  GLN L OE1 1 
ATOM   1087 N NE2 . GLN B 2  17  ? 39.689 10.054  13.765  1.00 59.32  ? 17  GLN L NE2 1 
ATOM   1088 N N   . LYS B 2  18  ? 41.751 5.580   15.083  1.00 43.27  ? 18  LYS L N   1 
ATOM   1089 C CA  . LYS B 2  18  ? 41.366 4.975   16.354  1.00 45.48  ? 18  LYS L CA  1 
ATOM   1090 C C   . LYS B 2  18  ? 39.974 5.465   16.721  1.00 43.50  ? 18  LYS L C   1 
ATOM   1091 O O   . LYS B 2  18  ? 39.717 6.672   16.725  1.00 44.07  ? 18  LYS L O   1 
ATOM   1092 C CB  . LYS B 2  18  ? 42.356 5.374   17.456  1.00 50.20  ? 18  LYS L CB  1 
ATOM   1093 C CG  . LYS B 2  18  ? 41.882 5.103   18.884  1.00 54.49  ? 18  LYS L CG  1 
ATOM   1094 C CD  . LYS B 2  18  ? 41.851 3.619   19.215  1.00 62.10  ? 18  LYS L CD  1 
ATOM   1095 C CE  . LYS B 2  18  ? 42.958 3.229   20.203  1.00 64.17  ? 18  LYS L CE  1 
ATOM   1096 N NZ  . LYS B 2  18  ? 44.335 3.297   19.627  1.00 66.68  ? 18  LYS L NZ  1 
ATOM   1097 N N   . VAL B 2  19  ? 39.081 4.529   17.031  1.00 39.29  ? 19  VAL L N   1 
ATOM   1098 C CA  . VAL B 2  19  ? 37.721 4.886   17.396  1.00 36.06  ? 19  VAL L CA  1 
ATOM   1099 C C   . VAL B 2  19  ? 37.406 4.407   18.798  1.00 35.49  ? 19  VAL L C   1 
ATOM   1100 O O   . VAL B 2  19  ? 37.746 3.287   19.164  1.00 36.33  ? 19  VAL L O   1 
ATOM   1101 C CB  . VAL B 2  19  ? 36.694 4.245   16.447  1.00 34.21  ? 19  VAL L CB  1 
ATOM   1102 C CG1 . VAL B 2  19  ? 35.305 4.738   16.782  1.00 34.42  ? 19  VAL L CG1 1 
ATOM   1103 C CG2 . VAL B 2  19  ? 37.032 4.567   15.010  1.00 34.91  ? 19  VAL L CG2 1 
ATOM   1104 N N   . THR B 2  20  ? 36.771 5.259   19.589  1.00 36.48  ? 20  THR L N   1 
ATOM   1105 C CA  . THR B 2  20  ? 36.386 4.857   20.928  1.00 39.63  ? 20  THR L CA  1 
ATOM   1106 C C   . THR B 2  20  ? 34.962 5.275   21.206  1.00 39.71  ? 20  THR L C   1 
ATOM   1107 O O   . THR B 2  20  ? 34.649 6.463   21.249  1.00 40.17  ? 20  THR L O   1 
ATOM   1108 C CB  . THR B 2  20  ? 37.308 5.441   22.001  1.00 38.51  ? 20  THR L CB  1 
ATOM   1109 O OG1 . THR B 2  20  ? 38.583 4.793   21.921  1.00 44.97  ? 20  THR L OG1 1 
ATOM   1110 C CG2 . THR B 2  20  ? 36.732 5.203   23.386  1.00 37.48  ? 20  THR L CG2 1 
ATOM   1111 N N   . ILE B 2  21  ? 34.103 4.273   21.366  1.00 39.88  ? 21  ILE L N   1 
ATOM   1112 C CA  . ILE B 2  21  ? 32.695 4.482   21.656  1.00 37.97  ? 21  ILE L CA  1 
ATOM   1113 C C   . ILE B 2  21  ? 32.534 4.245   23.142  1.00 39.89  ? 21  ILE L C   1 
ATOM   1114 O O   . ILE B 2  21  ? 33.137 3.320   23.703  1.00 43.18  ? 21  ILE L O   1 
ATOM   1115 C CB  . ILE B 2  21  ? 31.814 3.456   20.952  1.00 37.60  ? 21  ILE L CB  1 
ATOM   1116 C CG1 . ILE B 2  21  ? 32.143 3.412   19.469  1.00 38.52  ? 21  ILE L CG1 1 
ATOM   1117 C CG2 . ILE B 2  21  ? 30.344 3.805   21.165  1.00 40.79  ? 21  ILE L CG2 1 
ATOM   1118 C CD1 . ILE B 2  21  ? 31.510 2.236   18.772  1.00 39.54  ? 21  ILE L CD1 1 
ATOM   1119 N N   . THR B 2  22  ? 31.728 5.075   23.784  1.00 38.99  ? 22  THR L N   1 
ATOM   1120 C CA  . THR B 2  22  ? 31.506 4.914   25.206  1.00 42.26  ? 22  THR L CA  1 
ATOM   1121 C C   . THR B 2  22  ? 30.029 4.791   25.515  1.00 41.43  ? 22  THR L C   1 
ATOM   1122 O O   . THR B 2  22  ? 29.170 5.306   24.800  1.00 37.88  ? 22  THR L O   1 
ATOM   1123 C CB  . THR B 2  22  ? 32.074 6.088   26.010  1.00 43.12  ? 22  THR L CB  1 
ATOM   1124 O OG1 . THR B 2  22  ? 31.408 7.291   25.615  1.00 46.62  ? 22  THR L OG1 1 
ATOM   1125 C CG2 . THR B 2  22  ? 33.578 6.224   25.776  1.00 45.12  ? 22  THR L CG2 1 
ATOM   1126 N N   . CYS B 2  23  ? 29.756 4.094   26.603  1.00 43.85  ? 23  CYS L N   1 
ATOM   1127 C CA  . CYS B 2  23  ? 28.404 3.855   27.056  1.00 47.00  ? 23  CYS L CA  1 
ATOM   1128 C C   . CYS B 2  23  ? 28.404 4.349   28.496  1.00 48.64  ? 23  CYS L C   1 
ATOM   1129 O O   . CYS B 2  23  ? 29.181 3.867   29.327  1.00 47.09  ? 23  CYS L O   1 
ATOM   1130 C CB  . CYS B 2  23  ? 28.137 2.354   26.978  1.00 47.42  ? 23  CYS L CB  1 
ATOM   1131 S SG  . CYS B 2  23  ? 26.464 1.707   27.294  1.00 50.65  ? 23  CYS L SG  1 
ATOM   1132 N N   . SER B 2  24  ? 27.565 5.342   28.775  1.00 50.63  ? 24  SER L N   1 
ATOM   1133 C CA  . SER B 2  24  ? 27.468 5.901   30.119  1.00 54.83  ? 24  SER L CA  1 
ATOM   1134 C C   . SER B 2  24  ? 26.212 5.348   30.794  1.00 54.93  ? 24  SER L C   1 
ATOM   1135 O O   . SER B 2  24  ? 25.112 5.429   30.236  1.00 55.27  ? 24  SER L O   1 
ATOM   1136 C CB  . SER B 2  24  ? 27.405 7.433   30.050  1.00 55.83  ? 24  SER L CB  1 
ATOM   1137 O OG  . SER B 2  24  ? 27.338 8.013   31.343  1.00 57.64  ? 24  SER L OG  1 
ATOM   1138 N N   . ALA B 2  25  ? 26.379 4.785   31.990  1.00 53.83  ? 25  ALA L N   1 
ATOM   1139 C CA  . ALA B 2  25  ? 25.254 4.209   32.719  1.00 54.99  ? 25  ALA L CA  1 
ATOM   1140 C C   . ALA B 2  25  ? 24.705 5.102   33.836  1.00 55.68  ? 25  ALA L C   1 
ATOM   1141 O O   . ALA B 2  25  ? 25.454 5.746   34.568  1.00 56.00  ? 25  ALA L O   1 
ATOM   1142 C CB  . ALA B 2  25  ? 25.652 2.857   33.286  1.00 49.71  ? 25  ALA L CB  1 
ATOM   1143 N N   . SER B 2  26  ? 23.383 5.134   33.953  1.00 56.65  ? 26  SER L N   1 
ATOM   1144 C CA  . SER B 2  26  ? 22.708 5.917   34.977  1.00 56.83  ? 26  SER L CA  1 
ATOM   1145 C C   . SER B 2  26  ? 23.130 5.424   36.370  1.00 56.73  ? 26  SER L C   1 
ATOM   1146 O O   . SER B 2  26  ? 23.141 6.187   37.337  1.00 58.20  ? 26  SER L O   1 
ATOM   1147 C CB  . SER B 2  26  ? 21.198 5.776   34.798  1.00 56.81  ? 26  SER L CB  1 
ATOM   1148 O OG  . SER B 2  26  ? 20.491 6.470   35.802  1.00 66.02  ? 26  SER L OG  1 
ATOM   1149 N N   . SER B 2  27  ? 23.476 4.140   36.456  1.00 54.37  ? 27  SER L N   1 
ATOM   1150 C CA  . SER B 2  27  ? 23.913 3.513   37.700  1.00 51.55  ? 27  SER L CA  1 
ATOM   1151 C C   . SER B 2  27  ? 24.858 2.372   37.360  1.00 52.31  ? 27  SER L C   1 
ATOM   1152 O O   . SER B 2  27  ? 24.927 1.929   36.215  1.00 53.91  ? 27  SER L O   1 
ATOM   1153 C CB  . SER B 2  27  ? 22.724 2.953   38.474  1.00 53.44  ? 27  SER L CB  1 
ATOM   1154 O OG  . SER B 2  27  ? 21.750 3.952   38.698  1.00 56.95  ? 27  SER L OG  1 
ATOM   1155 N N   . SER B 2  28  ? 25.575 1.881   38.360  1.00 51.60  ? 29  SER L N   1 
ATOM   1156 C CA  . SER B 2  28  ? 26.522 0.801   38.146  1.00 50.25  ? 29  SER L CA  1 
ATOM   1157 C C   . SER B 2  28  ? 25.897 -0.491  37.617  1.00 48.50  ? 29  SER L C   1 
ATOM   1158 O O   . SER B 2  28  ? 24.765 -0.836  37.956  1.00 48.98  ? 29  SER L O   1 
ATOM   1159 C CB  . SER B 2  28  ? 27.258 0.498   39.452  1.00 50.50  ? 29  SER L CB  1 
ATOM   1160 O OG  . SER B 2  28  ? 27.961 1.637   39.916  1.00 57.81  ? 29  SER L OG  1 
ATOM   1161 N N   . VAL B 2  29  ? 26.644 -1.192  36.770  1.00 43.96  ? 30  VAL L N   1 
ATOM   1162 C CA  . VAL B 2  29  ? 26.215 -2.473  36.235  1.00 40.91  ? 30  VAL L CA  1 
ATOM   1163 C C   . VAL B 2  29  ? 27.497 -3.288  36.253  1.00 39.10  ? 30  VAL L C   1 
ATOM   1164 O O   . VAL B 2  29  ? 28.557 -2.783  35.895  1.00 37.62  ? 30  VAL L O   1 
ATOM   1165 C CB  . VAL B 2  29  ? 25.640 -2.364  34.788  1.00 41.63  ? 30  VAL L CB  1 
ATOM   1166 C CG1 . VAL B 2  29  ? 24.436 -1.441  34.778  1.00 42.04  ? 30  VAL L CG1 1 
ATOM   1167 C CG2 . VAL B 2  29  ? 26.687 -1.856  33.829  1.00 47.16  ? 30  VAL L CG2 1 
ATOM   1168 N N   . SER B 2  30  ? 27.408 -4.534  36.701  1.00 38.39  ? 31  SER L N   1 
ATOM   1169 C CA  . SER B 2  30  ? 28.576 -5.399  36.788  1.00 38.90  ? 31  SER L CA  1 
ATOM   1170 C C   . SER B 2  30  ? 29.200 -5.734  35.442  1.00 38.70  ? 31  SER L C   1 
ATOM   1171 O O   . SER B 2  30  ? 30.422 -5.788  35.319  1.00 44.58  ? 31  SER L O   1 
ATOM   1172 C CB  . SER B 2  30  ? 28.210 -6.683  37.522  1.00 37.11  ? 31  SER L CB  1 
ATOM   1173 O OG  . SER B 2  30  ? 27.703 -6.364  38.803  1.00 38.08  ? 31  SER L OG  1 
ATOM   1174 N N   . TYR B 2  31  ? 28.373 -5.982  34.435  1.00 34.15  ? 32  TYR L N   1 
ATOM   1175 C CA  . TYR B 2  31  ? 28.903 -6.285  33.123  1.00 29.55  ? 32  TYR L CA  1 
ATOM   1176 C C   . TYR B 2  31  ? 28.138 -5.565  32.024  1.00 30.17  ? 32  TYR L C   1 
ATOM   1177 O O   . TYR B 2  31  ? 26.947 -5.245  32.161  1.00 29.97  ? 32  TYR L O   1 
ATOM   1178 C CB  . TYR B 2  31  ? 28.905 -7.789  32.870  1.00 29.58  ? 32  TYR L CB  1 
ATOM   1179 C CG  . TYR B 2  31  ? 29.771 -8.560  33.835  1.00 34.24  ? 32  TYR L CG  1 
ATOM   1180 C CD1 . TYR B 2  31  ? 29.279 -8.946  35.085  1.00 34.83  ? 32  TYR L CD1 1 
ATOM   1181 C CD2 . TYR B 2  31  ? 31.098 -8.882  33.513  1.00 35.20  ? 32  TYR L CD2 1 
ATOM   1182 C CE1 . TYR B 2  31  ? 30.084 -9.637  36.000  1.00 34.20  ? 32  TYR L CE1 1 
ATOM   1183 C CE2 . TYR B 2  31  ? 31.916 -9.572  34.419  1.00 33.82  ? 32  TYR L CE2 1 
ATOM   1184 C CZ  . TYR B 2  31  ? 31.398 -9.945  35.661  1.00 35.71  ? 32  TYR L CZ  1 
ATOM   1185 O OH  . TYR B 2  31  ? 32.180 -10.621 36.566  1.00 34.93  ? 32  TYR L OH  1 
ATOM   1186 N N   . MET B 2  32  ? 28.851 -5.298  30.936  1.00 28.74  ? 33  MET L N   1 
ATOM   1187 C CA  . MET B 2  32  ? 28.292 -4.606  29.792  1.00 28.52  ? 33  MET L CA  1 
ATOM   1188 C C   . MET B 2  32  ? 28.687 -5.396  28.550  1.00 27.62  ? 33  MET L C   1 
ATOM   1189 O O   . MET B 2  32  ? 29.801 -5.922  28.477  1.00 26.80  ? 33  MET L O   1 
ATOM   1190 C CB  . MET B 2  32  ? 28.866 -3.191  29.726  1.00 31.03  ? 33  MET L CB  1 
ATOM   1191 C CG  . MET B 2  32  ? 28.199 -2.276  28.723  1.00 32.96  ? 33  MET L CG  1 
ATOM   1192 S SD  . MET B 2  32  ? 26.563 -1.822  29.264  1.00 41.24  ? 33  MET L SD  1 
ATOM   1193 C CE  . MET B 2  32  ? 26.914 -0.536  30.452  1.00 40.61  ? 33  MET L CE  1 
ATOM   1194 N N   . HIS B 2  33  ? 27.767 -5.498  27.590  1.00 26.34  ? 34  HIS L N   1 
ATOM   1195 C CA  . HIS B 2  33  ? 28.030 -6.220  26.349  1.00 25.70  ? 34  HIS L CA  1 
ATOM   1196 C C   . HIS B 2  33  ? 27.927 -5.245  25.184  1.00 25.62  ? 34  HIS L C   1 
ATOM   1197 O O   . HIS B 2  33  ? 27.367 -4.159  25.321  1.00 27.37  ? 34  HIS L O   1 
ATOM   1198 C CB  . HIS B 2  33  ? 27.004 -7.338  26.125  1.00 25.42  ? 34  HIS L CB  1 
ATOM   1199 C CG  . HIS B 2  33  ? 26.887 -8.304  27.259  1.00 24.13  ? 34  HIS L CG  1 
ATOM   1200 N ND1 . HIS B 2  33  ? 25.689 -8.553  27.897  1.00 24.93  ? 34  HIS L ND1 1 
ATOM   1201 C CD2 . HIS B 2  33  ? 27.799 -9.119  27.838  1.00 23.05  ? 34  HIS L CD2 1 
ATOM   1202 C CE1 . HIS B 2  33  ? 25.871 -9.482  28.819  1.00 24.04  ? 34  HIS L CE1 1 
ATOM   1203 N NE2 . HIS B 2  33  ? 27.142 -9.844  28.804  1.00 25.81  ? 34  HIS L NE2 1 
ATOM   1204 N N   . TRP B 2  34  ? 28.467 -5.640  24.038  1.00 24.19  ? 35  TRP L N   1 
ATOM   1205 C CA  . TRP B 2  34  ? 28.407 -4.810  22.846  1.00 24.43  ? 35  TRP L CA  1 
ATOM   1206 C C   . TRP B 2  34  ? 27.981 -5.686  21.669  1.00 25.63  ? 35  TRP L C   1 
ATOM   1207 O O   . TRP B 2  34  ? 28.507 -6.796  21.484  1.00 25.15  ? 35  TRP L O   1 
ATOM   1208 C CB  . TRP B 2  34  ? 29.775 -4.166  22.557  1.00 26.20  ? 35  TRP L CB  1 
ATOM   1209 C CG  . TRP B 2  34  ? 30.230 -3.163  23.602  1.00 29.07  ? 35  TRP L CG  1 
ATOM   1210 C CD1 . TRP B 2  34  ? 30.899 -3.430  24.767  1.00 30.80  ? 35  TRP L CD1 1 
ATOM   1211 C CD2 . TRP B 2  34  ? 30.024 -1.741  23.577  1.00 27.64  ? 35  TRP L CD2 1 
ATOM   1212 N NE1 . TRP B 2  34  ? 31.122 -2.266  25.464  1.00 29.95  ? 35  TRP L NE1 1 
ATOM   1213 C CE2 . TRP B 2  34  ? 30.596 -1.215  24.758  1.00 29.87  ? 35  TRP L CE2 1 
ATOM   1214 C CE3 . TRP B 2  34  ? 29.413 -0.862  22.673  1.00 25.80  ? 35  TRP L CE3 1 
ATOM   1215 C CZ2 . TRP B 2  34  ? 30.575 0.155   25.058  1.00 29.09  ? 35  TRP L CZ2 1 
ATOM   1216 C CZ3 . TRP B 2  34  ? 29.392 0.506   22.975  1.00 23.73  ? 35  TRP L CZ3 1 
ATOM   1217 C CH2 . TRP B 2  34  ? 29.971 0.995   24.160  1.00 24.79  ? 35  TRP L CH2 1 
ATOM   1218 N N   . TYR B 2  35  ? 27.016 -5.201  20.886  1.00 24.33  ? 36  TYR L N   1 
ATOM   1219 C CA  . TYR B 2  35  ? 26.534 -5.947  19.723  1.00 22.09  ? 36  TYR L CA  1 
ATOM   1220 C C   . TYR B 2  35  ? 26.758 -5.092  18.496  1.00 20.81  ? 36  TYR L C   1 
ATOM   1221 O O   . TYR B 2  35  ? 26.707 -3.866  18.587  1.00 22.04  ? 36  TYR L O   1 
ATOM   1222 C CB  . TYR B 2  35  ? 25.036 -6.251  19.830  1.00 21.90  ? 36  TYR L CB  1 
ATOM   1223 C CG  . TYR B 2  35  ? 24.636 -7.074  21.028  1.00 21.68  ? 36  TYR L CG  1 
ATOM   1224 C CD1 . TYR B 2  35  ? 24.404 -6.472  22.267  1.00 21.59  ? 36  TYR L CD1 1 
ATOM   1225 C CD2 . TYR B 2  35  ? 24.500 -8.462  20.927  1.00 21.42  ? 36  TYR L CD2 1 
ATOM   1226 C CE1 . TYR B 2  35  ? 24.045 -7.233  23.380  1.00 24.06  ? 36  TYR L CE1 1 
ATOM   1227 C CE2 . TYR B 2  35  ? 24.144 -9.238  22.036  1.00 20.68  ? 36  TYR L CE2 1 
ATOM   1228 C CZ  . TYR B 2  35  ? 23.920 -8.618  23.259  1.00 22.80  ? 36  TYR L CZ  1 
ATOM   1229 O OH  . TYR B 2  35  ? 23.600 -9.380  24.367  1.00 25.10  ? 36  TYR L OH  1 
ATOM   1230 N N   . GLN B 2  36  ? 27.017 -5.738  17.360  1.00 22.65  ? 37  GLN L N   1 
ATOM   1231 C CA  . GLN B 2  36  ? 27.224 -5.025  16.102  1.00 25.10  ? 37  GLN L CA  1 
ATOM   1232 C C   . GLN B 2  36  ? 26.084 -5.334  15.144  1.00 23.48  ? 37  GLN L C   1 
ATOM   1233 O O   . GLN B 2  36  ? 25.770 -6.496  14.907  1.00 25.96  ? 37  GLN L O   1 
ATOM   1234 C CB  . GLN B 2  36  ? 28.537 -5.436  15.424  1.00 25.01  ? 37  GLN L CB  1 
ATOM   1235 C CG  . GLN B 2  36  ? 28.673 -4.843  14.008  1.00 23.72  ? 37  GLN L CG  1 
ATOM   1236 C CD  . GLN B 2  36  ? 29.815 -5.437  13.223  1.00 20.56  ? 37  GLN L CD  1 
ATOM   1237 O OE1 . GLN B 2  36  ? 30.930 -4.913  13.223  1.00 26.65  ? 37  GLN L OE1 1 
ATOM   1238 N NE2 . GLN B 2  36  ? 29.551 -6.548  12.556  1.00 22.66  ? 37  GLN L NE2 1 
ATOM   1239 N N   . GLN B 2  37  ? 25.469 -4.303  14.580  1.00 22.63  ? 38  GLN L N   1 
ATOM   1240 C CA  . GLN B 2  37  ? 24.377 -4.537  13.647  1.00 21.80  ? 38  GLN L CA  1 
ATOM   1241 C C   . GLN B 2  37  ? 24.584 -3.835  12.319  1.00 23.18  ? 38  GLN L C   1 
ATOM   1242 O O   . GLN B 2  37  ? 24.962 -2.669  12.277  1.00 25.38  ? 38  GLN L O   1 
ATOM   1243 C CB  . GLN B 2  37  ? 23.046 -4.085  14.243  1.00 19.90  ? 38  GLN L CB  1 
ATOM   1244 C CG  . GLN B 2  37  ? 21.874 -4.384  13.331  1.00 19.34  ? 38  GLN L CG  1 
ATOM   1245 C CD  . GLN B 2  37  ? 20.561 -3.973  13.936  1.00 20.19  ? 38  GLN L CD  1 
ATOM   1246 O OE1 . GLN B 2  37  ? 20.417 -2.859  14.426  1.00 24.43  ? 38  GLN L OE1 1 
ATOM   1247 N NE2 . GLN B 2  37  ? 19.588 -4.866  13.896  1.00 23.19  ? 38  GLN L NE2 1 
ATOM   1248 N N   . LYS B 2  38  ? 24.328 -4.556  11.235  1.00 25.42  ? 39  LYS L N   1 
ATOM   1249 C CA  . LYS B 2  38  ? 24.466 -4.005  9.891   1.00 30.16  ? 39  LYS L CA  1 
ATOM   1250 C C   . LYS B 2  38  ? 23.166 -4.173  9.119   1.00 32.25  ? 39  LYS L C   1 
ATOM   1251 O O   . LYS B 2  38  ? 22.518 -5.209  9.213   1.00 33.97  ? 39  LYS L O   1 
ATOM   1252 C CB  . LYS B 2  38  ? 25.590 -4.719  9.133   1.00 26.61  ? 39  LYS L CB  1 
ATOM   1253 C CG  . LYS B 2  38  ? 26.981 -4.485  9.709   1.00 25.58  ? 39  LYS L CG  1 
ATOM   1254 C CD  . LYS B 2  38  ? 28.052 -5.110  8.839   1.00 27.78  ? 39  LYS L CD  1 
ATOM   1255 C CE  . LYS B 2  38  ? 29.440 -4.779  9.351   1.00 27.82  ? 39  LYS L CE  1 
ATOM   1256 N NZ  . LYS B 2  38  ? 30.483 -5.290  8.440   1.00 29.40  ? 39  LYS L NZ  1 
ATOM   1257 N N   . SER B 2  39  ? 22.777 -3.147  8.376   1.00 36.36  ? 40  SER L N   1 
ATOM   1258 C CA  . SER B 2  39  ? 21.578 -3.213  7.553   1.00 39.18  ? 40  SER L CA  1 
ATOM   1259 C C   . SER B 2  39  ? 20.361 -3.802  8.250   1.00 41.59  ? 40  SER L C   1 
ATOM   1260 O O   . SER B 2  39  ? 19.647 -4.629  7.673   1.00 40.34  ? 40  SER L O   1 
ATOM   1261 C CB  . SER B 2  39  ? 21.874 -4.031  6.303   1.00 41.07  ? 40  SER L CB  1 
ATOM   1262 O OG  . SER B 2  39  ? 23.061 -3.566  5.682   1.00 50.36  ? 40  SER L OG  1 
ATOM   1263 N N   . GLY B 2  40  ? 20.142 -3.380  9.493   1.00 41.82  ? 41  GLY L N   1 
ATOM   1264 C CA  . GLY B 2  40  ? 18.996 -3.839  10.259  1.00 41.14  ? 41  GLY L CA  1 
ATOM   1265 C C   . GLY B 2  40  ? 18.822 -5.333  10.481  1.00 41.82  ? 41  GLY L C   1 
ATOM   1266 O O   . GLY B 2  40  ? 17.777 -5.746  11.005  1.00 40.80  ? 41  GLY L O   1 
ATOM   1267 N N   . THR B 2  41  ? 19.806 -6.148  10.088  1.00 39.33  ? 42  THR L N   1 
ATOM   1268 C CA  . THR B 2  41  ? 19.708 -7.596  10.292  1.00 35.84  ? 42  THR L CA  1 
ATOM   1269 C C   . THR B 2  41  ? 20.019 -7.924  11.748  1.00 33.38  ? 42  THR L C   1 
ATOM   1270 O O   . THR B 2  41  ? 20.251 -7.015  12.552  1.00 35.23  ? 42  THR L O   1 
ATOM   1271 C CB  . THR B 2  41  ? 20.646 -8.384  9.362   1.00 36.69  ? 42  THR L CB  1 
ATOM   1272 O OG1 . THR B 2  41  ? 22.004 -7.971  9.577   1.00 36.30  ? 42  THR L OG1 1 
ATOM   1273 C CG2 . THR B 2  41  ? 20.249 -8.152  7.906   1.00 38.79  ? 42  THR L CG2 1 
ATOM   1274 N N   . SER B 2  42  ? 20.021 -9.205  12.097  1.00 28.07  ? 43  SER L N   1 
ATOM   1275 C CA  . SER B 2  42  ? 20.252 -9.584  13.487  1.00 27.30  ? 43  SER L CA  1 
ATOM   1276 C C   . SER B 2  42  ? 21.510 -8.997  14.107  1.00 26.18  ? 43  SER L C   1 
ATOM   1277 O O   . SER B 2  42  ? 22.596 -9.077  13.528  1.00 27.23  ? 43  SER L O   1 
ATOM   1278 C CB  . SER B 2  42  ? 20.313 -11.102 13.624  1.00 24.68  ? 43  SER L CB  1 
ATOM   1279 O OG  . SER B 2  42  ? 19.155 -11.686 13.086  1.00 32.31  ? 43  SER L OG  1 
ATOM   1280 N N   . PRO B 2  43  ? 21.372 -8.359  15.280  1.00 22.57  ? 44  PRO L N   1 
ATOM   1281 C CA  . PRO B 2  43  ? 22.562 -7.800  15.919  1.00 22.29  ? 44  PRO L CA  1 
ATOM   1282 C C   . PRO B 2  43  ? 23.474 -8.994  16.207  1.00 26.07  ? 44  PRO L C   1 
ATOM   1283 O O   . PRO B 2  43  ? 22.994 -10.089 16.522  1.00 25.28  ? 44  PRO L O   1 
ATOM   1284 C CB  . PRO B 2  43  ? 22.007 -7.186  17.196  1.00 23.44  ? 44  PRO L CB  1 
ATOM   1285 C CG  . PRO B 2  43  ? 20.648 -6.710  16.756  1.00 21.37  ? 44  PRO L CG  1 
ATOM   1286 C CD  . PRO B 2  43  ? 20.143 -7.876  15.931  1.00 17.86  ? 44  PRO L CD  1 
ATOM   1287 N N   . LYS B 2  44  ? 24.779 -8.803  16.065  1.00 25.13  ? 45  LYS L N   1 
ATOM   1288 C CA  . LYS B 2  44  ? 25.711 -9.886  16.325  1.00 23.55  ? 45  LYS L CA  1 
ATOM   1289 C C   . LYS B 2  44  ? 26.468 -9.611  17.614  1.00 23.32  ? 45  LYS L C   1 
ATOM   1290 O O   . LYS B 2  44  ? 26.984 -8.509  17.817  1.00 23.27  ? 45  LYS L O   1 
ATOM   1291 C CB  . LYS B 2  44  ? 26.718 -10.021 15.185  1.00 25.72  ? 45  LYS L CB  1 
ATOM   1292 C CG  . LYS B 2  44  ? 26.106 -10.084 13.824  1.00 29.25  ? 45  LYS L CG  1 
ATOM   1293 C CD  . LYS B 2  44  ? 27.160 -10.326 12.766  1.00 31.59  ? 45  LYS L CD  1 
ATOM   1294 C CE  . LYS B 2  44  ? 26.496 -10.347 11.402  1.00 37.26  ? 45  LYS L CE  1 
ATOM   1295 N NZ  . LYS B 2  44  ? 27.375 -10.901 10.347  1.00 43.14  ? 45  LYS L NZ  1 
ATOM   1296 N N   . PRO B 2  45  ? 26.524 -10.603 18.516  1.00 22.03  ? 46  PRO L N   1 
ATOM   1297 C CA  . PRO B 2  45  ? 27.256 -10.382 19.767  1.00 19.85  ? 46  PRO L CA  1 
ATOM   1298 C C   . PRO B 2  45  ? 28.681 -10.030 19.322  1.00 22.03  ? 46  PRO L C   1 
ATOM   1299 O O   . PRO B 2  45  ? 29.257 -10.730 18.485  1.00 21.65  ? 46  PRO L O   1 
ATOM   1300 C CB  . PRO B 2  45  ? 27.180 -11.743 20.449  1.00 20.02  ? 46  PRO L CB  1 
ATOM   1301 C CG  . PRO B 2  45  ? 25.895 -12.329 19.898  1.00 22.69  ? 46  PRO L CG  1 
ATOM   1302 C CD  . PRO B 2  45  ? 25.964 -11.966 18.453  1.00 19.96  ? 46  PRO L CD  1 
ATOM   1303 N N   . TRP B 2  46  ? 29.241 -8.952  19.861  1.00 22.62  ? 47  TRP L N   1 
ATOM   1304 C CA  . TRP B 2  46  ? 30.580 -8.514  19.460  1.00 22.96  ? 47  TRP L CA  1 
ATOM   1305 C C   . TRP B 2  46  ? 31.602 -8.643  20.593  1.00 22.28  ? 47  TRP L C   1 
ATOM   1306 O O   . TRP B 2  46  ? 32.644 -9.278  20.438  1.00 20.68  ? 47  TRP L O   1 
ATOM   1307 C CB  . TRP B 2  46  ? 30.516 -7.063  18.973  1.00 19.96  ? 47  TRP L CB  1 
ATOM   1308 C CG  . TRP B 2  46  ? 31.445 -6.780  17.832  1.00 23.96  ? 47  TRP L CG  1 
ATOM   1309 C CD1 . TRP B 2  46  ? 32.449 -5.858  17.801  1.00 21.16  ? 47  TRP L CD1 1 
ATOM   1310 C CD2 . TRP B 2  46  ? 31.478 -7.454  16.561  1.00 22.46  ? 47  TRP L CD2 1 
ATOM   1311 N NE1 . TRP B 2  46  ? 33.107 -5.919  16.597  1.00 22.43  ? 47  TRP L NE1 1 
ATOM   1312 C CE2 . TRP B 2  46  ? 32.532 -6.889  15.819  1.00 19.04  ? 47  TRP L CE2 1 
ATOM   1313 C CE3 . TRP B 2  46  ? 30.718 -8.481  15.985  1.00 20.47  ? 47  TRP L CE3 1 
ATOM   1314 C CZ2 . TRP B 2  46  ? 32.850 -7.315  14.531  1.00 21.88  ? 47  TRP L CZ2 1 
ATOM   1315 C CZ3 . TRP B 2  46  ? 31.033 -8.905  14.710  1.00 23.50  ? 47  TRP L CZ3 1 
ATOM   1316 C CH2 . TRP B 2  46  ? 32.093 -8.322  13.994  1.00 22.91  ? 47  TRP L CH2 1 
ATOM   1317 N N   . ILE B 2  47  ? 31.283 -8.028  21.724  1.00 24.99  ? 48  ILE L N   1 
ATOM   1318 C CA  . ILE B 2  47  ? 32.111 -8.056  22.922  1.00 28.89  ? 48  ILE L CA  1 
ATOM   1319 C C   . ILE B 2  47  ? 31.171 -8.319  24.098  1.00 28.69  ? 48  ILE L C   1 
ATOM   1320 O O   . ILE B 2  47  ? 30.212 -7.572  24.306  1.00 30.54  ? 48  ILE L O   1 
ATOM   1321 C CB  . ILE B 2  47  ? 32.823 -6.691  23.153  1.00 32.43  ? 48  ILE L CB  1 
ATOM   1322 C CG1 . ILE B 2  47  ? 33.831 -6.424  22.031  1.00 31.22  ? 48  ILE L CG1 1 
ATOM   1323 C CG2 . ILE B 2  47  ? 33.537 -6.688  24.501  1.00 33.31  ? 48  ILE L CG2 1 
ATOM   1324 C CD1 . ILE B 2  47  ? 34.561 -5.098  22.177  1.00 31.05  ? 48  ILE L CD1 1 
ATOM   1325 N N   . PHE B 2  48  ? 31.435 -9.377  24.859  1.00 29.48  ? 49  PHE L N   1 
ATOM   1326 C CA  . PHE B 2  48  ? 30.594 -9.703  26.011  1.00 33.78  ? 49  PHE L CA  1 
ATOM   1327 C C   . PHE B 2  48  ? 31.407 -9.760  27.305  1.00 37.00  ? 49  PHE L C   1 
ATOM   1328 O O   . PHE B 2  48  ? 32.630 -9.904  27.270  1.00 37.27  ? 49  PHE L O   1 
ATOM   1329 C CB  . PHE B 2  48  ? 29.872 -11.027 25.776  1.00 29.94  ? 49  PHE L CB  1 
ATOM   1330 C CG  . PHE B 2  48  ? 30.782 -12.212 25.724  1.00 32.08  ? 49  PHE L CG  1 
ATOM   1331 C CD1 . PHE B 2  48  ? 31.041 -12.956 26.872  1.00 32.03  ? 49  PHE L CD1 1 
ATOM   1332 C CD2 . PHE B 2  48  ? 31.370 -12.599 24.522  1.00 33.69  ? 49  PHE L CD2 1 
ATOM   1333 C CE1 . PHE B 2  48  ? 31.865 -14.071 26.828  1.00 33.97  ? 49  PHE L CE1 1 
ATOM   1334 C CE2 . PHE B 2  48  ? 32.198 -13.714 24.460  1.00 34.21  ? 49  PHE L CE2 1 
ATOM   1335 C CZ  . PHE B 2  48  ? 32.446 -14.453 25.616  1.00 36.76  ? 49  PHE L CZ  1 
ATOM   1336 N N   . GLU B 2  49  ? 30.719 -9.654  28.441  1.00 41.63  ? 50  GLU L N   1 
ATOM   1337 C CA  . GLU B 2  49  ? 31.369 -9.652  29.750  1.00 45.45  ? 50  GLU L CA  1 
ATOM   1338 C C   . GLU B 2  49  ? 32.503 -8.635  29.725  1.00 46.58  ? 50  GLU L C   1 
ATOM   1339 O O   . GLU B 2  49  ? 33.657 -8.932  30.024  1.00 55.38  ? 50  GLU L O   1 
ATOM   1340 C CB  . GLU B 2  49  ? 31.864 -11.056 30.115  1.00 46.89  ? 50  GLU L CB  1 
ATOM   1341 C CG  . GLU B 2  49  ? 30.710 -12.052 30.192  1.00 52.17  ? 50  GLU L CG  1 
ATOM   1342 C CD  . GLU B 2  49  ? 30.972 -13.225 31.111  1.00 52.91  ? 50  GLU L CD  1 
ATOM   1343 O OE1 . GLU B 2  49  ? 31.941 -13.964 30.859  1.00 50.76  ? 50  GLU L OE1 1 
ATOM   1344 O OE2 . GLU B 2  49  ? 30.201 -13.412 32.081  1.00 58.33  ? 50  GLU L OE2 1 
ATOM   1345 N N   . ILE B 2  50  ? 32.118 -7.427  29.326  1.00 39.90  ? 51  ILE L N   1 
ATOM   1346 C CA  . ILE B 2  50  ? 32.972 -6.252  29.221  1.00 37.12  ? 51  ILE L CA  1 
ATOM   1347 C C   . ILE B 2  50  ? 34.103 -6.293  28.193  1.00 34.51  ? 51  ILE L C   1 
ATOM   1348 O O   . ILE B 2  50  ? 34.268 -5.349  27.424  1.00 34.23  ? 51  ILE L O   1 
ATOM   1349 C CB  . ILE B 2  50  ? 33.595 -5.882  30.592  1.00 38.66  ? 51  ILE L CB  1 
ATOM   1350 C CG1 . ILE B 2  50  ? 32.528 -5.925  31.688  1.00 36.34  ? 51  ILE L CG1 1 
ATOM   1351 C CG2 . ILE B 2  50  ? 34.199 -4.477  30.519  1.00 32.55  ? 51  ILE L CG2 1 
ATOM   1352 C CD1 . ILE B 2  50  ? 33.078 -5.777  33.091  1.00 36.22  ? 51  ILE L CD1 1 
ATOM   1353 N N   . SER B 2  51  ? 34.868 -7.378  28.149  1.00 31.16  ? 52  SER L N   1 
ATOM   1354 C CA  . SER B 2  51  ? 35.987 -7.406  27.229  1.00 31.17  ? 52  SER L CA  1 
ATOM   1355 C C   . SER B 2  51  ? 36.255 -8.688  26.460  1.00 30.79  ? 52  SER L C   1 
ATOM   1356 O O   . SER B 2  51  ? 37.277 -8.790  25.779  1.00 32.97  ? 52  SER L O   1 
ATOM   1357 C CB  . SER B 2  51  ? 37.248 -7.012  27.985  1.00 33.69  ? 52  SER L CB  1 
ATOM   1358 O OG  . SER B 2  51  ? 37.478 -7.914  29.052  1.00 38.85  ? 52  SER L OG  1 
ATOM   1359 N N   . LYS B 2  52  ? 35.375 -9.676  26.554  1.00 27.38  ? 53  LYS L N   1 
ATOM   1360 C CA  . LYS B 2  52  ? 35.617 -10.898 25.798  1.00 30.19  ? 53  LYS L CA  1 
ATOM   1361 C C   . LYS B 2  52  ? 35.078 -10.751 24.366  1.00 30.03  ? 53  LYS L C   1 
ATOM   1362 O O   . LYS B 2  52  ? 33.953 -10.311 24.160  1.00 31.75  ? 53  LYS L O   1 
ATOM   1363 C CB  . LYS B 2  52  ? 34.961 -12.099 26.482  1.00 34.12  ? 53  LYS L CB  1 
ATOM   1364 C CG  . LYS B 2  52  ? 35.471 -12.412 27.878  1.00 35.32  ? 53  LYS L CG  1 
ATOM   1365 C CD  . LYS B 2  52  ? 34.943 -13.770 28.320  1.00 42.59  ? 53  LYS L CD  1 
ATOM   1366 C CE  . LYS B 2  52  ? 35.249 -14.049 29.776  1.00 47.70  ? 53  LYS L CE  1 
ATOM   1367 N NZ  . LYS B 2  52  ? 34.583 -13.056 30.666  1.00 51.47  ? 53  LYS L NZ  1 
ATOM   1368 N N   . LEU B 2  53  ? 35.884 -11.114 23.378  1.00 29.80  ? 54  LEU L N   1 
ATOM   1369 C CA  . LEU B 2  53  ? 35.455 -11.005 21.994  1.00 30.95  ? 54  LEU L CA  1 
ATOM   1370 C C   . LEU B 2  53  ? 34.701 -12.247 21.554  1.00 31.15  ? 54  LEU L C   1 
ATOM   1371 O O   . LEU B 2  53  ? 35.094 -13.357 21.891  1.00 33.15  ? 54  LEU L O   1 
ATOM   1372 C CB  . LEU B 2  53  ? 36.657 -10.808 21.067  1.00 30.54  ? 54  LEU L CB  1 
ATOM   1373 C CG  . LEU B 2  53  ? 37.541 -9.588  21.321  1.00 32.37  ? 54  LEU L CG  1 
ATOM   1374 C CD1 . LEU B 2  53  ? 38.474 -9.406  20.144  1.00 32.20  ? 54  LEU L CD1 1 
ATOM   1375 C CD2 . LEU B 2  53  ? 36.685 -8.350  21.503  1.00 33.38  ? 54  LEU L CD2 1 
ATOM   1376 N N   . ALA B 2  54  ? 33.618 -12.055 20.802  1.00 29.18  ? 55  ALA L N   1 
ATOM   1377 C CA  . ALA B 2  54  ? 32.831 -13.170 20.291  1.00 28.88  ? 55  ALA L CA  1 
ATOM   1378 C C   . ALA B 2  54  ? 33.666 -13.858 19.224  1.00 32.74  ? 55  ALA L C   1 
ATOM   1379 O O   . ALA B 2  54  ? 34.596 -13.266 18.668  1.00 33.67  ? 55  ALA L O   1 
ATOM   1380 C CB  . ALA B 2  54  ? 31.543 -12.671 19.692  1.00 29.30  ? 55  ALA L CB  1 
ATOM   1381 N N   . SER B 2  55  ? 33.340 -15.111 18.940  1.00 34.79  ? 56  SER L N   1 
ATOM   1382 C CA  . SER B 2  55  ? 34.081 -15.866 17.939  1.00 41.71  ? 56  SER L CA  1 
ATOM   1383 C C   . SER B 2  55  ? 34.079 -15.127 16.596  1.00 41.99  ? 56  SER L C   1 
ATOM   1384 O O   . SER B 2  55  ? 33.021 -14.737 16.090  1.00 43.23  ? 56  SER L O   1 
ATOM   1385 C CB  . SER B 2  55  ? 33.462 -17.264 17.778  1.00 43.98  ? 56  SER L CB  1 
ATOM   1386 O OG  . SER B 2  55  ? 34.282 -18.116 16.992  1.00 47.13  ? 56  SER L OG  1 
ATOM   1387 N N   . GLY B 2  56  ? 35.263 -14.922 16.030  1.00 40.31  ? 57  GLY L N   1 
ATOM   1388 C CA  . GLY B 2  56  ? 35.348 -14.239 14.753  1.00 38.34  ? 57  GLY L CA  1 
ATOM   1389 C C   . GLY B 2  56  ? 35.631 -12.746 14.809  1.00 37.68  ? 57  GLY L C   1 
ATOM   1390 O O   . GLY B 2  56  ? 36.006 -12.159 13.798  1.00 40.31  ? 57  GLY L O   1 
ATOM   1391 N N   . VAL B 2  57  ? 35.448 -12.122 15.968  1.00 33.57  ? 58  VAL L N   1 
ATOM   1392 C CA  . VAL B 2  57  ? 35.703 -10.691 16.110  1.00 30.34  ? 58  VAL L CA  1 
ATOM   1393 C C   . VAL B 2  57  ? 37.219 -10.422 16.023  1.00 34.06  ? 58  VAL L C   1 
ATOM   1394 O O   . VAL B 2  57  ? 38.004 -11.006 16.776  1.00 36.03  ? 58  VAL L O   1 
ATOM   1395 C CB  . VAL B 2  57  ? 35.150 -10.186 17.459  1.00 27.05  ? 58  VAL L CB  1 
ATOM   1396 C CG1 . VAL B 2  57  ? 35.409 -8.704  17.620  1.00 21.71  ? 58  VAL L CG1 1 
ATOM   1397 C CG2 . VAL B 2  57  ? 33.666 -10.489 17.540  1.00 24.77  ? 58  VAL L CG2 1 
ATOM   1398 N N   . PRO B 2  58  ? 37.648 -9.538  15.094  1.00 35.28  ? 59  PRO L N   1 
ATOM   1399 C CA  . PRO B 2  58  ? 39.060 -9.185  14.886  1.00 34.26  ? 59  PRO L CA  1 
ATOM   1400 C C   . PRO B 2  58  ? 39.720 -8.615  16.131  1.00 33.86  ? 59  PRO L C   1 
ATOM   1401 O O   . PRO B 2  58  ? 39.062 -7.976  16.955  1.00 33.99  ? 59  PRO L O   1 
ATOM   1402 C CB  . PRO B 2  58  ? 39.000 -8.142  13.767  1.00 33.01  ? 59  PRO L CB  1 
ATOM   1403 C CG  . PRO B 2  58  ? 37.742 -8.445  13.056  1.00 32.28  ? 59  PRO L CG  1 
ATOM   1404 C CD  . PRO B 2  58  ? 36.796 -8.745  14.193  1.00 35.44  ? 59  PRO L CD  1 
ATOM   1405 N N   . ALA B 2  59  ? 41.033 -8.817  16.233  1.00 33.35  ? 60  ALA L N   1 
ATOM   1406 C CA  . ALA B 2  59  ? 41.820 -8.339  17.366  1.00 31.15  ? 60  ALA L CA  1 
ATOM   1407 C C   . ALA B 2  59  ? 41.853 -6.818  17.530  1.00 31.36  ? 60  ALA L C   1 
ATOM   1408 O O   . ALA B 2  59  ? 42.160 -6.322  18.618  1.00 32.97  ? 60  ALA L O   1 
ATOM   1409 C CB  . ALA B 2  59  ? 43.250 -8.883  17.265  1.00 33.47  ? 60  ALA L CB  1 
ATOM   1410 N N   . ARG B 2  60  ? 41.550 -6.070  16.467  1.00 30.43  ? 61  ARG L N   1 
ATOM   1411 C CA  . ARG B 2  60  ? 41.565 -4.604  16.558  1.00 29.62  ? 61  ARG L CA  1 
ATOM   1412 C C   . ARG B 2  60  ? 40.471 -4.090  17.492  1.00 28.53  ? 61  ARG L C   1 
ATOM   1413 O O   . ARG B 2  60  ? 40.471 -2.924  17.897  1.00 27.47  ? 61  ARG L O   1 
ATOM   1414 C CB  . ARG B 2  60  ? 41.414 -3.968  15.169  1.00 28.43  ? 61  ARG L CB  1 
ATOM   1415 C CG  . ARG B 2  60  ? 40.203 -4.412  14.386  1.00 28.32  ? 61  ARG L CG  1 
ATOM   1416 C CD  . ARG B 2  60  ? 40.148 -3.660  13.080  1.00 29.42  ? 61  ARG L CD  1 
ATOM   1417 N NE  . ARG B 2  60  ? 39.019 -4.046  12.245  1.00 29.79  ? 61  ARG L NE  1 
ATOM   1418 C CZ  . ARG B 2  60  ? 38.927 -5.196  11.588  1.00 33.98  ? 61  ARG L CZ  1 
ATOM   1419 N NH1 . ARG B 2  60  ? 39.900 -6.093  11.664  1.00 37.36  ? 61  ARG L NH1 1 
ATOM   1420 N NH2 . ARG B 2  60  ? 37.863 -5.447  10.837  1.00 36.76  ? 61  ARG L NH2 1 
ATOM   1421 N N   . PHE B 2  61  ? 39.543 -4.978  17.835  1.00 29.44  ? 62  PHE L N   1 
ATOM   1422 C CA  . PHE B 2  61  ? 38.449 -4.637  18.729  1.00 29.21  ? 62  PHE L CA  1 
ATOM   1423 C C   . PHE B 2  61  ? 38.784 -5.000  20.159  1.00 30.86  ? 62  PHE L C   1 
ATOM   1424 O O   . PHE B 2  61  ? 39.367 -6.048  20.431  1.00 36.46  ? 62  PHE L O   1 
ATOM   1425 C CB  . PHE B 2  61  ? 37.174 -5.391  18.347  1.00 27.54  ? 62  PHE L CB  1 
ATOM   1426 C CG  . PHE B 2  61  ? 36.482 -4.849  17.141  1.00 24.57  ? 62  PHE L CG  1 
ATOM   1427 C CD1 . PHE B 2  61  ? 36.727 -5.384  15.882  1.00 24.90  ? 62  PHE L CD1 1 
ATOM   1428 C CD2 . PHE B 2  61  ? 35.571 -3.801  17.266  1.00 25.79  ? 62  PHE L CD2 1 
ATOM   1429 C CE1 . PHE B 2  61  ? 36.074 -4.885  14.763  1.00 25.16  ? 62  PHE L CE1 1 
ATOM   1430 C CE2 . PHE B 2  61  ? 34.911 -3.292  16.155  1.00 22.05  ? 62  PHE L CE2 1 
ATOM   1431 C CZ  . PHE B 2  61  ? 35.162 -3.833  14.902  1.00 24.42  ? 62  PHE L CZ  1 
ATOM   1432 N N   . SER B 2  62  ? 38.403 -4.136  21.078  1.00 28.70  ? 63  SER L N   1 
ATOM   1433 C CA  . SER B 2  62  ? 38.629 -4.401  22.479  1.00 33.19  ? 63  SER L CA  1 
ATOM   1434 C C   . SER B 2  62  ? 37.611 -3.581  23.252  1.00 34.66  ? 63  SER L C   1 
ATOM   1435 O O   . SER B 2  62  ? 37.145 -2.541  22.781  1.00 32.97  ? 63  SER L O   1 
ATOM   1436 C CB  . SER B 2  62  ? 40.049 -4.007  22.880  1.00 34.56  ? 63  SER L CB  1 
ATOM   1437 O OG  . SER B 2  62  ? 40.270 -2.627  22.654  1.00 37.28  ? 63  SER L OG  1 
ATOM   1438 N N   . GLY B 2  63  ? 37.250 -4.062  24.431  1.00 36.88  ? 64  GLY L N   1 
ATOM   1439 C CA  . GLY B 2  63  ? 36.289 -3.342  25.236  1.00 37.62  ? 64  GLY L CA  1 
ATOM   1440 C C   . GLY B 2  63  ? 36.801 -3.240  26.651  1.00 40.64  ? 64  GLY L C   1 
ATOM   1441 O O   . GLY B 2  63  ? 37.586 -4.082  27.092  1.00 43.18  ? 64  GLY L O   1 
ATOM   1442 N N   . SER B 2  64  ? 36.363 -2.212  27.365  1.00 39.58  ? 65  SER L N   1 
ATOM   1443 C CA  . SER B 2  64  ? 36.798 -2.030  28.735  1.00 43.51  ? 65  SER L CA  1 
ATOM   1444 C C   . SER B 2  64  ? 35.802 -1.161  29.478  1.00 43.69  ? 65  SER L C   1 
ATOM   1445 O O   . SER B 2  64  ? 34.936 -0.531  28.867  1.00 43.28  ? 65  SER L O   1 
ATOM   1446 C CB  . SER B 2  64  ? 38.178 -1.367  28.768  1.00 46.23  ? 65  SER L CB  1 
ATOM   1447 O OG  . SER B 2  64  ? 38.098 -0.019  28.329  1.00 49.08  ? 65  SER L OG  1 
ATOM   1448 N N   . GLY B 2  65  ? 35.938 -1.127  30.799  1.00 45.43  ? 66  GLY L N   1 
ATOM   1449 C CA  . GLY B 2  65  ? 35.051 -0.320  31.612  1.00 43.52  ? 66  GLY L CA  1 
ATOM   1450 C C   . GLY B 2  65  ? 34.729 -0.975  32.940  1.00 44.60  ? 66  GLY L C   1 
ATOM   1451 O O   . GLY B 2  65  ? 35.129 -2.114  33.210  1.00 43.91  ? 66  GLY L O   1 
ATOM   1452 N N   . SER B 2  66  ? 34.007 -0.233  33.771  1.00 41.98  ? 67  SER L N   1 
ATOM   1453 C CA  . SER B 2  66  ? 33.592 -0.700  35.083  1.00 43.81  ? 67  SER L CA  1 
ATOM   1454 C C   . SER B 2  66  ? 32.490 0.220   35.538  1.00 43.17  ? 67  SER L C   1 
ATOM   1455 O O   . SER B 2  66  ? 32.300 1.298   34.972  1.00 41.44  ? 67  SER L O   1 
ATOM   1456 C CB  . SER B 2  66  ? 34.741 -0.632  36.090  1.00 46.59  ? 67  SER L CB  1 
ATOM   1457 O OG  . SER B 2  66  ? 35.646 -1.711  35.932  1.00 56.56  ? 67  SER L OG  1 
ATOM   1458 N N   . GLY B 2  67  ? 31.758 -0.217  36.555  1.00 46.91  ? 68  GLY L N   1 
ATOM   1459 C CA  . GLY B 2  67  ? 30.679 0.582   37.103  1.00 49.43  ? 68  GLY L CA  1 
ATOM   1460 C C   . GLY B 2  67  ? 29.776 1.345   36.151  1.00 49.81  ? 68  GLY L C   1 
ATOM   1461 O O   . GLY B 2  67  ? 28.900 0.764   35.505  1.00 52.60  ? 68  GLY L O   1 
ATOM   1462 N N   . THR B 2  68  ? 29.990 2.654   36.062  1.00 48.98  ? 69  THR L N   1 
ATOM   1463 C CA  . THR B 2  68  ? 29.158 3.513   35.224  1.00 48.67  ? 69  THR L CA  1 
ATOM   1464 C C   . THR B 2  68  ? 29.682 3.855   33.832  1.00 48.50  ? 69  THR L C   1 
ATOM   1465 O O   . THR B 2  68  ? 28.974 4.463   33.027  1.00 43.14  ? 69  THR L O   1 
ATOM   1466 C CB  . THR B 2  68  ? 28.842 4.811   35.984  1.00 49.61  ? 69  THR L CB  1 
ATOM   1467 O OG1 . THR B 2  68  ? 28.036 4.488   37.121  1.00 56.38  ? 69  THR L OG1 1 
ATOM   1468 C CG2 . THR B 2  68  ? 28.087 5.804   35.115  1.00 46.98  ? 69  THR L CG2 1 
ATOM   1469 N N   . SER B 2  69  ? 30.915 3.473   33.533  1.00 50.44  ? 70  SER L N   1 
ATOM   1470 C CA  . SER B 2  69  ? 31.444 3.769   32.216  1.00 50.72  ? 70  SER L CA  1 
ATOM   1471 C C   . SER B 2  69  ? 32.126 2.577   31.578  1.00 49.46  ? 70  SER L C   1 
ATOM   1472 O O   . SER B 2  69  ? 32.934 1.878   32.201  1.00 50.73  ? 70  SER L O   1 
ATOM   1473 C CB  . SER B 2  69  ? 32.416 4.949   32.264  1.00 54.69  ? 70  SER L CB  1 
ATOM   1474 O OG  . SER B 2  69  ? 32.877 5.266   30.958  1.00 54.88  ? 70  SER L OG  1 
ATOM   1475 N N   . TYR B 2  70  ? 31.769 2.357   30.319  1.00 47.36  ? 71  TYR L N   1 
ATOM   1476 C CA  . TYR B 2  70  ? 32.314 1.278   29.516  1.00 43.93  ? 71  TYR L CA  1 
ATOM   1477 C C   . TYR B 2  70  ? 32.581 1.836   28.129  1.00 42.16  ? 71  TYR L C   1 
ATOM   1478 O O   . TYR B 2  70  ? 31.979 2.837   27.721  1.00 40.20  ? 71  TYR L O   1 
ATOM   1479 C CB  . TYR B 2  70  ? 31.319 0.119   29.421  1.00 38.79  ? 71  TYR L CB  1 
ATOM   1480 C CG  . TYR B 2  70  ? 31.124 -0.633  30.716  1.00 33.78  ? 71  TYR L CG  1 
ATOM   1481 C CD1 . TYR B 2  70  ? 30.206 -0.198  31.677  1.00 31.94  ? 71  TYR L CD1 1 
ATOM   1482 C CD2 . TYR B 2  70  ? 31.859 -1.787  30.978  1.00 33.18  ? 71  TYR L CD2 1 
ATOM   1483 C CE1 . TYR B 2  70  ? 30.025 -0.906  32.869  1.00 29.09  ? 71  TYR L CE1 1 
ATOM   1484 C CE2 . TYR B 2  70  ? 31.689 -2.498  32.156  1.00 34.46  ? 71  TYR L CE2 1 
ATOM   1485 C CZ  . TYR B 2  70  ? 30.773 -2.057  33.092  1.00 31.57  ? 71  TYR L CZ  1 
ATOM   1486 O OH  . TYR B 2  70  ? 30.603 -2.794  34.237  1.00 37.32  ? 71  TYR L OH  1 
ATOM   1487 N N   . SER B 2  71  ? 33.477 1.190   27.398  1.00 41.17  ? 72  SER L N   1 
ATOM   1488 C CA  . SER B 2  71  ? 33.799 1.658   26.065  1.00 38.38  ? 72  SER L CA  1 
ATOM   1489 C C   . SER B 2  71  ? 34.265 0.527   25.182  1.00 36.84  ? 72  SER L C   1 
ATOM   1490 O O   . SER B 2  71  ? 34.872 -0.443  25.645  1.00 36.51  ? 72  SER L O   1 
ATOM   1491 C CB  . SER B 2  71  ? 34.899 2.721   26.136  1.00 40.42  ? 72  SER L CB  1 
ATOM   1492 O OG  . SER B 2  71  ? 36.097 2.160   26.659  1.00 39.24  ? 72  SER L OG  1 
ATOM   1493 N N   . LEU B 2  72  ? 33.952 0.653   23.902  1.00 32.86  ? 73  LEU L N   1 
ATOM   1494 C CA  . LEU B 2  72  ? 34.378 -0.318  22.925  1.00 31.31  ? 73  LEU L CA  1 
ATOM   1495 C C   . LEU B 2  72  ? 35.359 0.504   22.130  1.00 32.58  ? 73  LEU L C   1 
ATOM   1496 O O   . LEU B 2  72  ? 35.113 1.677   21.853  1.00 29.80  ? 73  LEU L O   1 
ATOM   1497 C CB  . LEU B 2  72  ? 33.214 -0.758  22.046  1.00 31.82  ? 73  LEU L CB  1 
ATOM   1498 C CG  . LEU B 2  72  ? 33.552 -1.599  20.810  1.00 32.98  ? 73  LEU L CG  1 
ATOM   1499 C CD1 . LEU B 2  72  ? 32.355 -2.424  20.398  1.00 32.30  ? 73  LEU L CD1 1 
ATOM   1500 C CD2 . LEU B 2  72  ? 33.961 -0.689  19.672  1.00 34.15  ? 73  LEU L CD2 1 
ATOM   1501 N N   . THR B 2  73  ? 36.484 -0.096  21.784  1.00 35.71  ? 74  THR L N   1 
ATOM   1502 C CA  . THR B 2  73  ? 37.493 0.621   21.027  1.00 36.69  ? 74  THR L CA  1 
ATOM   1503 C C   . THR B 2  73  ? 37.970 -0.221  19.871  1.00 35.80  ? 74  THR L C   1 
ATOM   1504 O O   . THR B 2  73  ? 38.073 -1.446  19.972  1.00 38.95  ? 74  THR L O   1 
ATOM   1505 C CB  . THR B 2  73  ? 38.737 0.983   21.912  1.00 40.07  ? 74  THR L CB  1 
ATOM   1506 O OG1 . THR B 2  73  ? 38.347 1.873   22.968  1.00 41.93  ? 74  THR L OG1 1 
ATOM   1507 C CG2 . THR B 2  73  ? 39.825 1.648   21.075  1.00 38.76  ? 74  THR L CG2 1 
ATOM   1508 N N   . ILE B 2  74  ? 38.229 0.442   18.757  1.00 33.96  ? 75  ILE L N   1 
ATOM   1509 C CA  . ILE B 2  74  ? 38.772 -0.232  17.597  1.00 37.34  ? 75  ILE L CA  1 
ATOM   1510 C C   . ILE B 2  74  ? 40.063 0.544   17.333  1.00 38.93  ? 75  ILE L C   1 
ATOM   1511 O O   . ILE B 2  74  ? 40.040 1.723   16.963  1.00 38.00  ? 75  ILE L O   1 
ATOM   1512 C CB  . ILE B 2  74  ? 37.821 -0.172  16.389  1.00 36.32  ? 75  ILE L CB  1 
ATOM   1513 C CG1 . ILE B 2  74  ? 38.564 -0.627  15.141  1.00 36.30  ? 75  ILE L CG1 1 
ATOM   1514 C CG2 . ILE B 2  74  ? 37.262 1.208   16.228  1.00 44.16  ? 75  ILE L CG2 1 
ATOM   1515 C CD1 . ILE B 2  74  ? 37.790 -0.443  13.881  1.00 42.04  ? 75  ILE L CD1 1 
ATOM   1516 N N   . SER B 2  75  ? 41.192 -0.115  17.570  1.00 40.04  ? 76  SER L N   1 
ATOM   1517 C CA  . SER B 2  75  ? 42.494 0.518   17.397  1.00 40.44  ? 76  SER L CA  1 
ATOM   1518 C C   . SER B 2  75  ? 42.713 1.076   15.994  1.00 38.85  ? 76  SER L C   1 
ATOM   1519 O O   . SER B 2  75  ? 43.202 2.194   15.833  1.00 38.31  ? 76  SER L O   1 
ATOM   1520 C CB  . SER B 2  75  ? 43.602 -0.475  17.746  1.00 41.78  ? 76  SER L CB  1 
ATOM   1521 O OG  . SER B 2  75  ? 43.439 -1.671  17.009  1.00 50.28  ? 76  SER L OG  1 
ATOM   1522 N N   . SER B 2  76  ? 42.351 0.308   14.978  1.00 35.23  ? 77  SER L N   1 
ATOM   1523 C CA  . SER B 2  76  ? 42.534 0.778   13.619  1.00 34.29  ? 77  SER L CA  1 
ATOM   1524 C C   . SER B 2  76  ? 41.292 0.537   12.787  1.00 32.69  ? 77  SER L C   1 
ATOM   1525 O O   . SER B 2  76  ? 41.033 -0.584  12.364  1.00 31.90  ? 77  SER L O   1 
ATOM   1526 C CB  . SER B 2  76  ? 43.730 0.080   12.976  1.00 34.62  ? 77  SER L CB  1 
ATOM   1527 O OG  . SER B 2  76  ? 43.859 0.474   11.627  1.00 39.74  ? 77  SER L OG  1 
ATOM   1528 N N   . MET B 2  77  ? 40.539 1.608   12.549  1.00 33.40  ? 78  MET L N   1 
ATOM   1529 C CA  . MET B 2  77  ? 39.297 1.572   11.770  1.00 32.74  ? 78  MET L CA  1 
ATOM   1530 C C   . MET B 2  77  ? 39.423 0.960   10.372  1.00 30.96  ? 78  MET L C   1 
ATOM   1531 O O   . MET B 2  77  ? 40.224 1.404   9.564   1.00 30.97  ? 78  MET L O   1 
ATOM   1532 C CB  . MET B 2  77  ? 38.741 2.997   11.645  1.00 33.19  ? 78  MET L CB  1 
ATOM   1533 C CG  . MET B 2  77  ? 37.484 3.135   10.793  1.00 35.72  ? 78  MET L CG  1 
ATOM   1534 S SD  . MET B 2  77  ? 35.994 2.394   11.511  1.00 42.03  ? 78  MET L SD  1 
ATOM   1535 C CE  . MET B 2  77  ? 34.885 2.305   10.050  1.00 38.32  ? 78  MET L CE  1 
ATOM   1536 N N   . GLU B 2  78  ? 38.628 -0.066  10.094  1.00 32.00  ? 79  GLU L N   1 
ATOM   1537 C CA  . GLU B 2  78  ? 38.624 -0.697  8.777   1.00 33.66  ? 79  GLU L CA  1 
ATOM   1538 C C   . GLU B 2  78  ? 37.227 -0.582  8.166   1.00 35.47  ? 79  GLU L C   1 
ATOM   1539 O O   . GLU B 2  78  ? 36.256 -0.309  8.870   1.00 36.32  ? 79  GLU L O   1 
ATOM   1540 C CB  . GLU B 2  78  ? 39.053 -2.159  8.874   1.00 37.82  ? 79  GLU L CB  1 
ATOM   1541 C CG  . GLU B 2  78  ? 40.556 -2.314  8.977   1.00 42.08  ? 79  GLU L CG  1 
ATOM   1542 C CD  . GLU B 2  78  ? 41.001 -3.754  9.091   1.00 44.40  ? 79  GLU L CD  1 
ATOM   1543 O OE1 . GLU B 2  78  ? 40.412 -4.621  8.407   1.00 41.14  ? 79  GLU L OE1 1 
ATOM   1544 O OE2 . GLU B 2  78  ? 41.956 -4.009  9.860   1.00 49.23  ? 79  GLU L OE2 1 
ATOM   1545 N N   . ALA B 2  79  ? 37.125 -0.791  6.859   1.00 36.19  ? 80  ALA L N   1 
ATOM   1546 C CA  . ALA B 2  79  ? 35.848 -0.654  6.160   1.00 35.43  ? 80  ALA L CA  1 
ATOM   1547 C C   . ALA B 2  79  ? 34.700 -1.492  6.715   1.00 33.28  ? 80  ALA L C   1 
ATOM   1548 O O   . ALA B 2  79  ? 33.618 -0.974  6.959   1.00 33.37  ? 80  ALA L O   1 
ATOM   1549 C CB  . ALA B 2  79  ? 36.041 -0.948  4.674   1.00 32.18  ? 80  ALA L CB  1 
ATOM   1550 N N   . GLU B 2  80  ? 34.940 -2.781  6.916   1.00 33.50  ? 81  GLU L N   1 
ATOM   1551 C CA  . GLU B 2  80  ? 33.916 -3.690  7.419   1.00 31.86  ? 81  GLU L CA  1 
ATOM   1552 C C   . GLU B 2  80  ? 33.463 -3.383  8.837   1.00 30.82  ? 81  GLU L C   1 
ATOM   1553 O O   . GLU B 2  80  ? 32.536 -4.025  9.342   1.00 32.01  ? 81  GLU L O   1 
ATOM   1554 C CB  . GLU B 2  80  ? 34.421 -5.128  7.372   1.00 34.71  ? 81  GLU L CB  1 
ATOM   1555 C CG  . GLU B 2  80  ? 35.719 -5.326  8.124   1.00 43.30  ? 81  GLU L CG  1 
ATOM   1556 C CD  . GLU B 2  80  ? 36.114 -6.784  8.231   1.00 49.27  ? 81  GLU L CD  1 
ATOM   1557 O OE1 . GLU B 2  80  ? 35.974 -7.509  7.218   1.00 54.08  ? 81  GLU L OE1 1 
ATOM   1558 O OE2 . GLU B 2  80  ? 36.572 -7.198  9.323   1.00 51.66  ? 81  GLU L OE2 1 
ATOM   1559 N N   . ASP B 2  81  ? 34.112 -2.419  9.486   1.00 28.35  ? 82  ASP L N   1 
ATOM   1560 C CA  . ASP B 2  81  ? 33.736 -2.068  10.848  1.00 29.75  ? 82  ASP L CA  1 
ATOM   1561 C C   . ASP B 2  81  ? 32.611 -1.036  10.861  1.00 30.06  ? 82  ASP L C   1 
ATOM   1562 O O   . ASP B 2  81  ? 32.109 -0.665  11.927  1.00 29.73  ? 82  ASP L O   1 
ATOM   1563 C CB  . ASP B 2  81  ? 34.943 -1.533  11.640  1.00 30.07  ? 82  ASP L CB  1 
ATOM   1564 C CG  . ASP B 2  81  ? 36.077 -2.550  11.758  1.00 31.64  ? 82  ASP L CG  1 
ATOM   1565 O OD1 . ASP B 2  81  ? 35.802 -3.769  11.792  1.00 34.47  ? 82  ASP L OD1 1 
ATOM   1566 O OD2 . ASP B 2  81  ? 37.250 -2.129  11.833  1.00 29.40  ? 82  ASP L OD2 1 
ATOM   1567 N N   . ALA B 2  82  ? 32.225 -0.561  9.680   1.00 30.76  ? 83  ALA L N   1 
ATOM   1568 C CA  . ALA B 2  82  ? 31.144 0.420   9.591   1.00 29.89  ? 83  ALA L CA  1 
ATOM   1569 C C   . ALA B 2  82  ? 29.850 -0.331  9.919   1.00 28.20  ? 83  ALA L C   1 
ATOM   1570 O O   . ALA B 2  82  ? 29.522 -1.330  9.267   1.00 27.39  ? 83  ALA L O   1 
ATOM   1571 C CB  . ALA B 2  82  ? 31.081 1.023   8.180   1.00 26.19  ? 83  ALA L CB  1 
ATOM   1572 N N   . ALA B 2  83  ? 29.139 0.144   10.942  1.00 26.17  ? 84  ALA L N   1 
ATOM   1573 C CA  . ALA B 2  83  ? 27.899 -0.478  11.399  1.00 22.89  ? 84  ALA L CA  1 
ATOM   1574 C C   . ALA B 2  83  ? 27.359 0.303   12.578  1.00 23.55  ? 84  ALA L C   1 
ATOM   1575 O O   . ALA B 2  83  ? 27.854 1.380   12.906  1.00 24.93  ? 84  ALA L O   1 
ATOM   1576 C CB  . ALA B 2  83  ? 28.164 -1.917  11.837  1.00 23.40  ? 84  ALA L CB  1 
ATOM   1577 N N   . ILE B 2  84  ? 26.324 -0.238  13.206  1.00 23.98  ? 85  ILE L N   1 
ATOM   1578 C CA  . ILE B 2  84  ? 25.747 0.389   14.383  1.00 25.60  ? 85  ILE L CA  1 
ATOM   1579 C C   . ILE B 2  84  ? 26.155 -0.527  15.531  1.00 24.37  ? 85  ILE L C   1 
ATOM   1580 O O   . ILE B 2  84  ? 26.022 -1.755  15.445  1.00 23.22  ? 85  ILE L O   1 
ATOM   1581 C CB  . ILE B 2  84  ? 24.196 0.478   14.309  1.00 27.93  ? 85  ILE L CB  1 
ATOM   1582 C CG1 . ILE B 2  84  ? 23.778 1.181   13.018  1.00 27.51  ? 85  ILE L CG1 1 
ATOM   1583 C CG2 . ILE B 2  84  ? 23.653 1.271   15.507  1.00 25.07  ? 85  ILE L CG2 1 
ATOM   1584 C CD1 . ILE B 2  84  ? 22.296 1.176   12.790  1.00 36.10  ? 85  ILE L CD1 1 
ATOM   1585 N N   . TYR B 2  85  ? 26.679 0.076   16.587  1.00 22.80  ? 86  TYR L N   1 
ATOM   1586 C CA  . TYR B 2  85  ? 27.126 -0.664  17.750  1.00 26.33  ? 86  TYR L CA  1 
ATOM   1587 C C   . TYR B 2  85  ? 26.213 -0.303  18.890  1.00 27.95  ? 86  TYR L C   1 
ATOM   1588 O O   . TYR B 2  85  ? 25.933 0.875   19.108  1.00 29.21  ? 86  TYR L O   1 
ATOM   1589 C CB  . TYR B 2  85  ? 28.569 -0.279  18.087  1.00 25.07  ? 86  TYR L CB  1 
ATOM   1590 C CG  . TYR B 2  85  ? 29.546 -0.745  17.040  1.00 24.93  ? 86  TYR L CG  1 
ATOM   1591 C CD1 . TYR B 2  85  ? 30.135 -2.008  17.129  1.00 23.79  ? 86  TYR L CD1 1 
ATOM   1592 C CD2 . TYR B 2  85  ? 29.818 0.034   15.912  1.00 25.13  ? 86  TYR L CD2 1 
ATOM   1593 C CE1 . TYR B 2  85  ? 30.970 -2.494  16.116  1.00 26.00  ? 86  TYR L CE1 1 
ATOM   1594 C CE2 . TYR B 2  85  ? 30.652 -0.441  14.886  1.00 24.30  ? 86  TYR L CE2 1 
ATOM   1595 C CZ  . TYR B 2  85  ? 31.220 -1.710  14.995  1.00 24.84  ? 86  TYR L CZ  1 
ATOM   1596 O OH  . TYR B 2  85  ? 31.993 -2.224  13.978  1.00 22.83  ? 86  TYR L OH  1 
ATOM   1597 N N   . TYR B 2  86  ? 25.746 -1.321  19.607  1.00 29.36  ? 87  TYR L N   1 
ATOM   1598 C CA  . TYR B 2  86  ? 24.852 -1.124  20.745  1.00 28.53  ? 87  TYR L CA  1 
ATOM   1599 C C   . TYR B 2  86  ? 25.457 -1.738  21.987  1.00 26.27  ? 87  TYR L C   1 
ATOM   1600 O O   . TYR B 2  86  ? 25.943 -2.865  21.937  1.00 26.29  ? 87  TYR L O   1 
ATOM   1601 C CB  . TYR B 2  86  ? 23.505 -1.826  20.518  1.00 27.49  ? 87  TYR L CB  1 
ATOM   1602 C CG  . TYR B 2  86  ? 22.627 -1.231  19.450  1.00 23.35  ? 87  TYR L CG  1 
ATOM   1603 C CD1 . TYR B 2  86  ? 21.857 -0.098  19.703  1.00 24.43  ? 87  TYR L CD1 1 
ATOM   1604 C CD2 . TYR B 2  86  ? 22.560 -1.806  18.183  1.00 22.04  ? 87  TYR L CD2 1 
ATOM   1605 C CE1 . TYR B 2  86  ? 21.039 0.450   18.716  1.00 24.46  ? 87  TYR L CE1 1 
ATOM   1606 C CE2 . TYR B 2  86  ? 21.749 -1.265  17.189  1.00 24.40  ? 87  TYR L CE2 1 
ATOM   1607 C CZ  . TYR B 2  86  ? 20.990 -0.137  17.460  1.00 25.10  ? 87  TYR L CZ  1 
ATOM   1608 O OH  . TYR B 2  86  ? 20.193 0.408   16.471  1.00 27.16  ? 87  TYR L OH  1 
ATOM   1609 N N   . CYS B 2  87  ? 25.448 -1.004  23.092  1.00 26.30  ? 88  CYS L N   1 
ATOM   1610 C CA  . CYS B 2  87  ? 25.926 -1.573  24.334  1.00 29.70  ? 88  CYS L CA  1 
ATOM   1611 C C   . CYS B 2  87  ? 24.666 -2.079  25.019  1.00 28.78  ? 88  CYS L C   1 
ATOM   1612 O O   . CYS B 2  87  ? 23.559 -1.667  24.672  1.00 28.02  ? 88  CYS L O   1 
ATOM   1613 C CB  . CYS B 2  87  ? 26.623 -0.528  25.219  1.00 36.36  ? 88  CYS L CB  1 
ATOM   1614 S SG  . CYS B 2  87  ? 25.808 1.092   25.458  1.00 45.41  ? 88  CYS L SG  1 
ATOM   1615 N N   . GLN B 2  88  ? 24.821 -2.978  25.978  1.00 28.80  ? 89  GLN L N   1 
ATOM   1616 C CA  . GLN B 2  88  ? 23.660 -3.492  26.691  1.00 27.69  ? 89  GLN L CA  1 
ATOM   1617 C C   . GLN B 2  88  ? 24.052 -3.975  28.069  1.00 27.03  ? 89  GLN L C   1 
ATOM   1618 O O   . GLN B 2  88  ? 25.076 -4.651  28.229  1.00 29.40  ? 89  GLN L O   1 
ATOM   1619 C CB  . GLN B 2  88  ? 23.015 -4.663  25.937  1.00 26.06  ? 89  GLN L CB  1 
ATOM   1620 C CG  . GLN B 2  88  ? 21.864 -5.291  26.721  1.00 24.87  ? 89  GLN L CG  1 
ATOM   1621 C CD  . GLN B 2  88  ? 21.495 -6.675  26.242  1.00 24.19  ? 89  GLN L CD  1 
ATOM   1622 O OE1 . GLN B 2  88  ? 22.357 -7.526  26.046  1.00 28.15  ? 89  GLN L OE1 1 
ATOM   1623 N NE2 . GLN B 2  88  ? 20.203 -6.913  26.069  1.00 25.20  ? 89  GLN L NE2 1 
ATOM   1624 N N   . GLN B 2  89  ? 23.246 -3.629  29.069  1.00 25.45  ? 90  GLN L N   1 
ATOM   1625 C CA  . GLN B 2  89  ? 23.523 -4.101  30.411  1.00 26.38  ? 90  GLN L CA  1 
ATOM   1626 C C   . GLN B 2  89  ? 23.243 -5.605  30.392  1.00 27.10  ? 90  GLN L C   1 
ATOM   1627 O O   . GLN B 2  89  ? 22.344 -6.078  29.689  1.00 25.87  ? 90  GLN L O   1 
ATOM   1628 C CB  . GLN B 2  89  ? 22.632 -3.405  31.423  1.00 24.29  ? 90  GLN L CB  1 
ATOM   1629 C CG  . GLN B 2  89  ? 21.169 -3.668  31.245  1.00 27.02  ? 90  GLN L CG  1 
ATOM   1630 C CD  . GLN B 2  89  ? 20.365 -2.975  32.310  1.00 29.32  ? 90  GLN L CD  1 
ATOM   1631 O OE1 . GLN B 2  89  ? 20.637 -3.131  33.503  1.00 32.97  ? 90  GLN L OE1 1 
ATOM   1632 N NE2 . GLN B 2  89  ? 19.372 -2.203  31.896  1.00 29.77  ? 90  GLN L NE2 1 
ATOM   1633 N N   . TRP B 2  90  ? 24.032 -6.347  31.158  1.00 26.74  ? 91  TRP L N   1 
ATOM   1634 C CA  . TRP B 2  90  ? 23.919 -7.795  31.220  1.00 24.43  ? 91  TRP L CA  1 
ATOM   1635 C C   . TRP B 2  90  ? 22.704 -8.306  31.987  1.00 25.34  ? 91  TRP L C   1 
ATOM   1636 O O   . TRP B 2  90  ? 22.264 -9.437  31.763  1.00 23.76  ? 91  TRP L O   1 
ATOM   1637 C CB  . TRP B 2  90  ? 25.191 -8.373  31.850  1.00 21.60  ? 91  TRP L CB  1 
ATOM   1638 C CG  . TRP B 2  90  ? 25.270 -8.213  33.346  1.00 22.49  ? 91  TRP L CG  1 
ATOM   1639 C CD1 . TRP B 2  90  ? 25.024 -7.070  34.076  1.00 23.92  ? 91  TRP L CD1 1 
ATOM   1640 C CD2 . TRP B 2  90  ? 25.599 -9.232  34.300  1.00 21.40  ? 91  TRP L CD2 1 
ATOM   1641 N NE1 . TRP B 2  90  ? 25.174 -7.325  35.423  1.00 22.69  ? 91  TRP L NE1 1 
ATOM   1642 C CE2 . TRP B 2  90  ? 25.529 -8.640  35.589  1.00 22.68  ? 91  TRP L CE2 1 
ATOM   1643 C CE3 . TRP B 2  90  ? 25.947 -10.590 34.193  1.00 23.95  ? 91  TRP L CE3 1 
ATOM   1644 C CZ2 . TRP B 2  90  ? 25.795 -9.363  36.765  1.00 23.21  ? 91  TRP L CZ2 1 
ATOM   1645 C CZ3 . TRP B 2  90  ? 26.212 -11.312 35.369  1.00 25.71  ? 91  TRP L CZ3 1 
ATOM   1646 C CH2 . TRP B 2  90  ? 26.133 -10.691 36.636  1.00 24.36  ? 91  TRP L CH2 1 
ATOM   1647 N N   . ASN B 2  91  ? 22.160 -7.465  32.868  1.00 26.43  ? 92  ASN L N   1 
ATOM   1648 C CA  . ASN B 2  91  ? 21.042 -7.840  33.730  1.00 26.30  ? 92  ASN L CA  1 
ATOM   1649 C C   . ASN B 2  91  ? 19.640 -7.307  33.432  1.00 26.42  ? 92  ASN L C   1 
ATOM   1650 O O   . ASN B 2  91  ? 19.453 -6.423  32.599  1.00 27.62  ? 92  ASN L O   1 
ATOM   1651 C CB  . ASN B 2  91  ? 21.418 -7.527  35.180  1.00 28.51  ? 92  ASN L CB  1 
ATOM   1652 C CG  . ASN B 2  91  ? 21.770 -6.068  35.396  1.00 31.63  ? 92  ASN L CG  1 
ATOM   1653 O OD1 . ASN B 2  91  ? 22.135 -5.359  34.459  1.00 35.52  ? 92  ASN L OD1 1 
ATOM   1654 N ND2 . ASN B 2  91  ? 21.677 -5.617  36.644  1.00 31.32  ? 92  ASN L ND2 1 
ATOM   1655 N N   . TYR B 2  92  ? 18.675 -7.864  34.167  1.00 29.48  ? 93  TYR L N   1 
ATOM   1656 C CA  . TYR B 2  92  ? 17.230 -7.613  34.058  1.00 34.22  ? 93  TYR L CA  1 
ATOM   1657 C C   . TYR B 2  92  ? 16.573 -6.588  33.136  1.00 40.68  ? 93  TYR L C   1 
ATOM   1658 O O   . TYR B 2  92  ? 15.683 -6.949  32.358  1.00 50.98  ? 93  TYR L O   1 
ATOM   1659 C CB  . TYR B 2  92  ? 16.592 -7.440  35.432  1.00 29.46  ? 93  TYR L CB  1 
ATOM   1660 C CG  . TYR B 2  92  ? 15.146 -6.966  35.350  1.00 27.40  ? 93  TYR L CG  1 
ATOM   1661 C CD1 . TYR B 2  92  ? 14.697 -5.923  36.150  1.00 27.05  ? 93  TYR L CD1 1 
ATOM   1662 C CD2 . TYR B 2  92  ? 14.226 -7.564  34.471  1.00 24.97  ? 93  TYR L CD2 1 
ATOM   1663 C CE1 . TYR B 2  92  ? 13.376 -5.483  36.085  1.00 26.29  ? 93  TYR L CE1 1 
ATOM   1664 C CE2 . TYR B 2  92  ? 12.895 -7.130  34.401  1.00 24.87  ? 93  TYR L CE2 1 
ATOM   1665 C CZ  . TYR B 2  92  ? 12.479 -6.090  35.217  1.00 25.93  ? 93  TYR L CZ  1 
ATOM   1666 O OH  . TYR B 2  92  ? 11.166 -5.666  35.205  1.00 26.46  ? 93  TYR L OH  1 
ATOM   1667 N N   . PRO B 2  93  ? 16.911 -5.303  33.236  1.00 35.73  ? 94  PRO L N   1 
ATOM   1668 C CA  . PRO B 2  93  ? 16.101 -4.608  32.223  1.00 31.67  ? 94  PRO L CA  1 
ATOM   1669 C C   . PRO B 2  93  ? 16.565 -4.911  30.790  1.00 27.53  ? 94  PRO L C   1 
ATOM   1670 O O   . PRO B 2  93  ? 15.803 -4.762  29.827  1.00 24.90  ? 94  PRO L O   1 
ATOM   1671 C CB  . PRO B 2  93  ? 16.242 -3.150  32.624  1.00 35.14  ? 94  PRO L CB  1 
ATOM   1672 C CG  . PRO B 2  93  ? 16.289 -3.262  34.103  1.00 36.07  ? 94  PRO L CG  1 
ATOM   1673 C CD  . PRO B 2  93  ? 17.256 -4.405  34.344  1.00 33.80  ? 94  PRO L CD  1 
ATOM   1674 N N   . PHE B 2  94  ? 17.814 -5.362  30.678  1.00 26.26  ? 96  PHE L N   1 
ATOM   1675 C CA  . PHE B 2  94  ? 18.439 -5.717  29.404  1.00 24.71  ? 96  PHE L CA  1 
ATOM   1676 C C   . PHE B 2  94  ? 18.374 -4.549  28.431  1.00 26.90  ? 96  PHE L C   1 
ATOM   1677 O O   . PHE B 2  94  ? 18.313 -4.740  27.214  1.00 27.06  ? 96  PHE L O   1 
ATOM   1678 C CB  . PHE B 2  94  ? 17.743 -6.951  28.811  1.00 22.36  ? 96  PHE L CB  1 
ATOM   1679 C CG  . PHE B 2  94  ? 17.592 -8.081  29.793  1.00 21.41  ? 96  PHE L CG  1 
ATOM   1680 C CD1 . PHE B 2  94  ? 18.709 -8.741  30.287  1.00 18.51  ? 96  PHE L CD1 1 
ATOM   1681 C CD2 . PHE B 2  94  ? 16.335 -8.424  30.294  1.00 19.28  ? 96  PHE L CD2 1 
ATOM   1682 C CE1 . PHE B 2  94  ? 18.581 -9.723  31.274  1.00 21.28  ? 96  PHE L CE1 1 
ATOM   1683 C CE2 . PHE B 2  94  ? 16.198 -9.409  31.288  1.00 18.34  ? 96  PHE L CE2 1 
ATOM   1684 C CZ  . PHE B 2  94  ? 17.319 -10.053 31.776  1.00 20.58  ? 96  PHE L CZ  1 
ATOM   1685 N N   . THR B 2  95  ? 18.391 -3.338  28.979  1.00 25.70  ? 97  THR L N   1 
ATOM   1686 C CA  . THR B 2  95  ? 18.328 -2.124  28.178  1.00 26.48  ? 97  THR L CA  1 
ATOM   1687 C C   . THR B 2  95  ? 19.525 -1.992  27.254  1.00 24.99  ? 97  THR L C   1 
ATOM   1688 O O   . THR B 2  95  ? 20.649 -2.272  27.652  1.00 25.32  ? 97  THR L O   1 
ATOM   1689 C CB  . THR B 2  95  ? 18.279 -0.873  29.079  1.00 28.50  ? 97  THR L CB  1 
ATOM   1690 O OG1 . THR B 2  95  ? 17.041 -0.859  29.797  1.00 31.93  ? 97  THR L OG1 1 
ATOM   1691 C CG2 . THR B 2  95  ? 18.402 0.403   28.252  1.00 26.89  ? 97  THR L CG2 1 
ATOM   1692 N N   . PHE B 2  96  ? 19.263 -1.573  26.019  1.00 28.03  ? 98  PHE L N   1 
ATOM   1693 C CA  . PHE B 2  96  ? 20.308 -1.351  25.024  1.00 27.41  ? 98  PHE L CA  1 
ATOM   1694 C C   . PHE B 2  96  ? 20.580 0.155   24.961  1.00 30.41  ? 98  PHE L C   1 
ATOM   1695 O O   . PHE B 2  96  ? 19.671 0.971   25.174  1.00 30.07  ? 98  PHE L O   1 
ATOM   1696 C CB  . PHE B 2  96  ? 19.866 -1.796  23.626  1.00 26.47  ? 98  PHE L CB  1 
ATOM   1697 C CG  . PHE B 2  96  ? 19.734 -3.283  23.456  1.00 23.35  ? 98  PHE L CG  1 
ATOM   1698 C CD1 . PHE B 2  96  ? 18.551 -3.932  23.786  1.00 23.60  ? 98  PHE L CD1 1 
ATOM   1699 C CD2 . PHE B 2  96  ? 20.791 -4.032  22.936  1.00 20.92  ? 98  PHE L CD2 1 
ATOM   1700 C CE1 . PHE B 2  96  ? 18.416 -5.314  23.595  1.00 24.32  ? 98  PHE L CE1 1 
ATOM   1701 C CE2 . PHE B 2  96  ? 20.668 -5.408  22.745  1.00 23.71  ? 98  PHE L CE2 1 
ATOM   1702 C CZ  . PHE B 2  96  ? 19.473 -6.050  23.076  1.00 23.02  ? 98  PHE L CZ  1 
ATOM   1703 N N   . GLY B 2  97  ? 21.825 0.523   24.675  1.00 31.08  ? 99  GLY L N   1 
ATOM   1704 C CA  . GLY B 2  97  ? 22.155 1.928   24.558  1.00 29.70  ? 99  GLY L CA  1 
ATOM   1705 C C   . GLY B 2  97  ? 21.492 2.433   23.291  1.00 30.70  ? 99  GLY L C   1 
ATOM   1706 O O   . GLY B 2  97  ? 21.005 1.625   22.492  1.00 31.04  ? 99  GLY L O   1 
ATOM   1707 N N   . GLY B 2  98  ? 21.463 3.750   23.098  1.00 31.02  ? 100 GLY L N   1 
ATOM   1708 C CA  . GLY B 2  98  ? 20.847 4.311   21.909  1.00 30.02  ? 100 GLY L CA  1 
ATOM   1709 C C   . GLY B 2  98  ? 21.528 3.898   20.613  1.00 32.05  ? 100 GLY L C   1 
ATOM   1710 O O   . GLY B 2  98  ? 20.978 4.063   19.527  1.00 32.54  ? 100 GLY L O   1 
ATOM   1711 N N   . GLY B 2  99  ? 22.736 3.363   20.722  1.00 33.85  ? 101 GLY L N   1 
ATOM   1712 C CA  . GLY B 2  99  ? 23.450 2.929   19.539  1.00 32.72  ? 101 GLY L CA  1 
ATOM   1713 C C   . GLY B 2  99  ? 24.353 4.001   18.970  1.00 34.22  ? 101 GLY L C   1 
ATOM   1714 O O   . GLY B 2  99  ? 24.072 5.197   19.097  1.00 32.15  ? 101 GLY L O   1 
ATOM   1715 N N   . THR B 2  100 ? 25.447 3.560   18.350  1.00 35.56  ? 102 THR L N   1 
ATOM   1716 C CA  . THR B 2  100 ? 26.414 4.455   17.728  1.00 33.21  ? 102 THR L CA  1 
ATOM   1717 C C   . THR B 2  100 ? 26.583 4.049   16.273  1.00 32.11  ? 102 THR L C   1 
ATOM   1718 O O   . THR B 2  100 ? 26.923 2.903   15.979  1.00 30.48  ? 102 THR L O   1 
ATOM   1719 C CB  . THR B 2  100 ? 27.786 4.360   18.402  1.00 32.62  ? 102 THR L CB  1 
ATOM   1720 O OG1 . THR B 2  100 ? 27.666 4.691   19.786  1.00 34.52  ? 102 THR L OG1 1 
ATOM   1721 C CG2 . THR B 2  100 ? 28.758 5.316   17.744  1.00 33.43  ? 102 THR L CG2 1 
ATOM   1722 N N   . LYS B 2  101 ? 26.334 4.975   15.356  1.00 33.93  ? 103 LYS L N   1 
ATOM   1723 C CA  . LYS B 2  101 ? 26.503 4.663   13.943  1.00 35.93  ? 103 LYS L CA  1 
ATOM   1724 C C   . LYS B 2  101 ? 27.925 5.016   13.536  1.00 35.49  ? 103 LYS L C   1 
ATOM   1725 O O   . LYS B 2  101 ? 28.324 6.179   13.559  1.00 34.98  ? 103 LYS L O   1 
ATOM   1726 C CB  . LYS B 2  101 ? 25.515 5.436   13.064  1.00 36.68  ? 103 LYS L CB  1 
ATOM   1727 C CG  . LYS B 2  101 ? 25.576 4.998   11.608  1.00 41.54  ? 103 LYS L CG  1 
ATOM   1728 C CD  . LYS B 2  101 ? 24.432 5.557   10.791  1.00 49.52  ? 103 LYS L CD  1 
ATOM   1729 C CE  . LYS B 2  101 ? 24.392 4.932   9.395   1.00 52.26  ? 103 LYS L CE  1 
ATOM   1730 N NZ  . LYS B 2  101 ? 23.200 5.388   8.603   1.00 53.51  ? 103 LYS L NZ  1 
ATOM   1731 N N   . LEU B 2  102 ? 28.693 4.001   13.172  1.00 34.31  ? 104 LEU L N   1 
ATOM   1732 C CA  . LEU B 2  102 ? 30.062 4.223   12.774  1.00 33.35  ? 104 LEU L CA  1 
ATOM   1733 C C   . LEU B 2  102 ? 30.148 4.152   11.271  1.00 33.74  ? 104 LEU L C   1 
ATOM   1734 O O   . LEU B 2  102 ? 29.792 3.139   10.669  1.00 31.25  ? 104 LEU L O   1 
ATOM   1735 C CB  . LEU B 2  102 ? 30.971 3.172   13.399  1.00 32.81  ? 104 LEU L CB  1 
ATOM   1736 C CG  . LEU B 2  102 ? 32.452 3.358   13.079  1.00 34.36  ? 104 LEU L CG  1 
ATOM   1737 C CD1 . LEU B 2  102 ? 32.944 4.715   13.599  1.00 34.05  ? 104 LEU L CD1 1 
ATOM   1738 C CD2 . LEU B 2  102 ? 33.227 2.216   13.707  1.00 33.85  ? 104 LEU L CD2 1 
ATOM   1739 N N   . GLU B 2  103 ? 30.605 5.243   10.665  1.00 36.54  ? 105 GLU L N   1 
ATOM   1740 C CA  . GLU B 2  103 ? 30.748 5.292   9.223   1.00 39.67  ? 105 GLU L CA  1 
ATOM   1741 C C   . GLU B 2  103 ? 32.161 5.648   8.834   1.00 38.21  ? 105 GLU L C   1 
ATOM   1742 O O   . GLU B 2  103 ? 32.942 6.113   9.658   1.00 38.43  ? 105 GLU L O   1 
ATOM   1743 C CB  . GLU B 2  103 ? 29.754 6.283   8.620   1.00 44.27  ? 105 GLU L CB  1 
ATOM   1744 C CG  . GLU B 2  103 ? 28.335 5.744   8.699   1.00 59.64  ? 105 GLU L CG  1 
ATOM   1745 C CD  . GLU B 2  103 ? 27.345 6.526   7.873   1.00 66.73  ? 105 GLU L CD  1 
ATOM   1746 O OE1 . GLU B 2  103 ? 27.094 7.706   8.206   1.00 75.03  ? 105 GLU L OE1 1 
ATOM   1747 O OE2 . GLU B 2  103 ? 26.816 5.957   6.891   1.00 69.07  ? 105 GLU L OE2 1 
ATOM   1748 N N   . ILE B 2  104 ? 32.486 5.400   7.572   1.00 38.95  ? 106 ILE L N   1 
ATOM   1749 C CA  . ILE B 2  104 ? 33.809 5.679   7.038   1.00 36.61  ? 106 ILE L CA  1 
ATOM   1750 C C   . ILE B 2  104 ? 33.951 7.122   6.591   1.00 36.34  ? 106 ILE L C   1 
ATOM   1751 O O   . ILE B 2  104 ? 33.186 7.587   5.742   1.00 36.05  ? 106 ILE L O   1 
ATOM   1752 C CB  . ILE B 2  104 ? 34.099 4.789   5.833   1.00 36.38  ? 106 ILE L CB  1 
ATOM   1753 C CG1 . ILE B 2  104 ? 33.952 3.323   6.233   1.00 37.59  ? 106 ILE L CG1 1 
ATOM   1754 C CG2 . ILE B 2  104 ? 35.492 5.073   5.303   1.00 35.77  ? 106 ILE L CG2 1 
ATOM   1755 C CD1 . ILE B 2  104 ? 34.023 2.376   5.059   1.00 42.81  ? 106 ILE L CD1 1 
ATOM   1756 N N   . LYS B 2  105 A 34.913 7.837   7.172   1.00 36.83  ? 106 LYS L N   1 
ATOM   1757 C CA  . LYS B 2  105 A 35.146 9.216   6.759   1.00 35.47  ? 106 LYS L CA  1 
ATOM   1758 C C   . LYS B 2  105 A 35.906 9.133   5.447   1.00 35.35  ? 106 LYS L C   1 
ATOM   1759 O O   . LYS B 2  105 A 36.700 8.216   5.216   1.00 35.60  ? 106 LYS L O   1 
ATOM   1760 C CB  . LYS B 2  105 A 35.967 10.009  7.778   1.00 37.77  ? 106 LYS L CB  1 
ATOM   1761 C CG  . LYS B 2  105 A 36.201 11.442  7.322   1.00 40.90  ? 106 LYS L CG  1 
ATOM   1762 C CD  . LYS B 2  105 A 37.023 12.249  8.308   1.00 46.84  ? 106 LYS L CD  1 
ATOM   1763 C CE  . LYS B 2  105 A 36.233 12.595  9.560   1.00 52.17  ? 106 LYS L CE  1 
ATOM   1764 N NZ  . LYS B 2  105 A 37.026 13.489  10.463  1.00 56.85  ? 106 LYS L NZ  1 
ATOM   1765 N N   . ARG B 2  106 ? 35.659 10.095  4.582   1.00 33.48  ? 107 ARG L N   1 
ATOM   1766 C CA  . ARG B 2  106 ? 36.279 10.086  3.282   1.00 32.58  ? 107 ARG L CA  1 
ATOM   1767 C C   . ARG B 2  106 ? 36.348 11.533  2.833   1.00 32.56  ? 107 ARG L C   1 
ATOM   1768 O O   . ARG B 2  106 ? 35.846 12.417  3.524   1.00 31.91  ? 107 ARG L O   1 
ATOM   1769 C CB  . ARG B 2  106 ? 35.401 9.235   2.365   1.00 35.35  ? 107 ARG L CB  1 
ATOM   1770 C CG  . ARG B 2  106 ? 35.562 9.468   0.904   1.00 41.29  ? 107 ARG L CG  1 
ATOM   1771 C CD  . ARG B 2  106 ? 34.201 9.597   0.257   1.00 36.59  ? 107 ARG L CD  1 
ATOM   1772 N NE  . ARG B 2  106 ? 34.296 9.367   -1.181  1.00 39.74  ? 107 ARG L NE  1 
ATOM   1773 C CZ  . ARG B 2  106 ? 34.879 10.193  -2.041  1.00 43.89  ? 107 ARG L CZ  1 
ATOM   1774 N NH1 . ARG B 2  106 ? 35.426 11.323  -1.620  1.00 44.88  ? 107 ARG L NH1 1 
ATOM   1775 N NH2 . ARG B 2  106 ? 34.919 9.878   -3.328  1.00 51.73  ? 107 ARG L NH2 1 
ATOM   1776 N N   . ALA B 2  107 ? 36.985 11.782  1.696   1.00 33.92  ? 108 ALA L N   1 
ATOM   1777 C CA  . ALA B 2  107 ? 37.094 13.139  1.181   1.00 32.80  ? 108 ALA L CA  1 
ATOM   1778 C C   . ALA B 2  107 ? 35.736 13.632  0.688   1.00 31.44  ? 108 ALA L C   1 
ATOM   1779 O O   . ALA B 2  107 ? 34.934 12.865  0.138   1.00 27.06  ? 108 ALA L O   1 
ATOM   1780 C CB  . ALA B 2  107 ? 38.105 13.185  0.046   1.00 32.69  ? 108 ALA L CB  1 
ATOM   1781 N N   . ASP B 2  108 ? 35.480 14.917  0.901   1.00 32.03  ? 109 ASP L N   1 
ATOM   1782 C CA  . ASP B 2  108 ? 34.234 15.521  0.456   1.00 32.19  ? 109 ASP L CA  1 
ATOM   1783 C C   . ASP B 2  108 ? 34.034 15.284  -1.041  1.00 33.20  ? 109 ASP L C   1 
ATOM   1784 O O   . ASP B 2  108 ? 34.997 15.262  -1.817  1.00 34.45  ? 109 ASP L O   1 
ATOM   1785 C CB  . ASP B 2  108 ? 34.239 17.024  0.748   1.00 31.50  ? 109 ASP L CB  1 
ATOM   1786 C CG  . ASP B 2  108 ? 34.212 17.329  2.235   1.00 34.67  ? 109 ASP L CG  1 
ATOM   1787 O OD1 . ASP B 2  108 ? 34.015 16.395  3.043   1.00 35.80  ? 109 ASP L OD1 1 
ATOM   1788 O OD2 . ASP B 2  108 ? 34.375 18.511  2.600   1.00 38.36  ? 109 ASP L OD2 1 
ATOM   1789 N N   . ALA B 2  109 ? 32.778 15.081  -1.434  1.00 34.09  ? 110 ALA L N   1 
ATOM   1790 C CA  . ALA B 2  109 ? 32.415 14.850  -2.831  1.00 31.45  ? 110 ALA L CA  1 
ATOM   1791 C C   . ALA B 2  109 ? 31.095 15.565  -3.076  1.00 32.28  ? 110 ALA L C   1 
ATOM   1792 O O   . ALA B 2  109 ? 30.146 15.421  -2.298  1.00 32.20  ? 110 ALA L O   1 
ATOM   1793 C CB  . ALA B 2  109 ? 32.265 13.354  -3.116  1.00 29.54  ? 110 ALA L CB  1 
ATOM   1794 N N   . ALA B 2  110 ? 31.051 16.352  -4.147  1.00 32.39  ? 111 ALA L N   1 
ATOM   1795 C CA  . ALA B 2  110 ? 29.858 17.100  -4.498  1.00 29.86  ? 111 ALA L CA  1 
ATOM   1796 C C   . ALA B 2  110 ? 28.891 16.133  -5.139  1.00 27.89  ? 111 ALA L C   1 
ATOM   1797 O O   . ALA B 2  110 ? 29.305 15.184  -5.806  1.00 30.19  ? 111 ALA L O   1 
ATOM   1798 C CB  . ALA B 2  110 ? 30.206 18.225  -5.476  1.00 28.56  ? 111 ALA L CB  1 
ATOM   1799 N N   . PRO B 2  111 ? 27.585 16.350  -4.940  1.00 25.32  ? 112 PRO L N   1 
ATOM   1800 C CA  . PRO B 2  111 ? 26.620 15.437  -5.547  1.00 23.55  ? 112 PRO L CA  1 
ATOM   1801 C C   . PRO B 2  111 ? 26.470 15.640  -7.046  1.00 26.04  ? 112 PRO L C   1 
ATOM   1802 O O   . PRO B 2  111 ? 26.688 16.738  -7.560  1.00 28.33  ? 112 PRO L O   1 
ATOM   1803 C CB  . PRO B 2  111 ? 25.330 15.762  -4.802  1.00 20.81  ? 112 PRO L CB  1 
ATOM   1804 C CG  . PRO B 2  111 ? 25.476 17.223  -4.525  1.00 20.57  ? 112 PRO L CG  1 
ATOM   1805 C CD  . PRO B 2  111 ? 26.911 17.330  -4.068  1.00 20.72  ? 112 PRO L CD  1 
ATOM   1806 N N   . THR B 2  112 ? 26.121 14.563  -7.745  1.00 26.50  ? 113 THR L N   1 
ATOM   1807 C CA  . THR B 2  112 ? 25.860 14.624  -9.175  1.00 25.74  ? 113 THR L CA  1 
ATOM   1808 C C   . THR B 2  112 ? 24.333 14.678  -9.211  1.00 24.89  ? 113 THR L C   1 
ATOM   1809 O O   . THR B 2  112 ? 23.667 13.692  -8.899  1.00 24.37  ? 113 THR L O   1 
ATOM   1810 C CB  . THR B 2  112 ? 26.367 13.366  -9.899  1.00 25.80  ? 113 THR L CB  1 
ATOM   1811 O OG1 . THR B 2  112 ? 27.793 13.298  -9.779  1.00 31.06  ? 113 THR L OG1 1 
ATOM   1812 C CG2 . THR B 2  112 ? 26.002 13.403  -11.372 1.00 24.66  ? 113 THR L CG2 1 
ATOM   1813 N N   . VAL B 2  113 ? 23.793 15.844  -9.563  1.00 24.63  ? 114 VAL L N   1 
ATOM   1814 C CA  . VAL B 2  113 ? 22.348 16.069  -9.607  1.00 23.21  ? 114 VAL L CA  1 
ATOM   1815 C C   . VAL B 2  113 ? 21.713 15.816  -10.984 1.00 25.86  ? 114 VAL L C   1 
ATOM   1816 O O   . VAL B 2  113 ? 22.236 16.247  -12.015 1.00 26.72  ? 114 VAL L O   1 
ATOM   1817 C CB  . VAL B 2  113 ? 22.021 17.516  -9.166  1.00 21.38  ? 114 VAL L CB  1 
ATOM   1818 C CG1 . VAL B 2  113 ? 20.520 17.705  -9.030  1.00 21.74  ? 114 VAL L CG1 1 
ATOM   1819 C CG2 . VAL B 2  113 ? 22.715 17.826  -7.855  1.00 25.16  ? 114 VAL L CG2 1 
ATOM   1820 N N   . SER B 2  114 ? 20.582 15.113  -10.985 1.00 24.11  ? 115 SER L N   1 
ATOM   1821 C CA  . SER B 2  114 ? 19.854 14.794  -12.208 1.00 24.21  ? 115 SER L CA  1 
ATOM   1822 C C   . SER B 2  114 ? 18.363 14.964  -11.958 1.00 23.81  ? 115 SER L C   1 
ATOM   1823 O O   . SER B 2  114 ? 17.835 14.436  -10.988 1.00 21.35  ? 115 SER L O   1 
ATOM   1824 C CB  . SER B 2  114 ? 20.116 13.346  -12.638 1.00 26.45  ? 115 SER L CB  1 
ATOM   1825 O OG  . SER B 2  114 ? 21.438 13.174  -13.108 1.00 34.45  ? 115 SER L OG  1 
ATOM   1826 N N   . ILE B 2  115 ? 17.682 15.692  -12.837 1.00 23.90  ? 116 ILE L N   1 
ATOM   1827 C CA  . ILE B 2  115 ? 16.245 15.891  -12.684 1.00 22.25  ? 116 ILE L CA  1 
ATOM   1828 C C   . ILE B 2  115 ? 15.495 15.185  -13.821 1.00 21.42  ? 116 ILE L C   1 
ATOM   1829 O O   . ILE B 2  115 ? 15.992 15.102  -14.943 1.00 24.45  ? 116 ILE L O   1 
ATOM   1830 C CB  . ILE B 2  115 ? 15.917 17.402  -12.632 1.00 20.79  ? 116 ILE L CB  1 
ATOM   1831 C CG1 . ILE B 2  115 ? 14.457 17.600  -12.227 1.00 19.98  ? 116 ILE L CG1 1 
ATOM   1832 C CG2 . ILE B 2  115 ? 16.262 18.060  -13.963 1.00 20.93  ? 116 ILE L CG2 1 
ATOM   1833 C CD1 . ILE B 2  115 ? 14.121 19.023  -11.794 1.00 22.74  ? 116 ILE L CD1 1 
ATOM   1834 N N   . PHE B 2  116 ? 14.318 14.637  -13.521 1.00 22.08  ? 117 PHE L N   1 
ATOM   1835 C CA  . PHE B 2  116 ? 13.519 13.914  -14.520 1.00 23.12  ? 117 PHE L CA  1 
ATOM   1836 C C   . PHE B 2  116 ? 12.054 14.310  -14.481 1.00 25.08  ? 117 PHE L C   1 
ATOM   1837 O O   . PHE B 2  116 ? 11.447 14.372  -13.413 1.00 28.18  ? 117 PHE L O   1 
ATOM   1838 C CB  . PHE B 2  116 ? 13.617 12.399  -14.305 1.00 23.25  ? 117 PHE L CB  1 
ATOM   1839 C CG  . PHE B 2  116 ? 15.022 11.890  -14.245 1.00 22.79  ? 117 PHE L CG  1 
ATOM   1840 C CD1 . PHE B 2  116 ? 15.734 11.926  -13.053 1.00 22.45  ? 117 PHE L CD1 1 
ATOM   1841 C CD2 . PHE B 2  116 ? 15.655 11.435  -15.396 1.00 23.18  ? 117 PHE L CD2 1 
ATOM   1842 C CE1 . PHE B 2  116 ? 17.053 11.522  -13.012 1.00 24.18  ? 117 PHE L CE1 1 
ATOM   1843 C CE2 . PHE B 2  116 ? 16.977 11.030  -15.367 1.00 21.13  ? 117 PHE L CE2 1 
ATOM   1844 C CZ  . PHE B 2  116 ? 17.679 11.074  -14.174 1.00 21.41  ? 117 PHE L CZ  1 
ATOM   1845 N N   . PRO B 2  117 ? 11.465 14.584  -15.653 1.00 25.97  ? 118 PRO L N   1 
ATOM   1846 C CA  . PRO B 2  117 ? 10.059 14.977  -15.752 1.00 26.26  ? 118 PRO L CA  1 
ATOM   1847 C C   . PRO B 2  117 ? 9.146  13.763  -15.587 1.00 26.24  ? 118 PRO L C   1 
ATOM   1848 O O   . PRO B 2  117 ? 9.626  12.630  -15.552 1.00 26.03  ? 118 PRO L O   1 
ATOM   1849 C CB  . PRO B 2  117 ? 9.958  15.544  -17.172 1.00 24.71  ? 118 PRO L CB  1 
ATOM   1850 C CG  . PRO B 2  117 ? 11.369 15.838  -17.555 1.00 26.61  ? 118 PRO L CG  1 
ATOM   1851 C CD  . PRO B 2  117 ? 12.120 14.707  -16.963 1.00 25.53  ? 118 PRO L CD  1 
ATOM   1852 N N   . PRO B 2  118 ? 7.822  13.990  -15.449 1.00 26.01  ? 119 PRO L N   1 
ATOM   1853 C CA  . PRO B 2  118 ? 6.862  12.892  -15.308 1.00 24.60  ? 119 PRO L CA  1 
ATOM   1854 C C   . PRO B 2  118 ? 6.896  12.131  -16.623 1.00 24.73  ? 119 PRO L C   1 
ATOM   1855 O O   . PRO B 2  118 ? 6.994  12.743  -17.685 1.00 26.46  ? 119 PRO L O   1 
ATOM   1856 C CB  . PRO B 2  118 ? 5.530  13.619  -15.129 1.00 22.98  ? 119 PRO L CB  1 
ATOM   1857 C CG  . PRO B 2  118 ? 5.916  14.849  -14.410 1.00 22.56  ? 119 PRO L CG  1 
ATOM   1858 C CD  . PRO B 2  118 ? 7.179  15.278  -15.127 1.00 22.87  ? 119 PRO L CD  1 
ATOM   1859 N N   . SER B 2  119 ? 6.816  10.811  -16.574 1.00 26.59  ? 120 SER L N   1 
ATOM   1860 C CA  . SER B 2  119 ? 6.835  10.021  -17.806 1.00 27.05  ? 120 SER L CA  1 
ATOM   1861 C C   . SER B 2  119 ? 5.494  10.096  -18.548 1.00 27.56  ? 120 SER L C   1 
ATOM   1862 O O   . SER B 2  119 ? 4.485  10.511  -17.989 1.00 26.51  ? 120 SER L O   1 
ATOM   1863 C CB  . SER B 2  119 ? 7.148  8.558   -17.487 1.00 25.92  ? 120 SER L CB  1 
ATOM   1864 O OG  . SER B 2  119 ? 6.124  8.000   -16.683 1.00 26.74  ? 120 SER L OG  1 
ATOM   1865 N N   . SER B 2  120 ? 5.490  9.693   -19.813 1.00 29.57  ? 121 SER L N   1 
ATOM   1866 C CA  . SER B 2  120 ? 4.256  9.702   -20.589 1.00 32.38  ? 121 SER L CA  1 
ATOM   1867 C C   . SER B 2  120 ? 3.274  8.746   -19.939 1.00 32.85  ? 121 SER L C   1 
ATOM   1868 O O   . SER B 2  120 ? 2.085  9.049   -19.825 1.00 34.74  ? 121 SER L O   1 
ATOM   1869 C CB  . SER B 2  120 ? 4.509  9.235   -22.014 1.00 32.64  ? 121 SER L CB  1 
ATOM   1870 O OG  . SER B 2  120 ? 5.419  10.092  -22.666 1.00 50.17  ? 121 SER L OG  1 
ATOM   1871 N N   . GLU B 2  121 ? 3.781  7.590   -19.513 1.00 32.67  ? 122 GLU L N   1 
ATOM   1872 C CA  . GLU B 2  121 ? 2.941  6.577   -18.886 1.00 32.66  ? 122 GLU L CA  1 
ATOM   1873 C C   . GLU B 2  121 ? 2.241  7.098   -17.658 1.00 30.75  ? 122 GLU L C   1 
ATOM   1874 O O   . GLU B 2  121 ? 1.042  6.896   -17.500 1.00 30.67  ? 122 GLU L O   1 
ATOM   1875 C CB  . GLU B 2  121 ? 3.749  5.341   -18.491 1.00 33.39  ? 122 GLU L CB  1 
ATOM   1876 C CG  . GLU B 2  121 ? 4.353  4.592   -19.660 1.00 39.34  ? 122 GLU L CG  1 
ATOM   1877 C CD  . GLU B 2  121 ? 5.773  5.026   -19.966 1.00 44.37  ? 122 GLU L CD  1 
ATOM   1878 O OE1 . GLU B 2  121 ? 6.006  6.223   -20.265 1.00 45.20  ? 122 GLU L OE1 1 
ATOM   1879 O OE2 . GLU B 2  121 ? 6.664  4.155   -19.901 1.00 50.25  ? 122 GLU L OE2 1 
ATOM   1880 N N   . GLN B 2  122 ? 2.983  7.766   -16.782 1.00 29.77  ? 123 GLN L N   1 
ATOM   1881 C CA  . GLN B 2  122 ? 2.376  8.280   -15.564 1.00 27.55  ? 123 GLN L CA  1 
ATOM   1882 C C   . GLN B 2  122 ? 1.371  9.378   -15.848 1.00 27.58  ? 123 GLN L C   1 
ATOM   1883 O O   . GLN B 2  122 ? 0.310  9.439   -15.221 1.00 26.76  ? 123 GLN L O   1 
ATOM   1884 C CB  . GLN B 2  122 ? 3.429  8.813   -14.596 1.00 24.93  ? 123 GLN L CB  1 
ATOM   1885 C CG  . GLN B 2  122 ? 2.793  9.488   -13.400 1.00 25.05  ? 123 GLN L CG  1 
ATOM   1886 C CD  . GLN B 2  122 ? 3.795  9.892   -12.352 1.00 25.28  ? 123 GLN L CD  1 
ATOM   1887 O OE1 . GLN B 2  122 ? 4.860  10.427  -12.668 1.00 25.33  ? 123 GLN L OE1 1 
ATOM   1888 N NE2 . GLN B 2  122 ? 3.454  9.653   -11.088 1.00 23.83  ? 123 GLN L NE2 1 
ATOM   1889 N N   . LEU B 2  123 ? 1.711  10.255  -16.787 1.00 28.12  ? 124 LEU L N   1 
ATOM   1890 C CA  . LEU B 2  123 ? 0.817  11.351  -17.124 1.00 30.23  ? 124 LEU L CA  1 
ATOM   1891 C C   . LEU B 2  123 ? -0.488 10.833  -17.720 1.00 33.20  ? 124 LEU L C   1 
ATOM   1892 O O   . LEU B 2  123 ? -1.552 11.365  -17.410 1.00 34.75  ? 124 LEU L O   1 
ATOM   1893 C CB  . LEU B 2  123 ? 1.503  12.326  -18.086 1.00 28.39  ? 124 LEU L CB  1 
ATOM   1894 C CG  . LEU B 2  123 ? 2.569  13.242  -17.477 1.00 22.13  ? 124 LEU L CG  1 
ATOM   1895 C CD1 . LEU B 2  123 ? 3.449  13.799  -18.566 1.00 26.18  ? 124 LEU L CD1 1 
ATOM   1896 C CD2 . LEU B 2  123 ? 1.903  14.349  -16.687 1.00 21.29  ? 124 LEU L CD2 1 
ATOM   1897 N N   . THR B 2  124 ? -0.422 9.799   -18.561 1.00 36.34  ? 125 THR L N   1 
ATOM   1898 C CA  . THR B 2  124 ? -1.652 9.268   -19.138 1.00 39.10  ? 125 THR L CA  1 
ATOM   1899 C C   . THR B 2  124 ? -2.449 8.609   -18.017 1.00 39.32  ? 125 THR L C   1 
ATOM   1900 O O   . THR B 2  124 ? -3.650 8.383   -18.150 1.00 41.80  ? 125 THR L O   1 
ATOM   1901 C CB  . THR B 2  124 ? -1.395 8.229   -20.261 1.00 39.80  ? 125 THR L CB  1 
ATOM   1902 O OG1 . THR B 2  124 ? -0.795 7.061   -19.700 1.00 50.84  ? 125 THR L OG1 1 
ATOM   1903 C CG2 . THR B 2  124 ? -0.487 8.799   -21.336 1.00 34.64  ? 125 THR L CG2 1 
ATOM   1904 N N   . SER B 2  125 ? -1.773 8.318   -16.907 1.00 39.39  ? 126 SER L N   1 
ATOM   1905 C CA  . SER B 2  125 ? -2.405 7.702   -15.738 1.00 41.27  ? 126 SER L CA  1 
ATOM   1906 C C   . SER B 2  125 ? -3.099 8.777   -14.911 1.00 39.63  ? 126 SER L C   1 
ATOM   1907 O O   . SER B 2  125 ? -3.842 8.477   -13.976 1.00 38.96  ? 126 SER L O   1 
ATOM   1908 C CB  . SER B 2  125 ? -1.355 7.009   -14.861 1.00 46.00  ? 126 SER L CB  1 
ATOM   1909 O OG  . SER B 2  125 ? -0.641 6.029   -15.596 1.00 54.71  ? 126 SER L OG  1 
ATOM   1910 N N   . GLY B 2  126 ? -2.822 10.032  -15.250 1.00 38.02  ? 127 GLY L N   1 
ATOM   1911 C CA  . GLY B 2  126 ? -3.425 11.144  -14.547 1.00 34.57  ? 127 GLY L CA  1 
ATOM   1912 C C   . GLY B 2  126 ? -2.609 11.671  -13.383 1.00 34.80  ? 127 GLY L C   1 
ATOM   1913 O O   . GLY B 2  126 ? -3.099 12.504  -12.624 1.00 34.30  ? 127 GLY L O   1 
ATOM   1914 N N   . GLY B 2  127 ? -1.375 11.198  -13.227 1.00 34.01  ? 128 GLY L N   1 
ATOM   1915 C CA  . GLY B 2  127 ? -0.547 11.674  -12.129 1.00 30.77  ? 128 GLY L CA  1 
ATOM   1916 C C   . GLY B 2  127 ? 0.717  12.317  -12.656 1.00 28.59  ? 128 GLY L C   1 
ATOM   1917 O O   . GLY B 2  127 ? 0.968  12.295  -13.856 1.00 30.29  ? 128 GLY L O   1 
ATOM   1918 N N   . ALA B 2  128 ? 1.523  12.891  -11.774 1.00 26.33  ? 129 ALA L N   1 
ATOM   1919 C CA  . ALA B 2  128 ? 2.754  13.523  -12.219 1.00 25.10  ? 129 ALA L CA  1 
ATOM   1920 C C   . ALA B 2  128 ? 3.766  13.602  -11.079 1.00 26.52  ? 129 ALA L C   1 
ATOM   1921 O O   . ALA B 2  128 ? 3.517  14.243  -10.050 1.00 27.46  ? 129 ALA L O   1 
ATOM   1922 C CB  . ALA B 2  128 ? 2.460  14.925  -12.768 1.00 21.55  ? 129 ALA L CB  1 
ATOM   1923 N N   . SER B 2  129 ? 4.899  12.932  -11.267 1.00 24.93  ? 130 SER L N   1 
ATOM   1924 C CA  . SER B 2  129 ? 5.969  12.930  -10.281 1.00 23.84  ? 130 SER L CA  1 
ATOM   1925 C C   . SER B 2  129 ? 7.238  13.414  -10.946 1.00 22.96  ? 130 SER L C   1 
ATOM   1926 O O   . SER B 2  129 ? 7.592  12.972  -12.036 1.00 22.63  ? 130 SER L O   1 
ATOM   1927 C CB  . SER B 2  129 ? 6.209  11.525  -9.726  1.00 21.97  ? 130 SER L CB  1 
ATOM   1928 O OG  . SER B 2  129 ? 5.105  11.066  -8.974  1.00 26.41  ? 130 SER L OG  1 
ATOM   1929 N N   . VAL B 2  130 ? 7.917  14.340  -10.291 1.00 22.34  ? 131 VAL L N   1 
ATOM   1930 C CA  . VAL B 2  130 ? 9.162  14.848  -10.826 1.00 23.33  ? 131 VAL L CA  1 
ATOM   1931 C C   . VAL B 2  130 ? 10.232 14.268  -9.918  1.00 22.68  ? 131 VAL L C   1 
ATOM   1932 O O   . VAL B 2  130 ? 10.159 14.413  -8.700  1.00 21.70  ? 131 VAL L O   1 
ATOM   1933 C CB  . VAL B 2  130 ? 9.199  16.372  -10.784 1.00 22.72  ? 131 VAL L CB  1 
ATOM   1934 C CG1 . VAL B 2  130 ? 10.459 16.876  -11.495 1.00 21.63  ? 131 VAL L CG1 1 
ATOM   1935 C CG2 . VAL B 2  130 ? 7.927  16.927  -11.416 1.00 21.29  ? 131 VAL L CG2 1 
ATOM   1936 N N   . VAL B 2  131 ? 11.210 13.595  -10.508 1.00 21.69  ? 132 VAL L N   1 
ATOM   1937 C CA  . VAL B 2  131 ? 12.253 12.963  -9.722  1.00 23.58  ? 132 VAL L CA  1 
ATOM   1938 C C   . VAL B 2  131 ? 13.606 13.634  -9.849  1.00 26.38  ? 132 VAL L C   1 
ATOM   1939 O O   . VAL B 2  131 ? 13.989 14.098  -10.918 1.00 28.42  ? 132 VAL L O   1 
ATOM   1940 C CB  . VAL B 2  131 ? 12.410 11.471  -10.109 1.00 22.26  ? 132 VAL L CB  1 
ATOM   1941 C CG1 . VAL B 2  131 ? 13.523 10.830  -9.284  1.00 21.67  ? 132 VAL L CG1 1 
ATOM   1942 C CG2 . VAL B 2  131 ? 11.110 10.742  -9.876  1.00 22.21  ? 132 VAL L CG2 1 
ATOM   1943 N N   . CYS B 2  132 ? 14.331 13.665  -8.739  1.00 27.17  ? 133 CYS L N   1 
ATOM   1944 C CA  . CYS B 2  132 ? 15.653 14.253  -8.707  1.00 27.44  ? 133 CYS L CA  1 
ATOM   1945 C C   . CYS B 2  132 ? 16.618 13.351  -7.940  1.00 27.36  ? 133 CYS L C   1 
ATOM   1946 O O   . CYS B 2  132 ? 16.347 12.948  -6.811  1.00 27.82  ? 133 CYS L O   1 
ATOM   1947 C CB  . CYS B 2  132 ? 15.596 15.621  -8.043  1.00 30.16  ? 133 CYS L CB  1 
ATOM   1948 S SG  . CYS B 2  132 ? 17.180 16.503  -8.124  1.00 37.64  ? 133 CYS L SG  1 
ATOM   1949 N N   . PHE B 2  133 ? 17.736 13.019  -8.570  1.00 25.03  ? 134 PHE L N   1 
ATOM   1950 C CA  . PHE B 2  133 ? 18.747 12.195  -7.932  1.00 25.51  ? 134 PHE L CA  1 
ATOM   1951 C C   . PHE B 2  133 ? 19.935 13.076  -7.600  1.00 26.16  ? 134 PHE L C   1 
ATOM   1952 O O   . PHE B 2  133 ? 20.328 13.926  -8.392  1.00 27.66  ? 134 PHE L O   1 
ATOM   1953 C CB  . PHE B 2  133 ? 19.215 11.065  -8.858  1.00 23.64  ? 134 PHE L CB  1 
ATOM   1954 C CG  . PHE B 2  133 ? 18.173 10.003  -9.114  1.00 24.65  ? 134 PHE L CG  1 
ATOM   1955 C CD1 . PHE B 2  133 ? 17.532 9.362   -8.057  1.00 25.24  ? 134 PHE L CD1 1 
ATOM   1956 C CD2 . PHE B 2  133 ? 17.855 9.622   -10.414 1.00 26.26  ? 134 PHE L CD2 1 
ATOM   1957 C CE1 . PHE B 2  133 ? 16.589 8.356   -8.294  1.00 22.92  ? 134 PHE L CE1 1 
ATOM   1958 C CE2 . PHE B 2  133 ? 16.910 8.614   -10.663 1.00 25.19  ? 134 PHE L CE2 1 
ATOM   1959 C CZ  . PHE B 2  133 ? 16.278 7.982   -9.606  1.00 21.67  ? 134 PHE L CZ  1 
ATOM   1960 N N   . LEU B 2  134 ? 20.476 12.893  -6.405  1.00 26.49  ? 135 LEU L N   1 
ATOM   1961 C CA  . LEU B 2  134 ? 21.658 13.619  -5.962  1.00 26.32  ? 135 LEU L CA  1 
ATOM   1962 C C   . LEU B 2  134 ? 22.536 12.451  -5.539  1.00 26.95  ? 135 LEU L C   1 
ATOM   1963 O O   . LEU B 2  134 ? 22.417 11.937  -4.430  1.00 25.91  ? 135 LEU L O   1 
ATOM   1964 C CB  . LEU B 2  134 ? 21.341 14.525  -4.771  1.00 25.19  ? 135 LEU L CB  1 
ATOM   1965 C CG  . LEU B 2  134 ? 20.256 15.571  -5.029  1.00 27.96  ? 135 LEU L CG  1 
ATOM   1966 C CD1 . LEU B 2  134 ? 18.892 14.947  -4.849  1.00 30.06  ? 135 LEU L CD1 1 
ATOM   1967 C CD2 . LEU B 2  134 ? 20.407 16.704  -4.054  1.00 28.04  ? 135 LEU L CD2 1 
ATOM   1968 N N   . ASN B 2  135 ? 23.402 12.013  -6.442  1.00 27.08  ? 136 ASN L N   1 
ATOM   1969 C CA  . ASN B 2  135 ? 24.230 10.860  -6.155  1.00 26.54  ? 136 ASN L CA  1 
ATOM   1970 C C   . ASN B 2  135 ? 25.697 11.067  -5.818  1.00 29.35  ? 136 ASN L C   1 
ATOM   1971 O O   . ASN B 2  135 ? 26.316 12.080  -6.154  1.00 28.89  ? 136 ASN L O   1 
ATOM   1972 C CB  . ASN B 2  135 ? 24.142 9.863   -7.314  1.00 27.45  ? 136 ASN L CB  1 
ATOM   1973 C CG  . ASN B 2  135 ? 22.733 9.337   -7.532  1.00 29.47  ? 136 ASN L CG  1 
ATOM   1974 O OD1 . ASN B 2  135 ? 21.956 9.189   -6.583  1.00 29.65  ? 136 ASN L OD1 1 
ATOM   1975 N ND2 . ASN B 2  135 ? 22.403 9.032   -8.787  1.00 26.75  ? 136 ASN L ND2 1 
ATOM   1976 N N   . ASN B 2  136 ? 26.226 10.058  -5.131  1.00 30.91  ? 137 ASN L N   1 
ATOM   1977 C CA  . ASN B 2  136 ? 27.620 9.978   -4.738  1.00 29.11  ? 137 ASN L CA  1 
ATOM   1978 C C   . ASN B 2  136 ? 28.239 11.234  -4.165  1.00 27.74  ? 137 ASN L C   1 
ATOM   1979 O O   . ASN B 2  136 ? 29.141 11.816  -4.757  1.00 31.61  ? 137 ASN L O   1 
ATOM   1980 C CB  . ASN B 2  136 ? 28.423 9.502   -5.944  1.00 29.70  ? 137 ASN L CB  1 
ATOM   1981 C CG  . ASN B 2  136 ? 27.851 8.237   -6.550  1.00 28.91  ? 137 ASN L CG  1 
ATOM   1982 O OD1 . ASN B 2  136 ? 28.021 7.151   -6.011  1.00 35.03  ? 137 ASN L OD1 1 
ATOM   1983 N ND2 . ASN B 2  136 ? 27.153 8.377   -7.669  1.00 30.15  ? 137 ASN L ND2 1 
ATOM   1984 N N   . PHE B 2  137 ? 27.764 11.649  -3.003  1.00 27.79  ? 138 PHE L N   1 
ATOM   1985 C CA  . PHE B 2  137 ? 28.311 12.827  -2.354  1.00 27.04  ? 138 PHE L CA  1 
ATOM   1986 C C   . PHE B 2  137 ? 28.766 12.469  -0.941  1.00 28.58  ? 138 PHE L C   1 
ATOM   1987 O O   . PHE B 2  137 ? 28.346 11.456  -0.382  1.00 29.04  ? 138 PHE L O   1 
ATOM   1988 C CB  . PHE B 2  137 ? 27.256 13.947  -2.323  1.00 27.13  ? 138 PHE L CB  1 
ATOM   1989 C CG  . PHE B 2  137 ? 25.961 13.558  -1.651  1.00 26.56  ? 138 PHE L CG  1 
ATOM   1990 C CD1 . PHE B 2  137 ? 25.799 13.704  -0.270  1.00 24.35  ? 138 PHE L CD1 1 
ATOM   1991 C CD2 . PHE B 2  137 ? 24.905 13.031  -2.395  1.00 26.21  ? 138 PHE L CD2 1 
ATOM   1992 C CE1 . PHE B 2  137 ? 24.605 13.330  0.364   1.00 23.84  ? 138 PHE L CE1 1 
ATOM   1993 C CE2 . PHE B 2  137 ? 23.708 12.654  -1.772  1.00 25.60  ? 138 PHE L CE2 1 
ATOM   1994 C CZ  . PHE B 2  137 ? 23.560 12.806  -0.388  1.00 26.36  ? 138 PHE L CZ  1 
ATOM   1995 N N   . TYR B 2  138 ? 29.643 13.291  -0.381  1.00 29.47  ? 139 TYR L N   1 
ATOM   1996 C CA  . TYR B 2  138 ? 30.136 13.100  0.979   1.00 29.47  ? 139 TYR L CA  1 
ATOM   1997 C C   . TYR B 2  138 ? 30.564 14.474  1.502   1.00 30.13  ? 139 TYR L C   1 
ATOM   1998 O O   . TYR B 2  138 ? 31.195 15.241  0.769   1.00 30.15  ? 139 TYR L O   1 
ATOM   1999 C CB  . TYR B 2  138 ? 31.332 12.148  1.005   1.00 29.52  ? 139 TYR L CB  1 
ATOM   2000 C CG  . TYR B 2  138 ? 31.725 11.817  2.421   1.00 31.83  ? 139 TYR L CG  1 
ATOM   2001 C CD1 . TYR B 2  138 ? 31.188 10.707  3.072   1.00 32.86  ? 139 TYR L CD1 1 
ATOM   2002 C CD2 . TYR B 2  138 ? 32.535 12.681  3.154   1.00 31.98  ? 139 TYR L CD2 1 
ATOM   2003 C CE1 . TYR B 2  138 ? 31.441 10.475  4.428   1.00 36.03  ? 139 TYR L CE1 1 
ATOM   2004 C CE2 . TYR B 2  138 ? 32.793 12.462  4.509   1.00 33.94  ? 139 TYR L CE2 1 
ATOM   2005 C CZ  . TYR B 2  138 ? 32.241 11.361  5.140   1.00 34.99  ? 139 TYR L CZ  1 
ATOM   2006 O OH  . TYR B 2  138 ? 32.459 11.168  6.484   1.00 35.98  ? 139 TYR L OH  1 
ATOM   2007 N N   . PRO B 2  139 ? 30.226 14.815  2.762   1.00 30.33  ? 140 PRO L N   1 
ATOM   2008 C CA  . PRO B 2  139 ? 29.481 14.078  3.793   1.00 31.13  ? 140 PRO L CA  1 
ATOM   2009 C C   . PRO B 2  139 ? 27.989 13.865  3.517   1.00 33.28  ? 140 PRO L C   1 
ATOM   2010 O O   . PRO B 2  139 ? 27.471 14.285  2.488   1.00 30.90  ? 140 PRO L O   1 
ATOM   2011 C CB  . PRO B 2  139 ? 29.727 14.907  5.053   1.00 29.26  ? 140 PRO L CB  1 
ATOM   2012 C CG  . PRO B 2  139 ? 29.833 16.293  4.519   1.00 28.84  ? 140 PRO L CG  1 
ATOM   2013 C CD  . PRO B 2  139 ? 30.712 16.098  3.303   1.00 30.98  ? 140 PRO L CD  1 
ATOM   2014 N N   . LYS B 2  140 ? 27.302 13.224  4.458   1.00 34.98  ? 141 LYS L N   1 
ATOM   2015 C CA  . LYS B 2  140 ? 25.887 12.913  4.304   1.00 36.11  ? 141 LYS L CA  1 
ATOM   2016 C C   . LYS B 2  140 ? 24.927 14.093  4.346   1.00 35.16  ? 141 LYS L C   1 
ATOM   2017 O O   . LYS B 2  140 ? 23.877 14.057  3.705   1.00 35.73  ? 141 LYS L O   1 
ATOM   2018 C CB  . LYS B 2  140 ? 25.452 11.877  5.350   1.00 39.13  ? 141 LYS L CB  1 
ATOM   2019 C CG  . LYS B 2  140 ? 23.980 11.479  5.213   1.00 48.06  ? 141 LYS L CG  1 
ATOM   2020 C CD  . LYS B 2  140 ? 23.692 10.056  5.682   1.00 54.07  ? 141 LYS L CD  1 
ATOM   2021 C CE  . LYS B 2  140 ? 22.279 9.634   5.275   1.00 56.38  ? 141 LYS L CE  1 
ATOM   2022 N NZ  . LYS B 2  140 ? 22.059 8.167   5.428   1.00 60.55  ? 141 LYS L NZ  1 
ATOM   2023 N N   . ASP B 2  141 ? 25.270 15.128  5.101   1.00 33.69  ? 142 ASP L N   1 
ATOM   2024 C CA  . ASP B 2  141 ? 24.409 16.301  5.208   1.00 35.49  ? 142 ASP L CA  1 
ATOM   2025 C C   . ASP B 2  141 ? 24.177 16.946  3.851   1.00 33.93  ? 142 ASP L C   1 
ATOM   2026 O O   . ASP B 2  141 ? 25.124 17.259  3.129   1.00 36.67  ? 142 ASP L O   1 
ATOM   2027 C CB  . ASP B 2  141 ? 25.039 17.315  6.151   1.00 42.08  ? 142 ASP L CB  1 
ATOM   2028 C CG  . ASP B 2  141 ? 25.380 16.708  7.490   1.00 49.60  ? 142 ASP L CG  1 
ATOM   2029 O OD1 . ASP B 2  141 ? 24.459 16.579  8.330   1.00 51.18  ? 142 ASP L OD1 1 
ATOM   2030 O OD2 . ASP B 2  141 ? 26.564 16.339  7.684   1.00 53.56  ? 142 ASP L OD2 1 
ATOM   2031 N N   . ILE B 2  142 ? 22.914 17.145  3.499   1.00 31.76  ? 143 ILE L N   1 
ATOM   2032 C CA  . ILE B 2  142 ? 22.599 17.755  2.215   1.00 30.63  ? 143 ILE L CA  1 
ATOM   2033 C C   . ILE B 2  142 ? 21.179 18.290  2.251   1.00 31.83  ? 143 ILE L C   1 
ATOM   2034 O O   . ILE B 2  142 ? 20.314 17.710  2.898   1.00 30.33  ? 143 ILE L O   1 
ATOM   2035 C CB  . ILE B 2  142 ? 22.754 16.725  1.075   1.00 29.81  ? 143 ILE L CB  1 
ATOM   2036 C CG1 . ILE B 2  142 ? 22.673 17.422  -0.287  1.00 29.09  ? 143 ILE L CG1 1 
ATOM   2037 C CG2 . ILE B 2  142 ? 21.710 15.631  1.224   1.00 29.24  ? 143 ILE L CG2 1 
ATOM   2038 C CD1 . ILE B 2  142 ? 22.975 16.502  -1.451  1.00 28.23  ? 143 ILE L CD1 1 
ATOM   2039 N N   . ASN B 2  143 ? 20.953 19.413  1.577   1.00 35.50  ? 144 ASN L N   1 
ATOM   2040 C CA  . ASN B 2  143 ? 19.630 20.022  1.533   1.00 36.40  ? 144 ASN L CA  1 
ATOM   2041 C C   . ASN B 2  143 ? 19.093 20.081  0.103   1.00 36.40  ? 144 ASN L C   1 
ATOM   2042 O O   . ASN B 2  143 ? 19.782 20.543  -0.807  1.00 36.98  ? 144 ASN L O   1 
ATOM   2043 C CB  . ASN B 2  143 ? 19.681 21.437  2.107   1.00 40.26  ? 144 ASN L CB  1 
ATOM   2044 C CG  . ASN B 2  143 ? 18.336 22.144  2.025   1.00 48.03  ? 144 ASN L CG  1 
ATOM   2045 O OD1 . ASN B 2  143 ? 17.366 21.717  2.655   1.00 52.43  ? 144 ASN L OD1 1 
ATOM   2046 N ND2 . ASN B 2  143 ? 18.267 23.224  1.238   1.00 48.59  ? 144 ASN L ND2 1 
ATOM   2047 N N   . VAL B 2  144 ? 17.871 19.596  -0.099  1.00 34.59  ? 145 VAL L N   1 
ATOM   2048 C CA  . VAL B 2  144 ? 17.259 19.634  -1.420  1.00 32.93  ? 145 VAL L CA  1 
ATOM   2049 C C   . VAL B 2  144 ? 16.030 20.539  -1.349  1.00 32.45  ? 145 VAL L C   1 
ATOM   2050 O O   . VAL B 2  144 ? 15.165 20.388  -0.480  1.00 32.31  ? 145 VAL L O   1 
ATOM   2051 C CB  . VAL B 2  144 ? 16.841 18.228  -1.907  1.00 34.49  ? 145 VAL L CB  1 
ATOM   2052 C CG1 . VAL B 2  144 ? 15.813 17.635  -0.962  1.00 40.88  ? 145 VAL L CG1 1 
ATOM   2053 C CG2 . VAL B 2  144 ? 16.270 18.310  -3.319  1.00 34.94  ? 145 VAL L CG2 1 
ATOM   2054 N N   . LYS B 2  145 ? 15.970 21.494  -2.265  1.00 31.16  ? 146 LYS L N   1 
ATOM   2055 C CA  . LYS B 2  145 ? 14.868 22.439  -2.317  1.00 30.29  ? 146 LYS L CA  1 
ATOM   2056 C C   . LYS B 2  145 ? 14.270 22.405  -3.713  1.00 29.01  ? 146 LYS L C   1 
ATOM   2057 O O   . LYS B 2  145 ? 14.994 22.481  -4.703  1.00 29.09  ? 146 LYS L O   1 
ATOM   2058 C CB  . LYS B 2  145 ? 15.395 23.838  -1.998  1.00 31.11  ? 146 LYS L CB  1 
ATOM   2059 C CG  . LYS B 2  145 ? 14.385 24.967  -2.059  1.00 35.48  ? 146 LYS L CG  1 
ATOM   2060 C CD  . LYS B 2  145 ? 15.066 26.279  -1.672  1.00 38.88  ? 146 LYS L CD  1 
ATOM   2061 C CE  . LYS B 2  145 ? 14.104 27.450  -1.692  1.00 45.22  ? 146 LYS L CE  1 
ATOM   2062 N NZ  . LYS B 2  145 ? 14.756 28.724  -1.283  1.00 48.75  ? 146 LYS L NZ  1 
ATOM   2063 N N   . TRP B 2  146 ? 12.951 22.262  -3.792  1.00 26.58  ? 147 TRP L N   1 
ATOM   2064 C CA  . TRP B 2  146 ? 12.272 22.253  -5.073  1.00 24.87  ? 147 TRP L CA  1 
ATOM   2065 C C   . TRP B 2  146 ? 11.660 23.611  -5.358  1.00 25.31  ? 147 TRP L C   1 
ATOM   2066 O O   . TRP B 2  146 ? 11.222 24.316  -4.449  1.00 26.45  ? 147 TRP L O   1 
ATOM   2067 C CB  . TRP B 2  146 ? 11.152 21.218  -5.101  1.00 23.93  ? 147 TRP L CB  1 
ATOM   2068 C CG  . TRP B 2  146 ? 11.608 19.815  -5.224  1.00 24.57  ? 147 TRP L CG  1 
ATOM   2069 C CD1 . TRP B 2  146 ? 11.871 18.947  -4.207  1.00 24.57  ? 147 TRP L CD1 1 
ATOM   2070 C CD2 . TRP B 2  146 ? 11.796 19.083  -6.440  1.00 24.18  ? 147 TRP L CD2 1 
ATOM   2071 N NE1 . TRP B 2  146 ? 12.198 17.713  -4.713  1.00 25.69  ? 147 TRP L NE1 1 
ATOM   2072 C CE2 . TRP B 2  146 ? 12.160 17.767  -6.081  1.00 22.04  ? 147 TRP L CE2 1 
ATOM   2073 C CE3 . TRP B 2  146 ? 11.688 19.413  -7.802  1.00 25.49  ? 147 TRP L CE3 1 
ATOM   2074 C CZ2 . TRP B 2  146 ? 12.418 16.774  -7.032  1.00 20.34  ? 147 TRP L CZ2 1 
ATOM   2075 C CZ3 . TRP B 2  146 ? 11.945 18.424  -8.751  1.00 23.36  ? 147 TRP L CZ3 1 
ATOM   2076 C CH2 . TRP B 2  146 ? 12.305 17.118  -8.357  1.00 23.27  ? 147 TRP L CH2 1 
ATOM   2077 N N   . LYS B 2  147 ? 11.629 23.966  -6.632  1.00 24.38  ? 148 LYS L N   1 
ATOM   2078 C CA  . LYS B 2  147 ? 11.040 25.221  -7.069  1.00 26.54  ? 148 LYS L CA  1 
ATOM   2079 C C   . LYS B 2  147 ? 10.220 24.995  -8.341  1.00 27.30  ? 148 LYS L C   1 
ATOM   2080 O O   . LYS B 2  147 ? 10.669 24.327  -9.275  1.00 28.38  ? 148 LYS L O   1 
ATOM   2081 C CB  . LYS B 2  147 ? 12.134 26.253  -7.353  1.00 27.09  ? 148 LYS L CB  1 
ATOM   2082 C CG  . LYS B 2  147 ? 12.802 26.827  -6.119  1.00 30.34  ? 148 LYS L CG  1 
ATOM   2083 C CD  . LYS B 2  147 ? 13.939 27.754  -6.509  1.00 35.49  ? 148 LYS L CD  1 
ATOM   2084 C CE  . LYS B 2  147 ? 14.648 28.299  -5.279  1.00 36.37  ? 148 LYS L CE  1 
ATOM   2085 N NZ  . LYS B 2  147 ? 15.864 29.076  -5.639  1.00 40.11  ? 148 LYS L NZ  1 
ATOM   2086 N N   . ILE B 2  148 ? 9.008  25.531  -8.373  1.00 26.56  ? 149 ILE L N   1 
ATOM   2087 C CA  . ILE B 2  148 ? 8.165  25.418  -9.562  1.00 24.81  ? 149 ILE L CA  1 
ATOM   2088 C C   . ILE B 2  148 ? 8.036  26.846  -10.060 1.00 27.18  ? 149 ILE L C   1 
ATOM   2089 O O   . ILE B 2  148 ? 7.618  27.737  -9.315  1.00 25.59  ? 149 ILE L O   1 
ATOM   2090 C CB  . ILE B 2  148 ? 6.777  24.846  -9.233  1.00 23.95  ? 149 ILE L CB  1 
ATOM   2091 C CG1 . ILE B 2  148 ? 6.927  23.406  -8.735  1.00 22.47  ? 149 ILE L CG1 1 
ATOM   2092 C CG2 . ILE B 2  148 ? 5.887  24.909  -10.468 1.00 20.42  ? 149 ILE L CG2 1 
ATOM   2093 C CD1 . ILE B 2  148 ? 5.668  22.820  -8.131  1.00 23.69  ? 149 ILE L CD1 1 
ATOM   2094 N N   . ASP B 2  149 ? 8.412  27.066  -11.314 1.00 30.29  ? 150 ASP L N   1 
ATOM   2095 C CA  . ASP B 2  149 ? 8.393  28.408  -11.887 1.00 32.93  ? 150 ASP L CA  1 
ATOM   2096 C C   . ASP B 2  149 ? 9.053  29.385  -10.917 1.00 34.88  ? 150 ASP L C   1 
ATOM   2097 O O   . ASP B 2  149 ? 8.569  30.500  -10.725 1.00 38.57  ? 150 ASP L O   1 
ATOM   2098 C CB  . ASP B 2  149 ? 6.965  28.877  -12.191 1.00 31.80  ? 150 ASP L CB  1 
ATOM   2099 C CG  . ASP B 2  149 ? 6.398  28.249  -13.447 1.00 30.99  ? 150 ASP L CG  1 
ATOM   2100 O OD1 . ASP B 2  149 ? 7.181  27.973  -14.384 1.00 31.88  ? 150 ASP L OD1 1 
ATOM   2101 O OD2 . ASP B 2  149 ? 5.165  28.051  -13.500 1.00 33.68  ? 150 ASP L OD2 1 
ATOM   2102 N N   . GLY B 2  150 ? 10.142 28.947  -10.289 1.00 34.96  ? 151 GLY L N   1 
ATOM   2103 C CA  . GLY B 2  150 ? 10.867 29.800  -9.364  1.00 37.68  ? 151 GLY L CA  1 
ATOM   2104 C C   . GLY B 2  150 ? 10.415 29.894  -7.911  1.00 40.61  ? 151 GLY L C   1 
ATOM   2105 O O   . GLY B 2  150 ? 11.149 30.437  -7.089  1.00 44.12  ? 151 GLY L O   1 
ATOM   2106 N N   . SER B 2  151 ? 9.233  29.389  -7.572  1.00 39.13  ? 152 SER L N   1 
ATOM   2107 C CA  . SER B 2  151 ? 8.769  29.463  -6.189  1.00 38.68  ? 152 SER L CA  1 
ATOM   2108 C C   . SER B 2  151 ? 8.955  28.136  -5.464  1.00 38.37  ? 152 SER L C   1 
ATOM   2109 O O   . SER B 2  151 ? 8.572  27.083  -5.974  1.00 37.51  ? 152 SER L O   1 
ATOM   2110 C CB  . SER B 2  151 ? 7.299  29.876  -6.153  1.00 41.83  ? 152 SER L CB  1 
ATOM   2111 O OG  . SER B 2  151 ? 7.132  31.182  -6.683  1.00 47.68  ? 152 SER L OG  1 
ATOM   2112 N N   . GLU B 2  152 ? 9.536  28.188  -4.268  1.00 39.10  ? 153 GLU L N   1 
ATOM   2113 C CA  . GLU B 2  152 ? 9.785  26.973  -3.497  1.00 40.64  ? 153 GLU L CA  1 
ATOM   2114 C C   . GLU B 2  152 ? 8.545  26.155  -3.183  1.00 37.75  ? 153 GLU L C   1 
ATOM   2115 O O   . GLU B 2  152 ? 7.525  26.680  -2.757  1.00 37.04  ? 153 GLU L O   1 
ATOM   2116 C CB  . GLU B 2  152 ? 10.522 27.281  -2.188  1.00 45.20  ? 153 GLU L CB  1 
ATOM   2117 C CG  . GLU B 2  152 ? 10.463 26.116  -1.197  1.00 53.50  ? 153 GLU L CG  1 
ATOM   2118 C CD  . GLU B 2  152 ? 11.568 26.142  -0.160  1.00 59.56  ? 153 GLU L CD  1 
ATOM   2119 O OE1 . GLU B 2  152 ? 11.790 27.213  0.445   1.00 64.47  ? 153 GLU L OE1 1 
ATOM   2120 O OE2 . GLU B 2  152 ? 12.207 25.086  0.053   1.00 62.78  ? 153 GLU L OE2 1 
ATOM   2121 N N   . ARG B 2  153 ? 8.668  24.851  -3.381  1.00 35.87  ? 154 ARG L N   1 
ATOM   2122 C CA  . ARG B 2  153 ? 7.580  23.920  -3.145  1.00 37.37  ? 154 ARG L CA  1 
ATOM   2123 C C   . ARG B 2  153 ? 8.020  22.874  -2.133  1.00 38.92  ? 154 ARG L C   1 
ATOM   2124 O O   . ARG B 2  153 ? 8.943  22.099  -2.388  1.00 37.18  ? 154 ARG L O   1 
ATOM   2125 C CB  . ARG B 2  153 ? 7.188  23.257  -4.468  1.00 37.23  ? 154 ARG L CB  1 
ATOM   2126 C CG  . ARG B 2  153 ? 6.111  22.207  -4.369  1.00 37.18  ? 154 ARG L CG  1 
ATOM   2127 C CD  . ARG B 2  153 ? 4.854  22.761  -3.739  1.00 40.08  ? 154 ARG L CD  1 
ATOM   2128 N NE  . ARG B 2  153 ? 3.698  21.982  -4.157  1.00 44.84  ? 154 ARG L NE  1 
ATOM   2129 C CZ  . ARG B 2  153 ? 2.862  22.342  -5.126  1.00 44.79  ? 154 ARG L CZ  1 
ATOM   2130 N NH1 . ARG B 2  153 ? 3.036  23.485  -5.781  1.00 44.25  ? 154 ARG L NH1 1 
ATOM   2131 N NH2 . ARG B 2  153 ? 1.862  21.541  -5.453  1.00 47.62  ? 154 ARG L NH2 1 
ATOM   2132 N N   . GLN B 2  154 ? 7.360  22.848  -0.980  1.00 42.98  ? 155 GLN L N   1 
ATOM   2133 C CA  . GLN B 2  154 ? 7.733  21.888  0.042   1.00 46.77  ? 155 GLN L CA  1 
ATOM   2134 C C   . GLN B 2  154 ? 6.743  20.754  0.244   1.00 44.52  ? 155 GLN L C   1 
ATOM   2135 O O   . GLN B 2  154 ? 7.126  19.664  0.669   1.00 47.17  ? 155 GLN L O   1 
ATOM   2136 C CB  . GLN B 2  154 ? 7.992  22.594  1.366   1.00 50.07  ? 155 GLN L CB  1 
ATOM   2137 C CG  . GLN B 2  154 ? 8.901  21.775  2.267   1.00 63.71  ? 155 GLN L CG  1 
ATOM   2138 C CD  . GLN B 2  154 ? 9.449  22.573  3.429   1.00 70.51  ? 155 GLN L CD  1 
ATOM   2139 O OE1 . GLN B 2  154 ? 8.705  22.969  4.330   1.00 75.95  ? 155 GLN L OE1 1 
ATOM   2140 N NE2 . GLN B 2  154 ? 10.759 22.820  3.414   1.00 71.46  ? 155 GLN L NE2 1 
ATOM   2141 N N   . ASN B 2  155 ? 5.475  20.998  -0.060  1.00 41.00  ? 156 ASN L N   1 
ATOM   2142 C CA  . ASN B 2  155 ? 4.472  19.953  0.087   1.00 40.77  ? 156 ASN L CA  1 
ATOM   2143 C C   . ASN B 2  155 ? 4.524  18.985  -1.101  1.00 37.07  ? 156 ASN L C   1 
ATOM   2144 O O   . ASN B 2  155 ? 4.797  19.389  -2.232  1.00 35.21  ? 156 ASN L O   1 
ATOM   2145 C CB  . ASN B 2  155 ? 3.077  20.573  0.196   1.00 48.00  ? 156 ASN L CB  1 
ATOM   2146 C CG  . ASN B 2  155 ? 2.919  21.443  1.435   1.00 55.82  ? 156 ASN L CG  1 
ATOM   2147 O OD1 . ASN B 2  155 ? 3.159  20.996  2.564   1.00 59.96  ? 156 ASN L OD1 1 
ATOM   2148 N ND2 . ASN B 2  155 ? 2.510  22.692  1.231   1.00 59.44  ? 156 ASN L ND2 1 
ATOM   2149 N N   . GLY B 2  156 ? 4.270  17.706  -0.840  1.00 32.37  ? 157 GLY L N   1 
ATOM   2150 C CA  . GLY B 2  156 ? 4.292  16.720  -1.906  1.00 29.51  ? 157 GLY L CA  1 
ATOM   2151 C C   . GLY B 2  156 ? 5.670  16.159  -2.221  1.00 31.04  ? 157 GLY L C   1 
ATOM   2152 O O   . GLY B 2  156 ? 5.831  15.394  -3.176  1.00 32.29  ? 157 GLY L O   1 
ATOM   2153 N N   . VAL B 2  157 ? 6.665  16.531  -1.421  1.00 29.92  ? 158 VAL L N   1 
ATOM   2154 C CA  . VAL B 2  157 ? 8.038  16.062  -1.615  1.00 28.54  ? 158 VAL L CA  1 
ATOM   2155 C C   . VAL B 2  157 ? 8.397  14.900  -0.686  1.00 27.77  ? 158 VAL L C   1 
ATOM   2156 O O   . VAL B 2  157 ? 8.213  14.991  0.527   1.00 27.10  ? 158 VAL L O   1 
ATOM   2157 C CB  . VAL B 2  157 ? 9.057  17.201  -1.354  1.00 27.04  ? 158 VAL L CB  1 
ATOM   2158 C CG1 . VAL B 2  157 ? 10.469 16.681  -1.528  1.00 22.61  ? 158 VAL L CG1 1 
ATOM   2159 C CG2 . VAL B 2  157 ? 8.798  18.371  -2.296  1.00 25.94  ? 158 VAL L CG2 1 
ATOM   2160 N N   . LEU B 2  158 ? 8.908  13.813  -1.260  1.00 27.55  ? 159 LEU L N   1 
ATOM   2161 C CA  . LEU B 2  158 ? 9.334  12.647  -0.482  1.00 28.38  ? 159 LEU L CA  1 
ATOM   2162 C C   . LEU B 2  158 ? 10.784 12.335  -0.824  1.00 28.29  ? 159 LEU L C   1 
ATOM   2163 O O   . LEU B 2  158 ? 11.153 12.279  -2.002  1.00 26.92  ? 159 LEU L O   1 
ATOM   2164 C CB  . LEU B 2  158 ? 8.467  11.422  -0.790  1.00 27.82  ? 159 LEU L CB  1 
ATOM   2165 C CG  . LEU B 2  158 ? 7.037  11.436  -0.252  1.00 29.99  ? 159 LEU L CG  1 
ATOM   2166 C CD1 . LEU B 2  158 ? 6.272  10.224  -0.777  1.00 29.66  ? 159 LEU L CD1 1 
ATOM   2167 C CD2 . LEU B 2  158 ? 7.078  11.455  1.260   1.00 26.83  ? 159 LEU L CD2 1 
ATOM   2168 N N   . ASN B 2  159 ? 11.594 12.129  0.214   1.00 30.66  ? 160 ASN L N   1 
ATOM   2169 C CA  . ASN B 2  159 ? 13.020 11.838  0.064   1.00 28.88  ? 160 ASN L CA  1 
ATOM   2170 C C   . ASN B 2  159 ? 13.420 10.455  0.568   1.00 30.30  ? 160 ASN L C   1 
ATOM   2171 O O   . ASN B 2  159 ? 12.792 9.891   1.462   1.00 30.55  ? 160 ASN L O   1 
ATOM   2172 C CB  . ASN B 2  159 ? 13.846 12.879  0.814   1.00 25.71  ? 160 ASN L CB  1 
ATOM   2173 C CG  . ASN B 2  159 ? 13.536 14.286  0.376   1.00 26.49  ? 160 ASN L CG  1 
ATOM   2174 O OD1 . ASN B 2  159 ? 13.498 14.577  -0.814  1.00 26.78  ? 160 ASN L OD1 1 
ATOM   2175 N ND2 . ASN B 2  159 ? 13.322 15.172  1.338   1.00 26.45  ? 160 ASN L ND2 1 
ATOM   2176 N N   . SER B 2  160 ? 14.491 9.924   -0.003  1.00 30.53  ? 161 SER L N   1 
ATOM   2177 C CA  . SER B 2  160 ? 15.001 8.616   0.372   1.00 28.90  ? 161 SER L CA  1 
ATOM   2178 C C   . SER B 2  160 ? 16.532 8.672   0.249   1.00 30.34  ? 161 SER L C   1 
ATOM   2179 O O   . SER B 2  160 ? 17.062 9.272   -0.688  1.00 27.27  ? 161 SER L O   1 
ATOM   2180 C CB  . SER B 2  160 ? 14.414 7.569   -0.571  1.00 25.71  ? 161 SER L CB  1 
ATOM   2181 O OG  . SER B 2  160 ? 14.807 6.273   -0.199  1.00 33.48  ? 161 SER L OG  1 
ATOM   2182 N N   . TRP B 2  161 ? 17.238 8.069   1.202   1.00 32.03  ? 162 TRP L N   1 
ATOM   2183 C CA  . TRP B 2  161 ? 18.701 8.064   1.189   1.00 32.65  ? 162 TRP L CA  1 
ATOM   2184 C C   . TRP B 2  161 ? 19.232 6.643   1.137   1.00 34.57  ? 162 TRP L C   1 
ATOM   2185 O O   . TRP B 2  161 ? 18.588 5.724   1.626   1.00 37.60  ? 162 TRP L O   1 
ATOM   2186 C CB  . TRP B 2  161 ? 19.251 8.711   2.458   1.00 30.07  ? 162 TRP L CB  1 
ATOM   2187 C CG  . TRP B 2  161 ? 18.934 10.150  2.623   1.00 34.59  ? 162 TRP L CG  1 
ATOM   2188 C CD1 . TRP B 2  161 ? 19.786 11.207  2.443   1.00 37.17  ? 162 TRP L CD1 1 
ATOM   2189 C CD2 . TRP B 2  161 ? 17.674 10.708  3.014   1.00 37.85  ? 162 TRP L CD2 1 
ATOM   2190 N NE1 . TRP B 2  161 ? 19.130 12.391  2.700   1.00 39.96  ? 162 TRP L NE1 1 
ATOM   2191 C CE2 . TRP B 2  161 ? 17.833 12.114  3.051   1.00 38.03  ? 162 TRP L CE2 1 
ATOM   2192 C CE3 . TRP B 2  161 ? 16.426 10.157  3.340   1.00 40.54  ? 162 TRP L CE3 1 
ATOM   2193 C CZ2 . TRP B 2  161 ? 16.789 12.976  3.398   1.00 39.69  ? 162 TRP L CZ2 1 
ATOM   2194 C CZ3 . TRP B 2  161 ? 15.388 11.016  3.689   1.00 41.28  ? 162 TRP L CZ3 1 
ATOM   2195 C CH2 . TRP B 2  161 ? 15.578 12.411  3.714   1.00 43.71  ? 162 TRP L CH2 1 
ATOM   2196 N N   . THR B 2  162 ? 20.403 6.456   0.541   1.00 35.67  ? 163 THR L N   1 
ATOM   2197 C CA  . THR B 2  162 ? 21.015 5.133   0.500   1.00 35.36  ? 163 THR L CA  1 
ATOM   2198 C C   . THR B 2  162 ? 22.016 5.122   1.660   1.00 36.45  ? 163 THR L C   1 
ATOM   2199 O O   . THR B 2  162 ? 22.312 6.175   2.237   1.00 34.33  ? 163 THR L O   1 
ATOM   2200 C CB  . THR B 2  162 ? 21.791 4.872   -0.826  1.00 34.29  ? 163 THR L CB  1 
ATOM   2201 O OG1 . THR B 2  162 ? 22.757 5.910   -1.025  1.00 36.06  ? 163 THR L OG1 1 
ATOM   2202 C CG2 . THR B 2  162 ? 20.848 4.810   -2.022  1.00 29.97  ? 163 THR L CG2 1 
ATOM   2203 N N   . ASP B 2  163 ? 22.509 3.942   2.025   1.00 39.51  ? 164 ASP L N   1 
ATOM   2204 C CA  . ASP B 2  163 ? 23.505 3.842   3.092   1.00 41.75  ? 164 ASP L CA  1 
ATOM   2205 C C   . ASP B 2  163 ? 24.847 4.078   2.422   1.00 40.75  ? 164 ASP L C   1 
ATOM   2206 O O   . ASP B 2  163 ? 24.928 4.082   1.191   1.00 42.47  ? 164 ASP L O   1 
ATOM   2207 C CB  . ASP B 2  163 ? 23.502 2.446   3.729   1.00 47.52  ? 164 ASP L CB  1 
ATOM   2208 C CG  . ASP B 2  163 ? 22.379 2.260   4.745   1.00 54.18  ? 164 ASP L CG  1 
ATOM   2209 O OD1 . ASP B 2  163 ? 22.256 3.099   5.671   1.00 56.89  ? 164 ASP L OD1 1 
ATOM   2210 O OD2 . ASP B 2  163 ? 21.627 1.268   4.623   1.00 57.88  ? 164 ASP L OD2 1 
ATOM   2211 N N   . GLN B 2  164 ? 25.899 4.273   3.209   1.00 37.74  ? 165 GLN L N   1 
ATOM   2212 C CA  . GLN B 2  164 ? 27.209 4.489   2.619   1.00 36.85  ? 165 GLN L CA  1 
ATOM   2213 C C   . GLN B 2  164 ? 27.492 3.452   1.559   1.00 37.48  ? 165 GLN L C   1 
ATOM   2214 O O   . GLN B 2  164 ? 27.275 2.254   1.767   1.00 36.93  ? 165 GLN L O   1 
ATOM   2215 C CB  . GLN B 2  164 ? 28.311 4.421   3.664   1.00 38.93  ? 165 GLN L CB  1 
ATOM   2216 C CG  . GLN B 2  164 ? 28.796 5.769   4.105   1.00 39.00  ? 165 GLN L CG  1 
ATOM   2217 C CD  . GLN B 2  164 ? 30.223 5.725   4.554   1.00 36.94  ? 165 GLN L CD  1 
ATOM   2218 O OE1 . GLN B 2  164 ? 30.592 4.882   5.361   1.00 40.39  ? 165 GLN L OE1 1 
ATOM   2219 N NE2 . GLN B 2  164 ? 31.041 6.634   4.039   1.00 34.24  ? 165 GLN L NE2 1 
ATOM   2220 N N   . ASP B 2  165 ? 27.983 3.920   0.420   1.00 39.16  ? 166 ASP L N   1 
ATOM   2221 C CA  . ASP B 2  165 ? 28.288 3.026   -0.673  1.00 42.43  ? 166 ASP L CA  1 
ATOM   2222 C C   . ASP B 2  165 ? 29.458 2.119   -0.308  1.00 43.97  ? 166 ASP L C   1 
ATOM   2223 O O   . ASP B 2  165 ? 30.429 2.547   0.327   1.00 43.66  ? 166 ASP L O   1 
ATOM   2224 C CB  . ASP B 2  165 ? 28.609 3.824   -1.930  1.00 44.40  ? 166 ASP L CB  1 
ATOM   2225 C CG  . ASP B 2  165 ? 28.631 2.960   -3.172  1.00 49.85  ? 166 ASP L CG  1 
ATOM   2226 O OD1 . ASP B 2  165 ? 29.593 2.177   -3.345  1.00 53.91  ? 166 ASP L OD1 1 
ATOM   2227 O OD2 . ASP B 2  165 ? 27.675 3.059   -3.971  1.00 54.91  ? 166 ASP L OD2 1 
ATOM   2228 N N   . SER B 2  166 ? 29.342 0.859   -0.713  1.00 45.68  ? 167 SER L N   1 
ATOM   2229 C CA  . SER B 2  166 ? 30.355 -0.155  -0.459  1.00 47.26  ? 167 SER L CA  1 
ATOM   2230 C C   . SER B 2  166 ? 31.684 0.184   -1.116  1.00 48.56  ? 167 SER L C   1 
ATOM   2231 O O   . SER B 2  166 ? 32.741 0.121   -0.479  1.00 49.45  ? 167 SER L O   1 
ATOM   2232 C CB  . SER B 2  166 ? 29.873 -1.506  -0.984  1.00 47.63  ? 167 SER L CB  1 
ATOM   2233 O OG  . SER B 2  166 ? 30.925 -2.448  -0.965  1.00 57.34  ? 167 SER L OG  1 
ATOM   2234 N N   . LYS B 2  167 ? 31.625 0.543   -2.394  1.00 46.36  ? 168 LYS L N   1 
ATOM   2235 C CA  . LYS B 2  167 ? 32.825 0.869   -3.140  1.00 45.79  ? 168 LYS L CA  1 
ATOM   2236 C C   . LYS B 2  167 ? 33.477 2.220   -2.826  1.00 43.96  ? 168 LYS L C   1 
ATOM   2237 O O   . LYS B 2  167 ? 34.662 2.265   -2.490  1.00 45.62  ? 168 LYS L O   1 
ATOM   2238 C CB  . LYS B 2  167 ? 32.548 0.769   -4.647  1.00 49.49  ? 168 LYS L CB  1 
ATOM   2239 C CG  . LYS B 2  167 ? 32.210 -0.644  -5.121  1.00 56.64  ? 168 LYS L CG  1 
ATOM   2240 C CD  . LYS B 2  167 ? 32.424 -0.830  -6.631  1.00 60.04  ? 168 LYS L CD  1 
ATOM   2241 C CE  . LYS B 2  167 ? 32.274 -2.308  -7.030  1.00 63.28  ? 168 LYS L CE  1 
ATOM   2242 N NZ  . LYS B 2  167 ? 32.785 -2.618  -8.402  1.00 63.45  ? 168 LYS L NZ  1 
ATOM   2243 N N   . ASP B 2  168 ? 32.721 3.315   -2.901  1.00 38.68  ? 169 ASP L N   1 
ATOM   2244 C CA  . ASP B 2  168 ? 33.319 4.627   -2.672  1.00 35.40  ? 169 ASP L CA  1 
ATOM   2245 C C   . ASP B 2  168 ? 32.969 5.409   -1.413  1.00 34.19  ? 169 ASP L C   1 
ATOM   2246 O O   . ASP B 2  168 ? 33.325 6.583   -1.306  1.00 36.07  ? 169 ASP L O   1 
ATOM   2247 C CB  . ASP B 2  168 ? 33.057 5.523   -3.881  1.00 38.71  ? 169 ASP L CB  1 
ATOM   2248 C CG  . ASP B 2  168 ? 31.594 5.874   -4.035  1.00 41.74  ? 169 ASP L CG  1 
ATOM   2249 O OD1 . ASP B 2  168 ? 30.790 5.449   -3.182  1.00 41.85  ? 169 ASP L OD1 1 
ATOM   2250 O OD2 . ASP B 2  168 ? 31.249 6.579   -5.007  1.00 44.47  ? 169 ASP L OD2 1 
ATOM   2251 N N   . SER B 2  169 ? 32.280 4.788   -0.466  1.00 30.29  ? 170 SER L N   1 
ATOM   2252 C CA  . SER B 2  169 ? 31.930 5.481   0.772   1.00 29.92  ? 170 SER L CA  1 
ATOM   2253 C C   . SER B 2  169 ? 31.110 6.777   0.647   1.00 28.03  ? 170 SER L C   1 
ATOM   2254 O O   . SER B 2  169 ? 31.132 7.615   1.559   1.00 26.68  ? 170 SER L O   1 
ATOM   2255 C CB  . SER B 2  169 ? 33.198 5.789   1.570   1.00 29.93  ? 170 SER L CB  1 
ATOM   2256 O OG  . SER B 2  169 ? 33.824 4.592   1.979   1.00 35.45  ? 170 SER L OG  1 
ATOM   2257 N N   . THR B 2  170 ? 30.393 6.955   -0.462  1.00 27.95  ? 171 THR L N   1 
ATOM   2258 C CA  . THR B 2  170 ? 29.568 8.155   -0.624  1.00 28.09  ? 171 THR L CA  1 
ATOM   2259 C C   . THR B 2  170 ? 28.112 7.817   -0.324  1.00 27.97  ? 171 THR L C   1 
ATOM   2260 O O   . THR B 2  170 ? 27.770 6.657   -0.111  1.00 28.96  ? 171 THR L O   1 
ATOM   2261 C CB  . THR B 2  170 ? 29.627 8.733   -2.061  1.00 25.52  ? 171 THR L CB  1 
ATOM   2262 O OG1 . THR B 2  170 ? 29.270 7.715   -3.000  1.00 28.06  ? 171 THR L OG1 1 
ATOM   2263 C CG2 . THR B 2  170 ? 31.022 9.270   -2.385  1.00 27.80  ? 171 THR L CG2 1 
ATOM   2264 N N   . TYR B 2  171 ? 27.272 8.846   -0.300  1.00 28.40  ? 172 TYR L N   1 
ATOM   2265 C CA  . TYR B 2  171 ? 25.841 8.704   -0.060  1.00 28.09  ? 172 TYR L CA  1 
ATOM   2266 C C   . TYR B 2  171 ? 25.119 9.174   -1.304  1.00 27.84  ? 172 TYR L C   1 
ATOM   2267 O O   . TYR B 2  171 ? 25.650 9.961   -2.081  1.00 27.75  ? 172 TYR L O   1 
ATOM   2268 C CB  . TYR B 2  171 ? 25.388 9.591   1.090   1.00 31.18  ? 172 TYR L CB  1 
ATOM   2269 C CG  . TYR B 2  171 ? 26.052 9.292   2.402   1.00 36.07  ? 172 TYR L CG  1 
ATOM   2270 C CD1 . TYR B 2  171 ? 25.618 8.236   3.204   1.00 35.46  ? 172 TYR L CD1 1 
ATOM   2271 C CD2 . TYR B 2  171 ? 27.127 10.061  2.841   1.00 36.70  ? 172 TYR L CD2 1 
ATOM   2272 C CE1 . TYR B 2  171 ? 26.244 7.959   4.419   1.00 37.41  ? 172 TYR L CE1 1 
ATOM   2273 C CE2 . TYR B 2  171 ? 27.758 9.791   4.044   1.00 37.23  ? 172 TYR L CE2 1 
ATOM   2274 C CZ  . TYR B 2  171 ? 27.313 8.743   4.826   1.00 35.93  ? 172 TYR L CZ  1 
ATOM   2275 O OH  . TYR B 2  171 ? 27.960 8.485   6.006   1.00 38.78  ? 172 TYR L OH  1 
ATOM   2276 N N   . SER B 2  172 ? 23.901 8.687   -1.484  1.00 27.87  ? 173 SER L N   1 
ATOM   2277 C CA  . SER B 2  172 ? 23.076 9.081   -2.610  1.00 26.63  ? 173 SER L CA  1 
ATOM   2278 C C   . SER B 2  172 ? 21.697 9.396   -2.066  1.00 27.18  ? 173 SER L C   1 
ATOM   2279 O O   . SER B 2  172 ? 21.287 8.862   -1.030  1.00 26.90  ? 173 SER L O   1 
ATOM   2280 C CB  . SER B 2  172 ? 22.983 7.968   -3.647  1.00 29.46  ? 173 SER L CB  1 
ATOM   2281 O OG  . SER B 2  172 ? 24.166 7.907   -4.421  1.00 34.16  ? 173 SER L OG  1 
ATOM   2282 N N   . MET B 2  173 ? 20.986 10.281  -2.753  1.00 26.65  ? 174 MET L N   1 
ATOM   2283 C CA  . MET B 2  173 ? 19.662 10.664  -2.313  1.00 26.65  ? 174 MET L CA  1 
ATOM   2284 C C   . MET B 2  173 ? 18.732 10.873  -3.488  1.00 27.33  ? 174 MET L C   1 
ATOM   2285 O O   . MET B 2  173 ? 19.142 11.306  -4.559  1.00 26.59  ? 174 MET L O   1 
ATOM   2286 C CB  . MET B 2  173 ? 19.722 11.943  -1.487  1.00 27.10  ? 174 MET L CB  1 
ATOM   2287 C CG  . MET B 2  173 ? 18.360 12.452  -1.101  1.00 27.78  ? 174 MET L CG  1 
ATOM   2288 S SD  . MET B 2  173 ? 18.476 14.128  -0.549  1.00 34.36  ? 174 MET L SD  1 
ATOM   2289 C CE  . MET B 2  173 ? 16.816 14.446  -0.068  1.00 33.51  ? 174 MET L CE  1 
ATOM   2290 N N   . SER B 2  174 ? 17.467 10.564  -3.261  1.00 27.25  ? 175 SER L N   1 
ATOM   2291 C CA  . SER B 2  174 ? 16.438 10.697  -4.268  1.00 23.45  ? 175 SER L CA  1 
ATOM   2292 C C   . SER B 2  174 ? 15.325 11.520  -3.678  1.00 24.45  ? 175 SER L C   1 
ATOM   2293 O O   . SER B 2  174 ? 14.882 11.255  -2.564  1.00 26.45  ? 175 SER L O   1 
ATOM   2294 C CB  . SER B 2  174 ? 15.905 9.320   -4.641  1.00 22.93  ? 175 SER L CB  1 
ATOM   2295 O OG  . SER B 2  174 ? 14.673 9.417   -5.324  1.00 31.73  ? 175 SER L OG  1 
ATOM   2296 N N   . SER B 2  175 ? 14.884 12.529  -4.417  1.00 25.27  ? 176 SER L N   1 
ATOM   2297 C CA  . SER B 2  175 ? 13.786 13.381  -3.971  1.00 23.79  ? 176 SER L CA  1 
ATOM   2298 C C   . SER B 2  175 ? 12.701 13.357  -5.039  1.00 22.36  ? 176 SER L C   1 
ATOM   2299 O O   . SER B 2  175 ? 12.979 13.518  -6.223  1.00 25.07  ? 176 SER L O   1 
ATOM   2300 C CB  . SER B 2  175 ? 14.267 14.812  -3.758  1.00 23.94  ? 176 SER L CB  1 
ATOM   2301 O OG  . SER B 2  175 ? 13.225 15.606  -3.232  1.00 25.51  ? 176 SER L OG  1 
ATOM   2302 N N   . THR B 2  176 ? 11.464 13.135  -4.635  1.00 22.67  ? 177 THR L N   1 
ATOM   2303 C CA  . THR B 2  176 ? 10.389 13.105  -5.610  1.00 23.60  ? 177 THR L CA  1 
ATOM   2304 C C   . THR B 2  176 ? 9.296  14.099  -5.281  1.00 23.15  ? 177 THR L C   1 
ATOM   2305 O O   . THR B 2  176 ? 8.739  14.085  -4.183  1.00 25.55  ? 177 THR L O   1 
ATOM   2306 C CB  . THR B 2  176 ? 9.756  11.701  -5.714  1.00 24.69  ? 177 THR L CB  1 
ATOM   2307 O OG1 . THR B 2  176 ? 10.761 10.754  -6.094  1.00 29.32  ? 177 THR L OG1 1 
ATOM   2308 C CG2 . THR B 2  176 ? 8.652  11.689  -6.766  1.00 23.09  ? 177 THR L CG2 1 
ATOM   2309 N N   . LEU B 2  177 ? 9.005  14.977  -6.231  1.00 22.05  ? 178 LEU L N   1 
ATOM   2310 C CA  . LEU B 2  177 ? 7.949  15.951  -6.044  1.00 21.95  ? 178 LEU L CA  1 
ATOM   2311 C C   . LEU B 2  177 ? 6.739  15.411  -6.801  1.00 21.77  ? 178 LEU L C   1 
ATOM   2312 O O   . LEU B 2  177 ? 6.797  15.211  -8.016  1.00 23.49  ? 178 LEU L O   1 
ATOM   2313 C CB  . LEU B 2  177 ? 8.372  17.316  -6.602  1.00 19.68  ? 178 LEU L CB  1 
ATOM   2314 C CG  . LEU B 2  177 ? 7.274  18.385  -6.633  1.00 24.49  ? 178 LEU L CG  1 
ATOM   2315 C CD1 . LEU B 2  177 ? 6.797  18.704  -5.220  1.00 22.32  ? 178 LEU L CD1 1 
ATOM   2316 C CD2 . LEU B 2  177 ? 7.813  19.634  -7.308  1.00 25.20  ? 178 LEU L CD2 1 
ATOM   2317 N N   . THR B 2  178 ? 5.655  15.143  -6.085  1.00 20.92  ? 179 THR L N   1 
ATOM   2318 C CA  . THR B 2  178 ? 4.462  14.624  -6.733  1.00 23.88  ? 179 THR L CA  1 
ATOM   2319 C C   . THR B 2  178 ? 3.386  15.698  -6.690  1.00 24.88  ? 179 THR L C   1 
ATOM   2320 O O   . THR B 2  178 ? 3.161  16.332  -5.659  1.00 24.94  ? 179 THR L O   1 
ATOM   2321 C CB  . THR B 2  178 ? 3.925  13.319  -6.044  1.00 26.95  ? 179 THR L CB  1 
ATOM   2322 O OG1 . THR B 2  178 ? 4.933  12.296  -6.069  1.00 27.40  ? 179 THR L OG1 1 
ATOM   2323 C CG2 . THR B 2  178 ? 2.696  12.790  -6.779  1.00 24.22  ? 179 THR L CG2 1 
ATOM   2324 N N   . LEU B 2  179 ? 2.734  15.915  -7.826  1.00 28.31  ? 180 LEU L N   1 
ATOM   2325 C CA  . LEU B 2  179 ? 1.673  16.909  -7.924  1.00 27.11  ? 180 LEU L CA  1 
ATOM   2326 C C   . LEU B 2  179 ? 0.633  16.365  -8.882  1.00 26.61  ? 180 LEU L C   1 
ATOM   2327 O O   . LEU B 2  179 ? 0.860  15.332  -9.515  1.00 25.38  ? 180 LEU L O   1 
ATOM   2328 C CB  . LEU B 2  179 ? 2.237  18.257  -8.407  1.00 30.11  ? 180 LEU L CB  1 
ATOM   2329 C CG  . LEU B 2  179 ? 3.085  18.400  -9.677  1.00 31.87  ? 180 LEU L CG  1 
ATOM   2330 C CD1 . LEU B 2  179 ? 3.676  19.809  -9.711  1.00 31.71  ? 180 LEU L CD1 1 
ATOM   2331 C CD2 . LEU B 2  179 ? 4.214  17.389  -9.701  1.00 35.80  ? 180 LEU L CD2 1 
ATOM   2332 N N   . THR B 2  180 ? -0.518 17.025  -8.964  1.00 26.33  ? 181 THR L N   1 
ATOM   2333 C CA  . THR B 2  180 ? -1.571 16.565  -9.868  1.00 26.99  ? 181 THR L CA  1 
ATOM   2334 C C   . THR B 2  180 ? -1.111 16.870  -11.279 1.00 25.02  ? 181 THR L C   1 
ATOM   2335 O O   . THR B 2  180 ? -0.343 17.805  -11.485 1.00 24.71  ? 181 THR L O   1 
ATOM   2336 C CB  . THR B 2  180 ? -2.922 17.308  -9.651  1.00 27.16  ? 181 THR L CB  1 
ATOM   2337 O OG1 . THR B 2  180 ? -2.767 18.688  -9.992  1.00 27.00  ? 181 THR L OG1 1 
ATOM   2338 C CG2 . THR B 2  180 ? -3.386 17.206  -8.204  1.00 26.63  ? 181 THR L CG2 1 
ATOM   2339 N N   . LYS B 2  181 ? -1.582 16.081  -12.241 1.00 24.23  ? 182 LYS L N   1 
ATOM   2340 C CA  . LYS B 2  181 ? -1.244 16.281  -13.644 1.00 23.84  ? 182 LYS L CA  1 
ATOM   2341 C C   . LYS B 2  181 ? -1.637 17.690  -14.098 1.00 24.76  ? 182 LYS L C   1 
ATOM   2342 O O   . LYS B 2  181 ? -0.948 18.300  -14.917 1.00 24.50  ? 182 LYS L O   1 
ATOM   2343 C CB  . LYS B 2  181 ? -1.981 15.254  -14.500 1.00 21.84  ? 182 LYS L CB  1 
ATOM   2344 C CG  . LYS B 2  181 ? -1.795 15.393  -16.006 1.00 22.67  ? 182 LYS L CG  1 
ATOM   2345 C CD  . LYS B 2  181 ? -2.589 14.287  -16.695 1.00 31.62  ? 182 LYS L CD  1 
ATOM   2346 C CE  . LYS B 2  181 ? -2.650 14.431  -18.209 1.00 33.33  ? 182 LYS L CE  1 
ATOM   2347 N NZ  . LYS B 2  181 ? -3.584 13.415  -18.812 1.00 32.82  ? 182 LYS L NZ  1 
ATOM   2348 N N   . ASP B 2  182 ? -2.753 18.201  -13.578 1.00 23.14  ? 183 ASP L N   1 
ATOM   2349 C CA  . ASP B 2  182 ? -3.198 19.526  -13.966 1.00 21.84  ? 183 ASP L CA  1 
ATOM   2350 C C   . ASP B 2  182 ? -2.266 20.599  -13.423 1.00 21.57  ? 183 ASP L C   1 
ATOM   2351 O O   . ASP B 2  182 ? -1.920 21.526  -14.148 1.00 23.40  ? 183 ASP L O   1 
ATOM   2352 C CB  . ASP B 2  182 ? -4.621 19.800  -13.491 1.00 24.32  ? 183 ASP L CB  1 
ATOM   2353 C CG  . ASP B 2  182 ? -5.169 21.115  -14.047 1.00 29.76  ? 183 ASP L CG  1 
ATOM   2354 O OD1 . ASP B 2  182 ? -5.460 22.036  -13.247 1.00 29.62  ? 183 ASP L OD1 1 
ATOM   2355 O OD2 . ASP B 2  182 ? -5.290 21.228  -15.293 1.00 30.66  ? 183 ASP L OD2 1 
ATOM   2356 N N   . GLU B 2  183 ? -1.852 20.496  -12.161 1.00 20.29  ? 184 GLU L N   1 
ATOM   2357 C CA  . GLU B 2  183 ? -0.942 21.512  -11.640 1.00 20.11  ? 184 GLU L CA  1 
ATOM   2358 C C   . GLU B 2  183 ? 0.366  21.445  -12.401 1.00 20.37  ? 184 GLU L C   1 
ATOM   2359 O O   . GLU B 2  183 ? 0.985  22.463  -12.669 1.00 19.17  ? 184 GLU L O   1 
ATOM   2360 C CB  . GLU B 2  183 ? -0.654 21.349  -10.148 1.00 21.47  ? 184 GLU L CB  1 
ATOM   2361 C CG  . GLU B 2  183 ? 0.330  22.429  -9.682  1.00 26.86  ? 184 GLU L CG  1 
ATOM   2362 C CD  . GLU B 2  183 ? 0.386  22.611  -8.181  1.00 31.73  ? 184 GLU L CD  1 
ATOM   2363 O OE1 . GLU B 2  183 ? 0.520  21.597  -7.467  1.00 36.84  ? 184 GLU L OE1 1 
ATOM   2364 O OE2 . GLU B 2  183 ? 0.308  23.773  -7.719  1.00 33.73  ? 184 GLU L OE2 1 
ATOM   2365 N N   . TYR B 2  184 ? 0.784  20.234  -12.745 1.00 22.19  ? 185 TYR L N   1 
ATOM   2366 C CA  . TYR B 2  184 ? 2.014  20.046  -13.502 1.00 23.14  ? 185 TYR L CA  1 
ATOM   2367 C C   . TYR B 2  184 ? 1.903  20.743  -14.863 1.00 24.01  ? 185 TYR L C   1 
ATOM   2368 O O   . TYR B 2  184 ? 2.849  21.390  -15.316 1.00 20.37  ? 185 TYR L O   1 
ATOM   2369 C CB  . TYR B 2  184 ? 2.296  18.548  -13.717 1.00 20.94  ? 185 TYR L CB  1 
ATOM   2370 C CG  . TYR B 2  184 ? 3.475  18.306  -14.626 1.00 20.13  ? 185 TYR L CG  1 
ATOM   2371 C CD1 . TYR B 2  184 ? 4.759  18.686  -14.238 1.00 20.36  ? 185 TYR L CD1 1 
ATOM   2372 C CD2 . TYR B 2  184 ? 3.302  17.761  -15.898 1.00 17.34  ? 185 TYR L CD2 1 
ATOM   2373 C CE1 . TYR B 2  184 ? 5.847  18.537  -15.092 1.00 19.91  ? 185 TYR L CE1 1 
ATOM   2374 C CE2 . TYR B 2  184 ? 4.388  17.607  -16.765 1.00 19.74  ? 185 TYR L CE2 1 
ATOM   2375 C CZ  . TYR B 2  184 ? 5.656  18.003  -16.349 1.00 20.96  ? 185 TYR L CZ  1 
ATOM   2376 O OH  . TYR B 2  184 ? 6.743  17.880  -17.187 1.00 21.69  ? 185 TYR L OH  1 
ATOM   2377 N N   . GLU B 2  185 ? 0.737  20.607  -15.502 1.00 24.66  ? 186 GLU L N   1 
ATOM   2378 C CA  . GLU B 2  185 ? 0.484  21.203  -16.813 1.00 23.95  ? 186 GLU L CA  1 
ATOM   2379 C C   . GLU B 2  185 ? 0.346  22.722  -16.778 1.00 21.86  ? 186 GLU L C   1 
ATOM   2380 O O   . GLU B 2  185 ? 0.502  23.385  -17.804 1.00 23.36  ? 186 GLU L O   1 
ATOM   2381 C CB  . GLU B 2  185 ? -0.779 20.603  -17.440 1.00 25.15  ? 186 GLU L CB  1 
ATOM   2382 C CG  . GLU B 2  185 ? -0.677 19.132  -17.825 1.00 27.83  ? 186 GLU L CG  1 
ATOM   2383 C CD  . GLU B 2  185 ? 0.475  18.851  -18.774 1.00 32.78  ? 186 GLU L CD  1 
ATOM   2384 O OE1 . GLU B 2  185 ? 0.831  19.747  -19.573 1.00 35.72  ? 186 GLU L OE1 1 
ATOM   2385 O OE2 . GLU B 2  185 ? 1.021  17.726  -18.735 1.00 35.99  ? 186 GLU L OE2 1 
ATOM   2386 N N   . ARG B 2  186 ? 0.052  23.263  -15.601 1.00 20.82  ? 187 ARG L N   1 
ATOM   2387 C CA  . ARG B 2  186 ? -0.113 24.699  -15.415 1.00 19.90  ? 187 ARG L CA  1 
ATOM   2388 C C   . ARG B 2  186 ? 1.193  25.440  -15.101 1.00 22.44  ? 187 ARG L C   1 
ATOM   2389 O O   . ARG B 2  186 ? 1.217  26.665  -15.002 1.00 25.09  ? 187 ARG L O   1 
ATOM   2390 C CB  . ARG B 2  186 ? -1.144 24.951  -14.314 1.00 19.57  ? 187 ARG L CB  1 
ATOM   2391 C CG  . ARG B 2  186 ? -2.587 24.713  -14.770 1.00 21.60  ? 187 ARG L CG  1 
ATOM   2392 C CD  . ARG B 2  186 ? -3.509 24.387  -13.599 1.00 23.37  ? 187 ARG L CD  1 
ATOM   2393 N NE  . ARG B 2  186 ? -3.132 25.196  -12.465 1.00 28.38  ? 187 ARG L NE  1 
ATOM   2394 C CZ  . ARG B 2  186 ? -3.216 24.817  -11.203 1.00 22.73  ? 187 ARG L CZ  1 
ATOM   2395 N NH1 . ARG B 2  186 ? -3.680 23.623  -10.882 1.00 21.08  ? 187 ARG L NH1 1 
ATOM   2396 N NH2 . ARG B 2  186 ? -2.799 25.643  -10.265 1.00 31.24  ? 187 ARG L NH2 1 
ATOM   2397 N N   . HIS B 2  187 ? 2.286  24.700  -14.963 1.00 23.18  ? 188 HIS L N   1 
ATOM   2398 C CA  . HIS B 2  187 ? 3.572  25.311  -14.664 1.00 24.47  ? 188 HIS L CA  1 
ATOM   2399 C C   . HIS B 2  187 ? 4.630  24.831  -15.636 1.00 23.37  ? 188 HIS L C   1 
ATOM   2400 O O   . HIS B 2  187 ? 4.528  23.736  -16.180 1.00 26.30  ? 188 HIS L O   1 
ATOM   2401 C CB  . HIS B 2  187 ? 3.956  25.008  -13.223 1.00 22.04  ? 188 HIS L CB  1 
ATOM   2402 C CG  . HIS B 2  187 ? 3.081  25.703  -12.229 1.00 24.42  ? 188 HIS L CG  1 
ATOM   2403 N ND1 . HIS B 2  187 ? 3.209  27.045  -11.941 1.00 22.98  ? 188 HIS L ND1 1 
ATOM   2404 C CD2 . HIS B 2  187 ? 2.027  25.261  -11.504 1.00 23.21  ? 188 HIS L CD2 1 
ATOM   2405 C CE1 . HIS B 2  187 ? 2.270  27.398  -11.081 1.00 25.68  ? 188 HIS L CE1 1 
ATOM   2406 N NE2 . HIS B 2  187 ? 1.539  26.335  -10.799 1.00 25.25  ? 188 HIS L NE2 1 
ATOM   2407 N N   . ASN B 2  188 ? 5.653  25.650  -15.849 1.00 26.00  ? 189 ASN L N   1 
ATOM   2408 C CA  . ASN B 2  188 ? 6.685  25.313  -16.816 1.00 28.34  ? 189 ASN L CA  1 
ATOM   2409 C C   . ASN B 2  188 ? 8.068  24.916  -16.303 1.00 28.04  ? 189 ASN L C   1 
ATOM   2410 O O   . ASN B 2  188 ? 8.613  23.885  -16.696 1.00 28.57  ? 189 ASN L O   1 
ATOM   2411 C CB  . ASN B 2  188 ? 6.837  26.478  -17.787 1.00 32.54  ? 189 ASN L CB  1 
ATOM   2412 C CG  . ASN B 2  188 ? 7.686  26.120  -18.981 1.00 38.49  ? 189 ASN L CG  1 
ATOM   2413 O OD1 . ASN B 2  188 ? 7.461  25.091  -19.621 1.00 44.63  ? 189 ASN L OD1 1 
ATOM   2414 N ND2 . ASN B 2  188 ? 8.665  26.964  -19.295 1.00 40.95  ? 189 ASN L ND2 1 
ATOM   2415 N N   . SER B 2  189 ? 8.628  25.742  -15.432 1.00 27.29  ? 190 SER L N   1 
ATOM   2416 C CA  . SER B 2  189 ? 9.963  25.527  -14.904 1.00 28.08  ? 190 SER L CA  1 
ATOM   2417 C C   . SER B 2  189 ? 10.006 24.660  -13.647 1.00 25.54  ? 190 SER L C   1 
ATOM   2418 O O   . SER B 2  189 ? 9.440  25.021  -12.619 1.00 28.17  ? 190 SER L O   1 
ATOM   2419 C CB  . SER B 2  189 ? 10.591 26.899  -14.629 1.00 30.39  ? 190 SER L CB  1 
ATOM   2420 O OG  . SER B 2  189 ? 11.938 26.788  -14.222 1.00 40.03  ? 190 SER L OG  1 
ATOM   2421 N N   . TYR B 2  190 ? 10.682 23.519  -13.728 1.00 23.52  ? 191 TYR L N   1 
ATOM   2422 C CA  . TYR B 2  190 ? 10.809 22.625  -12.573 1.00 24.25  ? 191 TYR L CA  1 
ATOM   2423 C C   . TYR B 2  190 ? 12.277 22.520  -12.144 1.00 26.06  ? 191 TYR L C   1 
ATOM   2424 O O   . TYR B 2  190 ? 13.131 22.083  -12.912 1.00 28.96  ? 191 TYR L O   1 
ATOM   2425 C CB  . TYR B 2  190 ? 10.222 21.254  -12.907 1.00 18.38  ? 191 TYR L CB  1 
ATOM   2426 C CG  . TYR B 2  190 ? 8.728  21.327  -13.014 1.00 18.78  ? 191 TYR L CG  1 
ATOM   2427 C CD1 . TYR B 2  190 ? 7.932  21.282  -11.876 1.00 19.37  ? 191 TYR L CD1 1 
ATOM   2428 C CD2 . TYR B 2  190 ? 8.109  21.557  -14.238 1.00 20.92  ? 191 TYR L CD2 1 
ATOM   2429 C CE1 . TYR B 2  190 ? 6.553  21.472  -11.949 1.00 19.75  ? 191 TYR L CE1 1 
ATOM   2430 C CE2 . TYR B 2  190 ? 6.730  21.751  -14.321 1.00 21.84  ? 191 TYR L CE2 1 
ATOM   2431 C CZ  . TYR B 2  190 ? 5.960  21.710  -13.170 1.00 17.20  ? 191 TYR L CZ  1 
ATOM   2432 O OH  . TYR B 2  190 ? 4.605  21.926  -13.234 1.00 19.20  ? 191 TYR L OH  1 
ATOM   2433 N N   . THR B 2  191 ? 12.559 22.933  -10.912 1.00 24.74  ? 192 THR L N   1 
ATOM   2434 C CA  . THR B 2  191 ? 13.922 22.942  -10.414 1.00 26.05  ? 192 THR L CA  1 
ATOM   2435 C C   . THR B 2  191 ? 14.182 22.178  -9.117  1.00 25.75  ? 192 THR L C   1 
ATOM   2436 O O   . THR B 2  191 ? 13.387 22.186  -8.177  1.00 23.45  ? 192 THR L O   1 
ATOM   2437 C CB  . THR B 2  191 ? 14.412 24.400  -10.222 1.00 26.19  ? 192 THR L CB  1 
ATOM   2438 O OG1 . THR B 2  191 ? 14.320 25.105  -11.465 1.00 29.78  ? 192 THR L OG1 1 
ATOM   2439 C CG2 . THR B 2  191 ? 15.856 24.428  -9.745  1.00 29.15  ? 192 THR L CG2 1 
ATOM   2440 N N   . CYS B 2  192 ? 15.335 21.525  -9.111  1.00 27.68  ? 193 CYS L N   1 
ATOM   2441 C CA  . CYS B 2  192 ? 15.847 20.751  -7.998  1.00 29.16  ? 193 CYS L CA  1 
ATOM   2442 C C   . CYS B 2  192 ? 17.105 21.531  -7.592  1.00 28.70  ? 193 CYS L C   1 
ATOM   2443 O O   . CYS B 2  192 ? 18.010 21.719  -8.396  1.00 29.38  ? 193 CYS L O   1 
ATOM   2444 C CB  . CYS B 2  192 ? 16.214 19.350  -8.493  1.00 31.89  ? 193 CYS L CB  1 
ATOM   2445 S SG  . CYS B 2  192 ? 16.808 18.256  -7.180  1.00 46.00  ? 193 CYS L SG  1 
ATOM   2446 N N   . GLU B 2  193 ? 17.158 21.984  -6.349  1.00 31.05  ? 194 GLU L N   1 
ATOM   2447 C CA  . GLU B 2  193 ? 18.279 22.786  -5.857  1.00 33.96  ? 194 GLU L CA  1 
ATOM   2448 C C   . GLU B 2  193 ? 18.927 22.106  -4.637  1.00 35.54  ? 194 GLU L C   1 
ATOM   2449 O O   . GLU B 2  193 ? 18.304 21.993  -3.577  1.00 32.27  ? 194 GLU L O   1 
ATOM   2450 C CB  . GLU B 2  193 ? 17.725 24.171  -5.486  1.00 37.87  ? 194 GLU L CB  1 
ATOM   2451 C CG  . GLU B 2  193 ? 18.688 25.340  -5.493  1.00 45.37  ? 194 GLU L CG  1 
ATOM   2452 C CD  . GLU B 2  193 ? 17.948 26.684  -5.530  1.00 49.52  ? 194 GLU L CD  1 
ATOM   2453 O OE1 . GLU B 2  193 ? 17.420 27.052  -6.607  1.00 48.69  ? 194 GLU L OE1 1 
ATOM   2454 O OE2 . GLU B 2  193 ? 17.880 27.369  -4.483  1.00 53.49  ? 194 GLU L OE2 1 
ATOM   2455 N N   . ALA B 2  194 ? 20.177 21.666  -4.789  1.00 35.28  ? 195 ALA L N   1 
ATOM   2456 C CA  . ALA B 2  194 ? 20.905 20.983  -3.711  1.00 36.03  ? 195 ALA L CA  1 
ATOM   2457 C C   . ALA B 2  194 ? 22.012 21.804  -3.041  1.00 36.17  ? 195 ALA L C   1 
ATOM   2458 O O   . ALA B 2  194 ? 22.878 22.357  -3.721  1.00 38.39  ? 195 ALA L O   1 
ATOM   2459 C CB  . ALA B 2  194 ? 21.508 19.694  -4.243  1.00 34.25  ? 195 ALA L CB  1 
ATOM   2460 N N   . THR B 2  195 ? 21.992 21.867  -1.711  1.00 35.80  ? 196 THR L N   1 
ATOM   2461 C CA  . THR B 2  195 ? 23.022 22.588  -0.959  1.00 35.88  ? 196 THR L CA  1 
ATOM   2462 C C   . THR B 2  195 ? 23.894 21.588  -0.196  1.00 34.27  ? 196 THR L C   1 
ATOM   2463 O O   . THR B 2  195 ? 23.396 20.775  0.587   1.00 31.31  ? 196 THR L O   1 
ATOM   2464 C CB  . THR B 2  195 ? 22.416 23.559  0.043   1.00 36.97  ? 196 THR L CB  1 
ATOM   2465 O OG1 . THR B 2  195 ? 21.501 24.424  -0.635  1.00 40.67  ? 196 THR L OG1 1 
ATOM   2466 C CG2 . THR B 2  195 ? 23.510 24.399  0.687   1.00 38.92  ? 196 THR L CG2 1 
ATOM   2467 N N   . HIS B 2  196 ? 25.197 21.661  -0.435  1.00 32.98  ? 197 HIS L N   1 
ATOM   2468 C CA  . HIS B 2  196 ? 26.159 20.762  0.185   1.00 32.78  ? 197 HIS L CA  1 
ATOM   2469 C C   . HIS B 2  196 ? 27.399 21.580  0.566   1.00 33.91  ? 197 HIS L C   1 
ATOM   2470 O O   . HIS B 2  196 ? 27.721 22.573  -0.086  1.00 32.82  ? 197 HIS L O   1 
ATOM   2471 C CB  . HIS B 2  196 ? 26.521 19.672  -0.825  1.00 33.16  ? 197 HIS L CB  1 
ATOM   2472 C CG  . HIS B 2  196 ? 27.276 18.517  -0.245  1.00 31.98  ? 197 HIS L CG  1 
ATOM   2473 N ND1 . HIS B 2  196 ? 26.726 17.656  0.680   1.00 31.95  ? 197 HIS L ND1 1 
ATOM   2474 C CD2 . HIS B 2  196 ? 28.517 18.047  -0.504  1.00 29.69  ? 197 HIS L CD2 1 
ATOM   2475 C CE1 . HIS B 2  196 ? 27.595 16.703  0.962   1.00 29.13  ? 197 HIS L CE1 1 
ATOM   2476 N NE2 . HIS B 2  196 ? 28.690 16.917  0.257   1.00 33.37  ? 197 HIS L NE2 1 
ATOM   2477 N N   . LYS B 2  197 ? 28.094 21.161  1.617   1.00 35.47  ? 198 LYS L N   1 
ATOM   2478 C CA  . LYS B 2  197 ? 29.283 21.880  2.077   1.00 36.04  ? 198 LYS L CA  1 
ATOM   2479 C C   . LYS B 2  197 ? 30.345 22.025  0.996   1.00 35.21  ? 198 LYS L C   1 
ATOM   2480 O O   . LYS B 2  197 ? 31.202 22.896  1.093   1.00 38.79  ? 198 LYS L O   1 
ATOM   2481 C CB  . LYS B 2  197 ? 29.895 21.182  3.300   1.00 36.44  ? 198 LYS L CB  1 
ATOM   2482 C CG  . LYS B 2  197 ? 30.589 19.872  2.993   1.00 38.41  ? 198 LYS L CG  1 
ATOM   2483 C CD  . LYS B 2  197 ? 32.099 20.050  2.981   1.00 44.12  ? 198 LYS L CD  1 
ATOM   2484 C CE  . LYS B 2  197 ? 32.708 19.901  4.383   1.00 45.80  ? 198 LYS L CE  1 
ATOM   2485 N NZ  . LYS B 2  197 ? 32.067 20.770  5.413   1.00 45.32  ? 198 LYS L NZ  1 
ATOM   2486 N N   . THR B 2  198 ? 30.286 21.180  -0.032  1.00 35.41  ? 199 THR L N   1 
ATOM   2487 C CA  . THR B 2  198 ? 31.261 21.231  -1.116  1.00 36.16  ? 199 THR L CA  1 
ATOM   2488 C C   . THR B 2  198 ? 31.130 22.467  -2.006  1.00 39.02  ? 199 THR L C   1 
ATOM   2489 O O   . THR B 2  198 ? 32.006 22.741  -2.827  1.00 40.02  ? 199 THR L O   1 
ATOM   2490 C CB  . THR B 2  198 ? 31.192 19.965  -2.018  1.00 35.60  ? 199 THR L CB  1 
ATOM   2491 O OG1 . THR B 2  198 ? 29.845 19.752  -2.458  1.00 37.45  ? 199 THR L OG1 1 
ATOM   2492 C CG2 . THR B 2  198 ? 31.684 18.742  -1.264  1.00 33.00  ? 199 THR L CG2 1 
ATOM   2493 N N   . SER B 2  199 ? 30.047 23.219  -1.845  1.00 41.21  ? 200 SER L N   1 
ATOM   2494 C CA  . SER B 2  199 ? 29.848 24.412  -2.659  1.00 43.77  ? 200 SER L CA  1 
ATOM   2495 C C   . SER B 2  199 ? 29.118 25.507  -1.901  1.00 44.17  ? 200 SER L C   1 
ATOM   2496 O O   . SER B 2  199 ? 28.189 25.249  -1.132  1.00 45.03  ? 200 SER L O   1 
ATOM   2497 C CB  . SER B 2  199 ? 29.068 24.064  -3.930  1.00 45.72  ? 200 SER L CB  1 
ATOM   2498 O OG  . SER B 2  199 ? 29.010 25.170  -4.814  1.00 50.68  ? 200 SER L OG  1 
ATOM   2499 N N   . THR B 2  200 ? 29.553 26.739  -2.126  1.00 44.56  ? 201 THR L N   1 
ATOM   2500 C CA  . THR B 2  200 ? 28.955 27.892  -1.479  1.00 45.35  ? 201 THR L CA  1 
ATOM   2501 C C   . THR B 2  200 ? 27.589 28.178  -2.095  1.00 45.18  ? 201 THR L C   1 
ATOM   2502 O O   . THR B 2  200 ? 26.673 28.671  -1.428  1.00 45.34  ? 201 THR L O   1 
ATOM   2503 C CB  . THR B 2  200 ? 29.849 29.118  -1.649  1.00 44.51  ? 201 THR L CB  1 
ATOM   2504 O OG1 . THR B 2  200 ? 29.184 30.262  -1.111  1.00 50.74  ? 201 THR L OG1 1 
ATOM   2505 C CG2 . THR B 2  200 ? 30.161 29.351  -3.126  1.00 45.60  ? 201 THR L CG2 1 
ATOM   2506 N N   . SER B 2  201 ? 27.466 27.856  -3.378  1.00 46.08  ? 202 SER L N   1 
ATOM   2507 C CA  . SER B 2  201 ? 26.228 28.053  -4.124  1.00 45.38  ? 202 SER L CA  1 
ATOM   2508 C C   . SER B 2  201 ? 25.580 26.706  -4.414  1.00 44.72  ? 202 SER L C   1 
ATOM   2509 O O   . SER B 2  201 ? 26.269 25.698  -4.592  1.00 43.79  ? 202 SER L O   1 
ATOM   2510 C CB  . SER B 2  201 ? 26.514 28.771  -5.443  1.00 44.09  ? 202 SER L CB  1 
ATOM   2511 O OG  . SER B 2  201 ? 27.008 30.077  -5.207  1.00 51.72  ? 202 SER L OG  1 
ATOM   2512 N N   . PRO B 2  202 ? 24.241 26.676  -4.473  1.00 43.62  ? 203 PRO L N   1 
ATOM   2513 C CA  . PRO B 2  202 ? 23.481 25.451  -4.741  1.00 40.01  ? 203 PRO L CA  1 
ATOM   2514 C C   . PRO B 2  202 ? 23.760 24.844  -6.104  1.00 36.49  ? 203 PRO L C   1 
ATOM   2515 O O   . PRO B 2  202 ? 24.072 25.554  -7.058  1.00 35.64  ? 203 PRO L O   1 
ATOM   2516 C CB  . PRO B 2  202 ? 22.027 25.913  -4.633  1.00 40.81  ? 203 PRO L CB  1 
ATOM   2517 C CG  . PRO B 2  202 ? 22.100 27.086  -3.702  1.00 43.29  ? 203 PRO L CG  1 
ATOM   2518 C CD  . PRO B 2  202 ? 23.332 27.799  -4.186  1.00 44.07  ? 203 PRO L CD  1 
ATOM   2519 N N   . ILE B 2  203 ? 23.678 23.523  -6.190  1.00 33.21  ? 204 ILE L N   1 
ATOM   2520 C CA  . ILE B 2  203 ? 23.845 22.872  -7.472  1.00 33.45  ? 204 ILE L CA  1 
ATOM   2521 C C   . ILE B 2  203 ? 22.401 22.859  -7.957  1.00 35.21  ? 204 ILE L C   1 
ATOM   2522 O O   . ILE B 2  203 ? 21.535 22.250  -7.326  1.00 34.57  ? 204 ILE L O   1 
ATOM   2523 C CB  . ILE B 2  203 ? 24.378 21.434  -7.333  1.00 36.50  ? 204 ILE L CB  1 
ATOM   2524 C CG1 . ILE B 2  203 ? 25.822 21.467  -6.829  1.00 37.08  ? 204 ILE L CG1 1 
ATOM   2525 C CG2 . ILE B 2  203 ? 24.317 20.718  -8.681  1.00 33.71  ? 204 ILE L CG2 1 
ATOM   2526 C CD1 . ILE B 2  203 ? 26.449 20.089  -6.664  1.00 41.44  ? 204 ILE L CD1 1 
ATOM   2527 N N   . VAL B 2  204 ? 22.141 23.557  -9.058  1.00 34.52  ? 205 VAL L N   1 
ATOM   2528 C CA  . VAL B 2  204 ? 20.794 23.667  -9.596  1.00 34.27  ? 205 VAL L CA  1 
ATOM   2529 C C   . VAL B 2  204 ? 20.584 22.956  -10.929 1.00 35.53  ? 205 VAL L C   1 
ATOM   2530 O O   . VAL B 2  204 ? 21.331 23.160  -11.881 1.00 39.41  ? 205 VAL L O   1 
ATOM   2531 C CB  . VAL B 2  204 ? 20.410 25.146  -9.791  1.00 33.38  ? 205 VAL L CB  1 
ATOM   2532 C CG1 . VAL B 2  204 ? 19.015 25.241  -10.366 1.00 35.24  ? 205 VAL L CG1 1 
ATOM   2533 C CG2 . VAL B 2  204 ? 20.500 25.896  -8.463  1.00 32.74  ? 205 VAL L CG2 1 
ATOM   2534 N N   . LYS B 2  205 ? 19.558 22.114  -10.982 1.00 34.12  ? 206 LYS L N   1 
ATOM   2535 C CA  . LYS B 2  205 ? 19.205 21.399  -12.200 1.00 33.48  ? 206 LYS L CA  1 
ATOM   2536 C C   . LYS B 2  205 ? 17.710 21.583  -12.431 1.00 32.48  ? 206 LYS L C   1 
ATOM   2537 O O   . LYS B 2  205 ? 16.902 21.435  -11.517 1.00 30.42  ? 206 LYS L O   1 
ATOM   2538 C CB  . LYS B 2  205 ? 19.537 19.912  -12.078 1.00 33.90  ? 206 LYS L CB  1 
ATOM   2539 C CG  . LYS B 2  205 ? 21.010 19.604  -12.202 1.00 39.22  ? 206 LYS L CG  1 
ATOM   2540 C CD  . LYS B 2  205 ? 21.388 19.184  -13.611 1.00 42.74  ? 206 LYS L CD  1 
ATOM   2541 C CE  . LYS B 2  205 ? 22.876 18.842  -13.675 1.00 49.73  ? 206 LYS L CE  1 
ATOM   2542 N NZ  . LYS B 2  205 ? 23.243 18.062  -14.894 1.00 57.28  ? 206 LYS L NZ  1 
ATOM   2543 N N   . SER B 2  206 ? 17.341 21.922  -13.655 1.00 32.27  ? 207 SER L N   1 
ATOM   2544 C CA  . SER B 2  206 ? 15.937 22.106  -13.957 1.00 31.93  ? 207 SER L CA  1 
ATOM   2545 C C   . SER B 2  206 ? 15.617 21.786  -15.401 1.00 27.90  ? 207 SER L C   1 
ATOM   2546 O O   . SER B 2  206 ? 16.497 21.487  -16.198 1.00 27.68  ? 207 SER L O   1 
ATOM   2547 C CB  . SER B 2  206 ? 15.509 23.544  -13.630 1.00 34.84  ? 207 SER L CB  1 
ATOM   2548 O OG  . SER B 2  206 ? 16.174 24.476  -14.450 1.00 46.06  ? 207 SER L OG  1 
ATOM   2549 N N   . PHE B 2  207 ? 14.335 21.814  -15.718 1.00 25.18  ? 208 PHE L N   1 
ATOM   2550 C CA  . PHE B 2  207 ? 13.882 21.578  -17.068 1.00 24.36  ? 208 PHE L CA  1 
ATOM   2551 C C   . PHE B 2  207 ? 12.588 22.360  -17.212 1.00 27.57  ? 208 PHE L C   1 
ATOM   2552 O O   . PHE B 2  207 ? 11.989 22.771  -16.212 1.00 26.22  ? 208 PHE L O   1 
ATOM   2553 C CB  . PHE B 2  207 ? 13.639 20.083  -17.328 1.00 23.52  ? 208 PHE L CB  1 
ATOM   2554 C CG  . PHE B 2  207 ? 12.424 19.525  -16.633 1.00 24.76  ? 208 PHE L CG  1 
ATOM   2555 C CD1 . PHE B 2  207 ? 12.543 18.879  -15.406 1.00 22.77  ? 208 PHE L CD1 1 
ATOM   2556 C CD2 . PHE B 2  207 ? 11.153 19.674  -17.195 1.00 21.64  ? 208 PHE L CD2 1 
ATOM   2557 C CE1 . PHE B 2  207 ? 11.414 18.390  -14.743 1.00 25.88  ? 208 PHE L CE1 1 
ATOM   2558 C CE2 . PHE B 2  207 ? 10.024 19.193  -16.545 1.00 21.82  ? 208 PHE L CE2 1 
ATOM   2559 C CZ  . PHE B 2  207 ? 10.152 18.548  -15.314 1.00 23.51  ? 208 PHE L CZ  1 
ATOM   2560 N N   . ASN B 2  208 ? 12.177 22.584  -18.454 1.00 28.63  ? 209 ASN L N   1 
ATOM   2561 C CA  . ASN B 2  208 ? 10.942 23.294  -18.742 1.00 31.08  ? 209 ASN L CA  1 
ATOM   2562 C C   . ASN B 2  208 ? 9.983  22.305  -19.378 1.00 33.58  ? 209 ASN L C   1 
ATOM   2563 O O   . ASN B 2  208 ? 10.350 21.603  -20.324 1.00 33.02  ? 209 ASN L O   1 
ATOM   2564 C CB  . ASN B 2  208 ? 11.191 24.435  -19.726 1.00 33.95  ? 209 ASN L CB  1 
ATOM   2565 C CG  . ASN B 2  208 ? 11.885 25.615  -19.089 1.00 37.01  ? 209 ASN L CG  1 
ATOM   2566 O OD1 . ASN B 2  208 ? 12.390 26.494  -19.783 1.00 45.93  ? 209 ASN L OD1 1 
ATOM   2567 N ND2 . ASN B 2  208 ? 11.908 25.650  -17.767 1.00 34.47  ? 209 ASN L ND2 1 
ATOM   2568 N N   . ARG B 2  209 ? 8.762  22.239  -18.855 1.00 35.97  ? 210 ARG L N   1 
ATOM   2569 C CA  . ARG B 2  209 ? 7.752  21.338  -19.397 1.00 39.74  ? 210 ARG L CA  1 
ATOM   2570 C C   . ARG B 2  209 ? 7.552  21.656  -20.881 1.00 43.49  ? 210 ARG L C   1 
ATOM   2571 O O   . ARG B 2  209 ? 7.259  20.769  -21.679 1.00 42.44  ? 210 ARG L O   1 
ATOM   2572 C CB  . ARG B 2  209 ? 6.434  21.518  -18.647 1.00 35.67  ? 210 ARG L CB  1 
ATOM   2573 C CG  . ARG B 2  209 ? 5.419  20.437  -18.900 1.00 31.66  ? 210 ARG L CG  1 
ATOM   2574 C CD  . ARG B 2  209 ? 4.024  20.953  -18.615 1.00 32.93  ? 210 ARG L CD  1 
ATOM   2575 N NE  . ARG B 2  209 ? 3.591  21.869  -19.670 1.00 41.96  ? 210 ARG L NE  1 
ATOM   2576 C CZ  . ARG B 2  209 ? 3.523  23.190  -19.551 1.00 40.52  ? 210 ARG L CZ  1 
ATOM   2577 N NH1 . ARG B 2  209 ? 3.850  23.787  -18.422 1.00 38.73  ? 210 ARG L NH1 1 
ATOM   2578 N NH2 . ARG B 2  209 ? 3.137  23.923  -20.579 1.00 52.44  ? 210 ARG L NH2 1 
ATOM   2579 N N   . ASN B 2  210 ? 7.731  22.927  -21.238 1.00 50.40  ? 211 ASN L N   1 
ATOM   2580 C CA  . ASN B 2  210 ? 7.569  23.380  -22.616 1.00 59.36  ? 211 ASN L CA  1 
ATOM   2581 C C   . ASN B 2  210 ? 8.719  22.979  -23.533 1.00 63.38  ? 211 ASN L C   1 
ATOM   2582 O O   . ASN B 2  210 ? 8.495  22.461  -24.622 1.00 62.87  ? 211 ASN L O   1 
ATOM   2583 C CB  . ASN B 2  210 ? 7.407  24.907  -22.668 1.00 62.60  ? 211 ASN L CB  1 
ATOM   2584 C CG  . ASN B 2  210 ? 6.091  25.384  -22.063 1.00 69.20  ? 211 ASN L CG  1 
ATOM   2585 O OD1 . ASN B 2  210 ? 5.035  24.801  -22.307 1.00 73.70  ? 211 ASN L OD1 1 
ATOM   2586 N ND2 . ASN B 2  210 ? 6.148  26.462  -21.287 1.00 72.43  ? 211 ASN L ND2 1 
ATOM   2587 N N   . GLU B 2  211 ? 9.947  23.219  -23.087 1.00 70.49  ? 212 GLU L N   1 
ATOM   2588 C CA  . GLU B 2  211 ? 11.138 22.910  -23.882 1.00 77.44  ? 212 GLU L CA  1 
ATOM   2589 C C   . GLU B 2  211 ? 11.675 21.492  -23.657 1.00 80.41  ? 212 GLU L C   1 
ATOM   2590 O O   . GLU B 2  211 ? 12.230 21.197  -22.599 1.00 82.42  ? 212 GLU L O   1 
ATOM   2591 C CB  . GLU B 2  211 ? 12.245 23.928  -23.567 1.00 79.57  ? 212 GLU L CB  1 
ATOM   2592 C CG  . GLU B 2  211 ? 11.750 25.367  -23.371 1.00 82.92  ? 212 GLU L CG  1 
ATOM   2593 C CD  . GLU B 2  211 ? 11.085 25.953  -24.612 1.00 85.52  ? 212 GLU L CD  1 
ATOM   2594 O OE1 . GLU B 2  211 ? 11.789 26.170  -25.626 1.00 86.10  ? 212 GLU L OE1 1 
ATOM   2595 O OE2 . GLU B 2  211 ? 9.856  26.199  -24.569 1.00 87.12  ? 212 GLU L OE2 1 
ATOM   2596 N N   . ALA B 2  212 ? 11.517 20.626  -24.657 1.00 84.30  ? 213 ALA L N   1 
ATOM   2597 C CA  . ALA B 2  212 ? 11.988 19.236  -24.589 1.00 89.60  ? 213 ALA L CA  1 
ATOM   2598 C C   . ALA B 2  212 ? 11.550 18.437  -25.831 1.00 93.45  ? 213 ALA L C   1 
ATOM   2599 O O   . ALA B 2  212 ? 10.354 18.348  -26.130 1.00 95.65  ? 213 ALA L O   1 
ATOM   2600 C CB  . ALA B 2  212 ? 11.463 18.561  -23.314 1.00 89.58  ? 213 ALA L CB  1 
ATOM   2601 N N   . LYS B 2  213 ? 12.525 17.864  -26.541 1.00 95.15  ? 214 LYS L N   1 
ATOM   2602 C CA  . LYS B 2  213 ? 12.293 17.080  -27.765 1.00 94.95  ? 214 LYS L CA  1 
ATOM   2603 C C   . LYS B 2  213 ? 11.462 17.849  -28.795 1.00 96.31  ? 214 LYS L C   1 
ATOM   2604 O O   . LYS B 2  213 ? 11.177 19.035  -28.619 1.00 96.89  ? 214 LYS L O   1 
ATOM   2605 C CB  . LYS B 2  213 ? 11.587 15.757  -27.447 1.00 92.40  ? 214 LYS L CB  1 
ATOM   2606 C CG  . LYS B 2  213 ? 10.074 15.861  -27.324 1.00 89.01  ? 214 LYS L CG  1 
ATOM   2607 C CD  . LYS B 2  213 ? 9.451  14.509  -27.076 1.00 87.39  ? 214 LYS L CD  1 
ATOM   2608 C CE  . LYS B 2  213 ? 7.953  14.623  -26.905 1.00 85.60  ? 214 LYS L CE  1 
ATOM   2609 N NZ  . LYS B 2  213 ? 7.359  13.294  -26.597 1.00 85.37  ? 214 LYS L NZ  1 
ATOM   2610 N N   . ALA B 2  214 ? 11.073 17.166  -29.869 1.00 97.39  ? 215 ALA L N   1 
ATOM   2611 C CA  . ALA B 2  214 ? 10.271 17.789  -30.918 1.00 98.59  ? 215 ALA L CA  1 
ATOM   2612 C C   . ALA B 2  214 ? 8.844  18.025  -30.429 1.00 99.52  ? 215 ALA L C   1 
ATOM   2613 O O   . ALA B 2  214 ? 8.518  17.559  -29.309 1.00 100.09 ? 215 ALA L O   1 
ATOM   2614 C CB  . ALA B 2  214 ? 10.252 16.907  -32.162 1.00 98.03  ? 215 ALA L CB  1 
ATOM   2615 O OXT . ALA B 2  214 ? 8.070  18.670  -31.179 1.00 41.91  ? 215 ALA L OXT 1 
ATOM   2616 N N   . GLY C 3  1   ? 24.086 -26.046 14.009  1.00 41.60  ? 1   GLY H N   1 
ATOM   2617 C CA  . GLY C 3  1   ? 23.548 -26.798 15.173  1.00 40.78  ? 1   GLY H CA  1 
ATOM   2618 C C   . GLY C 3  1   ? 22.532 -25.989 15.964  1.00 39.23  ? 1   GLY H C   1 
ATOM   2619 O O   . GLY C 3  1   ? 21.325 -26.151 15.778  1.00 38.37  ? 1   GLY H O   1 
ATOM   2620 N N   . VAL C 3  2   ? 23.004 -25.110 16.844  1.00 36.21  ? 2   VAL H N   1 
ATOM   2621 C CA  . VAL C 3  2   ? 22.086 -24.317 17.646  1.00 35.43  ? 2   VAL H CA  1 
ATOM   2622 C C   . VAL C 3  2   ? 21.642 -23.021 16.962  1.00 33.44  ? 2   VAL H C   1 
ATOM   2623 O O   . VAL C 3  2   ? 22.448 -22.163 16.594  1.00 32.76  ? 2   VAL H O   1 
ATOM   2624 C CB  . VAL C 3  2   ? 22.672 -24.042 19.059  1.00 33.52  ? 2   VAL H CB  1 
ATOM   2625 C CG1 . VAL C 3  2   ? 24.119 -24.503 19.122  1.00 20.11  ? 2   VAL H CG1 1 
ATOM   2626 C CG2 . VAL C 3  2   ? 22.549 -22.567 19.420  1.00 20.11  ? 2   VAL H CG2 1 
ATOM   2627 N N   . LYS C 3  3   ? 20.329 -22.906 16.797  1.00 31.28  ? 3   LYS H N   1 
ATOM   2628 C CA  . LYS C 3  3   ? 19.725 -21.761 16.142  1.00 29.14  ? 3   LYS H CA  1 
ATOM   2629 C C   . LYS C 3  3   ? 18.297 -21.510 16.598  1.00 24.98  ? 3   LYS H C   1 
ATOM   2630 O O   . LYS C 3  3   ? 17.683 -22.357 17.236  1.00 23.70  ? 3   LYS H O   1 
ATOM   2631 C CB  . LYS C 3  3   ? 19.731 -21.984 14.628  1.00 32.79  ? 3   LYS H CB  1 
ATOM   2632 C CG  . LYS C 3  3   ? 19.239 -23.361 14.195  1.00 38.89  ? 3   LYS H CG  1 
ATOM   2633 C CD  . LYS C 3  3   ? 19.296 -23.527 12.673  1.00 41.57  ? 3   LYS H CD  1 
ATOM   2634 C CE  . LYS C 3  3   ? 17.929 -23.291 12.027  1.00 45.52  ? 3   LYS H CE  1 
ATOM   2635 N NZ  . LYS C 3  3   ? 17.328 -21.949 12.315  1.00 52.19  ? 3   LYS H NZ  1 
ATOM   2636 N N   . LEU C 3  4   ? 17.790 -20.329 16.254  1.00 23.12  ? 4   LEU H N   1 
ATOM   2637 C CA  . LEU C 3  4   ? 16.421 -19.916 16.565  1.00 23.59  ? 4   LEU H CA  1 
ATOM   2638 C C   . LEU C 3  4   ? 15.772 -19.569 15.216  1.00 23.88  ? 4   LEU H C   1 
ATOM   2639 O O   . LEU C 3  4   ? 16.219 -18.644 14.522  1.00 24.21  ? 4   LEU H O   1 
ATOM   2640 C CB  . LEU C 3  4   ? 16.420 -18.698 17.511  1.00 23.22  ? 4   LEU H CB  1 
ATOM   2641 C CG  . LEU C 3  4   ? 16.971 -18.942 18.930  1.00 22.29  ? 4   LEU H CG  1 
ATOM   2642 C CD1 . LEU C 3  4   ? 16.970 -17.665 19.735  1.00 23.48  ? 4   LEU H CD1 1 
ATOM   2643 C CD2 . LEU C 3  4   ? 16.130 -19.989 19.623  1.00 21.77  ? 4   LEU H CD2 1 
ATOM   2644 N N   . GLN C 3  5   ? 14.741 -20.330 14.842  1.00 22.66  ? 5   GLN H N   1 
ATOM   2645 C CA  . GLN C 3  5   ? 14.056 -20.139 13.565  1.00 24.83  ? 5   GLN H CA  1 
ATOM   2646 C C   . GLN C 3  5   ? 12.756 -19.354 13.712  1.00 21.13  ? 5   GLN H C   1 
ATOM   2647 O O   . GLN C 3  5   ? 11.794 -19.845 14.294  1.00 21.69  ? 5   GLN H O   1 
ATOM   2648 C CB  . GLN C 3  5   ? 13.781 -21.507 12.924  1.00 26.80  ? 5   GLN H CB  1 
ATOM   2649 C CG  . GLN C 3  5   ? 13.214 -21.421 11.526  1.00 42.41  ? 5   GLN H CG  1 
ATOM   2650 C CD  . GLN C 3  5   ? 14.045 -20.520 10.617  1.00 53.43  ? 5   GLN H CD  1 
ATOM   2651 O OE1 . GLN C 3  5   ? 15.256 -20.741 10.437  1.00 62.43  ? 5   GLN H OE1 1 
ATOM   2652 N NE2 . GLN C 3  5   ? 13.403 -19.498 10.036  1.00 50.36  ? 5   GLN H NE2 1 
ATOM   2653 N N   . GLN C 3  6   ? 12.726 -18.139 13.169  1.00 20.24  ? 6   GLN H N   1 
ATOM   2654 C CA  . GLN C 3  6   ? 11.543 -17.287 13.274  1.00 20.00  ? 6   GLN H CA  1 
ATOM   2655 C C   . GLN C 3  6   ? 10.596 -17.398 12.083  1.00 22.46  ? 6   GLN H C   1 
ATOM   2656 O O   . GLN C 3  6   ? 11.015 -17.748 10.977  1.00 22.05  ? 6   GLN H O   1 
ATOM   2657 C CB  . GLN C 3  6   ? 11.975 -15.834 13.487  1.00 18.61  ? 6   GLN H CB  1 
ATOM   2658 C CG  . GLN C 3  6   ? 12.705 -15.645 14.801  1.00 19.39  ? 6   GLN H CG  1 
ATOM   2659 C CD  . GLN C 3  6   ? 12.856 -14.199 15.182  1.00 20.02  ? 6   GLN H CD  1 
ATOM   2660 O OE1 . GLN C 3  6   ? 13.966 -13.671 15.242  1.00 21.07  ? 6   GLN H OE1 1 
ATOM   2661 N NE2 . GLN C 3  6   ? 11.736 -13.542 15.440  1.00 20.07  ? 6   GLN H NE2 1 
ATOM   2662 N N   . SER C 3  7   ? 9.317  -17.113 12.321  1.00 19.73  ? 7   SER H N   1 
ATOM   2663 C CA  . SER C 3  7   ? 8.308  -17.204 11.275  1.00 19.33  ? 7   SER H CA  1 
ATOM   2664 C C   . SER C 3  7   ? 8.407  -16.037 10.302  1.00 22.58  ? 7   SER H C   1 
ATOM   2665 O O   . SER C 3  7   ? 9.072  -15.048 10.576  1.00 21.74  ? 7   SER H O   1 
ATOM   2666 C CB  . SER C 3  7   ? 6.906  -17.298 11.885  1.00 16.56  ? 7   SER H CB  1 
ATOM   2667 O OG  . SER C 3  7   ? 6.697  -16.286 12.851  1.00 22.58  ? 7   SER H OG  1 
ATOM   2668 N N   . GLY C 3  8   ? 7.743  -16.176 9.158   1.00 25.50  ? 8   GLY H N   1 
ATOM   2669 C CA  . GLY C 3  8   ? 7.800  -15.163 8.119   1.00 25.22  ? 8   GLY H CA  1 
ATOM   2670 C C   . GLY C 3  8   ? 7.216  -13.791 8.370   1.00 26.04  ? 8   GLY H C   1 
ATOM   2671 O O   . GLY C 3  8   ? 6.525  -13.559 9.365   1.00 25.46  ? 8   GLY H O   1 
ATOM   2672 N N   . PRO C 3  9   ? 7.469  -12.852 7.441   1.00 28.79  ? 9   PRO H N   1 
ATOM   2673 C CA  . PRO C 3  9   ? 6.965  -11.482 7.560   1.00 29.08  ? 9   PRO H CA  1 
ATOM   2674 C C   . PRO C 3  9   ? 5.438  -11.473 7.637   1.00 29.89  ? 9   PRO H C   1 
ATOM   2675 O O   . PRO C 3  9   ? 4.770  -12.345 7.067   1.00 28.57  ? 9   PRO H O   1 
ATOM   2676 C CB  . PRO C 3  9   ? 7.515  -10.802 6.301   1.00 28.23  ? 9   PRO H CB  1 
ATOM   2677 C CG  . PRO C 3  9   ? 7.518  -11.907 5.305   1.00 26.35  ? 9   PRO H CG  1 
ATOM   2678 C CD  . PRO C 3  9   ? 8.061  -13.075 6.106   1.00 28.52  ? 9   PRO H CD  1 
ATOM   2679 N N   . GLU C 3  10  ? 4.903  -10.486 8.350   1.00 29.42  ? 10  GLU H N   1 
ATOM   2680 C CA  . GLU C 3  10  ? 3.469  -10.353 8.542   1.00 30.16  ? 10  GLU H CA  1 
ATOM   2681 C C   . GLU C 3  10  ? 2.970  -8.973  8.147   1.00 30.71  ? 10  GLU H C   1 
ATOM   2682 O O   . GLU C 3  10  ? 3.627  -7.969  8.405   1.00 31.40  ? 10  GLU H O   1 
ATOM   2683 C CB  . GLU C 3  10  ? 3.114  -10.575 10.022  1.00 30.37  ? 10  GLU H CB  1 
ATOM   2684 C CG  . GLU C 3  10  ? 3.447  -11.948 10.620  1.00 33.70  ? 10  GLU H CG  1 
ATOM   2685 C CD  . GLU C 3  10  ? 2.509  -13.062 10.156  1.00 36.49  ? 10  GLU H CD  1 
ATOM   2686 O OE1 . GLU C 3  10  ? 1.290  -12.809 10.026  1.00 34.31  ? 10  GLU H OE1 1 
ATOM   2687 O OE2 . GLU C 3  10  ? 2.993  -14.199 9.938   1.00 42.94  ? 10  GLU H OE2 1 
ATOM   2688 N N   . VAL C 3  11  ? 1.811  -8.931  7.504   1.00 33.00  ? 11  VAL H N   1 
ATOM   2689 C CA  . VAL C 3  11  ? 1.174  -7.664  7.151   1.00 34.19  ? 11  VAL H CA  1 
ATOM   2690 C C   . VAL C 3  11  ? -0.119 -7.799  7.923   1.00 35.30  ? 11  VAL H C   1 
ATOM   2691 O O   . VAL C 3  11  ? -0.924 -8.681  7.635   1.00 38.29  ? 11  VAL H O   1 
ATOM   2692 C CB  . VAL C 3  11  ? 0.817  -7.527  5.642   1.00 35.01  ? 11  VAL H CB  1 
ATOM   2693 C CG1 . VAL C 3  11  ? -0.041 -6.280  5.430   1.00 34.26  ? 11  VAL H CG1 1 
ATOM   2694 C CG2 . VAL C 3  11  ? 2.075  -7.417  4.801   1.00 36.83  ? 11  VAL H CG2 1 
ATOM   2695 N N   . VAL C 3  12  ? -0.309 -6.957  8.923   1.00 35.72  ? 12  VAL H N   1 
ATOM   2696 C CA  . VAL C 3  12  ? -1.520 -7.041  9.714   1.00 37.80  ? 12  VAL H CA  1 
ATOM   2697 C C   . VAL C 3  12  ? -2.246 -5.698  9.739   1.00 38.97  ? 12  VAL H C   1 
ATOM   2698 O O   . VAL C 3  12  ? -1.613 -4.633  9.719   1.00 36.04  ? 12  VAL H O   1 
ATOM   2699 C CB  . VAL C 3  12  ? -1.191 -7.506  11.146  1.00 39.62  ? 12  VAL H CB  1 
ATOM   2700 C CG1 . VAL C 3  12  ? -0.438 -8.824  11.085  1.00 41.28  ? 12  VAL H CG1 1 
ATOM   2701 C CG2 . VAL C 3  12  ? -0.347 -6.473  11.847  1.00 38.99  ? 12  VAL H CG2 1 
ATOM   2702 N N   . LYS C 3  13  ? -3.577 -5.761  9.759   1.00 37.97  ? 13  LYS H N   1 
ATOM   2703 C CA  . LYS C 3  13  ? -4.406 -4.564  9.779   1.00 35.37  ? 13  LYS H CA  1 
ATOM   2704 C C   . LYS C 3  13  ? -4.329 -3.919  11.145  1.00 32.02  ? 13  LYS H C   1 
ATOM   2705 O O   . LYS C 3  13  ? -4.199 -4.604  12.156  1.00 31.56  ? 13  LYS H O   1 
ATOM   2706 C CB  . LYS C 3  13  ? -5.865 -4.913  9.479   1.00 35.01  ? 13  LYS H CB  1 
ATOM   2707 C CG  . LYS C 3  13  ? -6.063 -5.717  8.213   1.00 38.82  ? 13  LYS H CG  1 
ATOM   2708 C CD  . LYS C 3  13  ? -7.518 -6.084  8.023   1.00 41.47  ? 13  LYS H CD  1 
ATOM   2709 C CE  . LYS C 3  13  ? -8.041 -6.922  9.182   1.00 44.24  ? 13  LYS H CE  1 
ATOM   2710 N NZ  . LYS C 3  13  ? -9.498 -7.213  9.029   1.00 48.10  ? 13  LYS H NZ  1 
ATOM   2711 N N   . PRO C 3  14  ? -4.393 -2.584  11.193  1.00 29.33  ? 14  PRO H N   1 
ATOM   2712 C CA  . PRO C 3  14  ? -4.334 -1.896  12.480  1.00 26.59  ? 14  PRO H CA  1 
ATOM   2713 C C   . PRO C 3  14  ? -5.466 -2.408  13.374  1.00 29.75  ? 14  PRO H C   1 
ATOM   2714 O O   . PRO C 3  14  ? -6.543 -2.758  12.880  1.00 33.01  ? 14  PRO H O   1 
ATOM   2715 C CB  . PRO C 3  14  ? -4.528 -0.438  12.091  1.00 24.53  ? 14  PRO H CB  1 
ATOM   2716 C CG  . PRO C 3  14  ? -3.932 -0.375  10.732  1.00 25.52  ? 14  PRO H CG  1 
ATOM   2717 C CD  . PRO C 3  14  ? -4.419 -1.623  10.077  1.00 27.85  ? 14  PRO H CD  1 
ATOM   2718 N N   . GLY C 3  15  ? -5.223 -2.452  14.681  1.00 29.36  ? 15  GLY H N   1 
ATOM   2719 C CA  . GLY C 3  15  ? -6.237 -2.913  15.611  1.00 29.62  ? 15  GLY H CA  1 
ATOM   2720 C C   . GLY C 3  15  ? -6.278 -4.417  15.833  1.00 32.50  ? 15  GLY H C   1 
ATOM   2721 O O   . GLY C 3  15  ? -6.734 -4.883  16.881  1.00 31.14  ? 15  GLY H O   1 
ATOM   2722 N N   . ALA C 3  16  ? -5.808 -5.179  14.847  1.00 33.76  ? 16  ALA H N   1 
ATOM   2723 C CA  . ALA C 3  16  ? -5.796 -6.637  14.938  1.00 30.81  ? 16  ALA H CA  1 
ATOM   2724 C C   . ALA C 3  16  ? -4.607 -7.122  15.763  1.00 30.37  ? 16  ALA H C   1 
ATOM   2725 O O   . ALA C 3  16  ? -3.815 -6.321  16.271  1.00 30.16  ? 16  ALA H O   1 
ATOM   2726 C CB  . ALA C 3  16  ? -5.746 -7.249  13.538  1.00 28.51  ? 16  ALA H CB  1 
ATOM   2727 N N   . SER C 3  17  ? -4.496 -8.440  15.904  1.00 28.94  ? 17  SER H N   1 
ATOM   2728 C CA  . SER C 3  17  ? -3.398 -9.039  16.650  1.00 28.33  ? 17  SER H CA  1 
ATOM   2729 C C   . SER C 3  17  ? -2.541 -9.882  15.716  1.00 24.87  ? 17  SER H C   1 
ATOM   2730 O O   . SER C 3  17  ? -2.942 -10.202 14.597  1.00 26.19  ? 17  SER H O   1 
ATOM   2731 C CB  . SER C 3  17  ? -3.924 -9.931  17.780  1.00 27.56  ? 17  SER H CB  1 
ATOM   2732 O OG  . SER C 3  17  ? -4.619 -9.174  18.747  1.00 32.47  ? 17  SER H OG  1 
ATOM   2733 N N   . VAL C 3  18  ? -1.353 -10.231 16.184  1.00 23.69  ? 18  VAL H N   1 
ATOM   2734 C CA  . VAL C 3  18  ? -0.448 -11.061 15.409  1.00 22.65  ? 18  VAL H CA  1 
ATOM   2735 C C   . VAL C 3  18  ? 0.324  -11.890 16.418  1.00 20.06  ? 18  VAL H C   1 
ATOM   2736 O O   . VAL C 3  18  ? 0.545  -11.455 17.541  1.00 17.77  ? 18  VAL H O   1 
ATOM   2737 C CB  . VAL C 3  18  ? 0.528  -10.209 14.556  1.00 21.20  ? 18  VAL H CB  1 
ATOM   2738 C CG1 . VAL C 3  18  ? 1.597  -9.593  15.435  1.00 21.07  ? 18  VAL H CG1 1 
ATOM   2739 C CG2 . VAL C 3  18  ? 1.132  -11.058 13.459  1.00 21.77  ? 18  VAL H CG2 1 
ATOM   2740 N N   . LYS C 3  19  ? 0.703  -13.097 16.027  1.00 20.24  ? 19  LYS H N   1 
ATOM   2741 C CA  . LYS C 3  19  ? 1.452  -13.981 16.910  1.00 21.07  ? 19  LYS H CA  1 
ATOM   2742 C C   . LYS C 3  19  ? 2.555  -14.606 16.072  1.00 21.82  ? 19  LYS H C   1 
ATOM   2743 O O   . LYS C 3  19  ? 2.288  -15.264 15.073  1.00 22.86  ? 19  LYS H O   1 
ATOM   2744 C CB  . LYS C 3  19  ? 0.518  -15.054 17.496  1.00 20.15  ? 19  LYS H CB  1 
ATOM   2745 C CG  . LYS C 3  19  ? 1.147  -15.988 18.518  1.00 13.91  ? 19  LYS H CG  1 
ATOM   2746 C CD  . LYS C 3  19  ? 0.084  -16.853 19.156  1.00 15.08  ? 19  LYS H CD  1 
ATOM   2747 C CE  . LYS C 3  19  ? 0.708  -17.962 19.965  1.00 16.68  ? 19  LYS H CE  1 
ATOM   2748 N NZ  . LYS C 3  19  ? -0.321 -18.849 20.568  1.00 20.48  ? 19  LYS H NZ  1 
ATOM   2749 N N   . ILE C 3  20  ? 3.799  -14.380 16.479  1.00 24.23  ? 20  ILE H N   1 
ATOM   2750 C CA  . ILE C 3  20  ? 4.947  -14.899 15.750  1.00 23.75  ? 20  ILE H CA  1 
ATOM   2751 C C   . ILE C 3  20  ? 5.671  -15.970 16.546  1.00 21.96  ? 20  ILE H C   1 
ATOM   2752 O O   . ILE C 3  20  ? 5.625  -15.979 17.781  1.00 20.98  ? 20  ILE H O   1 
ATOM   2753 C CB  . ILE C 3  20  ? 5.916  -13.756 15.378  1.00 26.12  ? 20  ILE H CB  1 
ATOM   2754 C CG1 . ILE C 3  20  ? 6.458  -13.090 16.638  1.00 24.60  ? 20  ILE H CG1 1 
ATOM   2755 C CG2 . ILE C 3  20  ? 5.178  -12.730 14.502  1.00 24.35  ? 20  ILE H CG2 1 
ATOM   2756 C CD1 . ILE C 3  20  ? 7.336  -11.875 16.349  1.00 26.83  ? 20  ILE H CD1 1 
ATOM   2757 N N   . SER C 3  21  ? 6.340  -16.872 15.832  1.00 20.27  ? 21  SER H N   1 
ATOM   2758 C CA  . SER C 3  21  ? 7.037  -17.975 16.477  1.00 20.49  ? 21  SER H CA  1 
ATOM   2759 C C   . SER C 3  21  ? 8.545  -17.937 16.344  1.00 20.09  ? 21  SER H C   1 
ATOM   2760 O O   . SER C 3  21  ? 9.103  -17.282 15.461  1.00 20.01  ? 21  SER H O   1 
ATOM   2761 C CB  . SER C 3  21  ? 6.516  -19.324 15.954  1.00 20.12  ? 21  SER H CB  1 
ATOM   2762 O OG  . SER C 3  21  ? 6.896  -19.549 14.607  1.00 21.12  ? 21  SER H OG  1 
ATOM   2763 N N   . CYS C 3  22  ? 9.184  -18.674 17.243  1.00 21.03  ? 22  CYS H N   1 
ATOM   2764 C CA  . CYS C 3  22  ? 10.636 -18.775 17.329  1.00 22.08  ? 22  CYS H CA  1 
ATOM   2765 C C   . CYS C 3  22  ? 10.958 -20.226 17.708  1.00 18.76  ? 22  CYS H C   1 
ATOM   2766 O O   . CYS C 3  22  ? 10.894 -20.602 18.880  1.00 19.03  ? 22  CYS H O   1 
ATOM   2767 C CB  . CYS C 3  22  ? 11.125 -17.812 18.417  1.00 22.77  ? 22  CYS H CB  1 
ATOM   2768 S SG  . CYS C 3  22  ? 12.904 -17.811 18.759  1.00 27.34  ? 22  CYS H SG  1 
ATOM   2769 N N   . LYS C 3  23  ? 11.280 -21.041 16.713  1.00 19.71  ? 23  LYS H N   1 
ATOM   2770 C CA  . LYS C 3  23  ? 11.576 -22.435 16.978  1.00 21.70  ? 23  LYS H CA  1 
ATOM   2771 C C   . LYS C 3  23  ? 13.040 -22.632 17.282  1.00 24.50  ? 23  LYS H C   1 
ATOM   2772 O O   . LYS C 3  23  ? 13.905 -22.322 16.460  1.00 24.37  ? 23  LYS H O   1 
ATOM   2773 C CB  . LYS C 3  23  ? 11.182 -23.326 15.798  1.00 27.20  ? 23  LYS H CB  1 
ATOM   2774 C CG  . LYS C 3  23  ? 11.382 -24.799 16.118  1.00 32.26  ? 23  LYS H CG  1 
ATOM   2775 C CD  . LYS C 3  23  ? 11.282 -25.690 14.902  1.00 40.51  ? 23  LYS H CD  1 
ATOM   2776 C CE  . LYS C 3  23  ? 11.682 -27.112 15.280  1.00 44.89  ? 23  LYS H CE  1 
ATOM   2777 N NZ  . LYS C 3  23  ? 10.942 -27.614 16.476  1.00 42.08  ? 23  LYS H NZ  1 
ATOM   2778 N N   . ALA C 3  24  ? 13.304 -23.160 18.473  1.00 24.11  ? 24  ALA H N   1 
ATOM   2779 C CA  . ALA C 3  24  ? 14.659 -23.410 18.928  1.00 25.14  ? 24  ALA H CA  1 
ATOM   2780 C C   . ALA C 3  24  ? 15.084 -24.833 18.585  1.00 28.76  ? 24  ALA H C   1 
ATOM   2781 O O   . ALA C 3  24  ? 14.279 -25.768 18.634  1.00 29.30  ? 24  ALA H O   1 
ATOM   2782 C CB  . ALA C 3  24  ? 14.739 -23.191 20.423  1.00 23.49  ? 24  ALA H CB  1 
ATOM   2783 N N   . SER C 3  25  ? 16.348 -24.994 18.221  1.00 29.22  ? 25  SER H N   1 
ATOM   2784 C CA  . SER C 3  25  ? 16.867 -26.312 17.902  1.00 30.35  ? 25  SER H CA  1 
ATOM   2785 C C   . SER C 3  25  ? 18.360 -26.310 18.139  1.00 30.29  ? 25  SER H C   1 
ATOM   2786 O O   . SER C 3  25  ? 18.987 -25.255 18.134  1.00 30.36  ? 25  SER H O   1 
ATOM   2787 C CB  . SER C 3  25  ? 16.555 -26.680 16.449  1.00 31.33  ? 25  SER H CB  1 
ATOM   2788 O OG  . SER C 3  25  ? 17.213 -25.820 15.544  1.00 35.93  ? 25  SER H OG  1 
ATOM   2789 N N   . GLY C 3  26  ? 18.927 -27.486 18.380  1.00 31.20  ? 26  GLY H N   1 
ATOM   2790 C CA  . GLY C 3  26  ? 20.357 -27.565 18.606  1.00 32.07  ? 26  GLY H CA  1 
ATOM   2791 C C   . GLY C 3  26  ? 20.794 -27.460 20.055  1.00 31.09  ? 26  GLY H C   1 
ATOM   2792 O O   . GLY C 3  26  ? 21.985 -27.405 20.331  1.00 32.79  ? 26  GLY H O   1 
ATOM   2793 N N   . TYR C 3  27  ? 19.837 -27.422 20.977  1.00 31.38  ? 27  TYR H N   1 
ATOM   2794 C CA  . TYR C 3  27  ? 20.143 -27.338 22.402  1.00 31.57  ? 27  TYR H CA  1 
ATOM   2795 C C   . TYR C 3  27  ? 18.874 -27.594 23.218  1.00 33.48  ? 27  TYR H C   1 
ATOM   2796 O O   . TYR C 3  27  ? 17.780 -27.666 22.657  1.00 35.49  ? 27  TYR H O   1 
ATOM   2797 C CB  . TYR C 3  27  ? 20.710 -25.958 22.752  1.00 29.88  ? 27  TYR H CB  1 
ATOM   2798 C CG  . TYR C 3  27  ? 19.689 -24.840 22.732  1.00 30.17  ? 27  TYR H CG  1 
ATOM   2799 C CD1 . TYR C 3  27  ? 19.382 -24.162 21.550  1.00 28.87  ? 27  TYR H CD1 1 
ATOM   2800 C CD2 . TYR C 3  27  ? 19.030 -24.458 23.901  1.00 26.12  ? 27  TYR H CD2 1 
ATOM   2801 C CE1 . TYR C 3  27  ? 18.445 -23.127 21.535  1.00 27.16  ? 27  TYR H CE1 1 
ATOM   2802 C CE2 . TYR C 3  27  ? 18.090 -23.432 23.899  1.00 27.70  ? 27  TYR H CE2 1 
ATOM   2803 C CZ  . TYR C 3  27  ? 17.801 -22.766 22.713  1.00 27.77  ? 27  TYR H CZ  1 
ATOM   2804 O OH  . TYR C 3  27  ? 16.869 -21.747 22.714  1.00 26.71  ? 27  TYR H OH  1 
ATOM   2805 N N   . SER C 3  28  ? 19.016 -27.731 24.535  1.00 32.24  ? 28  SER H N   1 
ATOM   2806 C CA  . SER C 3  28  ? 17.855 -27.963 25.390  1.00 33.93  ? 28  SER H CA  1 
ATOM   2807 C C   . SER C 3  28  ? 17.070 -26.670 25.609  1.00 31.90  ? 28  SER H C   1 
ATOM   2808 O O   . SER C 3  28  ? 17.461 -25.811 26.394  1.00 31.15  ? 28  SER H O   1 
ATOM   2809 C CB  . SER C 3  28  ? 18.278 -28.530 26.740  1.00 36.77  ? 28  SER H CB  1 
ATOM   2810 O OG  . SER C 3  28  ? 17.135 -28.786 27.540  1.00 43.40  ? 28  SER H OG  1 
ATOM   2811 N N   . PHE C 3  29  ? 15.958 -26.555 24.892  1.00 31.62  ? 29  PHE H N   1 
ATOM   2812 C CA  . PHE C 3  29  ? 15.072 -25.397 24.932  1.00 29.60  ? 29  PHE H CA  1 
ATOM   2813 C C   . PHE C 3  29  ? 14.656 -24.940 26.333  1.00 28.31  ? 29  PHE H C   1 
ATOM   2814 O O   . PHE C 3  29  ? 14.644 -23.747 26.627  1.00 28.50  ? 29  PHE H O   1 
ATOM   2815 C CB  . PHE C 3  29  ? 13.826 -25.729 24.102  1.00 28.46  ? 29  PHE H CB  1 
ATOM   2816 C CG  . PHE C 3  29  ? 12.721 -24.721 24.215  1.00 30.09  ? 29  PHE H CG  1 
ATOM   2817 C CD1 . PHE C 3  29  ? 12.825 -23.472 23.596  1.00 33.21  ? 29  PHE H CD1 1 
ATOM   2818 C CD2 . PHE C 3  29  ? 11.560 -25.025 24.929  1.00 29.25  ? 29  PHE H CD2 1 
ATOM   2819 C CE1 . PHE C 3  29  ? 11.785 -22.540 23.687  1.00 35.18  ? 29  PHE H CE1 1 
ATOM   2820 C CE2 . PHE C 3  29  ? 10.513 -24.104 25.030  1.00 31.15  ? 29  PHE H CE2 1 
ATOM   2821 C CZ  . PHE C 3  29  ? 10.623 -22.860 24.408  1.00 32.88  ? 29  PHE H CZ  1 
ATOM   2822 N N   . THR C 3  30  ? 14.320 -25.897 27.191  1.00 30.15  ? 30  THR H N   1 
ATOM   2823 C CA  . THR C 3  30  ? 13.845 -25.609 28.540  1.00 29.28  ? 30  THR H CA  1 
ATOM   2824 C C   . THR C 3  30  ? 14.870 -25.139 29.556  1.00 29.18  ? 30  THR H C   1 
ATOM   2825 O O   . THR C 3  30  ? 14.503 -24.773 30.667  1.00 31.56  ? 30  THR H O   1 
ATOM   2826 C CB  . THR C 3  30  ? 13.130 -26.834 29.126  1.00 31.70  ? 30  THR H CB  1 
ATOM   2827 O OG1 . THR C 3  30  ? 14.048 -27.936 29.176  1.00 36.88  ? 30  THR H OG1 1 
ATOM   2828 C CG2 . THR C 3  30  ? 11.927 -27.209 28.264  1.00 29.73  ? 30  THR H CG2 1 
ATOM   2829 N N   . ASN C 3  31  ? 16.147 -25.138 29.188  1.00 29.11  ? 31  ASN H N   1 
ATOM   2830 C CA  . ASN C 3  31  ? 17.194 -24.694 30.105  1.00 29.24  ? 31  ASN H CA  1 
ATOM   2831 C C   . ASN C 3  31  ? 17.704 -23.264 29.866  1.00 28.82  ? 31  ASN H C   1 
ATOM   2832 O O   . ASN C 3  31  ? 18.571 -22.785 30.595  1.00 31.58  ? 31  ASN H O   1 
ATOM   2833 C CB  . ASN C 3  31  ? 18.374 -25.671 30.071  1.00 33.50  ? 31  ASN H CB  1 
ATOM   2834 C CG  . ASN C 3  31  ? 18.012 -27.036 30.632  1.00 38.82  ? 31  ASN H CG  1 
ATOM   2835 O OD1 . ASN C 3  31  ? 17.623 -27.163 31.792  1.00 41.90  ? 31  ASN H OD1 1 
ATOM   2836 N ND2 . ASN C 3  31  ? 18.133 -28.062 29.806  1.00 44.46  ? 31  ASN H ND2 1 
ATOM   2837 N N   . PHE C 3  32  ? 17.173 -22.579 28.861  1.00 24.59  ? 32  PHE H N   1 
ATOM   2838 C CA  . PHE C 3  32  ? 17.602 -21.213 28.583  1.00 21.73  ? 32  PHE H CA  1 
ATOM   2839 C C   . PHE C 3  32  ? 16.431 -20.252 28.415  1.00 22.12  ? 32  PHE H C   1 
ATOM   2840 O O   . PHE C 3  32  ? 15.351 -20.632 27.956  1.00 22.39  ? 32  PHE H O   1 
ATOM   2841 C CB  . PHE C 3  32  ? 18.439 -21.146 27.301  1.00 22.72  ? 32  PHE H CB  1 
ATOM   2842 C CG  . PHE C 3  32  ? 19.698 -21.951 27.350  1.00 24.16  ? 32  PHE H CG  1 
ATOM   2843 C CD1 . PHE C 3  32  ? 19.675 -23.317 27.094  1.00 25.41  ? 32  PHE H CD1 1 
ATOM   2844 C CD2 . PHE C 3  32  ? 20.911 -21.341 27.659  1.00 22.90  ? 32  PHE H CD2 1 
ATOM   2845 C CE1 . PHE C 3  32  ? 20.840 -24.063 27.146  1.00 28.09  ? 32  PHE H CE1 1 
ATOM   2846 C CE2 . PHE C 3  32  ? 22.081 -22.074 27.714  1.00 25.05  ? 32  PHE H CE2 1 
ATOM   2847 C CZ  . PHE C 3  32  ? 22.048 -23.441 27.457  1.00 27.08  ? 32  PHE H CZ  1 
ATOM   2848 N N   . TYR C 3  33  ? 16.665 -19.000 28.789  1.00 20.67  ? 33  TYR H N   1 
ATOM   2849 C CA  . TYR C 3  33  ? 15.670 -17.957 28.628  1.00 17.27  ? 33  TYR H CA  1 
ATOM   2850 C C   . TYR C 3  33  ? 15.637 -17.553 27.155  1.00 21.54  ? 33  TYR H C   1 
ATOM   2851 O O   . TYR C 3  33  ? 16.657 -17.591 26.466  1.00 19.47  ? 33  TYR H O   1 
ATOM   2852 C CB  . TYR C 3  33  ? 16.057 -16.687 29.387  1.00 19.61  ? 33  TYR H CB  1 
ATOM   2853 C CG  . TYR C 3  33  ? 16.062 -16.764 30.892  1.00 22.58  ? 33  TYR H CG  1 
ATOM   2854 C CD1 . TYR C 3  33  ? 17.142 -17.319 31.585  1.00 20.50  ? 33  TYR H CD1 1 
ATOM   2855 C CD2 . TYR C 3  33  ? 15.003 -16.236 31.629  1.00 20.05  ? 33  TYR H CD2 1 
ATOM   2856 C CE1 . TYR C 3  33  ? 17.162 -17.340 32.971  1.00 21.22  ? 33  TYR H CE1 1 
ATOM   2857 C CE2 . TYR C 3  33  ? 15.017 -16.255 33.007  1.00 18.44  ? 33  TYR H CE2 1 
ATOM   2858 C CZ  . TYR C 3  33  ? 16.094 -16.805 33.672  1.00 18.79  ? 33  TYR H CZ  1 
ATOM   2859 O OH  . TYR C 3  33  ? 16.090 -16.823 35.042  1.00 22.36  ? 33  TYR H OH  1 
ATOM   2860 N N   . ILE C 3  34  ? 14.465 -17.165 26.675  1.00 20.58  ? 34  ILE H N   1 
ATOM   2861 C CA  . ILE C 3  34  ? 14.358 -16.659 25.325  1.00 19.86  ? 34  ILE H CA  1 
ATOM   2862 C C   . ILE C 3  34  ? 13.830 -15.249 25.509  1.00 18.17  ? 34  ILE H C   1 
ATOM   2863 O O   . ILE C 3  34  ? 12.831 -15.035 26.189  1.00 18.42  ? 34  ILE H O   1 
ATOM   2864 C CB  . ILE C 3  34  ? 13.407 -17.499 24.443  1.00 22.65  ? 34  ILE H CB  1 
ATOM   2865 C CG1 . ILE C 3  34  ? 14.105 -18.810 24.080  1.00 23.49  ? 34  ILE H CG1 1 
ATOM   2866 C CG2 . ILE C 3  34  ? 13.031 -16.729 23.167  1.00 17.40  ? 34  ILE H CG2 1 
ATOM   2867 C CD1 . ILE C 3  34  ? 13.361 -19.647 23.090  1.00 34.91  ? 34  ILE H CD1 1 
ATOM   2868 N N   . HIS C 3  35  ? 14.543 -14.287 24.935  1.00 18.91  ? 35  HIS H N   1 
ATOM   2869 C CA  . HIS C 3  35  ? 14.175 -12.879 25.015  1.00 17.93  ? 35  HIS H CA  1 
ATOM   2870 C C   . HIS C 3  35  ? 13.606 -12.453 23.689  1.00 17.25  ? 35  HIS H C   1 
ATOM   2871 O O   . HIS C 3  35  ? 13.946 -13.012 22.644  1.00 16.22  ? 35  HIS H O   1 
ATOM   2872 C CB  . HIS C 3  35  ? 15.405 -12.002 25.255  1.00 17.84  ? 35  HIS H CB  1 
ATOM   2873 C CG  . HIS C 3  35  ? 16.027 -12.174 26.601  1.00 18.70  ? 35  HIS H CG  1 
ATOM   2874 N ND1 . HIS C 3  35  ? 15.622 -11.452 27.703  1.00 17.85  ? 35  HIS H ND1 1 
ATOM   2875 C CD2 . HIS C 3  35  ? 17.012 -12.998 27.027  1.00 18.45  ? 35  HIS H CD2 1 
ATOM   2876 C CE1 . HIS C 3  35  ? 16.330 -11.826 28.752  1.00 17.34  ? 35  HIS H CE1 1 
ATOM   2877 N NE2 . HIS C 3  35  ? 17.179 -12.763 28.370  1.00 23.05  ? 35  HIS H NE2 1 
ATOM   2878 N N   . TRP C 3  36  ? 12.757 -11.440 23.736  1.00 17.06  ? 36  TRP H N   1 
ATOM   2879 C CA  . TRP C 3  36  ? 12.178 -10.884 22.537  1.00 17.40  ? 36  TRP H CA  1 
ATOM   2880 C C   . TRP C 3  36  ? 12.591 -9.423  22.486  1.00 20.65  ? 36  TRP H C   1 
ATOM   2881 O O   . TRP C 3  36  ? 12.515 -8.713  23.497  1.00 20.42  ? 36  TRP H O   1 
ATOM   2882 C CB  . TRP C 3  36  ? 10.658 -11.026 22.552  1.00 14.81  ? 36  TRP H CB  1 
ATOM   2883 C CG  . TRP C 3  36  ? 10.227 -12.441 22.376  1.00 16.31  ? 36  TRP H CG  1 
ATOM   2884 C CD1 . TRP C 3  36  ? 10.062 -13.374 23.354  1.00 16.38  ? 36  TRP H CD1 1 
ATOM   2885 C CD2 . TRP C 3  36  ? 9.931  -13.096 21.140  1.00 16.76  ? 36  TRP H CD2 1 
ATOM   2886 N NE1 . TRP C 3  36  ? 9.672  -14.573 22.802  1.00 18.61  ? 36  TRP H NE1 1 
ATOM   2887 C CE2 . TRP C 3  36  ? 9.584  -14.427 21.444  1.00 14.89  ? 36  TRP H CE2 1 
ATOM   2888 C CE3 . TRP C 3  36  ? 9.925  -12.684 19.800  1.00 16.79  ? 36  TRP H CE3 1 
ATOM   2889 C CZ2 . TRP C 3  36  ? 9.228  -15.353 20.459  1.00 16.62  ? 36  TRP H CZ2 1 
ATOM   2890 C CZ3 . TRP C 3  36  ? 9.574  -13.604 18.820  1.00 18.09  ? 36  TRP H CZ3 1 
ATOM   2891 C CH2 . TRP C 3  36  ? 9.228  -14.922 19.156  1.00 15.48  ? 36  TRP H CH2 1 
ATOM   2892 N N   . VAL C 3  37  ? 13.041 -8.992  21.307  1.00 21.22  ? 37  VAL H N   1 
ATOM   2893 C CA  . VAL C 3  37  ? 13.508 -7.623  21.093  1.00 21.12  ? 37  VAL H CA  1 
ATOM   2894 C C   . VAL C 3  37  ? 12.827 -6.956  19.892  1.00 20.73  ? 37  VAL H C   1 
ATOM   2895 O O   . VAL C 3  37  ? 12.664 -7.556  18.829  1.00 20.07  ? 37  VAL H O   1 
ATOM   2896 C CB  . VAL C 3  37  ? 15.053 -7.592  20.900  1.00 18.44  ? 37  VAL H CB  1 
ATOM   2897 C CG1 . VAL C 3  37  ? 15.533 -6.159  20.748  1.00 16.30  ? 37  VAL H CG1 1 
ATOM   2898 C CG2 . VAL C 3  37  ? 15.742 -8.234  22.107  1.00 19.50  ? 37  VAL H CG2 1 
ATOM   2899 N N   . LYS C 3  38  ? 12.421 -5.705  20.082  1.00 22.62  ? 38  LYS H N   1 
ATOM   2900 C CA  . LYS C 3  38  ? 11.754 -4.940  19.037  1.00 23.33  ? 38  LYS H CA  1 
ATOM   2901 C C   . LYS C 3  38  ? 12.677 -3.881  18.444  1.00 24.44  ? 38  LYS H C   1 
ATOM   2902 O O   . LYS C 3  38  ? 13.477 -3.270  19.157  1.00 22.74  ? 38  LYS H O   1 
ATOM   2903 C CB  . LYS C 3  38  ? 10.519 -4.241  19.616  1.00 25.38  ? 38  LYS H CB  1 
ATOM   2904 C CG  . LYS C 3  38  ? 9.814  -3.306  18.638  1.00 21.63  ? 38  LYS H CG  1 
ATOM   2905 C CD  . LYS C 3  38  ? 8.753  -2.488  19.343  1.00 20.47  ? 38  LYS H CD  1 
ATOM   2906 C CE  . LYS C 3  38  ? 7.970  -1.663  18.346  1.00 25.50  ? 38  LYS H CE  1 
ATOM   2907 N NZ  . LYS C 3  38  ? 6.864  -0.917  19.009  1.00 30.98  ? 38  LYS H NZ  1 
ATOM   2908 N N   . GLN C 3  39  ? 12.561 -3.664  17.139  1.00 23.89  ? 39  GLN H N   1 
ATOM   2909 C CA  . GLN C 3  39  ? 13.354 -2.633  16.485  1.00 24.42  ? 39  GLN H CA  1 
ATOM   2910 C C   . GLN C 3  39  ? 12.551 -1.977  15.365  1.00 24.74  ? 39  GLN H C   1 
ATOM   2911 O O   . GLN C 3  39  ? 12.315 -2.569  14.310  1.00 21.84  ? 39  GLN H O   1 
ATOM   2912 C CB  . GLN C 3  39  ? 14.660 -3.204  15.932  1.00 26.03  ? 39  GLN H CB  1 
ATOM   2913 C CG  . GLN C 3  39  ? 15.538 -2.137  15.261  1.00 26.88  ? 39  GLN H CG  1 
ATOM   2914 C CD  . GLN C 3  39  ? 16.936 -2.635  14.966  1.00 29.10  ? 39  GLN H CD  1 
ATOM   2915 O OE1 . GLN C 3  39  ? 17.117 -3.655  14.306  1.00 27.86  ? 39  GLN H OE1 1 
ATOM   2916 N NE2 . GLN C 3  39  ? 17.934 -1.915  15.458  1.00 29.42  ? 39  GLN H NE2 1 
ATOM   2917 N N   . ARG C 3  40  ? 12.121 -0.746  15.620  1.00 28.00  ? 40  ARG H N   1 
ATOM   2918 C CA  . ARG C 3  40  ? 11.343 0.007   14.651  1.00 31.64  ? 40  ARG H CA  1 
ATOM   2919 C C   . ARG C 3  40  ? 12.271 0.476   13.550  1.00 32.85  ? 40  ARG H C   1 
ATOM   2920 O O   . ARG C 3  40  ? 13.481 0.544   13.740  1.00 34.61  ? 40  ARG H O   1 
ATOM   2921 C CB  . ARG C 3  40  ? 10.667 1.201   15.329  1.00 33.24  ? 40  ARG H CB  1 
ATOM   2922 C CG  . ARG C 3  40  ? 9.595  0.801   16.326  1.00 36.43  ? 40  ARG H CG  1 
ATOM   2923 C CD  . ARG C 3  40  ? 8.907  2.012   16.926  1.00 41.08  ? 40  ARG H CD  1 
ATOM   2924 N NE  . ARG C 3  40  ? 8.317  2.849   15.887  1.00 47.47  ? 40  ARG H NE  1 
ATOM   2925 C CZ  . ARG C 3  40  ? 7.748  4.030   16.107  1.00 49.80  ? 40  ARG H CZ  1 
ATOM   2926 N NH1 . ARG C 3  40  ? 7.681  4.521   17.341  1.00 48.53  ? 40  ARG H NH1 1 
ATOM   2927 N NH2 . ARG C 3  40  ? 7.263  4.729   15.087  1.00 50.85  ? 40  ARG H NH2 1 
ATOM   2928 N N   . PRO C 3  41  ? 11.718 0.797   12.375  1.00 34.99  ? 41  PRO H N   1 
ATOM   2929 C CA  . PRO C 3  41  ? 12.557 1.254   11.268  1.00 34.96  ? 41  PRO H CA  1 
ATOM   2930 C C   . PRO C 3  41  ? 13.467 2.404   11.678  1.00 35.07  ? 41  PRO H C   1 
ATOM   2931 O O   . PRO C 3  41  ? 13.025 3.395   12.261  1.00 33.75  ? 41  PRO H O   1 
ATOM   2932 C CB  . PRO C 3  41  ? 11.536 1.664   10.209  1.00 37.92  ? 41  PRO H CB  1 
ATOM   2933 C CG  . PRO C 3  41  ? 10.383 0.731   10.476  1.00 35.97  ? 41  PRO H CG  1 
ATOM   2934 C CD  . PRO C 3  41  ? 10.296 0.773   11.985  1.00 34.79  ? 41  PRO H CD  1 
ATOM   2935 N N   . GLY C 3  42  ? 14.752 2.246   11.391  1.00 36.28  ? 42  GLY H N   1 
ATOM   2936 C CA  . GLY C 3  42  ? 15.712 3.281   11.710  1.00 33.58  ? 42  GLY H CA  1 
ATOM   2937 C C   . GLY C 3  42  ? 15.900 3.595   13.175  1.00 33.81  ? 42  GLY H C   1 
ATOM   2938 O O   . GLY C 3  42  ? 16.482 4.623   13.500  1.00 36.01  ? 42  GLY H O   1 
ATOM   2939 N N   . GLN C 3  43  ? 15.430 2.733   14.070  1.00 32.93  ? 43  GLN H N   1 
ATOM   2940 C CA  . GLN C 3  43  ? 15.609 2.997   15.496  1.00 32.55  ? 43  GLN H CA  1 
ATOM   2941 C C   . GLN C 3  43  ? 16.389 1.940   16.279  1.00 30.11  ? 43  GLN H C   1 
ATOM   2942 O O   . GLN C 3  43  ? 16.868 0.946   15.722  1.00 30.82  ? 43  GLN H O   1 
ATOM   2943 C CB  . GLN C 3  43  ? 14.258 3.242   16.158  1.00 36.61  ? 43  GLN H CB  1 
ATOM   2944 C CG  . GLN C 3  43  ? 13.604 4.522   15.690  1.00 45.89  ? 43  GLN H CG  1 
ATOM   2945 C CD  . GLN C 3  43  ? 12.295 4.773   16.387  1.00 54.36  ? 43  GLN H CD  1 
ATOM   2946 O OE1 . GLN C 3  43  ? 12.232 4.811   17.618  1.00 60.57  ? 43  GLN H OE1 1 
ATOM   2947 N NE2 . GLN C 3  43  ? 11.233 4.942   15.607  1.00 56.33  ? 43  GLN H NE2 1 
ATOM   2948 N N   . GLY C 3  44  ? 16.512 2.170   17.578  1.00 26.77  ? 44  GLY H N   1 
ATOM   2949 C CA  . GLY C 3  44  ? 17.259 1.260   18.424  1.00 26.29  ? 44  GLY H CA  1 
ATOM   2950 C C   . GLY C 3  44  ? 16.582 -0.049  18.772  1.00 26.57  ? 44  GLY H C   1 
ATOM   2951 O O   . GLY C 3  44  ? 15.552 -0.427  18.199  1.00 26.58  ? 44  GLY H O   1 
ATOM   2952 N N   . LEU C 3  45  ? 17.179 -0.741  19.733  1.00 25.09  ? 45  LEU H N   1 
ATOM   2953 C CA  . LEU C 3  45  ? 16.680 -2.025  20.188  1.00 24.56  ? 45  LEU H CA  1 
ATOM   2954 C C   . LEU C 3  45  ? 15.979 -1.878  21.531  1.00 24.66  ? 45  LEU H C   1 
ATOM   2955 O O   . LEU C 3  45  ? 16.493 -1.232  22.442  1.00 25.83  ? 45  LEU H O   1 
ATOM   2956 C CB  . LEU C 3  45  ? 17.844 -3.011  20.322  1.00 21.60  ? 45  LEU H CB  1 
ATOM   2957 C CG  . LEU C 3  45  ? 18.619 -3.361  19.050  1.00 20.52  ? 45  LEU H CG  1 
ATOM   2958 C CD1 . LEU C 3  45  ? 19.865 -4.157  19.421  1.00 20.03  ? 45  LEU H CD1 1 
ATOM   2959 C CD2 . LEU C 3  45  ? 17.726 -4.150  18.105  1.00 21.09  ? 45  LEU H CD2 1 
ATOM   2960 N N   . GLU C 3  46  ? 14.802 -2.487  21.642  1.00 25.71  ? 46  GLU H N   1 
ATOM   2961 C CA  . GLU C 3  46  ? 14.014 -2.449  22.871  1.00 24.84  ? 46  GLU H CA  1 
ATOM   2962 C C   . GLU C 3  46  ? 13.725 -3.861  23.363  1.00 24.26  ? 46  GLU H C   1 
ATOM   2963 O O   . GLU C 3  46  ? 13.237 -4.701  22.604  1.00 20.85  ? 46  GLU H O   1 
ATOM   2964 C CB  . GLU C 3  46  ? 12.667 -1.793  22.628  1.00 27.14  ? 46  GLU H CB  1 
ATOM   2965 C CG  . GLU C 3  46  ? 12.681 -0.358  22.259  1.00 31.42  ? 46  GLU H CG  1 
ATOM   2966 C CD  . GLU C 3  46  ? 11.284 0.102   21.938  1.00 38.17  ? 46  GLU H CD  1 
ATOM   2967 O OE1 . GLU C 3  46  ? 10.942 0.142   20.730  1.00 42.27  ? 46  GLU H OE1 1 
ATOM   2968 O OE2 . GLU C 3  46  ? 10.527 0.392   22.900  1.00 39.22  ? 46  GLU H OE2 1 
ATOM   2969 N N   . TRP C 3  47  ? 13.997 -4.119  24.631  1.00 21.62  ? 47  TRP H N   1 
ATOM   2970 C CA  . TRP C 3  47  ? 13.717 -5.428  25.185  1.00 23.20  ? 47  TRP H CA  1 
ATOM   2971 C C   . TRP C 3  47  ? 12.208 -5.522  25.451  1.00 24.79  ? 47  TRP H C   1 
ATOM   2972 O O   . TRP C 3  47  ? 11.623 -4.601  26.029  1.00 26.07  ? 47  TRP H O   1 
ATOM   2973 C CB  . TRP C 3  47  ? 14.482 -5.610  26.489  1.00 20.92  ? 47  TRP H CB  1 
ATOM   2974 C CG  . TRP C 3  47  ? 14.189 -6.893  27.171  1.00 21.39  ? 47  TRP H CG  1 
ATOM   2975 C CD1 . TRP C 3  47  ? 14.589 -8.136  26.785  1.00 18.60  ? 47  TRP H CD1 1 
ATOM   2976 C CD2 . TRP C 3  47  ? 13.482 -7.060  28.403  1.00 20.32  ? 47  TRP H CD2 1 
ATOM   2977 N NE1 . TRP C 3  47  ? 14.183 -9.072  27.707  1.00 19.34  ? 47  TRP H NE1 1 
ATOM   2978 C CE2 . TRP C 3  47  ? 13.503 -8.437  28.712  1.00 21.03  ? 47  TRP H CE2 1 
ATOM   2979 C CE3 . TRP C 3  47  ? 12.833 -6.176  29.280  1.00 21.64  ? 47  TRP H CE3 1 
ATOM   2980 C CZ2 . TRP C 3  47  ? 12.903 -8.956  29.866  1.00 18.51  ? 47  TRP H CZ2 1 
ATOM   2981 C CZ3 . TRP C 3  47  ? 12.237 -6.691  30.421  1.00 22.13  ? 47  TRP H CZ3 1 
ATOM   2982 C CH2 . TRP C 3  47  ? 12.278 -8.073  30.704  1.00 20.42  ? 47  TRP H CH2 1 
ATOM   2983 N N   . ILE C 3  48  ? 11.579 -6.620  25.024  1.00 23.90  ? 48  ILE H N   1 
ATOM   2984 C CA  . ILE C 3  48  ? 10.141 -6.809  25.240  1.00 21.79  ? 48  ILE H CA  1 
ATOM   2985 C C   . ILE C 3  48  ? 9.872  -7.626  26.507  1.00 21.74  ? 48  ILE H C   1 
ATOM   2986 O O   . ILE C 3  48  ? 9.044  -7.245  27.347  1.00 22.24  ? 48  ILE H O   1 
ATOM   2987 C CB  . ILE C 3  48  ? 9.483  -7.516  24.029  1.00 22.01  ? 48  ILE H CB  1 
ATOM   2988 C CG1 . ILE C 3  48  ? 9.598  -6.624  22.796  1.00 18.10  ? 48  ILE H CG1 1 
ATOM   2989 C CG2 . ILE C 3  48  ? 8.006  -7.821  24.325  1.00 18.53  ? 48  ILE H CG2 1 
ATOM   2990 C CD1 . ILE C 3  48  ? 9.096  -7.258  21.533  1.00 17.16  ? 48  ILE H CD1 1 
ATOM   2991 N N   . GLY C 3  49  ? 10.590 -8.742  26.639  1.00 19.52  ? 49  GLY H N   1 
ATOM   2992 C CA  . GLY C 3  49  ? 10.439 -9.616  27.791  1.00 18.45  ? 49  GLY H CA  1 
ATOM   2993 C C   . GLY C 3  49  ? 11.103 -10.960 27.542  1.00 21.07  ? 49  GLY H C   1 
ATOM   2994 O O   . GLY C 3  49  ? 11.727 -11.167 26.494  1.00 20.15  ? 49  GLY H O   1 
ATOM   2995 N N   . TRP C 3  50  ? 11.008 -11.868 28.508  1.00 20.98  ? 50  TRP H N   1 
ATOM   2996 C CA  . TRP C 3  50  ? 11.580 -13.196 28.332  1.00 20.62  ? 50  TRP H CA  1 
ATOM   2997 C C   . TRP C 3  50  ? 10.615 -14.253 28.817  1.00 20.22  ? 50  TRP H C   1 
ATOM   2998 O O   . TRP C 3  50  ? 9.640  -13.950 29.506  1.00 18.80  ? 50  TRP H O   1 
ATOM   2999 C CB  . TRP C 3  50  ? 12.936 -13.376 29.051  1.00 18.21  ? 50  TRP H CB  1 
ATOM   3000 C CG  . TRP C 3  50  ? 13.014 -13.098 30.546  1.00 22.30  ? 50  TRP H CG  1 
ATOM   3001 C CD1 . TRP C 3  50  ? 13.697 -12.071 31.139  1.00 22.36  ? 50  TRP H CD1 1 
ATOM   3002 C CD2 . TRP C 3  50  ? 12.501 -13.908 31.632  1.00 21.98  ? 50  TRP H CD2 1 
ATOM   3003 N NE1 . TRP C 3  50  ? 13.657 -12.190 32.511  1.00 24.35  ? 50  TRP H NE1 1 
ATOM   3004 C CE2 . TRP C 3  50  ? 12.930 -13.304 32.844  1.00 25.70  ? 50  TRP H CE2 1 
ATOM   3005 C CE3 . TRP C 3  50  ? 11.727 -15.080 31.700  1.00 23.56  ? 50  TRP H CE3 1 
ATOM   3006 C CZ2 . TRP C 3  50  ? 12.611 -13.835 34.118  1.00 22.21  ? 50  TRP H CZ2 1 
ATOM   3007 C CZ3 . TRP C 3  50  ? 11.406 -15.614 32.975  1.00 23.12  ? 50  TRP H CZ3 1 
ATOM   3008 C CH2 . TRP C 3  50  ? 11.854 -14.983 34.163  1.00 21.99  ? 50  TRP H CH2 1 
ATOM   3009 N N   . ILE C 3  51  ? 10.882 -15.488 28.410  1.00 18.05  ? 51  ILE H N   1 
ATOM   3010 C CA  . ILE C 3  51  ? 10.092 -16.634 28.816  1.00 19.25  ? 51  ILE H CA  1 
ATOM   3011 C C   . ILE C 3  51  ? 11.123 -17.674 29.192  1.00 18.54  ? 51  ILE H C   1 
ATOM   3012 O O   . ILE C 3  51  ? 12.224 -17.712 28.632  1.00 20.21  ? 51  ILE H O   1 
ATOM   3013 C CB  . ILE C 3  51  ? 9.194  -17.180 27.661  1.00 20.89  ? 51  ILE H CB  1 
ATOM   3014 C CG1 . ILE C 3  51  ? 8.320  -18.336 28.169  1.00 17.05  ? 51  ILE H CG1 1 
ATOM   3015 C CG2 . ILE C 3  51  ? 10.050 -17.692 26.519  1.00 20.65  ? 51  ILE H CG2 1 
ATOM   3016 C CD1 . ILE C 3  51  ? 7.208  -18.698 27.223  1.00 14.80  ? 51  ILE H CD1 1 
ATOM   3017 N N   . PHE C 3  52  ? 10.778 -18.502 30.162  1.00 18.68  ? 52  PHE H N   1 
ATOM   3018 C CA  . PHE C 3  52  ? 11.675 -19.549 30.596  1.00 19.32  ? 52  PHE H CA  1 
ATOM   3019 C C   . PHE C 3  52  ? 10.885 -20.834 30.805  1.00 21.58  ? 52  PHE H C   1 
ATOM   3020 O O   . PHE C 3  52  ? 9.985  -20.884 31.639  1.00 20.14  ? 52  PHE H O   1 
ATOM   3021 C CB  . PHE C 3  52  ? 12.370 -19.162 31.904  1.00 19.56  ? 52  PHE H CB  1 
ATOM   3022 C CG  . PHE C 3  52  ? 13.477 -20.106 32.290  1.00 21.44  ? 52  PHE H CG  1 
ATOM   3023 C CD1 . PHE C 3  52  ? 14.781 -19.885 31.856  1.00 22.92  ? 52  PHE H CD1 1 
ATOM   3024 C CD2 . PHE C 3  52  ? 13.204 -21.248 33.032  1.00 22.12  ? 52  PHE H CD2 1 
ATOM   3025 C CE1 . PHE C 3  52  ? 15.796 -20.786 32.152  1.00 23.53  ? 52  PHE H CE1 1 
ATOM   3026 C CE2 . PHE C 3  52  ? 14.209 -22.154 33.330  1.00 22.06  ? 52  PHE H CE2 1 
ATOM   3027 C CZ  . PHE C 3  52  ? 15.509 -21.921 32.889  1.00 25.88  ? 52  PHE H CZ  1 
ATOM   3028 N N   . HIS C 3  53  A 11.233 -21.859 30.031  1.00 25.65  ? 52  HIS H N   1 
ATOM   3029 C CA  . HIS C 3  53  A 10.598 -23.175 30.088  1.00 30.50  ? 52  HIS H CA  1 
ATOM   3030 C C   . HIS C 3  53  A 9.157  -23.200 29.568  1.00 30.99  ? 52  HIS H C   1 
ATOM   3031 O O   . HIS C 3  53  A 8.845  -23.958 28.649  1.00 34.65  ? 52  HIS H O   1 
ATOM   3032 C CB  . HIS C 3  53  A 10.668 -23.733 31.518  1.00 34.64  ? 52  HIS H CB  1 
ATOM   3033 C CG  . HIS C 3  53  A 10.229 -25.162 31.640  1.00 39.12  ? 52  HIS H CG  1 
ATOM   3034 N ND1 . HIS C 3  53  A 8.902  -25.535 31.685  1.00 43.77  ? 52  HIS H ND1 1 
ATOM   3035 C CD2 . HIS C 3  53  A 10.944 -26.310 31.708  1.00 39.82  ? 52  HIS H CD2 1 
ATOM   3036 C CE1 . HIS C 3  53  A 8.819  -26.851 31.773  1.00 44.18  ? 52  HIS H CE1 1 
ATOM   3037 N NE2 . HIS C 3  53  A 10.044 -27.346 31.789  1.00 42.40  ? 52  HIS H NE2 1 
ATOM   3038 N N   . GLY C 3  54  ? 8.286  -22.371 30.132  1.00 28.68  ? 53  GLY H N   1 
ATOM   3039 C CA  . GLY C 3  54  ? 6.906  -22.367 29.679  1.00 26.61  ? 53  GLY H CA  1 
ATOM   3040 C C   . GLY C 3  54  ? 6.166  -21.060 29.885  1.00 25.11  ? 53  GLY H C   1 
ATOM   3041 O O   . GLY C 3  54  ? 6.661  -20.152 30.547  1.00 23.75  ? 53  GLY H O   1 
ATOM   3042 N N   . SER C 3  55  ? 4.962  -20.990 29.326  1.00 23.66  ? 54  SER H N   1 
ATOM   3043 C CA  . SER C 3  55  ? 4.108  -19.816 29.387  1.00 23.43  ? 54  SER H CA  1 
ATOM   3044 C C   . SER C 3  55  ? 3.826  -19.263 30.775  1.00 25.18  ? 54  SER H C   1 
ATOM   3045 O O   . SER C 3  55  ? 3.444  -18.103 30.916  1.00 26.17  ? 54  SER H O   1 
ATOM   3046 C CB  . SER C 3  55  ? 2.779  -20.127 28.714  1.00 23.37  ? 54  SER H CB  1 
ATOM   3047 O OG  . SER C 3  55  ? 2.987  -20.653 27.417  1.00 25.39  ? 54  SER H OG  1 
ATOM   3048 N N   . ASP C 3  56  ? 4.012  -20.083 31.796  1.00 25.79  ? 55  ASP H N   1 
ATOM   3049 C CA  . ASP C 3  56  ? 3.736  -19.663 33.167  1.00 31.35  ? 55  ASP H CA  1 
ATOM   3050 C C   . ASP C 3  56  ? 4.921  -18.956 33.834  1.00 30.63  ? 55  ASP H C   1 
ATOM   3051 O O   . ASP C 3  56  ? 4.816  -18.520 34.978  1.00 31.42  ? 55  ASP H O   1 
ATOM   3052 C CB  . ASP C 3  56  ? 3.346  -20.890 33.996  1.00 36.53  ? 55  ASP H CB  1 
ATOM   3053 C CG  . ASP C 3  56  ? 4.500  -21.881 34.148  1.00 47.42  ? 55  ASP H CG  1 
ATOM   3054 O OD1 . ASP C 3  56  ? 5.110  -22.266 33.116  1.00 50.58  ? 55  ASP H OD1 1 
ATOM   3055 O OD2 . ASP C 3  56  ? 4.797  -22.278 35.303  1.00 51.13  ? 55  ASP H OD2 1 
ATOM   3056 N N   . ASN C 3  57  ? 6.037  -18.843 33.113  1.00 25.96  ? 56  ASN H N   1 
ATOM   3057 C CA  . ASN C 3  57  ? 7.253  -18.226 33.641  1.00 21.73  ? 56  ASN H CA  1 
ATOM   3058 C C   . ASN C 3  57  ? 7.785  -17.178 32.667  1.00 23.61  ? 56  ASN H C   1 
ATOM   3059 O O   . ASN C 3  57  ? 8.609  -17.474 31.796  1.00 21.98  ? 56  ASN H O   1 
ATOM   3060 C CB  . ASN C 3  57  ? 8.301  -19.304 33.856  1.00 18.67  ? 56  ASN H CB  1 
ATOM   3061 C CG  . ASN C 3  57  ? 9.450  -18.834 34.706  1.00 21.47  ? 56  ASN H CG  1 
ATOM   3062 O OD1 . ASN C 3  57  ? 9.590  -17.649 34.982  1.00 23.20  ? 56  ASN H OD1 1 
ATOM   3063 N ND2 . ASN C 3  57  ? 10.292 -19.763 35.120  1.00 20.09  ? 56  ASN H ND2 1 
ATOM   3064 N N   . THR C 3  58  ? 7.313  -15.949 32.823  1.00 23.04  ? 57  THR H N   1 
ATOM   3065 C CA  . THR C 3  58  ? 7.707  -14.864 31.942  1.00 23.32  ? 57  THR H CA  1 
ATOM   3066 C C   . THR C 3  58  ? 7.958  -13.565 32.710  1.00 24.35  ? 57  THR H C   1 
ATOM   3067 O O   . THR C 3  58  ? 7.489  -13.398 33.838  1.00 26.18  ? 57  THR H O   1 
ATOM   3068 C CB  . THR C 3  58  ? 6.592  -14.583 30.908  1.00 22.41  ? 57  THR H CB  1 
ATOM   3069 O OG1 . THR C 3  58  ? 5.394  -14.201 31.603  1.00 22.69  ? 57  THR H OG1 1 
ATOM   3070 C CG2 . THR C 3  58  ? 6.303  -15.821 30.055  1.00 20.28  ? 57  THR H CG2 1 
ATOM   3071 N N   . GLU C 3  59  ? 8.718  -12.660 32.104  1.00 21.36  ? 58  GLU H N   1 
ATOM   3072 C CA  . GLU C 3  59  ? 8.962  -11.346 32.688  1.00 22.20  ? 58  GLU H CA  1 
ATOM   3073 C C   . GLU C 3  59  ? 8.864  -10.362 31.534  1.00 25.63  ? 58  GLU H C   1 
ATOM   3074 O O   . GLU C 3  59  ? 9.395  -10.620 30.444  1.00 25.02  ? 58  GLU H O   1 
ATOM   3075 C CB  . GLU C 3  59  ? 10.329 -11.253 33.357  1.00 21.18  ? 58  GLU H CB  1 
ATOM   3076 C CG  . GLU C 3  59  ? 10.340 -11.636 34.831  1.00 22.01  ? 58  GLU H CG  1 
ATOM   3077 C CD  . GLU C 3  59  ? 9.208  -11.010 35.660  1.00 23.96  ? 58  GLU H CD  1 
ATOM   3078 O OE1 . GLU C 3  59  ? 8.764  -9.874  35.387  1.00 24.66  ? 58  GLU H OE1 1 
ATOM   3079 O OE2 . GLU C 3  59  ? 8.764  -11.663 36.621  1.00 24.21  ? 58  GLU H OE2 1 
ATOM   3080 N N   . TYR C 3  60  ? 8.167  -9.250  31.778  1.00 22.76  ? 59  TYR H N   1 
ATOM   3081 C CA  . TYR C 3  60  ? 7.940  -8.231  30.763  1.00 24.99  ? 59  TYR H CA  1 
ATOM   3082 C C   . TYR C 3  60  ? 8.493  -6.845  31.052  1.00 26.81  ? 59  TYR H C   1 
ATOM   3083 O O   . TYR C 3  60  ? 8.632  -6.433  32.198  1.00 27.39  ? 59  TYR H O   1 
ATOM   3084 C CB  . TYR C 3  60  ? 6.439  -8.054  30.519  1.00 25.53  ? 59  TYR H CB  1 
ATOM   3085 C CG  . TYR C 3  60  ? 5.720  -9.258  29.956  1.00 23.35  ? 59  TYR H CG  1 
ATOM   3086 C CD1 . TYR C 3  60  ? 5.587  -9.439  28.580  1.00 24.15  ? 59  TYR H CD1 1 
ATOM   3087 C CD2 . TYR C 3  60  ? 5.163  -10.216 30.806  1.00 23.50  ? 59  TYR H CD2 1 
ATOM   3088 C CE1 . TYR C 3  60  ? 4.907  -10.553 28.061  1.00 26.00  ? 59  TYR H CE1 1 
ATOM   3089 C CE2 . TYR C 3  60  ? 4.485  -11.333 30.300  1.00 25.60  ? 59  TYR H CE2 1 
ATOM   3090 C CZ  . TYR C 3  60  ? 4.358  -11.494 28.933  1.00 21.97  ? 59  TYR H CZ  1 
ATOM   3091 O OH  . TYR C 3  60  ? 3.665  -12.571 28.447  1.00 23.11  ? 59  TYR H OH  1 
ATOM   3092 N N   . ASN C 3  61  ? 8.782  -6.131  29.969  1.00 29.46  ? 60  ASN H N   1 
ATOM   3093 C CA  . ASN C 3  61  ? 9.234  -4.753  30.019  1.00 29.01  ? 60  ASN H CA  1 
ATOM   3094 C C   . ASN C 3  61  ? 7.934  -4.011  30.356  1.00 29.71  ? 60  ASN H C   1 
ATOM   3095 O O   . ASN C 3  61  ? 6.920  -4.171  29.664  1.00 29.04  ? 60  ASN H O   1 
ATOM   3096 C CB  . ASN C 3  61  ? 9.719  -4.316  28.632  1.00 25.39  ? 60  ASN H CB  1 
ATOM   3097 C CG  . ASN C 3  61  ? 10.114 -2.858  28.582  1.00 29.48  ? 60  ASN H CG  1 
ATOM   3098 O OD1 . ASN C 3  61  ? 9.496  -2.016  29.227  1.00 31.30  ? 60  ASN H OD1 1 
ATOM   3099 N ND2 . ASN C 3  61  ? 11.139 -2.546  27.796  1.00 26.78  ? 60  ASN H ND2 1 
ATOM   3100 N N   . GLU C 3  62  ? 7.954  -3.215  31.416  1.00 31.22  ? 61  GLU H N   1 
ATOM   3101 C CA  . GLU C 3  62  ? 6.774  -2.454  31.818  1.00 34.49  ? 61  GLU H CA  1 
ATOM   3102 C C   . GLU C 3  62  ? 6.009  -1.855  30.628  1.00 34.61  ? 61  GLU H C   1 
ATOM   3103 O O   . GLU C 3  62  ? 4.780  -1.873  30.599  1.00 35.70  ? 61  GLU H O   1 
ATOM   3104 C CB  . GLU C 3  62  ? 7.192  -1.329  32.772  1.00 40.97  ? 61  GLU H CB  1 
ATOM   3105 C CG  . GLU C 3  62  ? 6.035  -0.610  33.440  1.00 51.31  ? 61  GLU H CG  1 
ATOM   3106 C CD  . GLU C 3  62  ? 5.155  -1.547  34.264  1.00 57.62  ? 61  GLU H CD  1 
ATOM   3107 O OE1 . GLU C 3  62  ? 5.698  -2.301  35.108  1.00 59.66  ? 61  GLU H OE1 1 
ATOM   3108 O OE2 . GLU C 3  62  ? 3.918  -1.521  34.069  1.00 61.45  ? 61  GLU H OE2 1 
ATOM   3109 N N   . LYS C 3  63  ? 6.740  -1.336  29.645  1.00 33.00  ? 62  LYS H N   1 
ATOM   3110 C CA  . LYS C 3  63  ? 6.143  -0.710  28.466  1.00 32.42  ? 62  LYS H CA  1 
ATOM   3111 C C   . LYS C 3  63  ? 5.376  -1.656  27.530  1.00 33.69  ? 62  LYS H C   1 
ATOM   3112 O O   . LYS C 3  63  ? 4.581  -1.201  26.710  1.00 33.29  ? 62  LYS H O   1 
ATOM   3113 C CB  . LYS C 3  63  ? 7.236  0.015   27.656  1.00 36.86  ? 62  LYS H CB  1 
ATOM   3114 C CG  . LYS C 3  63  ? 7.557  1.470   28.044  1.00 43.41  ? 62  LYS H CG  1 
ATOM   3115 C CD  . LYS C 3  63  ? 7.742  1.702   29.553  1.00 52.36  ? 62  LYS H CD  1 
ATOM   3116 C CE  . LYS C 3  63  ? 6.408  2.054   30.254  1.00 56.79  ? 62  LYS H CE  1 
ATOM   3117 N NZ  . LYS C 3  63  ? 6.565  2.524   31.668  1.00 54.74  ? 62  LYS H NZ  1 
ATOM   3118 N N   . PHE C 3  64  ? 5.609  -2.963  27.640  1.00 32.83  ? 63  PHE H N   1 
ATOM   3119 C CA  . PHE C 3  64  ? 4.941  -3.922  26.757  1.00 31.42  ? 63  PHE H CA  1 
ATOM   3120 C C   . PHE C 3  64  ? 3.957  -4.819  27.476  1.00 31.17  ? 63  PHE H C   1 
ATOM   3121 O O   . PHE C 3  64  ? 3.276  -5.625  26.856  1.00 31.78  ? 63  PHE H O   1 
ATOM   3122 C CB  . PHE C 3  64  ? 5.984  -4.785  26.051  1.00 29.73  ? 63  PHE H CB  1 
ATOM   3123 C CG  . PHE C 3  64  ? 6.803  -4.033  25.039  1.00 29.10  ? 63  PHE H CG  1 
ATOM   3124 C CD1 . PHE C 3  64  ? 6.354  -3.888  23.729  1.00 30.60  ? 63  PHE H CD1 1 
ATOM   3125 C CD2 . PHE C 3  64  ? 8.016  -3.454  25.397  1.00 26.36  ? 63  PHE H CD2 1 
ATOM   3126 C CE1 . PHE C 3  64  ? 7.106  -3.174  22.787  1.00 30.53  ? 63  PHE H CE1 1 
ATOM   3127 C CE2 . PHE C 3  64  ? 8.771  -2.743  24.468  1.00 24.78  ? 63  PHE H CE2 1 
ATOM   3128 C CZ  . PHE C 3  64  ? 8.316  -2.602  23.162  1.00 27.90  ? 63  PHE H CZ  1 
ATOM   3129 N N   . LYS C 3  65  ? 3.884  -4.667  28.791  1.00 34.07  ? 64  LYS H N   1 
ATOM   3130 C CA  . LYS C 3  65  ? 2.992  -5.473  29.605  1.00 35.38  ? 64  LYS H CA  1 
ATOM   3131 C C   . LYS C 3  65  ? 1.582  -5.583  29.056  1.00 35.10  ? 64  LYS H C   1 
ATOM   3132 O O   . LYS C 3  65  ? 0.924  -6.594  29.262  1.00 37.15  ? 64  LYS H O   1 
ATOM   3133 C CB  . LYS C 3  65  ? 2.954  -4.942  31.046  1.00 37.25  ? 64  LYS H CB  1 
ATOM   3134 C CG  . LYS C 3  65  ? 4.126  -5.424  31.899  1.00 38.31  ? 64  LYS H CG  1 
ATOM   3135 C CD  . LYS C 3  65  ? 3.978  -5.004  33.360  1.00 45.87  ? 64  LYS H CD  1 
ATOM   3136 C CE  . LYS C 3  65  ? 5.088  -5.583  34.255  1.00 48.65  ? 64  LYS H CE  1 
ATOM   3137 N NZ  . LYS C 3  65  ? 6.450  -5.106  33.872  1.00 50.19  ? 64  LYS H NZ  1 
ATOM   3138 N N   . ASP C 3  66  ? 1.109  -4.563  28.353  1.00 37.42  ? 65  ASP H N   1 
ATOM   3139 C CA  . ASP C 3  66  ? -0.246 -4.616  27.802  1.00 40.43  ? 65  ASP H CA  1 
ATOM   3140 C C   . ASP C 3  66  ? -0.259 -4.733  26.280  1.00 36.46  ? 65  ASP H C   1 
ATOM   3141 O O   . ASP C 3  66  ? -1.279 -4.492  25.638  1.00 38.70  ? 65  ASP H O   1 
ATOM   3142 C CB  . ASP C 3  66  ? -1.047 -3.373  28.222  1.00 47.87  ? 65  ASP H CB  1 
ATOM   3143 C CG  . ASP C 3  66  ? -1.386 -3.362  29.713  1.00 54.52  ? 65  ASP H CG  1 
ATOM   3144 O OD1 . ASP C 3  66  ? -2.081 -4.295  30.180  1.00 55.11  ? 65  ASP H OD1 1 
ATOM   3145 O OD2 . ASP C 3  66  ? -0.960 -2.414  30.416  1.00 61.43  ? 65  ASP H OD2 1 
ATOM   3146 N N   . LYS C 3  67  ? 0.868  -5.119  25.702  1.00 32.56  ? 66  LYS H N   1 
ATOM   3147 C CA  . LYS C 3  67  ? 0.957  -5.230  24.257  1.00 29.19  ? 66  LYS H CA  1 
ATOM   3148 C C   . LYS C 3  67  ? 1.391  -6.630  23.841  1.00 26.63  ? 66  LYS H C   1 
ATOM   3149 O O   . LYS C 3  67  ? 0.866  -7.197  22.890  1.00 26.91  ? 66  LYS H O   1 
ATOM   3150 C CB  . LYS C 3  67  ? 1.949  -4.176  23.741  1.00 27.15  ? 66  LYS H CB  1 
ATOM   3151 C CG  . LYS C 3  67  ? 2.302  -4.252  22.265  1.00 28.28  ? 66  LYS H CG  1 
ATOM   3152 C CD  . LYS C 3  67  ? 1.124  -3.944  21.357  1.00 27.96  ? 66  LYS H CD  1 
ATOM   3153 C CE  . LYS C 3  67  ? 0.631  -2.533  21.560  1.00 26.84  ? 66  LYS H CE  1 
ATOM   3154 N NZ  . LYS C 3  67  ? -0.335 -2.193  20.506  1.00 30.84  ? 66  LYS H NZ  1 
ATOM   3155 N N   . ALA C 3  68  ? 2.329  -7.196  24.583  1.00 26.49  ? 67  ALA H N   1 
ATOM   3156 C CA  . ALA C 3  68  ? 2.855  -8.508  24.262  1.00 27.09  ? 67  ALA H CA  1 
ATOM   3157 C C   . ALA C 3  68  ? 2.453  -9.595  25.238  1.00 27.52  ? 67  ALA H C   1 
ATOM   3158 O O   . ALA C 3  68  ? 2.185  -9.333  26.409  1.00 26.35  ? 67  ALA H O   1 
ATOM   3159 C CB  . ALA C 3  68  ? 4.388  -8.439  24.186  1.00 29.16  ? 67  ALA H CB  1 
ATOM   3160 N N   . THR C 3  69  ? 2.416  -10.824 24.732  1.00 26.22  ? 68  THR H N   1 
ATOM   3161 C CA  . THR C 3  69  ? 2.106  -11.994 25.542  1.00 24.99  ? 68  THR H CA  1 
ATOM   3162 C C   . THR C 3  69  ? 3.057  -13.083 25.055  1.00 21.78  ? 68  THR H C   1 
ATOM   3163 O O   . THR C 3  69  ? 3.026  -13.469 23.886  1.00 21.27  ? 68  THR H O   1 
ATOM   3164 C CB  . THR C 3  69  ? 0.644  -12.470 25.358  1.00 26.34  ? 68  THR H CB  1 
ATOM   3165 O OG1 . THR C 3  69  ? -0.253 -11.373 25.573  1.00 28.49  ? 68  THR H OG1 1 
ATOM   3166 C CG2 . THR C 3  69  ? 0.323  -13.573 26.361  1.00 24.17  ? 68  THR H CG2 1 
ATOM   3167 N N   . LEU C 3  70  ? 3.915  -13.555 25.949  1.00 21.47  ? 69  LEU H N   1 
ATOM   3168 C CA  . LEU C 3  70  ? 4.882  -14.584 25.610  1.00 21.20  ? 69  LEU H CA  1 
ATOM   3169 C C   . LEU C 3  70  ? 4.409  -15.957 26.076  1.00 22.46  ? 69  LEU H C   1 
ATOM   3170 O O   . LEU C 3  70  ? 4.023  -16.134 27.230  1.00 22.52  ? 69  LEU H O   1 
ATOM   3171 C CB  . LEU C 3  70  ? 6.238  -14.266 26.251  1.00 18.50  ? 69  LEU H CB  1 
ATOM   3172 C CG  . LEU C 3  70  ? 6.798  -12.858 26.026  1.00 20.21  ? 69  LEU H CG  1 
ATOM   3173 C CD1 . LEU C 3  70  ? 8.147  -12.733 26.697  1.00 16.87  ? 69  LEU H CD1 1 
ATOM   3174 C CD2 . LEU C 3  70  ? 6.925  -12.581 24.540  1.00 21.68  ? 69  LEU H CD2 1 
ATOM   3175 N N   . THR C 3  71  ? 4.434  -16.925 25.165  1.00 23.17  ? 70  THR H N   1 
ATOM   3176 C CA  . THR C 3  71  ? 4.034  -18.287 25.487  1.00 23.59  ? 70  THR H CA  1 
ATOM   3177 C C   . THR C 3  71  ? 5.051  -19.240 24.879  1.00 24.52  ? 70  THR H C   1 
ATOM   3178 O O   . THR C 3  71  ? 5.965  -18.815 24.170  1.00 23.71  ? 70  THR H O   1 
ATOM   3179 C CB  . THR C 3  71  ? 2.632  -18.626 24.919  1.00 23.62  ? 70  THR H CB  1 
ATOM   3180 O OG1 . THR C 3  71  ? 2.603  -18.360 23.514  1.00 20.27  ? 70  THR H OG1 1 
ATOM   3181 C CG2 . THR C 3  71  ? 1.560  -17.799 25.615  1.00 22.03  ? 70  THR H CG2 1 
ATOM   3182 N N   . ALA C 3  72  ? 4.900  -20.527 25.165  1.00 25.10  ? 71  ALA H N   1 
ATOM   3183 C CA  . ALA C 3  72  ? 5.800  -21.526 24.614  1.00 23.62  ? 71  ALA H CA  1 
ATOM   3184 C C   . ALA C 3  72  ? 5.084  -22.861 24.470  1.00 25.51  ? 71  ALA H C   1 
ATOM   3185 O O   . ALA C 3  72  ? 4.143  -23.167 25.202  1.00 27.06  ? 71  ALA H O   1 
ATOM   3186 C CB  . ALA C 3  72  ? 7.042  -21.685 25.508  1.00 19.49  ? 71  ALA H CB  1 
ATOM   3187 N N   . ASP C 3  73  ? 5.524  -23.630 23.485  1.00 28.60  ? 72  ASP H N   1 
ATOM   3188 C CA  . ASP C 3  73  ? 5.006  -24.966 23.216  1.00 29.03  ? 72  ASP H CA  1 
ATOM   3189 C C   . ASP C 3  73  ? 6.260  -25.802 23.476  1.00 30.05  ? 72  ASP H C   1 
ATOM   3190 O O   . ASP C 3  73  ? 7.070  -26.011 22.572  1.00 29.76  ? 72  ASP H O   1 
ATOM   3191 C CB  . ASP C 3  73  ? 4.577  -25.096 21.742  1.00 30.78  ? 72  ASP H CB  1 
ATOM   3192 C CG  . ASP C 3  73  ? 3.992  -26.476 21.407  1.00 33.01  ? 72  ASP H CG  1 
ATOM   3193 O OD1 . ASP C 3  73  ? 4.252  -27.443 22.154  1.00 36.23  ? 72  ASP H OD1 1 
ATOM   3194 O OD2 . ASP C 3  73  ? 3.280  -26.596 20.384  1.00 33.26  ? 72  ASP H OD2 1 
ATOM   3195 N N   . THR C 3  74  ? 6.438  -26.243 24.715  1.00 29.91  ? 73  THR H N   1 
ATOM   3196 C CA  . THR C 3  74  ? 7.612  -27.027 25.076  1.00 36.72  ? 73  THR H CA  1 
ATOM   3197 C C   . THR C 3  74  ? 7.778  -28.282 24.227  1.00 37.05  ? 73  THR H C   1 
ATOM   3198 O O   . THR C 3  74  ? 8.893  -28.680 23.916  1.00 39.14  ? 73  THR H O   1 
ATOM   3199 C CB  . THR C 3  74  ? 7.547  -27.451 26.541  1.00 39.66  ? 73  THR H CB  1 
ATOM   3200 O OG1 . THR C 3  74  ? 6.464  -28.372 26.709  1.00 46.15  ? 73  THR H OG1 1 
ATOM   3201 C CG2 . THR C 3  74  ? 7.308  -26.239 27.435  1.00 35.90  ? 73  THR H CG2 1 
ATOM   3202 N N   . SER C 3  75  ? 6.664  -28.902 23.850  1.00 40.86  ? 74  SER H N   1 
ATOM   3203 C CA  . SER C 3  75  ? 6.692  -30.121 23.043  1.00 42.19  ? 74  SER H CA  1 
ATOM   3204 C C   . SER C 3  75  ? 7.306  -29.903 21.659  1.00 41.45  ? 74  SER H C   1 
ATOM   3205 O O   . SER C 3  75  ? 7.689  -30.857 20.982  1.00 47.23  ? 74  SER H O   1 
ATOM   3206 C CB  . SER C 3  75  ? 5.272  -30.682 22.875  1.00 44.90  ? 74  SER H CB  1 
ATOM   3207 O OG  . SER C 3  75  ? 4.599  -30.084 21.770  1.00 48.40  ? 74  SER H OG  1 
ATOM   3208 N N   . SER C 3  76  ? 7.380  -28.657 21.220  1.00 35.74  ? 75  SER H N   1 
ATOM   3209 C CA  . SER C 3  76  ? 7.958  -28.377 19.923  1.00 31.51  ? 75  SER H CA  1 
ATOM   3210 C C   . SER C 3  76  ? 9.130  -27.409 20.036  1.00 29.66  ? 75  SER H C   1 
ATOM   3211 O O   . SER C 3  76  ? 9.613  -26.902 19.028  1.00 32.25  ? 75  SER H O   1 
ATOM   3212 C CB  . SER C 3  76  ? 6.898  -27.801 19.005  1.00 32.72  ? 75  SER H CB  1 
ATOM   3213 O OG  . SER C 3  76  ? 6.335  -26.641 19.582  1.00 33.87  ? 75  SER H OG  1 
ATOM   3214 N N   . SER C 3  77  ? 9.582  -27.160 21.265  1.00 27.65  ? 76  SER H N   1 
ATOM   3215 C CA  . SER C 3  77  ? 10.700 -26.252 21.519  1.00 24.99  ? 76  SER H CA  1 
ATOM   3216 C C   . SER C 3  77  ? 10.502 -24.937 20.772  1.00 22.73  ? 76  SER H C   1 
ATOM   3217 O O   . SER C 3  77  ? 11.423 -24.443 20.121  1.00 22.36  ? 76  SER H O   1 
ATOM   3218 C CB  . SER C 3  77  ? 12.020 -26.896 21.073  1.00 27.76  ? 76  SER H CB  1 
ATOM   3219 O OG  . SER C 3  77  ? 12.294 -28.076 21.810  1.00 32.08  ? 76  SER H OG  1 
ATOM   3220 N N   . THR C 3  78  ? 9.300  -24.375 20.867  1.00 20.91  ? 77  THR H N   1 
ATOM   3221 C CA  . THR C 3  78  ? 8.989  -23.131 20.174  1.00 20.45  ? 77  THR H CA  1 
ATOM   3222 C C   . THR C 3  78  ? 8.419  -22.076 21.118  1.00 20.44  ? 77  THR H C   1 
ATOM   3223 O O   . THR C 3  78  ? 7.572  -22.369 21.965  1.00 20.25  ? 77  THR H O   1 
ATOM   3224 C CB  . THR C 3  78  ? 7.974  -23.387 19.017  1.00 22.56  ? 77  THR H CB  1 
ATOM   3225 O OG1 . THR C 3  78  ? 8.541  -24.319 18.084  1.00 24.63  ? 77  THR H OG1 1 
ATOM   3226 C CG2 . THR C 3  78  ? 7.648  -22.084 18.268  1.00 24.54  ? 77  THR H CG2 1 
ATOM   3227 N N   . ALA C 3  79  ? 8.903  -20.850 20.985  1.00 19.24  ? 78  ALA H N   1 
ATOM   3228 C CA  . ALA C 3  79  ? 8.404  -19.752 21.808  1.00 18.69  ? 78  ALA H CA  1 
ATOM   3229 C C   . ALA C 3  79  ? 7.561  -18.896 20.873  1.00 15.20  ? 78  ALA H C   1 
ATOM   3230 O O   . ALA C 3  79  ? 7.871  -18.780 19.694  1.00 16.89  ? 78  ALA H O   1 
ATOM   3231 C CB  . ALA C 3  79  ? 9.561  -18.932 22.374  1.00 19.00  ? 78  ALA H CB  1 
ATOM   3232 N N   . TYR C 3  80  ? 6.495  -18.308 21.405  1.00 16.71  ? 79  TYR H N   1 
ATOM   3233 C CA  . TYR C 3  80  ? 5.606  -17.471 20.619  1.00 15.92  ? 79  TYR H CA  1 
ATOM   3234 C C   . TYR C 3  80  ? 5.427  -16.127 21.288  1.00 16.03  ? 79  TYR H C   1 
ATOM   3235 O O   . TYR C 3  80  ? 5.528  -16.017 22.503  1.00 20.08  ? 79  TYR H O   1 
ATOM   3236 C CB  . TYR C 3  80  ? 4.220  -18.112 20.507  1.00 18.50  ? 79  TYR H CB  1 
ATOM   3237 C CG  . TYR C 3  80  ? 4.201  -19.442 19.813  1.00 20.63  ? 79  TYR H CG  1 
ATOM   3238 C CD1 . TYR C 3  80  ? 4.536  -20.622 20.487  1.00 20.06  ? 79  TYR H CD1 1 
ATOM   3239 C CD2 . TYR C 3  80  ? 3.889  -19.521 18.461  1.00 23.01  ? 79  TYR H CD2 1 
ATOM   3240 C CE1 . TYR C 3  80  ? 4.567  -21.852 19.816  1.00 18.27  ? 79  TYR H CE1 1 
ATOM   3241 C CE2 . TYR C 3  80  ? 3.915  -20.737 17.784  1.00 22.60  ? 79  TYR H CE2 1 
ATOM   3242 C CZ  . TYR C 3  80  ? 4.258  -21.896 18.462  1.00 22.42  ? 79  TYR H CZ  1 
ATOM   3243 O OH  . TYR C 3  80  ? 4.324  -23.069 17.744  1.00 24.45  ? 79  TYR H OH  1 
ATOM   3244 N N   . MET C 3  81  ? 5.162  -15.102 20.493  1.00 16.56  ? 80  MET H N   1 
ATOM   3245 C CA  . MET C 3  81  ? 4.900  -13.789 21.048  1.00 19.22  ? 80  MET H CA  1 
ATOM   3246 C C   . MET C 3  81  ? 3.703  -13.201 20.342  1.00 19.96  ? 80  MET H C   1 
ATOM   3247 O O   . MET C 3  81  ? 3.688  -13.096 19.123  1.00 22.40  ? 80  MET H O   1 
ATOM   3248 C CB  . MET C 3  81  ? 6.072  -12.831 20.875  1.00 17.93  ? 80  MET H CB  1 
ATOM   3249 C CG  . MET C 3  81  ? 5.674  -11.396 21.233  1.00 21.87  ? 80  MET H CG  1 
ATOM   3250 S SD  . MET C 3  81  ? 7.026  -10.224 21.277  1.00 24.88  ? 80  MET H SD  1 
ATOM   3251 C CE  . MET C 3  81  ? 7.333  -10.010 19.505  1.00 20.11  ? 80  MET H CE  1 
ATOM   3252 N N   . GLN C 3  82  ? 2.694  -12.816 21.109  1.00 24.54  ? 81  GLN H N   1 
ATOM   3253 C CA  . GLN C 3  82  ? 1.521  -12.211 20.514  1.00 25.16  ? 81  GLN H CA  1 
ATOM   3254 C C   . GLN C 3  82  ? 1.512  -10.716 20.805  1.00 25.17  ? 81  GLN H C   1 
ATOM   3255 O O   . GLN C 3  82  ? 1.858  -10.292 21.910  1.00 26.09  ? 81  GLN H O   1 
ATOM   3256 C CB  . GLN C 3  82  ? 0.248  -12.839 21.068  1.00 24.55  ? 81  GLN H CB  1 
ATOM   3257 C CG  . GLN C 3  82  ? -0.998 -12.288 20.401  1.00 35.53  ? 81  GLN H CG  1 
ATOM   3258 C CD  . GLN C 3  82  ? -2.292 -12.775 21.042  1.00 40.92  ? 81  GLN H CD  1 
ATOM   3259 O OE1 . GLN C 3  82  ? -2.646 -13.956 20.953  1.00 43.89  ? 81  GLN H OE1 1 
ATOM   3260 N NE2 . GLN C 3  82  ? -3.005 -11.858 21.693  1.00 40.74  ? 81  GLN H NE2 1 
ATOM   3261 N N   . LEU C 3  83  ? 1.138  -9.932  19.797  1.00 25.27  ? 82  LEU H N   1 
ATOM   3262 C CA  . LEU C 3  83  ? 1.035  -8.479  19.909  1.00 25.90  ? 82  LEU H CA  1 
ATOM   3263 C C   . LEU C 3  83  ? -0.405 -8.133  19.530  1.00 24.38  ? 82  LEU H C   1 
ATOM   3264 O O   . LEU C 3  83  ? -0.895 -8.552  18.492  1.00 26.59  ? 82  LEU H O   1 
ATOM   3265 C CB  . LEU C 3  83  ? 2.014  -7.793  18.948  1.00 26.00  ? 82  LEU H CB  1 
ATOM   3266 C CG  . LEU C 3  83  ? 3.504  -8.093  19.165  1.00 26.66  ? 82  LEU H CG  1 
ATOM   3267 C CD1 . LEU C 3  83  ? 4.303  -7.643  17.942  1.00 29.72  ? 82  LEU H CD1 1 
ATOM   3268 C CD2 . LEU C 3  83  ? 3.999  -7.398  20.420  1.00 24.65  ? 82  LEU H CD2 1 
ATOM   3269 N N   . SER C 3  84  A -1.084 -7.359  20.363  1.00 27.94  ? 82  SER H N   1 
ATOM   3270 C CA  . SER C 3  84  A -2.478 -7.021  20.090  1.00 32.87  ? 82  SER H CA  1 
ATOM   3271 C C   . SER C 3  84  A -2.754 -5.532  19.901  1.00 33.42  ? 82  SER H C   1 
ATOM   3272 O O   . SER C 3  84  A -1.968 -4.696  20.348  1.00 34.41  ? 82  SER H O   1 
ATOM   3273 C CB  . SER C 3  84  A -3.338 -7.569  21.220  1.00 36.09  ? 82  SER H CB  1 
ATOM   3274 O OG  . SER C 3  84  A -2.747 -7.252  22.466  1.00 40.25  ? 82  SER H OG  1 
ATOM   3275 N N   . SER C 3  85  B -3.881 -5.224  19.247  1.00 33.77  ? 82  SER H N   1 
ATOM   3276 C CA  . SER C 3  85  B -4.312 -3.846  18.947  1.00 34.52  ? 82  SER H CA  1 
ATOM   3277 C C   . SER C 3  85  B -3.199 -3.082  18.246  1.00 31.17  ? 82  SER H C   1 
ATOM   3278 O O   . SER C 3  85  B -2.866 -1.959  18.608  1.00 29.69  ? 82  SER H O   1 
ATOM   3279 C CB  . SER C 3  85  B -4.714 -3.103  20.225  1.00 35.43  ? 82  SER H CB  1 
ATOM   3280 O OG  . SER C 3  85  B -5.952 -3.569  20.722  1.00 43.20  ? 82  SER H OG  1 
ATOM   3281 N N   . LEU C 3  86  C -2.635 -3.700  17.222  1.00 31.60  ? 82  LEU H N   1 
ATOM   3282 C CA  . LEU C 3  86  C -1.531 -3.102  16.504  1.00 33.34  ? 82  LEU H CA  1 
ATOM   3283 C C   . LEU C 3  86  C -1.810 -1.740  15.904  1.00 35.88  ? 82  LEU H C   1 
ATOM   3284 O O   . LEU C 3  86  C -2.873 -1.505  15.319  1.00 37.23  ? 82  LEU H O   1 
ATOM   3285 C CB  . LEU C 3  86  C -1.058 -4.053  15.407  1.00 32.87  ? 82  LEU H CB  1 
ATOM   3286 C CG  . LEU C 3  86  C -0.569 -5.395  15.947  1.00 31.65  ? 82  LEU H CG  1 
ATOM   3287 C CD1 . LEU C 3  86  C -0.193 -6.286  14.801  1.00 35.83  ? 82  LEU H CD1 1 
ATOM   3288 C CD2 . LEU C 3  86  C 0.609  -5.181  16.869  1.00 31.69  ? 82  LEU H CD2 1 
ATOM   3289 N N   . THR C 3  87  ? -0.839 -0.844  16.068  1.00 36.59  ? 83  THR H N   1 
ATOM   3290 C CA  . THR C 3  87  ? -0.906 0.497   15.501  1.00 34.85  ? 83  THR H CA  1 
ATOM   3291 C C   . THR C 3  87  ? 0.289  0.569   14.564  1.00 36.10  ? 83  THR H C   1 
ATOM   3292 O O   . THR C 3  87  ? 0.931  -0.444  14.280  1.00 36.15  ? 83  THR H O   1 
ATOM   3293 C CB  . THR C 3  87  ? -0.728 1.595   16.548  1.00 33.72  ? 83  THR H CB  1 
ATOM   3294 O OG1 . THR C 3  87  ? 0.622  1.574   17.027  1.00 35.17  ? 83  THR H OG1 1 
ATOM   3295 C CG2 . THR C 3  87  ? -1.686 1.396   17.702  1.00 34.59  ? 83  THR H CG2 1 
ATOM   3296 N N   . SER C 3  88  ? 0.586  1.766   14.085  1.00 35.97  ? 84  SER H N   1 
ATOM   3297 C CA  . SER C 3  88  ? 1.711  1.958   13.192  1.00 37.21  ? 84  SER H CA  1 
ATOM   3298 C C   . SER C 3  88  ? 3.004  1.899   14.011  1.00 36.31  ? 84  SER H C   1 
ATOM   3299 O O   . SER C 3  88  ? 4.081  1.617   13.479  1.00 36.78  ? 84  SER H O   1 
ATOM   3300 C CB  . SER C 3  88  ? 1.579  3.310   12.488  1.00 37.53  ? 84  SER H CB  1 
ATOM   3301 O OG  . SER C 3  88  ? 1.386  4.354   13.432  1.00 41.66  ? 84  SER H OG  1 
ATOM   3302 N N   . GLU C 3  89  ? 2.876  2.155   15.311  1.00 34.54  ? 85  GLU H N   1 
ATOM   3303 C CA  . GLU C 3  89  ? 4.011  2.147   16.224  1.00 35.73  ? 85  GLU H CA  1 
ATOM   3304 C C   . GLU C 3  89  ? 4.529  0.734   16.423  1.00 34.53  ? 85  GLU H C   1 
ATOM   3305 O O   . GLU C 3  89  ? 5.621  0.532   16.945  1.00 32.22  ? 85  GLU H O   1 
ATOM   3306 C CB  . GLU C 3  89  ? 3.595  2.707   17.579  1.00 42.77  ? 85  GLU H CB  1 
ATOM   3307 C CG  . GLU C 3  89  ? 2.921  4.066   17.522  1.00 58.33  ? 85  GLU H CG  1 
ATOM   3308 C CD  . GLU C 3  89  ? 3.822  5.133   16.928  1.00 66.61  ? 85  GLU H CD  1 
ATOM   3309 O OE1 . GLU C 3  89  ? 4.948  5.321   17.446  1.00 72.26  ? 85  GLU H OE1 1 
ATOM   3310 O OE2 . GLU C 3  89  ? 3.404  5.784   15.943  1.00 72.10  ? 85  GLU H OE2 1 
ATOM   3311 N N   . ASP C 3  90  ? 3.733  -0.245  16.007  1.00 33.26  ? 86  ASP H N   1 
ATOM   3312 C CA  . ASP C 3  90  ? 4.102  -1.641  16.172  1.00 31.67  ? 86  ASP H CA  1 
ATOM   3313 C C   . ASP C 3  90  ? 4.757  -2.222  14.935  1.00 30.51  ? 86  ASP H C   1 
ATOM   3314 O O   . ASP C 3  90  ? 5.200  -3.369  14.948  1.00 30.25  ? 86  ASP H O   1 
ATOM   3315 C CB  . ASP C 3  90  ? 2.874  -2.472  16.566  1.00 29.79  ? 86  ASP H CB  1 
ATOM   3316 C CG  . ASP C 3  90  ? 2.255  -2.017  17.882  1.00 29.66  ? 86  ASP H CG  1 
ATOM   3317 O OD1 . ASP C 3  90  ? 2.986  -1.947  18.893  1.00 29.54  ? 86  ASP H OD1 1 
ATOM   3318 O OD2 . ASP C 3  90  ? 1.037  -1.726  17.907  1.00 32.76  ? 86  ASP H OD2 1 
ATOM   3319 N N   . SER C 3  91  ? 4.805  -1.447  13.856  1.00 29.54  ? 87  SER H N   1 
ATOM   3320 C CA  . SER C 3  91  ? 5.475  -1.929  12.652  1.00 29.04  ? 87  SER H CA  1 
ATOM   3321 C C   . SER C 3  91  ? 6.955  -1.959  13.021  1.00 27.87  ? 87  SER H C   1 
ATOM   3322 O O   . SER C 3  91  ? 7.545  -0.932  13.389  1.00 29.22  ? 87  SER H O   1 
ATOM   3323 C CB  . SER C 3  91  ? 5.247  -0.983  11.478  1.00 29.10  ? 87  SER H CB  1 
ATOM   3324 O OG  . SER C 3  91  ? 3.973  -1.195  10.912  1.00 30.61  ? 87  SER H OG  1 
ATOM   3325 N N   . ALA C 3  92  ? 7.550  -3.140  12.952  1.00 25.45  ? 88  ALA H N   1 
ATOM   3326 C CA  . ALA C 3  92  ? 8.942  -3.271  13.320  1.00 21.51  ? 88  ALA H CA  1 
ATOM   3327 C C   . ALA C 3  92  ? 9.439  -4.650  12.996  1.00 22.10  ? 88  ALA H C   1 
ATOM   3328 O O   . ALA C 3  92  ? 8.720  -5.472  12.422  1.00 22.24  ? 88  ALA H O   1 
ATOM   3329 C CB  . ALA C 3  92  ? 9.100  -3.016  14.805  1.00 17.64  ? 88  ALA H CB  1 
ATOM   3330 N N   . VAL C 3  93  ? 10.699 -4.879  13.342  1.00 22.26  ? 89  VAL H N   1 
ATOM   3331 C CA  . VAL C 3  93  ? 11.314 -6.179  13.166  1.00 21.26  ? 89  VAL H CA  1 
ATOM   3332 C C   . VAL C 3  93  ? 11.381 -6.709  14.595  1.00 21.16  ? 89  VAL H C   1 
ATOM   3333 O O   . VAL C 3  93  ? 11.804 -5.994  15.511  1.00 24.37  ? 89  VAL H O   1 
ATOM   3334 C CB  . VAL C 3  93  ? 12.752 -6.084  12.595  1.00 21.38  ? 89  VAL H CB  1 
ATOM   3335 C CG1 . VAL C 3  93  ? 13.406 -7.452  12.649  1.00 21.97  ? 89  VAL H CG1 1 
ATOM   3336 C CG2 . VAL C 3  93  ? 12.721 -5.591  11.156  1.00 19.82  ? 89  VAL H CG2 1 
ATOM   3337 N N   . TYR C 3  94  ? 10.933 -7.938  14.799  1.00 18.43  ? 90  TYR H N   1 
ATOM   3338 C CA  . TYR C 3  94  ? 10.971 -8.529  16.129  1.00 18.29  ? 90  TYR H CA  1 
ATOM   3339 C C   . TYR C 3  94  ? 11.915 -9.721  16.113  1.00 18.97  ? 90  TYR H C   1 
ATOM   3340 O O   . TYR C 3  94  ? 11.764 -10.631 15.298  1.00 19.09  ? 90  TYR H O   1 
ATOM   3341 C CB  . TYR C 3  94  ? 9.570  -8.970  16.543  1.00 19.50  ? 90  TYR H CB  1 
ATOM   3342 C CG  . TYR C 3  94  ? 8.624  -7.814  16.745  1.00 19.99  ? 90  TYR H CG  1 
ATOM   3343 C CD1 . TYR C 3  94  ? 8.522  -7.185  17.981  1.00 19.71  ? 90  TYR H CD1 1 
ATOM   3344 C CD2 . TYR C 3  94  ? 7.862  -7.319  15.688  1.00 19.98  ? 90  TYR H CD2 1 
ATOM   3345 C CE1 . TYR C 3  94  ? 7.685  -6.091  18.163  1.00 18.31  ? 90  TYR H CE1 1 
ATOM   3346 C CE2 . TYR C 3  94  ? 7.019  -6.218  15.855  1.00 19.06  ? 90  TYR H CE2 1 
ATOM   3347 C CZ  . TYR C 3  94  ? 6.937  -5.611  17.095  1.00 21.26  ? 90  TYR H CZ  1 
ATOM   3348 O OH  . TYR C 3  94  ? 6.112  -4.519  17.275  1.00 23.71  ? 90  TYR H OH  1 
ATOM   3349 N N   . PHE C 3  95  ? 12.901 -9.693  17.006  1.00 19.20  ? 91  PHE H N   1 
ATOM   3350 C CA  . PHE C 3  95  ? 13.888 -10.758 17.134  1.00 16.54  ? 91  PHE H CA  1 
ATOM   3351 C C   . PHE C 3  95  ? 13.667 -11.530 18.422  1.00 17.37  ? 91  PHE H C   1 
ATOM   3352 O O   . PHE C 3  95  ? 13.193 -10.976 19.415  1.00 19.18  ? 91  PHE H O   1 
ATOM   3353 C CB  . PHE C 3  95  ? 15.313 -10.199 17.264  1.00 15.14  ? 91  PHE H CB  1 
ATOM   3354 C CG  . PHE C 3  95  ? 15.727 -9.284  16.166  1.00 16.70  ? 91  PHE H CG  1 
ATOM   3355 C CD1 . PHE C 3  95  ? 16.222 -9.793  14.970  1.00 17.22  ? 91  PHE H CD1 1 
ATOM   3356 C CD2 . PHE C 3  95  ? 15.637 -7.907  16.334  1.00 15.20  ? 91  PHE H CD2 1 
ATOM   3357 C CE1 . PHE C 3  95  ? 16.623 -8.946  13.952  1.00 20.59  ? 91  PHE H CE1 1 
ATOM   3358 C CE2 . PHE C 3  95  ? 16.033 -7.045  15.324  1.00 19.46  ? 91  PHE H CE2 1 
ATOM   3359 C CZ  . PHE C 3  95  ? 16.530 -7.565  14.125  1.00 21.14  ? 91  PHE H CZ  1 
ATOM   3360 N N   . CYS C 3  96  ? 14.027 -12.809 18.406  1.00 18.86  ? 92  CYS H N   1 
ATOM   3361 C CA  . CYS C 3  96  ? 14.015 -13.606 19.619  1.00 16.14  ? 92  CYS H CA  1 
ATOM   3362 C C   . CYS C 3  96  ? 15.503 -13.914 19.796  1.00 16.04  ? 92  CYS H C   1 
ATOM   3363 O O   . CYS C 3  96  ? 16.244 -14.052 18.828  1.00 15.75  ? 92  CYS H O   1 
ATOM   3364 C CB  . CYS C 3  96  ? 13.181 -14.886 19.488  1.00 16.56  ? 92  CYS H CB  1 
ATOM   3365 S SG  . CYS C 3  96  ? 13.529 -15.988 18.089  1.00 26.99  ? 92  CYS H SG  1 
ATOM   3366 N N   . ALA C 3  97  ? 15.955 -13.962 21.035  1.00 17.21  ? 93  ALA H N   1 
ATOM   3367 C CA  . ALA C 3  97  ? 17.355 -14.226 21.301  1.00 18.48  ? 93  ALA H CA  1 
ATOM   3368 C C   . ALA C 3  97  ? 17.466 -15.059 22.567  1.00 19.70  ? 93  ALA H C   1 
ATOM   3369 O O   . ALA C 3  97  ? 16.666 -14.921 23.494  1.00 18.63  ? 93  ALA H O   1 
ATOM   3370 C CB  . ALA C 3  97  ? 18.096 -12.925 21.466  1.00 12.91  ? 93  ALA H CB  1 
ATOM   3371 N N   . ARG C 3  98  ? 18.450 -15.944 22.585  1.00 20.53  ? 94  ARG H N   1 
ATOM   3372 C CA  . ARG C 3  98  ? 18.679 -16.798 23.737  1.00 20.50  ? 94  ARG H CA  1 
ATOM   3373 C C   . ARG C 3  98  ? 19.640 -16.086 24.677  1.00 22.03  ? 94  ARG H C   1 
ATOM   3374 O O   . ARG C 3  98  ? 20.567 -15.398 24.237  1.00 20.97  ? 94  ARG H O   1 
ATOM   3375 C CB  . ARG C 3  98  ? 19.297 -18.141 23.307  1.00 19.47  ? 94  ARG H CB  1 
ATOM   3376 C CG  . ARG C 3  98  ? 19.434 -19.136 24.451  1.00 16.91  ? 94  ARG H CG  1 
ATOM   3377 C CD  . ARG C 3  98  ? 20.164 -20.385 24.035  1.00 20.05  ? 94  ARG H CD  1 
ATOM   3378 N NE  . ARG C 3  98  ? 21.600 -20.177 23.828  1.00 23.49  ? 94  ARG H NE  1 
ATOM   3379 C CZ  . ARG C 3  98  ? 22.478 -21.170 23.666  1.00 24.49  ? 94  ARG H CZ  1 
ATOM   3380 N NH1 . ARG C 3  98  ? 22.066 -22.432 23.687  1.00 26.71  ? 94  ARG H NH1 1 
ATOM   3381 N NH2 . ARG C 3  98  ? 23.767 -20.913 23.489  1.00 23.17  ? 94  ARG H NH2 1 
ATOM   3382 N N   . TRP C 3  99  ? 19.401 -16.228 25.972  1.00 20.74  ? 95  TRP H N   1 
ATOM   3383 C CA  . TRP C 3  99  ? 20.292 -15.642 26.960  1.00 22.38  ? 95  TRP H CA  1 
ATOM   3384 C C   . TRP C 3  99  ? 21.232 -16.816 27.222  1.00 23.28  ? 95  TRP H C   1 
ATOM   3385 O O   . TRP C 3  99  ? 20.882 -17.763 27.925  1.00 24.02  ? 95  TRP H O   1 
ATOM   3386 C CB  . TRP C 3  99  ? 19.512 -15.263 28.213  1.00 21.67  ? 95  TRP H CB  1 
ATOM   3387 C CG  . TRP C 3  99  ? 20.167 -14.213 29.042  1.00 22.23  ? 95  TRP H CG  1 
ATOM   3388 C CD1 . TRP C 3  99  ? 21.223 -13.417 28.692  1.00 21.24  ? 95  TRP H CD1 1 
ATOM   3389 C CD2 . TRP C 3  99  ? 19.794 -13.827 30.367  1.00 24.23  ? 95  TRP H CD2 1 
ATOM   3390 N NE1 . TRP C 3  99  ? 21.529 -12.557 29.725  1.00 22.80  ? 95  TRP H NE1 1 
ATOM   3391 C CE2 . TRP C 3  99  ? 20.667 -12.793 30.765  1.00 23.10  ? 95  TRP H CE2 1 
ATOM   3392 C CE3 . TRP C 3  99  ? 18.800 -14.257 31.261  1.00 22.74  ? 95  TRP H CE3 1 
ATOM   3393 C CZ2 . TRP C 3  99  ? 20.580 -12.186 32.018  1.00 25.33  ? 95  TRP H CZ2 1 
ATOM   3394 C CZ3 . TRP C 3  99  ? 18.714 -13.643 32.512  1.00 22.30  ? 95  TRP H CZ3 1 
ATOM   3395 C CH2 . TRP C 3  99  ? 19.599 -12.623 32.875  1.00 20.60  ? 95  TRP H CH2 1 
ATOM   3396 N N   . GLY C 3  100 ? 22.416 -16.754 26.619  1.00 23.85  ? 96  GLY H N   1 
ATOM   3397 C CA  . GLY C 3  100 ? 23.380 -17.831 26.738  1.00 25.67  ? 96  GLY H CA  1 
ATOM   3398 C C   . GLY C 3  100 ? 24.171 -17.991 28.027  1.00 28.68  ? 96  GLY H C   1 
ATOM   3399 O O   . GLY C 3  100 ? 24.002 -17.238 28.990  1.00 27.78  ? 96  GLY H O   1 
ATOM   3400 N N   . PRO C 3  101 ? 25.068 -18.989 28.050  1.00 31.38  ? 97  PRO H N   1 
ATOM   3401 C CA  . PRO C 3  101 ? 25.958 -19.375 29.148  1.00 34.13  ? 97  PRO H CA  1 
ATOM   3402 C C   . PRO C 3  101 ? 26.649 -18.231 29.885  1.00 34.88  ? 97  PRO H C   1 
ATOM   3403 O O   . PRO C 3  101 ? 26.702 -18.236 31.122  1.00 37.44  ? 97  PRO H O   1 
ATOM   3404 C CB  . PRO C 3  101 ? 26.955 -20.299 28.460  1.00 32.37  ? 97  PRO H CB  1 
ATOM   3405 C CG  . PRO C 3  101 ? 26.115 -20.983 27.466  1.00 34.61  ? 97  PRO H CG  1 
ATOM   3406 C CD  . PRO C 3  101 ? 25.325 -19.836 26.872  1.00 32.82  ? 97  PRO H CD  1 
ATOM   3407 N N   . HIS C 3  102 ? 27.183 -17.264 29.134  1.00 32.82  ? 98  HIS H N   1 
ATOM   3408 C CA  . HIS C 3  102 ? 27.877 -16.124 29.735  1.00 31.88  ? 98  HIS H CA  1 
ATOM   3409 C C   . HIS C 3  102 ? 27.013 -14.882 29.876  1.00 29.72  ? 98  HIS H C   1 
ATOM   3410 O O   . HIS C 3  102 ? 27.504 -13.752 29.932  1.00 30.90  ? 98  HIS H O   1 
ATOM   3411 C CB  . HIS C 3  102 ? 29.145 -15.817 28.945  1.00 34.48  ? 98  HIS H CB  1 
ATOM   3412 C CG  . HIS C 3  102 ? 30.214 -16.847 29.132  1.00 39.95  ? 98  HIS H CG  1 
ATOM   3413 N ND1 . HIS C 3  102 ? 31.097 -16.818 30.191  1.00 40.17  ? 98  HIS H ND1 1 
ATOM   3414 C CD2 . HIS C 3  102 ? 30.500 -17.971 28.434  1.00 40.98  ? 98  HIS H CD2 1 
ATOM   3415 C CE1 . HIS C 3  102 ? 31.882 -17.879 30.136  1.00 44.27  ? 98  HIS H CE1 1 
ATOM   3416 N NE2 . HIS C 3  102 ? 31.540 -18.595 29.079  1.00 43.88  ? 98  HIS H NE2 1 
ATOM   3417 N N   . TRP C 3  103 ? 25.710 -15.120 29.918  1.00 26.33  ? 99  TRP H N   1 
ATOM   3418 C CA  . TRP C 3  103 ? 24.718 -14.088 30.101  1.00 23.31  ? 99  TRP H CA  1 
ATOM   3419 C C   . TRP C 3  103 ? 24.649 -12.903 29.155  1.00 22.67  ? 99  TRP H C   1 
ATOM   3420 O O   . TRP C 3  103 ? 24.522 -11.762 29.595  1.00 21.55  ? 99  TRP H O   1 
ATOM   3421 C CB  . TRP C 3  103 ? 24.783 -13.603 31.541  1.00 24.24  ? 99  TRP H CB  1 
ATOM   3422 C CG  . TRP C 3  103 ? 24.757 -14.765 32.490  1.00 27.15  ? 99  TRP H CG  1 
ATOM   3423 C CD1 . TRP C 3  103 ? 25.834 -15.365 33.099  1.00 27.23  ? 99  TRP H CD1 1 
ATOM   3424 C CD2 . TRP C 3  103 ? 23.606 -15.520 32.881  1.00 24.13  ? 99  TRP H CD2 1 
ATOM   3425 N NE1 . TRP C 3  103 ? 25.416 -16.445 33.843  1.00 23.64  ? 99  TRP H NE1 1 
ATOM   3426 C CE2 . TRP C 3  103 ? 24.054 -16.562 33.726  1.00 24.80  ? 99  TRP H CE2 1 
ATOM   3427 C CE3 . TRP C 3  103 ? 22.239 -15.418 32.601  1.00 21.65  ? 99  TRP H CE3 1 
ATOM   3428 C CZ2 . TRP C 3  103 ? 23.182 -17.491 34.289  1.00 22.55  ? 99  TRP H CZ2 1 
ATOM   3429 C CZ3 . TRP C 3  103 ? 21.371 -16.345 33.165  1.00 19.72  ? 99  TRP H CZ3 1 
ATOM   3430 C CH2 . TRP C 3  103 ? 21.847 -17.365 33.998  1.00 19.84  ? 99  TRP H CH2 1 
ATOM   3431 N N   . TYR C 3  104 ? 24.740 -13.176 27.858  1.00 21.39  ? 100 TYR H N   1 
ATOM   3432 C CA  . TYR C 3  104 ? 24.567 -12.136 26.851  1.00 21.60  ? 100 TYR H CA  1 
ATOM   3433 C C   . TYR C 3  104 ? 23.656 -12.817 25.840  1.00 20.57  ? 100 TYR H C   1 
ATOM   3434 O O   . TYR C 3  104 ? 23.531 -14.040 25.863  1.00 21.67  ? 100 TYR H O   1 
ATOM   3435 C CB  . TYR C 3  104 ? 25.900 -11.686 26.213  1.00 18.99  ? 100 TYR H CB  1 
ATOM   3436 C CG  . TYR C 3  104 ? 26.696 -12.728 25.459  1.00 23.58  ? 100 TYR H CG  1 
ATOM   3437 C CD1 . TYR C 3  104 ? 27.571 -13.597 26.122  1.00 23.40  ? 100 TYR H CD1 1 
ATOM   3438 C CD2 . TYR C 3  104 ? 26.590 -12.834 24.072  1.00 24.06  ? 100 TYR H CD2 1 
ATOM   3439 C CE1 . TYR C 3  104 ? 28.315 -14.542 25.419  1.00 23.74  ? 100 TYR H CE1 1 
ATOM   3440 C CE2 . TYR C 3  104 ? 27.329 -13.775 23.362  1.00 26.20  ? 100 TYR H CE2 1 
ATOM   3441 C CZ  . TYR C 3  104 ? 28.186 -14.623 24.040  1.00 25.55  ? 100 TYR H CZ  1 
ATOM   3442 O OH  . TYR C 3  104 ? 28.901 -15.548 23.326  1.00 29.54  ? 100 TYR H OH  1 
ATOM   3443 N N   . PHE C 3  105 A 22.983 -12.048 24.994  1.00 20.73  ? 100 PHE H N   1 
ATOM   3444 C CA  . PHE C 3  105 A 22.092 -12.629 23.982  1.00 19.73  ? 100 PHE H CA  1 
ATOM   3445 C C   . PHE C 3  105 A 23.029 -13.223 22.931  1.00 18.79  ? 100 PHE H C   1 
ATOM   3446 O O   . PHE C 3  105 A 23.461 -12.535 22.000  1.00 20.68  ? 100 PHE H O   1 
ATOM   3447 C CB  . PHE C 3  105 A 21.216 -11.524 23.385  1.00 18.17  ? 100 PHE H CB  1 
ATOM   3448 C CG  . PHE C 3  105 A 20.248 -10.907 24.368  1.00 15.75  ? 100 PHE H CG  1 
ATOM   3449 C CD1 . PHE C 3  105 A 20.413 -11.070 25.736  1.00 19.73  ? 100 PHE H CD1 1 
ATOM   3450 C CD2 . PHE C 3  105 A 19.161 -10.167 23.915  1.00 17.61  ? 100 PHE H CD2 1 
ATOM   3451 C CE1 . PHE C 3  105 A 19.509 -10.509 26.644  1.00 18.17  ? 100 PHE H CE1 1 
ATOM   3452 C CE2 . PHE C 3  105 A 18.248 -9.599  24.805  1.00 20.17  ? 100 PHE H CE2 1 
ATOM   3453 C CZ  . PHE C 3  105 A 18.421 -9.770  26.176  1.00 17.96  ? 100 PHE H CZ  1 
ATOM   3454 N N   . ASP C 3  106 ? 23.344 -14.504 23.085  1.00 18.58  ? 101 ASP H N   1 
ATOM   3455 C CA  . ASP C 3  106 ? 24.301 -15.157 22.205  1.00 21.51  ? 101 ASP H CA  1 
ATOM   3456 C C   . ASP C 3  106 ? 23.814 -15.711 20.868  1.00 20.97  ? 101 ASP H C   1 
ATOM   3457 O O   . ASP C 3  106 ? 24.568 -15.746 19.897  1.00 22.45  ? 101 ASP H O   1 
ATOM   3458 C CB  . ASP C 3  106 ? 25.078 -16.230 23.008  1.00 22.54  ? 101 ASP H CB  1 
ATOM   3459 C CG  . ASP C 3  106 ? 24.255 -17.468 23.338  1.00 27.54  ? 101 ASP H CG  1 
ATOM   3460 O OD1 . ASP C 3  106 ? 23.012 -17.390 23.434  1.00 32.01  ? 101 ASP H OD1 1 
ATOM   3461 O OD2 . ASP C 3  106 ? 24.876 -18.539 23.525  1.00 28.12  ? 101 ASP H OD2 1 
ATOM   3462 N N   . VAL C 3  107 ? 22.564 -16.140 20.803  1.00 20.19  ? 102 VAL H N   1 
ATOM   3463 C CA  . VAL C 3  107 ? 22.018 -16.658 19.558  1.00 21.31  ? 102 VAL H CA  1 
ATOM   3464 C C   . VAL C 3  107 ? 20.757 -15.857 19.242  1.00 20.53  ? 102 VAL H C   1 
ATOM   3465 O O   . VAL C 3  107 ? 19.846 -15.776 20.062  1.00 22.01  ? 102 VAL H O   1 
ATOM   3466 C CB  . VAL C 3  107 ? 21.666 -18.159 19.673  1.00 22.62  ? 102 VAL H CB  1 
ATOM   3467 C CG1 . VAL C 3  107 ? 21.150 -18.675 18.332  1.00 23.13  ? 102 VAL H CG1 1 
ATOM   3468 C CG2 . VAL C 3  107 ? 22.894 -18.951 20.109  1.00 25.68  ? 102 VAL H CG2 1 
ATOM   3469 N N   . TRP C 3  108 ? 20.715 -15.259 18.055  1.00 20.82  ? 103 TRP H N   1 
ATOM   3470 C CA  . TRP C 3  108 ? 19.570 -14.456 17.641  1.00 18.98  ? 103 TRP H CA  1 
ATOM   3471 C C   . TRP C 3  108 ? 18.795 -15.064 16.480  1.00 19.47  ? 103 TRP H C   1 
ATOM   3472 O O   . TRP C 3  108 ? 19.384 -15.675 15.590  1.00 21.35  ? 103 TRP H O   1 
ATOM   3473 C CB  . TRP C 3  108 ? 20.034 -13.071 17.206  1.00 17.84  ? 103 TRP H CB  1 
ATOM   3474 C CG  . TRP C 3  108 ? 20.590 -12.233 18.296  1.00 22.37  ? 103 TRP H CG  1 
ATOM   3475 C CD1 . TRP C 3  108 ? 21.757 -12.433 18.978  1.00 20.72  ? 103 TRP H CD1 1 
ATOM   3476 C CD2 . TRP C 3  108 ? 20.015 -11.026 18.820  1.00 20.07  ? 103 TRP H CD2 1 
ATOM   3477 N NE1 . TRP C 3  108 ? 21.946 -11.420 19.894  1.00 22.09  ? 103 TRP H NE1 1 
ATOM   3478 C CE2 . TRP C 3  108 ? 20.892 -10.544 19.816  1.00 19.41  ? 103 TRP H CE2 1 
ATOM   3479 C CE3 . TRP C 3  108 ? 18.844 -10.303 18.539  1.00 19.39  ? 103 TRP H CE3 1 
ATOM   3480 C CZ2 . TRP C 3  108 ? 20.635 -9.370  20.537  1.00 16.24  ? 103 TRP H CZ2 1 
ATOM   3481 C CZ3 . TRP C 3  108 ? 18.588 -9.137  19.254  1.00 15.62  ? 103 TRP H CZ3 1 
ATOM   3482 C CH2 . TRP C 3  108 ? 19.483 -8.683  20.242  1.00 15.82  ? 103 TRP H CH2 1 
ATOM   3483 N N   . GLY C 3  109 ? 17.472 -14.904 16.490  1.00 19.40  ? 104 GLY H N   1 
ATOM   3484 C CA  . GLY C 3  109 ? 16.683 -15.378 15.368  1.00 19.22  ? 104 GLY H CA  1 
ATOM   3485 C C   . GLY C 3  109 ? 16.945 -14.349 14.266  1.00 21.40  ? 104 GLY H C   1 
ATOM   3486 O O   . GLY C 3  109 ? 17.517 -13.287 14.541  1.00 23.36  ? 104 GLY H O   1 
ATOM   3487 N N   . GLN C 3  110 ? 16.539 -14.627 13.033  1.00 19.53  ? 105 GLN H N   1 
ATOM   3488 C CA  . GLN C 3  110 ? 16.779 -13.689 11.934  1.00 22.11  ? 105 GLN H CA  1 
ATOM   3489 C C   . GLN C 3  110 ? 15.876 -12.458 11.965  1.00 23.03  ? 105 GLN H C   1 
ATOM   3490 O O   . GLN C 3  110 ? 16.126 -11.476 11.260  1.00 23.84  ? 105 GLN H O   1 
ATOM   3491 C CB  . GLN C 3  110 ? 16.621 -14.407 10.590  1.00 29.16  ? 105 GLN H CB  1 
ATOM   3492 C CG  . GLN C 3  110 ? 15.388 -15.334 10.489  1.00 46.97  ? 105 GLN H CG  1 
ATOM   3493 C CD  . GLN C 3  110 ? 15.528 -16.674 11.259  1.00 51.93  ? 105 GLN H CD  1 
ATOM   3494 O OE1 . GLN C 3  110 ? 15.429 -16.727 12.493  1.00 41.08  ? 105 GLN H OE1 1 
ATOM   3495 N NE2 . GLN C 3  110 ? 15.756 -17.758 10.511  1.00 54.39  ? 105 GLN H NE2 1 
ATOM   3496 N N   . GLY C 3  111 ? 14.828 -12.520 12.782  1.00 23.12  ? 106 GLY H N   1 
ATOM   3497 C CA  . GLY C 3  111 ? 13.896 -11.411 12.901  1.00 23.49  ? 106 GLY H CA  1 
ATOM   3498 C C   . GLY C 3  111 ? 12.628 -11.594 12.085  1.00 22.58  ? 106 GLY H C   1 
ATOM   3499 O O   . GLY C 3  111 ? 12.639 -12.211 11.023  1.00 25.83  ? 106 GLY H O   1 
ATOM   3500 N N   . THR C 3  112 ? 11.519 -11.072 12.585  1.00 22.51  ? 107 THR H N   1 
ATOM   3501 C CA  . THR C 3  112 ? 10.263 -11.170 11.857  1.00 21.93  ? 107 THR H CA  1 
ATOM   3502 C C   . THR C 3  112 ? 9.741  -9.763  11.617  1.00 22.20  ? 107 THR H C   1 
ATOM   3503 O O   . THR C 3  112 ? 9.545  -9.002  12.559  1.00 20.42  ? 107 THR H O   1 
ATOM   3504 C CB  . THR C 3  112 ? 9.193  -11.938 12.637  1.00 20.65  ? 107 THR H CB  1 
ATOM   3505 O OG1 . THR C 3  112 ? 9.597  -13.297 12.800  1.00 25.49  ? 107 THR H OG1 1 
ATOM   3506 C CG2 . THR C 3  112 ? 7.884  -11.911 11.879  1.00 17.82  ? 107 THR H CG2 1 
ATOM   3507 N N   . THR C 3  113 ? 9.523  -9.427  10.350  1.00 24.37  ? 108 THR H N   1 
ATOM   3508 C CA  . THR C 3  113 ? 9.026  -8.110  9.987   1.00 26.29  ? 108 THR H CA  1 
ATOM   3509 C C   . THR C 3  113 ? 7.511  -8.023  10.128  1.00 25.97  ? 108 THR H C   1 
ATOM   3510 O O   . THR C 3  113 ? 6.791  -8.825  9.544   1.00 27.39  ? 108 THR H O   1 
ATOM   3511 C CB  . THR C 3  113 ? 9.390  -7.759  8.537   1.00 24.82  ? 108 THR H CB  1 
ATOM   3512 O OG1 . THR C 3  113 ? 10.814 -7.690  8.405   1.00 30.85  ? 108 THR H OG1 1 
ATOM   3513 C CG2 . THR C 3  113 ? 8.791  -6.426  8.157   1.00 28.30  ? 108 THR H CG2 1 
ATOM   3514 N N   . VAL C 3  114 ? 7.036  -7.067  10.921  1.00 25.51  ? 109 VAL H N   1 
ATOM   3515 C CA  . VAL C 3  114 ? 5.597  -6.871  11.087  1.00 27.32  ? 109 VAL H CA  1 
ATOM   3516 C C   . VAL C 3  114 ? 5.188  -5.496  10.540  1.00 27.40  ? 109 VAL H C   1 
ATOM   3517 O O   . VAL C 3  114 ? 5.610  -4.462  11.052  1.00 29.63  ? 109 VAL H O   1 
ATOM   3518 C CB  . VAL C 3  114 ? 5.159  -6.950  12.561  1.00 22.74  ? 109 VAL H CB  1 
ATOM   3519 C CG1 . VAL C 3  114 ? 3.692  -6.560  12.678  1.00 22.22  ? 109 VAL H CG1 1 
ATOM   3520 C CG2 . VAL C 3  114 ? 5.358  -8.358  13.089  1.00 19.70  ? 109 VAL H CG2 1 
ATOM   3521 N N   . THR C 3  115 ? 4.381  -5.499  9.488   1.00 27.57  ? 110 THR H N   1 
ATOM   3522 C CA  . THR C 3  115 ? 3.911  -4.260  8.889   1.00 29.58  ? 110 THR H CA  1 
ATOM   3523 C C   . THR C 3  115 ? 2.427  -4.088  9.204   1.00 27.84  ? 110 THR H C   1 
ATOM   3524 O O   . THR C 3  115 ? 1.588  -4.863  8.736   1.00 28.24  ? 110 THR H O   1 
ATOM   3525 C CB  . THR C 3  115 ? 4.104  -4.280  7.358   1.00 31.69  ? 110 THR H CB  1 
ATOM   3526 O OG1 . THR C 3  115 ? 5.479  -4.555  7.050   1.00 33.08  ? 110 THR H OG1 1 
ATOM   3527 C CG2 . THR C 3  115 ? 3.704  -2.936  6.753   1.00 30.01  ? 110 THR H CG2 1 
ATOM   3528 N N   . VAL C 3  116 ? 2.120  -3.085  10.018  1.00 27.21  ? 111 VAL H N   1 
ATOM   3529 C CA  . VAL C 3  116 ? 0.746  -2.780  10.412  1.00 27.93  ? 111 VAL H CA  1 
ATOM   3530 C C   . VAL C 3  116 ? 0.150  -1.864  9.344   1.00 30.44  ? 111 VAL H C   1 
ATOM   3531 O O   . VAL C 3  116 ? 0.437  -0.668  9.308   1.00 28.82  ? 111 VAL H O   1 
ATOM   3532 C CB  . VAL C 3  116 ? 0.710  -2.059  11.777  1.00 26.79  ? 111 VAL H CB  1 
ATOM   3533 C CG1 . VAL C 3  116 ? -0.728 -1.771  12.185  1.00 29.29  ? 111 VAL H CG1 1 
ATOM   3534 C CG2 . VAL C 3  116 ? 1.389  -2.913  12.822  1.00 23.60  ? 111 VAL H CG2 1 
ATOM   3535 N N   . SER C 3  117 ? -0.669 -2.432  8.469   1.00 31.13  ? 112 SER H N   1 
ATOM   3536 C CA  . SER C 3  117 ? -1.266 -1.658  7.394   1.00 36.03  ? 112 SER H CA  1 
ATOM   3537 C C   . SER C 3  117 ? -2.639 -2.166  6.952   1.00 38.51  ? 112 SER H C   1 
ATOM   3538 O O   . SER C 3  117 ? -2.996 -3.324  7.177   1.00 38.64  ? 112 SER H O   1 
ATOM   3539 C CB  . SER C 3  117 ? -0.315 -1.636  6.192   1.00 35.25  ? 112 SER H CB  1 
ATOM   3540 O OG  . SER C 3  117 ? -0.950 -1.090  5.045   1.00 36.04  ? 112 SER H OG  1 
ATOM   3541 N N   . SER C 3  118 ? -3.395 -1.285  6.305   1.00 38.62  ? 113 SER H N   1 
ATOM   3542 C CA  . SER C 3  118 ? -4.725 -1.613  5.818   1.00 39.45  ? 113 SER H CA  1 
ATOM   3543 C C   . SER C 3  118 ? -4.666 -1.842  4.322   1.00 40.62  ? 113 SER H C   1 
ATOM   3544 O O   . SER C 3  118 ? -5.650 -2.249  3.717   1.00 43.87  ? 113 SER H O   1 
ATOM   3545 C CB  . SER C 3  118 ? -5.682 -0.461  6.100   1.00 39.85  ? 113 SER H CB  1 
ATOM   3546 O OG  . SER C 3  118 ? -5.495 0.041   7.414   1.00 48.50  ? 113 SER H OG  1 
ATOM   3547 N N   . ALA C 3  119 ? -3.510 -1.576  3.724   1.00 40.47  ? 114 ALA H N   1 
ATOM   3548 C CA  . ALA C 3  119 ? -3.345 -1.734  2.283   1.00 40.43  ? 114 ALA H CA  1 
ATOM   3549 C C   . ALA C 3  119 ? -3.518 -3.181  1.827   1.00 39.46  ? 114 ALA H C   1 
ATOM   3550 O O   . ALA C 3  119 ? -3.435 -4.109  2.626   1.00 39.51  ? 114 ALA H O   1 
ATOM   3551 C CB  . ALA C 3  119 ? -1.979 -1.203  1.857   1.00 38.80  ? 114 ALA H CB  1 
ATOM   3552 N N   . LYS C 3  120 ? -3.765 -3.362  0.535   1.00 39.18  ? 115 LYS H N   1 
ATOM   3553 C CA  . LYS C 3  120 ? -3.940 -4.688  -0.040  1.00 40.14  ? 115 LYS H CA  1 
ATOM   3554 C C   . LYS C 3  120 ? -2.804 -4.899  -1.042  1.00 39.17  ? 115 LYS H C   1 
ATOM   3555 O O   . LYS C 3  120 ? -2.177 -3.936  -1.485  1.00 40.23  ? 115 LYS H O   1 
ATOM   3556 C CB  . LYS C 3  120 ? -5.297 -4.776  -0.747  1.00 44.89  ? 115 LYS H CB  1 
ATOM   3557 C CG  . LYS C 3  120 ? -5.346 -3.985  -2.043  1.00 51.86  ? 115 LYS H CG  1 
ATOM   3558 C CD  . LYS C 3  120 ? -6.745 -3.886  -2.636  1.00 56.68  ? 115 LYS H CD  1 
ATOM   3559 C CE  . LYS C 3  120 ? -6.679 -3.566  -4.137  1.00 59.96  ? 115 LYS H CE  1 
ATOM   3560 N NZ  . LYS C 3  120 ? -5.742 -2.443  -4.471  1.00 61.12  ? 115 LYS H NZ  1 
ATOM   3561 N N   . THR C 3  121 ? -2.525 -6.149  -1.390  1.00 37.91  ? 116 THR H N   1 
ATOM   3562 C CA  . THR C 3  121 ? -1.458 -6.430  -2.340  1.00 36.36  ? 116 THR H CA  1 
ATOM   3563 C C   . THR C 3  121 ? -1.751 -5.695  -3.634  1.00 39.48  ? 116 THR H C   1 
ATOM   3564 O O   . THR C 3  121 ? -2.743 -5.975  -4.308  1.00 42.85  ? 116 THR H O   1 
ATOM   3565 C CB  . THR C 3  121 ? -1.345 -7.926  -2.650  1.00 33.17  ? 116 THR H CB  1 
ATOM   3566 O OG1 . THR C 3  121 ? -1.166 -8.651  -1.432  1.00 36.43  ? 116 THR H OG1 1 
ATOM   3567 C CG2 . THR C 3  121 ? -0.153 -8.190  -3.553  1.00 31.59  ? 116 THR H CG2 1 
ATOM   3568 N N   . THR C 3  122 ? -0.881 -4.750  -3.975  1.00 38.92  ? 117 THR H N   1 
ATOM   3569 C CA  . THR C 3  122 ? -1.037 -3.953  -5.185  1.00 34.33  ? 117 THR H CA  1 
ATOM   3570 C C   . THR C 3  122 ? 0.232  -4.035  -6.031  1.00 33.67  ? 117 THR H C   1 
ATOM   3571 O O   . THR C 3  122 ? 1.340  -3.895  -5.514  1.00 33.96  ? 117 THR H O   1 
ATOM   3572 C CB  . THR C 3  122 ? -1.280 -2.468  -4.829  1.00 32.68  ? 117 THR H CB  1 
ATOM   3573 O OG1 . THR C 3  122 ? -2.353 -2.369  -3.888  1.00 35.53  ? 117 THR H OG1 1 
ATOM   3574 C CG2 . THR C 3  122 ? -1.627 -1.661  -6.072  1.00 33.74  ? 117 THR H CG2 1 
ATOM   3575 N N   . PRO C 3  123 ? 0.095  -4.309  -7.337  1.00 33.76  ? 118 PRO H N   1 
ATOM   3576 C CA  . PRO C 3  123 ? 1.327  -4.362  -8.125  1.00 34.27  ? 118 PRO H CA  1 
ATOM   3577 C C   . PRO C 3  123 ? 1.801  -2.922  -8.367  1.00 35.29  ? 118 PRO H C   1 
ATOM   3578 O O   . PRO C 3  123 ? 1.012  -1.968  -8.341  1.00 35.53  ? 118 PRO H O   1 
ATOM   3579 C CB  . PRO C 3  123 ? 0.902  -5.100  -9.400  1.00 33.66  ? 118 PRO H CB  1 
ATOM   3580 C CG  . PRO C 3  123 ? -0.536 -4.764  -9.528  1.00 35.77  ? 118 PRO H CG  1 
ATOM   3581 C CD  . PRO C 3  123 ? -1.046 -4.837  -8.103  1.00 34.40  ? 118 PRO H CD  1 
ATOM   3582 N N   . PRO C 3  124 ? 3.100  -2.742  -8.595  1.00 33.49  ? 119 PRO H N   1 
ATOM   3583 C CA  . PRO C 3  124 ? 3.587  -1.386  -8.817  1.00 33.08  ? 119 PRO H CA  1 
ATOM   3584 C C   . PRO C 3  124 ? 3.383  -0.896  -10.225 1.00 35.21  ? 119 PRO H C   1 
ATOM   3585 O O   . PRO C 3  124 ? 3.119  -1.678  -11.140 1.00 35.93  ? 119 PRO H O   1 
ATOM   3586 C CB  . PRO C 3  124 ? 5.063  -1.511  -8.488  1.00 33.09  ? 119 PRO H CB  1 
ATOM   3587 C CG  . PRO C 3  124 ? 5.380  -2.855  -9.075  1.00 34.32  ? 119 PRO H CG  1 
ATOM   3588 C CD  . PRO C 3  124 ? 4.201  -3.718  -8.660  1.00 31.70  ? 119 PRO H CD  1 
ATOM   3589 N N   . SER C 3  125 ? 3.492  0.416   -10.390 1.00 36.01  ? 120 SER H N   1 
ATOM   3590 C CA  . SER C 3  125 ? 3.408  1.021   -11.710 1.00 33.04  ? 120 SER H CA  1 
ATOM   3591 C C   . SER C 3  125 ? 4.864  1.398   -11.957 1.00 32.69  ? 120 SER H C   1 
ATOM   3592 O O   . SER C 3  125 ? 5.480  2.095   -11.153 1.00 33.80  ? 120 SER H O   1 
ATOM   3593 C CB  . SER C 3  125 ? 2.519  2.260   -11.686 1.00 32.20  ? 120 SER H CB  1 
ATOM   3594 O OG  . SER C 3  125 ? 1.233  1.930   -11.193 1.00 36.11  ? 120 SER H OG  1 
ATOM   3595 N N   . VAL C 3  126 ? 5.431  0.903   -13.044 1.00 33.06  ? 121 VAL H N   1 
ATOM   3596 C CA  . VAL C 3  126 ? 6.819  1.191   -13.347 1.00 32.14  ? 121 VAL H CA  1 
ATOM   3597 C C   . VAL C 3  126 ? 6.883  2.300   -14.387 1.00 31.67  ? 121 VAL H C   1 
ATOM   3598 O O   . VAL C 3  126 ? 6.318  2.184   -15.482 1.00 31.97  ? 121 VAL H O   1 
ATOM   3599 C CB  . VAL C 3  126 ? 7.547  -0.091  -13.857 1.00 34.37  ? 121 VAL H CB  1 
ATOM   3600 C CG1 . VAL C 3  126 ? 9.043  0.152   -14.010 1.00 31.64  ? 121 VAL H CG1 1 
ATOM   3601 C CG2 . VAL C 3  126 ? 7.314  -1.226  -12.878 1.00 35.16  ? 121 VAL H CG2 1 
ATOM   3602 N N   . TYR C 3  127 ? 7.555  3.388   -14.021 1.00 30.16  ? 122 TYR H N   1 
ATOM   3603 C CA  . TYR C 3  127 ? 7.707  4.532   -14.908 1.00 29.59  ? 122 TYR H CA  1 
ATOM   3604 C C   . TYR C 3  127 ? 9.173  4.806   -15.194 1.00 30.33  ? 122 TYR H C   1 
ATOM   3605 O O   . TYR C 3  127 ? 10.006 4.823   -14.287 1.00 30.81  ? 122 TYR H O   1 
ATOM   3606 C CB  . TYR C 3  127 ? 7.102  5.790   -14.292 1.00 27.94  ? 122 TYR H CB  1 
ATOM   3607 C CG  . TYR C 3  127 ? 5.658  5.676   -13.895 1.00 25.33  ? 122 TYR H CG  1 
ATOM   3608 C CD1 . TYR C 3  127 ? 4.691  5.254   -14.805 1.00 26.99  ? 122 TYR H CD1 1 
ATOM   3609 C CD2 . TYR C 3  127 ? 5.249  6.034   -12.615 1.00 24.60  ? 122 TYR H CD2 1 
ATOM   3610 C CE1 . TYR C 3  127 ? 3.348  5.199   -14.446 1.00 29.93  ? 122 TYR H CE1 1 
ATOM   3611 C CE2 . TYR C 3  127 ? 3.915  5.983   -12.247 1.00 28.42  ? 122 TYR H CE2 1 
ATOM   3612 C CZ  . TYR C 3  127 ? 2.971  5.572   -13.164 1.00 28.66  ? 122 TYR H CZ  1 
ATOM   3613 O OH  . TYR C 3  127 ? 1.649  5.585   -12.804 1.00 34.16  ? 122 TYR H OH  1 
ATOM   3614 N N   . PRO C 3  128 ? 9.501  5.042   -16.472 1.00 32.75  ? 123 PRO H N   1 
ATOM   3615 C CA  . PRO C 3  128 ? 10.854 5.329   -16.948 1.00 32.29  ? 123 PRO H CA  1 
ATOM   3616 C C   . PRO C 3  128 ? 11.247 6.766   -16.644 1.00 33.78  ? 123 PRO H C   1 
ATOM   3617 O O   . PRO C 3  128 ? 10.454 7.684   -16.829 1.00 37.22  ? 123 PRO H O   1 
ATOM   3618 C CB  . PRO C 3  128 ? 10.738 5.097   -18.443 1.00 33.55  ? 123 PRO H CB  1 
ATOM   3619 C CG  . PRO C 3  128 ? 9.378  5.658   -18.720 1.00 35.96  ? 123 PRO H CG  1 
ATOM   3620 C CD  . PRO C 3  128 ? 8.547  5.050   -17.599 1.00 32.53  ? 123 PRO H CD  1 
ATOM   3621 N N   . LEU C 3  129 ? 12.470 6.959   -16.173 1.00 35.02  ? 124 LEU H N   1 
ATOM   3622 C CA  . LEU C 3  129 ? 12.959 8.295   -15.878 1.00 35.07  ? 124 LEU H CA  1 
ATOM   3623 C C   . LEU C 3  129 ? 14.063 8.632   -16.890 1.00 35.41  ? 124 LEU H C   1 
ATOM   3624 O O   . LEU C 3  129 ? 15.212 8.218   -16.740 1.00 32.18  ? 124 LEU H O   1 
ATOM   3625 C CB  . LEU C 3  129 ? 13.505 8.358   -14.444 1.00 33.22  ? 124 LEU H CB  1 
ATOM   3626 C CG  . LEU C 3  129 ? 12.538 7.963   -13.328 1.00 32.70  ? 124 LEU H CG  1 
ATOM   3627 C CD1 . LEU C 3  129 ? 13.217 8.094   -11.961 1.00 28.56  ? 124 LEU H CD1 1 
ATOM   3628 C CD2 . LEU C 3  129 ? 11.308 8.850   -13.411 1.00 34.53  ? 124 LEU H CD2 1 
ATOM   3629 N N   . ALA C 3  130 ? 13.696 9.360   -17.939 1.00 36.35  ? 125 ALA H N   1 
ATOM   3630 C CA  . ALA C 3  130 ? 14.650 9.767   -18.966 1.00 35.15  ? 125 ALA H CA  1 
ATOM   3631 C C   . ALA C 3  130 ? 14.893 11.271  -18.821 1.00 36.22  ? 125 ALA H C   1 
ATOM   3632 O O   . ALA C 3  130 ? 14.003 12.019  -18.412 1.00 33.47  ? 125 ALA H O   1 
ATOM   3633 C CB  . ALA C 3  130 ? 14.101 9.435   -20.364 1.00 34.92  ? 125 ALA H CB  1 
ATOM   3634 N N   . PRO C 3  131 ? 16.105 11.734  -19.155 1.00 40.40  ? 126 PRO H N   1 
ATOM   3635 C CA  . PRO C 3  131 ? 16.429 13.160  -19.043 1.00 45.67  ? 126 PRO H CA  1 
ATOM   3636 C C   . PRO C 3  131 ? 15.383 14.041  -19.721 1.00 52.00  ? 126 PRO H C   1 
ATOM   3637 O O   . PRO C 3  131 ? 14.849 13.681  -20.774 1.00 54.20  ? 126 PRO H O   1 
ATOM   3638 C CB  . PRO C 3  131 ? 17.789 13.255  -19.727 1.00 42.88  ? 126 PRO H CB  1 
ATOM   3639 C CG  . PRO C 3  131 ? 18.388 11.910  -19.473 1.00 40.13  ? 126 PRO H CG  1 
ATOM   3640 C CD  . PRO C 3  131 ? 17.226 10.990  -19.752 1.00 39.24  ? 126 PRO H CD  1 
ATOM   3641 N N   . ASN C 3  133 ? 27.273 14.198  -20.578 1.00 63.27  ? 128 ASN H N   1 
ATOM   3642 C CA  . ASN C 3  133 ? 27.216 13.963  -22.022 1.00 62.66  ? 128 ASN H CA  1 
ATOM   3643 C C   . ASN C 3  133 ? 27.987 12.704  -22.409 1.00 62.02  ? 128 ASN H C   1 
ATOM   3644 O O   . ASN C 3  133 ? 27.803 12.111  -23.463 1.00 62.53  ? 128 ASN H O   1 
ATOM   3645 C CB  . ASN C 3  133 ? 27.771 15.161  -22.772 1.00 63.60  ? 128 ASN H CB  1 
ATOM   3646 C CG  . ASN C 3  133 ? 27.129 16.472  -22.337 1.00 64.10  ? 128 ASN H CG  1 
ATOM   3647 O OD1 . ASN C 3  133 ? 25.911 16.524  -22.104 1.00 65.15  ? 128 ASN H OD1 1 
ATOM   3648 N ND2 . ASN C 3  133 ? 27.926 17.513  -22.212 1.00 64.82  ? 128 ASN H ND2 1 
ATOM   3649 N N   . SER C 3  134 ? 28.867 12.383  -21.461 1.00 60.78  ? 129 SER H N   1 
ATOM   3650 C CA  . SER C 3  134 ? 29.773 11.216  -21.431 1.00 59.55  ? 129 SER H CA  1 
ATOM   3651 C C   . SER C 3  134 ? 29.096 10.143  -20.572 1.00 58.39  ? 129 SER H C   1 
ATOM   3652 O O   . SER C 3  134 ? 29.301 8.954   -20.783 1.00 58.91  ? 129 SER H O   1 
ATOM   3653 C CB  . SER C 3  134 ? 31.164 11.595  -20.921 1.00 59.75  ? 129 SER H CB  1 
ATOM   3654 O OG  . SER C 3  134 ? 31.832 12.443  -21.837 1.00 59.36  ? 129 SER H OG  1 
ATOM   3655 N N   . MET C 3  135 ? 28.300 10.575  -19.595 1.00 56.82  ? 130 MET H N   1 
ATOM   3656 C CA  . MET C 3  135 ? 27.491 9.690   -18.767 1.00 55.60  ? 130 MET H CA  1 
ATOM   3657 C C   . MET C 3  135 ? 26.071 10.309  -18.739 1.00 54.04  ? 130 MET H C   1 
ATOM   3658 O O   . MET C 3  135 ? 25.928 11.528  -18.665 1.00 53.87  ? 130 MET H O   1 
ATOM   3659 C CB  . MET C 3  135 ? 28.121 9.509   -17.374 1.00 56.36  ? 130 MET H CB  1 
ATOM   3660 C CG  . MET C 3  135 ? 29.578 9.053   -17.420 1.00 57.55  ? 130 MET H CG  1 
ATOM   3661 S SD  . MET C 3  135 ? 29.766 7.338   -16.927 1.00 60.07  ? 130 MET H SD  1 
ATOM   3662 C CE  . MET C 3  135 ? 29.030 6.507   -18.328 1.00 59.16  ? 130 MET H CE  1 
ATOM   3663 N N   . VAL C 3  136 ? 25.048 9.477   -18.841 1.00 52.07  ? 131 VAL H N   1 
ATOM   3664 C CA  . VAL C 3  136 ? 23.647 9.912   -18.834 1.00 50.70  ? 131 VAL H CA  1 
ATOM   3665 C C   . VAL C 3  136 ? 22.875 9.139   -17.745 1.00 50.05  ? 131 VAL H C   1 
ATOM   3666 O O   . VAL C 3  136 ? 22.805 7.901   -17.824 1.00 50.42  ? 131 VAL H O   1 
ATOM   3667 C CB  . VAL C 3  136 ? 23.008 9.649   -20.187 1.00 50.42  ? 131 VAL H CB  1 
ATOM   3668 C CG1 . VAL C 3  136 ? 23.372 8.268   -20.693 1.00 49.91  ? 131 VAL H CG1 1 
ATOM   3669 C CG2 . VAL C 3  136 ? 21.503 9.822   -20.114 1.00 50.25  ? 131 VAL H CG2 1 
ATOM   3670 N N   . THR C 3  137 ? 22.317 9.742   -16.722 1.00 48.91  ? 132 THR H N   1 
ATOM   3671 C CA  . THR C 3  137 ? 21.662 8.870   -15.748 1.00 47.88  ? 132 THR H CA  1 
ATOM   3672 C C   . THR C 3  137 ? 20.291 8.327   -16.289 1.00 47.96  ? 132 THR H C   1 
ATOM   3673 O O   . THR C 3  137 ? 20.007 8.519   -17.471 1.00 49.76  ? 132 THR H O   1 
ATOM   3674 C CB  . THR C 3  137 ? 21.633 9.643   -14.403 1.00 47.36  ? 132 THR H CB  1 
ATOM   3675 O OG1 . THR C 3  137 ? 22.986 9.942   -14.030 1.00 45.10  ? 132 THR H OG1 1 
ATOM   3676 C CG2 . THR C 3  137 ? 20.964 8.806   -13.331 1.00 46.61  ? 132 THR H CG2 1 
ATOM   3677 N N   . LEU C 3  138 ? 19.441 7.649   -15.465 1.00 47.67  ? 133 LEU H N   1 
ATOM   3678 C CA  . LEU C 3  138 ? 18.121 7.105   -15.879 1.00 47.31  ? 133 LEU H CA  1 
ATOM   3679 C C   . LEU C 3  138 ? 17.514 6.466   -14.632 1.00 47.36  ? 133 LEU H C   1 
ATOM   3680 O O   . LEU C 3  138 ? 18.279 5.837   -13.893 1.00 47.47  ? 133 LEU H O   1 
ATOM   3681 C CB  . LEU C 3  138 ? 18.275 6.062   -17.010 1.00 46.35  ? 133 LEU H CB  1 
ATOM   3682 C CG  . LEU C 3  138 ? 19.076 6.428   -18.283 1.00 46.37  ? 133 LEU H CG  1 
ATOM   3683 C CD1 . LEU C 3  138 ? 19.079 5.265   -19.277 1.00 45.72  ? 133 LEU H CD1 1 
ATOM   3684 C CD2 . LEU C 3  138 ? 18.524 7.682   -18.941 1.00 45.41  ? 133 LEU H CD2 1 
ATOM   3685 N N   . GLY C 3  139 ? 16.300 6.589   -14.363 1.00 47.47  ? 134 GLY H N   1 
ATOM   3686 C CA  . GLY C 3  139 ? 16.053 5.819   -13.259 1.00 48.51  ? 134 GLY H CA  1 
ATOM   3687 C C   . GLY C 3  139 ? 15.117 4.784   -13.724 1.00 49.17  ? 134 GLY H C   1 
ATOM   3688 O O   . GLY C 3  139 ? 15.266 4.036   -14.684 1.00 50.94  ? 134 GLY H O   1 
ATOM   3689 N N   . CYS C 3  140 ? 14.309 4.875   -12.926 1.00 32.58  ? 135 CYS H N   1 
ATOM   3690 C CA  . CYS C 3  140 ? 13.115 4.022   -12.929 1.00 32.93  ? 135 CYS H CA  1 
ATOM   3691 C C   . CYS C 3  140 ? 12.316 4.350   -11.655 1.00 29.93  ? 135 CYS H C   1 
ATOM   3692 O O   . CYS C 3  140 ? 12.865 4.352   -10.559 1.00 27.71  ? 135 CYS H O   1 
ATOM   3693 C CB  . CYS C 3  140 ? 13.588 2.561   -12.929 1.00 38.80  ? 135 CYS H CB  1 
ATOM   3694 S SG  . CYS C 3  140 ? 12.443 1.172   -13.244 1.00 51.96  ? 135 CYS H SG  1 
ATOM   3695 N N   . LEU C 3  141 ? 11.033 4.657   -11.802 1.00 30.10  ? 136 LEU H N   1 
ATOM   3696 C CA  . LEU C 3  141 ? 10.189 4.985   -10.652 1.00 28.39  ? 136 LEU H CA  1 
ATOM   3697 C C   . LEU C 3  141 ? 9.143  3.893   -10.414 1.00 30.16  ? 136 LEU H C   1 
ATOM   3698 O O   . LEU C 3  141 ? 8.273  3.663   -11.250 1.00 31.13  ? 136 LEU H O   1 
ATOM   3699 C CB  . LEU C 3  141 ? 9.475  6.323   -10.874 1.00 26.02  ? 136 LEU H CB  1 
ATOM   3700 C CG  . LEU C 3  141 ? 8.432  6.769   -9.825  1.00 24.69  ? 136 LEU H CG  1 
ATOM   3701 C CD1 . LEU C 3  141 ? 9.119  7.078   -8.484  1.00 24.09  ? 136 LEU H CD1 1 
ATOM   3702 C CD2 . LEU C 3  141 ? 7.695  8.011   -10.328 1.00 22.98  ? 136 LEU H CD2 1 
ATOM   3703 N N   . VAL C 3  142 ? 9.239  3.227   -9.266  1.00 29.19  ? 137 VAL H N   1 
ATOM   3704 C CA  . VAL C 3  142 ? 8.319  2.151   -8.894  1.00 29.92  ? 137 VAL H CA  1 
ATOM   3705 C C   . VAL C 3  142 ? 7.326  2.720   -7.876  1.00 30.77  ? 137 VAL H C   1 
ATOM   3706 O O   . VAL C 3  142 ? 7.615  2.815   -6.682  1.00 29.57  ? 137 VAL H O   1 
ATOM   3707 C CB  . VAL C 3  142 ? 9.106  0.971   -8.286  1.00 29.04  ? 137 VAL H CB  1 
ATOM   3708 C CG1 . VAL C 3  142 ? 8.186  -0.208  -8.030  1.00 28.15  ? 137 VAL H CG1 1 
ATOM   3709 C CG2 . VAL C 3  142 ? 10.242 0.587   -9.232  1.00 24.72  ? 137 VAL H CG2 1 
ATOM   3710 N N   . LYS C 3  143 ? 6.143  3.078   -8.369  1.00 31.54  ? 138 LYS H N   1 
ATOM   3711 C CA  . LYS C 3  143 ? 5.120  3.713   -7.547  1.00 29.20  ? 138 LYS H CA  1 
ATOM   3712 C C   . LYS C 3  143 ? 3.834  2.933   -7.240  1.00 27.21  ? 138 LYS H C   1 
ATOM   3713 O O   . LYS C 3  143 ? 3.299  2.223   -8.090  1.00 26.02  ? 138 LYS H O   1 
ATOM   3714 C CB  . LYS C 3  143 ? 4.776  5.054   -8.209  1.00 26.84  ? 138 LYS H CB  1 
ATOM   3715 C CG  . LYS C 3  143 ? 3.765  5.923   -7.498  1.00 27.96  ? 138 LYS H CG  1 
ATOM   3716 C CD  . LYS C 3  143 ? 3.688  7.295   -8.169  1.00 28.33  ? 138 LYS H CD  1 
ATOM   3717 C CE  . LYS C 3  143 ? 2.420  8.026   -7.790  1.00 33.35  ? 138 LYS H CE  1 
ATOM   3718 N NZ  . LYS C 3  143 ? 2.271  8.152   -6.323  1.00 42.62  ? 138 LYS H NZ  1 
ATOM   3719 N N   . GLY C 3  144 ? 3.363  3.084   -5.999  1.00 27.26  ? 139 GLY H N   1 
ATOM   3720 C CA  . GLY C 3  144 ? 2.126  2.467   -5.546  1.00 30.73  ? 139 GLY H CA  1 
ATOM   3721 C C   . GLY C 3  144 ? 2.027  0.958   -5.465  1.00 32.28  ? 139 GLY H C   1 
ATOM   3722 O O   . GLY C 3  144 ? 1.082  0.377   -5.987  1.00 33.85  ? 139 GLY H O   1 
ATOM   3723 N N   . TYR C 3  145 ? 2.985  0.317   -4.806  1.00 33.27  ? 140 TYR H N   1 
ATOM   3724 C CA  . TYR C 3  145 ? 2.956  -1.132  -4.675  1.00 32.45  ? 140 TYR H CA  1 
ATOM   3725 C C   . TYR C 3  145 ? 2.809  -1.501  -3.213  1.00 30.89  ? 140 TYR H C   1 
ATOM   3726 O O   . TYR C 3  145 ? 3.017  -0.670  -2.330  1.00 28.61  ? 140 TYR H O   1 
ATOM   3727 C CB  . TYR C 3  145 ? 4.231  -1.765  -5.259  1.00 30.83  ? 140 TYR H CB  1 
ATOM   3728 C CG  . TYR C 3  145 ? 5.517  -1.424  -4.527  1.00 32.07  ? 140 TYR H CG  1 
ATOM   3729 C CD1 . TYR C 3  145 ? 5.887  -2.104  -3.362  1.00 32.36  ? 140 TYR H CD1 1 
ATOM   3730 C CD2 . TYR C 3  145 ? 6.372  -0.429  -5.007  1.00 28.09  ? 140 TYR H CD2 1 
ATOM   3731 C CE1 . TYR C 3  145 ? 7.079  -1.805  -2.696  1.00 30.82  ? 140 TYR H CE1 1 
ATOM   3732 C CE2 . TYR C 3  145 ? 7.562  -0.123  -4.346  1.00 30.16  ? 140 TYR H CE2 1 
ATOM   3733 C CZ  . TYR C 3  145 ? 7.910  -0.816  -3.195  1.00 32.80  ? 140 TYR H CZ  1 
ATOM   3734 O OH  . TYR C 3  145 ? 9.093  -0.530  -2.557  1.00 35.19  ? 140 TYR H OH  1 
ATOM   3735 N N   . PHE C 3  146 ? 2.428  -2.752  -2.974  1.00 32.14  ? 141 PHE H N   1 
ATOM   3736 C CA  . PHE C 3  146 ? 2.251  -3.267  -1.628  1.00 34.02  ? 141 PHE H CA  1 
ATOM   3737 C C   . PHE C 3  146 ? 2.068  -4.781  -1.676  1.00 35.62  ? 141 PHE H C   1 
ATOM   3738 O O   . PHE C 3  146 ? 1.360  -5.306  -2.531  1.00 36.48  ? 141 PHE H O   1 
ATOM   3739 C CB  . PHE C 3  146 ? 1.034  -2.638  -0.960  1.00 32.69  ? 141 PHE H CB  1 
ATOM   3740 C CG  . PHE C 3  146 ? 0.964  -2.898  0.512   1.00 34.15  ? 141 PHE H CG  1 
ATOM   3741 C CD1 . PHE C 3  146 ? 1.670  -2.095  1.406   1.00 32.12  ? 141 PHE H CD1 1 
ATOM   3742 C CD2 . PHE C 3  146 ? 0.225  -3.970  1.010   1.00 34.38  ? 141 PHE H CD2 1 
ATOM   3743 C CE1 . PHE C 3  146 ? 1.644  -2.356  2.778   1.00 34.97  ? 141 PHE H CE1 1 
ATOM   3744 C CE2 . PHE C 3  146 ? 0.192  -4.242  2.383   1.00 33.27  ? 141 PHE H CE2 1 
ATOM   3745 C CZ  . PHE C 3  146 ? 0.901  -3.434  3.268   1.00 35.70  ? 141 PHE H CZ  1 
ATOM   3746 N N   . PRO C 3  147 ? 2.721  -5.504  -0.759  1.00 36.41  ? 142 PRO H N   1 
ATOM   3747 C CA  . PRO C 3  147 ? 3.597  -4.963  0.286   1.00 36.40  ? 142 PRO H CA  1 
ATOM   3748 C C   . PRO C 3  147 ? 5.048  -4.957  -0.196  1.00 35.28  ? 142 PRO H C   1 
ATOM   3749 O O   . PRO C 3  147 ? 5.312  -5.179  -1.379  1.00 36.07  ? 142 PRO H O   1 
ATOM   3750 C CB  . PRO C 3  147 ? 3.387  -5.949  1.420   1.00 36.39  ? 142 PRO H CB  1 
ATOM   3751 C CG  . PRO C 3  147 ? 3.353  -7.251  0.663   1.00 33.40  ? 142 PRO H CG  1 
ATOM   3752 C CD  . PRO C 3  147 ? 2.475  -6.941  -0.542  1.00 33.95  ? 142 PRO H CD  1 
ATOM   3753 N N   . GLU C 3  148 ? 5.978  -4.696  0.718   1.00 35.73  ? 143 GLU H N   1 
ATOM   3754 C CA  . GLU C 3  148 ? 7.400  -4.728  0.389   1.00 38.23  ? 143 GLU H CA  1 
ATOM   3755 C C   . GLU C 3  148 ? 7.764  -6.199  0.181   1.00 39.18  ? 143 GLU H C   1 
ATOM   3756 O O   . GLU C 3  148 ? 7.123  -7.087  0.740   1.00 42.16  ? 143 GLU H O   1 
ATOM   3757 C CB  . GLU C 3  148 ? 8.232  -4.181  1.545   1.00 38.73  ? 143 GLU H CB  1 
ATOM   3758 C CG  . GLU C 3  148 ? 8.354  -2.672  1.619   1.00 40.56  ? 143 GLU H CG  1 
ATOM   3759 C CD  . GLU C 3  148 ? 9.514  -2.144  0.795   1.00 46.91  ? 143 GLU H CD  1 
ATOM   3760 O OE1 . GLU C 3  148 ? 10.142 -1.159  1.239   1.00 49.87  ? 143 GLU H OE1 1 
ATOM   3761 O OE2 . GLU C 3  148 ? 9.799  -2.701  -0.291  1.00 48.20  ? 143 GLU H OE2 1 
ATOM   3762 N N   . PRO C 3  149 ? 8.801  -6.481  -0.619  1.00 40.20  ? 144 PRO H N   1 
ATOM   3763 C CA  . PRO C 3  149 ? 9.628  -5.513  -1.331  1.00 38.95  ? 144 PRO H CA  1 
ATOM   3764 C C   . PRO C 3  149 ? 9.508  -5.793  -2.812  1.00 39.52  ? 144 PRO H C   1 
ATOM   3765 O O   . PRO C 3  149 ? 8.744  -6.661  -3.242  1.00 40.43  ? 144 PRO H O   1 
ATOM   3766 C CB  . PRO C 3  149 ? 11.010 -5.871  -0.853  1.00 39.39  ? 144 PRO H CB  1 
ATOM   3767 C CG  . PRO C 3  149 ? 10.948 -7.383  -1.006  1.00 38.36  ? 144 PRO H CG  1 
ATOM   3768 C CD  . PRO C 3  149 ? 9.543  -7.750  -0.480  1.00 39.05  ? 144 PRO H CD  1 
ATOM   3769 N N   . VAL C 3  150 ? 10.283 -5.057  -3.591  1.00 41.10  ? 145 VAL H N   1 
ATOM   3770 C CA  . VAL C 3  150 ? 10.312 -5.258  -5.026  1.00 40.99  ? 145 VAL H CA  1 
ATOM   3771 C C   . VAL C 3  150 ? 11.772 -5.508  -5.351  1.00 40.27  ? 145 VAL H C   1 
ATOM   3772 O O   . VAL C 3  150 ? 12.650 -5.268  -4.527  1.00 38.10  ? 145 VAL H O   1 
ATOM   3773 C CB  . VAL C 3  150 ? 9.819  -4.009  -5.815  1.00 39.20  ? 145 VAL H CB  1 
ATOM   3774 C CG1 . VAL C 3  150 ? 8.323  -3.835  -5.629  1.00 36.72  ? 145 VAL H CG1 1 
ATOM   3775 C CG2 . VAL C 3  150 ? 10.568 -2.765  -5.356  1.00 37.31  ? 145 VAL H CG2 1 
ATOM   3776 N N   . THR C 3  151 ? 12.026 -6.012  -6.545  1.00 40.80  ? 146 THR H N   1 
ATOM   3777 C CA  . THR C 3  151 ? 13.384 -6.256  -6.972  1.00 42.85  ? 146 THR H CA  1 
ATOM   3778 C C   . THR C 3  151 ? 13.614 -5.516  -8.279  1.00 41.13  ? 146 THR H C   1 
ATOM   3779 O O   . THR C 3  151 ? 12.946 -5.766  -9.283  1.00 41.50  ? 146 THR H O   1 
ATOM   3780 C CB  . THR C 3  151 ? 13.640 -7.758  -7.143  1.00 46.23  ? 146 THR H CB  1 
ATOM   3781 O OG1 . THR C 3  151 ? 13.828 -8.345  -5.847  1.00 51.40  ? 146 THR H OG1 1 
ATOM   3782 C CG2 . THR C 3  151 ? 14.877 -8.004  -8.004  1.00 52.04  ? 146 THR H CG2 1 
ATOM   3783 N N   . VAL C 3  152 ? 14.554 -4.583  -8.252  1.00 39.04  ? 147 VAL H N   1 
ATOM   3784 C CA  . VAL C 3  152 ? 14.858 -3.802  -9.437  1.00 37.92  ? 147 VAL H CA  1 
ATOM   3785 C C   . VAL C 3  152 ? 16.229 -4.174  -9.964  1.00 37.33  ? 147 VAL H C   1 
ATOM   3786 O O   . VAL C 3  152 ? 17.190 -4.239  -9.203  1.00 38.93  ? 147 VAL H O   1 
ATOM   3787 C CB  . VAL C 3  152 ? 14.839 -2.278  -9.129  1.00 37.65  ? 147 VAL H CB  1 
ATOM   3788 C CG1 . VAL C 3  152 ? 15.171 -1.483  -10.390 1.00 36.61  ? 147 VAL H CG1 1 
ATOM   3789 C CG2 . VAL C 3  152 ? 13.472 -1.872  -8.587  1.00 36.93  ? 147 VAL H CG2 1 
ATOM   3790 N N   . THR C 3  153 ? 16.306 -4.443  -11.262 1.00 35.99  ? 148 THR H N   1 
ATOM   3791 C CA  . THR C 3  153 ? 17.572 -4.771  -11.900 1.00 38.40  ? 148 THR H CA  1 
ATOM   3792 C C   . THR C 3  153 ? 17.641 -3.945  -13.168 1.00 39.85  ? 148 THR H C   1 
ATOM   3793 O O   . THR C 3  153 ? 16.631 -3.402  -13.610 1.00 40.75  ? 148 THR H O   1 
ATOM   3794 C CB  . THR C 3  153 ? 17.686 -6.279  -12.286 1.00 38.89  ? 148 THR H CB  1 
ATOM   3795 O OG1 . THR C 3  153 ? 16.585 -6.655  -13.120 1.00 37.99  ? 148 THR H OG1 1 
ATOM   3796 C CG2 . THR C 3  153 ? 17.715 -7.155  -11.042 1.00 39.53  ? 148 THR H CG2 1 
ATOM   3797 N N   . TRP C 3  154 ? 18.832 -3.840  -13.746 1.00 40.95  ? 149 TRP H N   1 
ATOM   3798 C CA  . TRP C 3  154 ? 19.008 -3.090  -14.981 1.00 40.54  ? 149 TRP H CA  1 
ATOM   3799 C C   . TRP C 3  154 ? 19.611 -3.990  -16.044 1.00 42.77  ? 149 TRP H C   1 
ATOM   3800 O O   . TRP C 3  154 ? 20.656 -4.602  -15.831 1.00 44.37  ? 149 TRP H O   1 
ATOM   3801 C CB  . TRP C 3  154 ? 19.886 -1.862  -14.736 1.00 37.04  ? 149 TRP H CB  1 
ATOM   3802 C CG  . TRP C 3  154 ? 19.138 -0.768  -14.041 1.00 34.65  ? 149 TRP H CG  1 
ATOM   3803 C CD1 . TRP C 3  154 ? 19.057 -0.542  -12.697 1.00 30.53  ? 149 TRP H CD1 1 
ATOM   3804 C CD2 . TRP C 3  154 ? 18.296 0.204   -14.665 1.00 32.85  ? 149 TRP H CD2 1 
ATOM   3805 N NE1 . TRP C 3  154 ? 18.208 0.515   -12.444 1.00 31.90  ? 149 TRP H NE1 1 
ATOM   3806 C CE2 . TRP C 3  154 ? 17.728 0.989   -13.638 1.00 32.37  ? 149 TRP H CE2 1 
ATOM   3807 C CE3 . TRP C 3  154 ? 17.965 0.486   -15.998 1.00 31.12  ? 149 TRP H CE3 1 
ATOM   3808 C CZ2 . TRP C 3  154 ? 16.847 2.040   -13.901 1.00 31.39  ? 149 TRP H CZ2 1 
ATOM   3809 C CZ3 . TRP C 3  154 ? 17.093 1.529   -16.262 1.00 31.98  ? 149 TRP H CZ3 1 
ATOM   3810 C CH2 . TRP C 3  154 ? 16.542 2.295   -15.216 1.00 33.95  ? 149 TRP H CH2 1 
ATOM   3811 N N   . ASN C 3  155 ? 18.940 -4.074  -17.187 1.00 44.00  ? 150 ASN H N   1 
ATOM   3812 C CA  . ASN C 3  155 ? 19.394 -4.934  -18.269 1.00 46.32  ? 150 ASN H CA  1 
ATOM   3813 C C   . ASN C 3  155 ? 19.592 -6.357  -17.743 1.00 49.03  ? 150 ASN H C   1 
ATOM   3814 O O   . ASN C 3  155 ? 20.616 -6.996  -17.988 1.00 48.27  ? 150 ASN H O   1 
ATOM   3815 C CB  . ASN C 3  155 ? 20.692 -4.395  -18.876 1.00 45.40  ? 150 ASN H CB  1 
ATOM   3816 C CG  . ASN C 3  155 ? 20.438 -3.371  -19.963 1.00 46.57  ? 150 ASN H CG  1 
ATOM   3817 O OD1 . ASN C 3  155 ? 19.287 -3.057  -20.283 1.00 46.17  ? 150 ASN H OD1 1 
ATOM   3818 N ND2 . ASN C 3  155 ? 21.512 -2.849  -20.545 1.00 46.29  ? 150 ASN H ND2 1 
ATOM   3819 N N   . SER C 3  156 ? 18.598 -6.831  -16.996 1.00 51.18  ? 151 SER H N   1 
ATOM   3820 C CA  . SER C 3  156 ? 18.606 -8.172  -16.437 1.00 51.36  ? 151 SER H CA  1 
ATOM   3821 C C   . SER C 3  156 ? 19.822 -8.457  -15.569 1.00 51.98  ? 151 SER H C   1 
ATOM   3822 O O   . SER C 3  156 ? 20.270 -9.599  -15.478 1.00 54.11  ? 151 SER H O   1 
ATOM   3823 C CB  . SER C 3  156 ? 18.525 -9.204  -17.568 1.00 51.68  ? 151 SER H CB  1 
ATOM   3824 O OG  . SER C 3  156 ? 17.339 -9.044  -18.333 1.00 52.81  ? 151 SER H OG  1 
ATOM   3825 N N   . GLY C 3  157 ? 20.355 -7.424  -14.928 1.00 51.69  ? 152 GLY H N   1 
ATOM   3826 C CA  . GLY C 3  157 ? 21.505 -7.624  -14.068 1.00 50.33  ? 152 GLY H CA  1 
ATOM   3827 C C   . GLY C 3  157 ? 22.821 -7.305  -14.743 1.00 52.26  ? 152 GLY H C   1 
ATOM   3828 O O   . GLY C 3  157 ? 23.849 -7.233  -14.071 1.00 53.92  ? 152 GLY H O   1 
ATOM   3829 N N   . SER C 3  158 ? 22.805 -7.130  -16.064 1.00 51.18  ? 153 SER H N   1 
ATOM   3830 C CA  . SER C 3  158 ? 24.025 -6.796  -16.793 1.00 52.28  ? 153 SER H CA  1 
ATOM   3831 C C   . SER C 3  158 ? 24.584 -5.503  -16.229 1.00 52.99  ? 153 SER H C   1 
ATOM   3832 O O   . SER C 3  158 ? 25.767 -5.417  -15.915 1.00 54.35  ? 153 SER H O   1 
ATOM   3833 C CB  . SER C 3  158 ? 23.741 -6.621  -18.279 1.00 54.51  ? 153 SER H CB  1 
ATOM   3834 O OG  . SER C 3  158 ? 23.434 -7.866  -18.867 1.00 58.21  ? 153 SER H OG  1 
ATOM   3835 N N   . LEU C 3  159 ? 23.730 -4.493  -16.108 1.00 53.05  ? 154 LEU H N   1 
ATOM   3836 C CA  . LEU C 3  159 ? 24.153 -3.223  -15.538 1.00 51.89  ? 154 LEU H CA  1 
ATOM   3837 C C   . LEU C 3  159 ? 24.100 -3.354  -14.024 1.00 50.96  ? 154 LEU H C   1 
ATOM   3838 O O   . LEU C 3  159 ? 23.024 -3.449  -13.437 1.00 50.74  ? 154 LEU H O   1 
ATOM   3839 C CB  . LEU C 3  159 ? 23.233 -2.091  -15.992 1.00 51.38  ? 154 LEU H CB  1 
ATOM   3840 C CG  . LEU C 3  159 ? 23.512 -1.544  -17.385 1.00 52.77  ? 154 LEU H CG  1 
ATOM   3841 C CD1 . LEU C 3  159 ? 22.441 -0.541  -17.767 1.00 50.97  ? 154 LEU H CD1 1 
ATOM   3842 C CD2 . LEU C 3  159 ? 24.892 -0.901  -17.396 1.00 53.02  ? 154 LEU H CD2 1 
ATOM   3843 N N   . SER C 3  160 ? 25.265 -3.374  -13.396 1.00 50.71  ? 155 SER H N   1 
ATOM   3844 C CA  . SER C 3  160 ? 25.347 -3.497  -11.946 1.00 53.11  ? 155 SER H CA  1 
ATOM   3845 C C   . SER C 3  160 ? 26.107 -2.297  -11.397 1.00 53.01  ? 155 SER H C   1 
ATOM   3846 O O   . SER C 3  160 ? 25.748 -1.713  -10.372 1.00 51.91  ? 155 SER H O   1 
ATOM   3847 C CB  . SER C 3  160 ? 26.081 -4.792  -11.577 1.00 56.59  ? 155 SER H CB  1 
ATOM   3848 O OG  . SER C 3  160 ? 26.331 -4.870  -10.185 1.00 60.21  ? 155 SER H OG  1 
ATOM   3849 N N   . SER C 3  161 ? 27.167 -1.940  -12.104 1.00 51.87  ? 156 SER H N   1 
ATOM   3850 C CA  . SER C 3  161 ? 27.999 -0.824  -11.717 1.00 52.80  ? 156 SER H CA  1 
ATOM   3851 C C   . SER C 3  161 ? 27.306 0.480   -12.106 1.00 51.51  ? 156 SER H C   1 
ATOM   3852 O O   . SER C 3  161 ? 26.913 0.670   -13.262 1.00 52.80  ? 156 SER H O   1 
ATOM   3853 C CB  . SER C 3  161 ? 29.359 -0.942  -12.414 1.00 54.43  ? 156 SER H CB  1 
ATOM   3854 O OG  . SER C 3  161 ? 30.246 0.088   -12.013 1.00 59.30  ? 156 SER H OG  1 
ATOM   3855 N N   . GLY C 3  162 ? 27.150 1.370   -11.131 1.00 49.95  ? 157 GLY H N   1 
ATOM   3856 C CA  . GLY C 3  162 ? 26.515 2.648   -11.398 1.00 46.13  ? 157 GLY H CA  1 
ATOM   3857 C C   . GLY C 3  162 ? 25.027 2.652   -11.111 1.00 43.06  ? 157 GLY H C   1 
ATOM   3858 O O   . GLY C 3  162 ? 24.291 3.492   -11.632 1.00 42.78  ? 157 GLY H O   1 
ATOM   3859 N N   . VAL C 3  163 ? 24.585 1.714   -10.279 1.00 38.27  ? 158 VAL H N   1 
ATOM   3860 C CA  . VAL C 3  163 ? 23.179 1.611   -9.927  1.00 32.75  ? 158 VAL H CA  1 
ATOM   3861 C C   . VAL C 3  163 ? 22.936 2.033   -8.491  1.00 34.81  ? 158 VAL H C   1 
ATOM   3862 O O   . VAL C 3  163 ? 23.722 1.721   -7.599  1.00 37.11  ? 158 VAL H O   1 
ATOM   3863 C CB  . VAL C 3  163 ? 22.662 0.172   -10.096 1.00 29.70  ? 158 VAL H CB  1 
ATOM   3864 C CG1 . VAL C 3  163 ? 21.244 0.061   -9.551  1.00 27.09  ? 158 VAL H CG1 1 
ATOM   3865 C CG2 . VAL C 3  163 ? 22.697 -0.224  -11.558 1.00 27.10  ? 158 VAL H CG2 1 
ATOM   3866 N N   . HIS C 3  164 ? 21.841 2.752   -8.277  1.00 34.58  ? 159 HIS H N   1 
ATOM   3867 C CA  . HIS C 3  164 ? 21.459 3.205   -6.948  1.00 35.30  ? 159 HIS H CA  1 
ATOM   3868 C C   . HIS C 3  164 ? 19.974 2.926   -6.795  1.00 36.10  ? 159 HIS H C   1 
ATOM   3869 O O   . HIS C 3  164 ? 19.145 3.561   -7.449  1.00 35.28  ? 159 HIS H O   1 
ATOM   3870 C CB  . HIS C 3  164 ? 21.699 4.715   -6.779  1.00 37.32  ? 159 HIS H CB  1 
ATOM   3871 C CG  . HIS C 3  164 ? 23.139 5.096   -6.611  1.00 39.45  ? 159 HIS H CG  1 
ATOM   3872 N ND1 . HIS C 3  164 ? 23.853 4.823   -5.463  1.00 43.23  ? 159 HIS H ND1 1 
ATOM   3873 C CD2 . HIS C 3  164 ? 23.994 5.737   -7.442  1.00 37.04  ? 159 HIS H CD2 1 
ATOM   3874 C CE1 . HIS C 3  164 ? 25.086 5.281   -5.594  1.00 42.68  ? 159 HIS H CE1 1 
ATOM   3875 N NE2 . HIS C 3  164 ? 25.197 5.839   -6.786  1.00 41.70  ? 159 HIS H NE2 1 
ATOM   3876 N N   . THR C 3  165 ? 19.633 1.955   -5.961  1.00 33.66  ? 160 THR H N   1 
ATOM   3877 C CA  . THR C 3  165 ? 18.233 1.656   -5.731  1.00 33.61  ? 160 THR H CA  1 
ATOM   3878 C C   . THR C 3  165 ? 17.914 2.131   -4.314  1.00 33.48  ? 160 THR H C   1 
ATOM   3879 O O   . THR C 3  165 ? 18.421 1.611   -3.321  1.00 37.59  ? 160 THR H O   1 
ATOM   3880 C CB  . THR C 3  165 ? 17.956 0.163   -5.936  1.00 34.00  ? 160 THR H CB  1 
ATOM   3881 O OG1 . THR C 3  165 ? 18.163 -0.151  -7.320  1.00 33.88  ? 160 THR H OG1 1 
ATOM   3882 C CG2 . THR C 3  165 ? 16.518 -0.178  -5.569  1.00 34.76  ? 160 THR H CG2 1 
ATOM   3883 N N   . PHE C 3  166 ? 17.079 3.157   -4.241  1.00 31.95  ? 161 PHE H N   1 
ATOM   3884 C CA  . PHE C 3  166 ? 16.721 3.781   -2.981  1.00 30.91  ? 161 PHE H CA  1 
ATOM   3885 C C   . PHE C 3  166 ? 15.628 3.105   -2.171  1.00 32.47  ? 161 PHE H C   1 
ATOM   3886 O O   . PHE C 3  166 ? 14.733 2.461   -2.712  1.00 31.65  ? 161 PHE H O   1 
ATOM   3887 C CB  . PHE C 3  166 ? 16.330 5.237   -3.252  1.00 28.04  ? 161 PHE H CB  1 
ATOM   3888 C CG  . PHE C 3  166 ? 17.381 6.007   -3.994  1.00 22.32  ? 161 PHE H CG  1 
ATOM   3889 C CD1 . PHE C 3  166 ? 18.319 6.761   -3.308  1.00 24.43  ? 161 PHE H CD1 1 
ATOM   3890 C CD2 . PHE C 3  166 ? 17.470 5.923   -5.381  1.00 24.09  ? 161 PHE H CD2 1 
ATOM   3891 C CE1 . PHE C 3  166 ? 19.337 7.422   -3.994  1.00 25.17  ? 161 PHE H CE1 1 
ATOM   3892 C CE2 . PHE C 3  166 ? 18.482 6.577   -6.078  1.00 22.01  ? 161 PHE H CE2 1 
ATOM   3893 C CZ  . PHE C 3  166 ? 19.418 7.328   -5.380  1.00 23.85  ? 161 PHE H CZ  1 
ATOM   3894 N N   . PRO C 3  167 ? 15.707 3.238   -0.842  1.00 34.61  ? 162 PRO H N   1 
ATOM   3895 C CA  . PRO C 3  167 ? 14.734 2.665   0.087   1.00 34.52  ? 162 PRO H CA  1 
ATOM   3896 C C   . PRO C 3  167 ? 13.349 3.176   -0.280  1.00 34.60  ? 162 PRO H C   1 
ATOM   3897 O O   . PRO C 3  167 ? 13.190 4.353   -0.612  1.00 35.15  ? 162 PRO H O   1 
ATOM   3898 C CB  . PRO C 3  167 ? 15.186 3.219   1.429   1.00 31.84  ? 162 PRO H CB  1 
ATOM   3899 C CG  . PRO C 3  167 ? 16.658 3.263   1.278   1.00 34.41  ? 162 PRO H CG  1 
ATOM   3900 C CD  . PRO C 3  167 ? 16.841 3.826   -0.109  1.00 34.15  ? 162 PRO H CD  1 
ATOM   3901 N N   . ALA C 3  168 ? 12.350 2.302   -0.221  1.00 33.94  ? 163 ALA H N   1 
ATOM   3902 C CA  . ALA C 3  168 ? 10.985 2.708   -0.540  1.00 34.29  ? 163 ALA H CA  1 
ATOM   3903 C C   . ALA C 3  168 ? 10.465 3.675   0.523   1.00 33.10  ? 163 ALA H C   1 
ATOM   3904 O O   . ALA C 3  168 ? 10.924 3.667   1.665   1.00 32.79  ? 163 ALA H O   1 
ATOM   3905 C CB  . ALA C 3  168 ? 10.077 1.478   -0.622  1.00 32.46  ? 163 ALA H CB  1 
ATOM   3906 N N   . VAL C 3  169 ? 9.537  4.538   0.135   1.00 31.77  ? 164 VAL H N   1 
ATOM   3907 C CA  . VAL C 3  169 ? 8.937  5.459   1.088   1.00 32.97  ? 164 VAL H CA  1 
ATOM   3908 C C   . VAL C 3  169 ? 7.450  5.163   1.029   1.00 32.31  ? 164 VAL H C   1 
ATOM   3909 O O   . VAL C 3  169 ? 6.986  4.502   0.104   1.00 29.54  ? 164 VAL H O   1 
ATOM   3910 C CB  . VAL C 3  169 ? 9.177  6.953   0.731   1.00 32.82  ? 164 VAL H CB  1 
ATOM   3911 C CG1 . VAL C 3  169 ? 10.650 7.269   0.785   1.00 35.49  ? 164 VAL H CG1 1 
ATOM   3912 C CG2 . VAL C 3  169 ? 8.623  7.262   -0.645  1.00 38.21  ? 164 VAL H CG2 1 
ATOM   3913 N N   . LEU C 3  170 ? 6.709  5.636   2.019   1.00 35.25  ? 165 LEU H N   1 
ATOM   3914 C CA  . LEU C 3  170 ? 5.272  5.407   2.057   1.00 38.21  ? 165 LEU H CA  1 
ATOM   3915 C C   . LEU C 3  170 ? 4.572  6.626   1.449   1.00 38.26  ? 165 LEU H C   1 
ATOM   3916 O O   . LEU C 3  170 ? 4.762  7.759   1.896   1.00 38.09  ? 165 LEU H O   1 
ATOM   3917 C CB  . LEU C 3  170 ? 4.813  5.173   3.508   1.00 37.35  ? 165 LEU H CB  1 
ATOM   3918 C CG  . LEU C 3  170 ? 3.601  4.259   3.751   1.00 39.51  ? 165 LEU H CG  1 
ATOM   3919 C CD1 . LEU C 3  170 ? 3.838  2.873   3.141   1.00 36.50  ? 165 LEU H CD1 1 
ATOM   3920 C CD2 . LEU C 3  170 ? 3.364  4.135   5.257   1.00 41.72  ? 165 LEU H CD2 1 
ATOM   3921 N N   . GLN C 3  171 ? 3.783  6.386   0.410   1.00 38.09  ? 166 GLN H N   1 
ATOM   3922 C CA  . GLN C 3  171 ? 3.063  7.451   -0.268  1.00 39.56  ? 166 GLN H CA  1 
ATOM   3923 C C   . GLN C 3  171 ? 1.656  6.944   -0.492  1.00 40.94  ? 166 GLN H C   1 
ATOM   3924 O O   . GLN C 3  171 ? 1.449  6.010   -1.263  1.00 42.04  ? 166 GLN H O   1 
ATOM   3925 C CB  . GLN C 3  171 ? 3.716  7.764   -1.620  1.00 40.87  ? 166 GLN H CB  1 
ATOM   3926 C CG  . GLN C 3  171 ? 3.172  9.017   -2.291  1.00 41.86  ? 166 GLN H CG  1 
ATOM   3927 C CD  . GLN C 3  171 ? 3.848  9.331   -3.611  1.00 44.36  ? 166 GLN H CD  1 
ATOM   3928 O OE1 . GLN C 3  171 ? 3.684  10.425  -4.158  1.00 47.75  ? 166 GLN H OE1 1 
ATOM   3929 N NE2 . GLN C 3  171 ? 4.604  8.373   -4.136  1.00 42.69  ? 166 GLN H NE2 1 
ATOM   3930 N N   . SER C 3  172 ? 0.689  7.552   0.187   1.00 44.20  ? 167 SER H N   1 
ATOM   3931 C CA  . SER C 3  172 ? -0.706 7.139   0.055   1.00 46.59  ? 167 SER H CA  1 
ATOM   3932 C C   . SER C 3  172 ? -0.898 5.708   0.575   1.00 46.98  ? 167 SER H C   1 
ATOM   3933 O O   . SER C 3  172 ? -1.618 4.915   -0.033  1.00 48.21  ? 167 SER H O   1 
ATOM   3934 C CB  . SER C 3  172 ? -1.148 7.209   -1.416  1.00 47.44  ? 167 SER H CB  1 
ATOM   3935 O OG  . SER C 3  172 ? -1.050 8.530   -1.928  1.00 51.02  ? 167 SER H OG  1 
ATOM   3936 N N   . ASP C 3  173 ? -0.255 5.382   1.693   1.00 44.30  ? 168 ASP H N   1 
ATOM   3937 C CA  . ASP C 3  173 ? -0.358 4.050   2.272   1.00 43.50  ? 168 ASP H CA  1 
ATOM   3938 C C   . ASP C 3  173 ? 0.182  2.946   1.377   1.00 41.27  ? 168 ASP H C   1 
ATOM   3939 O O   . ASP C 3  173 ? -0.011 1.760   1.648   1.00 41.42  ? 168 ASP H O   1 
ATOM   3940 C CB  . ASP C 3  173 ? -1.802 3.756   2.655   1.00 50.37  ? 168 ASP H CB  1 
ATOM   3941 C CG  . ASP C 3  173 ? -2.202 4.459   3.931   1.00 60.44  ? 168 ASP H CG  1 
ATOM   3942 O OD1 . ASP C 3  173 ? -1.644 4.103   4.992   1.00 63.50  ? 168 ASP H OD1 1 
ATOM   3943 O OD2 . ASP C 3  173 ? -3.055 5.371   3.874   1.00 64.53  ? 168 ASP H OD2 1 
ATOM   3944 N N   . LEU C 3  174 ? 0.848  3.343   0.300   1.00 35.81  ? 169 LEU H N   1 
ATOM   3945 C CA  . LEU C 3  174 ? 1.464  2.392   -0.614  1.00 31.92  ? 169 LEU H CA  1 
ATOM   3946 C C   . LEU C 3  174 ? 2.949  2.770   -0.684  1.00 30.99  ? 169 LEU H C   1 
ATOM   3947 O O   . LEU C 3  174 ? 3.347  3.822   -0.176  1.00 31.71  ? 169 LEU H O   1 
ATOM   3948 C CB  . LEU C 3  174 ? 0.814  2.459   -2.000  1.00 30.90  ? 169 LEU H CB  1 
ATOM   3949 C CG  . LEU C 3  174 ? -0.621 1.922   -2.134  1.00 29.16  ? 169 LEU H CG  1 
ATOM   3950 C CD1 . LEU C 3  174 ? -1.053 2.038   -3.581  1.00 31.94  ? 169 LEU H CD1 1 
ATOM   3951 C CD2 . LEU C 3  174 ? -0.705 0.471   -1.689  1.00 27.72  ? 169 LEU H CD2 1 
ATOM   3952 N N   . TYR C 3  175 ? 3.771  1.921   -1.291  1.00 29.17  ? 170 TYR H N   1 
ATOM   3953 C CA  . TYR C 3  175 ? 5.193  2.218   -1.375  1.00 28.57  ? 170 TYR H CA  1 
ATOM   3954 C C   . TYR C 3  175 ? 5.640  2.789   -2.704  1.00 26.09  ? 170 TYR H C   1 
ATOM   3955 O O   . TYR C 3  175 ? 5.098  2.466   -3.757  1.00 27.45  ? 170 TYR H O   1 
ATOM   3956 C CB  . TYR C 3  175 ? 6.029  0.970   -1.079  1.00 28.60  ? 170 TYR H CB  1 
ATOM   3957 C CG  . TYR C 3  175 ? 5.897  0.477   0.333   1.00 31.08  ? 170 TYR H CG  1 
ATOM   3958 C CD1 . TYR C 3  175 ? 5.061  -0.595  0.642   1.00 31.33  ? 170 TYR H CD1 1 
ATOM   3959 C CD2 . TYR C 3  175 ? 6.578  1.107   1.374   1.00 32.00  ? 170 TYR H CD2 1 
ATOM   3960 C CE1 . TYR C 3  175 ? 4.903  -1.026  1.954   1.00 32.34  ? 170 TYR H CE1 1 
ATOM   3961 C CE2 . TYR C 3  175 ? 6.425  0.688   2.686   1.00 33.24  ? 170 TYR H CE2 1 
ATOM   3962 C CZ  . TYR C 3  175 ? 5.583  -0.380  2.973   1.00 34.39  ? 170 TYR H CZ  1 
ATOM   3963 O OH  . TYR C 3  175 ? 5.403  -0.782  4.281   1.00 38.35  ? 170 TYR H OH  1 
ATOM   3964 N N   . THR C 3  176 ? 6.640  3.654   -2.635  1.00 26.52  ? 171 THR H N   1 
ATOM   3965 C CA  . THR C 3  176 ? 7.211  4.254   -3.824  1.00 29.38  ? 171 THR H CA  1 
ATOM   3966 C C   . THR C 3  176 ? 8.717  4.131   -3.675  1.00 27.78  ? 171 THR H C   1 
ATOM   3967 O O   . THR C 3  176 ? 9.280  4.388   -2.613  1.00 26.58  ? 171 THR H O   1 
ATOM   3968 C CB  . THR C 3  176 ? 6.822  5.734   -3.974  1.00 30.90  ? 171 THR H CB  1 
ATOM   3969 O OG1 . THR C 3  176 ? 5.393  5.845   -4.051  1.00 33.74  ? 171 THR H OG1 1 
ATOM   3970 C CG2 . THR C 3  176 ? 7.441  6.310   -5.245  1.00 28.56  ? 171 THR H CG2 1 
ATOM   3971 N N   . LEU C 3  177 ? 9.359  3.727   -4.757  1.00 30.32  ? 172 LEU H N   1 
ATOM   3972 C CA  . LEU C 3  177 ? 10.792 3.530   -4.766  1.00 30.98  ? 172 LEU H CA  1 
ATOM   3973 C C   . LEU C 3  177 ? 11.337 3.962   -6.121  1.00 29.51  ? 172 LEU H C   1 
ATOM   3974 O O   . LEU C 3  177 ? 10.605 4.045   -7.107  1.00 28.66  ? 172 LEU H O   1 
ATOM   3975 C CB  . LEU C 3  177 ? 11.070 2.040   -4.489  1.00 30.08  ? 172 LEU H CB  1 
ATOM   3976 C CG  . LEU C 3  177 ? 12.374 1.309   -4.803  1.00 30.71  ? 172 LEU H CG  1 
ATOM   3977 C CD1 . LEU C 3  177 ? 12.334 -0.056  -4.122  1.00 29.11  ? 172 LEU H CD1 1 
ATOM   3978 C CD2 . LEU C 3  177 ? 12.566 1.156   -6.305  1.00 29.56  ? 172 LEU H CD2 1 
ATOM   3979 N N   . SER C 3  178 ? 12.622 4.265   -6.168  1.00 27.22  ? 173 SER H N   1 
ATOM   3980 C CA  . SER C 3  178 ? 13.219 4.652   -7.425  1.00 27.42  ? 173 SER H CA  1 
ATOM   3981 C C   . SER C 3  178 ? 14.616 4.063   -7.512  1.00 29.78  ? 173 SER H C   1 
ATOM   3982 O O   . SER C 3  178 ? 15.198 3.662   -6.506  1.00 29.78  ? 173 SER H O   1 
ATOM   3983 C CB  . SER C 3  178 ? 13.274 6.171   -7.536  1.00 25.61  ? 173 SER H CB  1 
ATOM   3984 O OG  . SER C 3  178 ? 14.013 6.711   -6.462  1.00 29.95  ? 173 SER H OG  1 
ATOM   3985 N N   . SER C 3  179 ? 15.142 3.998   -8.727  1.00 28.89  ? 174 SER H N   1 
ATOM   3986 C CA  . SER C 3  179 ? 16.473 3.466   -8.960  1.00 28.20  ? 174 SER H CA  1 
ATOM   3987 C C   . SER C 3  179 ? 17.106 4.275   -10.088 1.00 29.25  ? 174 SER H C   1 
ATOM   3988 O O   . SER C 3  179 ? 16.433 4.650   -11.050 1.00 29.00  ? 174 SER H O   1 
ATOM   3989 C CB  . SER C 3  179 ? 16.388 1.985   -9.354  1.00 28.00  ? 174 SER H CB  1 
ATOM   3990 O OG  . SER C 3  179 ? 17.676 1.416   -9.528  1.00 32.67  ? 174 SER H OG  1 
ATOM   3991 N N   . SER C 3  180 ? 18.394 4.563   -9.962  1.00 29.02  ? 175 SER H N   1 
ATOM   3992 C CA  . SER C 3  180 ? 19.084 5.313   -10.994 1.00 28.83  ? 175 SER H CA  1 
ATOM   3993 C C   . SER C 3  180 ? 20.210 4.462   -11.533 1.00 29.75  ? 175 SER H C   1 
ATOM   3994 O O   . SER C 3  180 ? 20.787 3.655   -10.809 1.00 29.38  ? 175 SER H O   1 
ATOM   3995 C CB  . SER C 3  180 ? 19.662 6.627   -10.442 1.00 24.60  ? 175 SER H CB  1 
ATOM   3996 O OG  . SER C 3  180 ? 20.760 6.400   -9.574  1.00 26.09  ? 175 SER H OG  1 
ATOM   3997 N N   . VAL C 3  181 ? 20.492 4.623   -12.818 1.00 32.22  ? 176 VAL H N   1 
ATOM   3998 C CA  . VAL C 3  181 ? 21.587 3.909   -13.447 1.00 34.03  ? 176 VAL H CA  1 
ATOM   3999 C C   . VAL C 3  181 ? 22.342 4.922   -14.297 1.00 35.73  ? 176 VAL H C   1 
ATOM   4000 O O   . VAL C 3  181 ? 21.739 5.766   -14.964 1.00 35.57  ? 176 VAL H O   1 
ATOM   4001 C CB  . VAL C 3  181 ? 21.095 2.752   -14.327 1.00 32.98  ? 176 VAL H CB  1 
ATOM   4002 C CG1 . VAL C 3  181 ? 20.211 3.280   -15.440 1.00 30.40  ? 176 VAL H CG1 1 
ATOM   4003 C CG2 . VAL C 3  181 ? 22.293 1.991   -14.888 1.00 33.45  ? 176 VAL H CG2 1 
ATOM   4004 N N   . THR C 3  182 ? 23.665 4.852   -14.249 1.00 36.98  ? 177 THR H N   1 
ATOM   4005 C CA  . THR C 3  182 ? 24.492 5.770   -15.014 1.00 36.71  ? 177 THR H CA  1 
ATOM   4006 C C   . THR C 3  182 ? 25.302 4.985   -16.046 1.00 35.81  ? 177 THR H C   1 
ATOM   4007 O O   . THR C 3  182 ? 25.995 4.022   -15.709 1.00 35.65  ? 177 THR H O   1 
ATOM   4008 C CB  . THR C 3  182 ? 25.416 6.564   -14.067 1.00 36.47  ? 177 THR H CB  1 
ATOM   4009 O OG1 . THR C 3  182 ? 24.631 7.088   -12.989 1.00 38.34  ? 177 THR H OG1 1 
ATOM   4010 C CG2 . THR C 3  182 ? 26.067 7.733   -14.791 1.00 34.03  ? 177 THR H CG2 1 
ATOM   4011 N N   . VAL C 3  183 ? 25.177 5.386   -17.307 1.00 35.89  ? 178 VAL H N   1 
ATOM   4012 C CA  . VAL C 3  183 ? 25.878 4.732   -18.402 1.00 37.21  ? 178 VAL H CA  1 
ATOM   4013 C C   . VAL C 3  183 ? 26.508 5.762   -19.323 1.00 37.55  ? 178 VAL H C   1 
ATOM   4014 O O   . VAL C 3  183 ? 26.164 6.946   -19.276 1.00 36.45  ? 178 VAL H O   1 
ATOM   4015 C CB  . VAL C 3  183 ? 24.924 3.858   -19.265 1.00 36.80  ? 178 VAL H CB  1 
ATOM   4016 C CG1 . VAL C 3  183 ? 24.365 2.722   -18.437 1.00 37.57  ? 178 VAL H CG1 1 
ATOM   4017 C CG2 . VAL C 3  183 ? 23.803 4.712   -19.836 1.00 33.32  ? 178 VAL H CG2 1 
ATOM   4018 N N   . PRO C 3  184 ? 27.453 5.323   -20.171 1.00 38.26  ? 179 PRO H N   1 
ATOM   4019 C CA  . PRO C 3  184 ? 28.097 6.260   -21.094 1.00 37.63  ? 179 PRO H CA  1 
ATOM   4020 C C   . PRO C 3  184 ? 27.026 6.681   -22.090 1.00 37.90  ? 179 PRO H C   1 
ATOM   4021 O O   . PRO C 3  184 ? 26.150 5.880   -22.439 1.00 39.27  ? 179 PRO H O   1 
ATOM   4022 C CB  . PRO C 3  184 ? 29.181 5.411   -21.747 1.00 39.88  ? 179 PRO H CB  1 
ATOM   4023 C CG  . PRO C 3  184 ? 29.446 4.318   -20.722 1.00 37.72  ? 179 PRO H CG  1 
ATOM   4024 C CD  . PRO C 3  184 ? 28.065 3.985   -20.267 1.00 37.45  ? 179 PRO H CD  1 
ATOM   4025 N N   . SER C 3  185 ? 27.077 7.927   -22.540 1.00 36.48  ? 180 SER H N   1 
ATOM   4026 C CA  . SER C 3  185 ? 26.082 8.406   -23.487 1.00 39.00  ? 180 SER H CA  1 
ATOM   4027 C C   . SER C 3  185 ? 26.176 7.661   -24.826 1.00 41.39  ? 180 SER H C   1 
ATOM   4028 O O   . SER C 3  185 ? 25.219 7.648   -25.611 1.00 41.11  ? 180 SER H O   1 
ATOM   4029 C CB  . SER C 3  185 ? 26.236 9.915   -23.688 1.00 39.15  ? 180 SER H CB  1 
ATOM   4030 O OG  . SER C 3  185 ? 27.576 10.247  -24.002 1.00 45.97  ? 180 SER H OG  1 
ATOM   4031 N N   . SER C 3  186 ? 27.326 7.036   -25.080 1.00 42.63  ? 181 SER H N   1 
ATOM   4032 C CA  . SER C 3  186 ? 27.529 6.275   -26.312 1.00 44.38  ? 181 SER H CA  1 
ATOM   4033 C C   . SER C 3  186 ? 26.774 4.950   -26.214 1.00 44.98  ? 181 SER H C   1 
ATOM   4034 O O   . SER C 3  186 ? 26.630 4.235   -27.201 1.00 45.43  ? 181 SER H O   1 
ATOM   4035 C CB  . SER C 3  186 ? 29.018 6.000   -26.538 1.00 41.34  ? 181 SER H CB  1 
ATOM   4036 O OG  . SER C 3  186 ? 29.526 5.124   -25.549 1.00 41.09  ? 181 SER H OG  1 
ATOM   4037 N N   . THR C 3  187 ? 26.290 4.640   -25.013 1.00 45.06  ? 182 THR H N   1 
ATOM   4038 C CA  . THR C 3  187 ? 25.545 3.413   -24.751 1.00 42.46  ? 182 THR H CA  1 
ATOM   4039 C C   . THR C 3  187 ? 24.038 3.630   -24.858 1.00 41.41  ? 182 THR H C   1 
ATOM   4040 O O   . THR C 3  187 ? 23.310 2.769   -25.343 1.00 40.90  ? 182 THR H O   1 
ATOM   4041 C CB  . THR C 3  187 ? 25.862 2.886   -23.354 1.00 42.95  ? 182 THR H CB  1 
ATOM   4042 O OG1 . THR C 3  187 ? 27.260 2.579   -23.274 1.00 45.03  ? 182 THR H OG1 1 
ATOM   4043 C CG2 . THR C 3  187 ? 25.043 1.640   -23.056 1.00 44.93  ? 182 THR H CG2 1 
ATOM   4044 N N   . TRP C 3  188 ? 23.569 4.781   -24.394 1.00 38.52  ? 183 TRP H N   1 
ATOM   4045 C CA  . TRP C 3  188 ? 22.151 5.089   -24.464 1.00 37.85  ? 183 TRP H CA  1 
ATOM   4046 C C   . TRP C 3  188 ? 21.998 6.450   -25.122 1.00 38.37  ? 183 TRP H C   1 
ATOM   4047 O O   . TRP C 3  188 ? 22.810 7.343   -24.896 1.00 37.63  ? 183 TRP H O   1 
ATOM   4048 C CB  . TRP C 3  188 ? 21.550 5.121   -23.063 1.00 36.18  ? 183 TRP H CB  1 
ATOM   4049 C CG  . TRP C 3  188 ? 20.082 5.398   -23.052 1.00 34.48  ? 183 TRP H CG  1 
ATOM   4050 C CD1 . TRP C 3  188 ? 19.072 4.480   -23.113 1.00 34.40  ? 183 TRP H CD1 1 
ATOM   4051 C CD2 . TRP C 3  188 ? 19.452 6.685   -22.982 1.00 35.11  ? 183 TRP H CD2 1 
ATOM   4052 N NE1 . TRP C 3  188 ? 17.851 5.113   -23.080 1.00 35.86  ? 183 TRP H NE1 1 
ATOM   4053 C CE2 . TRP C 3  188 ? 18.053 6.467   -23.000 1.00 35.62  ? 183 TRP H CE2 1 
ATOM   4054 C CE3 . TRP C 3  188 ? 19.932 8.001   -22.907 1.00 30.55  ? 183 TRP H CE3 1 
ATOM   4055 C CZ2 . TRP C 3  188 ? 17.124 7.523   -22.943 1.00 35.67  ? 183 TRP H CZ2 1 
ATOM   4056 C CZ3 . TRP C 3  188 ? 19.011 9.051   -22.852 1.00 31.86  ? 183 TRP H CZ3 1 
ATOM   4057 C CH2 . TRP C 3  188 ? 17.620 8.803   -22.869 1.00 32.42  ? 183 TRP H CH2 1 
ATOM   4058 N N   . PRO C 3  189 ? 20.942 6.642   -25.927 1.00 40.89  ? 184 PRO H N   1 
ATOM   4059 C CA  . PRO C 3  189 ? 19.888 5.680   -26.268 1.00 41.95  ? 184 PRO H CA  1 
ATOM   4060 C C   . PRO C 3  189 ? 20.172 4.850   -27.515 1.00 44.15  ? 184 PRO H C   1 
ATOM   4061 O O   . PRO C 3  189 ? 19.257 4.224   -28.055 1.00 43.63  ? 184 PRO H O   1 
ATOM   4062 C CB  . PRO C 3  189 ? 18.676 6.576   -26.460 1.00 41.44  ? 184 PRO H CB  1 
ATOM   4063 C CG  . PRO C 3  189 ? 19.284 7.743   -27.169 1.00 43.78  ? 184 PRO H CG  1 
ATOM   4064 C CD  . PRO C 3  189 ? 20.579 7.992   -26.400 1.00 40.67  ? 184 PRO H CD  1 
ATOM   4065 N N   . SER C 3  190 ? 21.424 4.855   -27.980 1.00 47.10  ? 185 SER H N   1 
ATOM   4066 C CA  . SER C 3  190 ? 21.790 4.088   -29.173 1.00 47.36  ? 185 SER H CA  1 
ATOM   4067 C C   . SER C 3  190 ? 21.591 2.601   -28.883 1.00 49.33  ? 185 SER H C   1 
ATOM   4068 O O   . SER C 3  190 ? 21.309 1.811   -29.789 1.00 49.43  ? 185 SER H O   1 
ATOM   4069 C CB  . SER C 3  190 ? 23.239 4.381   -29.601 1.00 43.53  ? 185 SER H CB  1 
ATOM   4070 O OG  . SER C 3  190 ? 24.182 4.003   -28.619 1.00 42.49  ? 185 SER H OG  1 
ATOM   4071 N N   . GLU C 3  191 ? 21.744 2.238   -27.609 1.00 49.90  ? 186 GLU H N   1 
ATOM   4072 C CA  . GLU C 3  191 ? 21.528 0.875   -27.144 1.00 51.41  ? 186 GLU H CA  1 
ATOM   4073 C C   . GLU C 3  191 ? 20.363 0.926   -26.162 1.00 52.62  ? 186 GLU H C   1 
ATOM   4074 O O   . GLU C 3  191 ? 19.939 2.007   -25.748 1.00 54.21  ? 186 GLU H O   1 
ATOM   4075 C CB  . GLU C 3  191 ? 22.761 0.323   -26.447 1.00 52.57  ? 186 GLU H CB  1 
ATOM   4076 C CG  . GLU C 3  191 ? 23.847 -0.106  -27.394 1.00 55.45  ? 186 GLU H CG  1 
ATOM   4077 C CD  . GLU C 3  191 ? 25.048 -0.640  -26.661 1.00 58.28  ? 186 GLU H CD  1 
ATOM   4078 O OE1 . GLU C 3  191 ? 24.890 -1.619  -25.898 1.00 61.80  ? 186 GLU H OE1 1 
ATOM   4079 O OE2 . GLU C 3  191 ? 26.148 -0.075  -26.846 1.00 62.11  ? 186 GLU H OE2 1 
ATOM   4080 N N   . THR C 3  192 ? 19.852 -0.238  -25.782 1.00 52.86  ? 187 THR H N   1 
ATOM   4081 C CA  . THR C 3  192 ? 18.713 -0.298  -24.877 1.00 50.71  ? 187 THR H CA  1 
ATOM   4082 C C   . THR C 3  192 ? 19.059 -0.525  -23.422 1.00 47.99  ? 187 THR H C   1 
ATOM   4083 O O   . THR C 3  192 ? 19.855 -1.402  -23.085 1.00 47.31  ? 187 THR H O   1 
ATOM   4084 C CB  . THR C 3  192 ? 17.727 -1.411  -25.295 1.00 53.08  ? 187 THR H CB  1 
ATOM   4085 O OG1 . THR C 3  192 ? 17.186 -1.115  -26.588 1.00 57.58  ? 187 THR H OG1 1 
ATOM   4086 C CG2 . THR C 3  192 ? 16.590 -1.522  -24.294 1.00 53.52  ? 187 THR H CG2 1 
ATOM   4087 N N   . VAL C 3  193 ? 18.455 0.292   -22.565 1.00 45.41  ? 188 VAL H N   1 
ATOM   4088 C CA  . VAL C 3  193 ? 18.613 0.157   -21.126 1.00 39.78  ? 188 VAL H CA  1 
ATOM   4089 C C   . VAL C 3  193 ? 17.197 -0.080  -20.635 1.00 38.70  ? 188 VAL H C   1 
ATOM   4090 O O   . VAL C 3  193 ? 16.279 0.678   -20.963 1.00 38.99  ? 188 VAL H O   1 
ATOM   4091 C CB  . VAL C 3  193 ? 19.180 1.407   -20.477 1.00 37.63  ? 188 VAL H CB  1 
ATOM   4092 C CG1 . VAL C 3  193 ? 19.178 1.239   -18.963 1.00 35.50  ? 188 VAL H CG1 1 
ATOM   4093 C CG2 . VAL C 3  193 ? 20.594 1.640   -20.979 1.00 37.78  ? 188 VAL H CG2 1 
ATOM   4094 N N   . THR C 3  194 ? 17.026 -1.152  -19.871 1.00 37.47  ? 189 THR H N   1 
ATOM   4095 C CA  . THR C 3  194 ? 15.721 -1.539  -19.373 1.00 36.37  ? 189 THR H CA  1 
ATOM   4096 C C   . THR C 3  194 ? 15.737 -1.924  -17.906 1.00 34.66  ? 189 THR H C   1 
ATOM   4097 O O   . THR C 3  194 ? 16.562 -2.734  -17.498 1.00 32.15  ? 189 THR H O   1 
ATOM   4098 C CB  . THR C 3  194 ? 15.212 -2.742  -20.160 1.00 36.94  ? 189 THR H CB  1 
ATOM   4099 O OG1 . THR C 3  194 ? 15.002 -2.364  -21.526 1.00 41.68  ? 189 THR H OG1 1 
ATOM   4100 C CG2 . THR C 3  194 ? 13.927 -3.262  -19.562 1.00 40.14  ? 189 THR H CG2 1 
ATOM   4101 N N   . CYS C 3  195 ? 14.845 -1.342  -17.105 1.00 35.52  ? 190 CYS H N   1 
ATOM   4102 C CA  . CYS C 3  195 ? 14.796 -1.729  -15.702 1.00 38.93  ? 190 CYS H CA  1 
ATOM   4103 C C   . CYS C 3  195 ? 13.792 -2.849  -15.564 1.00 39.44  ? 190 CYS H C   1 
ATOM   4104 O O   . CYS C 3  195 ? 12.713 -2.810  -16.154 1.00 39.74  ? 190 CYS H O   1 
ATOM   4105 C CB  . CYS C 3  195 ? 14.433 -0.569  -14.754 1.00 40.86  ? 190 CYS H CB  1 
ATOM   4106 S SG  . CYS C 3  195 ? 12.969 0.467   -15.083 1.00 50.69  ? 190 CYS H SG  1 
ATOM   4107 N N   . ASN C 3  196 ? 14.175 -3.866  -14.805 1.00 40.41  ? 191 ASN H N   1 
ATOM   4108 C CA  . ASN C 3  196 ? 13.321 -5.015  -14.588 1.00 40.40  ? 191 ASN H CA  1 
ATOM   4109 C C   . ASN C 3  196 ? 12.845 -4.933  -13.160 1.00 37.31  ? 191 ASN H C   1 
ATOM   4110 O O   . ASN C 3  196 ? 13.643 -4.933  -12.230 1.00 39.45  ? 191 ASN H O   1 
ATOM   4111 C CB  . ASN C 3  196 ? 14.107 -6.305  -14.820 1.00 41.64  ? 191 ASN H CB  1 
ATOM   4112 C CG  . ASN C 3  196 ? 15.078 -6.188  -15.978 1.00 44.37  ? 191 ASN H CG  1 
ATOM   4113 O OD1 . ASN C 3  196 ? 16.292 -6.127  -15.778 1.00 44.72  ? 191 ASN H OD1 1 
ATOM   4114 N ND2 . ASN C 3  196 ? 14.547 -6.141  -17.198 1.00 47.00  ? 191 ASN H ND2 1 
ATOM   4115 N N   . VAL C 3  197 ? 11.535 -4.838  -12.995 1.00 36.37  ? 192 VAL H N   1 
ATOM   4116 C CA  . VAL C 3  197 ? 10.951 -4.736  -11.674 1.00 35.14  ? 192 VAL H CA  1 
ATOM   4117 C C   . VAL C 3  197 ? 10.157 -5.993  -11.377 1.00 36.97  ? 192 VAL H C   1 
ATOM   4118 O O   . VAL C 3  197 ? 9.358  -6.448  -12.194 1.00 39.03  ? 192 VAL H O   1 
ATOM   4119 C CB  . VAL C 3  197 ? 10.029 -3.503  -11.577 1.00 32.85  ? 192 VAL H CB  1 
ATOM   4120 C CG1 . VAL C 3  197 ? 9.367  -3.447  -10.217 1.00 33.70  ? 192 VAL H CG1 1 
ATOM   4121 C CG2 . VAL C 3  197 ? 10.838 -2.239  -11.813 1.00 31.68  ? 192 VAL H CG2 1 
ATOM   4122 N N   . ALA C 3  198 ? 10.387 -6.563  -10.205 1.00 37.29  ? 193 ALA H N   1 
ATOM   4123 C CA  . ALA C 3  198 ? 9.678  -7.766  -9.825  1.00 37.38  ? 193 ALA H CA  1 
ATOM   4124 C C   . ALA C 3  198 ? 9.016  -7.566  -8.470  1.00 38.23  ? 193 ALA H C   1 
ATOM   4125 O O   . ALA C 3  198 ? 9.667  -7.164  -7.503  1.00 36.58  ? 193 ALA H O   1 
ATOM   4126 C CB  . ALA C 3  198 ? 10.646 -8.945  -9.779  1.00 35.41  ? 193 ALA H CB  1 
ATOM   4127 N N   . HIS C 3  199 ? 7.711  -7.819  -8.414  1.00 39.15  ? 194 HIS H N   1 
ATOM   4128 C CA  . HIS C 3  199 ? 6.961  -7.706  -7.169  1.00 40.23  ? 194 HIS H CA  1 
ATOM   4129 C C   . HIS C 3  199 ? 6.337  -9.074  -6.915  1.00 43.30  ? 194 HIS H C   1 
ATOM   4130 O O   . HIS C 3  199 ? 5.251  -9.365  -7.417  1.00 45.10  ? 194 HIS H O   1 
ATOM   4131 C CB  . HIS C 3  199 ? 5.853  -6.666  -7.290  1.00 37.80  ? 194 HIS H CB  1 
ATOM   4132 C CG  . HIS C 3  199 ? 5.155  -6.381  -5.998  1.00 33.50  ? 194 HIS H CG  1 
ATOM   4133 N ND1 . HIS C 3  199 ? 3.792  -6.515  -5.839  1.00 33.82  ? 194 HIS H ND1 1 
ATOM   4134 C CD2 . HIS C 3  199 ? 5.632  -5.950  -4.807  1.00 31.57  ? 194 HIS H CD2 1 
ATOM   4135 C CE1 . HIS C 3  199 ? 3.458  -6.176  -4.606  1.00 32.80  ? 194 HIS H CE1 1 
ATOM   4136 N NE2 . HIS C 3  199 ? 4.557  -5.829  -3.959  1.00 32.91  ? 194 HIS H NE2 1 
ATOM   4137 N N   . PRO C 3  200 ? 7.018  -9.935  -6.138  1.00 45.02  ? 195 PRO H N   1 
ATOM   4138 C CA  . PRO C 3  200 ? 6.512  -11.278 -5.834  1.00 45.52  ? 195 PRO H CA  1 
ATOM   4139 C C   . PRO C 3  200 ? 5.121  -11.311 -5.211  1.00 46.74  ? 195 PRO H C   1 
ATOM   4140 O O   . PRO C 3  200 ? 4.288  -12.131 -5.599  1.00 49.05  ? 195 PRO H O   1 
ATOM   4141 C CB  . PRO C 3  200 ? 7.588  -11.845 -4.914  1.00 43.80  ? 195 PRO H CB  1 
ATOM   4142 C CG  . PRO C 3  200 ? 8.839  -11.204 -5.462  1.00 44.28  ? 195 PRO H CG  1 
ATOM   4143 C CD  . PRO C 3  200 ? 8.385  -9.767  -5.612  1.00 45.62  ? 195 PRO H CD  1 
ATOM   4144 N N   . ALA C 3  201 ? 4.866  -10.419 -4.261  1.00 46.96  ? 196 ALA H N   1 
ATOM   4145 C CA  . ALA C 3  201 ? 3.565  -10.360 -3.597  1.00 47.59  ? 196 ALA H CA  1 
ATOM   4146 C C   . ALA C 3  201 ? 2.402  -10.379 -4.582  1.00 49.79  ? 196 ALA H C   1 
ATOM   4147 O O   . ALA C 3  201 ? 1.345  -10.922 -4.280  1.00 54.18  ? 196 ALA H O   1 
ATOM   4148 C CB  . ALA C 3  201 ? 3.475  -9.120  -2.728  1.00 45.11  ? 196 ALA H CB  1 
ATOM   4149 N N   . SER C 3  202 ? 2.588  -9.785  -5.755  1.00 50.64  ? 197 SER H N   1 
ATOM   4150 C CA  . SER C 3  202 ? 1.527  -9.753  -6.757  1.00 50.29  ? 197 SER H CA  1 
ATOM   4151 C C   . SER C 3  202 ? 1.896  -10.593 -7.970  1.00 50.14  ? 197 SER H C   1 
ATOM   4152 O O   . SER C 3  202 ? 1.277  -10.479 -9.028  1.00 49.35  ? 197 SER H O   1 
ATOM   4153 C CB  . SER C 3  202 ? 1.252  -8.310  -7.191  1.00 50.77  ? 197 SER H CB  1 
ATOM   4154 O OG  . SER C 3  202 ? 2.412  -7.717  -7.746  1.00 48.65  ? 197 SER H OG  1 
ATOM   4155 N N   . SER C 3  203 ? 2.910  -11.436 -7.803  1.00 50.78  ? 198 SER H N   1 
ATOM   4156 C CA  . SER C 3  203 ? 3.389  -12.310 -8.870  1.00 54.25  ? 198 SER H CA  1 
ATOM   4157 C C   . SER C 3  203 ? 3.592  -11.552 -10.178 1.00 55.72  ? 198 SER H C   1 
ATOM   4158 O O   . SER C 3  203 ? 3.217  -12.048 -11.243 1.00 56.68  ? 198 SER H O   1 
ATOM   4159 C CB  . SER C 3  203 ? 2.399  -13.453 -9.103  1.00 55.79  ? 198 SER H CB  1 
ATOM   4160 O OG  . SER C 3  203 ? 2.155  -14.170 -7.906  1.00 61.26  ? 198 SER H OG  1 
ATOM   4161 N N   . THR C 3  204 ? 4.186  -10.360 -10.101 1.00 55.13  ? 199 THR H N   1 
ATOM   4162 C CA  . THR C 3  204 ? 4.423  -9.545  -11.294 1.00 52.83  ? 199 THR H CA  1 
ATOM   4163 C C   . THR C 3  204 ? 5.890  -9.233  -11.579 1.00 51.22  ? 199 THR H C   1 
ATOM   4164 O O   . THR C 3  204 ? 6.691  -9.042  -10.663 1.00 48.54  ? 199 THR H O   1 
ATOM   4165 C CB  . THR C 3  204 ? 3.668  -8.198  -11.221 1.00 51.38  ? 199 THR H CB  1 
ATOM   4166 O OG1 . THR C 3  204 ? 3.925  -7.577  -9.956  1.00 52.47  ? 199 THR H OG1 1 
ATOM   4167 C CG2 . THR C 3  204 ? 2.172  -8.404  -11.402 1.00 50.39  ? 199 THR H CG2 1 
ATOM   4168 N N   . LYS C 3  205 ? 6.218  -9.191  -12.869 1.00 50.96  ? 200 LYS H N   1 
ATOM   4169 C CA  . LYS C 3  205 ? 7.559  -8.876  -13.359 1.00 51.36  ? 200 LYS H CA  1 
ATOM   4170 C C   . LYS C 3  205 ? 7.343  -7.967  -14.564 1.00 50.43  ? 200 LYS H C   1 
ATOM   4171 O O   . LYS C 3  205 ? 6.666  -8.348  -15.521 1.00 51.20  ? 200 LYS H O   1 
ATOM   4172 C CB  . LYS C 3  205 ? 8.301  -10.140 -13.812 1.00 54.87  ? 200 LYS H CB  1 
ATOM   4173 C CG  . LYS C 3  205 ? 8.399  -11.234 -12.751 1.00 61.56  ? 200 LYS H CG  1 
ATOM   4174 C CD  . LYS C 3  205 ? 8.989  -12.528 -13.319 1.00 64.39  ? 200 LYS H CD  1 
ATOM   4175 C CE  . LYS C 3  205 ? 9.028  -13.630 -12.265 1.00 66.19  ? 200 LYS H CE  1 
ATOM   4176 N NZ  . LYS C 3  205 ? 7.668  -13.953 -11.740 1.00 68.38  ? 200 LYS H NZ  1 
ATOM   4177 N N   . VAL C 3  206 ? 7.898  -6.762  -14.511 1.00 48.50  ? 201 VAL H N   1 
ATOM   4178 C CA  . VAL C 3  206 ? 7.749  -5.816  -15.607 1.00 46.59  ? 201 VAL H CA  1 
ATOM   4179 C C   . VAL C 3  206 ? 9.095  -5.265  -16.066 1.00 44.50  ? 201 VAL H C   1 
ATOM   4180 O O   . VAL C 3  206 ? 9.982  -4.992  -15.260 1.00 44.16  ? 201 VAL H O   1 
ATOM   4181 C CB  . VAL C 3  206 ? 6.772  -4.654  -15.219 1.00 45.89  ? 201 VAL H CB  1 
ATOM   4182 C CG1 . VAL C 3  206 ? 6.858  -4.372  -13.739 1.00 49.90  ? 201 VAL H CG1 1 
ATOM   4183 C CG2 . VAL C 3  206 ? 7.095  -3.395  -16.005 1.00 46.61  ? 201 VAL H CG2 1 
ATOM   4184 N N   . ASP C 3  207 ? 9.239  -5.146  -17.383 1.00 45.39  ? 202 ASP H N   1 
ATOM   4185 C CA  . ASP C 3  207 ? 10.452 -4.628  -18.003 1.00 44.34  ? 202 ASP H CA  1 
ATOM   4186 C C   . ASP C 3  207 ? 10.075 -3.290  -18.596 1.00 44.86  ? 202 ASP H C   1 
ATOM   4187 O O   . ASP C 3  207 ? 9.165  -3.214  -19.422 1.00 47.89  ? 202 ASP H O   1 
ATOM   4188 C CB  . ASP C 3  207 ? 10.929 -5.535  -19.144 1.00 45.47  ? 202 ASP H CB  1 
ATOM   4189 C CG  . ASP C 3  207 ? 11.090 -6.984  -18.722 1.00 48.87  ? 202 ASP H CG  1 
ATOM   4190 O OD1 . ASP C 3  207 ? 11.719 -7.242  -17.670 1.00 47.64  ? 202 ASP H OD1 1 
ATOM   4191 O OD2 . ASP C 3  207 ? 10.593 -7.865  -19.460 1.00 50.85  ? 202 ASP H OD2 1 
ATOM   4192 N N   . LYS C 3  208 ? 10.758 -2.233  -18.177 1.00 43.35  ? 203 LYS H N   1 
ATOM   4193 C CA  . LYS C 3  208 ? 10.461 -0.913  -18.708 1.00 40.64  ? 203 LYS H CA  1 
ATOM   4194 C C   . LYS C 3  208 ? 11.680 -0.362  -19.423 1.00 39.17  ? 203 LYS H C   1 
ATOM   4195 O O   . LYS C 3  208 ? 12.676 -0.005  -18.792 1.00 39.19  ? 203 LYS H O   1 
ATOM   4196 C CB  . LYS C 3  208 ? 10.050 0.037   -17.583 1.00 38.63  ? 203 LYS H CB  1 
ATOM   4197 C CG  . LYS C 3  208 ? 9.026  1.058   -18.016 1.00 40.08  ? 203 LYS H CG  1 
ATOM   4198 C CD  . LYS C 3  208 ? 7.674  0.396   -18.265 1.00 42.82  ? 203 LYS H CD  1 
ATOM   4199 C CE  . LYS C 3  208 ? 6.783  1.301   -19.091 1.00 46.33  ? 203 LYS H CE  1 
ATOM   4200 N NZ  . LYS C 3  208 ? 7.504  1.747   -20.324 1.00 48.50  ? 203 LYS H NZ  1 
ATOM   4201 N N   . LYS C 3  209 ? 11.617 -0.307  -20.745 1.00 37.80  ? 204 LYS H N   1 
ATOM   4202 C CA  . LYS C 3  209 ? 12.741 0.226   -21.493 1.00 39.94  ? 204 LYS H CA  1 
ATOM   4203 C C   . LYS C 3  209 ? 12.745 1.748   -21.353 1.00 39.35  ? 204 LYS H C   1 
ATOM   4204 O O   . LYS C 3  209 ? 11.686 2.390   -21.401 1.00 38.72  ? 204 LYS H O   1 
ATOM   4205 C CB  . LYS C 3  209 ? 12.642 -0.157  -22.969 1.00 42.24  ? 204 LYS H CB  1 
ATOM   4206 C CG  . LYS C 3  209 ? 13.803 0.355   -23.803 1.00 46.57  ? 204 LYS H CG  1 
ATOM   4207 C CD  . LYS C 3  209 ? 13.609 0.007   -25.267 1.00 52.63  ? 204 LYS H CD  1 
ATOM   4208 C CE  . LYS C 3  209 ? 14.698 0.623   -26.137 1.00 56.37  ? 204 LYS H CE  1 
ATOM   4209 N NZ  . LYS C 3  209 ? 14.459 0.386   -27.598 1.00 56.46  ? 204 LYS H NZ  1 
ATOM   4210 N N   . ILE C 3  210 ? 13.931 2.320   -21.156 1.00 38.64  ? 205 ILE H N   1 
ATOM   4211 C CA  . ILE C 3  210 ? 14.053 3.762   -21.026 1.00 35.97  ? 205 ILE H CA  1 
ATOM   4212 C C   . ILE C 3  210 ? 14.243 4.335   -22.426 1.00 37.10  ? 205 ILE H C   1 
ATOM   4213 O O   . ILE C 3  210 ? 15.296 4.157   -23.051 1.00 37.66  ? 205 ILE H O   1 
ATOM   4214 C CB  . ILE C 3  210 ? 15.263 4.160   -20.168 1.00 33.87  ? 205 ILE H CB  1 
ATOM   4215 C CG1 . ILE C 3  210 ? 15.316 3.310   -18.888 1.00 31.50  ? 205 ILE H CG1 1 
ATOM   4216 C CG2 . ILE C 3  210 ? 15.199 5.647   -19.871 1.00 32.03  ? 205 ILE H CG2 1 
ATOM   4217 C CD1 . ILE C 3  210 ? 14.107 3.410   -17.991 1.00 29.40  ? 205 ILE H CD1 1 
ATOM   4218 N N   . ALA C 3  211 ? 13.209 5.001   -22.924 1.00 37.92  ? 206 ALA H N   1 
ATOM   4219 C CA  . ALA C 3  211 ? 13.262 5.598   -24.245 1.00 41.16  ? 206 ALA H CA  1 
ATOM   4220 C C   . ALA C 3  211 ? 13.557 7.087   -24.096 1.00 43.35  ? 206 ALA H C   1 
ATOM   4221 O O   . ALA C 3  211 ? 13.087 7.734   -23.154 1.00 42.40  ? 206 ALA H O   1 
ATOM   4222 C CB  . ALA C 3  211 ? 11.939 5.385   -24.965 1.00 37.91  ? 206 ALA H CB  1 
ATOM   4223 N N   . ALA C 3  212 ? 14.347 7.620   -25.022 1.00 45.12  ? 207 ALA H N   1 
ATOM   4224 C CA  . ALA C 3  212 ? 14.715 9.025   -25.002 1.00 49.33  ? 207 ALA H CA  1 
ATOM   4225 C C   . ALA C 3  212 ? 13.475 9.911   -24.865 1.00 52.39  ? 207 ALA H C   1 
ATOM   4226 O O   . ALA C 3  212 ? 12.501 9.750   -25.604 1.00 49.21  ? 207 ALA H O   1 
ATOM   4227 C CB  . ALA C 3  212 ? 15.474 9.367   -26.271 1.00 49.48  ? 207 ALA H CB  1 
ATOM   4228 N N   . ALA C 3  213 ? 13.512 10.843  -23.914 1.00 56.63  ? 208 ALA H N   1 
ATOM   4229 C CA  . ALA C 3  213 ? 12.379 11.740  -23.685 1.00 61.14  ? 208 ALA H CA  1 
ATOM   4230 C C   . ALA C 3  213 ? 12.399 12.906  -24.655 1.00 64.22  ? 208 ALA H C   1 
ATOM   4231 O O   . ALA C 3  213 ? 13.498 13.245  -25.151 1.00 66.57  ? 208 ALA H O   1 
ATOM   4232 C CB  . ALA C 3  213 ? 12.395 12.267  -22.246 1.00 60.99  ? 208 ALA H CB  1 
ATOM   4233 O OXT . ALA C 3  213 ? 11.312 13.473  -24.889 1.00 69.22  ? 208 ALA H OXT 1 
ATOM   4234 N N   . SER D 4  1   A 10.491 -48.293 66.042  1.00 57.62  ? 1   SER U N   1 
ATOM   4235 C CA  . SER D 4  1   A 11.340 -49.053 67.000  1.00 56.00  ? 1   SER U CA  1 
ATOM   4236 C C   . SER D 4  1   A 12.713 -49.397 66.404  1.00 53.45  ? 1   SER U C   1 
ATOM   4237 O O   . SER D 4  1   A 13.150 -50.550 66.462  1.00 55.06  ? 1   SER U O   1 
ATOM   4238 C CB  . SER D 4  1   A 10.608 -50.336 67.432  1.00 58.78  ? 1   SER U CB  1 
ATOM   4239 O OG  . SER D 4  1   A 10.213 -51.125 66.316  1.00 60.70  ? 1   SER U OG  1 
ATOM   4240 N N   . LEU D 4  2   ? 13.391 -48.394 65.843  1.00 46.82  ? 1   LEU U N   1 
ATOM   4241 C CA  . LEU D 4  2   ? 14.713 -48.587 65.242  1.00 42.38  ? 1   LEU U CA  1 
ATOM   4242 C C   . LEU D 4  2   ? 15.794 -48.269 66.266  1.00 41.05  ? 1   LEU U C   1 
ATOM   4243 O O   . LEU D 4  2   ? 15.630 -47.375 67.085  1.00 39.82  ? 1   LEU U O   1 
ATOM   4244 C CB  . LEU D 4  2   ? 14.893 -47.649 64.039  1.00 42.15  ? 1   LEU U CB  1 
ATOM   4245 C CG  . LEU D 4  2   ? 15.888 -47.939 62.902  1.00 41.91  ? 1   LEU U CG  1 
ATOM   4246 C CD1 . LEU D 4  2   ? 16.615 -46.661 62.524  1.00 37.37  ? 1   LEU U CD1 1 
ATOM   4247 C CD2 . LEU D 4  2   ? 16.881 -48.993 63.311  1.00 44.04  ? 1   LEU U CD2 1 
ATOM   4248 N N   . ARG D 4  3   ? 16.898 -49.007 66.222  1.00 41.93  ? 2   ARG U N   1 
ATOM   4249 C CA  . ARG D 4  3   ? 18.022 -48.765 67.126  1.00 39.62  ? 2   ARG U CA  1 
ATOM   4250 C C   . ARG D 4  3   ? 19.284 -48.679 66.285  1.00 39.30  ? 2   ARG U C   1 
ATOM   4251 O O   . ARG D 4  3   ? 19.430 -49.404 65.296  1.00 37.26  ? 2   ARG U O   1 
ATOM   4252 C CB  . ARG D 4  3   ? 18.190 -49.900 68.132  1.00 39.87  ? 2   ARG U CB  1 
ATOM   4253 C CG  . ARG D 4  3   ? 17.024 -50.131 69.059  1.00 39.68  ? 2   ARG U CG  1 
ATOM   4254 C CD  . ARG D 4  3   ? 17.448 -51.091 70.152  1.00 42.17  ? 2   ARG U CD  1 
ATOM   4255 N NE  . ARG D 4  3   ? 17.928 -52.360 69.607  1.00 43.80  ? 2   ARG U NE  1 
ATOM   4256 C CZ  . ARG D 4  3   ? 18.756 -53.186 70.242  1.00 43.79  ? 2   ARG U CZ  1 
ATOM   4257 N NH1 . ARG D 4  3   ? 19.202 -52.875 71.452  1.00 45.42  ? 2   ARG U NH1 1 
ATOM   4258 N NH2 . ARG D 4  3   ? 19.140 -54.321 69.668  1.00 40.42  ? 2   ARG U NH2 1 
ATOM   4259 N N   . CYS D 4  4   ? 20.196 -47.797 66.677  1.00 39.17  ? 3   CYS U N   1 
ATOM   4260 C CA  . CYS D 4  4   ? 21.445 -47.630 65.939  1.00 38.83  ? 3   CYS U CA  1 
ATOM   4261 C C   . CYS D 4  4   ? 22.632 -47.447 66.861  1.00 36.92  ? 3   CYS U C   1 
ATOM   4262 O O   . CYS D 4  4   ? 22.483 -47.042 68.011  1.00 36.69  ? 3   CYS U O   1 
ATOM   4263 C CB  . CYS D 4  4   ? 21.390 -46.398 65.025  1.00 38.59  ? 3   CYS U CB  1 
ATOM   4264 S SG  . CYS D 4  4   ? 20.012 -46.305 63.845  1.00 41.00  ? 3   CYS U SG  1 
ATOM   4265 N N   . MET D 4  5   ? 23.815 -47.743 66.343  1.00 33.75  ? 4   MET U N   1 
ATOM   4266 C CA  . MET D 4  5   ? 25.019 -47.542 67.115  1.00 33.45  ? 4   MET U CA  1 
ATOM   4267 C C   . MET D 4  5   ? 25.267 -46.047 67.114  1.00 35.76  ? 4   MET U C   1 
ATOM   4268 O O   . MET D 4  5   ? 25.140 -45.389 66.083  1.00 37.87  ? 4   MET U O   1 
ATOM   4269 C CB  . MET D 4  5   ? 26.209 -48.246 66.470  1.00 31.44  ? 4   MET U CB  1 
ATOM   4270 C CG  . MET D 4  5   ? 26.232 -49.743 66.686  1.00 35.71  ? 4   MET U CG  1 
ATOM   4271 S SD  . MET D 4  5   ? 26.261 -50.141 68.444  1.00 34.52  ? 4   MET U SD  1 
ATOM   4272 C CE  . MET D 4  5   ? 24.599 -50.518 68.657  1.00 38.19  ? 4   MET U CE  1 
ATOM   4273 N N   . GLN D 4  6   ? 25.605 -45.504 68.271  1.00 35.36  ? 5   GLN U N   1 
ATOM   4274 C CA  . GLN D 4  6   ? 25.902 -44.091 68.375  1.00 37.01  ? 5   GLN U CA  1 
ATOM   4275 C C   . GLN D 4  6   ? 27.342 -43.990 68.855  1.00 36.84  ? 5   GLN U C   1 
ATOM   4276 O O   . GLN D 4  6   ? 27.634 -44.267 70.017  1.00 38.64  ? 5   GLN U O   1 
ATOM   4277 C CB  . GLN D 4  6   ? 24.953 -43.422 69.368  1.00 39.72  ? 5   GLN U CB  1 
ATOM   4278 C CG  . GLN D 4  6   ? 25.235 -41.949 69.603  1.00 48.36  ? 5   GLN U CG  1 
ATOM   4279 C CD  . GLN D 4  6   ? 24.146 -41.276 70.416  1.00 53.86  ? 5   GLN U CD  1 
ATOM   4280 O OE1 . GLN D 4  6   ? 23.757 -41.761 71.484  1.00 59.19  ? 5   GLN U OE1 1 
ATOM   4281 N NE2 . GLN D 4  6   ? 23.646 -40.150 69.915  1.00 56.45  ? 5   GLN U NE2 1 
ATOM   4282 N N   . CYS D 4  7   ? 28.243 -43.608 67.958  1.00 34.53  ? 6   CYS U N   1 
ATOM   4283 C CA  . CYS D 4  7   ? 29.649 -43.500 68.308  1.00 34.44  ? 6   CYS U CA  1 
ATOM   4284 C C   . CYS D 4  7   ? 30.217 -42.114 68.063  1.00 34.17  ? 6   CYS U C   1 
ATOM   4285 O O   . CYS D 4  7   ? 29.867 -41.469 67.086  1.00 34.66  ? 6   CYS U O   1 
ATOM   4286 C CB  . CYS D 4  7   ? 30.470 -44.475 67.483  1.00 35.74  ? 6   CYS U CB  1 
ATOM   4287 S SG  . CYS D 4  7   ? 29.978 -46.228 67.464  1.00 48.93  ? 6   CYS U SG  1 
ATOM   4288 N N   . LYS D 4  8   ? 31.103 -41.664 68.949  1.00 35.56  ? 7   LYS U N   1 
ATOM   4289 C CA  . LYS D 4  8   ? 31.754 -40.367 68.787  1.00 37.25  ? 7   LYS U CA  1 
ATOM   4290 C C   . LYS D 4  8   ? 33.014 -40.697 68.013  1.00 38.41  ? 7   LYS U C   1 
ATOM   4291 O O   . LYS D 4  8   ? 33.277 -41.863 67.722  1.00 40.16  ? 7   LYS U O   1 
ATOM   4292 C CB  . LYS D 4  8   ? 32.183 -39.756 70.126  1.00 39.31  ? 7   LYS U CB  1 
ATOM   4293 C CG  . LYS D 4  8   ? 31.092 -39.373 71.102  1.00 40.93  ? 7   LYS U CG  1 
ATOM   4294 C CD  . LYS D 4  8   ? 31.756 -38.904 72.388  1.00 45.54  ? 7   LYS U CD  1 
ATOM   4295 C CE  . LYS D 4  8   ? 30.757 -38.668 73.496  1.00 52.11  ? 7   LYS U CE  1 
ATOM   4296 N NZ  . LYS D 4  8   ? 31.452 -38.306 74.760  1.00 53.08  ? 7   LYS U NZ  1 
ATOM   4297 N N   . THR D 4  9   ? 33.808 -39.683 67.702  1.00 36.95  ? 8   THR U N   1 
ATOM   4298 C CA  . THR D 4  9   ? 35.030 -39.920 66.966  1.00 37.80  ? 8   THR U CA  1 
ATOM   4299 C C   . THR D 4  9   ? 36.088 -40.585 67.839  1.00 39.33  ? 8   THR U C   1 
ATOM   4300 O O   . THR D 4  9   ? 37.004 -41.225 67.324  1.00 38.34  ? 8   THR U O   1 
ATOM   4301 C CB  . THR D 4  9   ? 35.587 -38.609 66.381  1.00 38.65  ? 8   THR U CB  1 
ATOM   4302 O OG1 . THR D 4  9   ? 35.632 -37.606 67.403  1.00 39.57  ? 8   THR U OG1 1 
ATOM   4303 C CG2 . THR D 4  9   ? 34.707 -38.130 65.228  1.00 37.68  ? 8   THR U CG2 1 
ATOM   4304 N N   . ASN D 4  10  ? 35.950 -40.453 69.158  1.00 41.34  ? 9   ASN U N   1 
ATOM   4305 C CA  . ASN D 4  10  ? 36.913 -41.042 70.098  1.00 42.18  ? 9   ASN U CA  1 
ATOM   4306 C C   . ASN D 4  10  ? 36.815 -42.573 70.224  1.00 41.94  ? 9   ASN U C   1 
ATOM   4307 O O   . ASN D 4  10  ? 37.687 -43.214 70.813  1.00 43.44  ? 9   ASN U O   1 
ATOM   4308 C CB  . ASN D 4  10  ? 36.763 -40.397 71.484  1.00 41.48  ? 9   ASN U CB  1 
ATOM   4309 C CG  . ASN D 4  10  ? 35.445 -40.743 72.156  1.00 41.91  ? 9   ASN U CG  1 
ATOM   4310 O OD1 . ASN D 4  10  ? 34.648 -41.528 71.635  1.00 40.91  ? 9   ASN U OD1 1 
ATOM   4311 N ND2 . ASN D 4  10  ? 35.214 -40.163 73.331  1.00 40.60  ? 9   ASN U ND2 1 
ATOM   4312 N N   . GLY D 4  11  ? 35.755 -43.149 69.670  1.00 40.10  ? 10  GLY U N   1 
ATOM   4313 C CA  . GLY D 4  11  ? 35.583 -44.587 69.722  1.00 38.23  ? 10  GLY U CA  1 
ATOM   4314 C C   . GLY D 4  11  ? 34.536 -45.023 70.723  1.00 38.30  ? 10  GLY U C   1 
ATOM   4315 O O   . GLY D 4  11  ? 34.147 -46.186 70.769  1.00 36.11  ? 10  GLY U O   1 
ATOM   4316 N N   . ASP D 4  12  ? 34.077 -44.081 71.533  1.00 38.92  ? 11  ASP U N   1 
ATOM   4317 C CA  . ASP D 4  12  ? 33.078 -44.376 72.545  1.00 40.09  ? 11  ASP U CA  1 
ATOM   4318 C C   . ASP D 4  12  ? 31.754 -44.682 71.854  1.00 40.87  ? 11  ASP U C   1 
ATOM   4319 O O   . ASP D 4  12  ? 31.120 -43.791 71.295  1.00 43.20  ? 11  ASP U O   1 
ATOM   4320 C CB  . ASP D 4  12  ? 32.918 -43.167 73.467  1.00 42.42  ? 11  ASP U CB  1 
ATOM   4321 C CG  . ASP D 4  12  ? 32.238 -43.513 74.775  1.00 45.83  ? 11  ASP U CG  1 
ATOM   4322 O OD1 . ASP D 4  12  ? 31.243 -44.267 74.755  1.00 48.34  ? 11  ASP U OD1 1 
ATOM   4323 O OD2 . ASP D 4  12  ? 32.692 -43.018 75.826  1.00 46.18  ? 11  ASP U OD2 1 
ATOM   4324 N N   . CYS D 4  13  ? 31.337 -45.941 71.885  1.00 40.62  ? 12  CYS U N   1 
ATOM   4325 C CA  . CYS D 4  13  ? 30.082 -46.329 71.256  1.00 40.18  ? 12  CYS U CA  1 
ATOM   4326 C C   . CYS D 4  13  ? 29.040 -46.761 72.267  1.00 42.03  ? 12  CYS U C   1 
ATOM   4327 O O   . CYS D 4  13  ? 29.359 -47.120 73.399  1.00 44.68  ? 12  CYS U O   1 
ATOM   4328 C CB  . CYS D 4  13  ? 30.287 -47.473 70.279  1.00 42.20  ? 12  CYS U CB  1 
ATOM   4329 S SG  . CYS D 4  13  ? 31.259 -47.143 68.776  1.00 46.69  ? 12  CYS U SG  1 
ATOM   4330 N N   . ARG D 4  14  ? 27.791 -46.771 71.823  1.00 41.89  ? 13  ARG U N   1 
ATOM   4331 C CA  . ARG D 4  14  ? 26.664 -47.119 72.668  1.00 42.82  ? 13  ARG U CA  1 
ATOM   4332 C C   . ARG D 4  14  ? 25.445 -47.306 71.774  1.00 40.75  ? 13  ARG U C   1 
ATOM   4333 O O   . ARG D 4  14  ? 25.403 -46.771 70.667  1.00 38.59  ? 13  ARG U O   1 
ATOM   4334 C CB  . ARG D 4  14  ? 26.427 -45.970 73.648  1.00 49.58  ? 13  ARG U CB  1 
ATOM   4335 C CG  . ARG D 4  14  ? 25.081 -45.958 74.322  1.00 62.74  ? 13  ARG U CG  1 
ATOM   4336 C CD  . ARG D 4  14  ? 24.935 -44.718 75.195  1.00 72.84  ? 13  ARG U CD  1 
ATOM   4337 N NE  . ARG D 4  14  ? 23.760 -44.816 76.058  1.00 82.92  ? 13  ARG U NE  1 
ATOM   4338 C CZ  . ARG D 4  14  ? 23.501 -43.998 77.075  1.00 85.11  ? 13  ARG U CZ  1 
ATOM   4339 N NH1 . ARG D 4  14  ? 24.336 -43.005 77.367  1.00 86.37  ? 13  ARG U NH1 1 
ATOM   4340 N NH2 . ARG D 4  14  ? 22.409 -44.184 77.809  1.00 85.63  ? 13  ARG U NH2 1 
ATOM   4341 N N   . VAL D 4  15  ? 24.459 -48.062 72.245  1.00 37.93  ? 14  VAL U N   1 
ATOM   4342 C CA  . VAL D 4  15  ? 23.239 -48.288 71.474  1.00 38.50  ? 14  VAL U CA  1 
ATOM   4343 C C   . VAL D 4  15  ? 22.320 -47.084 71.658  1.00 41.04  ? 14  VAL U C   1 
ATOM   4344 O O   . VAL D 4  15  ? 22.188 -46.559 72.770  1.00 39.57  ? 14  VAL U O   1 
ATOM   4345 C CB  . VAL D 4  15  ? 22.485 -49.568 71.941  1.00 37.48  ? 14  VAL U CB  1 
ATOM   4346 C CG1 . VAL D 4  15  ? 21.190 -49.733 71.153  1.00 34.42  ? 14  VAL U CG1 1 
ATOM   4347 C CG2 . VAL D 4  15  ? 23.365 -50.796 71.748  1.00 35.76  ? 14  VAL U CG2 1 
ATOM   4348 N N   . GLU D 4  16  ? 21.698 -46.643 70.565  1.00 41.80  ? 15  GLU U N   1 
ATOM   4349 C CA  . GLU D 4  16  ? 20.784 -45.500 70.596  1.00 41.47  ? 15  GLU U CA  1 
ATOM   4350 C C   . GLU D 4  16  ? 19.371 -45.878 70.174  1.00 41.26  ? 15  GLU U C   1 
ATOM   4351 O O   . GLU D 4  16  ? 19.170 -46.545 69.158  1.00 42.80  ? 15  GLU U O   1 
ATOM   4352 C CB  . GLU D 4  16  ? 21.271 -44.377 69.669  1.00 43.61  ? 15  GLU U CB  1 
ATOM   4353 C CG  . GLU D 4  16  ? 20.312 -43.182 69.625  1.00 44.96  ? 15  GLU U CG  1 
ATOM   4354 C CD  . GLU D 4  16  ? 20.595 -42.190 68.503  1.00 46.09  ? 15  GLU U CD  1 
ATOM   4355 O OE1 . GLU D 4  16  ? 19.816 -41.216 68.387  1.00 49.53  ? 15  GLU U OE1 1 
ATOM   4356 O OE2 . GLU D 4  16  ? 21.573 -42.378 67.743  1.00 43.20  ? 15  GLU U OE2 1 
ATOM   4357 N N   . GLU D 4  17  ? 18.393 -45.442 70.958  1.00 42.34  ? 16  GLU U N   1 
ATOM   4358 C CA  . GLU D 4  17  ? 16.996 -45.707 70.651  1.00 45.29  ? 16  GLU U CA  1 
ATOM   4359 C C   . GLU D 4  17  ? 16.530 -44.542 69.791  1.00 45.78  ? 16  GLU U C   1 
ATOM   4360 O O   . GLU D 4  17  ? 16.342 -43.439 70.292  1.00 48.99  ? 16  GLU U O   1 
ATOM   4361 C CB  . GLU D 4  17  ? 16.178 -45.765 71.942  1.00 49.18  ? 16  GLU U CB  1 
ATOM   4362 C CG  . GLU D 4  17  ? 16.656 -46.818 72.932  1.00 56.27  ? 16  GLU U CG  1 
ATOM   4363 C CD  . GLU D 4  17  ? 15.715 -48.006 73.033  1.00 59.03  ? 16  GLU U CD  1 
ATOM   4364 O OE1 . GLU D 4  17  ? 15.517 -48.722 72.028  1.00 64.75  ? 16  GLU U OE1 1 
ATOM   4365 O OE2 . GLU D 4  17  ? 15.167 -48.221 74.133  1.00 62.99  ? 16  GLU U OE2 1 
ATOM   4366 N N   . CYS D 4  18  ? 16.352 -44.783 68.498  1.00 45.31  ? 17  CYS U N   1 
ATOM   4367 C CA  . CYS D 4  18  ? 15.926 -43.737 67.570  1.00 45.14  ? 17  CYS U CA  1 
ATOM   4368 C C   . CYS D 4  18  ? 14.631 -43.035 67.976  1.00 47.49  ? 17  CYS U C   1 
ATOM   4369 O O   . CYS D 4  18  ? 13.697 -43.674 68.469  1.00 48.34  ? 17  CYS U O   1 
ATOM   4370 C CB  . CYS D 4  18  ? 15.763 -44.321 66.167  1.00 43.57  ? 17  CYS U CB  1 
ATOM   4371 S SG  . CYS D 4  18  ? 17.278 -45.045 65.458  1.00 41.82  ? 17  CYS U SG  1 
ATOM   4372 N N   . ALA D 4  19  ? 14.580 -41.719 67.761  1.00 48.72  ? 18  ALA U N   1 
ATOM   4373 C CA  . ALA D 4  19  ? 13.394 -40.924 68.085  1.00 50.85  ? 18  ALA U CA  1 
ATOM   4374 C C   . ALA D 4  19  ? 12.437 -40.976 66.896  1.00 53.08  ? 18  ALA U C   1 
ATOM   4375 O O   . ALA D 4  19  ? 12.878 -41.168 65.764  1.00 56.22  ? 18  ALA U O   1 
ATOM   4376 C CB  . ALA D 4  19  ? 13.798 -39.481 68.376  1.00 48.73  ? 18  ALA U CB  1 
ATOM   4377 N N   . LEU D 4  20  ? 11.136 -40.823 67.141  1.00 54.66  ? 19  LEU U N   1 
ATOM   4378 C CA  . LEU D 4  20  ? 10.155 -40.854 66.048  1.00 56.73  ? 19  LEU U CA  1 
ATOM   4379 C C   . LEU D 4  20  ? 10.608 -39.996 64.864  1.00 58.66  ? 19  LEU U C   1 
ATOM   4380 O O   . LEU D 4  20  ? 10.972 -38.829 65.034  1.00 59.66  ? 19  LEU U O   1 
ATOM   4381 C CB  . LEU D 4  20  ? 8.782  -40.343 66.517  1.00 55.82  ? 19  LEU U CB  1 
ATOM   4382 C CG  . LEU D 4  20  ? 7.830  -41.223 67.337  1.00 55.73  ? 19  LEU U CG  1 
ATOM   4383 C CD1 . LEU D 4  20  ? 6.592  -40.411 67.677  1.00 53.49  ? 19  LEU U CD1 1 
ATOM   4384 C CD2 . LEU D 4  20  ? 7.440  -42.472 66.557  1.00 54.48  ? 19  LEU U CD2 1 
ATOM   4385 N N   . GLY D 4  21  ? 10.580 -40.572 63.666  1.00 59.95  ? 20  GLY U N   1 
ATOM   4386 C CA  . GLY D 4  21  ? 10.989 -39.825 62.487  1.00 60.86  ? 20  GLY U CA  1 
ATOM   4387 C C   . GLY D 4  21  ? 12.341 -40.248 61.949  1.00 60.03  ? 20  GLY U C   1 
ATOM   4388 O O   . GLY D 4  21  ? 12.607 -40.144 60.750  1.00 59.57  ? 20  GLY U O   1 
ATOM   4389 N N   . GLN D 4  22  ? 13.199 -40.720 62.847  1.00 59.92  ? 21  GLN U N   1 
ATOM   4390 C CA  . GLN D 4  22  ? 14.530 -41.179 62.480  1.00 57.85  ? 21  GLN U CA  1 
ATOM   4391 C C   . GLN D 4  22  ? 14.490 -42.693 62.312  1.00 55.01  ? 21  GLN U C   1 
ATOM   4392 O O   . GLN D 4  22  ? 14.715 -43.443 63.261  1.00 53.27  ? 21  GLN U O   1 
ATOM   4393 C CB  . GLN D 4  22  ? 15.534 -40.786 63.562  1.00 59.31  ? 21  GLN U CB  1 
ATOM   4394 C CG  . GLN D 4  22  ? 15.594 -39.294 63.805  1.00 62.77  ? 21  GLN U CG  1 
ATOM   4395 C CD  . GLN D 4  22  ? 16.686 -38.915 64.775  1.00 67.33  ? 21  GLN U CD  1 
ATOM   4396 O OE1 . GLN D 4  22  ? 16.712 -39.384 65.914  1.00 70.83  ? 21  GLN U OE1 1 
ATOM   4397 N NE2 . GLN D 4  22  ? 17.601 -38.061 64.329  1.00 68.51  ? 21  GLN U NE2 1 
ATOM   4398 N N   . ASP D 4  23  ? 14.188 -43.128 61.094  1.00 52.59  ? 22  ASP U N   1 
ATOM   4399 C CA  . ASP D 4  23  ? 14.091 -44.543 60.771  1.00 53.22  ? 22  ASP U CA  1 
ATOM   4400 C C   . ASP D 4  23  ? 15.296 -45.020 59.964  1.00 49.96  ? 22  ASP U C   1 
ATOM   4401 O O   . ASP D 4  23  ? 15.197 -45.955 59.164  1.00 49.64  ? 22  ASP U O   1 
ATOM   4402 C CB  . ASP D 4  23  ? 12.800 -44.800 59.993  1.00 60.05  ? 22  ASP U CB  1 
ATOM   4403 C CG  . ASP D 4  23  ? 12.583 -43.787 58.880  1.00 69.11  ? 22  ASP U CG  1 
ATOM   4404 O OD1 . ASP D 4  23  ? 12.514 -42.577 59.194  1.00 71.79  ? 22  ASP U OD1 1 
ATOM   4405 O OD2 . ASP D 4  23  ? 12.484 -44.192 57.698  1.00 74.40  ? 22  ASP U OD2 1 
ATOM   4406 N N   . LEU D 4  24  ? 16.435 -44.373 60.185  1.00 45.29  ? 23  LEU U N   1 
ATOM   4407 C CA  . LEU D 4  24  ? 17.670 -44.738 59.503  1.00 41.65  ? 23  LEU U CA  1 
ATOM   4408 C C   . LEU D 4  24  ? 18.899 -44.606 60.402  1.00 40.52  ? 23  LEU U C   1 
ATOM   4409 O O   . LEU D 4  24  ? 18.950 -43.761 61.295  1.00 39.80  ? 23  LEU U O   1 
ATOM   4410 C CB  . LEU D 4  24  ? 17.881 -43.865 58.268  1.00 39.46  ? 23  LEU U CB  1 
ATOM   4411 C CG  . LEU D 4  24  ? 16.998 -44.105 57.054  1.00 40.84  ? 23  LEU U CG  1 
ATOM   4412 C CD1 . LEU D 4  24  ? 17.420 -43.153 55.945  1.00 37.97  ? 23  LEU U CD1 1 
ATOM   4413 C CD2 . LEU D 4  24  ? 17.127 -45.552 56.609  1.00 40.76  ? 23  LEU U CD2 1 
ATOM   4414 N N   . CYS D 4  25  ? 19.891 -45.446 60.146  1.00 38.50  ? 24  CYS U N   1 
ATOM   4415 C CA  . CYS D 4  25  ? 21.135 -45.419 60.894  1.00 37.19  ? 24  CYS U CA  1 
ATOM   4416 C C   . CYS D 4  25  ? 22.180 -44.833 59.960  1.00 35.73  ? 24  CYS U C   1 
ATOM   4417 O O   . CYS D 4  25  ? 22.106 -45.038 58.753  1.00 37.03  ? 24  CYS U O   1 
ATOM   4418 C CB  . CYS D 4  25  ? 21.556 -46.838 61.294  1.00 38.00  ? 24  CYS U CB  1 
ATOM   4419 S SG  . CYS D 4  25  ? 20.451 -47.711 62.449  1.00 39.22  ? 24  CYS U SG  1 
ATOM   4420 N N   . ARG D 4  26  ? 23.159 -44.120 60.504  1.00 34.97  ? 25  ARG U N   1 
ATOM   4421 C CA  . ARG D 4  26  ? 24.190 -43.541 59.658  1.00 34.72  ? 25  ARG U CA  1 
ATOM   4422 C C   . ARG D 4  26  ? 25.611 -43.683 60.191  1.00 36.78  ? 25  ARG U C   1 
ATOM   4423 O O   . ARG D 4  26  ? 25.851 -43.626 61.395  1.00 40.88  ? 25  ARG U O   1 
ATOM   4424 C CB  . ARG D 4  26  ? 23.880 -42.061 59.406  1.00 32.85  ? 25  ARG U CB  1 
ATOM   4425 C CG  . ARG D 4  26  ? 23.943 -41.175 60.637  1.00 30.48  ? 25  ARG U CG  1 
ATOM   4426 C CD  . ARG D 4  26  ? 25.344 -40.627 60.861  1.00 29.23  ? 25  ARG U CD  1 
ATOM   4427 N NE  . ARG D 4  26  ? 25.407 -39.886 62.113  1.00 29.52  ? 25  ARG U NE  1 
ATOM   4428 C CZ  . ARG D 4  26  ? 26.382 -39.050 62.446  1.00 29.41  ? 25  ARG U CZ  1 
ATOM   4429 N NH1 . ARG D 4  26  ? 27.391 -38.832 61.618  1.00 28.49  ? 25  ARG U NH1 1 
ATOM   4430 N NH2 . ARG D 4  26  ? 26.349 -38.433 63.620  1.00 32.09  ? 25  ARG U NH2 1 
ATOM   4431 N N   . THR D 4  27  ? 26.551 -43.888 59.279  1.00 36.61  ? 26  THR U N   1 
ATOM   4432 C CA  . THR D 4  27  ? 27.958 -43.990 59.630  1.00 34.47  ? 26  THR U CA  1 
ATOM   4433 C C   . THR D 4  27  ? 28.649 -42.946 58.775  1.00 36.61  ? 26  THR U C   1 
ATOM   4434 O O   . THR D 4  27  ? 28.718 -43.087 57.556  1.00 38.59  ? 26  THR U O   1 
ATOM   4435 C CB  . THR D 4  27  ? 28.546 -45.356 59.270  1.00 33.69  ? 26  THR U CB  1 
ATOM   4436 O OG1 . THR D 4  27  ? 27.941 -46.369 60.078  1.00 34.52  ? 26  THR U OG1 1 
ATOM   4437 C CG2 . THR D 4  27  ? 30.047 -45.353 59.493  1.00 31.80  ? 26  THR U CG2 1 
ATOM   4438 N N   . THR D 4  28  ? 29.151 -41.894 59.404  1.00 37.64  ? 27  THR U N   1 
ATOM   4439 C CA  . THR D 4  28  ? 29.825 -40.831 58.672  1.00 35.64  ? 27  THR U CA  1 
ATOM   4440 C C   . THR D 4  28  ? 31.326 -41.026 58.802  1.00 35.78  ? 27  THR U C   1 
ATOM   4441 O O   . THR D 4  28  ? 31.844 -41.111 59.912  1.00 37.20  ? 27  THR U O   1 
ATOM   4442 C CB  . THR D 4  28  ? 29.433 -39.469 59.246  1.00 34.46  ? 27  THR U CB  1 
ATOM   4443 O OG1 . THR D 4  28  ? 28.006 -39.369 59.271  1.00 35.68  ? 27  THR U OG1 1 
ATOM   4444 C CG2 . THR D 4  28  ? 30.006 -38.346 58.406  1.00 34.80  ? 27  THR U CG2 1 
ATOM   4445 N N   . ILE D 4  29  ? 32.024 -41.107 57.675  1.00 34.32  ? 28  ILE U N   1 
ATOM   4446 C CA  . ILE D 4  29  ? 33.466 -41.304 57.703  1.00 33.73  ? 28  ILE U CA  1 
ATOM   4447 C C   . ILE D 4  29  ? 34.220 -40.181 57.014  1.00 37.74  ? 28  ILE U C   1 
ATOM   4448 O O   . ILE D 4  29  ? 33.865 -39.771 55.909  1.00 38.56  ? 28  ILE U O   1 
ATOM   4449 C CB  . ILE D 4  29  ? 33.872 -42.612 57.022  1.00 32.88  ? 28  ILE U CB  1 
ATOM   4450 C CG1 . ILE D 4  29  ? 33.084 -43.779 57.608  1.00 30.44  ? 28  ILE U CG1 1 
ATOM   4451 C CG2 . ILE D 4  29  ? 35.355 -42.855 57.225  1.00 32.93  ? 28  ILE U CG2 1 
ATOM   4452 C CD1 . ILE D 4  29  ? 33.318 -45.079 56.882  1.00 34.61  ? 28  ILE U CD1 1 
ATOM   4453 N N   . VAL D 4  30  ? 35.265 -39.695 57.678  1.00 36.97  ? 29  VAL U N   1 
ATOM   4454 C CA  . VAL D 4  30  ? 36.100 -38.628 57.149  1.00 37.37  ? 29  VAL U CA  1 
ATOM   4455 C C   . VAL D 4  30  ? 37.541 -39.133 57.152  1.00 40.91  ? 29  VAL U C   1 
ATOM   4456 O O   . VAL D 4  30  ? 37.999 -39.690 58.141  1.00 44.84  ? 29  VAL U O   1 
ATOM   4457 C CB  . VAL D 4  30  ? 35.998 -37.349 58.025  1.00 34.81  ? 29  VAL U CB  1 
ATOM   4458 C CG1 . VAL D 4  30  ? 36.817 -36.230 57.423  1.00 32.11  ? 29  VAL U CG1 1 
ATOM   4459 C CG2 . VAL D 4  30  ? 34.552 -36.917 58.151  1.00 34.04  ? 29  VAL U CG2 1 
ATOM   4460 N N   . ARG D 4  31  ? 38.247 -38.962 56.041  1.00 44.28  ? 30  ARG U N   1 
ATOM   4461 C CA  . ARG D 4  31  ? 39.632 -39.403 55.947  1.00 45.31  ? 30  ARG U CA  1 
ATOM   4462 C C   . ARG D 4  31  ? 40.480 -38.247 55.448  1.00 47.49  ? 30  ARG U C   1 
ATOM   4463 O O   . ARG D 4  31  ? 40.154 -37.635 54.434  1.00 47.41  ? 30  ARG U O   1 
ATOM   4464 C CB  . ARG D 4  31  ? 39.766 -40.581 54.981  1.00 44.74  ? 30  ARG U CB  1 
ATOM   4465 C CG  . ARG D 4  31  ? 39.000 -41.822 55.387  1.00 47.85  ? 30  ARG U CG  1 
ATOM   4466 C CD  . ARG D 4  31  ? 39.348 -43.002 54.481  1.00 53.57  ? 30  ARG U CD  1 
ATOM   4467 N NE  . ARG D 4  31  ? 38.674 -44.242 54.877  1.00 56.54  ? 30  ARG U NE  1 
ATOM   4468 C CZ  . ARG D 4  31  ? 37.414 -44.553 54.576  1.00 58.43  ? 30  ARG U CZ  1 
ATOM   4469 N NH1 . ARG D 4  31  ? 36.668 -43.714 53.861  1.00 59.70  ? 30  ARG U NH1 1 
ATOM   4470 N NH2 . ARG D 4  31  ? 36.897 -45.705 54.995  1.00 57.10  ? 30  ARG U NH2 1 
ATOM   4471 N N   . LEU D 4  32  ? 41.564 -37.955 56.162  1.00 49.17  ? 31  LEU U N   1 
ATOM   4472 C CA  . LEU D 4  32  ? 42.467 -36.867 55.802  1.00 51.83  ? 31  LEU U CA  1 
ATOM   4473 C C   . LEU D 4  32  ? 43.877 -37.401 55.545  1.00 55.45  ? 31  LEU U C   1 
ATOM   4474 O O   . LEU D 4  32  ? 44.557 -37.846 56.468  1.00 57.26  ? 31  LEU U O   1 
ATOM   4475 C CB  . LEU D 4  32  ? 42.500 -35.833 56.923  1.00 49.56  ? 31  LEU U CB  1 
ATOM   4476 C CG  . LEU D 4  32  ? 41.178 -35.149 57.284  1.00 50.66  ? 31  LEU U CG  1 
ATOM   4477 C CD1 . LEU D 4  32  ? 40.141 -36.167 57.705  1.00 51.59  ? 31  LEU U CD1 1 
ATOM   4478 C CD2 . LEU D 4  32  ? 41.427 -34.174 58.420  1.00 52.75  ? 31  LEU U CD2 1 
ATOM   4479 N N   . TRP D 4  33  ? 44.311 -37.344 54.289  1.00 58.22  ? 32  TRP U N   1 
ATOM   4480 C CA  . TRP D 4  33  ? 45.626 -37.837 53.885  1.00 60.18  ? 32  TRP U CA  1 
ATOM   4481 C C   . TRP D 4  33  ? 46.624 -36.715 53.603  1.00 59.74  ? 32  TRP U C   1 
ATOM   4482 O O   . TRP D 4  33  ? 46.230 -35.607 53.256  1.00 61.05  ? 32  TRP U O   1 
ATOM   4483 C CB  . TRP D 4  33  ? 45.478 -38.699 52.628  1.00 65.21  ? 32  TRP U CB  1 
ATOM   4484 C CG  . TRP D 4  33  ? 46.786 -39.102 52.014  1.00 73.16  ? 32  TRP U CG  1 
ATOM   4485 C CD1 . TRP D 4  33  ? 47.504 -40.235 52.278  1.00 75.49  ? 32  TRP U CD1 1 
ATOM   4486 C CD2 . TRP D 4  33  ? 47.561 -38.347 51.069  1.00 75.92  ? 32  TRP U CD2 1 
ATOM   4487 N NE1 . TRP D 4  33  ? 48.678 -40.232 51.558  1.00 77.07  ? 32  TRP U NE1 1 
ATOM   4488 C CE2 . TRP D 4  33  ? 48.738 -39.086 50.808  1.00 77.10  ? 32  TRP U CE2 1 
ATOM   4489 C CE3 . TRP D 4  33  ? 47.376 -37.116 50.419  1.00 77.11  ? 32  TRP U CE3 1 
ATOM   4490 C CZ2 . TRP D 4  33  ? 49.728 -38.634 49.924  1.00 77.90  ? 32  TRP U CZ2 1 
ATOM   4491 C CZ3 . TRP D 4  33  ? 48.364 -36.666 49.538  1.00 78.73  ? 32  TRP U CZ3 1 
ATOM   4492 C CH2 . TRP D 4  33  ? 49.524 -37.426 49.301  1.00 78.56  ? 32  TRP U CH2 1 
ATOM   4493 N N   . GLU D 4  34  ? 47.915 -37.019 53.755  1.00 59.81  ? 33  GLU U N   1 
ATOM   4494 C CA  . GLU D 4  34  ? 49.008 -36.077 53.492  1.00 60.51  ? 33  GLU U CA  1 
ATOM   4495 C C   . GLU D 4  34  ? 50.357 -36.789 53.353  1.00 59.96  ? 33  GLU U C   1 
ATOM   4496 O O   . GLU D 4  34  ? 50.844 -37.427 54.289  1.00 60.03  ? 33  GLU U O   1 
ATOM   4497 C CB  . GLU D 4  34  ? 49.110 -35.012 54.592  1.00 61.87  ? 33  GLU U CB  1 
ATOM   4498 C CG  . GLU D 4  34  ? 48.070 -33.901 54.492  1.00 65.65  ? 33  GLU U CG  1 
ATOM   4499 C CD  . GLU D 4  34  ? 48.609 -32.542 54.910  1.00 67.03  ? 33  GLU U CD  1 
ATOM   4500 O OE1 . GLU D 4  34  ? 49.479 -31.999 54.193  1.00 67.05  ? 33  GLU U OE1 1 
ATOM   4501 O OE2 . GLU D 4  34  ? 48.163 -32.018 55.954  1.00 68.57  ? 33  GLU U OE2 1 
ATOM   4502 N N   . GLU D 4  38  ? 47.749 -40.972 56.910  1.00 60.58  ? 37  GLU U N   1 
ATOM   4503 C CA  . GLU D 4  38  ? 46.321 -40.692 56.821  1.00 61.10  ? 37  GLU U CA  1 
ATOM   4504 C C   . GLU D 4  38  ? 45.621 -40.744 58.182  1.00 61.11  ? 37  GLU U C   1 
ATOM   4505 O O   . GLU D 4  38  ? 46.069 -41.443 59.090  1.00 64.11  ? 37  GLU U O   1 
ATOM   4506 C CB  . GLU D 4  38  ? 45.640 -41.692 55.890  1.00 62.64  ? 37  GLU U CB  1 
ATOM   4507 C CG  . GLU D 4  38  ? 44.166 -41.387 55.675  1.00 65.98  ? 37  GLU U CG  1 
ATOM   4508 C CD  . GLU D 4  38  ? 43.424 -42.495 54.957  1.00 68.20  ? 37  GLU U CD  1 
ATOM   4509 O OE1 . GLU D 4  38  ? 43.154 -43.544 55.585  1.00 70.18  ? 37  GLU U OE1 1 
ATOM   4510 O OE2 . GLU D 4  38  ? 43.114 -42.311 53.760  1.00 67.42  ? 37  GLU U OE2 1 
ATOM   4511 N N   . LEU D 4  39  ? 44.520 -40.001 58.309  1.00 57.71  ? 38  LEU U N   1 
ATOM   4512 C CA  . LEU D 4  39  ? 43.724 -39.956 59.537  1.00 53.97  ? 38  LEU U CA  1 
ATOM   4513 C C   . LEU D 4  39  ? 42.268 -40.255 59.203  1.00 54.03  ? 38  LEU U C   1 
ATOM   4514 O O   . LEU D 4  39  ? 41.707 -39.654 58.293  1.00 55.21  ? 38  LEU U O   1 
ATOM   4515 C CB  . LEU D 4  39  ? 43.800 -38.575 60.193  1.00 51.34  ? 38  LEU U CB  1 
ATOM   4516 C CG  . LEU D 4  39  ? 42.697 -38.298 61.227  1.00 51.54  ? 38  LEU U CG  1 
ATOM   4517 C CD1 . LEU D 4  39  ? 42.861 -39.227 62.420  1.00 51.88  ? 38  LEU U CD1 1 
ATOM   4518 C CD2 . LEU D 4  39  ? 42.744 -36.848 61.675  1.00 51.67  ? 38  LEU U CD2 1 
ATOM   4519 N N   . GLU D 4  40  ? 41.651 -41.170 59.943  1.00 53.34  ? 39  GLU U N   1 
ATOM   4520 C CA  . GLU D 4  40  ? 40.259 -41.522 59.692  1.00 50.37  ? 39  GLU U CA  1 
ATOM   4521 C C   . GLU D 4  40  ? 39.339 -41.282 60.887  1.00 48.07  ? 39  GLU U C   1 
ATOM   4522 O O   . GLU D 4  40  ? 39.581 -41.783 61.983  1.00 48.76  ? 39  GLU U O   1 
ATOM   4523 C CB  . GLU D 4  40  ? 40.158 -42.984 59.260  1.00 53.58  ? 39  GLU U CB  1 
ATOM   4524 C CG  . GLU D 4  40  ? 38.727 -43.471 59.076  1.00 60.24  ? 39  GLU U CG  1 
ATOM   4525 C CD  . GLU D 4  40  ? 38.656 -44.921 58.628  1.00 65.93  ? 39  GLU U CD  1 
ATOM   4526 O OE1 . GLU D 4  40  ? 37.531 -45.461 58.540  1.00 69.40  ? 39  GLU U OE1 1 
ATOM   4527 O OE2 . GLU D 4  40  ? 39.723 -45.519 58.360  1.00 68.50  ? 39  GLU U OE2 1 
ATOM   4528 N N   . LEU D 4  41  ? 38.281 -40.510 60.657  1.00 44.00  ? 40  LEU U N   1 
ATOM   4529 C CA  . LEU D 4  41  ? 37.295 -40.201 61.680  1.00 39.78  ? 40  LEU U CA  1 
ATOM   4530 C C   . LEU D 4  41  ? 36.027 -40.969 61.348  1.00 38.76  ? 40  LEU U C   1 
ATOM   4531 O O   . LEU D 4  41  ? 35.617 -41.020 60.191  1.00 40.38  ? 40  LEU U O   1 
ATOM   4532 C CB  . LEU D 4  41  ? 36.978 -38.707 61.685  1.00 38.82  ? 40  LEU U CB  1 
ATOM   4533 C CG  . LEU D 4  41  ? 38.013 -37.716 62.206  1.00 40.23  ? 40  LEU U CG  1 
ATOM   4534 C CD1 . LEU D 4  41  ? 39.374 -38.024 61.644  1.00 44.04  ? 40  LEU U CD1 1 
ATOM   4535 C CD2 . LEU D 4  41  ? 37.576 -36.312 61.827  1.00 42.46  ? 40  LEU U CD2 1 
ATOM   4536 N N   . VAL D 4  42  ? 35.416 -41.578 62.354  1.00 35.84  ? 41  VAL U N   1 
ATOM   4537 C CA  . VAL D 4  42  ? 34.182 -42.319 62.139  1.00 34.30  ? 41  VAL U CA  1 
ATOM   4538 C C   . VAL D 4  42  ? 33.193 -41.860 63.181  1.00 34.82  ? 41  VAL U C   1 
ATOM   4539 O O   . VAL D 4  42  ? 33.556 -41.679 64.335  1.00 37.43  ? 41  VAL U O   1 
ATOM   4540 C CB  . VAL D 4  42  ? 34.375 -43.831 62.292  1.00 32.79  ? 41  VAL U CB  1 
ATOM   4541 C CG1 . VAL D 4  42  ? 33.037 -44.541 62.103  1.00 31.01  ? 41  VAL U CG1 1 
ATOM   4542 C CG2 . VAL D 4  42  ? 35.396 -44.332 61.286  1.00 31.42  ? 41  VAL U CG2 1 
ATOM   4543 N N   . GLU D 4  43  ? 31.947 -41.671 62.765  1.00 36.05  ? 42  GLU U N   1 
ATOM   4544 C CA  . GLU D 4  43  ? 30.880 -41.223 63.655  1.00 36.09  ? 42  GLU U CA  1 
ATOM   4545 C C   . GLU D 4  43  ? 29.568 -41.927 63.255  1.00 35.51  ? 42  GLU U C   1 
ATOM   4546 O O   . GLU D 4  43  ? 29.333 -42.191 62.072  1.00 35.92  ? 42  GLU U O   1 
ATOM   4547 C CB  . GLU D 4  43  ? 30.769 -39.706 63.552  1.00 38.15  ? 42  GLU U CB  1 
ATOM   4548 C CG  . GLU D 4  43  ? 29.727 -39.077 64.417  1.00 41.56  ? 42  GLU U CG  1 
ATOM   4549 C CD  . GLU D 4  43  ? 29.780 -37.568 64.322  1.00 49.32  ? 42  GLU U CD  1 
ATOM   4550 O OE1 . GLU D 4  43  ? 30.650 -36.963 64.992  1.00 49.49  ? 42  GLU U OE1 1 
ATOM   4551 O OE2 . GLU D 4  43  ? 28.963 -36.991 63.562  1.00 53.74  ? 42  GLU U OE2 1 
ATOM   4552 N N   . LYS D 4  44  ? 28.727 -42.255 64.235  1.00 32.36  ? 43  LYS U N   1 
ATOM   4553 C CA  . LYS D 4  44  ? 27.485 -42.968 63.947  1.00 30.12  ? 43  LYS U CA  1 
ATOM   4554 C C   . LYS D 4  44  ? 26.354 -42.548 64.853  1.00 32.26  ? 43  LYS U C   1 
ATOM   4555 O O   . LYS D 4  44  ? 26.589 -42.001 65.923  1.00 35.96  ? 43  LYS U O   1 
ATOM   4556 C CB  . LYS D 4  44  ? 27.705 -44.467 64.109  1.00 28.58  ? 43  LYS U CB  1 
ATOM   4557 C CG  . LYS D 4  44  ? 28.929 -44.990 63.368  1.00 26.13  ? 43  LYS U CG  1 
ATOM   4558 C CD  . LYS D 4  44  ? 29.092 -46.484 63.570  1.00 26.23  ? 43  LYS U CD  1 
ATOM   4559 C CE  . LYS D 4  44  ? 30.346 -46.996 62.888  1.00 29.34  ? 43  LYS U CE  1 
ATOM   4560 N NZ  . LYS D 4  44  ? 30.411 -48.477 62.956  1.00 34.87  ? 43  LYS U NZ  1 
ATOM   4561 N N   . SER D 4  45  ? 25.124 -42.816 64.419  1.00 33.85  ? 44  SER U N   1 
ATOM   4562 C CA  . SER D 4  45  ? 23.922 -42.480 65.187  1.00 35.72  ? 44  SER U CA  1 
ATOM   4563 C C   . SER D 4  45  ? 22.659 -42.739 64.366  1.00 36.44  ? 44  SER U C   1 
ATOM   4564 O O   . SER D 4  45  ? 22.737 -43.166 63.215  1.00 36.97  ? 44  SER U O   1 
ATOM   4565 C CB  . SER D 4  45  ? 23.948 -41.000 65.599  1.00 37.78  ? 44  SER U CB  1 
ATOM   4566 O OG  . SER D 4  45  ? 23.839 -40.131 64.475  1.00 38.27  ? 44  SER U OG  1 
ATOM   4567 N N   . CYS D 4  46  ? 21.496 -42.503 64.969  1.00 39.07  ? 45  CYS U N   1 
ATOM   4568 C CA  . CYS D 4  46  ? 20.231 -42.646 64.254  1.00 40.81  ? 45  CYS U CA  1 
ATOM   4569 C C   . CYS D 4  46  ? 20.180 -41.419 63.354  1.00 43.63  ? 45  CYS U C   1 
ATOM   4570 O O   . CYS D 4  46  ? 20.826 -40.410 63.649  1.00 44.35  ? 45  CYS U O   1 
ATOM   4571 C CB  . CYS D 4  46  ? 19.040 -42.570 65.204  1.00 39.90  ? 45  CYS U CB  1 
ATOM   4572 S SG  . CYS D 4  46  ? 18.795 -43.990 66.309  1.00 43.25  ? 45  CYS U SG  1 
ATOM   4573 N N   . THR D 4  47  ? 19.421 -41.486 62.268  1.00 43.21  ? 46  THR U N   1 
ATOM   4574 C CA  . THR D 4  47  ? 19.330 -40.338 61.382  1.00 44.14  ? 46  THR U CA  1 
ATOM   4575 C C   . THR D 4  47  ? 17.965 -40.233 60.727  1.00 46.34  ? 46  THR U C   1 
ATOM   4576 O O   . THR D 4  47  ? 17.151 -41.151 60.812  1.00 46.03  ? 46  THR U O   1 
ATOM   4577 C CB  . THR D 4  47  ? 20.426 -40.377 60.300  1.00 42.70  ? 46  THR U CB  1 
ATOM   4578 O OG1 . THR D 4  47  ? 20.506 -39.096 59.668  1.00 44.05  ? 46  THR U OG1 1 
ATOM   4579 C CG2 . THR D 4  47  ? 20.126 -41.440 59.260  1.00 39.27  ? 46  THR U CG2 1 
ATOM   4580 N N   . HIS D 4  48  ? 17.728 -39.104 60.069  1.00 50.50  ? 47  HIS U N   1 
ATOM   4581 C CA  . HIS D 4  48  ? 16.455 -38.827 59.412  1.00 54.34  ? 47  HIS U CA  1 
ATOM   4582 C C   . HIS D 4  48  ? 16.124 -39.731 58.231  1.00 53.41  ? 47  HIS U C   1 
ATOM   4583 O O   . HIS D 4  48  ? 17.006 -40.206 57.514  1.00 53.14  ? 47  HIS U O   1 
ATOM   4584 C CB  . HIS D 4  48  ? 16.434 -37.358 59.013  1.00 61.70  ? 47  HIS U CB  1 
ATOM   4585 C CG  . HIS D 4  48  ? 16.896 -36.456 60.113  1.00 72.43  ? 47  HIS U CG  1 
ATOM   4586 N ND1 . HIS D 4  48  ? 16.225 -36.347 61.314  1.00 77.91  ? 47  HIS U ND1 1 
ATOM   4587 C CD2 . HIS D 4  48  ? 18.008 -35.690 60.234  1.00 76.21  ? 47  HIS U CD2 1 
ATOM   4588 C CE1 . HIS D 4  48  ? 16.904 -35.556 62.126  1.00 80.06  ? 47  HIS U CE1 1 
ATOM   4589 N NE2 . HIS D 4  48  ? 17.990 -35.145 61.496  1.00 80.56  ? 47  HIS U NE2 1 
ATOM   4590 N N   . SER D 4  49  ? 14.830 -39.966 58.052  1.00 53.35  ? 48  SER U N   1 
ATOM   4591 C CA  . SER D 4  49  ? 14.310 -40.835 57.001  1.00 52.91  ? 48  SER U CA  1 
ATOM   4592 C C   . SER D 4  49  ? 14.804 -40.570 55.586  1.00 50.95  ? 48  SER U C   1 
ATOM   4593 O O   . SER D 4  49  ? 15.054 -41.508 54.832  1.00 49.01  ? 48  SER U O   1 
ATOM   4594 C CB  . SER D 4  49  ? 12.782 -40.772 57.008  1.00 55.33  ? 48  SER U CB  1 
ATOM   4595 O OG  . SER D 4  49  ? 12.338 -39.426 56.936  1.00 61.16  ? 48  SER U OG  1 
ATOM   4596 N N   . GLU D 4  50  ? 14.945 -39.299 55.227  1.00 50.84  ? 49  GLU U N   1 
ATOM   4597 C CA  . GLU D 4  50  ? 15.366 -38.937 53.879  1.00 51.42  ? 49  GLU U CA  1 
ATOM   4598 C C   . GLU D 4  50  ? 16.867 -38.770 53.628  1.00 48.28  ? 49  GLU U C   1 
ATOM   4599 O O   . GLU D 4  50  ? 17.265 -38.139 52.650  1.00 48.33  ? 49  GLU U O   1 
ATOM   4600 C CB  . GLU D 4  50  ? 14.600 -37.682 53.433  1.00 58.49  ? 49  GLU U CB  1 
ATOM   4601 C CG  . GLU D 4  50  ? 13.091 -37.941 53.243  1.00 69.50  ? 49  GLU U CG  1 
ATOM   4602 C CD  . GLU D 4  50  ? 12.276 -36.687 52.921  1.00 76.85  ? 49  GLU U CD  1 
ATOM   4603 O OE1 . GLU D 4  50  ? 12.049 -35.854 53.835  1.00 79.06  ? 49  GLU U OE1 1 
ATOM   4604 O OE2 . GLU D 4  50  ? 11.862 -36.543 51.745  1.00 80.53  ? 49  GLU U OE2 1 
ATOM   4605 N N   . LYS D 4  51  ? 17.696 -39.337 54.502  1.00 44.22  ? 50  LYS U N   1 
ATOM   4606 C CA  . LYS D 4  51  ? 19.145 -39.269 54.337  1.00 38.75  ? 50  LYS U CA  1 
ATOM   4607 C C   . LYS D 4  51  ? 19.521 -40.322 53.302  1.00 38.98  ? 50  LYS U C   1 
ATOM   4608 O O   . LYS D 4  51  ? 18.741 -41.239 53.055  1.00 38.96  ? 50  LYS U O   1 
ATOM   4609 C CB  . LYS D 4  51  ? 19.842 -39.555 55.662  1.00 37.75  ? 50  LYS U CB  1 
ATOM   4610 C CG  . LYS D 4  51  ? 19.819 -38.395 56.626  1.00 35.79  ? 50  LYS U CG  1 
ATOM   4611 C CD  . LYS D 4  51  ? 20.746 -37.301 56.151  1.00 39.11  ? 50  LYS U CD  1 
ATOM   4612 C CE  . LYS D 4  51  ? 20.937 -36.226 57.206  1.00 42.81  ? 50  LYS U CE  1 
ATOM   4613 N NZ  . LYS D 4  51  ? 21.975 -35.231 56.796  1.00 48.48  ? 50  LYS U NZ  1 
ATOM   4614 N N   . THR D 4  52  ? 20.704 -40.204 52.701  1.00 38.48  ? 51  THR U N   1 
ATOM   4615 C CA  . THR D 4  52  ? 21.123 -41.145 51.661  1.00 37.09  ? 51  THR U CA  1 
ATOM   4616 C C   . THR D 4  52  ? 22.626 -41.371 51.615  1.00 37.28  ? 51  THR U C   1 
ATOM   4617 O O   . THR D 4  52  ? 23.396 -40.627 52.224  1.00 39.98  ? 51  THR U O   1 
ATOM   4618 C CB  . THR D 4  52  ? 20.741 -40.628 50.272  1.00 38.95  ? 51  THR U CB  1 
ATOM   4619 O OG1 . THR D 4  52  ? 21.521 -39.459 49.989  1.00 40.11  ? 51  THR U OG1 1 
ATOM   4620 C CG2 . THR D 4  52  ? 19.263 -40.262 50.209  1.00 37.63  ? 51  THR U CG2 1 
ATOM   4621 N N   . ASN D 4  53  ? 23.034 -42.398 50.870  1.00 37.53  ? 52  ASN U N   1 
ATOM   4622 C CA  . ASN D 4  53  ? 24.446 -42.714 50.700  1.00 39.73  ? 52  ASN U CA  1 
ATOM   4623 C C   . ASN D 4  53  ? 25.042 -41.598 49.861  1.00 43.22  ? 52  ASN U C   1 
ATOM   4624 O O   . ASN D 4  53  ? 24.523 -41.269 48.793  1.00 46.76  ? 52  ASN U O   1 
ATOM   4625 C CB  . ASN D 4  53  ? 24.608 -44.053 49.992  1.00 38.72  ? 52  ASN U CB  1 
ATOM   4626 C CG  . ASN D 4  53  ? 24.344 -45.221 50.910  1.00 41.76  ? 52  ASN U CG  1 
ATOM   4627 O OD1 . ASN D 4  53  ? 24.035 -45.030 52.081  1.00 41.63  ? 52  ASN U OD1 1 
ATOM   4628 N ND2 . ASN D 4  53  ? 24.453 -46.439 50.387  1.00 43.91  ? 52  ASN U ND2 1 
ATOM   4629 N N   . ARG D 4  54  ? 26.133 -41.015 50.338  1.00 43.10  ? 53  ARG U N   1 
ATOM   4630 C CA  . ARG D 4  54  ? 26.752 -39.903 49.632  1.00 40.50  ? 53  ARG U CA  1 
ATOM   4631 C C   . ARG D 4  54  ? 28.250 -39.799 49.886  1.00 41.21  ? 53  ARG U C   1 
ATOM   4632 O O   . ARG D 4  54  ? 28.727 -40.111 50.973  1.00 44.72  ? 53  ARG U O   1 
ATOM   4633 C CB  . ARG D 4  54  ? 26.078 -38.615 50.076  1.00 37.85  ? 53  ARG U CB  1 
ATOM   4634 C CG  . ARG D 4  54  ? 26.162 -38.416 51.569  1.00 37.09  ? 53  ARG U CG  1 
ATOM   4635 C CD  . ARG D 4  54  ? 25.277 -37.287 52.023  1.00 28.13  ? 53  ARG U CD  1 
ATOM   4636 N NE  . ARG D 4  54  ? 23.863 -37.579 51.832  1.00 33.30  ? 53  ARG U NE  1 
ATOM   4637 C CZ  . ARG D 4  54  ? 22.893 -36.783 52.261  1.00 40.31  ? 53  ARG U CZ  1 
ATOM   4638 N NH1 . ARG D 4  54  ? 23.198 -35.659 52.895  1.00 43.14  ? 53  ARG U NH1 1 
ATOM   4639 N NH2 . ARG D 4  54  ? 21.625 -37.111 52.072  1.00 44.68  ? 53  ARG U NH2 1 
ATOM   4640 N N   . THR D 4  55  ? 28.986 -39.342 48.879  1.00 39.60  ? 54  THR U N   1 
ATOM   4641 C CA  . THR D 4  55  ? 30.423 -39.191 48.998  1.00 38.19  ? 54  THR U CA  1 
ATOM   4642 C C   . THR D 4  55  ? 30.879 -37.850 48.468  1.00 36.92  ? 54  THR U C   1 
ATOM   4643 O O   . THR D 4  55  ? 30.183 -37.201 47.700  1.00 37.67  ? 54  THR U O   1 
ATOM   4644 C CB  . THR D 4  55  ? 31.146 -40.284 48.230  1.00 40.68  ? 54  THR U CB  1 
ATOM   4645 O OG1 . THR D 4  55  ? 30.771 -41.553 48.773  1.00 45.54  ? 54  THR U OG1 1 
ATOM   4646 C CG2 . THR D 4  55  ? 32.651 -40.120 48.353  1.00 44.40  ? 54  THR U CG2 1 
ATOM   4647 N N   . LEU D 4  56  ? 32.056 -37.438 48.903  1.00 36.43  ? 55  LEU U N   1 
ATOM   4648 C CA  . LEU D 4  56  ? 32.647 -36.189 48.479  1.00 36.89  ? 55  LEU U CA  1 
ATOM   4649 C C   . LEU D 4  56  ? 34.123 -36.262 48.821  1.00 39.54  ? 55  LEU U C   1 
ATOM   4650 O O   . LEU D 4  56  ? 34.498 -36.501 49.965  1.00 40.39  ? 55  LEU U O   1 
ATOM   4651 C CB  . LEU D 4  56  ? 32.004 -35.002 49.200  1.00 36.68  ? 55  LEU U CB  1 
ATOM   4652 C CG  . LEU D 4  56  ? 32.676 -33.642 48.964  1.00 36.19  ? 55  LEU U CG  1 
ATOM   4653 C CD1 . LEU D 4  56  ? 32.591 -33.260 47.495  1.00 39.23  ? 55  LEU U CD1 1 
ATOM   4654 C CD2 . LEU D 4  56  ? 32.007 -32.590 49.814  1.00 35.82  ? 55  LEU U CD2 1 
ATOM   4655 N N   . SER D 4  57  ? 34.961 -36.076 47.814  1.00 40.08  ? 56  SER U N   1 
ATOM   4656 C CA  . SER D 4  57  ? 36.391 -36.109 48.012  1.00 40.54  ? 56  SER U CA  1 
ATOM   4657 C C   . SER D 4  57  ? 36.966 -34.903 47.278  1.00 40.58  ? 56  SER U C   1 
ATOM   4658 O O   . SER D 4  57  ? 36.529 -34.570 46.179  1.00 41.11  ? 56  SER U O   1 
ATOM   4659 C CB  . SER D 4  57  ? 36.960 -37.405 47.451  1.00 39.42  ? 56  SER U CB  1 
ATOM   4660 O OG  . SER D 4  57  ? 38.311 -37.554 47.825  1.00 49.28  ? 56  SER U OG  1 
ATOM   4661 N N   . TYR D 4  58  ? 37.927 -34.233 47.898  1.00 39.68  ? 57  TYR U N   1 
ATOM   4662 C CA  . TYR D 4  58  ? 38.538 -33.068 47.291  1.00 41.99  ? 57  TYR U CA  1 
ATOM   4663 C C   . TYR D 4  58  ? 39.923 -32.851 47.863  1.00 43.86  ? 57  TYR U C   1 
ATOM   4664 O O   . TYR D 4  58  ? 40.175 -33.137 49.033  1.00 44.44  ? 57  TYR U O   1 
ATOM   4665 C CB  . TYR D 4  58  ? 37.667 -31.831 47.534  1.00 40.65  ? 57  TYR U CB  1 
ATOM   4666 C CG  . TYR D 4  58  ? 37.453 -31.481 48.993  1.00 42.03  ? 57  TYR U CG  1 
ATOM   4667 C CD1 . TYR D 4  58  ? 38.351 -30.654 49.673  1.00 41.23  ? 57  TYR U CD1 1 
ATOM   4668 C CD2 . TYR D 4  58  ? 36.346 -31.979 49.698  1.00 41.49  ? 57  TYR U CD2 1 
ATOM   4669 C CE1 . TYR D 4  58  ? 38.154 -30.326 51.017  1.00 43.44  ? 57  TYR U CE1 1 
ATOM   4670 C CE2 . TYR D 4  58  ? 36.142 -31.657 51.042  1.00 41.68  ? 57  TYR U CE2 1 
ATOM   4671 C CZ  . TYR D 4  58  ? 37.048 -30.828 51.694  1.00 43.17  ? 57  TYR U CZ  1 
ATOM   4672 O OH  . TYR D 4  58  ? 36.842 -30.481 53.010  1.00 43.38  ? 57  TYR U OH  1 
ATOM   4673 N N   . ARG D 4  59  ? 40.835 -32.372 47.026  1.00 46.38  ? 58  ARG U N   1 
ATOM   4674 C CA  . ARG D 4  59  ? 42.178 -32.108 47.496  1.00 48.97  ? 58  ARG U CA  1 
ATOM   4675 C C   . ARG D 4  59  ? 42.322 -30.612 47.661  1.00 49.04  ? 58  ARG U C   1 
ATOM   4676 O O   . ARG D 4  59  ? 41.850 -29.831 46.836  1.00 46.69  ? 58  ARG U O   1 
ATOM   4677 C CB  . ARG D 4  59  ? 43.222 -32.646 46.525  1.00 51.97  ? 58  ARG U CB  1 
ATOM   4678 C CG  . ARG D 4  59  ? 43.232 -32.011 45.162  1.00 55.68  ? 58  ARG U CG  1 
ATOM   4679 C CD  . ARG D 4  59  ? 44.486 -32.450 44.426  1.00 58.59  ? 58  ARG U CD  1 
ATOM   4680 N NE  . ARG D 4  59  ? 44.754 -33.869 44.645  1.00 61.22  ? 58  ARG U NE  1 
ATOM   4681 C CZ  . ARG D 4  59  ? 45.740 -34.546 44.068  1.00 64.89  ? 58  ARG U CZ  1 
ATOM   4682 N NH1 . ARG D 4  59  ? 46.560 -33.932 43.223  1.00 66.16  ? 58  ARG U NH1 1 
ATOM   4683 N NH2 . ARG D 4  59  ? 45.915 -35.835 44.346  1.00 65.73  ? 58  ARG U NH2 1 
ATOM   4684 N N   . THR D 4  60  ? 42.965 -30.220 48.751  1.00 50.93  ? 59  THR U N   1 
ATOM   4685 C CA  . THR D 4  60  ? 43.154 -28.819 49.060  1.00 52.00  ? 59  THR U CA  1 
ATOM   4686 C C   . THR D 4  60  ? 44.645 -28.546 49.270  1.00 52.96  ? 59  THR U C   1 
ATOM   4687 O O   . THR D 4  60  ? 45.084 -28.181 50.358  1.00 57.23  ? 59  THR U O   1 
ATOM   4688 C CB  . THR D 4  60  ? 42.326 -28.459 50.315  1.00 50.27  ? 59  THR U CB  1 
ATOM   4689 O OG1 . THR D 4  60  ? 42.413 -27.057 50.564  1.00 54.93  ? 59  THR U OG1 1 
ATOM   4690 C CG2 . THR D 4  60  ? 42.821 -29.223 51.527  1.00 48.91  ? 59  THR U CG2 1 
ATOM   4691 N N   . GLY D 4  61  ? 45.421 -28.724 48.207  1.00 53.07  ? 60  GLY U N   1 
ATOM   4692 C CA  . GLY D 4  61  ? 46.855 -28.519 48.284  1.00 50.93  ? 60  GLY U CA  1 
ATOM   4693 C C   . GLY D 4  61  ? 47.523 -29.878 48.271  1.00 50.94  ? 60  GLY U C   1 
ATOM   4694 O O   . GLY D 4  61  ? 47.442 -30.604 47.280  1.00 47.98  ? 60  GLY U O   1 
ATOM   4695 N N   . LEU D 4  62  ? 48.177 -30.230 49.374  1.00 53.75  ? 61  LEU U N   1 
ATOM   4696 C CA  . LEU D 4  62  ? 48.838 -31.528 49.491  1.00 55.85  ? 61  LEU U CA  1 
ATOM   4697 C C   . LEU D 4  62  ? 47.866 -32.550 50.082  1.00 57.27  ? 61  LEU U C   1 
ATOM   4698 O O   . LEU D 4  62  ? 47.947 -33.751 49.796  1.00 58.16  ? 61  LEU U O   1 
ATOM   4699 C CB  . LEU D 4  62  ? 50.060 -31.422 50.401  1.00 54.73  ? 61  LEU U CB  1 
ATOM   4700 C CG  . LEU D 4  62  ? 51.220 -30.566 49.908  1.00 55.62  ? 61  LEU U CG  1 
ATOM   4701 C CD1 . LEU D 4  62  ? 52.292 -30.522 50.980  1.00 58.04  ? 61  LEU U CD1 1 
ATOM   4702 C CD2 . LEU D 4  62  ? 51.771 -31.144 48.616  1.00 54.63  ? 61  LEU U CD2 1 
ATOM   4703 N N   . LYS D 4  63  ? 46.946 -32.051 50.903  1.00 56.55  ? 62  LYS U N   1 
ATOM   4704 C CA  . LYS D 4  63  ? 45.950 -32.882 51.567  1.00 55.78  ? 62  LYS U CA  1 
ATOM   4705 C C   . LYS D 4  63  ? 44.813 -33.328 50.646  1.00 55.03  ? 62  LYS U C   1 
ATOM   4706 O O   . LYS D 4  63  ? 44.592 -32.765 49.573  1.00 54.97  ? 62  LYS U O   1 
ATOM   4707 C CB  . LYS D 4  63  ? 45.361 -32.125 52.761  1.00 56.02  ? 62  LYS U CB  1 
ATOM   4708 C CG  . LYS D 4  63  ? 44.527 -32.978 53.710  1.00 56.40  ? 62  LYS U CG  1 
ATOM   4709 C CD  . LYS D 4  63  ? 43.640 -32.111 54.594  1.00 57.41  ? 62  LYS U CD  1 
ATOM   4710 C CE  . LYS D 4  63  ? 44.411 -30.944 55.199  1.00 58.36  ? 62  LYS U CE  1 
ATOM   4711 N NZ  . LYS D 4  63  ? 43.541 -30.055 56.021  1.00 58.26  ? 62  LYS U NZ  1 
ATOM   4712 N N   . ILE D 4  64  ? 44.098 -34.352 51.096  1.00 54.31  ? 63  ILE U N   1 
ATOM   4713 C CA  . ILE D 4  64  ? 42.965 -34.914 50.380  1.00 51.89  ? 63  ILE U CA  1 
ATOM   4714 C C   . ILE D 4  64  ? 41.939 -35.274 51.444  1.00 51.90  ? 63  ILE U C   1 
ATOM   4715 O O   . ILE D 4  64  ? 42.213 -36.100 52.308  1.00 53.48  ? 63  ILE U O   1 
ATOM   4716 C CB  . ILE D 4  64  ? 43.342 -36.209 49.637  1.00 50.30  ? 63  ILE U CB  1 
ATOM   4717 C CG1 . ILE D 4  64  ? 44.417 -35.925 48.589  1.00 51.12  ? 63  ILE U CG1 1 
ATOM   4718 C CG2 . ILE D 4  64  ? 42.101 -36.810 48.997  1.00 49.49  ? 63  ILE U CG2 1 
ATOM   4719 C CD1 . ILE D 4  64  ? 44.911 -37.169 47.864  1.00 49.05  ? 63  ILE U CD1 1 
ATOM   4720 N N   . THR D 4  65  ? 40.767 -34.654 51.392  1.00 49.96  ? 64  THR U N   1 
ATOM   4721 C CA  . THR D 4  65  ? 39.725 -34.945 52.366  1.00 47.71  ? 64  THR U CA  1 
ATOM   4722 C C   . THR D 4  65  ? 38.658 -35.822 51.716  1.00 48.77  ? 64  THR U C   1 
ATOM   4723 O O   . THR D 4  65  ? 38.170 -35.512 50.632  1.00 49.55  ? 64  THR U O   1 
ATOM   4724 C CB  . THR D 4  65  ? 39.089 -33.647 52.890  1.00 44.04  ? 64  THR U CB  1 
ATOM   4725 O OG1 . THR D 4  65  ? 40.110 -32.822 53.459  1.00 43.66  ? 64  THR U OG1 1 
ATOM   4726 C CG2 . THR D 4  65  ? 38.053 -33.943 53.953  1.00 36.92  ? 64  THR U CG2 1 
ATOM   4727 N N   . SER D 4  66  ? 38.311 -36.924 52.374  1.00 46.92  ? 65  SER U N   1 
ATOM   4728 C CA  . SER D 4  66  ? 37.309 -37.840 51.844  1.00 45.77  ? 65  SER U CA  1 
ATOM   4729 C C   . SER D 4  66  ? 36.152 -38.056 52.808  1.00 45.50  ? 65  SER U C   1 
ATOM   4730 O O   . SER D 4  66  ? 36.277 -38.771 53.800  1.00 44.97  ? 65  SER U O   1 
ATOM   4731 C CB  . SER D 4  66  ? 37.949 -39.188 51.515  1.00 46.19  ? 65  SER U CB  1 
ATOM   4732 O OG  . SER D 4  66  ? 39.033 -39.023 50.618  1.00 49.04  ? 65  SER U OG  1 
ATOM   4733 N N   . LEU D 4  67  ? 35.023 -37.428 52.507  1.00 44.13  ? 66  LEU U N   1 
ATOM   4734 C CA  . LEU D 4  67  ? 33.829 -37.561 53.323  1.00 42.91  ? 66  LEU U CA  1 
ATOM   4735 C C   . LEU D 4  67  ? 32.954 -38.647 52.691  1.00 42.24  ? 66  LEU U C   1 
ATOM   4736 O O   . LEU D 4  67  ? 32.915 -38.794 51.476  1.00 43.29  ? 66  LEU U O   1 
ATOM   4737 C CB  . LEU D 4  67  ? 33.083 -36.223 53.373  1.00 41.34  ? 66  LEU U CB  1 
ATOM   4738 C CG  . LEU D 4  67  ? 33.948 -35.025 53.783  1.00 42.28  ? 66  LEU U CG  1 
ATOM   4739 C CD1 . LEU D 4  67  ? 33.140 -33.739 53.765  1.00 44.33  ? 66  LEU U CD1 1 
ATOM   4740 C CD2 . LEU D 4  67  ? 34.504 -35.267 55.165  1.00 45.91  ? 66  LEU U CD2 1 
ATOM   4741 N N   . THR D 4  68  ? 32.273 -39.429 53.516  1.00 42.16  ? 67  THR U N   1 
ATOM   4742 C CA  . THR D 4  68  ? 31.414 -40.487 53.006  1.00 41.23  ? 67  THR U CA  1 
ATOM   4743 C C   . THR D 4  68  ? 30.398 -40.915 54.063  1.00 41.00  ? 67  THR U C   1 
ATOM   4744 O O   . THR D 4  68  ? 30.757 -41.179 55.206  1.00 44.45  ? 67  THR U O   1 
ATOM   4745 C CB  . THR D 4  68  ? 32.240 -41.726 52.537  1.00 40.98  ? 67  THR U CB  1 
ATOM   4746 O OG1 . THR D 4  68  ? 31.589 -42.919 52.982  1.00 39.73  ? 67  THR U OG1 1 
ATOM   4747 C CG2 . THR D 4  68  ? 33.671 -41.686 53.065  1.00 41.82  ? 67  THR U CG2 1 
ATOM   4748 N N   . GLU D 4  69  ? 29.127 -40.967 53.678  1.00 39.48  ? 68  GLU U N   1 
ATOM   4749 C CA  . GLU D 4  69  ? 28.068 -41.345 54.599  1.00 39.48  ? 68  GLU U CA  1 
ATOM   4750 C C   . GLU D 4  69  ? 27.205 -42.463 54.044  1.00 41.17  ? 68  GLU U C   1 
ATOM   4751 O O   . GLU D 4  69  ? 26.685 -42.367 52.939  1.00 42.54  ? 68  GLU U O   1 
ATOM   4752 C CB  . GLU D 4  69  ? 27.199 -40.127 54.914  1.00 40.81  ? 68  GLU U CB  1 
ATOM   4753 C CG  . GLU D 4  69  ? 26.055 -40.389 55.875  1.00 45.18  ? 68  GLU U CG  1 
ATOM   4754 C CD  . GLU D 4  69  ? 25.525 -39.108 56.510  1.00 49.52  ? 68  GLU U CD  1 
ATOM   4755 O OE1 . GLU D 4  69  ? 26.315 -38.389 57.166  1.00 50.77  ? 68  GLU U OE1 1 
ATOM   4756 O OE2 . GLU D 4  69  ? 24.317 -38.820 56.356  1.00 50.40  ? 68  GLU U OE2 1 
ATOM   4757 N N   . VAL D 4  70  ? 27.073 -43.537 54.811  1.00 41.38  ? 69  VAL U N   1 
ATOM   4758 C CA  . VAL D 4  70  ? 26.251 -44.670 54.404  1.00 41.36  ? 69  VAL U CA  1 
ATOM   4759 C C   . VAL D 4  70  ? 25.072 -44.774 55.365  1.00 41.07  ? 69  VAL U C   1 
ATOM   4760 O O   . VAL D 4  70  ? 25.196 -44.459 56.554  1.00 40.98  ? 69  VAL U O   1 
ATOM   4761 C CB  . VAL D 4  70  ? 27.055 -45.987 54.413  1.00 41.96  ? 69  VAL U CB  1 
ATOM   4762 C CG1 . VAL D 4  70  ? 28.150 -45.924 53.371  1.00 42.77  ? 69  VAL U CG1 1 
ATOM   4763 C CG2 . VAL D 4  70  ? 27.666 -46.215 55.772  1.00 45.08  ? 69  VAL U CG2 1 
ATOM   4764 N N   . VAL D 4  71  ? 23.926 -45.200 54.847  1.00 39.78  ? 70  VAL U N   1 
ATOM   4765 C CA  . VAL D 4  71  ? 22.727 -45.311 55.660  1.00 41.91  ? 70  VAL U CA  1 
ATOM   4766 C C   . VAL D 4  71  ? 22.064 -46.674 55.507  1.00 43.17  ? 70  VAL U C   1 
ATOM   4767 O O   . VAL D 4  71  ? 22.310 -47.384 54.536  1.00 43.90  ? 70  VAL U O   1 
ATOM   4768 C CB  . VAL D 4  71  ? 21.729 -44.197 55.287  1.00 42.03  ? 70  VAL U CB  1 
ATOM   4769 C CG1 . VAL D 4  71  ? 20.398 -44.424 55.982  1.00 50.45  ? 70  VAL U CG1 1 
ATOM   4770 C CG2 . VAL D 4  71  ? 22.304 -42.845 55.687  1.00 39.59  ? 70  VAL U CG2 1 
ATOM   4771 N N   . CYS D 4  72  ? 21.233 -47.035 56.479  1.00 42.79  ? 71  CYS U N   1 
ATOM   4772 C CA  . CYS D 4  72  ? 20.535 -48.313 56.468  1.00 42.71  ? 71  CYS U CA  1 
ATOM   4773 C C   . CYS D 4  72  ? 19.391 -48.249 57.474  1.00 41.73  ? 71  CYS U C   1 
ATOM   4774 O O   . CYS D 4  72  ? 19.447 -47.483 58.432  1.00 41.01  ? 71  CYS U O   1 
ATOM   4775 C CB  . CYS D 4  72  ? 21.515 -49.436 56.819  1.00 46.17  ? 71  CYS U CB  1 
ATOM   4776 S SG  . CYS D 4  72  ? 22.477 -49.149 58.343  1.00 50.03  ? 71  CYS U SG  1 
ATOM   4777 N N   . GLY D 4  73  ? 18.354 -49.053 57.258  1.00 42.11  ? 72  GLY U N   1 
ATOM   4778 C CA  . GLY D 4  73  ? 17.209 -49.020 58.155  1.00 43.18  ? 72  GLY U CA  1 
ATOM   4779 C C   . GLY D 4  73  ? 16.912 -50.277 58.954  1.00 44.20  ? 72  GLY U C   1 
ATOM   4780 O O   . GLY D 4  73  ? 15.752 -50.597 59.222  1.00 44.99  ? 72  GLY U O   1 
ATOM   4781 N N   . LEU D 4  74  ? 17.958 -50.996 59.340  1.00 46.19  ? 73  LEU U N   1 
ATOM   4782 C CA  . LEU D 4  74  ? 17.790 -52.208 60.132  1.00 45.55  ? 73  LEU U CA  1 
ATOM   4783 C C   . LEU D 4  74  ? 18.499 -52.036 61.469  1.00 43.99  ? 73  LEU U C   1 
ATOM   4784 O O   . LEU D 4  74  ? 19.501 -51.318 61.569  1.00 40.86  ? 73  LEU U O   1 
ATOM   4785 C CB  . LEU D 4  74  ? 18.356 -53.422 59.389  1.00 46.17  ? 73  LEU U CB  1 
ATOM   4786 C CG  . LEU D 4  74  ? 17.601 -53.838 58.124  1.00 43.71  ? 73  LEU U CG  1 
ATOM   4787 C CD1 . LEU D 4  74  ? 18.326 -54.984 57.436  1.00 42.50  ? 73  LEU U CD1 1 
ATOM   4788 C CD2 . LEU D 4  74  ? 16.181 -54.240 58.496  1.00 44.73  ? 73  LEU U CD2 1 
ATOM   4789 N N   . ASP D 4  75  ? 17.969 -52.699 62.491  1.00 44.14  ? 74  ASP U N   1 
ATOM   4790 C CA  . ASP D 4  75  ? 18.525 -52.632 63.837  1.00 43.75  ? 74  ASP U CA  1 
ATOM   4791 C C   . ASP D 4  75  ? 20.050 -52.802 63.884  1.00 42.15  ? 74  ASP U C   1 
ATOM   4792 O O   . ASP D 4  75  ? 20.595 -53.804 63.411  1.00 42.60  ? 74  ASP U O   1 
ATOM   4793 C CB  . ASP D 4  75  ? 17.846 -53.685 64.713  1.00 45.20  ? 74  ASP U CB  1 
ATOM   4794 C CG  . ASP D 4  75  ? 18.175 -53.523 66.174  1.00 45.93  ? 74  ASP U CG  1 
ATOM   4795 O OD1 . ASP D 4  75  ? 19.156 -54.143 66.636  1.00 49.82  ? 74  ASP U OD1 1 
ATOM   4796 O OD2 . ASP D 4  75  ? 17.455 -52.763 66.858  1.00 47.07  ? 74  ASP U OD2 1 
ATOM   4797 N N   . LEU D 4  76  ? 20.719 -51.801 64.453  1.00 40.78  ? 75  LEU U N   1 
ATOM   4798 C CA  . LEU D 4  76  ? 22.179 -51.767 64.603  1.00 40.38  ? 75  LEU U CA  1 
ATOM   4799 C C   . LEU D 4  76  ? 22.985 -52.045 63.336  1.00 40.25  ? 75  LEU U C   1 
ATOM   4800 O O   . LEU D 4  76  ? 24.174 -52.369 63.417  1.00 38.54  ? 75  LEU U O   1 
ATOM   4801 C CB  . LEU D 4  76  ? 22.632 -52.735 65.703  1.00 37.22  ? 75  LEU U CB  1 
ATOM   4802 C CG  . LEU D 4  76  ? 21.860 -52.658 67.021  1.00 35.94  ? 75  LEU U CG  1 
ATOM   4803 C CD1 . LEU D 4  76  ? 22.533 -53.554 68.045  1.00 33.45  ? 75  LEU U CD1 1 
ATOM   4804 C CD2 . LEU D 4  76  ? 21.797 -51.223 67.512  1.00 33.98  ? 75  LEU U CD2 1 
ATOM   4805 N N   . CYS D 4  77  ? 22.351 -51.912 62.172  1.00 41.63  ? 76  CYS U N   1 
ATOM   4806 C CA  . CYS D 4  77  ? 23.039 -52.133 60.898  1.00 42.30  ? 76  CYS U CA  1 
ATOM   4807 C C   . CYS D 4  77  ? 24.261 -51.209 60.875  1.00 42.29  ? 76  CYS U C   1 
ATOM   4808 O O   . CYS D 4  77  ? 25.192 -51.371 60.094  1.00 43.63  ? 76  CYS U O   1 
ATOM   4809 C CB  . CYS D 4  77  ? 22.088 -51.808 59.741  1.00 43.68  ? 76  CYS U CB  1 
ATOM   4810 S SG  . CYS D 4  77  ? 21.394 -50.118 59.768  1.00 51.12  ? 76  CYS U SG  1 
ATOM   4811 N N   . ASN D 4  78  ? 24.221 -50.254 61.793  1.00 42.83  ? 77  ASN U N   1 
ATOM   4812 C CA  . ASN D 4  78  ? 25.216 -49.215 62.036  1.00 42.16  ? 77  ASN U CA  1 
ATOM   4813 C C   . ASN D 4  78  ? 26.594 -49.736 62.491  1.00 40.60  ? 77  ASN U C   1 
ATOM   4814 O O   . ASN D 4  78  ? 27.631 -49.166 62.160  1.00 34.74  ? 77  ASN U O   1 
ATOM   4815 C CB  . ASN D 4  78  ? 24.647 -48.316 63.138  1.00 44.47  ? 77  ASN U CB  1 
ATOM   4816 C CG  . ASN D 4  78  ? 25.003 -46.885 62.957  1.00 50.07  ? 77  ASN U CG  1 
ATOM   4817 O OD1 . ASN D 4  78  ? 26.146 -46.552 62.672  1.00 58.85  ? 77  ASN U OD1 1 
ATOM   4818 N ND2 . ASN D 4  78  ? 24.026 -46.011 63.136  1.00 48.04  ? 77  ASN U ND2 1 
ATOM   4819 N N   . GLN D 4  79  ? 26.577 -50.814 63.270  1.00 39.46  ? 78  GLN U N   1 
ATOM   4820 C CA  . GLN D 4  79  ? 27.777 -51.414 63.860  1.00 39.20  ? 78  GLN U CA  1 
ATOM   4821 C C   . GLN D 4  79  ? 28.895 -51.898 62.929  1.00 38.70  ? 78  GLN U C   1 
ATOM   4822 O O   . GLN D 4  79  ? 30.078 -51.689 63.216  1.00 36.97  ? 78  GLN U O   1 
ATOM   4823 C CB  . GLN D 4  79  ? 27.353 -52.568 64.780  1.00 39.64  ? 78  GLN U CB  1 
ATOM   4824 C CG  . GLN D 4  79  ? 28.424 -53.033 65.759  1.00 40.87  ? 78  GLN U CG  1 
ATOM   4825 C CD  . GLN D 4  79  ? 27.927 -54.127 66.699  1.00 41.51  ? 78  GLN U CD  1 
ATOM   4826 O OE1 . GLN D 4  79  ? 28.643 -54.554 67.604  1.00 39.05  ? 78  GLN U OE1 1 
ATOM   4827 N NE2 . GLN D 4  79  ? 26.695 -54.586 66.483  1.00 43.40  ? 78  GLN U NE2 1 
ATOM   4828 N N   . GLY D 4  80  ? 28.530 -52.557 61.834  1.00 38.80  ? 79  GLY U N   1 
ATOM   4829 C CA  . GLY D 4  80  ? 29.533 -53.062 60.913  1.00 40.62  ? 79  GLY U CA  1 
ATOM   4830 C C   . GLY D 4  80  ? 30.434 -51.989 60.331  1.00 43.45  ? 79  GLY U C   1 
ATOM   4831 O O   . GLY D 4  80  ? 30.079 -50.810 60.328  1.00 45.13  ? 79  GLY U O   1 
ATOM   4832 N N   . ASN D 4  81  ? 31.604 -52.394 59.842  1.00 44.86  ? 80  ASN U N   1 
ATOM   4833 C CA  . ASN D 4  81  ? 32.552 -51.461 59.242  1.00 45.01  ? 80  ASN U CA  1 
ATOM   4834 C C   . ASN D 4  81  ? 32.259 -51.331 57.747  1.00 46.98  ? 80  ASN U C   1 
ATOM   4835 O O   . ASN D 4  81  ? 32.226 -50.229 57.195  1.00 49.35  ? 80  ASN U O   1 
ATOM   4836 C CB  . ASN D 4  81  ? 33.992 -51.953 59.440  1.00 47.36  ? 80  ASN U CB  1 
ATOM   4837 C CG  . ASN D 4  81  ? 34.422 -51.951 60.903  1.00 48.64  ? 80  ASN U CG  1 
ATOM   4838 O OD1 . ASN D 4  81  ? 34.103 -51.026 61.647  1.00 50.70  ? 80  ASN U OD1 1 
ATOM   4839 N ND2 . ASN D 4  81  ? 35.167 -52.977 61.312  1.00 48.23  ? 80  ASN U ND2 1 
ATOM   4840 N N   . TYR D 4  93  ? 37.249 -44.567 36.180  1.00 72.54  ? 92  TYR U N   1 
ATOM   4841 C CA  . TYR D 4  93  ? 38.052 -43.448 36.662  1.00 71.97  ? 92  TYR U CA  1 
ATOM   4842 C C   . TYR D 4  93  ? 37.716 -42.125 35.968  1.00 68.95  ? 92  TYR U C   1 
ATOM   4843 O O   . TYR D 4  93  ? 38.358 -41.759 34.981  1.00 68.78  ? 92  TYR U O   1 
ATOM   4844 C CB  . TYR D 4  93  ? 39.551 -43.728 36.467  1.00 76.12  ? 92  TYR U CB  1 
ATOM   4845 C CG  . TYR D 4  93  ? 40.113 -44.876 37.279  1.00 82.44  ? 92  TYR U CG  1 
ATOM   4846 C CD1 . TYR D 4  93  ? 40.008 -46.195 36.830  1.00 87.07  ? 92  TYR U CD1 1 
ATOM   4847 C CD2 . TYR D 4  93  ? 40.761 -44.644 38.495  1.00 84.02  ? 92  TYR U CD2 1 
ATOM   4848 C CE1 . TYR D 4  93  ? 40.538 -47.259 37.573  1.00 89.06  ? 92  TYR U CE1 1 
ATOM   4849 C CE2 . TYR D 4  93  ? 41.293 -45.698 39.247  1.00 87.06  ? 92  TYR U CE2 1 
ATOM   4850 C CZ  . TYR D 4  93  ? 41.179 -47.001 38.779  1.00 88.78  ? 92  TYR U CZ  1 
ATOM   4851 O OH  . TYR D 4  93  ? 41.705 -48.042 39.515  1.00 90.04  ? 92  TYR U OH  1 
ATOM   4852 N N   . LEU D 4  94  ? 36.716 -41.409 36.476  1.00 63.97  ? 93  LEU U N   1 
ATOM   4853 C CA  . LEU D 4  94  ? 36.348 -40.117 35.898  1.00 58.88  ? 93  LEU U CA  1 
ATOM   4854 C C   . LEU D 4  94  ? 37.243 -39.072 36.556  1.00 56.99  ? 93  LEU U C   1 
ATOM   4855 O O   . LEU D 4  94  ? 37.350 -39.018 37.779  1.00 56.90  ? 93  LEU U O   1 
ATOM   4856 C CB  . LEU D 4  94  ? 34.885 -39.780 36.198  1.00 58.13  ? 93  LEU U CB  1 
ATOM   4857 C CG  . LEU D 4  94  ? 34.159 -38.737 35.337  1.00 56.44  ? 93  LEU U CG  1 
ATOM   4858 C CD1 . LEU D 4  94  ? 32.860 -38.356 36.035  1.00 56.80  ? 93  LEU U CD1 1 
ATOM   4859 C CD2 . LEU D 4  94  ? 35.013 -37.506 35.123  1.00 56.12  ? 93  LEU U CD2 1 
ATOM   4860 N N   . GLU D 4  95  ? 37.888 -38.243 35.748  1.00 55.22  ? 94  GLU U N   1 
ATOM   4861 C CA  . GLU D 4  95  ? 38.762 -37.216 36.285  1.00 54.71  ? 94  GLU U CA  1 
ATOM   4862 C C   . GLU D 4  95  ? 38.029 -35.894 36.469  1.00 52.54  ? 94  GLU U C   1 
ATOM   4863 O O   . GLU D 4  95  ? 37.327 -35.433 35.573  1.00 53.64  ? 94  GLU U O   1 
ATOM   4864 C CB  . GLU D 4  95  ? 39.959 -37.016 35.363  1.00 58.02  ? 94  GLU U CB  1 
ATOM   4865 C CG  . GLU D 4  95  ? 40.851 -35.869 35.767  1.00 66.14  ? 94  GLU U CG  1 
ATOM   4866 C CD  . GLU D 4  95  ? 42.119 -35.820 34.950  1.00 71.66  ? 94  GLU U CD  1 
ATOM   4867 O OE1 . GLU D 4  95  ? 42.896 -36.797 35.005  1.00 76.04  ? 94  GLU U OE1 1 
ATOM   4868 O OE2 . GLU D 4  95  ? 42.341 -34.809 34.252  1.00 74.00  ? 94  GLU U OE2 1 
ATOM   4869 N N   . CYS D 4  96  ? 38.197 -35.285 37.636  1.00 48.25  ? 95  CYS U N   1 
ATOM   4870 C CA  . CYS D 4  96  ? 37.551 -34.018 37.918  1.00 46.47  ? 95  CYS U CA  1 
ATOM   4871 C C   . CYS D 4  96  ? 38.552 -32.980 38.348  1.00 44.37  ? 95  CYS U C   1 
ATOM   4872 O O   . CYS D 4  96  ? 39.742 -33.254 38.464  1.00 44.66  ? 95  CYS U O   1 
ATOM   4873 C CB  . CYS D 4  96  ? 36.527 -34.172 39.034  1.00 47.52  ? 95  CYS U CB  1 
ATOM   4874 S SG  . CYS D 4  96  ? 35.218 -35.365 38.663  1.00 50.84  ? 95  CYS U SG  1 
ATOM   4875 N N   . ILE D 4  97  ? 38.046 -31.776 38.572  1.00 42.69  ? 96  ILE U N   1 
ATOM   4876 C CA  . ILE D 4  97  ? 38.862 -30.680 39.051  1.00 42.14  ? 96  ILE U CA  1 
ATOM   4877 C C   . ILE D 4  97  ? 38.516 -30.617 40.530  1.00 41.54  ? 96  ILE U C   1 
ATOM   4878 O O   . ILE D 4  97  ? 37.380 -30.908 40.911  1.00 40.05  ? 96  ILE U O   1 
ATOM   4879 C CB  . ILE D 4  97  ? 38.483 -29.352 38.370  1.00 42.09  ? 96  ILE U CB  1 
ATOM   4880 C CG1 . ILE D 4  97  ? 38.962 -29.368 36.911  1.00 44.88  ? 96  ILE U CG1 1 
ATOM   4881 C CG2 . ILE D 4  97  ? 39.078 -28.179 39.147  1.00 39.63  ? 96  ILE U CG2 1 
ATOM   4882 C CD1 . ILE D 4  97  ? 40.475 -29.521 36.750  1.00 40.68  ? 96  ILE U CD1 1 
ATOM   4883 N N   . SER D 4  98  ? 39.489 -30.254 41.360  1.00 41.31  ? 97  SER U N   1 
ATOM   4884 C CA  . SER D 4  98  ? 39.264 -30.180 42.801  1.00 40.65  ? 97  SER U CA  1 
ATOM   4885 C C   . SER D 4  98  ? 39.994 -29.009 43.467  1.00 37.22  ? 97  SER U C   1 
ATOM   4886 O O   . SER D 4  98  ? 41.108 -28.669 43.087  1.00 38.93  ? 97  SER U O   1 
ATOM   4887 C CB  . SER D 4  98  ? 39.704 -31.500 43.441  1.00 41.89  ? 97  SER U CB  1 
ATOM   4888 O OG  . SER D 4  98  ? 39.289 -31.577 44.791  1.00 44.26  ? 97  SER U OG  1 
ATOM   4889 N N   . CYS D 4  99  ? 39.349 -28.390 44.450  1.00 35.72  ? 98  CYS U N   1 
ATOM   4890 C CA  . CYS D 4  99  ? 39.931 -27.277 45.204  1.00 36.74  ? 98  CYS U CA  1 
ATOM   4891 C C   . CYS D 4  99  ? 39.105 -27.093 46.475  1.00 35.51  ? 98  CYS U C   1 
ATOM   4892 O O   . CYS D 4  99  ? 38.098 -27.780 46.669  1.00 36.75  ? 98  CYS U O   1 
ATOM   4893 C CB  . CYS D 4  99  ? 39.923 -25.978 44.388  1.00 41.17  ? 98  CYS U CB  1 
ATOM   4894 S SG  . CYS D 4  99  ? 38.264 -25.388 43.936  1.00 47.18  ? 98  CYS U SG  1 
ATOM   4895 N N   . GLY D 4  100 ? 39.520 -26.174 47.340  1.00 34.32  ? 99  GLY U N   1 
ATOM   4896 C CA  . GLY D 4  100 ? 38.777 -25.956 48.567  1.00 34.74  ? 99  GLY U CA  1 
ATOM   4897 C C   . GLY D 4  100 ? 38.980 -24.591 49.186  1.00 36.58  ? 99  GLY U C   1 
ATOM   4898 O O   . GLY D 4  100 ? 40.012 -23.955 48.998  1.00 37.63  ? 99  GLY U O   1 
ATOM   4899 N N   . SER D 4  101 ? 37.987 -24.144 49.944  1.00 40.05  ? 100 SER U N   1 
ATOM   4900 C CA  . SER D 4  101 ? 38.048 -22.842 50.595  1.00 43.89  ? 100 SER U CA  1 
ATOM   4901 C C   . SER D 4  101 ? 38.952 -22.823 51.820  1.00 46.33  ? 100 SER U C   1 
ATOM   4902 O O   . SER D 4  101 ? 39.502 -21.782 52.168  1.00 47.18  ? 100 SER U O   1 
ATOM   4903 C CB  . SER D 4  101 ? 36.644 -22.389 51.006  1.00 43.82  ? 100 SER U CB  1 
ATOM   4904 O OG  . SER D 4  101 ? 35.821 -22.209 49.868  1.00 49.85  ? 100 SER U OG  1 
ATOM   4905 N N   . SER D 4  102 ? 39.102 -23.968 52.477  1.00 49.14  ? 101 SER U N   1 
ATOM   4906 C CA  . SER D 4  102 ? 39.932 -24.041 53.677  1.00 51.64  ? 101 SER U CA  1 
ATOM   4907 C C   . SER D 4  102 ? 41.301 -23.390 53.471  1.00 51.36  ? 101 SER U C   1 
ATOM   4908 O O   . SER D 4  102 ? 41.761 -22.612 54.314  1.00 51.43  ? 101 SER U O   1 
ATOM   4909 C CB  . SER D 4  102 ? 40.105 -25.500 54.121  1.00 51.85  ? 101 SER U CB  1 
ATOM   4910 O OG  . SER D 4  102 ? 40.784 -26.262 53.137  1.00 57.30  ? 101 SER U OG  1 
ATOM   4911 N N   . ASP D 4  103 ? 41.939 -23.693 52.344  1.00 50.55  ? 102 ASP U N   1 
ATOM   4912 C CA  . ASP D 4  103 ? 43.253 -23.138 52.046  1.00 51.79  ? 102 ASP U CA  1 
ATOM   4913 C C   . ASP D 4  103 ? 43.211 -22.148 50.889  1.00 52.06  ? 102 ASP U C   1 
ATOM   4914 O O   . ASP D 4  103 ? 44.216 -21.933 50.220  1.00 53.46  ? 102 ASP U O   1 
ATOM   4915 C CB  . ASP D 4  103 ? 44.222 -24.263 51.702  1.00 52.10  ? 102 ASP U CB  1 
ATOM   4916 C CG  . ASP D 4  103 ? 44.014 -24.792 50.303  1.00 52.38  ? 102 ASP U CG  1 
ATOM   4917 O OD1 . ASP D 4  103 ? 42.876 -24.676 49.803  1.00 53.21  ? 102 ASP U OD1 1 
ATOM   4918 O OD2 . ASP D 4  103 ? 44.978 -25.328 49.709  1.00 53.62  ? 102 ASP U OD2 1 
ATOM   4919 N N   . MET D 4  104 ? 42.052 -21.548 50.650  1.00 53.49  ? 103 MET U N   1 
ATOM   4920 C CA  . MET D 4  104 ? 41.917 -20.586 49.566  1.00 54.23  ? 103 MET U CA  1 
ATOM   4921 C C   . MET D 4  104 ? 42.389 -21.206 48.259  1.00 54.32  ? 103 MET U C   1 
ATOM   4922 O O   . MET D 4  104 ? 43.005 -20.549 47.422  1.00 55.02  ? 103 MET U O   1 
ATOM   4923 C CB  . MET D 4  104 ? 42.732 -19.338 49.881  1.00 56.60  ? 103 MET U CB  1 
ATOM   4924 C CG  . MET D 4  104 ? 42.163 -18.527 51.023  1.00 62.20  ? 103 MET U CG  1 
ATOM   4925 S SD  . MET D 4  104 ? 40.517 -17.907 50.612  1.00 72.57  ? 103 MET U SD  1 
ATOM   4926 C CE  . MET D 4  104 ? 39.460 -18.910 51.673  1.00 69.74  ? 103 MET U CE  1 
ATOM   4927 N N   . SER D 4  105 ? 42.101 -22.492 48.106  1.00 54.10  ? 104 SER U N   1 
ATOM   4928 C CA  . SER D 4  105 ? 42.466 -23.240 46.911  1.00 52.37  ? 104 SER U CA  1 
ATOM   4929 C C   . SER D 4  105 ? 41.625 -22.774 45.723  1.00 50.04  ? 104 SER U C   1 
ATOM   4930 O O   . SER D 4  105 ? 42.149 -22.472 44.650  1.00 48.88  ? 104 SER U O   1 
ATOM   4931 C CB  . SER D 4  105 ? 42.230 -24.734 47.154  1.00 51.77  ? 104 SER U CB  1 
ATOM   4932 O OG  . SER D 4  105 ? 42.467 -25.492 45.985  1.00 60.44  ? 104 SER U OG  1 
ATOM   4933 N N   . CYS D 4  106 ? 40.314 -22.725 45.928  1.00 48.73  ? 105 CYS U N   1 
ATOM   4934 C CA  . CYS D 4  106 ? 39.394 -22.305 44.885  1.00 50.31  ? 105 CYS U CA  1 
ATOM   4935 C C   . CYS D 4  106 ? 39.485 -20.812 44.608  1.00 50.62  ? 105 CYS U C   1 
ATOM   4936 O O   . CYS D 4  106 ? 39.692 -20.398 43.472  1.00 51.77  ? 105 CYS U O   1 
ATOM   4937 C CB  . CYS D 4  106 ? 37.960 -22.635 45.276  1.00 49.28  ? 105 CYS U CB  1 
ATOM   4938 S SG  . CYS D 4  106 ? 37.602 -24.390 45.584  1.00 59.69  ? 105 CYS U SG  1 
ATOM   4939 N N   . GLU D 4  107 ? 39.316 -20.010 45.652  1.00 49.67  ? 106 GLU U N   1 
ATOM   4940 C CA  . GLU D 4  107 ? 39.359 -18.567 45.520  1.00 50.36  ? 106 GLU U CA  1 
ATOM   4941 C C   . GLU D 4  107 ? 40.633 -18.072 44.855  1.00 48.71  ? 106 GLU U C   1 
ATOM   4942 O O   . GLU D 4  107 ? 40.669 -16.954 44.344  1.00 49.42  ? 106 GLU U O   1 
ATOM   4943 C CB  . GLU D 4  107 ? 39.201 -17.907 46.893  1.00 57.36  ? 106 GLU U CB  1 
ATOM   4944 C CG  . GLU D 4  107 ? 37.841 -18.143 47.550  1.00 71.10  ? 106 GLU U CG  1 
ATOM   4945 C CD  . GLU D 4  107 ? 37.754 -19.457 48.317  1.00 78.08  ? 106 GLU U CD  1 
ATOM   4946 O OE1 . GLU D 4  107 ? 38.354 -20.460 47.872  1.00 82.43  ? 106 GLU U OE1 1 
ATOM   4947 O OE2 . GLU D 4  107 ? 37.069 -19.484 49.363  1.00 77.33  ? 106 GLU U OE2 1 
ATOM   4948 N N   . ARG D 4  108 ? 41.672 -18.903 44.853  1.00 45.67  ? 107 ARG U N   1 
ATOM   4949 C CA  . ARG D 4  108 ? 42.956 -18.532 44.251  1.00 43.86  ? 107 ARG U CA  1 
ATOM   4950 C C   . ARG D 4  108 ? 43.247 -19.193 42.907  1.00 42.26  ? 107 ARG U C   1 
ATOM   4951 O O   . ARG D 4  108 ? 44.347 -19.078 42.376  1.00 43.65  ? 107 ARG U O   1 
ATOM   4952 C CB  . ARG D 4  108 ? 44.100 -18.854 45.208  1.00 45.07  ? 107 ARG U CB  1 
ATOM   4953 C CG  . ARG D 4  108 ? 44.238 -17.899 46.371  1.00 45.69  ? 107 ARG U CG  1 
ATOM   4954 C CD  . ARG D 4  108 ? 45.226 -18.474 47.356  1.00 51.14  ? 107 ARG U CD  1 
ATOM   4955 N NE  . ARG D 4  108 ? 45.791 -17.468 48.243  1.00 51.44  ? 107 ARG U NE  1 
ATOM   4956 C CZ  . ARG D 4  108 ? 46.786 -17.715 49.086  1.00 52.47  ? 107 ARG U CZ  1 
ATOM   4957 N NH1 . ARG D 4  108 ? 47.311 -18.932 49.148  1.00 50.10  ? 107 ARG U NH1 1 
ATOM   4958 N NH2 . ARG D 4  108 ? 47.267 -16.746 49.851  1.00 53.94  ? 107 ARG U NH2 1 
ATOM   4959 N N   . GLY D 4  109 ? 42.268 -19.902 42.367  1.00 44.00  ? 108 GLY U N   1 
ATOM   4960 C CA  . GLY D 4  109 ? 42.462 -20.540 41.084  1.00 41.99  ? 108 GLY U CA  1 
ATOM   4961 C C   . GLY D 4  109 ? 43.541 -21.597 41.075  1.00 42.45  ? 108 GLY U C   1 
ATOM   4962 O O   . GLY D 4  109 ? 44.057 -21.953 40.015  1.00 42.80  ? 108 GLY U O   1 
ATOM   4963 N N   . ARG D 4  110 ? 43.893 -22.102 42.250  1.00 43.87  ? 109 ARG U N   1 
ATOM   4964 C CA  . ARG D 4  110 ? 44.902 -23.145 42.324  1.00 44.68  ? 109 ARG U CA  1 
ATOM   4965 C C   . ARG D 4  110 ? 44.177 -24.480 42.345  1.00 44.52  ? 109 ARG U C   1 
ATOM   4966 O O   . ARG D 4  110 ? 44.283 -25.246 43.298  1.00 46.61  ? 109 ARG U O   1 
ATOM   4967 C CB  . ARG D 4  110 ? 45.749 -22.982 43.582  1.00 45.32  ? 109 ARG U CB  1 
ATOM   4968 C CG  . ARG D 4  110 ? 46.444 -21.640 43.672  1.00 47.50  ? 109 ARG U CG  1 
ATOM   4969 C CD  . ARG D 4  110 ? 47.426 -21.613 44.825  1.00 50.09  ? 109 ARG U CD  1 
ATOM   4970 N NE  . ARG D 4  110 ? 47.908 -20.262 45.101  1.00 51.87  ? 109 ARG U NE  1 
ATOM   4971 C CZ  . ARG D 4  110 ? 48.800 -19.966 46.042  1.00 53.37  ? 109 ARG U CZ  1 
ATOM   4972 N NH1 . ARG D 4  110 ? 49.311 -20.927 46.797  1.00 56.65  ? 109 ARG U NH1 1 
ATOM   4973 N NH2 . ARG D 4  110 ? 49.171 -18.707 46.238  1.00 55.32  ? 109 ARG U NH2 1 
ATOM   4974 N N   . HIS D 4  111 ? 43.432 -24.750 41.280  1.00 44.29  ? 110 HIS U N   1 
ATOM   4975 C CA  . HIS D 4  111 ? 42.665 -25.982 41.172  1.00 42.11  ? 110 HIS U CA  1 
ATOM   4976 C C   . HIS D 4  111 ? 43.533 -27.119 40.682  1.00 42.28  ? 110 HIS U C   1 
ATOM   4977 O O   . HIS D 4  111 ? 44.450 -26.917 39.893  1.00 41.87  ? 110 HIS U O   1 
ATOM   4978 C CB  . HIS D 4  111 ? 41.491 -25.783 40.220  1.00 39.59  ? 110 HIS U CB  1 
ATOM   4979 C CG  . HIS D 4  111 ? 40.670 -24.574 40.531  1.00 37.68  ? 110 HIS U CG  1 
ATOM   4980 N ND1 . HIS D 4  111 ? 39.683 -24.110 39.690  1.00 39.15  ? 110 HIS U ND1 1 
ATOM   4981 C CD2 . HIS D 4  111 ? 40.709 -23.716 41.577  1.00 40.07  ? 110 HIS U CD2 1 
ATOM   4982 C CE1 . HIS D 4  111 ? 39.152 -23.014 40.203  1.00 40.71  ? 110 HIS U CE1 1 
ATOM   4983 N NE2 . HIS D 4  111 ? 39.757 -22.753 41.347  1.00 42.53  ? 110 HIS U NE2 1 
ATOM   4984 N N   . GLN D 4  112 ? 43.227 -28.320 41.154  1.00 44.25  ? 111 GLN U N   1 
ATOM   4985 C CA  . GLN D 4  112 ? 43.992 -29.500 40.785  1.00 46.47  ? 111 GLN U CA  1 
ATOM   4986 C C   . GLN D 4  112 ? 43.113 -30.604 40.246  1.00 46.20  ? 111 GLN U C   1 
ATOM   4987 O O   . GLN D 4  112 ? 41.904 -30.633 40.479  1.00 47.04  ? 111 GLN U O   1 
ATOM   4988 C CB  . GLN D 4  112 ? 44.751 -30.030 41.996  1.00 46.87  ? 111 GLN U CB  1 
ATOM   4989 C CG  . GLN D 4  112 ? 45.564 -28.984 42.709  1.00 47.19  ? 111 GLN U CG  1 
ATOM   4990 C CD  . GLN D 4  112 ? 46.317 -29.557 43.882  1.00 47.37  ? 111 GLN U CD  1 
ATOM   4991 O OE1 . GLN D 4  112 ? 47.191 -30.410 43.718  1.00 49.33  ? 111 GLN U OE1 1 
ATOM   4992 N NE2 . GLN D 4  112 ? 45.978 -29.098 45.079  1.00 47.09  ? 111 GLN U NE2 1 
ATOM   4993 N N   . SER D 4  113 ? 43.741 -31.526 39.534  1.00 47.46  ? 112 SER U N   1 
ATOM   4994 C CA  . SER D 4  113 ? 43.028 -32.646 38.959  1.00 50.05  ? 112 SER U CA  1 
ATOM   4995 C C   . SER D 4  113 ? 42.954 -33.771 39.994  1.00 51.37  ? 112 SER U C   1 
ATOM   4996 O O   . SER D 4  113 ? 43.936 -34.068 40.668  1.00 53.34  ? 112 SER U O   1 
ATOM   4997 C CB  . SER D 4  113 ? 43.752 -33.119 37.698  1.00 49.95  ? 112 SER U CB  1 
ATOM   4998 O OG  . SER D 4  113 ? 42.977 -34.074 36.998  1.00 54.11  ? 112 SER U OG  1 
ATOM   4999 N N   . LEU D 4  114 ? 41.778 -34.373 40.132  1.00 51.76  ? 113 LEU U N   1 
ATOM   5000 C CA  . LEU D 4  114 ? 41.567 -35.470 41.072  1.00 52.63  ? 113 LEU U CA  1 
ATOM   5001 C C   . LEU D 4  114 ? 40.764 -36.545 40.342  1.00 53.74  ? 113 LEU U C   1 
ATOM   5002 O O   . LEU D 4  114 ? 39.705 -36.264 39.790  1.00 52.15  ? 113 LEU U O   1 
ATOM   5003 C CB  . LEU D 4  114 ? 40.791 -34.972 42.299  1.00 55.14  ? 113 LEU U CB  1 
ATOM   5004 C CG  . LEU D 4  114 ? 40.538 -35.904 43.493  1.00 56.90  ? 113 LEU U CG  1 
ATOM   5005 C CD1 . LEU D 4  114 ? 39.765 -35.136 44.548  1.00 55.84  ? 113 LEU U CD1 1 
ATOM   5006 C CD2 . LEU D 4  114 ? 39.746 -37.137 43.078  1.00 58.71  ? 113 LEU U CD2 1 
ATOM   5007 N N   . GLN D 4  115 ? 41.265 -37.772 40.328  1.00 56.40  ? 114 GLN U N   1 
ATOM   5008 C CA  . GLN D 4  115 ? 40.554 -38.842 39.651  1.00 59.23  ? 114 GLN U CA  1 
ATOM   5009 C C   . GLN D 4  115 ? 39.674 -39.567 40.634  1.00 59.84  ? 114 GLN U C   1 
ATOM   5010 O O   . GLN D 4  115 ? 40.142 -40.007 41.676  1.00 60.55  ? 114 GLN U O   1 
ATOM   5011 C CB  . GLN D 4  115 ? 41.528 -39.833 39.031  1.00 63.04  ? 114 GLN U CB  1 
ATOM   5012 C CG  . GLN D 4  115 ? 42.540 -39.188 38.120  1.00 71.59  ? 114 GLN U CG  1 
ATOM   5013 C CD  . GLN D 4  115 ? 43.331 -40.206 37.336  1.00 76.83  ? 114 GLN U CD  1 
ATOM   5014 O OE1 . GLN D 4  115 ? 43.850 -41.176 37.895  1.00 79.91  ? 114 GLN U OE1 1 
ATOM   5015 N NE2 . GLN D 4  115 ? 43.435 -39.991 36.029  1.00 80.40  ? 114 GLN U NE2 1 
ATOM   5016 N N   . CYS D 4  116 ? 38.395 -39.688 40.303  1.00 61.47  ? 115 CYS U N   1 
ATOM   5017 C CA  . CYS D 4  116 ? 37.462 -40.378 41.175  1.00 63.10  ? 115 CYS U CA  1 
ATOM   5018 C C   . CYS D 4  116 ? 37.847 -41.846 41.230  1.00 65.74  ? 115 CYS U C   1 
ATOM   5019 O O   . CYS D 4  116 ? 38.481 -42.367 40.307  1.00 65.45  ? 115 CYS U O   1 
ATOM   5020 C CB  . CYS D 4  116 ? 36.029 -40.221 40.662  1.00 58.43  ? 115 CYS U CB  1 
ATOM   5021 S SG  . CYS D 4  116 ? 35.513 -38.482 40.470  1.00 53.58  ? 115 CYS U SG  1 
ATOM   5022 N N   . ARG D 4  117 ? 37.475 -42.506 42.320  1.00 68.74  ? 116 ARG U N   1 
ATOM   5023 C CA  . ARG D 4  117 ? 37.794 -43.912 42.494  1.00 72.78  ? 116 ARG U CA  1 
ATOM   5024 C C   . ARG D 4  117 ? 36.553 -44.761 42.724  1.00 72.16  ? 116 ARG U C   1 
ATOM   5025 O O   . ARG D 4  117 ? 36.556 -45.691 43.525  1.00 74.34  ? 116 ARG U O   1 
ATOM   5026 C CB  . ARG D 4  117 ? 38.802 -44.063 43.636  1.00 76.60  ? 116 ARG U CB  1 
ATOM   5027 C CG  . ARG D 4  117 ? 40.157 -43.478 43.249  1.00 85.11  ? 116 ARG U CG  1 
ATOM   5028 C CD  . ARG D 4  117 ? 41.211 -43.537 44.342  1.00 89.55  ? 116 ARG U CD  1 
ATOM   5029 N NE  . ARG D 4  117 ? 42.533 -43.192 43.810  1.00 93.84  ? 116 ARG U NE  1 
ATOM   5030 C CZ  . ARG D 4  117 ? 42.849 -42.020 43.259  1.00 95.23  ? 116 ARG U CZ  1 
ATOM   5031 N NH1 . ARG D 4  117 ? 41.943 -41.056 43.163  1.00 95.62  ? 116 ARG U NH1 1 
ATOM   5032 N NH2 . ARG D 4  117 ? 44.074 -41.813 42.791  1.00 96.55  ? 116 ARG U NH2 1 
ATOM   5033 N N   . SER D 4  118 ? 35.495 -44.425 41.994  1.00 71.18  ? 117 SER U N   1 
ATOM   5034 C CA  . SER D 4  118 ? 34.216 -45.123 42.057  1.00 71.09  ? 117 SER U CA  1 
ATOM   5035 C C   . SER D 4  118 ? 33.457 -44.756 40.789  1.00 70.97  ? 117 SER U C   1 
ATOM   5036 O O   . SER D 4  118 ? 33.216 -43.581 40.523  1.00 72.08  ? 117 SER U O   1 
ATOM   5037 C CB  . SER D 4  118 ? 33.409 -44.670 43.276  1.00 70.77  ? 117 SER U CB  1 
ATOM   5038 O OG  . SER D 4  118 ? 34.091 -44.949 44.484  1.00 74.17  ? 117 SER U OG  1 
ATOM   5039 N N   . PRO D 4  119 ? 33.074 -45.752 39.981  1.00 70.48  ? 118 PRO U N   1 
ATOM   5040 C CA  . PRO D 4  119 ? 32.344 -45.423 38.756  1.00 69.86  ? 118 PRO U CA  1 
ATOM   5041 C C   . PRO D 4  119 ? 31.030 -44.680 38.993  1.00 69.31  ? 118 PRO U C   1 
ATOM   5042 O O   . PRO D 4  119 ? 30.363 -44.273 38.039  1.00 70.91  ? 118 PRO U O   1 
ATOM   5043 C CB  . PRO D 4  119 ? 32.149 -46.787 38.093  1.00 70.00  ? 118 PRO U CB  1 
ATOM   5044 C CG  . PRO D 4  119 ? 32.126 -47.731 39.247  1.00 69.13  ? 118 PRO U CG  1 
ATOM   5045 C CD  . PRO D 4  119 ? 33.242 -47.208 40.117  1.00 70.16  ? 118 PRO U CD  1 
ATOM   5046 N N   . GLU D 4  120 ? 30.667 -44.496 40.261  1.00 67.55  ? 119 GLU U N   1 
ATOM   5047 C CA  . GLU D 4  120 ? 29.434 -43.791 40.608  1.00 66.68  ? 119 GLU U CA  1 
ATOM   5048 C C   . GLU D 4  120 ? 29.699 -42.319 40.930  1.00 65.32  ? 119 GLU U C   1 
ATOM   5049 O O   . GLU D 4  120 ? 28.787 -41.492 40.870  1.00 66.59  ? 119 GLU U O   1 
ATOM   5050 C CB  . GLU D 4  120 ? 28.745 -44.431 41.821  1.00 68.56  ? 119 GLU U CB  1 
ATOM   5051 C CG  . GLU D 4  120 ? 28.465 -45.917 41.720  1.00 72.62  ? 119 GLU U CG  1 
ATOM   5052 C CD  . GLU D 4  120 ? 29.679 -46.766 42.049  1.00 75.74  ? 119 GLU U CD  1 
ATOM   5053 O OE1 . GLU D 4  120 ? 29.526 -48.002 42.136  1.00 78.22  ? 119 GLU U OE1 1 
ATOM   5054 O OE2 . GLU D 4  120 ? 30.784 -46.202 42.219  1.00 75.84  ? 119 GLU U OE2 1 
ATOM   5055 N N   . GLU D 4  121 ? 30.941 -41.997 41.283  1.00 62.16  ? 120 GLU U N   1 
ATOM   5056 C CA  . GLU D 4  121 ? 31.306 -40.625 41.621  1.00 58.54  ? 120 GLU U CA  1 
ATOM   5057 C C   . GLU D 4  121 ? 31.377 -39.705 40.406  1.00 55.29  ? 120 GLU U C   1 
ATOM   5058 O O   . GLU D 4  121 ? 32.011 -40.020 39.397  1.00 54.44  ? 120 GLU U O   1 
ATOM   5059 C CB  . GLU D 4  121 ? 32.642 -40.597 42.365  1.00 60.60  ? 120 GLU U CB  1 
ATOM   5060 C CG  . GLU D 4  121 ? 32.593 -41.235 43.746  1.00 65.91  ? 120 GLU U CG  1 
ATOM   5061 C CD  . GLU D 4  121 ? 33.875 -41.018 44.541  1.00 69.28  ? 120 GLU U CD  1 
ATOM   5062 O OE1 . GLU D 4  121 ? 33.891 -41.357 45.744  1.00 73.51  ? 120 GLU U OE1 1 
ATOM   5063 O OE2 . GLU D 4  121 ? 34.864 -40.512 43.968  1.00 71.60  ? 120 GLU U OE2 1 
ATOM   5064 N N   . GLN D 4  122 ? 30.711 -38.563 40.519  1.00 51.04  ? 121 GLN U N   1 
ATOM   5065 C CA  . GLN D 4  122 ? 30.683 -37.577 39.454  1.00 47.78  ? 121 GLN U CA  1 
ATOM   5066 C C   . GLN D 4  122 ? 31.490 -36.369 39.889  1.00 44.77  ? 121 GLN U C   1 
ATOM   5067 O O   . GLN D 4  122 ? 31.950 -36.301 41.028  1.00 41.34  ? 121 GLN U O   1 
ATOM   5068 C CB  . GLN D 4  122 ? 29.245 -37.144 39.178  1.00 50.04  ? 121 GLN U CB  1 
ATOM   5069 C CG  . GLN D 4  122 ? 28.339 -38.246 38.666  1.00 53.01  ? 121 GLN U CG  1 
ATOM   5070 C CD  . GLN D 4  122 ? 26.951 -37.733 38.343  1.00 57.73  ? 121 GLN U CD  1 
ATOM   5071 O OE1 . GLN D 4  122 ? 26.789 -36.803 37.547  1.00 60.06  ? 121 GLN U OE1 1 
ATOM   5072 N NE2 . GLN D 4  122 ? 25.938 -38.334 38.959  1.00 59.90  ? 121 GLN U NE2 1 
ATOM   5073 N N   . CYS D 4  123 ? 31.676 -35.420 38.978  1.00 42.77  ? 122 CYS U N   1 
ATOM   5074 C CA  . CYS D 4  123 ? 32.401 -34.209 39.322  1.00 41.70  ? 122 CYS U CA  1 
ATOM   5075 C C   . CYS D 4  123 ? 31.417 -33.311 40.030  1.00 38.51  ? 122 CYS U C   1 
ATOM   5076 O O   . CYS D 4  123 ? 30.287 -33.135 39.573  1.00 38.02  ? 122 CYS U O   1 
ATOM   5077 C CB  . CYS D 4  123 ? 32.923 -33.499 38.079  1.00 44.82  ? 122 CYS U CB  1 
ATOM   5078 S SG  . CYS D 4  123 ? 34.160 -34.470 37.180  1.00 50.81  ? 122 CYS U SG  1 
ATOM   5079 N N   . LEU D 4  124 ? 31.846 -32.746 41.148  1.00 36.27  ? 123 LEU U N   1 
ATOM   5080 C CA  . LEU D 4  124 ? 30.978 -31.876 41.917  1.00 34.48  ? 123 LEU U CA  1 
ATOM   5081 C C   . LEU D 4  124 ? 31.551 -30.484 42.087  1.00 32.34  ? 123 LEU U C   1 
ATOM   5082 O O   . LEU D 4  124 ? 32.760 -30.283 42.080  1.00 31.93  ? 123 LEU U O   1 
ATOM   5083 C CB  . LEU D 4  124 ? 30.728 -32.485 43.292  1.00 35.73  ? 123 LEU U CB  1 
ATOM   5084 C CG  . LEU D 4  124 ? 30.230 -33.926 43.273  1.00 39.79  ? 123 LEU U CG  1 
ATOM   5085 C CD1 . LEU D 4  124 ? 30.100 -34.437 44.702  1.00 42.13  ? 123 LEU U CD1 1 
ATOM   5086 C CD2 . LEU D 4  124 ? 28.896 -33.990 42.556  1.00 44.31  ? 123 LEU U CD2 1 
ATOM   5087 N N   . ASP D 4  125 ? 30.655 -29.523 42.235  1.00 34.17  ? 124 ASP U N   1 
ATOM   5088 C CA  . ASP D 4  125 ? 31.031 -28.139 42.446  1.00 37.05  ? 124 ASP U CA  1 
ATOM   5089 C C   . ASP D 4  125 ? 29.964 -27.620 43.408  1.00 37.43  ? 124 ASP U C   1 
ATOM   5090 O O   . ASP D 4  125 ? 28.807 -27.422 43.020  1.00 37.05  ? 124 ASP U O   1 
ATOM   5091 C CB  . ASP D 4  125 ? 30.978 -27.370 41.132  1.00 40.25  ? 124 ASP U CB  1 
ATOM   5092 C CG  . ASP D 4  125 ? 31.684 -26.034 41.211  1.00 47.62  ? 124 ASP U CG  1 
ATOM   5093 O OD1 . ASP D 4  125 ? 31.521 -25.323 42.224  1.00 53.24  ? 124 ASP U OD1 1 
ATOM   5094 O OD2 . ASP D 4  125 ? 32.399 -25.688 40.247  1.00 54.51  ? 124 ASP U OD2 1 
ATOM   5095 N N   . VAL D 4  126 ? 30.336 -27.426 44.671  1.00 37.22  ? 125 VAL U N   1 
ATOM   5096 C CA  . VAL D 4  126 ? 29.357 -26.958 45.647  1.00 37.97  ? 125 VAL U CA  1 
ATOM   5097 C C   . VAL D 4  126 ? 29.731 -25.630 46.287  1.00 35.00  ? 125 VAL U C   1 
ATOM   5098 O O   . VAL D 4  126 ? 30.865 -25.424 46.714  1.00 34.14  ? 125 VAL U O   1 
ATOM   5099 C CB  . VAL D 4  126 ? 29.099 -28.042 46.733  1.00 38.67  ? 125 VAL U CB  1 
ATOM   5100 C CG1 . VAL D 4  126 ? 30.413 -28.524 47.302  1.00 42.77  ? 125 VAL U CG1 1 
ATOM   5101 C CG2 . VAL D 4  126 ? 28.166 -27.494 47.818  1.00 36.85  ? 125 VAL U CG2 1 
ATOM   5102 N N   . VAL D 4  127 ? 28.756 -24.727 46.319  1.00 33.90  ? 126 VAL U N   1 
ATOM   5103 C CA  . VAL D 4  127 ? 28.929 -23.396 46.869  1.00 30.54  ? 126 VAL U CA  1 
ATOM   5104 C C   . VAL D 4  127 ? 28.028 -23.231 48.076  1.00 31.92  ? 126 VAL U C   1 
ATOM   5105 O O   . VAL D 4  127 ? 26.804 -23.380 47.986  1.00 31.44  ? 126 VAL U O   1 
ATOM   5106 C CB  . VAL D 4  127 ? 28.566 -22.312 45.829  1.00 29.85  ? 126 VAL U CB  1 
ATOM   5107 C CG1 . VAL D 4  127 ? 28.576 -20.929 46.477  1.00 28.42  ? 126 VAL U CG1 1 
ATOM   5108 C CG2 . VAL D 4  127 ? 29.543 -22.357 44.674  1.00 26.96  ? 126 VAL U CG2 1 
ATOM   5109 N N   . THR D 4  128 ? 28.646 -22.918 49.208  1.00 33.63  ? 127 THR U N   1 
ATOM   5110 C CA  . THR D 4  128 ? 27.916 -22.728 50.452  1.00 36.84  ? 127 THR U CA  1 
ATOM   5111 C C   . THR D 4  128 ? 28.323 -21.391 51.037  1.00 36.66  ? 127 THR U C   1 
ATOM   5112 O O   . THR D 4  128 ? 29.330 -21.289 51.741  1.00 36.55  ? 127 THR U O   1 
ATOM   5113 C CB  . THR D 4  128 ? 28.237 -23.857 51.480  1.00 37.84  ? 127 THR U CB  1 
ATOM   5114 O OG1 . THR D 4  128 ? 27.828 -25.128 50.955  1.00 35.92  ? 127 THR U OG1 1 
ATOM   5115 C CG2 . THR D 4  128 ? 27.507 -23.614 52.785  1.00 34.69  ? 127 THR U CG2 1 
ATOM   5116 N N   . HIS D 4  129 ? 27.553 -20.357 50.723  1.00 38.70  ? 128 HIS U N   1 
ATOM   5117 C CA  . HIS D 4  129 ? 27.858 -19.035 51.236  1.00 44.70  ? 128 HIS U CA  1 
ATOM   5118 C C   . HIS D 4  129 ? 26.923 -18.687 52.372  1.00 49.37  ? 128 HIS U C   1 
ATOM   5119 O O   . HIS D 4  129 ? 25.702 -18.601 52.183  1.00 46.48  ? 128 HIS U O   1 
ATOM   5120 C CB  . HIS D 4  129 ? 27.767 -17.982 50.127  1.00 46.43  ? 128 HIS U CB  1 
ATOM   5121 C CG  . HIS D 4  129 ? 29.080 -17.696 49.461  1.00 47.59  ? 128 HIS U CG  1 
ATOM   5122 N ND1 . HIS D 4  129 ? 30.068 -16.943 50.058  1.00 49.62  ? 128 HIS U ND1 1 
ATOM   5123 C CD2 . HIS D 4  129 ? 29.581 -18.090 48.266  1.00 48.54  ? 128 HIS U CD2 1 
ATOM   5124 C CE1 . HIS D 4  129 ? 31.121 -16.889 49.262  1.00 48.89  ? 128 HIS U CE1 1 
ATOM   5125 N NE2 . HIS D 4  129 ? 30.851 -17.577 48.167  1.00 46.18  ? 128 HIS U NE2 1 
ATOM   5126 N N   . TRP D 4  130 ? 27.532 -18.527 53.550  1.00 56.26  ? 129 TRP U N   1 
ATOM   5127 C CA  . TRP D 4  130 ? 26.866 -18.178 54.800  1.00 62.28  ? 129 TRP U CA  1 
ATOM   5128 C C   . TRP D 4  130 ? 25.384 -17.918 54.629  1.00 67.30  ? 129 TRP U C   1 
ATOM   5129 O O   . TRP D 4  130 ? 25.003 -16.889 54.080  1.00 73.99  ? 129 TRP U O   1 
ATOM   5130 C CB  . TRP D 4  130 ? 27.537 -16.938 55.392  1.00 65.83  ? 129 TRP U CB  1 
ATOM   5131 C CG  . TRP D 4  130 ? 26.716 -16.232 56.423  1.00 71.80  ? 129 TRP U CG  1 
ATOM   5132 C CD1 . TRP D 4  130 ? 26.411 -16.669 57.686  1.00 75.45  ? 129 TRP U CD1 1 
ATOM   5133 C CD2 . TRP D 4  130 ? 26.061 -14.971 56.266  1.00 71.63  ? 129 TRP U CD2 1 
ATOM   5134 N NE1 . TRP D 4  130 ? 25.601 -15.754 58.322  1.00 75.39  ? 129 TRP U NE1 1 
ATOM   5135 C CE2 . TRP D 4  130 ? 25.371 -14.703 57.471  1.00 73.92  ? 129 TRP U CE2 1 
ATOM   5136 C CE3 . TRP D 4  130 ? 25.987 -14.040 55.222  1.00 69.69  ? 129 TRP U CE3 1 
ATOM   5137 C CZ2 . TRP D 4  130 ? 24.618 -13.542 57.657  1.00 73.70  ? 129 TRP U CZ2 1 
ATOM   5138 C CZ3 . TRP D 4  130 ? 25.239 -12.887 55.407  1.00 69.41  ? 129 TRP U CZ3 1 
ATOM   5139 C CH2 . TRP D 4  130 ? 24.564 -12.650 56.616  1.00 72.16  ? 129 TRP U CH2 1 
ATOM   5140 N N   . ASP D 4  141 ? 30.605 -25.881 55.779  1.00 49.13  ? 140 ASP U N   1 
ATOM   5141 C CA  . ASP D 4  141 ? 31.355 -24.727 56.244  1.00 48.01  ? 140 ASP U CA  1 
ATOM   5142 C C   . ASP D 4  141 ? 32.175 -24.130 55.102  1.00 45.68  ? 140 ASP U C   1 
ATOM   5143 O O   . ASP D 4  141 ? 32.119 -22.924 54.883  1.00 47.04  ? 140 ASP U O   1 
ATOM   5144 C CB  . ASP D 4  141 ? 32.258 -25.117 57.427  1.00 47.56  ? 140 ASP U CB  1 
ATOM   5145 C CG  . ASP D 4  141 ? 31.794 -24.510 58.750  1.00 51.12  ? 140 ASP U CG  1 
ATOM   5146 O OD1 . ASP D 4  141 ? 30.576 -24.302 58.935  1.00 55.63  ? 140 ASP U OD1 1 
ATOM   5147 O OD2 . ASP D 4  141 ? 32.648 -24.252 59.621  1.00 52.97  ? 140 ASP U OD2 1 
ATOM   5148 N N   . ASP D 4  142 ? 32.929 -24.954 54.374  1.00 42.31  ? 141 ASP U N   1 
ATOM   5149 C CA  . ASP D 4  142 ? 33.717 -24.436 53.249  1.00 42.74  ? 141 ASP U CA  1 
ATOM   5150 C C   . ASP D 4  142 ? 32.799 -23.746 52.241  1.00 41.85  ? 141 ASP U C   1 
ATOM   5151 O O   . ASP D 4  142 ? 31.849 -24.354 51.746  1.00 39.48  ? 141 ASP U O   1 
ATOM   5152 C CB  . ASP D 4  142 ? 34.455 -25.553 52.510  1.00 46.53  ? 141 ASP U CB  1 
ATOM   5153 C CG  . ASP D 4  142 ? 35.625 -26.104 53.289  1.00 52.67  ? 141 ASP U CG  1 
ATOM   5154 O OD1 . ASP D 4  142 ? 35.436 -27.096 54.029  1.00 57.89  ? 141 ASP U OD1 1 
ATOM   5155 O OD2 . ASP D 4  142 ? 36.733 -25.540 53.160  1.00 52.99  ? 141 ASP U OD2 1 
ATOM   5156 N N   . ARG D 4  143 ? 33.084 -22.484 51.929  1.00 40.61  ? 142 ARG U N   1 
ATOM   5157 C CA  . ARG D 4  143 ? 32.270 -21.741 50.969  1.00 38.53  ? 142 ARG U CA  1 
ATOM   5158 C C   . ARG D 4  143 ? 32.307 -22.355 49.564  1.00 35.78  ? 142 ARG U C   1 
ATOM   5159 O O   . ARG D 4  143 ? 31.289 -22.386 48.870  1.00 36.84  ? 142 ARG U O   1 
ATOM   5160 C CB  . ARG D 4  143 ? 32.732 -20.284 50.908  1.00 39.43  ? 142 ARG U CB  1 
ATOM   5161 C CG  . ARG D 4  143 ? 32.422 -19.476 52.153  1.00 45.49  ? 142 ARG U CG  1 
ATOM   5162 C CD  . ARG D 4  143 ? 33.004 -18.070 52.033  1.00 54.90  ? 142 ARG U CD  1 
ATOM   5163 N NE  . ARG D 4  143 ? 32.605 -17.203 53.139  1.00 61.75  ? 142 ARG U NE  1 
ATOM   5164 C CZ  . ARG D 4  143 ? 31.345 -16.871 53.414  1.00 68.04  ? 142 ARG U CZ  1 
ATOM   5165 N NH1 . ARG D 4  143 ? 30.351 -17.329 52.662  1.00 68.46  ? 142 ARG U NH1 1 
ATOM   5166 N NH2 . ARG D 4  143 ? 31.075 -16.083 54.448  1.00 71.38  ? 142 ARG U NH2 1 
ATOM   5167 N N   . HIS D 4  144 ? 33.475 -22.840 49.150  1.00 32.19  ? 143 HIS U N   1 
ATOM   5168 C CA  . HIS D 4  144 ? 33.637 -23.447 47.833  1.00 32.33  ? 143 HIS U CA  1 
ATOM   5169 C C   . HIS D 4  144 ? 34.353 -24.791 47.926  1.00 34.50  ? 143 HIS U C   1 
ATOM   5170 O O   . HIS D 4  144 ? 35.401 -24.910 48.556  1.00 37.98  ? 143 HIS U O   1 
ATOM   5171 C CB  . HIS D 4  144 ? 34.421 -22.506 46.904  1.00 34.55  ? 143 HIS U CB  1 
ATOM   5172 C CG  . HIS D 4  144 ? 33.728 -21.204 46.632  1.00 35.32  ? 143 HIS U CG  1 
ATOM   5173 N ND1 . HIS D 4  144 ? 32.615 -21.105 45.826  1.00 38.86  ? 143 HIS U ND1 1 
ATOM   5174 C CD2 . HIS D 4  144 ? 33.970 -19.951 47.090  1.00 37.84  ? 143 HIS U CD2 1 
ATOM   5175 C CE1 . HIS D 4  144 ? 32.199 -19.850 45.803  1.00 39.46  ? 143 HIS U CE1 1 
ATOM   5176 N NE2 . HIS D 4  144 ? 33.005 -19.130 46.561  1.00 35.57  ? 143 HIS U NE2 1 
ATOM   5177 N N   . LEU D 4  145 ? 33.780 -25.797 47.276  1.00 35.48  ? 144 LEU U N   1 
ATOM   5178 C CA  . LEU D 4  145 ? 34.328 -27.152 47.263  1.00 36.81  ? 144 LEU U CA  1 
ATOM   5179 C C   . LEU D 4  145 ? 34.168 -27.792 45.864  1.00 36.42  ? 144 LEU U C   1 
ATOM   5180 O O   . LEU D 4  145 ? 33.104 -27.687 45.240  1.00 36.43  ? 144 LEU U O   1 
ATOM   5181 C CB  . LEU D 4  145 ? 33.581 -27.995 48.309  1.00 37.76  ? 144 LEU U CB  1 
ATOM   5182 C CG  . LEU D 4  145 ? 34.277 -28.622 49.517  1.00 38.70  ? 144 LEU U CG  1 
ATOM   5183 C CD1 . LEU D 4  145 ? 35.250 -27.643 50.151  1.00 39.79  ? 144 LEU U CD1 1 
ATOM   5184 C CD2 . LEU D 4  145 ? 33.209 -29.068 50.509  1.00 37.59  ? 144 LEU U CD2 1 
ATOM   5185 N N   . ARG D 4  146 ? 35.221 -28.447 45.380  1.00 34.71  ? 145 ARG U N   1 
ATOM   5186 C CA  . ARG D 4  146 ? 35.188 -29.118 44.078  1.00 35.11  ? 145 ARG U CA  1 
ATOM   5187 C C   . ARG D 4  146 ? 35.914 -30.438 44.155  1.00 35.81  ? 145 ARG U C   1 
ATOM   5188 O O   . ARG D 4  146 ? 36.995 -30.512 44.734  1.00 36.80  ? 145 ARG U O   1 
ATOM   5189 C CB  . ARG D 4  146 ? 35.881 -28.294 42.996  1.00 36.13  ? 145 ARG U CB  1 
ATOM   5190 C CG  . ARG D 4  146 ? 35.118 -27.098 42.518  1.00 39.31  ? 145 ARG U CG  1 
ATOM   5191 C CD  . ARG D 4  146 ? 35.821 -26.490 41.320  1.00 39.74  ? 145 ARG U CD  1 
ATOM   5192 N NE  . ARG D 4  146 ? 35.120 -25.306 40.840  1.00 43.53  ? 145 ARG U NE  1 
ATOM   5193 C CZ  . ARG D 4  146 ? 35.508 -24.576 39.803  1.00 40.69  ? 145 ARG U CZ  1 
ATOM   5194 N NH1 . ARG D 4  146 ? 36.600 -24.904 39.129  1.00 38.66  ? 145 ARG U NH1 1 
ATOM   5195 N NH2 . ARG D 4  146 ? 34.798 -23.519 39.440  1.00 44.27  ? 145 ARG U NH2 1 
ATOM   5196 N N   . GLY D 4  147 ? 35.343 -31.475 43.554  1.00 34.79  ? 146 GLY U N   1 
ATOM   5197 C CA  . GLY D 4  147 ? 35.999 -32.768 43.574  1.00 34.65  ? 146 GLY U CA  1 
ATOM   5198 C C   . GLY D 4  147 ? 35.140 -33.904 43.069  1.00 37.15  ? 146 GLY U C   1 
ATOM   5199 O O   . GLY D 4  147 ? 34.337 -33.730 42.151  1.00 38.74  ? 146 GLY U O   1 
ATOM   5200 N N   . CYS D 4  148 ? 35.325 -35.073 43.679  1.00 37.83  ? 147 CYS U N   1 
ATOM   5201 C CA  . CYS D 4  148 ? 34.590 -36.285 43.338  1.00 38.66  ? 147 CYS U CA  1 
ATOM   5202 C C   . CYS D 4  148 ? 33.507 -36.581 44.354  1.00 38.23  ? 147 CYS U C   1 
ATOM   5203 O O   . CYS D 4  148 ? 33.534 -36.081 45.473  1.00 41.45  ? 147 CYS U O   1 
ATOM   5204 C CB  . CYS D 4  148 ? 35.535 -37.475 43.298  1.00 40.61  ? 147 CYS U CB  1 
ATOM   5205 S SG  . CYS D 4  148 ? 36.618 -37.475 41.853  1.00 48.51  ? 147 CYS U SG  1 
ATOM   5206 N N   . GLY D 4  149 ? 32.550 -37.409 43.969  1.00 36.44  ? 148 GLY U N   1 
ATOM   5207 C CA  . GLY D 4  149 ? 31.501 -37.742 44.901  1.00 37.62  ? 148 GLY U CA  1 
ATOM   5208 C C   . GLY D 4  149 ? 30.132 -37.867 44.280  1.00 37.61  ? 148 GLY U C   1 
ATOM   5209 O O   . GLY D 4  149 ? 29.968 -37.860 43.060  1.00 37.86  ? 148 GLY U O   1 
ATOM   5210 N N   . TYR D 4  150 ? 29.146 -37.988 45.153  1.00 38.35  ? 149 TYR U N   1 
ATOM   5211 C CA  . TYR D 4  150 ? 27.765 -38.117 44.760  1.00 41.01  ? 149 TYR U CA  1 
ATOM   5212 C C   . TYR D 4  150 ? 26.978 -37.547 45.932  1.00 41.07  ? 149 TYR U C   1 
ATOM   5213 O O   . TYR D 4  150 ? 27.157 -37.972 47.070  1.00 40.68  ? 149 TYR U O   1 
ATOM   5214 C CB  . TYR D 4  150 ? 27.415 -39.586 44.547  1.00 46.44  ? 149 TYR U CB  1 
ATOM   5215 C CG  . TYR D 4  150 ? 26.136 -39.778 43.776  1.00 54.47  ? 149 TYR U CG  1 
ATOM   5216 C CD1 . TYR D 4  150 ? 26.104 -39.607 42.393  1.00 57.86  ? 149 TYR U CD1 1 
ATOM   5217 C CD2 . TYR D 4  150 ? 24.942 -40.067 44.433  1.00 58.82  ? 149 TYR U CD2 1 
ATOM   5218 C CE1 . TYR D 4  150 ? 24.909 -39.713 41.679  1.00 61.47  ? 149 TYR U CE1 1 
ATOM   5219 C CE2 . TYR D 4  150 ? 23.742 -40.174 43.732  1.00 63.50  ? 149 TYR U CE2 1 
ATOM   5220 C CZ  . TYR D 4  150 ? 23.732 -39.995 42.355  1.00 62.48  ? 149 TYR U CZ  1 
ATOM   5221 O OH  . TYR D 4  150 ? 22.544 -40.089 41.662  1.00 63.72  ? 149 TYR U OH  1 
ATOM   5222 N N   . LEU D 4  151 ? 26.121 -36.572 45.662  1.00 38.49  ? 150 LEU U N   1 
ATOM   5223 C CA  . LEU D 4  151 ? 25.348 -35.959 46.724  1.00 41.00  ? 150 LEU U CA  1 
ATOM   5224 C C   . LEU D 4  151 ? 23.875 -35.898 46.377  1.00 45.60  ? 150 LEU U C   1 
ATOM   5225 O O   . LEU D 4  151 ? 23.487 -36.116 45.230  1.00 48.86  ? 150 LEU U O   1 
ATOM   5226 C CB  . LEU D 4  151 ? 25.869 -34.546 47.000  1.00 36.78  ? 150 LEU U CB  1 
ATOM   5227 C CG  . LEU D 4  151 ? 27.266 -34.464 47.615  1.00 33.53  ? 150 LEU U CG  1 
ATOM   5228 C CD1 . LEU D 4  151 ? 27.708 -33.020 47.667  1.00 33.30  ? 150 LEU U CD1 1 
ATOM   5229 C CD2 . LEU D 4  151 ? 27.252 -35.079 49.006  1.00 31.18  ? 150 LEU U CD2 1 
ATOM   5230 N N   . PRO D 4  152 ? 23.025 -35.621 47.373  1.00 47.59  ? 151 PRO U N   1 
ATOM   5231 C CA  . PRO D 4  152 ? 21.601 -35.549 47.059  1.00 50.01  ? 151 PRO U CA  1 
ATOM   5232 C C   . PRO D 4  152 ? 21.357 -34.453 46.017  1.00 52.06  ? 151 PRO U C   1 
ATOM   5233 O O   . PRO D 4  152 ? 21.856 -33.331 46.151  1.00 50.25  ? 151 PRO U O   1 
ATOM   5234 C CB  . PRO D 4  152 ? 20.963 -35.252 48.416  1.00 49.75  ? 151 PRO U CB  1 
ATOM   5235 C CG  . PRO D 4  152 ? 22.060 -34.535 49.168  1.00 50.03  ? 151 PRO U CG  1 
ATOM   5236 C CD  . PRO D 4  152 ? 23.272 -35.339 48.798  1.00 47.83  ? 151 PRO U CD  1 
ATOM   5237 N N   . GLY D 4  153 ? 20.608 -34.803 44.973  1.00 54.24  ? 152 GLY U N   1 
ATOM   5238 C CA  . GLY D 4  153 ? 20.300 -33.865 43.905  1.00 55.04  ? 152 GLY U CA  1 
ATOM   5239 C C   . GLY D 4  153 ? 21.453 -33.773 42.929  1.00 55.63  ? 152 GLY U C   1 
ATOM   5240 O O   . GLY D 4  153 ? 21.626 -32.768 42.238  1.00 55.25  ? 152 GLY U O   1 
ATOM   5241 N N   . CYS D 4  154 ? 22.234 -34.842 42.849  1.00 56.76  ? 153 CYS U N   1 
ATOM   5242 C CA  . CYS D 4  154 ? 23.393 -34.828 41.984  1.00 59.53  ? 153 CYS U CA  1 
ATOM   5243 C C   . CYS D 4  154 ? 23.108 -34.716 40.503  1.00 61.94  ? 153 CYS U C   1 
ATOM   5244 O O   . CYS D 4  154 ? 23.381 -33.675 39.904  1.00 68.46  ? 153 CYS U O   1 
ATOM   5245 C CB  . CYS D 4  154 ? 24.282 -36.042 42.237  1.00 58.95  ? 153 CYS U CB  1 
ATOM   5246 S SG  . CYS D 4  154 ? 26.029 -35.549 42.343  1.00 60.18  ? 153 CYS U SG  1 
ATOM   5247 N N   . PRO D 4  155 ? 22.550 -35.770 39.888  1.00 59.90  ? 154 PRO U N   1 
ATOM   5248 C CA  . PRO D 4  155 ? 22.271 -35.685 38.446  1.00 54.93  ? 154 PRO U CA  1 
ATOM   5249 C C   . PRO D 4  155 ? 21.781 -34.289 38.050  1.00 50.87  ? 154 PRO U C   1 
ATOM   5250 O O   . PRO D 4  155 ? 20.587 -33.988 38.162  1.00 51.65  ? 154 PRO U O   1 
ATOM   5251 C CB  . PRO D 4  155 ? 21.206 -36.753 38.244  1.00 56.07  ? 154 PRO U CB  1 
ATOM   5252 C CG  . PRO D 4  155 ? 21.552 -37.766 39.303  1.00 60.51  ? 154 PRO U CG  1 
ATOM   5253 C CD  . PRO D 4  155 ? 21.834 -36.901 40.500  1.00 57.48  ? 154 PRO U CD  1 
ATOM   5254 N N   . GLY D 4  156 ? 22.709 -33.435 37.616  1.00 43.49  ? 155 GLY U N   1 
ATOM   5255 C CA  . GLY D 4  156 ? 22.345 -32.081 37.223  1.00 39.85  ? 155 GLY U CA  1 
ATOM   5256 C C   . GLY D 4  156 ? 22.915 -30.995 38.120  1.00 36.30  ? 155 GLY U C   1 
ATOM   5257 O O   . GLY D 4  156 ? 24.084 -31.038 38.493  1.00 36.39  ? 155 GLY U O   1 
ATOM   5258 N N   . SER D 4  157 ? 22.096 -30.009 38.463  1.00 33.40  ? 156 SER U N   1 
ATOM   5259 C CA  . SER D 4  157 ? 22.548 -28.928 39.330  1.00 33.73  ? 156 SER U CA  1 
ATOM   5260 C C   . SER D 4  157 ? 21.355 -28.182 39.923  1.00 35.40  ? 156 SER U C   1 
ATOM   5261 O O   . SER D 4  157 ? 20.252 -28.232 39.379  1.00 37.95  ? 156 SER U O   1 
ATOM   5262 C CB  . SER D 4  157 ? 23.438 -27.961 38.548  1.00 30.75  ? 156 SER U CB  1 
ATOM   5263 O OG  . SER D 4  157 ? 22.662 -27.109 37.737  1.00 38.87  ? 156 SER U OG  1 
ATOM   5264 N N   . ASN D 4  158 ? 21.564 -27.504 41.047  1.00 32.31  ? 157 ASN U N   1 
ATOM   5265 C CA  . ASN D 4  158 ? 20.480 -26.769 41.684  1.00 31.21  ? 157 ASN U CA  1 
ATOM   5266 C C   . ASN D 4  158 ? 21.012 -25.549 42.428  1.00 29.01  ? 157 ASN U C   1 
ATOM   5267 O O   . ASN D 4  158 ? 22.183 -25.492 42.780  1.00 29.84  ? 157 ASN U O   1 
ATOM   5268 C CB  . ASN D 4  158 ? 19.691 -27.692 42.634  1.00 35.36  ? 157 ASN U CB  1 
ATOM   5269 C CG  . ASN D 4  158 ? 20.536 -28.231 43.791  1.00 37.99  ? 157 ASN U CG  1 
ATOM   5270 O OD1 . ASN D 4  158 ? 21.139 -27.467 44.547  1.00 42.29  ? 157 ASN U OD1 1 
ATOM   5271 N ND2 . ASN D 4  158 ? 20.568 -29.554 43.937  1.00 34.10  ? 157 ASN U ND2 1 
ATOM   5272 N N   . GLY D 4  159 ? 20.154 -24.569 42.660  1.00 27.52  ? 158 GLY U N   1 
ATOM   5273 C CA  . GLY D 4  159 ? 20.603 -23.379 43.343  1.00 26.50  ? 158 GLY U CA  1 
ATOM   5274 C C   . GLY D 4  159 ? 19.500 -22.662 44.088  1.00 30.42  ? 158 GLY U C   1 
ATOM   5275 O O   . GLY D 4  159 ? 18.312 -22.778 43.760  1.00 30.98  ? 158 GLY U O   1 
ATOM   5276 N N   . PHE D 4  160 ? 19.900 -21.905 45.101  1.00 28.33  ? 159 PHE U N   1 
ATOM   5277 C CA  . PHE D 4  160 ? 18.950 -21.155 45.909  1.00 28.16  ? 159 PHE U CA  1 
ATOM   5278 C C   . PHE D 4  160 ? 19.648 -19.951 46.535  1.00 27.43  ? 159 PHE U C   1 
ATOM   5279 O O   . PHE D 4  160 ? 20.850 -19.991 46.812  1.00 28.07  ? 159 PHE U O   1 
ATOM   5280 C CB  . PHE D 4  160 ? 18.391 -22.053 47.026  1.00 26.28  ? 159 PHE U CB  1 
ATOM   5281 C CG  . PHE D 4  160 ? 17.591 -21.310 48.051  1.00 27.49  ? 159 PHE U CG  1 
ATOM   5282 C CD1 . PHE D 4  160 ? 16.248 -21.041 47.840  1.00 25.74  ? 159 PHE U CD1 1 
ATOM   5283 C CD2 . PHE D 4  160 ? 18.209 -20.796 49.194  1.00 29.63  ? 159 PHE U CD2 1 
ATOM   5284 C CE1 . PHE D 4  160 ? 15.530 -20.267 48.740  1.00 26.97  ? 159 PHE U CE1 1 
ATOM   5285 C CE2 . PHE D 4  160 ? 17.497 -20.017 50.101  1.00 26.61  ? 159 PHE U CE2 1 
ATOM   5286 C CZ  . PHE D 4  160 ? 16.158 -19.751 49.873  1.00 25.42  ? 159 PHE U CZ  1 
ATOM   5287 N N   . HIS D 4  161 ? 18.903 -18.871 46.730  1.00 28.84  ? 160 HIS U N   1 
ATOM   5288 C CA  . HIS D 4  161 ? 19.468 -17.709 47.388  1.00 28.92  ? 160 HIS U CA  1 
ATOM   5289 C C   . HIS D 4  161 ? 18.387 -16.816 47.986  1.00 30.18  ? 160 HIS U C   1 
ATOM   5290 O O   . HIS D 4  161 ? 17.303 -16.656 47.415  1.00 29.79  ? 160 HIS U O   1 
ATOM   5291 C CB  . HIS D 4  161 ? 20.404 -16.918 46.441  1.00 28.95  ? 160 HIS U CB  1 
ATOM   5292 C CG  . HIS D 4  161 ? 19.707 -16.017 45.460  1.00 27.87  ? 160 HIS U CG  1 
ATOM   5293 N ND1 . HIS D 4  161 ? 19.299 -16.441 44.213  1.00 31.17  ? 160 HIS U ND1 1 
ATOM   5294 C CD2 . HIS D 4  161 ? 19.419 -14.694 45.516  1.00 24.65  ? 160 HIS U CD2 1 
ATOM   5295 C CE1 . HIS D 4  161 ? 18.795 -15.418 43.543  1.00 29.59  ? 160 HIS U CE1 1 
ATOM   5296 N NE2 . HIS D 4  161 ? 18.858 -14.345 44.312  1.00 28.20  ? 160 HIS U NE2 1 
ATOM   5297 N N   . ASN D 4  162 ? 18.669 -16.275 49.170  1.00 28.56  ? 161 ASN U N   1 
ATOM   5298 C CA  . ASN D 4  162 ? 17.730 -15.383 49.829  1.00 28.33  ? 161 ASN U CA  1 
ATOM   5299 C C   . ASN D 4  162 ? 18.497 -14.348 50.643  1.00 29.76  ? 161 ASN U C   1 
ATOM   5300 O O   . ASN D 4  162 ? 19.716 -14.245 50.505  1.00 28.67  ? 161 ASN U O   1 
ATOM   5301 C CB  . ASN D 4  162 ? 16.762 -16.171 50.707  1.00 29.91  ? 161 ASN U CB  1 
ATOM   5302 C CG  . ASN D 4  162 ? 17.437 -16.815 51.883  1.00 29.14  ? 161 ASN U CG  1 
ATOM   5303 O OD1 . ASN D 4  162 ? 18.664 -16.867 51.963  1.00 31.30  ? 161 ASN U OD1 1 
ATOM   5304 N ND2 . ASN D 4  162 ? 16.637 -17.322 52.808  1.00 29.88  ? 161 ASN U ND2 1 
ATOM   5305 N N   . ASN D 4  163 ? 17.796 -13.603 51.496  1.00 33.01  ? 162 ASN U N   1 
ATOM   5306 C CA  . ASN D 4  163 ? 18.419 -12.526 52.276  1.00 38.09  ? 162 ASN U CA  1 
ATOM   5307 C C   . ASN D 4  163 ? 19.767 -12.777 52.953  1.00 39.52  ? 162 ASN U C   1 
ATOM   5308 O O   . ASN D 4  163 ? 20.453 -11.824 53.335  1.00 39.50  ? 162 ASN U O   1 
ATOM   5309 C CB  . ASN D 4  163 ? 17.417 -11.915 53.304  1.00 40.08  ? 162 ASN U CB  1 
ATOM   5310 C CG  . ASN D 4  163 ? 16.913 -12.913 54.357  1.00 41.74  ? 162 ASN U CG  1 
ATOM   5311 O OD1 . ASN D 4  163 ? 17.690 -13.678 54.909  1.00 47.50  ? 162 ASN U OD1 1 
ATOM   5312 N ND2 . ASN D 4  163 ? 15.606 -12.871 54.661  1.00 33.02  ? 162 ASN U ND2 1 
ATOM   5313 N N   . ASP D 4  164 ? 20.176 -14.036 53.077  1.00 40.75  ? 163 ASP U N   1 
ATOM   5314 C CA  . ASP D 4  164 ? 21.448 -14.323 53.735  1.00 43.02  ? 163 ASP U CA  1 
ATOM   5315 C C   . ASP D 4  164 ? 22.038 -15.657 53.339  1.00 42.03  ? 163 ASP U C   1 
ATOM   5316 O O   . ASP D 4  164 ? 22.867 -16.201 54.056  1.00 42.62  ? 163 ASP U O   1 
ATOM   5317 C CB  . ASP D 4  164 ? 21.268 -14.297 55.260  1.00 47.62  ? 163 ASP U CB  1 
ATOM   5318 C CG  . ASP D 4  164 ? 20.345 -15.408 55.770  1.00 51.99  ? 163 ASP U CG  1 
ATOM   5319 O OD1 . ASP D 4  164 ? 19.750 -15.226 56.858  1.00 55.79  ? 163 ASP U OD1 1 
ATOM   5320 O OD2 . ASP D 4  164 ? 20.219 -16.462 55.102  1.00 51.73  ? 163 ASP U OD2 1 
ATOM   5321 N N   . THR D 4  165 ? 21.622 -16.183 52.196  1.00 42.40  ? 164 THR U N   1 
ATOM   5322 C CA  . THR D 4  165 ? 22.113 -17.480 51.767  1.00 41.02  ? 164 THR U CA  1 
ATOM   5323 C C   . THR D 4  165 ? 22.238 -17.606 50.264  1.00 36.64  ? 164 THR U C   1 
ATOM   5324 O O   . THR D 4  165 ? 21.482 -16.999 49.508  1.00 36.42  ? 164 THR U O   1 
ATOM   5325 C CB  . THR D 4  165 ? 21.158 -18.618 52.242  1.00 43.34  ? 164 THR U CB  1 
ATOM   5326 O OG1 . THR D 4  165 ? 20.982 -18.544 53.661  1.00 45.92  ? 164 THR U OG1 1 
ATOM   5327 C CG2 . THR D 4  165 ? 21.717 -19.986 51.876  1.00 44.31  ? 164 THR U CG2 1 
ATOM   5328 N N   . PHE D 4  166 ? 23.219 -18.395 49.855  1.00 34.60  ? 165 PHE U N   1 
ATOM   5329 C CA  . PHE D 4  166 ? 23.427 -18.716 48.458  1.00 32.67  ? 165 PHE U CA  1 
ATOM   5330 C C   . PHE D 4  166 ? 23.979 -20.130 48.402  1.00 32.04  ? 165 PHE U C   1 
ATOM   5331 O O   . PHE D 4  166 ? 25.084 -20.400 48.873  1.00 29.22  ? 165 PHE U O   1 
ATOM   5332 C CB  . PHE D 4  166 ? 24.423 -17.797 47.761  1.00 30.71  ? 165 PHE U CB  1 
ATOM   5333 C CG  . PHE D 4  166 ? 24.761 -18.255 46.363  1.00 29.45  ? 165 PHE U CG  1 
ATOM   5334 C CD1 . PHE D 4  166 ? 26.059 -18.171 45.877  1.00 27.40  ? 165 PHE U CD1 1 
ATOM   5335 C CD2 . PHE D 4  166 ? 23.769 -18.791 45.538  1.00 27.20  ? 165 PHE U CD2 1 
ATOM   5336 C CE1 . PHE D 4  166 ? 26.372 -18.614 44.588  1.00 30.05  ? 165 PHE U CE1 1 
ATOM   5337 C CE2 . PHE D 4  166 ? 24.069 -19.234 44.256  1.00 29.76  ? 165 PHE U CE2 1 
ATOM   5338 C CZ  . PHE D 4  166 ? 25.375 -19.146 43.777  1.00 27.89  ? 165 PHE U CZ  1 
ATOM   5339 N N   . HIS D 4  167 ? 23.196 -21.039 47.840  1.00 33.10  ? 166 HIS U N   1 
ATOM   5340 C CA  . HIS D 4  167 ? 23.635 -22.414 47.702  1.00 32.78  ? 166 HIS U CA  1 
ATOM   5341 C C   . HIS D 4  167 ? 23.564 -22.818 46.244  1.00 30.58  ? 166 HIS U C   1 
ATOM   5342 O O   . HIS D 4  167 ? 22.628 -22.454 45.524  1.00 28.18  ? 166 HIS U O   1 
ATOM   5343 C CB  . HIS D 4  167 ? 22.761 -23.359 48.537  1.00 36.71  ? 166 HIS U CB  1 
ATOM   5344 C CG  . HIS D 4  167 ? 22.842 -24.797 48.111  1.00 40.99  ? 166 HIS U CG  1 
ATOM   5345 N ND1 . HIS D 4  167 ? 22.116 -25.304 47.053  1.00 44.27  ? 166 HIS U ND1 1 
ATOM   5346 C CD2 . HIS D 4  167 ? 23.584 -25.827 48.582  1.00 40.92  ? 166 HIS U CD2 1 
ATOM   5347 C CE1 . HIS D 4  167 ? 22.407 -26.582 46.891  1.00 39.32  ? 166 HIS U CE1 1 
ATOM   5348 N NE2 . HIS D 4  167 ? 23.296 -26.923 47.806  1.00 42.80  ? 166 HIS U NE2 1 
ATOM   5349 N N   . PHE D 4  168 ? 24.570 -23.562 45.812  1.00 29.49  ? 167 PHE U N   1 
ATOM   5350 C CA  . PHE D 4  168 ? 24.590 -24.051 44.455  1.00 31.62  ? 167 PHE U CA  1 
ATOM   5351 C C   . PHE D 4  168 ? 25.362 -25.360 44.395  1.00 32.08  ? 167 PHE U C   1 
ATOM   5352 O O   . PHE D 4  168 ? 26.427 -25.501 44.997  1.00 32.91  ? 167 PHE U O   1 
ATOM   5353 C CB  . PHE D 4  168 ? 25.218 -23.027 43.511  1.00 31.47  ? 167 PHE U CB  1 
ATOM   5354 C CG  . PHE D 4  168 ? 24.657 -23.077 42.116  1.00 32.69  ? 167 PHE U CG  1 
ATOM   5355 C CD1 . PHE D 4  168 ? 23.507 -22.352 41.790  1.00 32.88  ? 167 PHE U CD1 1 
ATOM   5356 C CD2 . PHE D 4  168 ? 25.254 -23.871 41.139  1.00 32.69  ? 167 PHE U CD2 1 
ATOM   5357 C CE1 . PHE D 4  168 ? 22.957 -22.413 40.508  1.00 34.21  ? 167 PHE U CE1 1 
ATOM   5358 C CE2 . PHE D 4  168 ? 24.713 -23.944 39.852  1.00 34.78  ? 167 PHE U CE2 1 
ATOM   5359 C CZ  . PHE D 4  168 ? 23.561 -23.213 39.535  1.00 35.93  ? 167 PHE U CZ  1 
ATOM   5360 N N   . LEU D 4  169 ? 24.802 -26.328 43.679  1.00 34.18  ? 168 LEU U N   1 
ATOM   5361 C CA  . LEU D 4  169 ? 25.443 -27.624 43.520  1.00 34.05  ? 168 LEU U CA  1 
ATOM   5362 C C   . LEU D 4  169 ? 25.432 -27.935 42.038  1.00 34.01  ? 168 LEU U C   1 
ATOM   5363 O O   . LEU D 4  169 ? 24.412 -27.775 41.373  1.00 32.21  ? 168 LEU U O   1 
ATOM   5364 C CB  . LEU D 4  169 ? 24.662 -28.728 44.255  1.00 35.51  ? 168 LEU U CB  1 
ATOM   5365 C CG  . LEU D 4  169 ? 25.336 -30.063 44.630  1.00 35.18  ? 168 LEU U CG  1 
ATOM   5366 C CD1 . LEU D 4  169 ? 24.259 -31.113 44.814  1.00 38.93  ? 168 LEU U CD1 1 
ATOM   5367 C CD2 . LEU D 4  169 ? 26.313 -30.527 43.573  1.00 36.50  ? 168 LEU U CD2 1 
ATOM   5368 N N   . LYS D 4  170 ? 26.577 -28.346 41.519  1.00 33.46  ? 169 LYS U N   1 
ATOM   5369 C CA  . LYS D 4  170 ? 26.663 -28.743 40.133  1.00 36.77  ? 169 LYS U CA  1 
ATOM   5370 C C   . LYS D 4  170 ? 27.260 -30.141 40.148  1.00 35.61  ? 169 LYS U C   1 
ATOM   5371 O O   . LYS D 4  170 ? 28.314 -30.366 40.730  1.00 37.07  ? 169 LYS U O   1 
ATOM   5372 C CB  . LYS D 4  170 ? 27.564 -27.820 39.323  1.00 39.95  ? 169 LYS U CB  1 
ATOM   5373 C CG  . LYS D 4  170 ? 27.638 -28.262 37.858  1.00 44.73  ? 169 LYS U CG  1 
ATOM   5374 C CD  . LYS D 4  170 ? 28.670 -27.500 37.057  1.00 48.04  ? 169 LYS U CD  1 
ATOM   5375 C CE  . LYS D 4  170 ? 28.772 -28.079 35.662  1.00 48.46  ? 169 LYS U CE  1 
ATOM   5376 N NZ  . LYS D 4  170 ? 29.932 -27.498 34.930  1.00 54.89  ? 169 LYS U NZ  1 
ATOM   5377 N N   . CYS D 4  171 ? 26.564 -31.078 39.526  1.00 35.71  ? 170 CYS U N   1 
ATOM   5378 C CA  . CYS D 4  171 ? 27.010 -32.455 39.454  1.00 41.58  ? 170 CYS U CA  1 
ATOM   5379 C C   . CYS D 4  171 ? 26.907 -32.879 37.990  1.00 42.01  ? 170 CYS U C   1 
ATOM   5380 O O   . CYS D 4  171 ? 25.842 -32.787 37.387  1.00 46.08  ? 170 CYS U O   1 
ATOM   5381 C CB  . CYS D 4  171 ? 26.105 -33.312 40.328  1.00 46.73  ? 170 CYS U CB  1 
ATOM   5382 S SG  . CYS D 4  171 ? 26.525 -35.078 40.426  1.00 61.12  ? 170 CYS U SG  1 
ATOM   5383 N N   . CYS D 4  172 ? 28.018 -33.333 37.424  1.00 41.66  ? 171 CYS U N   1 
ATOM   5384 C CA  . CYS D 4  172 ? 28.078 -33.752 36.024  1.00 42.12  ? 171 CYS U CA  1 
ATOM   5385 C C   . CYS D 4  172 ? 29.045 -34.928 35.897  1.00 42.62  ? 171 CYS U C   1 
ATOM   5386 O O   . CYS D 4  172 ? 29.912 -35.118 36.753  1.00 42.95  ? 171 CYS U O   1 
ATOM   5387 C CB  . CYS D 4  172 ? 28.563 -32.579 35.163  1.00 42.87  ? 171 CYS U CB  1 
ATOM   5388 S SG  . CYS D 4  172 ? 30.020 -31.730 35.868  1.00 50.92  ? 171 CYS U SG  1 
ATOM   5389 N N   . ASN D 4  173 ? 28.919 -35.712 34.830  1.00 43.06  ? 172 ASN U N   1 
ATOM   5390 C CA  . ASN D 4  173 ? 29.803 -36.865 34.659  1.00 42.35  ? 172 ASN U CA  1 
ATOM   5391 C C   . ASN D 4  173 ? 30.623 -36.917 33.379  1.00 40.69  ? 172 ASN U C   1 
ATOM   5392 O O   . ASN D 4  173 ? 30.581 -37.901 32.648  1.00 39.42  ? 172 ASN U O   1 
ATOM   5393 C CB  . ASN D 4  173 ? 28.999 -38.145 34.780  1.00 43.40  ? 172 ASN U CB  1 
ATOM   5394 C CG  . ASN D 4  173 ? 27.809 -38.142 33.876  1.00 50.40  ? 172 ASN U CG  1 
ATOM   5395 O OD1 . ASN D 4  173 ? 27.350 -37.080 33.448  1.00 50.72  ? 172 ASN U OD1 1 
ATOM   5396 N ND2 . ASN D 4  173 ? 27.289 -39.330 33.572  1.00 54.60  ? 172 ASN U ND2 1 
ATOM   5397 N N   . THR D 4  174 ? 31.366 -35.852 33.112  1.00 41.39  ? 173 THR U N   1 
ATOM   5398 C CA  . THR D 4  174 ? 32.238 -35.798 31.952  1.00 41.54  ? 173 THR U CA  1 
ATOM   5399 C C   . THR D 4  174 ? 33.533 -35.201 32.480  1.00 43.67  ? 173 THR U C   1 
ATOM   5400 O O   . THR D 4  174 ? 33.517 -34.338 33.360  1.00 43.63  ? 173 THR U O   1 
ATOM   5401 C CB  . THR D 4  174 ? 31.660 -34.919 30.812  1.00 39.76  ? 173 THR U CB  1 
ATOM   5402 O OG1 . THR D 4  174 ? 31.544 -33.563 31.248  1.00 42.68  ? 173 THR U OG1 1 
ATOM   5403 C CG2 . THR D 4  174 ? 30.289 -35.423 30.396  1.00 37.41  ? 173 THR U CG2 1 
ATOM   5404 N N   . THR D 4  175 ? 34.653 -35.681 31.959  1.00 43.89  ? 174 THR U N   1 
ATOM   5405 C CA  . THR D 4  175 ? 35.966 -35.228 32.391  1.00 45.23  ? 174 THR U CA  1 
ATOM   5406 C C   . THR D 4  175 ? 36.080 -33.738 32.721  1.00 45.16  ? 174 THR U C   1 
ATOM   5407 O O   . THR D 4  175 ? 35.763 -32.880 31.895  1.00 45.89  ? 174 THR U O   1 
ATOM   5408 C CB  . THR D 4  175 ? 37.019 -35.576 31.339  1.00 46.59  ? 174 THR U CB  1 
ATOM   5409 O OG1 . THR D 4  175 ? 36.899 -36.961 30.990  1.00 48.90  ? 174 THR U OG1 1 
ATOM   5410 C CG2 . THR D 4  175 ? 38.409 -35.326 31.886  1.00 48.50  ? 174 THR U CG2 1 
ATOM   5411 N N   . LYS D 4  176 ? 36.538 -33.451 33.939  1.00 43.90  ? 175 LYS U N   1 
ATOM   5412 C CA  . LYS D 4  176 ? 36.735 -32.088 34.427  1.00 42.17  ? 175 LYS U CA  1 
ATOM   5413 C C   . LYS D 4  176 ? 35.589 -31.128 34.075  1.00 42.13  ? 175 LYS U C   1 
ATOM   5414 O O   . LYS D 4  176 ? 35.819 -29.946 33.805  1.00 41.27  ? 175 LYS U O   1 
ATOM   5415 C CB  . LYS D 4  176 ? 38.036 -31.522 33.862  1.00 43.15  ? 175 LYS U CB  1 
ATOM   5416 C CG  . LYS D 4  176 ? 39.272 -32.377 34.037  1.00 41.33  ? 175 LYS U CG  1 
ATOM   5417 C CD  . LYS D 4  176 ? 40.205 -32.075 32.874  1.00 47.24  ? 175 LYS U CD  1 
ATOM   5418 C CE  . LYS D 4  176 ? 41.649 -32.429 33.143  1.00 49.13  ? 175 LYS U CE  1 
ATOM   5419 N NZ  . LYS D 4  176 ? 42.282 -31.505 34.124  1.00 53.61  ? 175 LYS U NZ  1 
ATOM   5420 N N   . CYS D 4  177 ? 34.359 -31.626 34.080  1.00 40.86  ? 176 CYS U N   1 
ATOM   5421 C CA  . CYS D 4  177 ? 33.212 -30.792 33.749  1.00 39.96  ? 176 CYS U CA  1 
ATOM   5422 C C   . CYS D 4  177 ? 32.942 -29.763 34.844  1.00 40.58  ? 176 CYS U C   1 
ATOM   5423 O O   . CYS D 4  177 ? 32.143 -28.848 34.666  1.00 40.70  ? 176 CYS U O   1 
ATOM   5424 C CB  . CYS D 4  177 ? 31.984 -31.675 33.553  1.00 41.70  ? 176 CYS U CB  1 
ATOM   5425 S SG  . CYS D 4  177 ? 31.604 -32.687 35.022  1.00 46.58  ? 176 CYS U SG  1 
ATOM   5426 N N   . ASN D 4  178 ? 33.604 -29.914 35.984  1.00 40.66  ? 177 ASN U N   1 
ATOM   5427 C CA  . ASN D 4  178 ? 33.410 -28.984 37.083  1.00 40.53  ? 177 ASN U CA  1 
ATOM   5428 C C   . ASN D 4  178 ? 34.509 -27.927 37.156  1.00 42.23  ? 177 ASN U C   1 
ATOM   5429 O O   . ASN D 4  178 ? 34.705 -27.306 38.200  1.00 43.90  ? 177 ASN U O   1 
ATOM   5430 C CB  . ASN D 4  178 ? 33.318 -29.742 38.414  1.00 39.57  ? 177 ASN U CB  1 
ATOM   5431 C CG  . ASN D 4  178 ? 34.590 -30.496 38.758  1.00 39.22  ? 177 ASN U CG  1 
ATOM   5432 O OD1 . ASN D 4  178 ? 34.726 -31.028 39.858  1.00 41.55  ? 177 ASN U OD1 1 
ATOM   5433 N ND2 . ASN D 4  178 ? 35.523 -30.549 37.823  1.00 41.39  ? 177 ASN U ND2 1 
ATOM   5434 N N   . GLU D 4  179 ? 35.213 -27.712 36.045  1.00 42.75  ? 178 GLU U N   1 
ATOM   5435 C CA  . GLU D 4  179 ? 36.287 -26.718 36.003  1.00 44.33  ? 178 GLU U CA  1 
ATOM   5436 C C   . GLU D 4  179 ? 35.743 -25.315 35.719  1.00 42.34  ? 178 GLU U C   1 
ATOM   5437 O O   . GLU D 4  179 ? 34.540 -25.137 35.505  1.00 39.05  ? 178 GLU U O   1 
ATOM   5438 C CB  . GLU D 4  179 ? 37.321 -27.093 34.935  1.00 47.80  ? 178 GLU U CB  1 
ATOM   5439 C CG  . GLU D 4  179 ? 36.922 -26.724 33.505  1.00 55.62  ? 178 GLU U CG  1 
ATOM   5440 C CD  . GLU D 4  179 ? 37.841 -27.340 32.452  1.00 58.54  ? 178 GLU U CD  1 
ATOM   5441 O OE1 . GLU D 4  179 ? 39.058 -27.465 32.724  1.00 59.51  ? 178 GLU U OE1 1 
ATOM   5442 O OE2 . GLU D 4  179 ? 37.344 -27.685 31.351  1.00 59.03  ? 178 GLU U OE2 1 
ATOM   5443 N N   . GLY D 4  180 ? 36.633 -24.324 35.730  1.00 42.10  ? 179 GLY U N   1 
ATOM   5444 C CA  . GLY D 4  180 ? 36.227 -22.949 35.474  1.00 43.19  ? 179 GLY U CA  1 
ATOM   5445 C C   . GLY D 4  180 ? 36.321 -22.010 36.670  1.00 44.14  ? 179 GLY U C   1 
ATOM   5446 O O   . GLY D 4  180 ? 36.753 -22.417 37.749  1.00 45.98  ? 179 GLY U O   1 
ATOM   5447 N N   . PRO D 4  181 ? 35.930 -20.733 36.508  1.00 43.97  ? 180 PRO U N   1 
ATOM   5448 C CA  . PRO D 4  181 ? 35.979 -19.752 37.601  1.00 42.89  ? 180 PRO U CA  1 
ATOM   5449 C C   . PRO D 4  181 ? 34.992 -20.183 38.665  1.00 41.54  ? 180 PRO U C   1 
ATOM   5450 O O   . PRO D 4  181 ? 33.945 -20.743 38.336  1.00 43.14  ? 180 PRO U O   1 
ATOM   5451 C CB  . PRO D 4  181 ? 35.536 -18.450 36.931  1.00 42.55  ? 180 PRO U CB  1 
ATOM   5452 C CG  . PRO D 4  181 ? 35.891 -18.662 35.479  1.00 45.62  ? 180 PRO U CG  1 
ATOM   5453 C CD  . PRO D 4  181 ? 35.480 -20.100 35.257  1.00 44.61  ? 180 PRO U CD  1 
ATOM   5454 N N   . ILE D 4  182 ? 35.301 -19.936 39.933  1.00 39.12  ? 181 ILE U N   1 
ATOM   5455 C CA  . ILE D 4  182 ? 34.363 -20.349 40.963  1.00 39.54  ? 181 ILE U CA  1 
ATOM   5456 C C   . ILE D 4  182 ? 33.135 -19.463 40.861  1.00 39.46  ? 181 ILE U C   1 
ATOM   5457 O O   . ILE D 4  182 ? 33.239 -18.261 40.606  1.00 39.62  ? 181 ILE U O   1 
ATOM   5458 C CB  . ILE D 4  182 ? 34.967 -20.264 42.376  1.00 41.36  ? 181 ILE U CB  1 
ATOM   5459 C CG1 . ILE D 4  182 ? 35.315 -18.818 42.721  1.00 40.93  ? 181 ILE U CG1 1 
ATOM   5460 C CG2 . ILE D 4  182 ? 36.181 -21.176 42.463  1.00 40.45  ? 181 ILE U CG2 1 
ATOM   5461 C CD1 . ILE D 4  182 ? 35.575 -18.617 44.191  1.00 41.36  ? 181 ILE U CD1 1 
ATOM   5462 N N   . LEU D 4  183 ? 31.969 -20.069 41.055  1.00 37.33  ? 182 LEU U N   1 
ATOM   5463 C CA  . LEU D 4  183 ? 30.703 -19.359 40.951  1.00 36.10  ? 182 LEU U CA  1 
ATOM   5464 C C   . LEU D 4  183 ? 30.359 -18.498 42.167  1.00 35.68  ? 182 LEU U C   1 
ATOM   5465 O O   . LEU D 4  183 ? 30.274 -18.994 43.292  1.00 36.29  ? 182 LEU U O   1 
ATOM   5466 C CB  . LEU D 4  183 ? 29.582 -20.376 40.697  1.00 37.39  ? 182 LEU U CB  1 
ATOM   5467 C CG  . LEU D 4  183 ? 28.218 -19.957 40.143  1.00 37.48  ? 182 LEU U CG  1 
ATOM   5468 C CD1 . LEU D 4  183 ? 27.349 -21.196 40.027  1.00 40.22  ? 182 LEU U CD1 1 
ATOM   5469 C CD2 . LEU D 4  183 ? 27.550 -18.946 41.048  1.00 41.82  ? 182 LEU U CD2 1 
ATOM   5470 N N   . GLU D 4  184 ? 30.171 -17.202 41.936  1.00 34.02  ? 183 GLU U N   1 
ATOM   5471 C CA  . GLU D 4  184 ? 29.788 -16.287 43.001  1.00 33.28  ? 183 GLU U CA  1 
ATOM   5472 C C   . GLU D 4  184 ? 28.404 -15.756 42.622  1.00 32.26  ? 183 GLU U C   1 
ATOM   5473 O O   . GLU D 4  184 ? 28.081 -15.641 41.442  1.00 32.60  ? 183 GLU U O   1 
ATOM   5474 C CB  . GLU D 4  184 ? 30.794 -15.133 43.133  1.00 34.65  ? 183 GLU U CB  1 
ATOM   5475 C CG  . GLU D 4  184 ? 32.222 -15.538 43.532  1.00 39.52  ? 183 GLU U CG  1 
ATOM   5476 C CD  . GLU D 4  184 ? 32.303 -16.373 44.819  1.00 43.94  ? 183 GLU U CD  1 
ATOM   5477 O OE1 . GLU D 4  184 ? 31.399 -16.280 45.678  1.00 46.25  ? 183 GLU U OE1 1 
ATOM   5478 O OE2 . GLU D 4  184 ? 33.292 -17.117 44.982  1.00 44.92  ? 183 GLU U OE2 1 
ATOM   5479 N N   . LEU D 4  185 ? 27.582 -15.453 43.616  1.00 29.58  ? 184 LEU U N   1 
ATOM   5480 C CA  . LEU D 4  185 ? 26.242 -14.958 43.356  1.00 28.88  ? 184 LEU U CA  1 
ATOM   5481 C C   . LEU D 4  185 ? 26.261 -13.634 42.606  1.00 29.28  ? 184 LEU U C   1 
ATOM   5482 O O   . LEU D 4  185 ? 25.355 -13.326 41.837  1.00 29.89  ? 184 LEU U O   1 
ATOM   5483 C CB  . LEU D 4  185 ? 25.480 -14.789 44.671  1.00 26.87  ? 184 LEU U CB  1 
ATOM   5484 C CG  . LEU D 4  185 ? 24.028 -14.323 44.536  1.00 27.65  ? 184 LEU U CG  1 
ATOM   5485 C CD1 . LEU D 4  185 ? 23.233 -15.355 43.725  1.00 26.78  ? 184 LEU U CD1 1 
ATOM   5486 C CD2 . LEU D 4  185 ? 23.410 -14.135 45.914  1.00 25.09  ? 184 LEU U CD2 1 
ATOM   5487 N N   . GLU D 4  186 ? 27.304 -12.852 42.833  1.00 31.02  ? 185 GLU U N   1 
ATOM   5488 C CA  . GLU D 4  186 ? 27.433 -11.547 42.202  1.00 32.60  ? 185 GLU U CA  1 
ATOM   5489 C C   . GLU D 4  186 ? 27.695 -11.644 40.696  1.00 28.43  ? 185 GLU U C   1 
ATOM   5490 O O   . GLU D 4  186 ? 27.535 -10.671 39.961  1.00 28.01  ? 185 GLU U O   1 
ATOM   5491 C CB  . GLU D 4  186 ? 28.549 -10.759 42.897  1.00 39.74  ? 185 GLU U CB  1 
ATOM   5492 C CG  . GLU D 4  186 ? 28.304 -10.473 44.398  1.00 51.11  ? 185 GLU U CG  1 
ATOM   5493 C CD  . GLU D 4  186 ? 28.292 -11.729 45.299  1.00 57.35  ? 185 GLU U CD  1 
ATOM   5494 O OE1 . GLU D 4  186 ? 29.183 -12.597 45.156  1.00 58.79  ? 185 GLU U OE1 1 
ATOM   5495 O OE2 . GLU D 4  186 ? 27.399 -11.838 46.172  1.00 59.73  ? 185 GLU U OE2 1 
ATOM   5496 N N   . ASN D 4  187 ? 28.088 -12.823 40.240  1.00 29.01  ? 186 ASN U N   1 
ATOM   5497 C CA  . ASN D 4  187 ? 28.354 -13.038 38.826  1.00 28.80  ? 186 ASN U CA  1 
ATOM   5498 C C   . ASN D 4  187 ? 27.179 -13.633 38.085  1.00 29.14  ? 186 ASN U C   1 
ATOM   5499 O O   . ASN D 4  187 ? 27.321 -14.047 36.935  1.00 28.80  ? 186 ASN U O   1 
ATOM   5500 C CB  . ASN D 4  187 ? 29.572 -13.928 38.631  1.00 28.89  ? 186 ASN U CB  1 
ATOM   5501 C CG  . ASN D 4  187 ? 30.860 -13.192 38.908  1.00 34.43  ? 186 ASN U CG  1 
ATOM   5502 O OD1 . ASN D 4  187 ? 30.967 -11.994 38.629  1.00 33.91  ? 186 ASN U OD1 1 
ATOM   5503 N ND2 . ASN D 4  187 ? 31.852 -13.900 39.446  1.00 36.47  ? 186 ASN U ND2 1 
ATOM   5504 N N   . LEU D 4  188 ? 26.034 -13.700 38.761  1.00 27.63  ? 187 LEU U N   1 
ATOM   5505 C CA  . LEU D 4  188 ? 24.801 -14.196 38.168  1.00 25.61  ? 187 LEU U CA  1 
ATOM   5506 C C   . LEU D 4  188 ? 23.946 -12.950 38.054  1.00 25.71  ? 187 LEU U C   1 
ATOM   5507 O O   . LEU D 4  188 ? 23.721 -12.246 39.036  1.00 29.45  ? 187 LEU U O   1 
ATOM   5508 C CB  . LEU D 4  188 ? 24.126 -15.227 39.068  1.00 24.32  ? 187 LEU U CB  1 
ATOM   5509 C CG  . LEU D 4  188 ? 24.866 -16.558 39.109  1.00 22.89  ? 187 LEU U CG  1 
ATOM   5510 C CD1 . LEU D 4  188 ? 24.137 -17.514 40.027  1.00 25.91  ? 187 LEU U CD1 1 
ATOM   5511 C CD2 . LEU D 4  188 ? 24.968 -17.127 37.707  1.00 22.24  ? 187 LEU U CD2 1 
ATOM   5512 N N   . PRO D 4  189 ? 23.454 -12.656 36.848  1.00 25.14  ? 188 PRO U N   1 
ATOM   5513 C CA  . PRO D 4  189 ? 22.634 -11.463 36.652  1.00 24.42  ? 188 PRO U CA  1 
ATOM   5514 C C   . PRO D 4  189 ? 21.225 -11.532 37.213  1.00 25.37  ? 188 PRO U C   1 
ATOM   5515 O O   . PRO D 4  189 ? 20.612 -12.603 37.239  1.00 28.31  ? 188 PRO U O   1 
ATOM   5516 C CB  . PRO D 4  189 ? 22.620 -11.326 35.135  1.00 24.68  ? 188 PRO U CB  1 
ATOM   5517 C CG  . PRO D 4  189 ? 22.511 -12.771 34.715  1.00 21.10  ? 188 PRO U CG  1 
ATOM   5518 C CD  . PRO D 4  189 ? 23.518 -13.461 35.611  1.00 21.07  ? 188 PRO U CD  1 
ATOM   5519 N N   . GLN D 4  190 ? 20.719 -10.387 37.662  1.00 24.06  ? 189 GLN U N   1 
ATOM   5520 C CA  . GLN D 4  190 ? 19.341 -10.296 38.139  1.00 25.51  ? 189 GLN U CA  1 
ATOM   5521 C C   . GLN D 4  190 ? 18.492 -10.610 36.894  1.00 26.45  ? 189 GLN U C   1 
ATOM   5522 O O   . GLN D 4  190 ? 18.735 -10.058 35.805  1.00 24.19  ? 189 GLN U O   1 
ATOM   5523 C CB  . GLN D 4  190 ? 19.000 -8.871  38.606  1.00 25.83  ? 189 GLN U CB  1 
ATOM   5524 C CG  . GLN D 4  190 ? 19.697 -8.391  39.863  1.00 28.19  ? 189 GLN U CG  1 
ATOM   5525 C CD  . GLN D 4  190 ? 20.988 -7.633  39.601  1.00 33.41  ? 189 GLN U CD  1 
ATOM   5526 O OE1 . GLN D 4  190 ? 21.284 -6.663  40.293  1.00 41.22  ? 189 GLN U OE1 1 
ATOM   5527 N NE2 . GLN D 4  190 ? 21.766 -8.077  38.623  1.00 28.04  ? 189 GLN U NE2 1 
ATOM   5528 N N   . ASN D 4  191 ? 17.489 -11.467 37.049  1.00 25.31  ? 190 ASN U N   1 
ATOM   5529 C CA  . ASN D 4  191 ? 16.660 -11.848 35.910  1.00 24.04  ? 190 ASN U CA  1 
ATOM   5530 C C   . ASN D 4  191 ? 15.353 -11.078 35.772  1.00 23.08  ? 190 ASN U C   1 
ATOM   5531 O O   . ASN D 4  191 ? 14.706 -11.141 34.729  1.00 22.58  ? 190 ASN U O   1 
ATOM   5532 C CB  . ASN D 4  191 ? 16.386 -13.360 35.951  1.00 24.41  ? 190 ASN U CB  1 
ATOM   5533 C CG  . ASN D 4  191 ? 15.907 -13.837 37.320  1.00 22.27  ? 190 ASN U CG  1 
ATOM   5534 O OD1 . ASN D 4  191 ? 15.018 -13.232 37.908  1.00 25.78  ? 190 ASN U OD1 1 
ATOM   5535 N ND2 . ASN D 4  191 ? 16.489 -14.934 37.822  1.00 22.32  ? 190 ASN U ND2 1 
ATOM   5536 N N   . GLY D 4  192 ? 14.976 -10.340 36.817  1.00 23.19  ? 191 GLY U N   1 
ATOM   5537 C CA  . GLY D 4  192 ? 13.735 -9.574  36.787  1.00 20.68  ? 191 GLY U CA  1 
ATOM   5538 C C   . GLY D 4  192 ? 12.672 -10.120 37.725  1.00 22.56  ? 191 GLY U C   1 
ATOM   5539 O O   . GLY D 4  192 ? 11.785 -9.392  38.174  1.00 22.94  ? 191 GLY U O   1 
ATOM   5540 N N   . ARG D 4  193 ? 12.757 -11.419 37.997  1.00 21.96  ? 192 ARG U N   1 
ATOM   5541 C CA  . ARG D 4  193 ? 11.837 -12.108 38.896  1.00 22.73  ? 192 ARG U CA  1 
ATOM   5542 C C   . ARG D 4  193 ? 12.096 -11.615 40.311  1.00 24.74  ? 192 ARG U C   1 
ATOM   5543 O O   . ARG D 4  193 ? 13.246 -11.467 40.714  1.00 23.72  ? 192 ARG U O   1 
ATOM   5544 C CB  . ARG D 4  193 ? 12.095 -13.619 38.863  1.00 22.87  ? 192 ARG U CB  1 
ATOM   5545 C CG  . ARG D 4  193 ? 11.234 -14.442 39.828  1.00 21.73  ? 192 ARG U CG  1 
ATOM   5546 C CD  . ARG D 4  193 ? 9.807  -14.563 39.316  1.00 23.77  ? 192 ARG U CD  1 
ATOM   5547 N NE  . ARG D 4  193 ? 9.772  -15.235 38.014  1.00 28.52  ? 192 ARG U NE  1 
ATOM   5548 C CZ  . ARG D 4  193 ? 8.966  -14.869 37.033  1.00 34.07  ? 192 ARG U CZ  1 
ATOM   5549 N NH1 . ARG D 4  193 ? 8.137  -13.857 37.219  1.00 46.78  ? 192 ARG U NH1 1 
ATOM   5550 N NH2 . ARG D 4  193 ? 9.008  -15.479 35.866  1.00 33.55  ? 192 ARG U NH2 1 
ATOM   5551 N N   . GLN D 4  194 ? 11.031 -11.366 41.061  1.00 25.50  ? 193 GLN U N   1 
ATOM   5552 C CA  . GLN D 4  194 ? 11.174 -10.927 42.439  1.00 30.57  ? 193 GLN U CA  1 
ATOM   5553 C C   . GLN D 4  194 ? 10.426 -11.887 43.355  1.00 31.48  ? 193 GLN U C   1 
ATOM   5554 O O   . GLN D 4  194 ? 9.257  -12.202 43.117  1.00 32.28  ? 193 GLN U O   1 
ATOM   5555 C CB  . GLN D 4  194 ? 10.641 -9.507  42.599  1.00 33.37  ? 193 GLN U CB  1 
ATOM   5556 C CG  . GLN D 4  194 ? 11.622 -8.466  42.126  1.00 37.49  ? 193 GLN U CG  1 
ATOM   5557 C CD  . GLN D 4  194 ? 11.044 -7.082  42.153  1.00 42.28  ? 193 GLN U CD  1 
ATOM   5558 O OE1 . GLN D 4  194 ? 11.780 -6.100  42.180  1.00 51.18  ? 193 GLN U OE1 1 
ATOM   5559 N NE2 . GLN D 4  194 ? 9.717  -6.987  42.132  1.00 44.65  ? 193 GLN U NE2 1 
ATOM   5560 N N   . CYS D 4  195 ? 11.111 -12.355 44.394  1.00 30.42  ? 194 CYS U N   1 
ATOM   5561 C CA  . CYS D 4  195 ? 10.527 -13.299 45.340  1.00 30.17  ? 194 CYS U CA  1 
ATOM   5562 C C   . CYS D 4  195 ? 10.755 -12.841 46.758  1.00 30.69  ? 194 CYS U C   1 
ATOM   5563 O O   . CYS D 4  195 ? 11.726 -12.139 47.027  1.00 30.99  ? 194 CYS U O   1 
ATOM   5564 C CB  . CYS D 4  195 ? 11.160 -14.680 45.178  1.00 28.97  ? 194 CYS U CB  1 
ATOM   5565 S SG  . CYS D 4  195 ? 10.959 -15.421 43.528  1.00 33.45  ? 194 CYS U SG  1 
ATOM   5566 N N   . TYR D 4  196 ? 9.868  -13.257 47.661  1.00 29.85  ? 195 TYR U N   1 
ATOM   5567 C CA  . TYR D 4  196 ? 9.989  -12.886 49.063  1.00 27.81  ? 195 TYR U CA  1 
ATOM   5568 C C   . TYR D 4  196 ? 11.014 -13.741 49.769  1.00 29.08  ? 195 TYR U C   1 
ATOM   5569 O O   . TYR D 4  196 ? 11.161 -14.926 49.469  1.00 31.42  ? 195 TYR U O   1 
ATOM   5570 C CB  . TYR D 4  196 ? 8.636  -12.986 49.757  1.00 22.14  ? 195 TYR U CB  1 
ATOM   5571 C CG  . TYR D 4  196 ? 7.778  -11.791 49.443  1.00 23.70  ? 195 TYR U CG  1 
ATOM   5572 C CD1 . TYR D 4  196 ? 8.024  -10.556 50.044  1.00 20.51  ? 195 TYR U CD1 1 
ATOM   5573 C CD2 . TYR D 4  196 ? 6.775  -11.866 48.477  1.00 24.10  ? 195 TYR U CD2 1 
ATOM   5574 C CE1 . TYR D 4  196 ? 7.298  -9.426  49.685  1.00 24.07  ? 195 TYR U CE1 1 
ATOM   5575 C CE2 . TYR D 4  196 ? 6.042  -10.742 48.105  1.00 26.37  ? 195 TYR U CE2 1 
ATOM   5576 C CZ  . TYR D 4  196 ? 6.308  -9.521  48.710  1.00 26.16  ? 195 TYR U CZ  1 
ATOM   5577 O OH  . TYR D 4  196 ? 5.595  -8.404  48.315  1.00 25.30  ? 195 TYR U OH  1 
ATOM   5578 N N   . SER D 4  197 ? 11.740 -13.114 50.692  1.00 29.79  ? 196 SER U N   1 
ATOM   5579 C CA  . SER D 4  197 ? 12.778 -13.784 51.461  1.00 30.72  ? 196 SER U CA  1 
ATOM   5580 C C   . SER D 4  197 ? 12.454 -13.758 52.950  1.00 32.17  ? 196 SER U C   1 
ATOM   5581 O O   . SER D 4  197 ? 11.838 -12.813 53.438  1.00 33.71  ? 196 SER U O   1 
ATOM   5582 C CB  . SER D 4  197 ? 14.124 -13.099 51.233  1.00 30.55  ? 196 SER U CB  1 
ATOM   5583 O OG  . SER D 4  197 ? 15.145 -13.745 51.971  1.00 31.08  ? 196 SER U OG  1 
ATOM   5584 N N   . CYS D 4  198 ? 12.866 -14.806 53.659  1.00 34.36  ? 197 CYS U N   1 
ATOM   5585 C CA  . CYS D 4  198 ? 12.643 -14.918 55.099  1.00 34.70  ? 197 CYS U CA  1 
ATOM   5586 C C   . CYS D 4  198 ? 13.193 -16.251 55.592  1.00 34.36  ? 197 CYS U C   1 
ATOM   5587 O O   . CYS D 4  198 ? 13.599 -17.099 54.800  1.00 35.45  ? 197 CYS U O   1 
ATOM   5588 C CB  . CYS D 4  198 ? 11.137 -14.808 55.440  1.00 34.79  ? 197 CYS U CB  1 
ATOM   5589 S SG  . CYS D 4  198 ? 10.122 -16.256 54.985  1.00 40.31  ? 197 CYS U SG  1 
ATOM   5590 N N   . LYS D 4  199 ? 13.220 -16.418 56.908  1.00 36.12  ? 198 LYS U N   1 
ATOM   5591 C CA  . LYS D 4  199 ? 13.692 -17.647 57.536  1.00 37.57  ? 198 LYS U CA  1 
ATOM   5592 C C   . LYS D 4  199 ? 13.184 -17.664 58.981  1.00 38.80  ? 198 LYS U C   1 
ATOM   5593 O O   . LYS D 4  199 ? 13.113 -16.614 59.633  1.00 37.75  ? 198 LYS U O   1 
ATOM   5594 C CB  . LYS D 4  199 ? 15.219 -17.718 57.516  1.00 37.55  ? 198 LYS U CB  1 
ATOM   5595 C CG  . LYS D 4  199 ? 15.883 -16.586 58.277  1.00 45.04  ? 198 LYS U CG  1 
ATOM   5596 C CD  . LYS D 4  199 ? 17.377 -16.798 58.421  1.00 47.81  ? 198 LYS U CD  1 
ATOM   5597 C CE  . LYS D 4  199 ? 18.009 -15.621 59.136  1.00 49.18  ? 198 LYS U CE  1 
ATOM   5598 N NZ  . LYS D 4  199 ? 17.273 -15.325 60.392  1.00 54.27  ? 198 LYS U NZ  1 
ATOM   5599 N N   . GLY D 4  200 ? 12.825 -18.856 59.461  1.00 39.55  ? 199 GLY U N   1 
ATOM   5600 C CA  . GLY D 4  200 ? 12.307 -19.018 60.814  1.00 38.85  ? 199 GLY U CA  1 
ATOM   5601 C C   . GLY D 4  200 ? 10.973 -19.756 60.882  1.00 37.23  ? 199 GLY U C   1 
ATOM   5602 O O   . GLY D 4  200 ? 10.836 -20.849 60.347  1.00 38.36  ? 199 GLY U O   1 
ATOM   5603 N N   . ASN D 4  201 ? 9.993  -19.156 61.549  1.00 36.93  ? 200 ASN U N   1 
ATOM   5604 C CA  . ASN D 4  201 ? 8.660  -19.740 61.704  1.00 39.74  ? 200 ASN U CA  1 
ATOM   5605 C C   . ASN D 4  201 ? 7.722  -18.870 60.902  1.00 38.41  ? 200 ASN U C   1 
ATOM   5606 O O   . ASN D 4  201 ? 8.109  -17.814 60.426  1.00 38.41  ? 200 ASN U O   1 
ATOM   5607 C CB  . ASN D 4  201 ? 8.182  -19.677 63.168  1.00 49.90  ? 200 ASN U CB  1 
ATOM   5608 C CG  . ASN D 4  201 ? 9.134  -20.338 64.134  1.00 55.92  ? 200 ASN U CG  1 
ATOM   5609 O OD1 . ASN D 4  201 ? 9.175  -21.561 64.247  1.00 63.43  ? 200 ASN U OD1 1 
ATOM   5610 N ND2 . ASN D 4  201 ? 9.913  -19.526 64.839  1.00 59.61  ? 200 ASN U ND2 1 
ATOM   5611 N N   . SER D 4  202 ? 6.472  -19.289 60.785  1.00 36.99  ? 201 SER U N   1 
ATOM   5612 C CA  . SER D 4  202 ? 5.517  -18.486 60.054  1.00 40.60  ? 201 SER U CA  1 
ATOM   5613 C C   . SER D 4  202 ? 5.146  -17.272 60.894  1.00 41.52  ? 201 SER U C   1 
ATOM   5614 O O   . SER D 4  202 ? 4.641  -16.278 60.373  1.00 42.73  ? 201 SER U O   1 
ATOM   5615 C CB  . SER D 4  202 ? 4.268  -19.306 59.724  1.00 41.96  ? 201 SER U CB  1 
ATOM   5616 O OG  . SER D 4  202 ? 3.677  -19.828 60.894  1.00 45.96  ? 201 SER U OG  1 
ATOM   5617 N N   . THR D 4  203 ? 5.409  -17.353 62.195  1.00 44.22  ? 202 THR U N   1 
ATOM   5618 C CA  . THR D 4  203 ? 5.090  -16.256 63.109  1.00 45.23  ? 202 THR U CA  1 
ATOM   5619 C C   . THR D 4  203 ? 6.334  -15.468 63.487  1.00 45.14  ? 202 THR U C   1 
ATOM   5620 O O   . THR D 4  203 ? 6.264  -14.268 63.770  1.00 44.45  ? 202 THR U O   1 
ATOM   5621 C CB  . THR D 4  203 ? 4.442  -16.778 64.421  1.00 44.44  ? 202 THR U CB  1 
ATOM   5622 O OG1 . THR D 4  203 ? 5.347  -17.675 65.082  1.00 44.27  ? 202 THR U OG1 1 
ATOM   5623 C CG2 . THR D 4  203 ? 3.137  -17.503 64.124  1.00 42.99  ? 202 THR U CG2 1 
ATOM   5624 N N   . HIS D 4  204 ? 7.470  -16.156 63.485  1.00 44.62  ? 203 HIS U N   1 
ATOM   5625 C CA  . HIS D 4  204 ? 8.735  -15.544 63.854  1.00 46.61  ? 203 HIS U CA  1 
ATOM   5626 C C   . HIS D 4  204 ? 9.824  -15.760 62.813  1.00 47.86  ? 203 HIS U C   1 
ATOM   5627 O O   . HIS D 4  204 ? 10.565 -16.740 62.878  1.00 46.91  ? 203 HIS U O   1 
ATOM   5628 C CB  . HIS D 4  204 ? 9.184  -16.097 65.209  1.00 48.26  ? 203 HIS U CB  1 
ATOM   5629 C CG  . HIS D 4  204 ? 8.289  -15.695 66.342  1.00 51.01  ? 203 HIS U CG  1 
ATOM   5630 N ND1 . HIS D 4  204 ? 8.442  -14.509 67.026  1.00 52.06  ? 203 HIS U ND1 1 
ATOM   5631 C CD2 . HIS D 4  204 ? 7.192  -16.291 66.866  1.00 49.45  ? 203 HIS U CD2 1 
ATOM   5632 C CE1 . HIS D 4  204 ? 7.479  -14.391 67.922  1.00 54.33  ? 203 HIS U CE1 1 
ATOM   5633 N NE2 . HIS D 4  204 ? 6.707  -15.459 67.845  1.00 52.75  ? 203 HIS U NE2 1 
ATOM   5634 N N   . GLY D 4  205 ? 9.916  -14.827 61.865  1.00 47.58  ? 204 GLY U N   1 
ATOM   5635 C CA  . GLY D 4  205 ? 10.914 -14.916 60.810  1.00 46.55  ? 204 GLY U CA  1 
ATOM   5636 C C   . GLY D 4  205 ? 10.292 -14.759 59.436  1.00 45.45  ? 204 GLY U C   1 
ATOM   5637 O O   . GLY D 4  205 ? 10.830 -14.062 58.572  1.00 44.86  ? 204 GLY U O   1 
ATOM   5638 N N   . CYS D 4  206 ? 9.141  -15.402 59.248  1.00 44.05  ? 205 CYS U N   1 
ATOM   5639 C CA  . CYS D 4  206 ? 8.419  -15.370 57.984  1.00 43.54  ? 205 CYS U CA  1 
ATOM   5640 C C   . CYS D 4  206 ? 7.021  -14.781 58.093  1.00 42.02  ? 205 CYS U C   1 
ATOM   5641 O O   . CYS D 4  206 ? 6.051  -15.352 57.601  1.00 42.15  ? 205 CYS U O   1 
ATOM   5642 C CB  . CYS D 4  206 ? 8.342  -16.776 57.393  1.00 40.78  ? 205 CYS U CB  1 
ATOM   5643 S SG  . CYS D 4  206 ? 9.921  -17.357 56.699  1.00 45.42  ? 205 CYS U SG  1 
ATOM   5644 N N   . SER D 4  207 ? 6.932  -13.628 58.740  1.00 41.12  ? 206 SER U N   1 
ATOM   5645 C CA  . SER D 4  207 ? 5.669  -12.930 58.903  1.00 43.78  ? 206 SER U CA  1 
ATOM   5646 C C   . SER D 4  207 ? 5.556  -11.917 57.760  1.00 43.32  ? 206 SER U C   1 
ATOM   5647 O O   . SER D 4  207 ? 6.552  -11.623 57.104  1.00 43.59  ? 206 SER U O   1 
ATOM   5648 C CB  . SER D 4  207 ? 5.668  -12.210 60.254  1.00 45.76  ? 206 SER U CB  1 
ATOM   5649 O OG  . SER D 4  207 ? 4.529  -11.391 60.412  1.00 59.03  ? 206 SER U OG  1 
ATOM   5650 N N   . SER D 4  208 ? 4.356  -11.389 57.521  1.00 42.17  ? 207 SER U N   1 
ATOM   5651 C CA  . SER D 4  208 ? 4.145  -10.398 56.463  1.00 44.64  ? 207 SER U CA  1 
ATOM   5652 C C   . SER D 4  208 ? 5.001  -9.150  56.672  1.00 45.95  ? 207 SER U C   1 
ATOM   5653 O O   . SER D 4  208 ? 5.278  -8.417  55.721  1.00 45.30  ? 207 SER U O   1 
ATOM   5654 C CB  . SER D 4  208 ? 2.677  -9.958  56.406  1.00 44.71  ? 207 SER U CB  1 
ATOM   5655 O OG  . SER D 4  208 ? 1.819  -11.027 56.061  1.00 51.77  ? 207 SER U OG  1 
ATOM   5656 N N   . GLU D 4  209 ? 5.405  -8.910  57.921  1.00 47.16  ? 208 GLU U N   1 
ATOM   5657 C CA  . GLU D 4  209 ? 6.210  -7.740  58.271  1.00 48.44  ? 208 GLU U CA  1 
ATOM   5658 C C   . GLU D 4  209 ? 7.705  -8.026  58.313  1.00 46.07  ? 208 GLU U C   1 
ATOM   5659 O O   . GLU D 4  209 ? 8.510  -7.114  58.510  1.00 46.89  ? 208 GLU U O   1 
ATOM   5660 C CB  . GLU D 4  209 ? 5.794  -7.185  59.636  1.00 51.06  ? 208 GLU U CB  1 
ATOM   5661 C CG  . GLU D 4  209 ? 4.308  -6.961  59.820  1.00 59.40  ? 208 GLU U CG  1 
ATOM   5662 C CD  . GLU D 4  209 ? 3.578  -8.228  60.201  1.00 65.62  ? 208 GLU U CD  1 
ATOM   5663 O OE1 . GLU D 4  209 ? 3.303  -9.060  59.315  1.00 71.56  ? 208 GLU U OE1 1 
ATOM   5664 O OE2 . GLU D 4  209 ? 3.287  -8.402  61.399  1.00 71.33  ? 208 GLU U OE2 1 
ATOM   5665 N N   . GLU D 4  210 ? 8.080  -9.286  58.130  1.00 41.89  ? 209 GLU U N   1 
ATOM   5666 C CA  . GLU D 4  210 ? 9.487  -9.652  58.171  1.00 41.44  ? 209 GLU U CA  1 
ATOM   5667 C C   . GLU D 4  210 ? 9.999  -10.059 56.787  1.00 40.61  ? 209 GLU U C   1 
ATOM   5668 O O   . GLU D 4  210 ? 11.179 -9.890  56.461  1.00 40.35  ? 209 GLU U O   1 
ATOM   5669 C CB  . GLU D 4  210 ? 9.676  -10.807 59.143  1.00 42.15  ? 209 GLU U CB  1 
ATOM   5670 C CG  . GLU D 4  210 ? 8.786  -10.727 60.372  1.00 44.55  ? 209 GLU U CG  1 
ATOM   5671 C CD  . GLU D 4  210 ? 8.970  -11.926 61.283  1.00 46.88  ? 209 GLU U CD  1 
ATOM   5672 O OE1 . GLU D 4  210 ? 10.085 -12.080 61.832  1.00 49.10  ? 209 GLU U OE1 1 
ATOM   5673 O OE2 . GLU D 4  210 ? 8.010  -12.714 61.442  1.00 42.83  ? 209 GLU U OE2 1 
ATOM   5674 N N   . THR D 4  211 ? 9.097  -10.593 55.976  1.00 38.38  ? 210 THR U N   1 
ATOM   5675 C CA  . THR D 4  211 ? 9.436  -11.044 54.636  1.00 34.44  ? 210 THR U CA  1 
ATOM   5676 C C   . THR D 4  211 ? 9.462  -9.851  53.678  1.00 31.91  ? 210 THR U C   1 
ATOM   5677 O O   . THR D 4  211 ? 8.625  -8.959  53.765  1.00 33.09  ? 210 THR U O   1 
ATOM   5678 C CB  . THR D 4  211 ? 8.403  -12.084 54.160  1.00 31.10  ? 210 THR U CB  1 
ATOM   5679 O OG1 . THR D 4  211 ? 8.920  -12.782 53.026  1.00 40.78  ? 210 THR U OG1 1 
ATOM   5680 C CG2 . THR D 4  211 ? 7.094  -11.399 53.780  1.00 27.95  ? 210 THR U CG2 1 
ATOM   5681 N N   . PHE D 4  212 ? 10.431 -9.834  52.772  1.00 30.75  ? 211 PHE U N   1 
ATOM   5682 C CA  . PHE D 4  212 ? 10.560 -8.742  51.801  1.00 30.93  ? 211 PHE U CA  1 
ATOM   5683 C C   . PHE D 4  212 ? 11.099 -9.248  50.442  1.00 31.44  ? 211 PHE U C   1 
ATOM   5684 O O   . PHE D 4  212 ? 11.700 -10.326 50.348  1.00 31.05  ? 211 PHE U O   1 
ATOM   5685 C CB  . PHE D 4  212 ? 11.508 -7.675  52.355  1.00 28.49  ? 211 PHE U CB  1 
ATOM   5686 C CG  . PHE D 4  212 ? 12.923 -8.147  52.477  1.00 28.31  ? 211 PHE U CG  1 
ATOM   5687 C CD1 . PHE D 4  212 ? 13.895 -7.706  51.586  1.00 26.87  ? 211 PHE U CD1 1 
ATOM   5688 C CD2 . PHE D 4  212 ? 13.268 -9.094  53.434  1.00 26.27  ? 211 PHE U CD2 1 
ATOM   5689 C CE1 . PHE D 4  212 ? 15.191 -8.206  51.644  1.00 27.00  ? 211 PHE U CE1 1 
ATOM   5690 C CE2 . PHE D 4  212 ? 14.561 -9.603  53.500  1.00 26.72  ? 211 PHE U CE2 1 
ATOM   5691 C CZ  . PHE D 4  212 ? 15.526 -9.157  52.601  1.00 28.20  ? 211 PHE U CZ  1 
ATOM   5692 N N   . LEU D 4  213 ? 10.895 -8.449  49.398  1.00 30.02  ? 212 LEU U N   1 
ATOM   5693 C CA  . LEU D 4  213 ? 11.350 -8.807  48.056  1.00 30.16  ? 212 LEU U CA  1 
ATOM   5694 C C   . LEU D 4  213 ? 12.865 -8.754  47.830  1.00 30.00  ? 212 LEU U C   1 
ATOM   5695 O O   . LEU D 4  213 ? 13.561 -7.865  48.327  1.00 31.21  ? 212 LEU U O   1 
ATOM   5696 C CB  . LEU D 4  213 ? 10.702 -7.894  47.001  1.00 29.54  ? 212 LEU U CB  1 
ATOM   5697 C CG  . LEU D 4  213 ? 9.288  -8.029  46.423  1.00 26.90  ? 212 LEU U CG  1 
ATOM   5698 C CD1 . LEU D 4  213 ? 8.857  -9.488  46.378  1.00 26.25  ? 212 LEU U CD1 1 
ATOM   5699 C CD2 . LEU D 4  213 ? 8.343  -7.210  47.238  1.00 32.09  ? 212 LEU U CD2 1 
ATOM   5700 N N   . ILE D 4  214 ? 13.364 -9.718  47.069  1.00 28.53  ? 213 ILE U N   1 
ATOM   5701 C CA  . ILE D 4  214 ? 14.769 -9.747  46.686  1.00 28.13  ? 213 ILE U CA  1 
ATOM   5702 C C   . ILE D 4  214 ? 14.763 -9.975  45.171  1.00 30.65  ? 213 ILE U C   1 
ATOM   5703 O O   . ILE D 4  214 ? 13.743 -10.374 44.606  1.00 28.76  ? 213 ILE U O   1 
ATOM   5704 C CB  . ILE D 4  214 ? 15.570 -10.880 47.376  1.00 29.11  ? 213 ILE U CB  1 
ATOM   5705 C CG1 . ILE D 4  214 ? 14.867 -12.224 47.184  1.00 27.46  ? 213 ILE U CG1 1 
ATOM   5706 C CG2 . ILE D 4  214 ? 15.801 -10.536 48.851  1.00 29.67  ? 213 ILE U CG2 1 
ATOM   5707 C CD1 . ILE D 4  214 ? 15.719 -13.413 47.626  1.00 24.20  ? 213 ILE U CD1 1 
ATOM   5708 N N   . ASP D 4  215 ? 15.878 -9.693  44.506  1.00 31.64  ? 214 ASP U N   1 
ATOM   5709 C CA  . ASP D 4  215 ? 15.947 -9.882  43.062  1.00 29.49  ? 214 ASP U CA  1 
ATOM   5710 C C   . ASP D 4  215 ? 16.584 -11.217 42.751  1.00 25.71  ? 214 ASP U C   1 
ATOM   5711 O O   . ASP D 4  215 ? 17.740 -11.458 43.088  1.00 23.02  ? 214 ASP U O   1 
ATOM   5712 C CB  . ASP D 4  215 ? 16.759 -8.773  42.395  1.00 30.54  ? 214 ASP U CB  1 
ATOM   5713 C CG  . ASP D 4  215 ? 16.143 -7.415  42.578  1.00 32.24  ? 214 ASP U CG  1 
ATOM   5714 O OD1 . ASP D 4  215 ? 14.905 -7.292  42.452  1.00 31.16  ? 214 ASP U OD1 1 
ATOM   5715 O OD2 . ASP D 4  215 ? 16.905 -6.464  42.835  1.00 38.51  ? 214 ASP U OD2 1 
ATOM   5716 N N   . CYS D 4  216 ? 15.817 -12.090 42.115  1.00 26.79  ? 215 CYS U N   1 
ATOM   5717 C CA  . CYS D 4  216 ? 16.315 -13.406 41.757  1.00 26.66  ? 215 CYS U CA  1 
ATOM   5718 C C   . CYS D 4  216 ? 17.414 -13.244 40.722  1.00 24.34  ? 215 CYS U C   1 
ATOM   5719 O O   . CYS D 4  216 ? 17.343 -12.342 39.881  1.00 26.53  ? 215 CYS U O   1 
ATOM   5720 C CB  . CYS D 4  216 ? 15.177 -14.248 41.189  1.00 29.68  ? 215 CYS U CB  1 
ATOM   5721 S SG  . CYS D 4  216 ? 13.878 -14.575 42.413  1.00 29.76  ? 215 CYS U SG  1 
ATOM   5722 N N   . ARG D 4  217 ? 18.414 -14.120 40.779  1.00 22.07  ? 216 ARG U N   1 
ATOM   5723 C CA  . ARG D 4  217 ? 19.536 -14.059 39.857  1.00 21.45  ? 216 ARG U CA  1 
ATOM   5724 C C   . ARG D 4  217 ? 19.753 -15.306 39.026  1.00 22.46  ? 216 ARG U C   1 
ATOM   5725 O O   . ARG D 4  217 ? 19.475 -16.416 39.468  1.00 21.99  ? 216 ARG U O   1 
ATOM   5726 C CB  . ARG D 4  217 ? 20.823 -13.782 40.620  1.00 23.95  ? 216 ARG U CB  1 
ATOM   5727 C CG  . ARG D 4  217 ? 20.921 -12.392 41.186  1.00 23.11  ? 216 ARG U CG  1 
ATOM   5728 C CD  . ARG D 4  217 ? 22.104 -12.295 42.112  1.00 25.33  ? 216 ARG U CD  1 
ATOM   5729 N NE  . ARG D 4  217 ? 22.214 -10.945 42.652  1.00 32.20  ? 216 ARG U NE  1 
ATOM   5730 C CZ  . ARG D 4  217 ? 22.909 -9.961  42.083  1.00 34.08  ? 216 ARG U CZ  1 
ATOM   5731 N NH1 . ARG D 4  217 ? 23.570 -10.170 40.954  1.00 31.87  ? 216 ARG U NH1 1 
ATOM   5732 N NH2 . ARG D 4  217 ? 22.934 -8.761  42.643  1.00 39.42  ? 216 ARG U NH2 1 
ATOM   5733 N N   . GLY D 4  218 ? 20.285 -15.097 37.824  1.00 23.62  ? 217 GLY U N   1 
ATOM   5734 C CA  . GLY D 4  218 ? 20.588 -16.192 36.924  1.00 24.15  ? 217 GLY U CA  1 
ATOM   5735 C C   . GLY D 4  218 ? 19.466 -17.167 36.638  1.00 22.22  ? 217 GLY U C   1 
ATOM   5736 O O   . GLY D 4  218 ? 18.368 -16.762 36.252  1.00 23.34  ? 217 GLY U O   1 
ATOM   5737 N N   . PRO D 4  219 ? 19.718 -18.472 36.828  1.00 22.48  ? 218 PRO U N   1 
ATOM   5738 C CA  . PRO D 4  219 ? 18.726 -19.526 36.581  1.00 25.10  ? 218 PRO U CA  1 
ATOM   5739 C C   . PRO D 4  219 ? 17.668 -19.668 37.674  1.00 26.05  ? 218 PRO U C   1 
ATOM   5740 O O   . PRO D 4  219 ? 16.679 -20.358 37.493  1.00 28.43  ? 218 PRO U O   1 
ATOM   5741 C CB  . PRO D 4  219 ? 19.594 -20.777 36.437  1.00 24.15  ? 218 PRO U CB  1 
ATOM   5742 C CG  . PRO D 4  219 ? 20.687 -20.527 37.447  1.00 22.48  ? 218 PRO U CG  1 
ATOM   5743 C CD  . PRO D 4  219 ? 21.001 -19.042 37.290  1.00 20.82  ? 218 PRO U CD  1 
ATOM   5744 N N   . MET D 4  220 ? 17.876 -19.002 38.803  1.00 26.07  ? 219 MET U N   1 
ATOM   5745 C CA  . MET D 4  220 ? 16.941 -19.080 39.911  1.00 23.65  ? 219 MET U CA  1 
ATOM   5746 C C   . MET D 4  220 ? 15.809 -18.088 39.765  1.00 23.30  ? 219 MET U C   1 
ATOM   5747 O O   . MET D 4  220 ? 15.925 -16.926 40.136  1.00 24.83  ? 219 MET U O   1 
ATOM   5748 C CB  . MET D 4  220 ? 17.705 -18.877 41.212  1.00 24.94  ? 219 MET U CB  1 
ATOM   5749 C CG  . MET D 4  220 ? 18.813 -19.905 41.320  1.00 27.64  ? 219 MET U CG  1 
ATOM   5750 S SD  . MET D 4  220 ? 20.089 -19.569 42.504  1.00 39.39  ? 219 MET U SD  1 
ATOM   5751 C CE  . MET D 4  220 ? 21.115 -18.366 41.593  1.00 33.75  ? 219 MET U CE  1 
ATOM   5752 N N   . ASN D 4  221 ? 14.707 -18.563 39.196  1.00 23.29  ? 220 ASN U N   1 
ATOM   5753 C CA  . ASN D 4  221 ? 13.536 -17.728 38.987  1.00 23.85  ? 220 ASN U CA  1 
ATOM   5754 C C   . ASN D 4  221 ? 12.280 -18.340 39.588  1.00 22.39  ? 220 ASN U C   1 
ATOM   5755 O O   . ASN D 4  221 ? 11.173 -17.894 39.309  1.00 22.92  ? 220 ASN U O   1 
ATOM   5756 C CB  . ASN D 4  221 ? 13.329 -17.451 37.493  1.00 23.23  ? 220 ASN U CB  1 
ATOM   5757 C CG  . ASN D 4  221 ? 13.233 -18.715 36.678  1.00 25.08  ? 220 ASN U CG  1 
ATOM   5758 O OD1 . ASN D 4  221 ? 12.391 -19.566 36.949  1.00 24.15  ? 220 ASN U OD1 1 
ATOM   5759 N ND2 . ASN D 4  221 ? 14.100 -18.849 35.672  1.00 22.08  ? 220 ASN U ND2 1 
ATOM   5760 N N   . GLN D 4  222 ? 12.459 -19.377 40.397  1.00 23.97  ? 221 GLN U N   1 
ATOM   5761 C CA  . GLN D 4  222 ? 11.338 -20.005 41.087  1.00 25.36  ? 221 GLN U CA  1 
ATOM   5762 C C   . GLN D 4  222 ? 11.243 -19.322 42.454  1.00 26.10  ? 221 GLN U C   1 
ATOM   5763 O O   . GLN D 4  222 ? 12.247 -19.218 43.165  1.00 27.15  ? 221 GLN U O   1 
ATOM   5764 C CB  . GLN D 4  222 ? 11.591 -21.501 41.332  1.00 23.21  ? 221 GLN U CB  1 
ATOM   5765 C CG  . GLN D 4  222 ? 11.616 -22.411 40.099  1.00 25.36  ? 221 GLN U CG  1 
ATOM   5766 C CD  . GLN D 4  222 ? 10.241 -22.653 39.509  1.00 24.61  ? 221 GLN U CD  1 
ATOM   5767 O OE1 . GLN D 4  222 ? 9.233  -22.587 40.206  1.00 27.58  ? 221 GLN U OE1 1 
ATOM   5768 N NE2 . GLN D 4  222 ? 10.194 -22.951 38.224  1.00 19.23  ? 221 GLN U NE2 1 
ATOM   5769 N N   . CYS D 4  223 ? 10.056 -18.832 42.805  1.00 25.59  ? 222 CYS U N   1 
ATOM   5770 C CA  . CYS D 4  223 ? 9.842  -18.222 44.116  1.00 26.11  ? 222 CYS U CA  1 
ATOM   5771 C C   . CYS D 4  223 ? 9.547  -19.435 44.998  1.00 26.80  ? 222 CYS U C   1 
ATOM   5772 O O   . CYS D 4  223 ? 8.508  -20.077 44.859  1.00 28.79  ? 222 CYS U O   1 
ATOM   5773 C CB  . CYS D 4  223 ? 8.642  -17.264 44.099  1.00 25.52  ? 222 CYS U CB  1 
ATOM   5774 S SG  . CYS D 4  223 ? 8.953  -15.646 43.316  1.00 27.60  ? 222 CYS U SG  1 
ATOM   5775 N N   . LEU D 4  224 ? 10.463 -19.752 45.900  1.00 27.03  ? 223 LEU U N   1 
ATOM   5776 C CA  . LEU D 4  224 ? 10.300 -20.931 46.727  1.00 29.09  ? 223 LEU U CA  1 
ATOM   5777 C C   . LEU D 4  224 ? 9.909  -20.709 48.188  1.00 32.18  ? 223 LEU U C   1 
ATOM   5778 O O   . LEU D 4  224 ? 10.138 -19.642 48.761  1.00 31.77  ? 223 LEU U O   1 
ATOM   5779 C CB  . LEU D 4  224 ? 11.589 -21.759 46.632  1.00 27.82  ? 223 LEU U CB  1 
ATOM   5780 C CG  . LEU D 4  224 ? 11.872 -22.924 47.581  1.00 30.83  ? 223 LEU U CG  1 
ATOM   5781 C CD1 . LEU D 4  224 ? 12.866 -23.860 46.926  1.00 25.50  ? 223 LEU U CD1 1 
ATOM   5782 C CD2 . LEU D 4  224 ? 12.416 -22.407 48.920  1.00 31.15  ? 223 LEU U CD2 1 
ATOM   5783 N N   . VAL D 4  225 ? 9.289  -21.739 48.762  1.00 33.69  ? 224 VAL U N   1 
ATOM   5784 C CA  . VAL D 4  225 ? 8.867  -21.764 50.160  1.00 33.17  ? 224 VAL U CA  1 
ATOM   5785 C C   . VAL D 4  225 ? 9.158  -23.183 50.624  1.00 35.67  ? 224 VAL U C   1 
ATOM   5786 O O   . VAL D 4  225 ? 8.622  -24.139 50.068  1.00 37.75  ? 224 VAL U O   1 
ATOM   5787 C CB  . VAL D 4  225 ? 7.351  -21.528 50.351  1.00 31.34  ? 224 VAL U CB  1 
ATOM   5788 C CG1 . VAL D 4  225 ? 7.029  -21.532 51.843  1.00 32.75  ? 224 VAL U CG1 1 
ATOM   5789 C CG2 . VAL D 4  225 ? 6.917  -20.216 49.727  1.00 30.10  ? 224 VAL U CG2 1 
ATOM   5790 N N   . ALA D 4  226 ? 10.022 -23.320 51.622  1.00 37.54  ? 225 ALA U N   1 
ATOM   5791 C CA  . ALA D 4  226 ? 10.375 -24.631 52.159  1.00 39.75  ? 225 ALA U CA  1 
ATOM   5792 C C   . ALA D 4  226 ? 10.020 -24.688 53.643  1.00 45.69  ? 225 ALA U C   1 
ATOM   5793 O O   . ALA D 4  226 ? 10.498 -23.878 54.438  1.00 48.24  ? 225 ALA U O   1 
ATOM   5794 C CB  . ALA D 4  226 ? 11.864 -24.901 51.968  1.00 33.50  ? 225 ALA U CB  1 
ATOM   5795 N N   . THR D 4  227 ? 9.163  -25.637 54.006  1.00 48.47  ? 226 THR U N   1 
ATOM   5796 C CA  . THR D 4  227 ? 8.750  -25.812 55.393  1.00 48.00  ? 226 THR U CA  1 
ATOM   5797 C C   . THR D 4  227 ? 9.189  -27.181 55.872  1.00 48.08  ? 226 THR U C   1 
ATOM   5798 O O   . THR D 4  227 ? 9.049  -28.173 55.159  1.00 48.13  ? 226 THR U O   1 
ATOM   5799 C CB  . THR D 4  227 ? 7.232  -25.722 55.551  1.00 47.59  ? 226 THR U CB  1 
ATOM   5800 O OG1 . THR D 4  227 ? 6.785  -24.423 55.148  1.00 48.84  ? 226 THR U OG1 1 
ATOM   5801 C CG2 . THR D 4  227 ? 6.845  -25.961 57.008  1.00 53.35  ? 226 THR U CG2 1 
ATOM   5802 N N   . GLY D 4  228 ? 9.723  -27.231 57.085  1.00 49.40  ? 227 GLY U N   1 
ATOM   5803 C CA  . GLY D 4  228 ? 10.175 -28.496 57.618  1.00 50.97  ? 227 GLY U CA  1 
ATOM   5804 C C   . GLY D 4  228 ? 10.539 -28.425 59.081  1.00 52.62  ? 227 GLY U C   1 
ATOM   5805 O O   . GLY D 4  228 ? 9.812  -27.855 59.893  1.00 50.85  ? 227 GLY U O   1 
ATOM   5806 N N   . THR D 4  229 ? 11.680 -29.016 59.408  1.00 55.26  ? 228 THR U N   1 
ATOM   5807 C CA  . THR D 4  229 ? 12.167 -29.054 60.773  1.00 60.62  ? 228 THR U CA  1 
ATOM   5808 C C   . THR D 4  229 ? 13.668 -28.802 60.799  1.00 64.66  ? 228 THR U C   1 
ATOM   5809 O O   . THR D 4  229 ? 14.424 -29.416 60.048  1.00 63.83  ? 228 THR U O   1 
ATOM   5810 C CB  . THR D 4  229 ? 11.877 -30.424 61.416  1.00 59.68  ? 228 THR U CB  1 
ATOM   5811 O OG1 . THR D 4  229 ? 12.483 -31.457 60.627  1.00 60.73  ? 228 THR U OG1 1 
ATOM   5812 C CG2 . THR D 4  229 ? 10.371 -30.668 61.498  1.00 57.20  ? 228 THR U CG2 1 
ATOM   5813 N N   . HIS D 4  230 ? 14.086 -27.891 61.669  1.00 70.97  ? 229 HIS U N   1 
ATOM   5814 C CA  . HIS D 4  230 ? 15.493 -27.533 61.811  1.00 77.34  ? 229 HIS U CA  1 
ATOM   5815 C C   . HIS D 4  230 ? 15.835 -27.642 63.293  1.00 83.72  ? 229 HIS U C   1 
ATOM   5816 O O   . HIS D 4  230 ? 15.178 -28.379 64.034  1.00 84.56  ? 229 HIS U O   1 
ATOM   5817 C CB  . HIS D 4  230 ? 15.714 -26.091 61.329  1.00 73.74  ? 229 HIS U CB  1 
ATOM   5818 C CG  . HIS D 4  230 ? 17.154 -25.680 61.258  1.00 70.75  ? 229 HIS U CG  1 
ATOM   5819 N ND1 . HIS D 4  230 ? 17.543 -24.378 61.034  1.00 70.98  ? 229 HIS U ND1 1 
ATOM   5820 C CD2 . HIS D 4  230 ? 18.297 -26.399 61.367  1.00 71.86  ? 229 HIS U CD2 1 
ATOM   5821 C CE1 . HIS D 4  230 ? 18.863 -24.310 61.008  1.00 69.76  ? 229 HIS U CE1 1 
ATOM   5822 N NE2 . HIS D 4  230 ? 19.345 -25.523 61.208  1.00 70.36  ? 229 HIS U NE2 1 
ATOM   5823 N N   . GLU D 4  231 ? 16.865 -26.905 63.711  1.00 90.07  ? 230 GLU U N   1 
ATOM   5824 C CA  . GLU D 4  231 ? 17.311 -26.871 65.101  1.00 94.67  ? 230 GLU U CA  1 
ATOM   5825 C C   . GLU D 4  231 ? 17.469 -28.283 65.684  1.00 96.27  ? 230 GLU U C   1 
ATOM   5826 O O   . GLU D 4  231 ? 17.572 -29.256 64.929  1.00 97.40  ? 230 GLU U O   1 
ATOM   5827 C CB  . GLU D 4  231 ? 16.316 -26.029 65.909  1.00 97.34  ? 230 GLU U CB  1 
ATOM   5828 C CG  . GLU D 4  231 ? 16.179 -24.604 65.386  1.00 101.67 ? 230 GLU U CG  1 
ATOM   5829 C CD  . GLU D 4  231 ? 15.143 -23.792 66.138  1.00 104.57 ? 230 GLU U CD  1 
ATOM   5830 O OE1 . GLU D 4  231 ? 15.317 -23.586 67.358  1.00 105.99 ? 230 GLU U OE1 1 
ATOM   5831 O OE2 . GLU D 4  231 ? 14.155 -23.359 65.504  1.00 105.88 ? 230 GLU U OE2 1 
ATOM   5832 N N   . PRO D 4  232 ? 17.518 -28.417 67.027  1.00 96.74  ? 231 PRO U N   1 
ATOM   5833 C CA  . PRO D 4  232 ? 17.668 -29.767 67.588  1.00 96.31  ? 231 PRO U CA  1 
ATOM   5834 C C   . PRO D 4  232 ? 16.452 -30.688 67.401  1.00 95.88  ? 231 PRO U C   1 
ATOM   5835 O O   . PRO D 4  232 ? 16.534 -31.719 66.725  1.00 95.88  ? 231 PRO U O   1 
ATOM   5836 C CB  . PRO D 4  232 ? 17.970 -29.493 69.064  1.00 95.99  ? 231 PRO U CB  1 
ATOM   5837 C CG  . PRO D 4  232 ? 17.256 -28.192 69.320  1.00 95.04  ? 231 PRO U CG  1 
ATOM   5838 C CD  . PRO D 4  232 ? 17.625 -27.402 68.095  1.00 94.98  ? 231 PRO U CD  1 
ATOM   5839 N N   . LYS D 4  233 ? 15.330 -30.301 68.002  1.00 94.28  ? 232 LYS U N   1 
ATOM   5840 C CA  . LYS D 4  233 ? 14.094 -31.077 67.937  1.00 92.43  ? 232 LYS U CA  1 
ATOM   5841 C C   . LYS D 4  233 ? 13.348 -30.872 66.615  1.00 91.20  ? 232 LYS U C   1 
ATOM   5842 O O   . LYS D 4  233 ? 13.940 -30.471 65.608  1.00 90.93  ? 232 LYS U O   1 
ATOM   5843 C CB  . LYS D 4  233 ? 13.196 -30.679 69.109  1.00 91.34  ? 232 LYS U CB  1 
ATOM   5844 C CG  . LYS D 4  233 ? 13.964 -30.494 70.403  1.00 91.09  ? 232 LYS U CG  1 
ATOM   5845 C CD  . LYS D 4  233 ? 13.177 -29.706 71.430  1.00 91.12  ? 232 LYS U CD  1 
ATOM   5846 C CE  . LYS D 4  233 ? 14.042 -29.412 72.642  1.00 89.86  ? 232 LYS U CE  1 
ATOM   5847 N NZ  . LYS D 4  233 ? 13.313 -28.629 73.669  1.00 91.16  ? 232 LYS U NZ  1 
ATOM   5848 N N   . ASN D 4  234 ? 12.048 -31.154 66.629  1.00 88.24  ? 233 ASN U N   1 
ATOM   5849 C CA  . ASN D 4  234 ? 11.205 -31.001 65.449  1.00 85.34  ? 233 ASN U CA  1 
ATOM   5850 C C   . ASN D 4  234 ? 10.675 -29.579 65.298  1.00 83.54  ? 233 ASN U C   1 
ATOM   5851 O O   . ASN D 4  234 ? 9.504  -29.387 64.958  1.00 83.34  ? 233 ASN U O   1 
ATOM   5852 C CB  . ASN D 4  234 ? 10.022 -31.974 65.509  1.00 86.61  ? 233 ASN U CB  1 
ATOM   5853 C CG  . ASN D 4  234 ? 10.383 -33.366 65.031  1.00 88.53  ? 233 ASN U CG  1 
ATOM   5854 O OD1 . ASN D 4  234 ? 11.329 -33.979 65.524  1.00 91.39  ? 233 ASN U OD1 1 
ATOM   5855 N ND2 . ASN D 4  234 ? 9.624  -33.874 64.065  1.00 87.76  ? 233 ASN U ND2 1 
ATOM   5856 N N   . GLN D 4  235 ? 11.526 -28.585 65.552  1.00 80.34  ? 234 GLN U N   1 
ATOM   5857 C CA  . GLN D 4  235 ? 11.107 -27.192 65.424  1.00 75.61  ? 234 GLN U CA  1 
ATOM   5858 C C   . GLN D 4  235 ? 10.670 -26.922 63.998  1.00 71.19  ? 234 GLN U C   1 
ATOM   5859 O O   . GLN D 4  235 ? 11.422 -27.181 63.054  1.00 67.68  ? 234 GLN U O   1 
ATOM   5860 C CB  . GLN D 4  235 ? 12.244 -26.227 65.776  1.00 77.54  ? 234 GLN U CB  1 
ATOM   5861 C CG  . GLN D 4  235 ? 12.506 -26.063 67.255  1.00 79.67  ? 234 GLN U CG  1 
ATOM   5862 C CD  . GLN D 4  235 ? 13.185 -27.271 67.857  1.00 83.40  ? 234 GLN U CD  1 
ATOM   5863 O OE1 . GLN D 4  235 ? 14.305 -27.621 67.479  1.00 84.84  ? 234 GLN U OE1 1 
ATOM   5864 N NE2 . GLN D 4  235 ? 12.511 -27.919 68.800  1.00 84.92  ? 234 GLN U NE2 1 
ATOM   5865 N N   . SER D 4  236 ? 9.452  -26.413 63.844  1.00 67.28  ? 235 SER U N   1 
ATOM   5866 C CA  . SER D 4  236 ? 8.940  -26.099 62.519  1.00 64.99  ? 235 SER U CA  1 
ATOM   5867 C C   . SER D 4  236 ? 9.819  -24.992 61.956  1.00 61.62  ? 235 SER U C   1 
ATOM   5868 O O   . SER D 4  236 ? 10.050 -23.974 62.609  1.00 61.86  ? 235 SER U O   1 
ATOM   5869 C CB  . SER D 4  236 ? 7.479  -25.642 62.594  1.00 64.30  ? 235 SER U CB  1 
ATOM   5870 O OG  . SER D 4  236 ? 7.328  -24.541 63.468  1.00 64.98  ? 235 SER U OG  1 
ATOM   5871 N N   . TYR D 4  237 ? 10.334 -25.209 60.753  1.00 56.87  ? 236 TYR U N   1 
ATOM   5872 C CA  . TYR D 4  237 ? 11.196 -24.230 60.116  1.00 51.59  ? 236 TYR U CA  1 
ATOM   5873 C C   . TYR D 4  237 ? 10.573 -23.826 58.789  1.00 49.56  ? 236 TYR U C   1 
ATOM   5874 O O   . TYR D 4  237 ? 9.666  -24.494 58.287  1.00 50.97  ? 236 TYR U O   1 
ATOM   5875 C CB  . TYR D 4  237 ? 12.579 -24.826 59.876  1.00 50.37  ? 236 TYR U CB  1 
ATOM   5876 C CG  . TYR D 4  237 ? 13.661 -23.798 59.692  1.00 50.16  ? 236 TYR U CG  1 
ATOM   5877 C CD1 . TYR D 4  237 ? 14.689 -24.001 58.776  1.00 52.06  ? 236 TYR U CD1 1 
ATOM   5878 C CD2 . TYR D 4  237 ? 13.683 -22.637 60.463  1.00 50.30  ? 236 TYR U CD2 1 
ATOM   5879 C CE1 . TYR D 4  237 ? 15.715 -23.077 58.633  1.00 53.32  ? 236 TYR U CE1 1 
ATOM   5880 C CE2 . TYR D 4  237 ? 14.704 -21.705 60.330  1.00 51.02  ? 236 TYR U CE2 1 
ATOM   5881 C CZ  . TYR D 4  237 ? 15.716 -21.933 59.415  1.00 53.03  ? 236 TYR U CZ  1 
ATOM   5882 O OH  . TYR D 4  237 ? 16.738 -21.025 59.290  1.00 54.44  ? 236 TYR U OH  1 
ATOM   5883 N N   . MET D 4  238 ? 11.067 -22.735 58.220  1.00 45.46  ? 237 MET U N   1 
ATOM   5884 C CA  . MET D 4  238 ? 10.546 -22.235 56.960  1.00 41.52  ? 237 MET U CA  1 
ATOM   5885 C C   . MET D 4  238 ? 11.586 -21.319 56.332  1.00 41.88  ? 237 MET U C   1 
ATOM   5886 O O   . MET D 4  238 ? 12.318 -20.622 57.031  1.00 43.07  ? 237 MET U O   1 
ATOM   5887 C CB  . MET D 4  238 ? 9.247  -21.474 57.218  1.00 37.81  ? 237 MET U CB  1 
ATOM   5888 C CG  . MET D 4  238 ? 8.596  -20.866 56.003  1.00 36.50  ? 237 MET U CG  1 
ATOM   5889 S SD  . MET D 4  238 ? 7.255  -19.757 56.493  1.00 39.03  ? 237 MET U SD  1 
ATOM   5890 C CE  . MET D 4  238 ? 5.897  -20.908 56.678  1.00 37.27  ? 237 MET U CE  1 
ATOM   5891 N N   . VAL D 4  239 ? 11.664 -21.337 55.007  1.00 40.65  ? 238 VAL U N   1 
ATOM   5892 C CA  . VAL D 4  239 ? 12.616 -20.503 54.286  1.00 36.70  ? 238 VAL U CA  1 
ATOM   5893 C C   . VAL D 4  239 ? 11.965 -20.096 52.976  1.00 35.60  ? 238 VAL U C   1 
ATOM   5894 O O   . VAL D 4  239 ? 11.237 -20.881 52.374  1.00 35.82  ? 238 VAL U O   1 
ATOM   5895 C CB  . VAL D 4  239 ? 13.911 -21.264 53.956  1.00 35.74  ? 238 VAL U CB  1 
ATOM   5896 C CG1 . VAL D 4  239 ? 14.932 -20.306 53.410  1.00 35.97  ? 238 VAL U CG1 1 
ATOM   5897 C CG2 . VAL D 4  239 ? 14.448 -21.964 55.192  1.00 37.37  ? 238 VAL U CG2 1 
ATOM   5898 N N   . ARG D 4  240 ? 12.210 -18.862 52.551  1.00 32.62  ? 239 ARG U N   1 
ATOM   5899 C CA  . ARG D 4  240 ? 11.661 -18.365 51.303  1.00 30.91  ? 239 ARG U CA  1 
ATOM   5900 C C   . ARG D 4  240 ? 12.771 -17.641 50.559  1.00 33.33  ? 239 ARG U C   1 
ATOM   5901 O O   . ARG D 4  240 ? 13.660 -17.042 51.172  1.00 32.04  ? 239 ARG U O   1 
ATOM   5902 C CB  . ARG D 4  240 ? 10.480 -17.426 51.560  1.00 30.34  ? 239 ARG U CB  1 
ATOM   5903 C CG  . ARG D 4  240 ? 9.300  -18.096 52.259  1.00 32.49  ? 239 ARG U CG  1 
ATOM   5904 C CD  . ARG D 4  240 ? 8.080  -17.175 52.367  1.00 33.08  ? 239 ARG U CD  1 
ATOM   5905 N NE  . ARG D 4  240 ? 7.092  -17.696 53.318  1.00 37.00  ? 239 ARG U NE  1 
ATOM   5906 C CZ  . ARG D 4  240 ? 5.860  -18.094 53.008  1.00 38.38  ? 239 ARG U CZ  1 
ATOM   5907 N NH1 . ARG D 4  240 ? 5.427  -18.038 51.759  1.00 41.40  ? 239 ARG U NH1 1 
ATOM   5908 N NH2 . ARG D 4  240 ? 5.058  -18.557 53.955  1.00 40.64  ? 239 ARG U NH2 1 
ATOM   5909 N N   . GLY D 4  241 ? 12.719 -17.719 49.234  1.00 32.68  ? 240 GLY U N   1 
ATOM   5910 C CA  . GLY D 4  241 ? 13.724 -17.087 48.402  1.00 31.29  ? 240 GLY U CA  1 
ATOM   5911 C C   . GLY D 4  241 ? 13.573 -17.473 46.939  1.00 31.90  ? 240 GLY U C   1 
ATOM   5912 O O   . GLY D 4  241 ? 12.496 -17.874 46.489  1.00 29.12  ? 240 GLY U O   1 
ATOM   5913 N N   . CYS D 4  242 ? 14.665 -17.348 46.194  1.00 31.35  ? 241 CYS U N   1 
ATOM   5914 C CA  . CYS D 4  242 ? 14.683 -17.670 44.769  1.00 29.75  ? 241 CYS U CA  1 
ATOM   5915 C C   . CYS D 4  242 ? 15.371 -19.020 44.565  1.00 28.37  ? 241 CYS U C   1 
ATOM   5916 O O   . CYS D 4  242 ? 16.360 -19.323 45.239  1.00 26.75  ? 241 CYS U O   1 
ATOM   5917 C CB  . CYS D 4  242 ? 15.468 -16.608 43.995  1.00 30.95  ? 241 CYS U CB  1 
ATOM   5918 S SG  . CYS D 4  242 ? 14.940 -14.868 44.120  1.00 31.64  ? 241 CYS U SG  1 
ATOM   5919 N N   . ALA D 4  243 ? 14.875 -19.816 43.618  1.00 26.31  ? 242 ALA U N   1 
ATOM   5920 C CA  . ALA D 4  243 ? 15.467 -21.120 43.373  1.00 24.49  ? 242 ALA U CA  1 
ATOM   5921 C C   . ALA D 4  243 ? 15.399 -21.592 41.921  1.00 24.29  ? 242 ALA U C   1 
ATOM   5922 O O   . ALA D 4  243 ? 14.667 -21.030 41.101  1.00 21.55  ? 242 ALA U O   1 
ATOM   5923 C CB  . ALA D 4  243 ? 14.797 -22.143 44.274  1.00 26.12  ? 242 ALA U CB  1 
ATOM   5924 N N   . THR D 4  244 ? 16.191 -22.619 41.611  1.00 23.16  ? 243 THR U N   1 
ATOM   5925 C CA  . THR D 4  244 ? 16.192 -23.227 40.286  1.00 25.55  ? 243 THR U CA  1 
ATOM   5926 C C   . THR D 4  244 ? 15.023 -24.210 40.304  1.00 28.00  ? 243 THR U C   1 
ATOM   5927 O O   . THR D 4  244 ? 14.502 -24.529 41.372  1.00 28.78  ? 243 THR U O   1 
ATOM   5928 C CB  . THR D 4  244 ? 17.451 -24.035 40.039  1.00 21.90  ? 243 THR U CB  1 
ATOM   5929 O OG1 . THR D 4  244 ? 17.598 -24.994 41.091  1.00 25.25  ? 243 THR U OG1 1 
ATOM   5930 C CG2 . THR D 4  244 ? 18.666 -23.139 39.988  1.00 22.87  ? 243 THR U CG2 1 
ATOM   5931 N N   . ALA D 4  245 ? 14.618 -24.700 39.137  1.00 27.96  ? 244 ALA U N   1 
ATOM   5932 C CA  . ALA D 4  245 ? 13.500 -25.637 39.056  1.00 28.01  ? 244 ALA U CA  1 
ATOM   5933 C C   . ALA D 4  245 ? 13.813 -26.913 39.797  1.00 27.48  ? 244 ALA U C   1 
ATOM   5934 O O   . ALA D 4  245 ? 12.964 -27.458 40.494  1.00 28.74  ? 244 ALA U O   1 
ATOM   5935 C CB  . ALA D 4  245 ? 13.184 -25.964 37.611  1.00 26.32  ? 244 ALA U CB  1 
ATOM   5936 N N   . SER D 4  246 ? 15.039 -27.387 39.640  1.00 28.00  ? 245 SER U N   1 
ATOM   5937 C CA  . SER D 4  246 ? 15.466 -28.619 40.273  1.00 33.04  ? 245 SER U CA  1 
ATOM   5938 C C   . SER D 4  246 ? 15.251 -28.644 41.790  1.00 38.22  ? 245 SER U C   1 
ATOM   5939 O O   . SER D 4  246 ? 15.234 -29.719 42.398  1.00 39.54  ? 245 SER U O   1 
ATOM   5940 C CB  . SER D 4  246 ? 16.936 -28.879 39.943  1.00 30.92  ? 245 SER U CB  1 
ATOM   5941 O OG  . SER D 4  246 ? 17.721 -27.738 40.228  1.00 33.75  ? 245 SER U OG  1 
ATOM   5942 N N   . MET D 4  247 ? 15.076 -27.471 42.396  1.00 41.05  ? 246 MET U N   1 
ATOM   5943 C CA  . MET D 4  247 ? 14.868 -27.371 43.850  1.00 42.42  ? 246 MET U CA  1 
ATOM   5944 C C   . MET D 4  247 ? 13.417 -27.592 44.285  1.00 44.51  ? 246 MET U C   1 
ATOM   5945 O O   . MET D 4  247 ? 13.126 -27.716 45.474  1.00 42.62  ? 246 MET U O   1 
ATOM   5946 C CB  . MET D 4  247 ? 15.324 -25.994 44.350  1.00 43.58  ? 246 MET U CB  1 
ATOM   5947 C CG  . MET D 4  247 ? 16.819 -25.745 44.254  1.00 45.68  ? 246 MET U CG  1 
ATOM   5948 S SD  . MET D 4  247 ? 17.717 -26.288 45.711  1.00 47.80  ? 246 MET U SD  1 
ATOM   5949 C CE  . MET D 4  247 ? 17.677 -28.055 45.490  1.00 50.79  ? 246 MET U CE  1 
ATOM   5950 N N   . CYS D 4  248 ? 12.504 -27.646 43.325  1.00 46.41  ? 247 CYS U N   1 
ATOM   5951 C CA  . CYS D 4  248 ? 11.097 -27.820 43.647  1.00 49.66  ? 247 CYS U CA  1 
ATOM   5952 C C   . CYS D 4  248 ? 10.604 -29.262 43.531  1.00 53.77  ? 247 CYS U C   1 
ATOM   5953 O O   . CYS D 4  248 ? 9.483  -29.504 43.085  1.00 55.34  ? 247 CYS U O   1 
ATOM   5954 C CB  . CYS D 4  248 ? 10.267 -26.906 42.748  1.00 48.77  ? 247 CYS U CB  1 
ATOM   5955 S SG  . CYS D 4  248 ? 10.900 -25.194 42.672  1.00 47.64  ? 247 CYS U SG  1 
ATOM   5956 N N   . GLN D 4  249 ? 11.438 -30.213 43.947  1.00 59.28  ? 248 GLN U N   1 
ATOM   5957 C CA  . GLN D 4  249 ? 11.086 -31.630 43.898  1.00 63.09  ? 248 GLN U CA  1 
ATOM   5958 C C   . GLN D 4  249 ? 10.959 -32.219 45.305  1.00 63.23  ? 248 GLN U C   1 
ATOM   5959 O O   . GLN D 4  249 ? 11.566 -33.247 45.626  1.00 63.70  ? 248 GLN U O   1 
ATOM   5960 C CB  . GLN D 4  249 ? 12.144 -32.401 43.112  1.00 66.50  ? 248 GLN U CB  1 
ATOM   5961 C CG  . GLN D 4  249 ? 12.285 -31.958 41.671  1.00 74.36  ? 248 GLN U CG  1 
ATOM   5962 C CD  . GLN D 4  249 ? 13.402 -32.692 40.954  1.00 80.34  ? 248 GLN U CD  1 
ATOM   5963 O OE1 . GLN D 4  249 ? 13.484 -33.919 41.011  1.00 82.45  ? 248 GLN U OE1 1 
ATOM   5964 N NE2 . GLN D 4  249 ? 14.266 -31.946 40.268  1.00 82.36  ? 248 GLN U NE2 1 
ATOM   5965 N N   . LEU D 4  253 ? 17.313 -31.544 48.110  1.00 53.90  ? 252 LEU U N   1 
ATOM   5966 C CA  . LEU D 4  253 ? 16.728 -31.865 49.410  1.00 52.71  ? 252 LEU U CA  1 
ATOM   5967 C C   . LEU D 4  253 ? 17.096 -30.825 50.473  1.00 52.65  ? 252 LEU U C   1 
ATOM   5968 O O   . LEU D 4  253 ? 17.721 -29.799 50.175  1.00 51.31  ? 252 LEU U O   1 
ATOM   5969 C CB  . LEU D 4  253 ? 17.154 -33.274 49.868  1.00 50.43  ? 252 LEU U CB  1 
ATOM   5970 C CG  . LEU D 4  253 ? 16.586 -34.479 49.101  1.00 52.18  ? 252 LEU U CG  1 
ATOM   5971 C CD1 . LEU D 4  253 ? 17.201 -35.772 49.628  1.00 49.08  ? 252 LEU U CD1 1 
ATOM   5972 C CD2 . LEU D 4  253 ? 15.063 -34.511 49.231  1.00 49.02  ? 252 LEU U CD2 1 
ATOM   5973 N N   . GLY D 4  254 ? 16.702 -31.115 51.712  1.00 51.43  ? 253 GLY U N   1 
ATOM   5974 C CA  . GLY D 4  254 ? 16.930 -30.223 52.838  1.00 48.72  ? 253 GLY U CA  1 
ATOM   5975 C C   . GLY D 4  254 ? 18.339 -29.899 53.294  1.00 48.23  ? 253 GLY U C   1 
ATOM   5976 O O   . GLY D 4  254 ? 18.524 -28.889 53.960  1.00 50.97  ? 253 GLY U O   1 
ATOM   5977 N N   . ASP D 4  255 ? 19.329 -30.725 52.963  1.00 47.50  ? 254 ASP U N   1 
ATOM   5978 C CA  . ASP D 4  255 ? 20.706 -30.452 53.386  1.00 47.84  ? 254 ASP U CA  1 
ATOM   5979 C C   . ASP D 4  255 ? 21.121 -29.025 53.044  1.00 47.67  ? 254 ASP U C   1 
ATOM   5980 O O   . ASP D 4  255 ? 21.879 -28.397 53.782  1.00 48.27  ? 254 ASP U O   1 
ATOM   5981 C CB  . ASP D 4  255 ? 21.699 -31.428 52.734  1.00 50.50  ? 254 ASP U CB  1 
ATOM   5982 C CG  . ASP D 4  255 ? 21.626 -32.836 53.320  1.00 55.56  ? 254 ASP U CG  1 
ATOM   5983 O OD1 . ASP D 4  255 ? 21.762 -32.983 54.559  1.00 55.03  ? 254 ASP U OD1 1 
ATOM   5984 O OD2 . ASP D 4  255 ? 21.444 -33.796 52.537  1.00 56.43  ? 254 ASP U OD2 1 
ATOM   5985 N N   . ALA D 4  256 ? 20.619 -28.514 51.926  1.00 47.70  ? 255 ALA U N   1 
ATOM   5986 C CA  . ALA D 4  256 ? 20.951 -27.163 51.496  1.00 47.52  ? 255 ALA U CA  1 
ATOM   5987 C C   . ALA D 4  256 ? 20.308 -26.103 52.381  1.00 48.60  ? 255 ALA U C   1 
ATOM   5988 O O   . ALA D 4  256 ? 20.847 -25.006 52.508  1.00 50.08  ? 255 ALA U O   1 
ATOM   5989 C CB  . ALA D 4  256 ? 20.530 -26.956 50.050  1.00 47.52  ? 255 ALA U CB  1 
ATOM   5990 N N   . PHE D 4  257 ? 19.160 -26.423 52.982  1.00 49.05  ? 256 PHE U N   1 
ATOM   5991 C CA  . PHE D 4  257 ? 18.455 -25.487 53.868  1.00 50.29  ? 256 PHE U CA  1 
ATOM   5992 C C   . PHE D 4  257 ? 18.645 -25.863 55.350  1.00 51.08  ? 256 PHE U C   1 
ATOM   5993 O O   . PHE D 4  257 ? 18.001 -25.298 56.240  1.00 49.18  ? 256 PHE U O   1 
ATOM   5994 C CB  . PHE D 4  257 ? 16.950 -25.470 53.563  1.00 51.84  ? 256 PHE U CB  1 
ATOM   5995 C CG  . PHE D 4  257 ? 16.612 -25.265 52.109  1.00 53.89  ? 256 PHE U CG  1 
ATOM   5996 C CD1 . PHE D 4  257 ? 16.533 -26.347 51.238  1.00 54.79  ? 256 PHE U CD1 1 
ATOM   5997 C CD2 . PHE D 4  257 ? 16.349 -23.987 51.614  1.00 53.41  ? 256 PHE U CD2 1 
ATOM   5998 C CE1 . PHE D 4  257 ? 16.194 -26.160 49.896  1.00 57.00  ? 256 PHE U CE1 1 
ATOM   5999 C CE2 . PHE D 4  257 ? 16.011 -23.788 50.274  1.00 52.89  ? 256 PHE U CE2 1 
ATOM   6000 C CZ  . PHE D 4  257 ? 15.932 -24.872 49.414  1.00 54.95  ? 256 PHE U CZ  1 
ATOM   6001 N N   . SER D 4  258 ? 19.521 -26.832 55.601  1.00 52.75  ? 257 SER U N   1 
ATOM   6002 C CA  . SER D 4  258 ? 19.801 -27.300 56.954  1.00 56.02  ? 257 SER U CA  1 
ATOM   6003 C C   . SER D 4  258 ? 18.588 -27.943 57.633  1.00 56.52  ? 257 SER U C   1 
ATOM   6004 O O   . SER D 4  258 ? 18.583 -28.152 58.847  1.00 59.70  ? 257 SER U O   1 
ATOM   6005 C CB  . SER D 4  258 ? 20.324 -26.142 57.804  1.00 58.67  ? 257 SER U CB  1 
ATOM   6006 O OG  . SER D 4  258 ? 21.552 -25.655 57.284  1.00 61.18  ? 257 SER U OG  1 
ATOM   6007 N N   . MET D 4  259 ? 17.568 -28.266 56.846  1.00 55.25  ? 258 MET U N   1 
ATOM   6008 C CA  . MET D 4  259 ? 16.366 -28.887 57.379  1.00 54.75  ? 258 MET U CA  1 
ATOM   6009 C C   . MET D 4  259 ? 16.400 -30.403 57.247  1.00 57.20  ? 258 MET U C   1 
ATOM   6010 O O   . MET D 4  259 ? 17.373 -30.972 56.753  1.00 56.66  ? 258 MET U O   1 
ATOM   6011 C CB  . MET D 4  259 ? 15.132 -28.348 56.660  1.00 53.20  ? 258 MET U CB  1 
ATOM   6012 C CG  . MET D 4  259 ? 14.897 -26.872 56.877  1.00 55.14  ? 258 MET U CG  1 
ATOM   6013 S SD  . MET D 4  259 ? 13.314 -26.352 56.218  1.00 57.58  ? 258 MET U SD  1 
ATOM   6014 C CE  . MET D 4  259 ? 13.807 -25.620 54.684  1.00 59.06  ? 258 MET U CE  1 
ATOM   6015 N N   . ASN D 4  260 ? 15.328 -31.049 57.702  1.00 60.50  ? 259 ASN U N   1 
ATOM   6016 C CA  . ASN D 4  260 ? 15.199 -32.501 57.636  1.00 62.87  ? 259 ASN U CA  1 
ATOM   6017 C C   . ASN D 4  260 ? 14.096 -32.816 56.635  1.00 64.90  ? 259 ASN U C   1 
ATOM   6018 O O   . ASN D 4  260 ? 14.333 -32.831 55.426  1.00 66.05  ? 259 ASN U O   1 
ATOM   6019 C CB  . ASN D 4  260 ? 14.838 -33.057 59.011  1.00 62.90  ? 259 ASN U CB  1 
ATOM   6020 C CG  . ASN D 4  260 ? 15.821 -32.632 60.081  1.00 66.54  ? 259 ASN U CG  1 
ATOM   6021 O OD1 . ASN D 4  260 ? 17.030 -32.845 59.950  1.00 64.45  ? 259 ASN U OD1 1 
ATOM   6022 N ND2 . ASN D 4  260 ? 15.311 -32.026 61.150  1.00 68.39  ? 259 ASN U ND2 1 
ATOM   6023 N N   . HIS D 4  261 ? 12.891 -33.069 57.131  1.00 66.74  ? 260 HIS U N   1 
ATOM   6024 C CA  . HIS D 4  261 ? 11.785 -33.341 56.228  1.00 68.70  ? 260 HIS U CA  1 
ATOM   6025 C C   . HIS D 4  261 ? 11.408 -32.000 55.617  1.00 66.60  ? 260 HIS U C   1 
ATOM   6026 O O   . HIS D 4  261 ? 10.779 -31.167 56.272  1.00 66.92  ? 260 HIS U O   1 
ATOM   6027 C CB  . HIS D 4  261 ? 10.575 -33.907 56.970  1.00 74.63  ? 260 HIS U CB  1 
ATOM   6028 C CG  . HIS D 4  261 ? 9.379  -34.110 56.089  1.00 81.04  ? 260 HIS U CG  1 
ATOM   6029 N ND1 . HIS D 4  261 ? 8.115  -34.345 56.587  1.00 81.88  ? 260 HIS U ND1 1 
ATOM   6030 C CD2 . HIS D 4  261 ? 9.257  -34.109 54.739  1.00 83.63  ? 260 HIS U CD2 1 
ATOM   6031 C CE1 . HIS D 4  261 ? 7.267  -34.477 55.583  1.00 81.55  ? 260 HIS U CE1 1 
ATOM   6032 N NE2 . HIS D 4  261 ? 7.934  -34.338 54.451  1.00 84.32  ? 260 HIS U NE2 1 
ATOM   6033 N N   . ILE D 4  262 ? 11.794 -31.794 54.364  1.00 62.12  ? 261 ILE U N   1 
ATOM   6034 C CA  . ILE D 4  262 ? 11.507 -30.545 53.680  1.00 57.06  ? 261 ILE U CA  1 
ATOM   6035 C C   . ILE D 4  262 ? 10.306 -30.648 52.744  1.00 54.82  ? 261 ILE U C   1 
ATOM   6036 O O   . ILE D 4  262 ? 10.190 -31.592 51.971  1.00 56.04  ? 261 ILE U O   1 
ATOM   6037 C CB  . ILE D 4  262 ? 12.732 -30.089 52.870  1.00 56.00  ? 261 ILE U CB  1 
ATOM   6038 C CG1 . ILE D 4  262 ? 12.406 -28.820 52.083  1.00 57.20  ? 261 ILE U CG1 1 
ATOM   6039 C CG2 . ILE D 4  262 ? 13.163 -31.197 51.925  1.00 58.58  ? 261 ILE U CG2 1 
ATOM   6040 C CD1 . ILE D 4  262 ? 13.566 -28.297 51.256  1.00 54.07  ? 261 ILE U CD1 1 
ATOM   6041 N N   . ASP D 4  263 ? 9.404  -29.678 52.832  1.00 52.04  ? 262 ASP U N   1 
ATOM   6042 C CA  . ASP D 4  263 ? 8.232  -29.635 51.964  1.00 51.72  ? 262 ASP U CA  1 
ATOM   6043 C C   . ASP D 4  263 ? 8.360  -28.337 51.167  1.00 49.71  ? 262 ASP U C   1 
ATOM   6044 O O   . ASP D 4  263 ? 8.158  -27.253 51.709  1.00 48.98  ? 262 ASP U O   1 
ATOM   6045 C CB  . ASP D 4  263 ? 6.928  -29.608 52.778  1.00 54.92  ? 262 ASP U CB  1 
ATOM   6046 C CG  . ASP D 4  263 ? 6.668  -30.908 53.538  1.00 59.52  ? 262 ASP U CG  1 
ATOM   6047 O OD1 . ASP D 4  263 ? 6.627  -31.984 52.902  1.00 62.44  ? 262 ASP U OD1 1 
ATOM   6048 O OD2 . ASP D 4  263 ? 6.494  -30.850 54.777  1.00 63.87  ? 262 ASP U OD2 1 
ATOM   6049 N N   . VAL D 4  264 ? 8.692  -28.439 49.884  1.00 46.46  ? 263 VAL U N   1 
ATOM   6050 C CA  . VAL D 4  264 ? 8.858  -27.241 49.074  1.00 41.84  ? 263 VAL U CA  1 
ATOM   6051 C C   . VAL D 4  264 ? 7.694  -26.910 48.164  1.00 39.77  ? 263 VAL U C   1 
ATOM   6052 O O   . VAL D 4  264 ? 7.024  -27.785 47.628  1.00 40.99  ? 263 VAL U O   1 
ATOM   6053 C CB  . VAL D 4  264 ? 10.113 -27.325 48.198  1.00 41.38  ? 263 VAL U CB  1 
ATOM   6054 C CG1 . VAL D 4  264 ? 11.318 -27.626 49.051  1.00 40.85  ? 263 VAL U CG1 1 
ATOM   6055 C CG2 . VAL D 4  264 ? 9.932  -28.390 47.139  1.00 47.55  ? 263 VAL U CG2 1 
ATOM   6056 N N   . SER D 4  265 ? 7.472  -25.617 47.992  1.00 38.24  ? 264 SER U N   1 
ATOM   6057 C CA  . SER D 4  265 ? 6.422  -25.111 47.130  1.00 38.19  ? 264 SER U CA  1 
ATOM   6058 C C   . SER D 4  265 ? 7.062  -24.018 46.251  1.00 39.45  ? 264 SER U C   1 
ATOM   6059 O O   . SER D 4  265 ? 7.864  -23.223 46.739  1.00 37.29  ? 264 SER U O   1 
ATOM   6060 C CB  . SER D 4  265 ? 5.300  -24.533 47.982  1.00 37.63  ? 264 SER U CB  1 
ATOM   6061 O OG  . SER D 4  265 ? 4.191  -24.205 47.177  1.00 46.45  ? 264 SER U OG  1 
ATOM   6062 N N   . CYS D 4  266 ? 6.729  -23.996 44.958  1.00 39.86  ? 265 CYS U N   1 
ATOM   6063 C CA  . CYS D 4  266 ? 7.290  -23.010 44.032  1.00 36.51  ? 265 CYS U CA  1 
ATOM   6064 C C   . CYS D 4  266 ? 6.266  -22.418 43.090  1.00 36.68  ? 265 CYS U C   1 
ATOM   6065 O O   . CYS D 4  266 ? 5.258  -23.043 42.782  1.00 40.20  ? 265 CYS U O   1 
ATOM   6066 C CB  . CYS D 4  266 ? 8.387  -23.634 43.189  1.00 35.67  ? 265 CYS U CB  1 
ATOM   6067 S SG  . CYS D 4  266 ? 9.846  -24.207 44.103  1.00 43.88  ? 265 CYS U SG  1 
ATOM   6068 N N   . CYS D 4  267 ? 6.545  -21.208 42.625  1.00 34.42  ? 266 CYS U N   1 
ATOM   6069 C CA  . CYS D 4  267 ? 5.672  -20.496 41.697  1.00 33.90  ? 266 CYS U CA  1 
ATOM   6070 C C   . CYS D 4  267 ? 6.574  -19.538 40.915  1.00 31.39  ? 266 CYS U C   1 
ATOM   6071 O O   . CYS D 4  267 ? 7.613  -19.104 41.421  1.00 30.20  ? 266 CYS U O   1 
ATOM   6072 C CB  . CYS D 4  267 ? 4.582  -19.729 42.460  1.00 35.60  ? 266 CYS U CB  1 
ATOM   6073 S SG  . CYS D 4  267 ? 5.217  -18.635 43.780  1.00 42.08  ? 266 CYS U SG  1 
ATOM   6074 N N   . THR D 4  268 ? 6.181  -19.221 39.684  1.00 29.86  ? 267 THR U N   1 
ATOM   6075 C CA  . THR D 4  268 ? 6.978  -18.362 38.821  1.00 23.49  ? 267 THR U CA  1 
ATOM   6076 C C   . THR D 4  268 ? 6.292  -17.062 38.466  1.00 23.56  ? 267 THR U C   1 
ATOM   6077 O O   . THR D 4  268 ? 6.095  -16.742 37.301  1.00 24.97  ? 267 THR U O   1 
ATOM   6078 C CB  . THR D 4  268 ? 7.351  -19.110 37.545  1.00 24.14  ? 267 THR U CB  1 
ATOM   6079 O OG1 . THR D 4  268 ? 6.176  -19.709 36.993  1.00 26.41  ? 267 THR U OG1 1 
ATOM   6080 C CG2 . THR D 4  268 ? 8.364  -20.203 37.849  1.00 23.26  ? 267 THR U CG2 1 
ATOM   6081 N N   . LYS D 4  269 ? 5.926  -16.316 39.498  1.00 28.32  ? 268 LYS U N   1 
ATOM   6082 C CA  . LYS D 4  269 ? 5.286  -15.019 39.354  1.00 29.72  ? 268 LYS U CA  1 
ATOM   6083 C C   . LYS D 4  269 ? 5.937  -14.162 40.449  1.00 30.04  ? 268 LYS U C   1 
ATOM   6084 O O   . LYS D 4  269 ? 6.049  -14.602 41.589  1.00 31.21  ? 268 LYS U O   1 
ATOM   6085 C CB  . LYS D 4  269 ? 3.788  -15.151 39.606  1.00 32.71  ? 268 LYS U CB  1 
ATOM   6086 C CG  . LYS D 4  269 ? 2.975  -13.969 39.142  1.00 38.04  ? 268 LYS U CG  1 
ATOM   6087 C CD  . LYS D 4  269 ? 2.849  -13.975 37.630  1.00 45.08  ? 268 LYS U CD  1 
ATOM   6088 C CE  . LYS D 4  269 ? 1.998  -12.817 37.144  1.00 49.08  ? 268 LYS U CE  1 
ATOM   6089 N NZ  . LYS D 4  269 ? 1.945  -12.781 35.661  1.00 51.67  ? 268 LYS U NZ  1 
ATOM   6090 N N   . SER D 4  270 ? 6.386  -12.957 40.119  1.00 28.65  ? 269 SER U N   1 
ATOM   6091 C CA  . SER D 4  270 ? 7.025  -12.120 41.135  1.00 29.09  ? 269 SER U CA  1 
ATOM   6092 C C   . SER D 4  270 ? 6.143  -11.944 42.374  1.00 28.72  ? 269 SER U C   1 
ATOM   6093 O O   . SER D 4  270 ? 4.963  -11.596 42.260  1.00 28.51  ? 269 SER U O   1 
ATOM   6094 C CB  . SER D 4  270 ? 7.378  -10.740 40.558  1.00 30.30  ? 269 SER U CB  1 
ATOM   6095 O OG  . SER D 4  270 ? 8.460  -10.821 39.642  1.00 31.76  ? 269 SER U OG  1 
ATOM   6096 N N   . GLY D 4  271 ? 6.722  -12.199 43.547  1.00 29.02  ? 270 GLY U N   1 
ATOM   6097 C CA  . GLY D 4  271 ? 6.007  -12.046 44.805  1.00 33.58  ? 270 GLY U CA  1 
ATOM   6098 C C   . GLY D 4  271 ? 4.988  -13.109 45.185  1.00 36.35  ? 270 GLY U C   1 
ATOM   6099 O O   . GLY D 4  271 ? 4.436  -13.061 46.284  1.00 36.95  ? 270 GLY U O   1 
ATOM   6100 N N   . CYS D 4  272 ? 4.734  -14.060 44.286  1.00 38.17  ? 271 CYS U N   1 
ATOM   6101 C CA  . CYS D 4  272 ? 3.767  -15.146 44.515  1.00 35.74  ? 271 CYS U CA  1 
ATOM   6102 C C   . CYS D 4  272 ? 4.189  -15.977 45.726  1.00 35.48  ? 271 CYS U C   1 
ATOM   6103 O O   . CYS D 4  272 ? 3.460  -16.845 46.208  1.00 34.01  ? 271 CYS U O   1 
ATOM   6104 C CB  . CYS D 4  272 ? 3.708  -16.045 43.275  1.00 34.66  ? 271 CYS U CB  1 
ATOM   6105 S SG  . CYS D 4  272 ? 5.312  -16.817 42.890  1.00 35.23  ? 271 CYS U SG  1 
ATOM   6106 N N   . ASN D 4  273 ? 5.391  -15.665 46.190  1.00 36.16  ? 272 ASN U N   1 
ATOM   6107 C CA  . ASN D 4  273 ? 6.082  -16.290 47.309  1.00 32.64  ? 272 ASN U CA  1 
ATOM   6108 C C   . ASN D 4  273 ? 5.588  -15.802 48.676  1.00 31.96  ? 272 ASN U C   1 
ATOM   6109 O O   . ASN D 4  273 ? 5.895  -16.401 49.708  1.00 29.19  ? 272 ASN U O   1 
ATOM   6110 C CB  . ASN D 4  273 ? 7.557  -15.919 47.193  1.00 30.88  ? 272 ASN U CB  1 
ATOM   6111 C CG  . ASN D 4  273 ? 8.446  -16.971 47.721  1.00 33.82  ? 272 ASN U CG  1 
ATOM   6112 O OD1 . ASN D 4  273 ? 9.598  -16.715 48.040  1.00 31.75  ? 272 ASN U OD1 1 
ATOM   6113 N ND2 . ASN D 4  273 ? 7.927  -18.190 47.809  1.00 40.96  ? 272 ASN U ND2 1 
ATOM   6114 N N   . HIS D 4  274 ? 4.857  -14.692 48.677  1.00 31.80  ? 273 HIS U N   1 
ATOM   6115 C CA  . HIS D 4  274 ? 4.365  -14.086 49.910  1.00 32.82  ? 273 HIS U CA  1 
ATOM   6116 C C   . HIS D 4  274 ? 3.550  -15.021 50.787  1.00 35.34  ? 273 HIS U C   1 
ATOM   6117 O O   . HIS D 4  274 ? 2.880  -15.918 50.279  1.00 35.03  ? 273 HIS U O   1 
ATOM   6118 C CB  . HIS D 4  274 ? 3.516  -12.864 49.588  1.00 34.05  ? 273 HIS U CB  1 
ATOM   6119 C CG  . HIS D 4  274 ? 3.273  -11.988 50.768  1.00 36.25  ? 273 HIS U CG  1 
ATOM   6120 N ND1 . HIS D 4  274 ? 4.293  -11.347 51.433  1.00 38.44  ? 273 HIS U ND1 1 
ATOM   6121 C CD2 . HIS D 4  274 ? 2.137  -11.678 51.432  1.00 39.73  ? 273 HIS U CD2 1 
ATOM   6122 C CE1 . HIS D 4  274 ? 3.798  -10.678 52.457  1.00 39.06  ? 273 HIS U CE1 1 
ATOM   6123 N NE2 . HIS D 4  274 ? 2.491  -10.862 52.479  1.00 42.59  ? 273 HIS U NE2 1 
ATOM   6124 N N   . PRO D 4  275 ? 3.610  -14.837 52.124  1.00 38.43  ? 274 PRO U N   1 
ATOM   6125 C CA  . PRO D 4  275 ? 2.828  -15.712 52.999  1.00 40.14  ? 274 PRO U CA  1 
ATOM   6126 C C   . PRO D 4  275 ? 1.354  -15.504 52.673  1.00 43.45  ? 274 PRO U C   1 
ATOM   6127 O O   . PRO D 4  275 ? 0.599  -14.977 53.473  1.00 40.69  ? 274 PRO U O   1 
ATOM   6128 C CB  . PRO D 4  275 ? 3.205  -15.220 54.391  1.00 38.06  ? 274 PRO U CB  1 
ATOM   6129 C CG  . PRO D 4  275 ? 4.633  -14.794 54.208  1.00 33.89  ? 274 PRO U CG  1 
ATOM   6130 C CD  . PRO D 4  275 ? 4.550  -14.022 52.917  1.00 36.91  ? 274 PRO U CD  1 
ATOM   6131 N N   . ASP D 4  276 ? 0.985  -15.907 51.459  1.00 51.75  ? 275 ASP U N   1 
ATOM   6132 C CA  . ASP D 4  276 ? -0.364 -15.806 50.918  1.00 54.36  ? 275 ASP U CA  1 
ATOM   6133 C C   . ASP D 4  276 ? -1.188 -14.683 51.527  1.00 58.02  ? 275 ASP U C   1 
ATOM   6134 O O   . ASP D 4  276 ? -0.591 -13.737 52.092  1.00 60.02  ? 275 ASP U O   1 
ATOM   6135 C CB  . ASP D 4  276 ? -1.080 -17.150 51.072  1.00 54.32  ? 275 ASP U CB  1 
ATOM   6136 C CG  . ASP D 4  276 ? -0.592 -18.188 50.073  1.00 51.39  ? 275 ASP U CG  1 
ATOM   6137 O OD1 . ASP D 4  276 ? -0.525 -19.382 50.439  1.00 49.80  ? 275 ASP U OD1 1 
ATOM   6138 O OD2 . ASP D 4  276 ? -0.292 -17.808 48.921  1.00 50.34  ? 275 ASP U OD2 1 
ATOM   6139 O OXT . ASP D 4  276 ? -2.427 -14.754 51.399  1.00 62.55  ? 275 ASP U OXT 1 
HETATM 6140 S S   . SO4 E 5  .   ? 34.016 -33.795 70.358  1.00 47.44  ? 501 SO4 A S   1 
HETATM 6141 O O1  . SO4 E 5  .   ? 35.142 -33.340 71.182  1.00 47.83  ? 501 SO4 A O1  1 
HETATM 6142 O O2  . SO4 E 5  .   ? 34.442 -33.869 68.950  1.00 47.89  ? 501 SO4 A O2  1 
HETATM 6143 O O3  . SO4 E 5  .   ? 33.569 -35.127 70.793  1.00 47.68  ? 501 SO4 A O3  1 
HETATM 6144 O O4  . SO4 E 5  .   ? 32.908 -32.833 70.491  1.00 47.86  ? 501 SO4 A O4  1 
HETATM 6145 C C2  . ETX F 6  .   ? 17.893 -1.222  36.761  1.00 52.53  ? 401 ETX L C2  1 
HETATM 6146 O O2  . ETX F 6  .   ? 18.768 -2.175  36.152  1.00 41.57  ? 401 ETX L O2  1 
HETATM 6147 C C3  . ETX F 6  .   ? 19.532 -3.216  36.738  1.00 48.83  ? 401 ETX L C3  1 
HETATM 6148 C C4  . ETX F 6  .   ? 20.046 -2.902  38.214  1.00 47.31  ? 401 ETX L C4  1 
HETATM 6149 O O1  . ETX F 6  .   ? 15.399 -1.013  36.077  1.00 61.93  ? 401 ETX L O1  1 
HETATM 6150 C C1  . ETX F 6  .   ? 16.793 -0.553  35.862  1.00 52.08  ? 401 ETX L C1  1 
HETATM 6151 C C1  . EDO G 7  .   ? 29.684 -12.582 15.069  1.00 50.67  ? 405 EDO L C1  1 
HETATM 6152 O O1  . EDO G 7  .   ? 29.682 -12.810 16.487  1.00 47.34  ? 405 EDO L O1  1 
HETATM 6153 C C2  . EDO G 7  .   ? 30.679 -13.395 14.235  1.00 49.80  ? 405 EDO L C2  1 
HETATM 6154 O O2  . EDO G 7  .   ? 31.573 -12.623 13.413  1.00 49.17  ? 405 EDO L O2  1 
HETATM 6155 C C2  . ETX H 6  .   ? 7.948  -6.184  38.620  1.00 56.36  ? 407 ETX L C2  1 
HETATM 6156 O O2  . ETX H 6  .   ? 9.351  -6.359  38.681  1.00 59.92  ? 407 ETX L O2  1 
HETATM 6157 C C3  . ETX H 6  .   ? 10.389 -5.433  38.455  1.00 59.11  ? 407 ETX L C3  1 
HETATM 6158 C C4  . ETX H 6  .   ? 11.762 -5.889  39.103  1.00 52.25  ? 407 ETX L C4  1 
HETATM 6159 O O1  . ETX H 6  .   ? 5.683  -7.114  37.753  1.00 53.83  ? 407 ETX L O1  1 
HETATM 6160 C C1  . ETX H 6  .   ? 7.120  -7.366  37.991  1.00 56.78  ? 407 ETX L C1  1 
HETATM 6161 C C2  . ETX I 6  .   ? 7.515  -24.658 15.421  1.00 43.78  ? 403 ETX H C2  1 
HETATM 6162 O O2  . ETX I 6  .   ? 7.060  -25.934 15.837  1.00 52.41  ? 403 ETX H O2  1 
HETATM 6163 C C3  . ETX I 6  .   ? 5.826  -26.588 15.600  1.00 49.39  ? 403 ETX H C3  1 
HETATM 6164 C C4  . ETX I 6  .   ? 6.000  -28.153 15.380  1.00 48.63  ? 403 ETX H C4  1 
HETATM 6165 O O1  . ETX I 6  .   ? 8.397  -23.205 13.458  1.00 45.59  ? 403 ETX H O1  1 
HETATM 6166 C C1  . ETX I 6  .   ? 8.150  -24.560 13.986  1.00 48.63  ? 403 ETX H C1  1 
HETATM 6167 C C1  . EDO J 7  .   ? 1.032  -21.340 22.075  1.00 46.03  ? 404 EDO H C1  1 
HETATM 6168 O O1  . EDO J 7  .   ? 0.694  -20.250 22.931  1.00 42.08  ? 404 EDO H O1  1 
HETATM 6169 C C2  . EDO J 7  .   ? 0.465  -22.702 22.460  1.00 50.05  ? 404 EDO H C2  1 
HETATM 6170 O O2  . EDO J 7  .   ? 1.335  -23.525 23.258  1.00 53.22  ? 404 EDO H O2  1 
HETATM 6171 C C1  . PGE K 8  .   ? 26.720 -20.648 35.955  1.00 62.56  ? 406 PGE H C1  1 
HETATM 6172 O O1  . PGE K 8  .   ? 26.739 -19.258 35.456  1.00 61.97  ? 406 PGE H O1  1 
HETATM 6173 C C2  . PGE K 8  .   ? 25.392 -21.435 36.015  1.00 61.87  ? 406 PGE H C2  1 
HETATM 6174 O O2  . PGE K 8  .   ? 24.139 -20.852 35.594  1.00 63.23  ? 406 PGE H O2  1 
HETATM 6175 C C3  . PGE K 8  .   ? 23.800 -21.035 34.210  1.00 64.71  ? 406 PGE H C3  1 
HETATM 6176 C C4  . PGE K 8  .   ? 22.262 -20.744 33.927  1.00 62.12  ? 406 PGE H C4  1 
HETATM 6177 O O4  . PGE K 8  .   ? 19.797 -18.959 29.947  1.00 38.79  ? 406 PGE H O4  1 
HETATM 6178 C C6  . PGE K 8  .   ? 20.136 -19.951 30.996  1.00 51.91  ? 406 PGE H C6  1 
HETATM 6179 C C5  . PGE K 8  .   ? 21.612 -19.943 31.567  1.00 56.42  ? 406 PGE H C5  1 
HETATM 6180 O O3  . PGE K 8  .   ? 21.916 -20.909 32.570  1.00 61.96  ? 406 PGE H O3  1 
HETATM 6181 C C1  . NAG L 9  .   ? 24.335 -48.060 50.807  1.00 79.36  ? 452 NAG U C1  1 
HETATM 6182 C C2  . NAG L 9  .   ? 23.078 -48.636 50.136  1.00 81.47  ? 452 NAG U C2  1 
HETATM 6183 C C3  . NAG L 9  .   ? 22.579 -49.896 50.871  1.00 81.75  ? 452 NAG U C3  1 
HETATM 6184 C C4  . NAG L 9  .   ? 23.724 -50.891 51.013  1.00 81.01  ? 452 NAG U C4  1 
HETATM 6185 C C5  . NAG L 9  .   ? 24.838 -50.204 51.785  1.00 81.44  ? 452 NAG U C5  1 
HETATM 6186 C C6  . NAG L 9  .   ? 26.007 -51.131 52.054  1.00 83.73  ? 452 NAG U C6  1 
HETATM 6187 C C7  . NAG L 9  .   ? 21.074 -47.666 49.204  1.00 80.42  ? 452 NAG U C7  1 
HETATM 6188 C C8  . NAG L 9  .   ? 21.505 -47.900 47.768  1.00 81.13  ? 452 NAG U C8  1 
HETATM 6189 N N2  . NAG L 9  .   ? 22.031 -47.631 50.126  1.00 82.38  ? 452 NAG U N2  1 
HETATM 6190 O O1  . NAG L 9  .   ? 24.008 -47.501 52.026  1.00 79.99  ? 452 NAG U O1  1 
HETATM 6191 O O3  . NAG L 9  .   ? 21.511 -50.496 50.151  1.00 84.87  ? 452 NAG U O3  1 
HETATM 6192 O O4  . NAG L 9  .   ? 23.291 -52.059 51.697  1.00 78.19  ? 452 NAG U O4  1 
HETATM 6193 O O5  . NAG L 9  .   ? 25.331 -49.074 51.023  1.00 79.34  ? 452 NAG U O5  1 
HETATM 6194 O O6  . NAG L 9  .   ? 27.247 -50.453 51.903  1.00 86.38  ? 452 NAG U O6  1 
HETATM 6195 O O7  . NAG L 9  .   ? 19.881 -47.515 49.470  1.00 80.18  ? 452 NAG U O7  1 
HETATM 6196 C C1  . FUC M 10 .   ? 27.724 -50.594 50.881  1.00 99.26  ? 453 FUC U C1  1 
HETATM 6197 C C2  . FUC M 10 .   ? 27.963 -51.840 50.023  1.00 99.79  ? 453 FUC U C2  1 
HETATM 6198 C C3  . FUC M 10 .   ? 29.116 -51.585 49.045  1.00 100.88 ? 453 FUC U C3  1 
HETATM 6199 C C4  . FUC M 10 .   ? 30.364 -51.115 49.805  1.00 101.40 ? 453 FUC U C4  1 
HETATM 6200 C C5  . FUC M 10 .   ? 30.020 -49.898 50.670  1.00 100.28 ? 453 FUC U C5  1 
HETATM 6201 C C6  . FUC M 10 .   ? 31.191 -49.462 51.528  1.00 98.74  ? 453 FUC U C6  1 
HETATM 6202 O O1  . FUC M 10 .   ? 26.757 -50.871 51.835  1.00 99.31  ? 453 FUC U O1  1 
HETATM 6203 O O2  . FUC M 10 .   ? 26.778 -52.156 49.303  1.00 98.05  ? 453 FUC U O2  1 
HETATM 6204 O O3  . FUC M 10 .   ? 29.410 -52.772 48.321  1.00 100.94 ? 453 FUC U O3  1 
HETATM 6205 O O4  . FUC M 10 .   ? 30.856 -52.163 50.630  1.00 102.74 ? 453 FUC U O4  1 
HETATM 6206 O O5  . FUC M 10 .   ? 28.931 -50.215 51.566  1.00 98.97  ? 453 FUC U O5  1 
HETATM 6207 C C1  . NAG N 9  .   ? 26.142 -38.639 32.099  1.00 77.20  ? 472 NAG U C1  1 
HETATM 6208 C C2  . NAG N 9  .   ? 25.260 -39.875 32.134  1.00 77.28  ? 472 NAG U C2  1 
HETATM 6209 C C3  . NAG N 9  .   ? 24.134 -39.690 31.125  1.00 76.77  ? 472 NAG U C3  1 
HETATM 6210 C C4  . NAG N 9  .   ? 23.347 -38.412 31.448  1.00 75.42  ? 472 NAG U C4  1 
HETATM 6211 C C5  . NAG N 9  .   ? 24.298 -37.207 31.547  1.00 76.20  ? 472 NAG U C5  1 
HETATM 6212 C C6  . NAG N 9  .   ? 23.588 -35.950 32.029  1.00 76.67  ? 472 NAG U C6  1 
HETATM 6213 C C7  . NAG N 9  .   ? 27.298 -41.161 32.257  1.00 77.02  ? 472 NAG U C7  1 
HETATM 6214 C C8  . NAG N 9  .   ? 28.395 -41.056 31.211  1.00 77.44  ? 472 NAG U C8  1 
HETATM 6215 N N2  . NAG N 9  .   ? 26.041 -41.060 31.830  1.00 77.79  ? 472 NAG U N2  1 
HETATM 6216 O O1  . NAG N 9  .   ? 27.173 -38.796 33.005  1.00 78.97  ? 472 NAG U O1  1 
HETATM 6217 O O3  . NAG N 9  .   ? 23.271 -40.814 31.167  1.00 80.30  ? 472 NAG U O3  1 
HETATM 6218 O O4  . NAG N 9  .   ? 22.383 -38.172 30.432  1.00 71.73  ? 472 NAG U O4  1 
HETATM 6219 O O5  . NAG N 9  .   ? 25.376 -37.484 32.475  1.00 76.45  ? 472 NAG U O5  1 
HETATM 6220 O O6  . NAG N 9  .   ? 24.190 -35.421 33.203  1.00 79.30  ? 472 NAG U O6  1 
HETATM 6221 O O7  . NAG N 9  .   ? 27.592 -41.308 33.445  1.00 75.78  ? 472 NAG U O7  1 
HETATM 6222 C C1  . NAG O 9  .   ? 20.833 -38.279 30.398  1.00 103.70 ? 473 NAG U C1  1 
HETATM 6223 C C2  . NAG O 9  .   ? 19.840 -37.132 30.188  1.00 103.33 ? 473 NAG U C2  1 
HETATM 6224 C C3  . NAG O 9  .   ? 18.527 -37.682 29.608  1.00 102.27 ? 473 NAG U C3  1 
HETATM 6225 C C4  . NAG O 9  .   ? 18.782 -38.567 28.372  1.00 101.42 ? 473 NAG U C4  1 
HETATM 6226 C C5  . NAG O 9  .   ? 19.859 -39.618 28.673  1.00 100.36 ? 473 NAG U C5  1 
HETATM 6227 C C6  . NAG O 9  .   ? 20.255 -40.430 27.452  1.00 99.18  ? 473 NAG U C6  1 
HETATM 6228 C C7  . NAG O 9  .   ? 19.833 -35.147 31.597  1.00 104.66 ? 473 NAG U C7  1 
HETATM 6229 C C8  . NAG O 9  .   ? 21.146 -34.762 32.268  1.00 102.40 ? 473 NAG U C8  1 
HETATM 6230 N N2  . NAG O 9  .   ? 19.576 -36.449 31.447  1.00 104.93 ? 473 NAG U N2  1 
HETATM 6231 O O1  . NAG O 9  .   ? 20.320 -39.183 31.316  1.00 105.28 ? 473 NAG U O1  1 
HETATM 6232 O O3  . NAG O 9  .   ? 17.674 -36.601 29.253  1.00 102.61 ? 473 NAG U O3  1 
HETATM 6233 O O4  . NAG O 9  .   ? 17.577 -39.223 27.990  1.00 101.46 ? 473 NAG U O4  1 
HETATM 6234 O O5  . NAG O 9  .   ? 21.054 -38.974 29.163  1.00 100.51 ? 473 NAG U O5  1 
HETATM 6235 O O6  . NAG O 9  .   ? 21.615 -40.841 27.523  1.00 98.34  ? 473 NAG U O6  1 
HETATM 6236 O O7  . NAG O 9  .   ? 19.056 -34.264 31.226  1.00 103.74 ? 473 NAG U O7  1 
HETATM 6237 C C1  . NDG P 11 .   ? 9.078  -19.999 67.399  1.00 80.98  ? 400 NDG U C1  1 
HETATM 6238 C C2  . NDG P 11 .   ? 8.220  -20.475 68.573  1.00 81.50  ? 400 NDG U C2  1 
HETATM 6239 C C3  . NDG P 11 .   ? 8.282  -19.450 69.716  1.00 82.03  ? 400 NDG U C3  1 
HETATM 6240 C C4  . NDG P 11 .   ? 9.741  -19.201 70.107  1.00 82.77  ? 400 NDG U C4  1 
HETATM 6241 C C5  . NDG P 11 .   ? 10.537 -18.760 68.864  1.00 82.88  ? 400 NDG U C5  1 
HETATM 6242 C C6  . NDG P 11 .   ? 12.022 -18.578 69.142  1.00 82.39  ? 400 NDG U C6  1 
HETATM 6243 C C7  . NDG P 11 .   ? 6.611  -21.267 66.962  1.00 74.90  ? 400 NDG U C7  1 
HETATM 6244 C C8  . NDG P 11 .   ? 5.932  -20.437 65.884  1.00 71.91  ? 400 NDG U C8  1 
HETATM 6245 O O   . NDG P 11 .   ? 10.430 -19.755 67.819  1.00 83.16  ? 400 NDG U O   1 
HETATM 6246 O O3  . NDG P 11 .   ? 7.562  -19.930 70.843  1.00 85.69  ? 400 NDG U O3  1 
HETATM 6247 O O4  . NDG P 11 .   ? 9.808  -18.203 71.121  1.00 82.57  ? 400 NDG U O4  1 
HETATM 6248 O O6  . NDG P 11 .   ? 12.820 -19.121 68.095  1.00 78.78  ? 400 NDG U O6  1 
HETATM 6249 O O7  . NDG P 11 .   ? 6.923  -22.440 66.730  1.00 72.24  ? 400 NDG U O7  1 
HETATM 6250 N N2  . NDG P 11 .   ? 6.852  -20.671 68.129  1.00 77.61  ? 400 NDG U N2  1 
HETATM 6251 O O1L . NDG P 11 .   ? 8.560  -18.828 66.873  1.00 83.69  ? 400 NDG U O1L 1 
HETATM 6252 O O1  . PG4 Q 12 .   ? 8.421  -23.320 34.462  1.00 46.13  ? 402 PG4 U O1  1 
HETATM 6253 C C1  . PG4 Q 12 .   ? 9.686  -22.527 34.572  1.00 49.42  ? 402 PG4 U C1  1 
HETATM 6254 C C2  . PG4 Q 12 .   ? 10.696 -23.516 35.177  1.00 49.21  ? 402 PG4 U C2  1 
HETATM 6255 O O2  . PG4 Q 12 .   ? 11.973 -22.794 35.277  1.00 51.75  ? 402 PG4 U O2  1 
HETATM 6256 C C3  . PG4 Q 12 .   ? 12.545 -22.805 36.676  1.00 44.89  ? 402 PG4 U C3  1 
HETATM 6257 C C4  . PG4 Q 12 .   ? 13.862 -22.055 36.732  1.00 48.36  ? 402 PG4 U C4  1 
HETATM 6258 O O3  . PG4 Q 12 .   ? 14.839 -22.972 37.284  1.00 46.21  ? 402 PG4 U O3  1 
HETATM 6259 C C5  . PG4 Q 12 .   ? 15.988 -23.064 36.385  1.00 45.76  ? 402 PG4 U C5  1 
HETATM 6260 C C6  . PG4 Q 12 .   ? 16.087 -24.459 35.847  1.00 52.21  ? 402 PG4 U C6  1 
HETATM 6261 O O4  . PG4 Q 12 .   ? 16.875 -24.436 34.663  1.00 48.93  ? 402 PG4 U O4  1 
HETATM 6262 C C7  . PG4 Q 12 .   ? 18.313 -24.659 34.727  1.00 54.71  ? 402 PG4 U C7  1 
HETATM 6263 C C8  . PG4 Q 12 .   ? 19.043 -23.537 34.001  1.00 54.74  ? 402 PG4 U C8  1 
HETATM 6264 O O5  . PG4 Q 12 .   ? 20.378 -23.885 33.450  1.00 58.03  ? 402 PG4 U O5  1 
HETATM 6265 O O   . HOH R 13 .   ? 37.009 -52.109 78.886  1.00 26.52  ? 502 HOH A O   1 
HETATM 6266 O O   . HOH R 13 .   ? 45.197 -36.992 72.463  1.00 37.03  ? 503 HOH A O   1 
HETATM 6267 O O   . HOH R 13 .   ? 44.492 -37.971 69.695  1.00 46.71  ? 504 HOH A O   1 
HETATM 6268 O O   . HOH R 13 .   ? 42.143 -37.433 66.429  1.00 53.60  ? 505 HOH A O   1 
HETATM 6269 O O   . HOH R 13 .   ? 39.592 -38.098 88.184  1.00 42.05  ? 506 HOH A O   1 
HETATM 6270 O O   . HOH R 13 .   ? 42.258 -39.902 69.023  1.00 40.97  ? 507 HOH A O   1 
HETATM 6271 O O   . HOH R 13 .   ? 47.868 -34.288 80.107  1.00 44.15  ? 508 HOH A O   1 
HETATM 6272 O O   . HOH R 13 .   ? 43.247 -43.050 90.645  1.00 40.34  ? 509 HOH A O   1 
HETATM 6273 O O   . HOH R 13 .   ? 47.124 -35.441 72.459  1.00 44.03  ? 510 HOH A O   1 
HETATM 6274 O O   . HOH R 13 .   ? 33.986 -34.976 66.546  1.00 40.31  ? 511 HOH A O   1 
HETATM 6275 O O   . HOH R 13 .   ? 43.652 -46.039 87.505  1.00 42.31  ? 512 HOH A O   1 
HETATM 6276 O O   . HOH R 13 .   ? 42.381 -52.234 83.686  1.00 46.77  ? 513 HOH A O   1 
HETATM 6277 O O   . HOH R 13 .   ? 20.999 -30.271 49.123  1.00 47.50  ? 514 HOH A O   1 
HETATM 6278 O O   . HOH R 13 .   ? 43.787 -53.767 76.424  1.00 42.43  ? 515 HOH A O   1 
HETATM 6279 O O   . HOH R 13 .   ? 39.700 -39.364 72.862  1.00 56.88  ? 516 HOH A O   1 
HETATM 6280 O O   . HOH R 13 .   ? 51.176 -50.904 73.996  1.00 45.46  ? 517 HOH A O   1 
HETATM 6281 O O   . HOH R 13 .   ? 59.144 -51.032 87.302  1.00 40.66  ? 518 HOH A O   1 
HETATM 6282 O O   . HOH R 13 .   ? 50.397 -28.757 72.605  1.00 51.56  ? 519 HOH A O   1 
HETATM 6283 O O   . HOH R 13 .   ? 45.197 -28.881 82.667  1.00 54.81  ? 520 HOH A O   1 
HETATM 6284 O O   . HOH R 13 .   ? 45.264 -22.890 60.168  1.00 42.12  ? 521 HOH A O   1 
HETATM 6285 O O   . HOH R 13 .   ? 41.430 -42.113 64.615  1.00 47.99  ? 522 HOH A O   1 
HETATM 6286 O O   . HOH R 13 .   ? 35.361 -31.775 68.425  1.00 13.01  ? 523 HOH A O   1 
HETATM 6287 O O   . HOH S 13 .   ? 22.382 -9.540  28.361  1.00 25.24  ? 408 HOH L O   1 
HETATM 6288 O O   . HOH S 13 .   ? 0.829  29.093  -13.644 1.00 22.65  ? 409 HOH L O   1 
HETATM 6289 O O   . HOH S 13 .   ? -5.246 16.653  -12.398 1.00 25.00  ? 410 HOH L O   1 
HETATM 6290 O O   . HOH S 13 .   ? 26.452 6.760   -3.111  1.00 29.10  ? 411 HOH L O   1 
HETATM 6291 O O   . HOH S 13 .   ? 6.916  9.354   -14.101 1.00 28.83  ? 412 HOH L O   1 
HETATM 6292 O O   . HOH S 13 .   ? 22.437 11.994  -10.535 1.00 24.49  ? 413 HOH L O   1 
HETATM 6293 O O   . HOH S 13 .   ? 9.031  11.210  -13.136 1.00 30.05  ? 414 HOH L O   1 
HETATM 6294 O O   . HOH S 13 .   ? 6.461  12.448  -4.008  1.00 29.00  ? 415 HOH L O   1 
HETATM 6295 O O   . HOH S 13 .   ? 25.497 17.903  -10.751 1.00 28.32  ? 416 HOH L O   1 
HETATM 6296 O O   . HOH S 13 .   ? 16.004 -4.375  12.126  1.00 31.44  ? 417 HOH L O   1 
HETATM 6297 O O   . HOH S 13 .   ? 12.286 9.729   -3.908  1.00 29.03  ? 418 HOH L O   1 
HETATM 6298 O O   . HOH S 13 .   ? 39.423 -1.243  5.331   1.00 32.84  ? 419 HOH L O   1 
HETATM 6299 O O   . HOH S 13 .   ? 11.263 22.228  -1.337  1.00 27.98  ? 420 HOH L O   1 
HETATM 6300 O O   . HOH S 13 .   ? 14.528 -2.388  29.071  1.00 30.36  ? 421 HOH L O   1 
HETATM 6301 O O   . HOH S 13 .   ? 9.726  -7.546  34.635  1.00 32.47  ? 422 HOH L O   1 
HETATM 6302 O O   . HOH S 13 .   ? 23.243 -12.588 15.273  1.00 34.95  ? 423 HOH L O   1 
HETATM 6303 O O   . HOH S 13 .   ? 11.865 26.518  -11.109 1.00 29.03  ? 424 HOH L O   1 
HETATM 6304 O O   . HOH S 13 .   ? 42.346 -7.102  13.399  1.00 29.22  ? 425 HOH L O   1 
HETATM 6305 O O   . HOH S 13 .   ? 17.842 -0.351  32.376  1.00 28.03  ? 426 HOH L O   1 
HETATM 6306 O O   . HOH S 13 .   ? 25.140 4.896   -1.376  1.00 33.17  ? 427 HOH L O   1 
HETATM 6307 O O   . HOH S 13 .   ? 24.004 10.027  -11.006 1.00 31.64  ? 428 HOH L O   1 
HETATM 6308 O O   . HOH S 13 .   ? 23.667 -7.194  12.008  1.00 33.31  ? 429 HOH L O   1 
HETATM 6309 O O   . HOH S 13 .   ? 28.505 12.162  6.454   1.00 35.87  ? 430 HOH L O   1 
HETATM 6310 O O   . HOH S 13 .   ? 28.964 12.947  -7.463  1.00 34.23  ? 431 HOH L O   1 
HETATM 6311 O O   . HOH S 13 .   ? 37.618 -3.820  5.715   1.00 35.85  ? 432 HOH L O   1 
HETATM 6312 O O   . HOH S 13 .   ? 19.393 17.074  -14.720 1.00 39.59  ? 433 HOH L O   1 
HETATM 6313 O O   . HOH S 13 .   ? 24.206 24.815  -10.586 1.00 32.75  ? 434 HOH L O   1 
HETATM 6314 O O   . HOH S 13 .   ? 34.895 -8.200  11.384  1.00 38.82  ? 435 HOH L O   1 
HETATM 6315 O O   . HOH S 13 .   ? 33.889 -5.792  11.729  1.00 30.72  ? 436 HOH L O   1 
HETATM 6316 O O   . HOH S 13 .   ? 38.769 -6.620  24.698  1.00 35.02  ? 437 HOH L O   1 
HETATM 6317 O O   . HOH S 13 .   ? -0.804 19.197  -7.517  1.00 38.13  ? 438 HOH L O   1 
HETATM 6318 O O   . HOH S 13 .   ? 24.512 -5.079  37.593  1.00 35.12  ? 439 HOH L O   1 
HETATM 6319 O O   . HOH S 13 .   ? -6.121 22.048  -10.712 1.00 35.03  ? 440 HOH L O   1 
HETATM 6320 O O   . HOH S 13 .   ? 10.709 12.565  3.215   1.00 35.95  ? 441 HOH L O   1 
HETATM 6321 O O   . HOH S 13 .   ? 1.025  8.626   -10.330 1.00 32.13  ? 442 HOH L O   1 
HETATM 6322 O O   . HOH S 13 .   ? 26.107 23.828  -2.138  1.00 31.26  ? 443 HOH L O   1 
HETATM 6323 O O   . HOH S 13 .   ? 18.649 -5.755  38.033  1.00 31.87  ? 444 HOH L O   1 
HETATM 6324 O O   . HOH S 13 .   ? -5.068 19.899  -9.362  1.00 44.34  ? 445 HOH L O   1 
HETATM 6325 O O   . HOH S 13 .   ? 0.991  11.315  -21.647 1.00 34.62  ? 446 HOH L O   1 
HETATM 6326 O O   . HOH S 13 .   ? 3.519  27.449  -17.942 1.00 36.89  ? 447 HOH L O   1 
HETATM 6327 O O   . HOH S 13 .   ? 43.465 -4.683  12.287  1.00 40.07  ? 448 HOH L O   1 
HETATM 6328 O O   . HOH S 13 .   ? 18.939 23.523  -1.711  1.00 36.32  ? 449 HOH L O   1 
HETATM 6329 O O   . HOH S 13 .   ? 42.157 -10.505 13.976  1.00 38.26  ? 450 HOH L O   1 
HETATM 6330 O O   . HOH S 13 .   ? 29.830 9.520   7.592   1.00 40.71  ? 451 HOH L O   1 
HETATM 6331 O O   . HOH S 13 .   ? 26.992 19.275  3.403   1.00 38.96  ? 452 HOH L O   1 
HETATM 6332 O O   . HOH S 13 .   ? 23.465 -10.964 11.643  1.00 33.10  ? 453 HOH L O   1 
HETATM 6333 O O   . HOH S 13 .   ? 13.205 7.874   3.585   1.00 38.40  ? 454 HOH L O   1 
HETATM 6334 O O   . HOH S 13 .   ? 27.020 -7.083  12.181  1.00 37.47  ? 455 HOH L O   1 
HETATM 6335 O O   . HOH S 13 .   ? 32.914 -3.033  27.336  1.00 39.42  ? 456 HOH L O   1 
HETATM 6336 O O   . HOH S 13 .   ? 30.256 -8.457  10.737  1.00 32.24  ? 457 HOH L O   1 
HETATM 6337 O O   . HOH S 13 .   ? 37.661 16.817  2.000   1.00 44.09  ? 458 HOH L O   1 
HETATM 6338 O O   . HOH S 13 .   ? 25.548 3.539   5.738   1.00 42.30  ? 459 HOH L O   1 
HETATM 6339 O O   . HOH S 13 .   ? 6.043  16.641  -19.300 1.00 42.02  ? 460 HOH L O   1 
HETATM 6340 O O   . HOH S 13 .   ? 2.064  14.361  -3.275  1.00 39.94  ? 461 HOH L O   1 
HETATM 6341 O O   . HOH S 13 .   ? 28.167 21.233  -3.926  1.00 41.33  ? 462 HOH L O   1 
HETATM 6342 O O   . HOH S 13 .   ? 20.907 1.741   0.549   1.00 37.36  ? 463 HOH L O   1 
HETATM 6343 O O   . HOH S 13 .   ? 10.342 30.963  -3.194  1.00 45.18  ? 464 HOH L O   1 
HETATM 6344 O O   . HOH S 13 .   ? 16.210 18.190  2.347   1.00 31.41  ? 465 HOH L O   1 
HETATM 6345 O O   . HOH S 13 .   ? 20.777 16.302  6.157   1.00 43.19  ? 466 HOH L O   1 
HETATM 6346 O O   . HOH S 13 .   ? 12.111 19.793  -0.570  1.00 40.90  ? 467 HOH L O   1 
HETATM 6347 O O   . HOH S 13 .   ? 43.554 -4.089  19.185  1.00 53.02  ? 468 HOH L O   1 
HETATM 6348 O O   . HOH S 13 .   ? 40.565 -9.203  10.253  1.00 44.28  ? 469 HOH L O   1 
HETATM 6349 O O   . HOH S 13 .   ? 13.889 21.266  -20.318 1.00 38.59  ? 470 HOH L O   1 
HETATM 6350 O O   . HOH S 13 .   ? 33.307 13.672  7.837   1.00 43.25  ? 471 HOH L O   1 
HETATM 6351 O O   . HOH S 13 .   ? 17.063 3.198   30.884  1.00 40.72  ? 472 HOH L O   1 
HETATM 6352 O O   . HOH S 13 .   ? -2.784 14.179  -10.956 1.00 55.76  ? 473 HOH L O   1 
HETATM 6353 O O   . HOH S 13 .   ? 3.071  19.757  -22.024 1.00 43.58  ? 474 HOH L O   1 
HETATM 6354 O O   . HOH S 13 .   ? 14.109 25.913  -16.560 1.00 43.33  ? 475 HOH L O   1 
HETATM 6355 O O   . HOH S 13 .   ? 37.777 0.176   25.091  1.00 46.12  ? 476 HOH L O   1 
HETATM 6356 O O   . HOH S 13 .   ? 19.879 3.194   16.130  1.00 38.41  ? 477 HOH L O   1 
HETATM 6357 O O   . HOH S 13 .   ? 26.903 -14.257 15.273  1.00 57.48  ? 478 HOH L O   1 
HETATM 6358 O O   . HOH S 13 .   ? 35.657 3.445   29.570  1.00 41.93  ? 479 HOH L O   1 
HETATM 6359 O O   . HOH S 13 .   ? 18.828 26.170  -2.306  1.00 42.43  ? 480 HOH L O   1 
HETATM 6360 O O   . HOH S 13 .   ? 0.258  10.588  -8.814  1.00 40.97  ? 481 HOH L O   1 
HETATM 6361 O O   . HOH S 13 .   ? 10.216 8.341   -4.028  1.00 40.25  ? 482 HOH L O   1 
HETATM 6362 O O   . HOH S 13 .   ? 15.606 6.538   3.242   1.00 44.02  ? 483 HOH L O   1 
HETATM 6363 O O   . HOH S 13 .   ? 38.820 -12.007 24.170  1.00 39.72  ? 484 HOH L O   1 
HETATM 6364 O O   . HOH S 13 .   ? 35.583 14.574  4.350   1.00 41.85  ? 485 HOH L O   1 
HETATM 6365 O O   . HOH S 13 .   ? 46.775 2.973   9.452   1.00 37.75  ? 486 HOH L O   1 
HETATM 6366 O O   . HOH S 13 .   ? 19.025 3.549   27.437  1.00 45.77  ? 487 HOH L O   1 
HETATM 6367 O O   . HOH S 13 .   ? 23.629 30.818  -1.835  1.00 45.11  ? 488 HOH L O   1 
HETATM 6368 O O   . HOH S 13 .   ? 4.552  -9.450  37.825  1.00 40.16  ? 489 HOH L O   1 
HETATM 6369 O O   . HOH S 13 .   ? -0.849 26.196  -8.615  1.00 45.42  ? 490 HOH L O   1 
HETATM 6370 O O   . HOH S 13 .   ? 40.029 -1.182  24.728  1.00 38.18  ? 491 HOH L O   1 
HETATM 6371 O O   . HOH S 13 .   ? 18.708 14.669  -15.754 1.00 35.85  ? 492 HOH L O   1 
HETATM 6372 O O   . HOH S 13 .   ? 21.851 -1.619  11.027  1.00 52.30  ? 493 HOH L O   1 
HETATM 6373 O O   . HOH S 13 .   ? 31.934 10.900  -6.269  1.00 40.00  ? 494 HOH L O   1 
HETATM 6374 O O   . HOH S 13 .   ? 40.807 -7.522  23.019  1.00 47.82  ? 495 HOH L O   1 
HETATM 6375 O O   . HOH S 13 .   ? 38.177 -14.471 16.768  1.00 39.46  ? 496 HOH L O   1 
HETATM 6376 O O   . HOH S 13 .   ? 38.708 9.959   0.163   1.00 44.06  ? 497 HOH L O   1 
HETATM 6377 O O   . HOH S 13 .   ? 19.566 22.481  -15.644 1.00 36.42  ? 498 HOH L O   1 
HETATM 6378 O O   . HOH S 13 .   ? 31.451 -16.354 20.676  1.00 46.38  ? 499 HOH L O   1 
HETATM 6379 O O   . HOH S 13 .   ? 8.540  4.688   -22.512 1.00 39.11  ? 500 HOH L O   1 
HETATM 6380 O O   . HOH S 13 .   ? 23.107 6.816   21.276  1.00 44.27  ? 501 HOH L O   1 
HETATM 6381 O O   . HOH S 13 .   ? 27.195 9.885   -10.363 1.00 54.25  ? 502 HOH L O   1 
HETATM 6382 O O   . HOH S 13 .   ? -1.300 23.491  -4.946  1.00 43.12  ? 503 HOH L O   1 
HETATM 6383 O O   . HOH S 13 .   ? 30.089 2.586   -6.613  1.00 56.76  ? 504 HOH L O   1 
HETATM 6384 O O   . HOH S 13 .   ? 16.872 28.343  -9.397  1.00 41.76  ? 505 HOH L O   1 
HETATM 6385 O O   . HOH S 13 .   ? 1.422  30.835  -10.566 1.00 40.70  ? 506 HOH L O   1 
HETATM 6386 O O   . HOH S 13 .   ? 26.874 -11.969 7.797   1.00 52.28  ? 507 HOH L O   1 
HETATM 6387 O O   . HOH S 13 .   ? 30.227 -2.714  6.652   1.00 59.05  ? 508 HOH L O   1 
HETATM 6388 O O   . HOH S 13 .   ? 21.817 5.592   6.377   1.00 55.92  ? 509 HOH L O   1 
HETATM 6389 O O   . HOH S 13 .   ? 8.225  8.530   -21.044 1.00 39.51  ? 510 HOH L O   1 
HETATM 6390 O O   . HOH S 13 .   ? 26.696 20.543  -12.702 1.00 37.23  ? 511 HOH L O   1 
HETATM 6391 O O   . HOH S 13 .   ? -1.487 12.457  -20.843 1.00 52.28  ? 512 HOH L O   1 
HETATM 6392 O O   . HOH S 13 .   ? 17.317 2.853   37.800  1.00 55.61  ? 513 HOH L O   1 
HETATM 6393 O O   . HOH S 13 .   ? 29.826 13.763  13.637  1.00 46.17  ? 514 HOH L O   1 
HETATM 6394 O O   . HOH S 13 .   ? 24.237 22.067  4.540   1.00 45.33  ? 515 HOH L O   1 
HETATM 6395 O O   . HOH S 13 .   ? 24.662 0.055   8.657   1.00 43.74  ? 516 HOH L O   1 
HETATM 6396 O O   . HOH S 13 .   ? 27.441 4.241   41.012  1.00 41.60  ? 517 HOH L O   1 
HETATM 6397 O O   . HOH S 13 .   ? 36.604 8.197   18.430  1.00 40.33  ? 518 HOH L O   1 
HETATM 6398 O O   . HOH S 13 .   ? 34.263 21.447  1.282   1.00 39.95  ? 519 HOH L O   1 
HETATM 6399 O O   . HOH S 13 .   ? 3.277  17.482  -20.128 1.00 43.81  ? 520 HOH L O   1 
HETATM 6400 O O   . HOH S 13 .   ? 16.403 -2.471  7.713   1.00 51.89  ? 521 HOH L O   1 
HETATM 6401 O O   . HOH S 13 .   ? 0.354  28.671  -9.621  1.00 44.28  ? 522 HOH L O   1 
HETATM 6402 O O   . HOH S 13 .   ? 38.934 6.675   3.234   1.00 53.42  ? 523 HOH L O   1 
HETATM 6403 O O   . HOH S 13 .   ? 3.491  29.630  -16.498 1.00 35.67  ? 524 HOH L O   1 
HETATM 6404 O O   . HOH S 13 .   ? 38.804 -12.701 12.626  1.00 46.01  ? 525 HOH L O   1 
HETATM 6405 O O   . HOH S 13 .   ? 19.819 4.943   37.726  1.00 46.70  ? 526 HOH L O   1 
HETATM 6406 O O   . HOH S 13 .   ? -3.683 27.614  -7.644  1.00 38.19  ? 527 HOH L O   1 
HETATM 6407 O O   . HOH S 13 .   ? 18.516 4.866   18.907  1.00 53.43  ? 528 HOH L O   1 
HETATM 6408 O O   . HOH T 13 .   ? 7.800  -16.446 24.029  1.00 15.86  ? 407 HOH H O   1 
HETATM 6409 O O   . HOH T 13 .   ? 30.939 -15.608 32.017  1.00 14.74  ? 408 HOH H O   1 
HETATM 6410 O O   . HOH T 13 .   ? 1.976  -15.896 22.716  1.00 20.28  ? 409 HOH H O   1 
HETATM 6411 O O   . HOH T 13 .   ? 9.172  -20.606 13.514  1.00 18.72  ? 410 HOH H O   1 
HETATM 6412 O O   . HOH T 13 .   ? 6.458  -9.163  34.012  1.00 19.75  ? 411 HOH H O   1 
HETATM 6413 O O   . HOH T 13 .   ? 5.252  -14.632 11.363  1.00 25.93  ? 412 HOH H O   1 
HETATM 6414 O O   . HOH T 13 .   ? 15.519 -21.800 25.121  1.00 20.59  ? 413 HOH H O   1 
HETATM 6415 O O   . HOH T 13 .   ? 10.359 -11.238 8.364   1.00 27.12  ? 414 HOH H O   1 
HETATM 6416 O O   . HOH T 13 .   ? 8.945  -14.592 15.275  1.00 20.76  ? 415 HOH H O   1 
HETATM 6417 O O   . HOH T 13 .   ? 19.648 -18.416 14.837  1.00 23.57  ? 416 HOH H O   1 
HETATM 6418 O O   . HOH T 13 .   ? -6.198 -6.860  18.495  1.00 24.82  ? 417 HOH H O   1 
HETATM 6419 O O   . HOH T 13 .   ? 2.361  -16.448 29.194  1.00 24.85  ? 418 HOH H O   1 
HETATM 6420 O O   . HOH T 13 .   ? 18.645 -10.964 10.096  1.00 31.80  ? 419 HOH H O   1 
HETATM 6421 O O   . HOH T 13 .   ? 3.323  -15.992 32.919  1.00 29.79  ? 420 HOH H O   1 
HETATM 6422 O O   . HOH T 13 .   ? 2.610  -13.945 30.369  1.00 30.17  ? 421 HOH H O   1 
HETATM 6423 O O   . HOH T 13 .   ? 6.282  -11.823 37.505  1.00 26.07  ? 422 HOH H O   1 
HETATM 6424 O O   . HOH T 13 .   ? 16.757 -0.929  24.993  1.00 24.97  ? 423 HOH H O   1 
HETATM 6425 O O   . HOH T 13 .   ? 22.995 -15.229 16.380  1.00 23.91  ? 424 HOH H O   1 
HETATM 6426 O O   . HOH T 13 .   ? 23.161 5.887   -10.920 1.00 31.85  ? 425 HOH H O   1 
HETATM 6427 O O   . HOH T 13 .   ? 14.487 -1.846  26.462  1.00 28.27  ? 426 HOH H O   1 
HETATM 6428 O O   . HOH T 13 .   ? 4.183  -25.628 18.044  1.00 28.53  ? 427 HOH H O   1 
HETATM 6429 O O   . HOH T 13 .   ? 33.081 -15.044 34.008  1.00 22.60  ? 428 HOH H O   1 
HETATM 6430 O O   . HOH T 13 .   ? -0.715 -15.657 23.041  1.00 29.18  ? 429 HOH H O   1 
HETATM 6431 O O   . HOH T 13 .   ? 1.151  -22.361 26.664  1.00 32.18  ? 430 HOH H O   1 
HETATM 6432 O O   . HOH T 13 .   ? 13.752 -25.549 33.448  1.00 36.79  ? 431 HOH H O   1 
HETATM 6433 O O   . HOH T 13 .   ? 18.385 0.957   21.392  1.00 32.62  ? 432 HOH H O   1 
HETATM 6434 O O   . HOH T 13 .   ? 15.489 -23.832 14.752  1.00 38.50  ? 433 HOH H O   1 
HETATM 6435 O O   . HOH T 13 .   ? -0.628 -9.870  23.352  1.00 30.89  ? 434 HOH H O   1 
HETATM 6436 O O   . HOH T 13 .   ? 12.284 0.015   26.448  1.00 29.30  ? 435 HOH H O   1 
HETATM 6437 O O   . HOH T 13 .   ? 7.448  9.566   -4.109  1.00 38.75  ? 436 HOH H O   1 
HETATM 6438 O O   . HOH T 13 .   ? -4.766 -8.285  9.825   1.00 38.91  ? 437 HOH H O   1 
HETATM 6439 O O   . HOH T 13 .   ? 12.875 0.192   18.116  1.00 42.79  ? 438 HOH H O   1 
HETATM 6440 O O   . HOH T 13 .   ? 13.099 -21.744 27.802  1.00 30.20  ? 439 HOH H O   1 
HETATM 6441 O O   . HOH T 13 .   ? 5.911  -7.236  6.703   1.00 38.09  ? 440 HOH H O   1 
HETATM 6442 O O   . HOH T 13 .   ? 20.157 12.446  -16.436 1.00 32.64  ? 441 HOH H O   1 
HETATM 6443 O O   . HOH T 13 .   ? 5.486  -3.106  19.227  1.00 32.07  ? 442 HOH H O   1 
HETATM 6444 O O   . HOH T 13 .   ? 4.395  -23.647 28.135  1.00 34.02  ? 443 HOH H O   1 
HETATM 6445 O O   . HOH T 13 .   ? -0.958 1.431   -7.266  1.00 40.45  ? 444 HOH H O   1 
HETATM 6446 O O   . HOH T 13 .   ? 6.450  -18.535 8.444   1.00 28.07  ? 445 HOH H O   1 
HETATM 6447 O O   . HOH T 13 .   ? 3.528  -26.492 26.050  1.00 33.47  ? 446 HOH H O   1 
HETATM 6448 O O   . HOH T 13 .   ? 1.370  -15.220 12.489  1.00 34.40  ? 447 HOH H O   1 
HETATM 6449 O O   . HOH T 13 .   ? -6.328 -10.307 14.877  1.00 35.94  ? 448 HOH H O   1 
HETATM 6450 O O   . HOH T 13 .   ? -7.219 -7.362  20.863  1.00 38.81  ? 449 HOH H O   1 
HETATM 6451 O O   . HOH T 13 .   ? -1.864 3.522   14.015  1.00 39.35  ? 450 HOH H O   1 
HETATM 6452 O O   . HOH T 13 .   ? 7.896  0.554   21.182  1.00 39.35  ? 451 HOH H O   1 
HETATM 6453 O O   . HOH T 13 .   ? 27.614 18.896  -24.193 1.00 35.04  ? 452 HOH H O   1 
HETATM 6454 O O   . HOH T 13 .   ? 6.832  -8.635  -3.163  1.00 39.15  ? 453 HOH H O   1 
HETATM 6455 O O   . HOH T 13 .   ? 5.479  -4.025  3.400   1.00 35.32  ? 454 HOH H O   1 
HETATM 6456 O O   . HOH T 13 .   ? -2.378 -17.364 22.186  1.00 44.11  ? 455 HOH H O   1 
HETATM 6457 O O   . HOH T 13 .   ? 22.381 12.669  -17.329 1.00 32.33  ? 456 HOH H O   1 
HETATM 6458 O O   . HOH T 13 .   ? 7.023  1.911   13.626  1.00 36.39  ? 457 HOH H O   1 
HETATM 6459 O O   . HOH T 13 .   ? 0.439  1.414   4.376   1.00 40.35  ? 458 HOH H O   1 
HETATM 6460 O O   . HOH T 13 .   ? 24.311 6.358   -27.758 1.00 44.14  ? 459 HOH H O   1 
HETATM 6461 O O   . HOH T 13 .   ? 12.801 -0.343  0.464   1.00 31.35  ? 460 HOH H O   1 
HETATM 6462 O O   . HOH T 13 .   ? -0.287 -16.596 28.812  1.00 37.19  ? 461 HOH H O   1 
HETATM 6463 O O   . HOH T 13 .   ? 10.967 -13.779 9.245   1.00 41.81  ? 462 HOH H O   1 
HETATM 6464 O O   . HOH T 13 .   ? 14.034 -7.550  -11.003 1.00 30.39  ? 463 HOH H O   1 
HETATM 6465 O O   . HOH T 13 .   ? 15.979 1.805   25.141  1.00 42.37  ? 464 HOH H O   1 
HETATM 6466 O O   . HOH T 13 .   ? 14.680 -28.646 23.057  1.00 35.56  ? 465 HOH H O   1 
HETATM 6467 O O   . HOH T 13 .   ? 4.289  12.668  -2.043  1.00 43.61  ? 466 HOH H O   1 
HETATM 6468 O O   . HOH T 13 .   ? 21.658 0.142   -4.661  1.00 40.00  ? 467 HOH H O   1 
HETATM 6469 O O   . HOH T 13 .   ? 0.965  5.865   -5.223  1.00 38.47  ? 468 HOH H O   1 
HETATM 6470 O O   . HOH T 13 .   ? 10.543 -2.771  33.168  1.00 36.06  ? 469 HOH H O   1 
HETATM 6471 O O   . HOH T 13 .   ? 2.663  -18.358 36.518  1.00 35.41  ? 470 HOH H O   1 
HETATM 6472 O O   . HOH T 13 .   ? 3.888  -0.216  -15.584 1.00 41.25  ? 471 HOH H O   1 
HETATM 6473 O O   . HOH T 13 .   ? 27.727 -18.290 24.904  1.00 36.65  ? 472 HOH H O   1 
HETATM 6474 O O   . HOH T 13 .   ? 10.502 4.108   12.870  1.00 41.59  ? 473 HOH H O   1 
HETATM 6475 O O   . HOH T 13 .   ? -0.766 -7.699  1.183   1.00 39.63  ? 474 HOH H O   1 
HETATM 6476 O O   . HOH T 13 .   ? 11.417 -4.923  7.521   1.00 53.57  ? 475 HOH H O   1 
HETATM 6477 O O   . HOH T 13 .   ? 7.915  -2.693  9.195   1.00 38.71  ? 476 HOH H O   1 
HETATM 6478 O O   . HOH T 13 .   ? 2.675  0.175   5.879   1.00 58.65  ? 477 HOH H O   1 
HETATM 6479 O O   . HOH T 13 .   ? 3.044  0.124   20.512  1.00 35.77  ? 478 HOH H O   1 
HETATM 6480 O O   . HOH T 13 .   ? -3.745 1.563   -6.716  1.00 49.48  ? 479 HOH H O   1 
HETATM 6481 O O   . HOH T 13 .   ? 20.904 -4.557  -12.433 1.00 37.79  ? 480 HOH H O   1 
HETATM 6482 O O   . HOH T 13 .   ? 1.961  -2.114  26.915  1.00 44.26  ? 481 HOH H O   1 
HETATM 6483 O O   . HOH T 13 .   ? 26.348 -22.321 22.715  1.00 40.77  ? 482 HOH H O   1 
HETATM 6484 O O   . HOH T 13 .   ? -1.446 -0.063  21.530  1.00 43.33  ? 483 HOH H O   1 
HETATM 6485 O O   . HOH T 13 .   ? 0.249  3.724   -13.915 1.00 43.35  ? 484 HOH H O   1 
HETATM 6486 O O   . HOH T 13 .   ? 0.684  -11.711 6.727   1.00 43.29  ? 485 HOH H O   1 
HETATM 6487 O O   . HOH T 13 .   ? 19.762 -16.283 11.091  1.00 41.41  ? 486 HOH H O   1 
HETATM 6488 O O   . HOH T 13 .   ? -2.630 -6.766  3.305   1.00 43.62  ? 487 HOH H O   1 
HETATM 6489 O O   . HOH T 13 .   ? 1.794  -8.779  28.964  1.00 38.58  ? 488 HOH H O   1 
HETATM 6490 O O   . HOH T 13 .   ? 16.112 -6.704  -19.658 1.00 45.07  ? 489 HOH H O   1 
HETATM 6491 O O   . HOH T 13 .   ? 17.322 2.630   -26.409 1.00 40.68  ? 490 HOH H O   1 
HETATM 6492 O O   . HOH T 13 .   ? 20.825 -30.590 24.990  1.00 51.54  ? 491 HOH H O   1 
HETATM 6493 O O   . HOH T 13 .   ? 3.276  1.320   10.075  1.00 48.74  ? 492 HOH H O   1 
HETATM 6494 O O   . HOH T 13 .   ? -3.452 -5.267  5.380   1.00 39.44  ? 493 HOH H O   1 
HETATM 6495 O O   . HOH T 13 .   ? -6.023 -12.886 16.933  1.00 47.25  ? 494 HOH H O   1 
HETATM 6496 O O   . HOH T 13 .   ? 17.875 -3.492  -22.428 1.00 45.10  ? 495 HOH H O   1 
HETATM 6497 O O   . HOH T 13 .   ? 11.156 -30.645 20.741  1.00 41.15  ? 496 HOH H O   1 
HETATM 6498 O O   . HOH T 13 .   ? 18.305 -18.594 12.205  1.00 40.68  ? 497 HOH H O   1 
HETATM 6499 O O   . HOH T 13 .   ? 9.733  -4.211  -22.686 1.00 43.01  ? 498 HOH H O   1 
HETATM 6500 O O   . HOH T 13 .   ? 11.332 -28.075 24.404  1.00 45.54  ? 499 HOH H O   1 
HETATM 6501 O O   . HOH T 13 .   ? 16.084 -9.774  -14.142 1.00 48.48  ? 500 HOH H O   1 
HETATM 6502 O O   . HOH T 13 .   ? 15.855 12.087  -22.851 1.00 43.32  ? 501 HOH H O   1 
HETATM 6503 O O   . HOH T 13 .   ? 11.025 16.069  -21.723 1.00 46.20  ? 502 HOH H O   1 
HETATM 6504 O O   . HOH T 13 .   ? 20.564 -14.518 13.154  1.00 41.88  ? 503 HOH H O   1 
HETATM 6505 O O   . HOH T 13 .   ? 18.160 0.288   12.910  1.00 47.97  ? 504 HOH H O   1 
HETATM 6506 O O   . HOH T 13 .   ? 12.277 -1.596  30.614  1.00 54.27  ? 505 HOH H O   1 
HETATM 6507 O O   . HOH T 13 .   ? -0.367 -10.286 28.429  1.00 39.66  ? 506 HOH H O   1 
HETATM 6508 O O   . HOH T 13 .   ? -2.971 1.381   7.140   1.00 40.82  ? 507 HOH H O   1 
HETATM 6509 O O   . HOH T 13 .   ? 16.297 -4.223  -5.980  1.00 47.16  ? 508 HOH H O   1 
HETATM 6510 O O   . HOH T 13 .   ? 10.508 -18.510 7.821   1.00 55.45  ? 509 HOH H O   1 
HETATM 6511 O O   . HOH T 13 .   ? 16.198 -0.319  10.865  1.00 47.09  ? 510 HOH H O   1 
HETATM 6512 O O   . HOH T 13 .   ? 12.545 6.606   -3.843  1.00 46.34  ? 511 HOH H O   1 
HETATM 6513 O O   . HOH T 13 .   ? 19.493 -26.520 14.492  1.00 49.51  ? 512 HOH H O   1 
HETATM 6514 O O   . HOH T 13 .   ? 15.568 3.770   19.375  1.00 50.40  ? 513 HOH H O   1 
HETATM 6515 O O   . HOH T 13 .   ? 5.596  0.844   22.208  1.00 53.25  ? 514 HOH H O   1 
HETATM 6516 O O   . HOH T 13 .   ? 0.593  6.956   3.570   1.00 49.06  ? 515 HOH H O   1 
HETATM 6517 O O   . HOH T 13 .   ? 28.472 -3.420  -14.697 1.00 46.89  ? 516 HOH H O   1 
HETATM 6518 O O   . HOH T 13 .   ? 14.287 -8.966  -1.929  1.00 51.30  ? 517 HOH H O   1 
HETATM 6519 O O   . HOH T 13 .   ? 23.445 2.125   -3.651  1.00 47.02  ? 518 HOH H O   1 
HETATM 6520 O O   . HOH T 13 .   ? 27.746 0.744   -18.598 1.00 43.42  ? 519 HOH H O   1 
HETATM 6521 O O   . HOH T 13 .   ? 3.974  13.624  0.608   1.00 38.20  ? 520 HOH H O   1 
HETATM 6522 O O   . HOH T 13 .   ? 3.534  2.038   -17.266 1.00 42.70  ? 521 HOH H O   1 
HETATM 6523 O O   . HOH T 13 .   ? 12.021 -3.367  -2.139  1.00 44.63  ? 522 HOH H O   1 
HETATM 6524 O O   . HOH T 13 .   ? 15.612 -7.844  8.876   1.00 38.92  ? 523 HOH H O   1 
HETATM 6525 O O   . HOH T 13 .   ? -7.551 -1.796  23.205  1.00 44.82  ? 524 HOH H O   1 
HETATM 6526 O O   . HOH T 13 .   ? 26.527 -20.146 20.233  1.00 46.35  ? 525 HOH H O   1 
HETATM 6527 O O   . HOH T 13 .   ? 14.156 -10.003 8.860   1.00 37.88  ? 526 HOH H O   1 
HETATM 6528 O O   . HOH T 13 .   ? 29.650 -4.275  -9.920  1.00 49.53  ? 527 HOH H O   1 
HETATM 6529 O O   . HOH U 13 .   ? 5.454  -15.384 35.089  1.00 24.66  ? 474 HOH U O   1 
HETATM 6530 O O   . HOH U 13 .   ? 16.538 -26.595 37.653  1.00 31.92  ? 475 HOH U O   1 
HETATM 6531 O O   . HOH U 13 .   ? 15.632 -10.136 39.667  1.00 24.33  ? 476 HOH U O   1 
HETATM 6532 O O   . HOH U 13 .   ? 17.760 -8.063  46.056  1.00 26.12  ? 477 HOH U O   1 
HETATM 6533 O O   . HOH U 13 .   ? 28.691 -15.329 46.336  1.00 32.65  ? 478 HOH U O   1 
HETATM 6534 O O   . HOH U 13 .   ? 2.876  -18.468 48.856  1.00 33.21  ? 479 HOH U O   1 
HETATM 6535 O O   . HOH U 13 .   ? 19.993 -10.036 44.220  1.00 37.63  ? 480 HOH U O   1 
HETATM 6536 O O   . HOH U 13 .   ? 41.768 -31.796 51.163  1.00 36.28  ? 481 HOH U O   1 
HETATM 6537 O O   . HOH U 13 .   ? 37.033 -41.884 64.665  1.00 42.27  ? 482 HOH U O   1 
HETATM 6538 O O   . HOH U 13 .   ? 32.043 -37.165 67.478  1.00 32.36  ? 483 HOH U O   1 
HETATM 6539 O O   . HOH U 13 .   ? 32.475 -23.966 44.117  1.00 37.41  ? 484 HOH U O   1 
HETATM 6540 O O   . HOH U 13 .   ? 33.137 -48.515 71.956  1.00 41.70  ? 485 HOH U O   1 
HETATM 6541 O O   . HOH U 13 .   ? 8.270  -24.900 36.826  1.00 48.68  ? 486 HOH U O   1 
HETATM 6542 O O   . HOH U 13 .   ? 28.346 -57.090 65.960  1.00 36.43  ? 487 HOH U O   1 
HETATM 6543 O O   . HOH U 13 .   ? 3.452  -19.643 39.347  1.00 31.93  ? 488 HOH U O   1 
HETATM 6544 O O   . HOH U 13 .   ? 6.997  -23.488 39.669  1.00 38.93  ? 489 HOH U O   1 
HETATM 6545 O O   . HOH U 13 .   ? 29.229 -48.395 59.069  1.00 35.03  ? 490 HOH U O   1 
HETATM 6546 O O   . HOH U 13 .   ? 2.872  -19.655 53.603  1.00 37.56  ? 491 HOH U O   1 
HETATM 6547 O O   . HOH U 13 .   ? 1.938  -19.370 51.608  1.00 38.76  ? 492 HOH U O   1 
HETATM 6548 O O   . HOH U 13 .   ? 34.339 -16.361 48.088  1.00 28.09  ? 493 HOH U O   1 
HETATM 6549 O O   . HOH U 13 .   ? 20.056 -32.981 50.591  1.00 43.13  ? 494 HOH U O   1 
HETATM 6550 O O   . HOH U 13 .   ? 20.551 -13.152 47.485  1.00 37.41  ? 495 HOH U O   1 
HETATM 6551 O O   . HOH U 13 .   ? 37.367 -40.540 44.487  1.00 47.38  ? 496 HOH U O   1 
HETATM 6552 O O   . HOH U 13 .   ? 15.424 -33.758 52.869  1.00 39.34  ? 497 HOH U O   1 
HETATM 6553 O O   . HOH U 13 .   ? 6.994  -5.985  49.550  1.00 45.63  ? 498 HOH U O   1 
HETATM 6554 O O   . HOH U 13 .   ? 34.019 -44.125 66.360  1.00 42.83  ? 499 HOH U O   1 
HETATM 6555 O O   . HOH U 13 .   ? 24.983 -54.871 63.883  1.00 48.90  ? 500 HOH U O   1 
HETATM 6556 O O   . HOH U 13 .   ? 35.189 -37.281 70.029  1.00 39.62  ? 501 HOH U O   1 
HETATM 6557 O O   . HOH U 13 .   ? 28.444 -26.810 56.228  1.00 36.91  ? 502 HOH U O   1 
HETATM 6558 O O   . HOH U 13 .   ? 29.234 -48.398 75.582  1.00 43.41  ? 503 HOH U O   1 
HETATM 6559 O O   . HOH U 13 .   ? 31.464 -16.616 39.307  1.00 36.05  ? 504 HOH U O   1 
HETATM 6560 O O   . HOH U 13 .   ? 31.766 -11.234 43.780  1.00 44.86  ? 505 HOH U O   1 
HETATM 6561 O O   . HOH U 13 .   ? 19.442 -6.489  42.516  1.00 47.33  ? 506 HOH U O   1 
HETATM 6562 O O   . HOH U 13 .   ? 29.844 -21.348 54.650  1.00 37.90  ? 507 HOH U O   1 
HETATM 6563 O O   . HOH U 13 .   ? 30.581 -48.590 56.553  1.00 37.48  ? 508 HOH U O   1 
HETATM 6564 O O   . HOH U 13 .   ? 34.157 -30.301 53.577  1.00 48.19  ? 509 HOH U O   1 
HETATM 6565 O O   . HOH U 13 .   ? 18.914 -27.030 37.077  1.00 46.76  ? 510 HOH U O   1 
HETATM 6566 O O   . HOH U 13 .   ? 15.799 -6.035  47.852  1.00 37.34  ? 511 HOH U O   1 
HETATM 6567 O O   . HOH U 13 .   ? 9.845  -5.925  49.938  1.00 47.33  ? 512 HOH U O   1 
HETATM 6568 O O   . HOH U 13 .   ? 2.424  -23.664 44.082  1.00 52.23  ? 513 HOH U O   1 
HETATM 6569 O O   . HOH U 13 .   ? 30.807 -26.166 50.320  1.00 49.92  ? 514 HOH U O   1 
HETATM 6570 O O   . HOH U 13 .   ? 5.155  -7.825  53.189  1.00 40.46  ? 515 HOH U O   1 
HETATM 6571 O O   . HOH U 13 .   ? 32.753 -48.812 61.897  1.00 62.44  ? 516 HOH U O   1 
HETATM 6572 O O   . HOH U 13 .   ? 20.570 -56.559 65.572  1.00 46.57  ? 517 HOH U O   1 
HETATM 6573 O O   . HOH U 13 .   ? 5.045  -32.893 55.129  1.00 56.87  ? 518 HOH U O   1 
HETATM 6574 O O   . HOH U 13 .   ? 13.781 -46.778 55.815  1.00 44.04  ? 519 HOH U O   1 
HETATM 6575 O O   . HOH U 13 .   ? 15.208 -53.996 62.444  1.00 52.32  ? 520 HOH U O   1 
HETATM 6576 O O   . HOH U 13 .   ? 35.056 -16.493 40.334  1.00 47.82  ? 521 HOH U O   1 
HETATM 6577 O O   . HOH U 13 .   ? -0.638 -11.896 53.634  1.00 35.38  ? 522 HOH U O   1 
HETATM 6578 O O   . HOH U 13 .   ? 38.418 -44.725 63.134  1.00 49.49  ? 523 HOH U O   1 
HETATM 6579 O O   . HOH U 13 .   ? 23.702 -5.162  41.664  1.00 43.27  ? 524 HOH U O   1 
HETATM 6580 O O   . HOH U 13 .   ? -0.622 -22.731 50.180  1.00 51.37  ? 525 HOH U O   1 
HETATM 6581 O O   . HOH U 13 .   ? 29.281 -27.435 54.159  1.00 41.15  ? 526 HOH U O   1 
HETATM 6582 O O   . HOH U 13 .   ? 35.186 -21.161 53.560  1.00 41.67  ? 527 HOH U O   1 
HETATM 6583 O O   . HOH U 13 .   ? 2.273  -11.231 43.431  1.00 44.78  ? 528 HOH U O   1 
HETATM 6584 O O   . HOH U 13 .   ? 31.763 -26.042 36.452  1.00 55.68  ? 529 HOH U O   1 
HETATM 6585 O O   . HOH U 13 .   ? 23.620 -47.309 47.076  1.00 43.73  ? 530 HOH U O   1 
HETATM 6586 O O   . HOH U 13 .   ? 22.138 -42.190 47.023  1.00 45.94  ? 531 HOH U O   1 
HETATM 6587 O O   . HOH U 13 .   ? 46.060 -32.768 47.047  1.00 44.46  ? 532 HOH U O   1 
HETATM 6588 O O   . HOH U 13 .   ? 19.652 -18.753 57.706  1.00 45.15  ? 533 HOH U O   1 
HETATM 6589 O O   . HOH U 13 .   ? 6.439  -25.462 52.130  1.00 39.87  ? 534 HOH U O   1 
HETATM 6590 O O   . HOH U 13 .   ? 19.409 -9.097  49.284  1.00 41.57  ? 535 HOH U O   1 
HETATM 6591 O O   . HOH U 13 .   ? -0.093 -15.543 47.936  1.00 33.03  ? 536 HOH U O   1 
HETATM 6592 O O   . HOH U 13 .   ? 38.111 -27.025 51.498  1.00 52.06  ? 537 HOH U O   1 
HETATM 6593 O O   . HOH U 13 .   ? 5.061  -5.622  52.047  1.00 38.91  ? 538 HOH U O   1 
HETATM 6594 O O   . HOH U 13 .   ? 18.885 -44.453 73.564  1.00 43.20  ? 539 HOH U O   1 
HETATM 6595 O O   . HOH U 13 .   ? 8.055  -48.240 64.986  1.00 46.61  ? 540 HOH U O   1 
HETATM 6596 O O   . HOH U 13 .   ? 23.109 -52.259 55.473  1.00 45.03  ? 541 HOH U O   1 
HETATM 6597 O O   . HOH U 13 .   ? 24.332 -13.855 50.458  1.00 42.76  ? 542 HOH U O   1 
HETATM 6598 O O   . HOH U 13 .   ? -0.783 -9.678  57.242  1.00 50.99  ? 543 HOH U O   1 
HETATM 6599 O O   . HOH U 13 .   ? 34.958 -39.291 47.097  1.00 69.17  ? 544 HOH U O   1 
HETATM 6600 O O   . HOH U 13 .   ? 32.502 -17.419 47.131  1.00 8.88   ? 545 HOH U O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   CYS 1   11  11  CYS CYS A . n 
A 1 2   ASP 2   12  12  ASP ASP A . n 
A 1 3   CYS 3   13  13  CYS CYS A . n 
A 1 4   LEU 4   14  14  LEU LEU A . n 
A 1 5   ASN 5   15  15  ASN ASN A . n 
A 1 6   GLY 6   16  16  GLY GLY A . n 
A 1 7   GLY 7   17  17  GLY GLY A . n 
A 1 8   THR 8   18  18  THR THR A . n 
A 1 9   CYS 9   19  19  CYS CYS A . n 
A 1 10  VAL 10  20  20  VAL VAL A . n 
A 1 11  SER 11  21  21  SER SER A . n 
A 1 12  ASN 12  22  22  ASN ASN A . n 
A 1 13  LYS 13  23  23  LYS LYS A . n 
A 1 14  TYR 14  24  24  TYR TYR A . n 
A 1 15  PHE 15  25  25  PHE PHE A . n 
A 1 16  SER 16  26  26  SER SER A . n 
A 1 17  ASN 17  27  27  ASN ASN A . n 
A 1 18  ILE 18  28  28  ILE ILE A . n 
A 1 19  HIS 19  29  29  HIS HIS A . n 
A 1 20  TRP 20  30  30  TRP TRP A . n 
A 1 21  CYS 21  31  31  CYS CYS A . n 
A 1 22  ASN 22  32  32  ASN ASN A . n 
A 1 23  CYS 23  33  33  CYS CYS A . n 
A 1 24  PRO 24  34  34  PRO PRO A . n 
A 1 25  LYS 25  35  35  LYS LYS A . n 
A 1 26  LYS 26  36  36  LYS LYS A . n 
A 1 27  PHE 27  37  37  PHE PHE A . n 
A 1 28  GLY 28  38  38  GLY GLY A . n 
A 1 29  GLY 29  39  39  GLY GLY A . n 
A 1 30  GLN 30  40  40  GLN GLN A . n 
A 1 31  HIS 31  41  41  HIS HIS A . n 
A 1 32  CYS 32  42  42  CYS CYS A . n 
A 1 33  GLU 33  43  43  GLU GLU A . n 
A 1 34  ILE 34  44  44  ILE ILE A . n 
A 1 35  ASP 35  45  45  ASP ASP A . n 
A 1 36  LYS 36  46  46  LYS LYS A . n 
A 1 37  SER 37  47  47  SER SER A . n 
A 1 38  LYS 38  48  48  LYS LYS A . n 
A 1 39  THR 39  49  49  THR THR A . n 
A 1 40  CYS 40  50  50  CYS CYS A . n 
A 1 41  TYR 41  51  51  TYR TYR A . n 
A 1 42  GLU 42  52  52  GLU GLU A . n 
A 1 43  GLY 43  53  53  GLY GLY A . n 
A 1 44  ASN 44  54  54  ASN ASN A . n 
A 1 45  GLY 45  55  55  GLY GLY A . n 
A 1 46  HIS 46  56  56  HIS HIS A . n 
A 1 47  PHE 47  57  57  PHE PHE A . n 
A 1 48  TYR 48  58  58  TYR TYR A . n 
A 1 49  ARG 49  59  59  ARG ARG A . n 
A 1 50  GLY 50  60  60  GLY GLY A . n 
A 1 51  LYS 51  61  61  LYS LYS A . n 
A 1 52  ALA 52  62  62  ALA ALA A . n 
A 1 53  SER 53  63  63  SER SER A . n 
A 1 54  THR 54  64  64  THR THR A . n 
A 1 55  ASP 55  65  65  ASP ASP A . n 
A 1 56  THR 56  66  66  THR THR A . n 
A 1 57  MET 57  67  67  MET MET A . n 
A 1 58  GLY 58  68  68  GLY GLY A . n 
A 1 59  ARG 59  69  69  ARG ARG A . n 
A 1 60  PRO 60  70  70  PRO PRO A . n 
A 1 61  CYS 61  71  71  CYS CYS A . n 
A 1 62  LEU 62  72  72  LEU LEU A . n 
A 1 63  PRO 63  73  73  PRO PRO A . n 
A 1 64  TRP 64  74  74  TRP TRP A . n 
A 1 65  ASN 65  75  75  ASN ASN A . n 
A 1 66  SER 66  76  76  SER SER A . n 
A 1 67  ALA 67  77  77  ALA ALA A . n 
A 1 68  THR 68  78  78  THR THR A . n 
A 1 69  VAL 69  79  79  VAL VAL A . n 
A 1 70  LEU 70  80  80  LEU LEU A . n 
A 1 71  GLN 71  81  81  GLN GLN A . n 
A 1 72  GLN 72  82  82  GLN GLN A . n 
A 1 73  THR 73  83  83  THR THR A . n 
A 1 74  TYR 74  84  84  TYR TYR A . n 
A 1 75  HIS 75  85  85  HIS HIS A . n 
A 1 76  ALA 76  86  86  ALA ALA A . n 
A 1 77  HIS 77  87  87  HIS HIS A . n 
A 1 78  ARG 78  88  88  ARG ARG A . n 
A 1 79  SER 79  89  89  SER SER A . n 
A 1 80  ASP 80  90  90  ASP ASP A . n 
A 1 81  ALA 81  91  91  ALA ALA A . n 
A 1 82  LEU 82  92  92  LEU LEU A . n 
A 1 83  GLN 83  93  93  GLN GLN A . n 
A 1 84  LEU 84  94  94  LEU LEU A . n 
A 1 85  GLY 85  95  95  GLY GLY A . n 
A 1 86  LEU 86  96  96  LEU LEU A . n 
A 1 87  GLY 87  97  97  GLY GLY A . n 
A 1 88  LYS 88  98  98  LYS LYS A . n 
A 1 89  HIS 89  99  99  HIS HIS A . n 
A 1 90  ASN 90  100 100 ASN ASN A . n 
A 1 91  TYR 91  101 101 TYR TYR A . n 
A 1 92  CYS 92  102 102 CYS CYS A . n 
A 1 93  ARG 93  103 103 ARG ARG A . n 
A 1 94  ASN 94  104 104 ASN ASN A . n 
A 1 95  PRO 95  105 105 PRO PRO A . n 
A 1 96  ASP 96  106 106 ASP ASP A . n 
A 1 97  ASN 97  107 107 ASN ASN A . n 
A 1 98  ARG 98  108 108 ARG ARG A . n 
A 1 99  ARG 99  109 109 ARG ARG A . n 
A 1 100 ARG 100 110 110 ARG ARG A . n 
A 1 101 PRO 101 111 111 PRO PRO A . n 
A 1 102 TRP 102 112 112 TRP TRP A . n 
A 1 103 CYS 103 113 113 CYS CYS A . n 
A 1 104 TYR 104 114 114 TYR TYR A . n 
A 1 105 VAL 105 115 115 VAL VAL A . n 
A 1 106 GLN 106 116 116 GLN GLN A . n 
A 1 107 VAL 107 117 117 VAL VAL A . n 
A 1 108 GLY 108 118 118 GLY GLY A . n 
A 1 109 LEU 109 119 119 LEU LEU A . n 
A 1 110 LYS 110 120 120 LYS LYS A . n 
A 1 111 PRO 111 121 121 PRO PRO A . n 
A 1 112 LEU 112 122 122 LEU LEU A . n 
A 1 113 VAL 113 123 123 VAL VAL A . n 
A 1 114 GLN 114 124 124 GLN GLN A . n 
A 1 115 GLU 115 125 125 GLU GLU A . n 
A 1 116 CYS 116 126 126 CYS CYS A . n 
A 1 117 MET 117 127 127 MET MET A . n 
A 1 118 VAL 118 128 128 VAL VAL A . n 
A 1 119 HIS 119 129 129 HIS HIS A . n 
A 1 120 ASP 120 130 130 ASP ASP A . n 
A 1 121 CYS 121 131 131 CYS CYS A . n 
A 1 122 ALA 122 132 132 ALA ALA A . n 
B 2 1   ASP 1   1   1   ASP ASP L . n 
B 2 2   ILE 2   2   2   ILE ILE L . n 
B 2 3   VAL 3   3   3   VAL VAL L . n 
B 2 4   LEU 4   4   4   LEU LEU L . n 
B 2 5   THR 5   5   5   THR THR L . n 
B 2 6   GLN 6   6   6   GLN GLN L . n 
B 2 7   SER 7   7   7   SER SER L . n 
B 2 8   PRO 8   8   8   PRO PRO L . n 
B 2 9   ASP 9   9   9   ASP ASP L . n 
B 2 10  ILE 10  10  10  ILE ILE L . n 
B 2 11  THR 11  11  11  THR THR L . n 
B 2 12  ALA 12  12  12  ALA ALA L . n 
B 2 13  ALA 13  13  13  ALA ALA L . n 
B 2 14  SER 14  14  14  SER SER L . n 
B 2 15  LEU 15  15  15  LEU LEU L . n 
B 2 16  GLY 16  16  16  GLY GLY L . n 
B 2 17  GLN 17  17  17  GLN GLN L . n 
B 2 18  LYS 18  18  18  LYS LYS L . n 
B 2 19  VAL 19  19  19  VAL VAL L . n 
B 2 20  THR 20  20  20  THR THR L . n 
B 2 21  ILE 21  21  21  ILE ILE L . n 
B 2 22  THR 22  22  22  THR THR L . n 
B 2 23  CYS 23  23  23  CYS CYS L . n 
B 2 24  SER 24  24  24  SER SER L . n 
B 2 25  ALA 25  25  25  ALA ALA L . n 
B 2 26  SER 26  26  26  SER SER L . n 
B 2 27  SER 27  27  27  SER SER L . n 
B 2 28  SER 28  29  29  SER SER L . n 
B 2 29  VAL 29  30  30  VAL VAL L . n 
B 2 30  SER 30  31  31  SER SER L . n 
B 2 31  TYR 31  32  32  TYR TYR L . n 
B 2 32  MET 32  33  33  MET MET L . n 
B 2 33  HIS 33  34  34  HIS HIS L . n 
B 2 34  TRP 34  35  35  TRP TRP L . n 
B 2 35  TYR 35  36  36  TYR TYR L . n 
B 2 36  GLN 36  37  37  GLN GLN L . n 
B 2 37  GLN 37  38  38  GLN GLN L . n 
B 2 38  LYS 38  39  39  LYS LYS L . n 
B 2 39  SER 39  40  40  SER SER L . n 
B 2 40  GLY 40  41  41  GLY GLY L . n 
B 2 41  THR 41  42  42  THR THR L . n 
B 2 42  SER 42  43  43  SER SER L . n 
B 2 43  PRO 43  44  44  PRO PRO L . n 
B 2 44  LYS 44  45  45  LYS LYS L . n 
B 2 45  PRO 45  46  46  PRO PRO L . n 
B 2 46  TRP 46  47  47  TRP TRP L . n 
B 2 47  ILE 47  48  48  ILE ILE L . n 
B 2 48  PHE 48  49  49  PHE PHE L . n 
B 2 49  GLU 49  50  50  GLU GLU L . n 
B 2 50  ILE 50  51  51  ILE ILE L . n 
B 2 51  SER 51  52  52  SER SER L . n 
B 2 52  LYS 52  53  53  LYS LYS L . n 
B 2 53  LEU 53  54  54  LEU LEU L . n 
B 2 54  ALA 54  55  55  ALA ALA L . n 
B 2 55  SER 55  56  56  SER SER L . n 
B 2 56  GLY 56  57  57  GLY GLY L . n 
B 2 57  VAL 57  58  58  VAL VAL L . n 
B 2 58  PRO 58  59  59  PRO PRO L . n 
B 2 59  ALA 59  60  60  ALA ALA L . n 
B 2 60  ARG 60  61  61  ARG ARG L . n 
B 2 61  PHE 61  62  62  PHE PHE L . n 
B 2 62  SER 62  63  63  SER SER L . n 
B 2 63  GLY 63  64  64  GLY GLY L . n 
B 2 64  SER 64  65  65  SER SER L . n 
B 2 65  GLY 65  66  66  GLY GLY L . n 
B 2 66  SER 66  67  67  SER SER L . n 
B 2 67  GLY 67  68  68  GLY GLY L . n 
B 2 68  THR 68  69  69  THR THR L . n 
B 2 69  SER 69  70  70  SER SER L . n 
B 2 70  TYR 70  71  71  TYR TYR L . n 
B 2 71  SER 71  72  72  SER SER L . n 
B 2 72  LEU 72  73  73  LEU LEU L . n 
B 2 73  THR 73  74  74  THR THR L . n 
B 2 74  ILE 74  75  75  ILE ILE L . n 
B 2 75  SER 75  76  76  SER SER L . n 
B 2 76  SER 76  77  77  SER SER L . n 
B 2 77  MET 77  78  78  MET MET L . n 
B 2 78  GLU 78  79  79  GLU GLU L . n 
B 2 79  ALA 79  80  80  ALA ALA L . n 
B 2 80  GLU 80  81  81  GLU GLU L . n 
B 2 81  ASP 81  82  82  ASP ASP L . n 
B 2 82  ALA 82  83  83  ALA ALA L . n 
B 2 83  ALA 83  84  84  ALA ALA L . n 
B 2 84  ILE 84  85  85  ILE ILE L . n 
B 2 85  TYR 85  86  86  TYR TYR L . n 
B 2 86  TYR 86  87  87  TYR TYR L . n 
B 2 87  CYS 87  88  88  CYS CYS L . n 
B 2 88  GLN 88  89  89  GLN GLN L . n 
B 2 89  GLN 89  90  90  GLN GLN L . n 
B 2 90  TRP 90  91  91  TRP TRP L . n 
B 2 91  ASN 91  92  92  ASN ASN L . n 
B 2 92  TYR 92  93  93  TYR TYR L . n 
B 2 93  PRO 93  94  94  PRO PRO L . n 
B 2 94  PHE 94  96  96  PHE PHE L . n 
B 2 95  THR 95  97  97  THR THR L . n 
B 2 96  PHE 96  98  98  PHE PHE L . n 
B 2 97  GLY 97  99  99  GLY GLY L . n 
B 2 98  GLY 98  100 100 GLY GLY L . n 
B 2 99  GLY 99  101 101 GLY GLY L . n 
B 2 100 THR 100 102 102 THR THR L . n 
B 2 101 LYS 101 103 103 LYS LYS L . n 
B 2 102 LEU 102 104 104 LEU LEU L . n 
B 2 103 GLU 103 105 105 GLU GLU L . n 
B 2 104 ILE 104 106 106 ILE ILE L . n 
B 2 105 LYS 105 106 106 LYS LYS L A n 
B 2 106 ARG 106 107 107 ARG ARG L . n 
B 2 107 ALA 107 108 108 ALA ALA L . n 
B 2 108 ASP 108 109 109 ASP ASP L . n 
B 2 109 ALA 109 110 110 ALA ALA L . n 
B 2 110 ALA 110 111 111 ALA ALA L . n 
B 2 111 PRO 111 112 112 PRO PRO L . n 
B 2 112 THR 112 113 113 THR THR L . n 
B 2 113 VAL 113 114 114 VAL VAL L . n 
B 2 114 SER 114 115 115 SER SER L . n 
B 2 115 ILE 115 116 116 ILE ILE L . n 
B 2 116 PHE 116 117 117 PHE PHE L . n 
B 2 117 PRO 117 118 118 PRO PRO L . n 
B 2 118 PRO 118 119 119 PRO PRO L . n 
B 2 119 SER 119 120 120 SER SER L . n 
B 2 120 SER 120 121 121 SER SER L . n 
B 2 121 GLU 121 122 122 GLU GLU L . n 
B 2 122 GLN 122 123 123 GLN GLN L . n 
B 2 123 LEU 123 124 124 LEU LEU L . n 
B 2 124 THR 124 125 125 THR THR L . n 
B 2 125 SER 125 126 126 SER SER L . n 
B 2 126 GLY 126 127 127 GLY GLY L . n 
B 2 127 GLY 127 128 128 GLY GLY L . n 
B 2 128 ALA 128 129 129 ALA ALA L . n 
B 2 129 SER 129 130 130 SER SER L . n 
B 2 130 VAL 130 131 131 VAL VAL L . n 
B 2 131 VAL 131 132 132 VAL VAL L . n 
B 2 132 CYS 132 133 133 CYS CYS L . n 
B 2 133 PHE 133 134 134 PHE PHE L . n 
B 2 134 LEU 134 135 135 LEU LEU L . n 
B 2 135 ASN 135 136 136 ASN ASN L . n 
B 2 136 ASN 136 137 137 ASN ASN L . n 
B 2 137 PHE 137 138 138 PHE PHE L . n 
B 2 138 TYR 138 139 139 TYR TYR L . n 
B 2 139 PRO 139 140 140 PRO PRO L . n 
B 2 140 LYS 140 141 141 LYS LYS L . n 
B 2 141 ASP 141 142 142 ASP ASP L . n 
B 2 142 ILE 142 143 143 ILE ILE L . n 
B 2 143 ASN 143 144 144 ASN ASN L . n 
B 2 144 VAL 144 145 145 VAL VAL L . n 
B 2 145 LYS 145 146 146 LYS LYS L . n 
B 2 146 TRP 146 147 147 TRP TRP L . n 
B 2 147 LYS 147 148 148 LYS LYS L . n 
B 2 148 ILE 148 149 149 ILE ILE L . n 
B 2 149 ASP 149 150 150 ASP ASP L . n 
B 2 150 GLY 150 151 151 GLY GLY L . n 
B 2 151 SER 151 152 152 SER SER L . n 
B 2 152 GLU 152 153 153 GLU GLU L . n 
B 2 153 ARG 153 154 154 ARG ARG L . n 
B 2 154 GLN 154 155 155 GLN GLN L . n 
B 2 155 ASN 155 156 156 ASN ASN L . n 
B 2 156 GLY 156 157 157 GLY GLY L . n 
B 2 157 VAL 157 158 158 VAL VAL L . n 
B 2 158 LEU 158 159 159 LEU LEU L . n 
B 2 159 ASN 159 160 160 ASN ASN L . n 
B 2 160 SER 160 161 161 SER SER L . n 
B 2 161 TRP 161 162 162 TRP TRP L . n 
B 2 162 THR 162 163 163 THR THR L . n 
B 2 163 ASP 163 164 164 ASP ASP L . n 
B 2 164 GLN 164 165 165 GLN GLN L . n 
B 2 165 ASP 165 166 166 ASP ASP L . n 
B 2 166 SER 166 167 167 SER SER L . n 
B 2 167 LYS 167 168 168 LYS LYS L . n 
B 2 168 ASP 168 169 169 ASP ASP L . n 
B 2 169 SER 169 170 170 SER SER L . n 
B 2 170 THR 170 171 171 THR THR L . n 
B 2 171 TYR 171 172 172 TYR TYR L . n 
B 2 172 SER 172 173 173 SER SER L . n 
B 2 173 MET 173 174 174 MET MET L . n 
B 2 174 SER 174 175 175 SER SER L . n 
B 2 175 SER 175 176 176 SER SER L . n 
B 2 176 THR 176 177 177 THR THR L . n 
B 2 177 LEU 177 178 178 LEU LEU L . n 
B 2 178 THR 178 179 179 THR THR L . n 
B 2 179 LEU 179 180 180 LEU LEU L . n 
B 2 180 THR 180 181 181 THR THR L . n 
B 2 181 LYS 181 182 182 LYS LYS L . n 
B 2 182 ASP 182 183 183 ASP ASP L . n 
B 2 183 GLU 183 184 184 GLU GLU L . n 
B 2 184 TYR 184 185 185 TYR TYR L . n 
B 2 185 GLU 185 186 186 GLU GLU L . n 
B 2 186 ARG 186 187 187 ARG ARG L . n 
B 2 187 HIS 187 188 188 HIS HIS L . n 
B 2 188 ASN 188 189 189 ASN ASN L . n 
B 2 189 SER 189 190 190 SER SER L . n 
B 2 190 TYR 190 191 191 TYR TYR L . n 
B 2 191 THR 191 192 192 THR THR L . n 
B 2 192 CYS 192 193 193 CYS CYS L . n 
B 2 193 GLU 193 194 194 GLU GLU L . n 
B 2 194 ALA 194 195 195 ALA ALA L . n 
B 2 195 THR 195 196 196 THR THR L . n 
B 2 196 HIS 196 197 197 HIS HIS L . n 
B 2 197 LYS 197 198 198 LYS LYS L . n 
B 2 198 THR 198 199 199 THR THR L . n 
B 2 199 SER 199 200 200 SER SER L . n 
B 2 200 THR 200 201 201 THR THR L . n 
B 2 201 SER 201 202 202 SER SER L . n 
B 2 202 PRO 202 203 203 PRO PRO L . n 
B 2 203 ILE 203 204 204 ILE ILE L . n 
B 2 204 VAL 204 205 205 VAL VAL L . n 
B 2 205 LYS 205 206 206 LYS LYS L . n 
B 2 206 SER 206 207 207 SER SER L . n 
B 2 207 PHE 207 208 208 PHE PHE L . n 
B 2 208 ASN 208 209 209 ASN ASN L . n 
B 2 209 ARG 209 210 210 ARG ARG L . n 
B 2 210 ASN 210 211 211 ASN ASN L . n 
B 2 211 GLU 211 212 212 GLU GLU L . n 
B 2 212 ALA 212 213 213 ALA ALA L . n 
B 2 213 LYS 213 214 214 LYS LYS L . n 
B 2 214 ALA 214 215 215 ALA ALA L . n 
C 3 1   GLY 1   1   1   GLY GLY H . n 
C 3 2   VAL 2   2   2   VAL VAL H . n 
C 3 3   LYS 3   3   3   LYS LYS H . n 
C 3 4   LEU 4   4   4   LEU LEU H . n 
C 3 5   GLN 5   5   5   GLN GLN H . n 
C 3 6   GLN 6   6   6   GLN GLN H . n 
C 3 7   SER 7   7   7   SER SER H . n 
C 3 8   GLY 8   8   8   GLY GLY H . n 
C 3 9   PRO 9   9   9   PRO PRO H . n 
C 3 10  GLU 10  10  10  GLU GLU H . n 
C 3 11  VAL 11  11  11  VAL VAL H . n 
C 3 12  VAL 12  12  12  VAL VAL H . n 
C 3 13  LYS 13  13  13  LYS LYS H . n 
C 3 14  PRO 14  14  14  PRO PRO H . n 
C 3 15  GLY 15  15  15  GLY GLY H . n 
C 3 16  ALA 16  16  16  ALA ALA H . n 
C 3 17  SER 17  17  17  SER SER H . n 
C 3 18  VAL 18  18  18  VAL VAL H . n 
C 3 19  LYS 19  19  19  LYS LYS H . n 
C 3 20  ILE 20  20  20  ILE ILE H . n 
C 3 21  SER 21  21  21  SER SER H . n 
C 3 22  CYS 22  22  22  CYS CYS H . n 
C 3 23  LYS 23  23  23  LYS LYS H . n 
C 3 24  ALA 24  24  24  ALA ALA H . n 
C 3 25  SER 25  25  25  SER SER H . n 
C 3 26  GLY 26  26  26  GLY GLY H . n 
C 3 27  TYR 27  27  27  TYR TYR H . n 
C 3 28  SER 28  28  28  SER SER H . n 
C 3 29  PHE 29  29  29  PHE PHE H . n 
C 3 30  THR 30  30  30  THR THR H . n 
C 3 31  ASN 31  31  31  ASN ASN H . n 
C 3 32  PHE 32  32  32  PHE PHE H . n 
C 3 33  TYR 33  33  33  TYR TYR H . n 
C 3 34  ILE 34  34  34  ILE ILE H . n 
C 3 35  HIS 35  35  35  HIS HIS H . n 
C 3 36  TRP 36  36  36  TRP TRP H . n 
C 3 37  VAL 37  37  37  VAL VAL H . n 
C 3 38  LYS 38  38  38  LYS LYS H . n 
C 3 39  GLN 39  39  39  GLN GLN H . n 
C 3 40  ARG 40  40  40  ARG ARG H . n 
C 3 41  PRO 41  41  41  PRO PRO H . n 
C 3 42  GLY 42  42  42  GLY GLY H . n 
C 3 43  GLN 43  43  43  GLN GLN H . n 
C 3 44  GLY 44  44  44  GLY GLY H . n 
C 3 45  LEU 45  45  45  LEU LEU H . n 
C 3 46  GLU 46  46  46  GLU GLU H . n 
C 3 47  TRP 47  47  47  TRP TRP H . n 
C 3 48  ILE 48  48  48  ILE ILE H . n 
C 3 49  GLY 49  49  49  GLY GLY H . n 
C 3 50  TRP 50  50  50  TRP TRP H . n 
C 3 51  ILE 51  51  51  ILE ILE H . n 
C 3 52  PHE 52  52  52  PHE PHE H . n 
C 3 53  HIS 53  52  52  HIS HIS H A n 
C 3 54  GLY 54  53  53  GLY GLY H . n 
C 3 55  SER 55  54  54  SER SER H . n 
C 3 56  ASP 56  55  55  ASP ASP H . n 
C 3 57  ASN 57  56  56  ASN ASN H . n 
C 3 58  THR 58  57  57  THR THR H . n 
C 3 59  GLU 59  58  58  GLU GLU H . n 
C 3 60  TYR 60  59  59  TYR TYR H . n 
C 3 61  ASN 61  60  60  ASN ASN H . n 
C 3 62  GLU 62  61  61  GLU GLU H . n 
C 3 63  LYS 63  62  62  LYS LYS H . n 
C 3 64  PHE 64  63  63  PHE PHE H . n 
C 3 65  LYS 65  64  64  LYS LYS H . n 
C 3 66  ASP 66  65  65  ASP ASP H . n 
C 3 67  LYS 67  66  66  LYS LYS H . n 
C 3 68  ALA 68  67  67  ALA ALA H . n 
C 3 69  THR 69  68  68  THR THR H . n 
C 3 70  LEU 70  69  69  LEU LEU H . n 
C 3 71  THR 71  70  70  THR THR H . n 
C 3 72  ALA 72  71  71  ALA ALA H . n 
C 3 73  ASP 73  72  72  ASP ASP H . n 
C 3 74  THR 74  73  73  THR THR H . n 
C 3 75  SER 75  74  74  SER SER H . n 
C 3 76  SER 76  75  75  SER SER H . n 
C 3 77  SER 77  76  76  SER SER H . n 
C 3 78  THR 78  77  77  THR THR H . n 
C 3 79  ALA 79  78  78  ALA ALA H . n 
C 3 80  TYR 80  79  79  TYR TYR H . n 
C 3 81  MET 81  80  80  MET MET H . n 
C 3 82  GLN 82  81  81  GLN GLN H . n 
C 3 83  LEU 83  82  82  LEU LEU H . n 
C 3 84  SER 84  82  82  SER SER H A n 
C 3 85  SER 85  82  82  SER SER H B n 
C 3 86  LEU 86  82  82  LEU LEU H C n 
C 3 87  THR 87  83  83  THR THR H . n 
C 3 88  SER 88  84  84  SER SER H . n 
C 3 89  GLU 89  85  85  GLU GLU H . n 
C 3 90  ASP 90  86  86  ASP ASP H . n 
C 3 91  SER 91  87  87  SER SER H . n 
C 3 92  ALA 92  88  88  ALA ALA H . n 
C 3 93  VAL 93  89  89  VAL VAL H . n 
C 3 94  TYR 94  90  90  TYR TYR H . n 
C 3 95  PHE 95  91  91  PHE PHE H . n 
C 3 96  CYS 96  92  92  CYS CYS H . n 
C 3 97  ALA 97  93  93  ALA ALA H . n 
C 3 98  ARG 98  94  94  ARG ARG H . n 
C 3 99  TRP 99  95  95  TRP TRP H . n 
C 3 100 GLY 100 96  96  GLY GLY H . n 
C 3 101 PRO 101 97  97  PRO PRO H . n 
C 3 102 HIS 102 98  98  HIS HIS H . n 
C 3 103 TRP 103 99  99  TRP TRP H . n 
C 3 104 TYR 104 100 100 TYR TYR H . n 
C 3 105 PHE 105 100 100 PHE PHE H A n 
C 3 106 ASP 106 101 101 ASP ASP H . n 
C 3 107 VAL 107 102 102 VAL VAL H . n 
C 3 108 TRP 108 103 103 TRP TRP H . n 
C 3 109 GLY 109 104 104 GLY GLY H . n 
C 3 110 GLN 110 105 105 GLN GLN H . n 
C 3 111 GLY 111 106 106 GLY GLY H . n 
C 3 112 THR 112 107 107 THR THR H . n 
C 3 113 THR 113 108 108 THR THR H . n 
C 3 114 VAL 114 109 109 VAL VAL H . n 
C 3 115 THR 115 110 110 THR THR H . n 
C 3 116 VAL 116 111 111 VAL VAL H . n 
C 3 117 SER 117 112 112 SER SER H . n 
C 3 118 SER 118 113 113 SER SER H . n 
C 3 119 ALA 119 114 114 ALA ALA H . n 
C 3 120 LYS 120 115 115 LYS LYS H . n 
C 3 121 THR 121 116 116 THR THR H . n 
C 3 122 THR 122 117 117 THR THR H . n 
C 3 123 PRO 123 118 118 PRO PRO H . n 
C 3 124 PRO 124 119 119 PRO PRO H . n 
C 3 125 SER 125 120 120 SER SER H . n 
C 3 126 VAL 126 121 121 VAL VAL H . n 
C 3 127 TYR 127 122 122 TYR TYR H . n 
C 3 128 PRO 128 123 123 PRO PRO H . n 
C 3 129 LEU 129 124 124 LEU LEU H . n 
C 3 130 ALA 130 125 125 ALA ALA H . n 
C 3 131 PRO 131 126 126 PRO PRO H . n 
C 3 132 GLY 132 127 ?   ?   ?   H . n 
C 3 133 ASN 133 128 128 ASN ASN H . n 
C 3 134 SER 134 129 129 SER SER H . n 
C 3 135 MET 135 130 130 MET MET H . n 
C 3 136 VAL 136 131 131 VAL VAL H . n 
C 3 137 THR 137 132 132 THR THR H . n 
C 3 138 LEU 138 133 133 LEU LEU H . n 
C 3 139 GLY 139 134 134 GLY GLY H . n 
C 3 140 CYS 140 135 135 CYS CYS H . n 
C 3 141 LEU 141 136 136 LEU LEU H . n 
C 3 142 VAL 142 137 137 VAL VAL H . n 
C 3 143 LYS 143 138 138 LYS LYS H . n 
C 3 144 GLY 144 139 139 GLY GLY H . n 
C 3 145 TYR 145 140 140 TYR TYR H . n 
C 3 146 PHE 146 141 141 PHE PHE H . n 
C 3 147 PRO 147 142 142 PRO PRO H . n 
C 3 148 GLU 148 143 143 GLU GLU H . n 
C 3 149 PRO 149 144 144 PRO PRO H . n 
C 3 150 VAL 150 145 145 VAL VAL H . n 
C 3 151 THR 151 146 146 THR THR H . n 
C 3 152 VAL 152 147 147 VAL VAL H . n 
C 3 153 THR 153 148 148 THR THR H . n 
C 3 154 TRP 154 149 149 TRP TRP H . n 
C 3 155 ASN 155 150 150 ASN ASN H . n 
C 3 156 SER 156 151 151 SER SER H . n 
C 3 157 GLY 157 152 152 GLY GLY H . n 
C 3 158 SER 158 153 153 SER SER H . n 
C 3 159 LEU 159 154 154 LEU LEU H . n 
C 3 160 SER 160 155 155 SER SER H . n 
C 3 161 SER 161 156 156 SER SER H . n 
C 3 162 GLY 162 157 157 GLY GLY H . n 
C 3 163 VAL 163 158 158 VAL VAL H . n 
C 3 164 HIS 164 159 159 HIS HIS H . n 
C 3 165 THR 165 160 160 THR THR H . n 
C 3 166 PHE 166 161 161 PHE PHE H . n 
C 3 167 PRO 167 162 162 PRO PRO H . n 
C 3 168 ALA 168 163 163 ALA ALA H . n 
C 3 169 VAL 169 164 164 VAL VAL H . n 
C 3 170 LEU 170 165 165 LEU LEU H . n 
C 3 171 GLN 171 166 166 GLN GLN H . n 
C 3 172 SER 172 167 167 SER SER H . n 
C 3 173 ASP 173 168 168 ASP ASP H . n 
C 3 174 LEU 174 169 169 LEU LEU H . n 
C 3 175 TYR 175 170 170 TYR TYR H . n 
C 3 176 THR 176 171 171 THR THR H . n 
C 3 177 LEU 177 172 172 LEU LEU H . n 
C 3 178 SER 178 173 173 SER SER H . n 
C 3 179 SER 179 174 174 SER SER H . n 
C 3 180 SER 180 175 175 SER SER H . n 
C 3 181 VAL 181 176 176 VAL VAL H . n 
C 3 182 THR 182 177 177 THR THR H . n 
C 3 183 VAL 183 178 178 VAL VAL H . n 
C 3 184 PRO 184 179 179 PRO PRO H . n 
C 3 185 SER 185 180 180 SER SER H . n 
C 3 186 SER 186 181 181 SER SER H . n 
C 3 187 THR 187 182 182 THR THR H . n 
C 3 188 TRP 188 183 183 TRP TRP H . n 
C 3 189 PRO 189 184 184 PRO PRO H . n 
C 3 190 SER 190 185 185 SER SER H . n 
C 3 191 GLU 191 186 186 GLU GLU H . n 
C 3 192 THR 192 187 187 THR THR H . n 
C 3 193 VAL 193 188 188 VAL VAL H . n 
C 3 194 THR 194 189 189 THR THR H . n 
C 3 195 CYS 195 190 190 CYS CYS H . n 
C 3 196 ASN 196 191 191 ASN ASN H . n 
C 3 197 VAL 197 192 192 VAL VAL H . n 
C 3 198 ALA 198 193 193 ALA ALA H . n 
C 3 199 HIS 199 194 194 HIS HIS H . n 
C 3 200 PRO 200 195 195 PRO PRO H . n 
C 3 201 ALA 201 196 196 ALA ALA H . n 
C 3 202 SER 202 197 197 SER SER H . n 
C 3 203 SER 203 198 198 SER SER H . n 
C 3 204 THR 204 199 199 THR THR H . n 
C 3 205 LYS 205 200 200 LYS LYS H . n 
C 3 206 VAL 206 201 201 VAL VAL H . n 
C 3 207 ASP 207 202 202 ASP ASP H . n 
C 3 208 LYS 208 203 203 LYS LYS H . n 
C 3 209 LYS 209 204 204 LYS LYS H . n 
C 3 210 ILE 210 205 205 ILE ILE H . n 
C 3 211 ALA 211 206 206 ALA ALA H . n 
C 3 212 ALA 212 207 207 ALA ALA H . n 
C 3 213 ALA 213 208 208 ALA ALA H . n 
D 4 1   SER 1   1   1   SER SER U A n 
D 4 2   LEU 2   1   1   LEU LEU U . n 
D 4 3   ARG 3   2   2   ARG ARG U . n 
D 4 4   CYS 4   3   3   CYS CYS U . n 
D 4 5   MET 5   4   4   MET MET U . n 
D 4 6   GLN 6   5   5   GLN GLN U . n 
D 4 7   CYS 7   6   6   CYS CYS U . n 
D 4 8   LYS 8   7   7   LYS LYS U . n 
D 4 9   THR 9   8   8   THR THR U . n 
D 4 10  ASN 10  9   9   ASN ASN U . n 
D 4 11  GLY 11  10  10  GLY GLY U . n 
D 4 12  ASP 12  11  11  ASP ASP U . n 
D 4 13  CYS 13  12  12  CYS CYS U . n 
D 4 14  ARG 14  13  13  ARG ARG U . n 
D 4 15  VAL 15  14  14  VAL VAL U . n 
D 4 16  GLU 16  15  15  GLU GLU U . n 
D 4 17  GLU 17  16  16  GLU GLU U . n 
D 4 18  CYS 18  17  17  CYS CYS U . n 
D 4 19  ALA 19  18  18  ALA ALA U . n 
D 4 20  LEU 20  19  19  LEU LEU U . n 
D 4 21  GLY 21  20  20  GLY GLY U . n 
D 4 22  GLN 22  21  21  GLN GLN U . n 
D 4 23  ASP 23  22  22  ASP ASP U . n 
D 4 24  LEU 24  23  23  LEU LEU U . n 
D 4 25  CYS 25  24  24  CYS CYS U . n 
D 4 26  ARG 26  25  25  ARG ARG U . n 
D 4 27  THR 27  26  26  THR THR U . n 
D 4 28  THR 28  27  27  THR THR U . n 
D 4 29  ILE 29  28  28  ILE ILE U . n 
D 4 30  VAL 30  29  29  VAL VAL U . n 
D 4 31  ARG 31  30  30  ARG ARG U . n 
D 4 32  LEU 32  31  31  LEU LEU U . n 
D 4 33  TRP 33  32  32  TRP TRP U . n 
D 4 34  GLU 34  33  33  GLU GLU U . n 
D 4 35  GLU 35  34  ?   ?   ?   U . n 
D 4 36  GLY 36  35  ?   ?   ?   U . n 
D 4 37  GLU 37  36  ?   ?   ?   U . n 
D 4 38  GLU 38  37  37  GLU GLU U . n 
D 4 39  LEU 39  38  38  LEU LEU U . n 
D 4 40  GLU 40  39  39  GLU GLU U . n 
D 4 41  LEU 41  40  40  LEU LEU U . n 
D 4 42  VAL 42  41  41  VAL VAL U . n 
D 4 43  GLU 43  42  42  GLU GLU U . n 
D 4 44  LYS 44  43  43  LYS LYS U . n 
D 4 45  SER 45  44  44  SER SER U . n 
D 4 46  CYS 46  45  45  CYS CYS U . n 
D 4 47  THR 47  46  46  THR THR U . n 
D 4 48  HIS 48  47  47  HIS HIS U . n 
D 4 49  SER 49  48  48  SER SER U . n 
D 4 50  GLU 50  49  49  GLU GLU U . n 
D 4 51  LYS 51  50  50  LYS LYS U . n 
D 4 52  THR 52  51  51  THR THR U . n 
D 4 53  ASN 53  52  52  ASN ASN U . n 
D 4 54  ARG 54  53  53  ARG ARG U . n 
D 4 55  THR 55  54  54  THR THR U . n 
D 4 56  LEU 56  55  55  LEU LEU U . n 
D 4 57  SER 57  56  56  SER SER U . n 
D 4 58  TYR 58  57  57  TYR TYR U . n 
D 4 59  ARG 59  58  58  ARG ARG U . n 
D 4 60  THR 60  59  59  THR THR U . n 
D 4 61  GLY 61  60  60  GLY GLY U . n 
D 4 62  LEU 62  61  61  LEU LEU U . n 
D 4 63  LYS 63  62  62  LYS LYS U . n 
D 4 64  ILE 64  63  63  ILE ILE U . n 
D 4 65  THR 65  64  64  THR THR U . n 
D 4 66  SER 66  65  65  SER SER U . n 
D 4 67  LEU 67  66  66  LEU LEU U . n 
D 4 68  THR 68  67  67  THR THR U . n 
D 4 69  GLU 69  68  68  GLU GLU U . n 
D 4 70  VAL 70  69  69  VAL VAL U . n 
D 4 71  VAL 71  70  70  VAL VAL U . n 
D 4 72  CYS 72  71  71  CYS CYS U . n 
D 4 73  GLY 73  72  72  GLY GLY U . n 
D 4 74  LEU 74  73  73  LEU LEU U . n 
D 4 75  ASP 75  74  74  ASP ASP U . n 
D 4 76  LEU 76  75  75  LEU LEU U . n 
D 4 77  CYS 77  76  76  CYS CYS U . n 
D 4 78  ASN 78  77  77  ASN ASN U . n 
D 4 79  GLN 79  78  78  GLN GLN U . n 
D 4 80  GLY 80  79  79  GLY GLY U . n 
D 4 81  ASN 81  80  80  ASN ASN U . n 
D 4 82  SER 82  81  ?   ?   ?   U . n 
D 4 83  GLY 83  82  ?   ?   ?   U . n 
D 4 84  ARG 84  83  ?   ?   ?   U . n 
D 4 85  ALA 85  84  ?   ?   ?   U . n 
D 4 86  VAL 86  85  ?   ?   ?   U . n 
D 4 87  THR 87  86  ?   ?   ?   U . n 
D 4 88  TYR 88  87  ?   ?   ?   U . n 
D 4 89  SER 89  88  ?   ?   ?   U . n 
D 4 90  ARG 90  89  ?   ?   ?   U . n 
D 4 91  SER 91  90  ?   ?   ?   U . n 
D 4 92  ARG 92  91  ?   ?   ?   U . n 
D 4 93  TYR 93  92  92  TYR TYR U . n 
D 4 94  LEU 94  93  93  LEU LEU U . n 
D 4 95  GLU 95  94  94  GLU GLU U . n 
D 4 96  CYS 96  95  95  CYS CYS U . n 
D 4 97  ILE 97  96  96  ILE ILE U . n 
D 4 98  SER 98  97  97  SER SER U . n 
D 4 99  CYS 99  98  98  CYS CYS U . n 
D 4 100 GLY 100 99  99  GLY GLY U . n 
D 4 101 SER 101 100 100 SER SER U . n 
D 4 102 SER 102 101 101 SER SER U . n 
D 4 103 ASP 103 102 102 ASP ASP U . n 
D 4 104 MET 104 103 103 MET MET U . n 
D 4 105 SER 105 104 104 SER SER U . n 
D 4 106 CYS 106 105 105 CYS CYS U . n 
D 4 107 GLU 107 106 106 GLU GLU U . n 
D 4 108 ARG 108 107 107 ARG ARG U . n 
D 4 109 GLY 109 108 108 GLY GLY U . n 
D 4 110 ARG 110 109 109 ARG ARG U . n 
D 4 111 HIS 111 110 110 HIS HIS U . n 
D 4 112 GLN 112 111 111 GLN GLN U . n 
D 4 113 SER 113 112 112 SER SER U . n 
D 4 114 LEU 114 113 113 LEU LEU U . n 
D 4 115 GLN 115 114 114 GLN GLN U . n 
D 4 116 CYS 116 115 115 CYS CYS U . n 
D 4 117 ARG 117 116 116 ARG ARG U . n 
D 4 118 SER 118 117 117 SER SER U . n 
D 4 119 PRO 119 118 118 PRO PRO U . n 
D 4 120 GLU 120 119 119 GLU GLU U . n 
D 4 121 GLU 121 120 120 GLU GLU U . n 
D 4 122 GLN 122 121 121 GLN GLN U . n 
D 4 123 CYS 123 122 122 CYS CYS U . n 
D 4 124 LEU 124 123 123 LEU LEU U . n 
D 4 125 ASP 125 124 124 ASP ASP U . n 
D 4 126 VAL 126 125 125 VAL VAL U . n 
D 4 127 VAL 127 126 126 VAL VAL U . n 
D 4 128 THR 128 127 127 THR THR U . n 
D 4 129 HIS 129 128 128 HIS HIS U . n 
D 4 130 TRP 130 129 129 TRP TRP U . n 
D 4 131 ILE 131 130 ?   ?   ?   U . n 
D 4 132 GLN 132 131 ?   ?   ?   U . n 
D 4 133 GLU 133 132 ?   ?   ?   U . n 
D 4 134 GLY 134 133 ?   ?   ?   U . n 
D 4 135 GLU 135 134 ?   ?   ?   U . n 
D 4 136 GLU 136 135 ?   ?   ?   U . n 
D 4 137 GLY 137 136 ?   ?   ?   U . n 
D 4 138 ARG 138 137 ?   ?   ?   U . n 
D 4 139 PRO 139 138 ?   ?   ?   U . n 
D 4 140 LYS 140 139 ?   ?   ?   U . n 
D 4 141 ASP 141 140 140 ASP ASP U . n 
D 4 142 ASP 142 141 141 ASP ASP U . n 
D 4 143 ARG 143 142 142 ARG ARG U . n 
D 4 144 HIS 144 143 143 HIS HIS U . n 
D 4 145 LEU 145 144 144 LEU LEU U . n 
D 4 146 ARG 146 145 145 ARG ARG U . n 
D 4 147 GLY 147 146 146 GLY GLY U . n 
D 4 148 CYS 148 147 147 CYS CYS U . n 
D 4 149 GLY 149 148 148 GLY GLY U . n 
D 4 150 TYR 150 149 149 TYR TYR U . n 
D 4 151 LEU 151 150 150 LEU LEU U . n 
D 4 152 PRO 152 151 151 PRO PRO U . n 
D 4 153 GLY 153 152 152 GLY GLY U . n 
D 4 154 CYS 154 153 153 CYS CYS U . n 
D 4 155 PRO 155 154 154 PRO PRO U . n 
D 4 156 GLY 156 155 155 GLY GLY U . n 
D 4 157 SER 157 156 156 SER SER U . n 
D 4 158 ASN 158 157 157 ASN ASN U . n 
D 4 159 GLY 159 158 158 GLY GLY U . n 
D 4 160 PHE 160 159 159 PHE PHE U . n 
D 4 161 HIS 161 160 160 HIS HIS U . n 
D 4 162 ASN 162 161 161 ASN ASN U . n 
D 4 163 ASN 163 162 162 ASN ASN U . n 
D 4 164 ASP 164 163 163 ASP ASP U . n 
D 4 165 THR 165 164 164 THR THR U . n 
D 4 166 PHE 166 165 165 PHE PHE U . n 
D 4 167 HIS 167 166 166 HIS HIS U . n 
D 4 168 PHE 168 167 167 PHE PHE U . n 
D 4 169 LEU 169 168 168 LEU LEU U . n 
D 4 170 LYS 170 169 169 LYS LYS U . n 
D 4 171 CYS 171 170 170 CYS CYS U . n 
D 4 172 CYS 172 171 171 CYS CYS U . n 
D 4 173 ASN 173 172 172 ASN ASN U . n 
D 4 174 THR 174 173 173 THR THR U . n 
D 4 175 THR 175 174 174 THR THR U . n 
D 4 176 LYS 176 175 175 LYS LYS U . n 
D 4 177 CYS 177 176 176 CYS CYS U . n 
D 4 178 ASN 178 177 177 ASN ASN U . n 
D 4 179 GLU 179 178 178 GLU GLU U . n 
D 4 180 GLY 180 179 179 GLY GLY U . n 
D 4 181 PRO 181 180 180 PRO PRO U . n 
D 4 182 ILE 182 181 181 ILE ILE U . n 
D 4 183 LEU 183 182 182 LEU LEU U . n 
D 4 184 GLU 184 183 183 GLU GLU U . n 
D 4 185 LEU 185 184 184 LEU LEU U . n 
D 4 186 GLU 186 185 185 GLU GLU U . n 
D 4 187 ASN 187 186 186 ASN ASN U . n 
D 4 188 LEU 188 187 187 LEU LEU U . n 
D 4 189 PRO 189 188 188 PRO PRO U . n 
D 4 190 GLN 190 189 189 GLN GLN U . n 
D 4 191 ASN 191 190 190 ASN ASN U . n 
D 4 192 GLY 192 191 191 GLY GLY U . n 
D 4 193 ARG 193 192 192 ARG ARG U . n 
D 4 194 GLN 194 193 193 GLN GLN U . n 
D 4 195 CYS 195 194 194 CYS CYS U . n 
D 4 196 TYR 196 195 195 TYR TYR U . n 
D 4 197 SER 197 196 196 SER SER U . n 
D 4 198 CYS 198 197 197 CYS CYS U . n 
D 4 199 LYS 199 198 198 LYS LYS U . n 
D 4 200 GLY 200 199 199 GLY GLY U . n 
D 4 201 ASN 201 200 200 ASN ASN U . n 
D 4 202 SER 202 201 201 SER SER U . n 
D 4 203 THR 203 202 202 THR THR U . n 
D 4 204 HIS 204 203 203 HIS HIS U . n 
D 4 205 GLY 205 204 204 GLY GLY U . n 
D 4 206 CYS 206 205 205 CYS CYS U . n 
D 4 207 SER 207 206 206 SER SER U . n 
D 4 208 SER 208 207 207 SER SER U . n 
D 4 209 GLU 209 208 208 GLU GLU U . n 
D 4 210 GLU 210 209 209 GLU GLU U . n 
D 4 211 THR 211 210 210 THR THR U . n 
D 4 212 PHE 212 211 211 PHE PHE U . n 
D 4 213 LEU 213 212 212 LEU LEU U . n 
D 4 214 ILE 214 213 213 ILE ILE U . n 
D 4 215 ASP 215 214 214 ASP ASP U . n 
D 4 216 CYS 216 215 215 CYS CYS U . n 
D 4 217 ARG 217 216 216 ARG ARG U . n 
D 4 218 GLY 218 217 217 GLY GLY U . n 
D 4 219 PRO 219 218 218 PRO PRO U . n 
D 4 220 MET 220 219 219 MET MET U . n 
D 4 221 ASN 221 220 220 ASN ASN U . n 
D 4 222 GLN 222 221 221 GLN GLN U . n 
D 4 223 CYS 223 222 222 CYS CYS U . n 
D 4 224 LEU 224 223 223 LEU LEU U . n 
D 4 225 VAL 225 224 224 VAL VAL U . n 
D 4 226 ALA 226 225 225 ALA ALA U . n 
D 4 227 THR 227 226 226 THR THR U . n 
D 4 228 GLY 228 227 227 GLY GLY U . n 
D 4 229 THR 229 228 228 THR THR U . n 
D 4 230 HIS 230 229 229 HIS HIS U . n 
D 4 231 GLU 231 230 230 GLU GLU U . n 
D 4 232 PRO 232 231 231 PRO PRO U . n 
D 4 233 LYS 233 232 232 LYS LYS U . n 
D 4 234 ASN 234 233 233 ASN ASN U . n 
D 4 235 GLN 235 234 234 GLN GLN U . n 
D 4 236 SER 236 235 235 SER SER U . n 
D 4 237 TYR 237 236 236 TYR TYR U . n 
D 4 238 MET 238 237 237 MET MET U . n 
D 4 239 VAL 239 238 238 VAL VAL U . n 
D 4 240 ARG 240 239 239 ARG ARG U . n 
D 4 241 GLY 241 240 240 GLY GLY U . n 
D 4 242 CYS 242 241 241 CYS CYS U . n 
D 4 243 ALA 243 242 242 ALA ALA U . n 
D 4 244 THR 244 243 243 THR THR U . n 
D 4 245 ALA 245 244 244 ALA ALA U . n 
D 4 246 SER 246 245 245 SER SER U . n 
D 4 247 MET 247 246 246 MET MET U . n 
D 4 248 CYS 248 247 247 CYS CYS U . n 
D 4 249 GLN 249 248 248 GLN GLN U . n 
D 4 250 HIS 250 249 ?   ?   ?   U . n 
D 4 251 ALA 251 250 ?   ?   ?   U . n 
D 4 252 HIS 252 251 ?   ?   ?   U . n 
D 4 253 LEU 253 252 252 LEU LEU U . n 
D 4 254 GLY 254 253 253 GLY GLY U . n 
D 4 255 ASP 255 254 254 ASP ASP U . n 
D 4 256 ALA 256 255 255 ALA ALA U . n 
D 4 257 PHE 257 256 256 PHE PHE U . n 
D 4 258 SER 258 257 257 SER SER U . n 
D 4 259 MET 259 258 258 MET MET U . n 
D 4 260 ASN 260 259 259 ASN ASN U . n 
D 4 261 HIS 261 260 260 HIS HIS U . n 
D 4 262 ILE 262 261 261 ILE ILE U . n 
D 4 263 ASP 263 262 262 ASP ASP U . n 
D 4 264 VAL 264 263 263 VAL VAL U . n 
D 4 265 SER 265 264 264 SER SER U . n 
D 4 266 CYS 266 265 265 CYS CYS U . n 
D 4 267 CYS 267 266 266 CYS CYS U . n 
D 4 268 THR 268 267 267 THR THR U . n 
D 4 269 LYS 269 268 268 LYS LYS U . n 
D 4 270 SER 270 269 269 SER SER U . n 
D 4 271 GLY 271 270 270 GLY GLY U . n 
D 4 272 CYS 272 271 271 CYS CYS U . n 
D 4 273 ASN 273 272 272 ASN ASN U . n 
D 4 274 HIS 274 273 273 HIS HIS U . n 
D 4 275 PRO 275 274 274 PRO PRO U . n 
D 4 276 ASP 276 275 275 ASP ASP U . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  SO4 1   501 501 SO4 SO4 A . 
F 6  ETX 1   401 401 ETX ETX L . 
G 7  EDO 1   405 405 EDO EDO L . 
H 6  ETX 1   407 407 ETX ETX L . 
I 6  ETX 1   403 403 ETX ETX H . 
J 7  EDO 1   404 404 EDO EDO H . 
K 8  PGE 1   406 406 PGE PGE H . 
L 9  NAG 1   452 452 NAG NAG U . 
M 10 FUC 2   453 453 FUC FUC U . 
N 9  NAG 1   472 472 NAG NAG U . 
O 9  NAG 2   473 473 NAG NAG U . 
P 11 NDG 1   400 400 NDG NDG U . 
Q 12 PG4 1   402 402 PG4 PG4 U . 
R 13 HOH 1   502 502 HOH HOH A . 
R 13 HOH 2   503 503 HOH HOH A . 
R 13 HOH 3   504 504 HOH HOH A . 
R 13 HOH 4   505 505 HOH HOH A . 
R 13 HOH 5   506 506 HOH HOH A . 
R 13 HOH 6   507 507 HOH HOH A . 
R 13 HOH 7   508 508 HOH HOH A . 
R 13 HOH 8   509 509 HOH HOH A . 
R 13 HOH 9   510 510 HOH HOH A . 
R 13 HOH 10  511 511 HOH HOH A . 
R 13 HOH 11  512 512 HOH HOH A . 
R 13 HOH 12  513 513 HOH HOH A . 
R 13 HOH 13  514 514 HOH HOH A . 
R 13 HOH 14  515 515 HOH HOH A . 
R 13 HOH 15  516 516 HOH HOH A . 
R 13 HOH 16  517 517 HOH HOH A . 
R 13 HOH 17  518 518 HOH HOH A . 
R 13 HOH 18  519 519 HOH HOH A . 
R 13 HOH 19  520 520 HOH HOH A . 
R 13 HOH 20  521 521 HOH HOH A . 
R 13 HOH 21  522 522 HOH HOH A . 
R 13 HOH 22  523 523 HOH HOH A . 
S 13 HOH 1   408 408 HOH HOH L . 
S 13 HOH 2   409 409 HOH HOH L . 
S 13 HOH 3   410 410 HOH HOH L . 
S 13 HOH 4   411 411 HOH HOH L . 
S 13 HOH 5   412 412 HOH HOH L . 
S 13 HOH 6   413 413 HOH HOH L . 
S 13 HOH 7   414 414 HOH HOH L . 
S 13 HOH 8   415 415 HOH HOH L . 
S 13 HOH 9   416 416 HOH HOH L . 
S 13 HOH 10  417 417 HOH HOH L . 
S 13 HOH 11  418 418 HOH HOH L . 
S 13 HOH 12  419 419 HOH HOH L . 
S 13 HOH 13  420 420 HOH HOH L . 
S 13 HOH 14  421 421 HOH HOH L . 
S 13 HOH 15  422 422 HOH HOH L . 
S 13 HOH 16  423 423 HOH HOH L . 
S 13 HOH 17  424 424 HOH HOH L . 
S 13 HOH 18  425 425 HOH HOH L . 
S 13 HOH 19  426 426 HOH HOH L . 
S 13 HOH 20  427 427 HOH HOH L . 
S 13 HOH 21  428 428 HOH HOH L . 
S 13 HOH 22  429 429 HOH HOH L . 
S 13 HOH 23  430 430 HOH HOH L . 
S 13 HOH 24  431 431 HOH HOH L . 
S 13 HOH 25  432 432 HOH HOH L . 
S 13 HOH 26  433 433 HOH HOH L . 
S 13 HOH 27  434 434 HOH HOH L . 
S 13 HOH 28  435 435 HOH HOH L . 
S 13 HOH 29  436 436 HOH HOH L . 
S 13 HOH 30  437 437 HOH HOH L . 
S 13 HOH 31  438 438 HOH HOH L . 
S 13 HOH 32  439 439 HOH HOH L . 
S 13 HOH 33  440 440 HOH HOH L . 
S 13 HOH 34  441 441 HOH HOH L . 
S 13 HOH 35  442 442 HOH HOH L . 
S 13 HOH 36  443 443 HOH HOH L . 
S 13 HOH 37  444 444 HOH HOH L . 
S 13 HOH 38  445 445 HOH HOH L . 
S 13 HOH 39  446 446 HOH HOH L . 
S 13 HOH 40  447 447 HOH HOH L . 
S 13 HOH 41  448 448 HOH HOH L . 
S 13 HOH 42  449 449 HOH HOH L . 
S 13 HOH 43  450 450 HOH HOH L . 
S 13 HOH 44  451 451 HOH HOH L . 
S 13 HOH 45  452 452 HOH HOH L . 
S 13 HOH 46  453 453 HOH HOH L . 
S 13 HOH 47  454 454 HOH HOH L . 
S 13 HOH 48  455 455 HOH HOH L . 
S 13 HOH 49  456 456 HOH HOH L . 
S 13 HOH 50  457 457 HOH HOH L . 
S 13 HOH 51  458 458 HOH HOH L . 
S 13 HOH 52  459 459 HOH HOH L . 
S 13 HOH 53  460 460 HOH HOH L . 
S 13 HOH 54  461 461 HOH HOH L . 
S 13 HOH 55  462 462 HOH HOH L . 
S 13 HOH 56  463 463 HOH HOH L . 
S 13 HOH 57  464 464 HOH HOH L . 
S 13 HOH 58  465 465 HOH HOH L . 
S 13 HOH 59  466 466 HOH HOH L . 
S 13 HOH 60  467 467 HOH HOH L . 
S 13 HOH 61  468 468 HOH HOH L . 
S 13 HOH 62  469 469 HOH HOH L . 
S 13 HOH 63  470 470 HOH HOH L . 
S 13 HOH 64  471 471 HOH HOH L . 
S 13 HOH 65  472 472 HOH HOH L . 
S 13 HOH 66  473 473 HOH HOH L . 
S 13 HOH 67  474 474 HOH HOH L . 
S 13 HOH 68  475 475 HOH HOH L . 
S 13 HOH 69  476 476 HOH HOH L . 
S 13 HOH 70  477 477 HOH HOH L . 
S 13 HOH 71  478 478 HOH HOH L . 
S 13 HOH 72  479 479 HOH HOH L . 
S 13 HOH 73  480 480 HOH HOH L . 
S 13 HOH 74  481 481 HOH HOH L . 
S 13 HOH 75  482 482 HOH HOH L . 
S 13 HOH 76  483 483 HOH HOH L . 
S 13 HOH 77  484 484 HOH HOH L . 
S 13 HOH 78  485 485 HOH HOH L . 
S 13 HOH 79  486 486 HOH HOH L . 
S 13 HOH 80  487 487 HOH HOH L . 
S 13 HOH 81  488 488 HOH HOH L . 
S 13 HOH 82  489 489 HOH HOH L . 
S 13 HOH 83  490 490 HOH HOH L . 
S 13 HOH 84  491 491 HOH HOH L . 
S 13 HOH 85  492 492 HOH HOH L . 
S 13 HOH 86  493 493 HOH HOH L . 
S 13 HOH 87  494 494 HOH HOH L . 
S 13 HOH 88  495 495 HOH HOH L . 
S 13 HOH 89  496 496 HOH HOH L . 
S 13 HOH 90  497 497 HOH HOH L . 
S 13 HOH 91  498 498 HOH HOH L . 
S 13 HOH 92  499 499 HOH HOH L . 
S 13 HOH 93  500 500 HOH HOH L . 
S 13 HOH 94  501 501 HOH HOH L . 
S 13 HOH 95  502 502 HOH HOH L . 
S 13 HOH 96  503 503 HOH HOH L . 
S 13 HOH 97  504 504 HOH HOH L . 
S 13 HOH 98  505 505 HOH HOH L . 
S 13 HOH 99  506 506 HOH HOH L . 
S 13 HOH 100 507 507 HOH HOH L . 
S 13 HOH 101 508 508 HOH HOH L . 
S 13 HOH 102 509 509 HOH HOH L . 
S 13 HOH 103 510 510 HOH HOH L . 
S 13 HOH 104 511 511 HOH HOH L . 
S 13 HOH 105 512 512 HOH HOH L . 
S 13 HOH 106 513 513 HOH HOH L . 
S 13 HOH 107 514 514 HOH HOH L . 
S 13 HOH 108 515 515 HOH HOH L . 
S 13 HOH 109 516 516 HOH HOH L . 
S 13 HOH 110 517 517 HOH HOH L . 
S 13 HOH 111 518 518 HOH HOH L . 
S 13 HOH 112 519 519 HOH HOH L . 
S 13 HOH 113 520 520 HOH HOH L . 
S 13 HOH 114 521 521 HOH HOH L . 
S 13 HOH 115 522 522 HOH HOH L . 
S 13 HOH 116 523 523 HOH HOH L . 
S 13 HOH 117 524 524 HOH HOH L . 
S 13 HOH 118 525 525 HOH HOH L . 
S 13 HOH 119 526 526 HOH HOH L . 
S 13 HOH 120 527 527 HOH HOH L . 
S 13 HOH 121 528 528 HOH HOH L . 
T 13 HOH 1   407 407 HOH HOH H . 
T 13 HOH 2   408 408 HOH HOH H . 
T 13 HOH 3   409 409 HOH HOH H . 
T 13 HOH 4   410 410 HOH HOH H . 
T 13 HOH 5   411 411 HOH HOH H . 
T 13 HOH 6   412 412 HOH HOH H . 
T 13 HOH 7   413 413 HOH HOH H . 
T 13 HOH 8   414 414 HOH HOH H . 
T 13 HOH 9   415 415 HOH HOH H . 
T 13 HOH 10  416 416 HOH HOH H . 
T 13 HOH 11  417 417 HOH HOH H . 
T 13 HOH 12  418 418 HOH HOH H . 
T 13 HOH 13  419 419 HOH HOH H . 
T 13 HOH 14  420 420 HOH HOH H . 
T 13 HOH 15  421 421 HOH HOH H . 
T 13 HOH 16  422 422 HOH HOH H . 
T 13 HOH 17  423 423 HOH HOH H . 
T 13 HOH 18  424 424 HOH HOH H . 
T 13 HOH 19  425 425 HOH HOH H . 
T 13 HOH 20  426 426 HOH HOH H . 
T 13 HOH 21  427 427 HOH HOH H . 
T 13 HOH 22  428 428 HOH HOH H . 
T 13 HOH 23  429 429 HOH HOH H . 
T 13 HOH 24  430 430 HOH HOH H . 
T 13 HOH 25  431 431 HOH HOH H . 
T 13 HOH 26  432 432 HOH HOH H . 
T 13 HOH 27  433 433 HOH HOH H . 
T 13 HOH 28  434 434 HOH HOH H . 
T 13 HOH 29  435 435 HOH HOH H . 
T 13 HOH 30  436 436 HOH HOH H . 
T 13 HOH 31  437 437 HOH HOH H . 
T 13 HOH 32  438 438 HOH HOH H . 
T 13 HOH 33  439 439 HOH HOH H . 
T 13 HOH 34  440 440 HOH HOH H . 
T 13 HOH 35  441 441 HOH HOH H . 
T 13 HOH 36  442 442 HOH HOH H . 
T 13 HOH 37  443 443 HOH HOH H . 
T 13 HOH 38  444 444 HOH HOH H . 
T 13 HOH 39  445 445 HOH HOH H . 
T 13 HOH 40  446 446 HOH HOH H . 
T 13 HOH 41  447 447 HOH HOH H . 
T 13 HOH 42  448 448 HOH HOH H . 
T 13 HOH 43  449 449 HOH HOH H . 
T 13 HOH 44  450 450 HOH HOH H . 
T 13 HOH 45  451 451 HOH HOH H . 
T 13 HOH 46  452 452 HOH HOH H . 
T 13 HOH 47  453 453 HOH HOH H . 
T 13 HOH 48  454 454 HOH HOH H . 
T 13 HOH 49  455 455 HOH HOH H . 
T 13 HOH 50  456 456 HOH HOH H . 
T 13 HOH 51  457 457 HOH HOH H . 
T 13 HOH 52  458 458 HOH HOH H . 
T 13 HOH 53  459 459 HOH HOH H . 
T 13 HOH 54  460 460 HOH HOH H . 
T 13 HOH 55  461 461 HOH HOH H . 
T 13 HOH 56  462 462 HOH HOH H . 
T 13 HOH 57  463 463 HOH HOH H . 
T 13 HOH 58  464 464 HOH HOH H . 
T 13 HOH 59  465 465 HOH HOH H . 
T 13 HOH 60  466 466 HOH HOH H . 
T 13 HOH 61  467 467 HOH HOH H . 
T 13 HOH 62  468 468 HOH HOH H . 
T 13 HOH 63  469 469 HOH HOH H . 
T 13 HOH 64  470 470 HOH HOH H . 
T 13 HOH 65  471 471 HOH HOH H . 
T 13 HOH 66  472 472 HOH HOH H . 
T 13 HOH 67  473 473 HOH HOH H . 
T 13 HOH 68  474 474 HOH HOH H . 
T 13 HOH 69  475 475 HOH HOH H . 
T 13 HOH 70  476 476 HOH HOH H . 
T 13 HOH 71  477 477 HOH HOH H . 
T 13 HOH 72  478 478 HOH HOH H . 
T 13 HOH 73  479 479 HOH HOH H . 
T 13 HOH 74  480 480 HOH HOH H . 
T 13 HOH 75  481 481 HOH HOH H . 
T 13 HOH 76  482 482 HOH HOH H . 
T 13 HOH 77  483 483 HOH HOH H . 
T 13 HOH 78  484 484 HOH HOH H . 
T 13 HOH 79  485 485 HOH HOH H . 
T 13 HOH 80  486 486 HOH HOH H . 
T 13 HOH 81  487 487 HOH HOH H . 
T 13 HOH 82  488 488 HOH HOH H . 
T 13 HOH 83  489 489 HOH HOH H . 
T 13 HOH 84  490 490 HOH HOH H . 
T 13 HOH 85  491 491 HOH HOH H . 
T 13 HOH 86  492 492 HOH HOH H . 
T 13 HOH 87  493 493 HOH HOH H . 
T 13 HOH 88  494 494 HOH HOH H . 
T 13 HOH 89  495 495 HOH HOH H . 
T 13 HOH 90  496 496 HOH HOH H . 
T 13 HOH 91  497 497 HOH HOH H . 
T 13 HOH 92  498 498 HOH HOH H . 
T 13 HOH 93  499 499 HOH HOH H . 
T 13 HOH 94  500 500 HOH HOH H . 
T 13 HOH 95  501 501 HOH HOH H . 
T 13 HOH 96  502 502 HOH HOH H . 
T 13 HOH 97  503 503 HOH HOH H . 
T 13 HOH 98  504 504 HOH HOH H . 
T 13 HOH 99  505 505 HOH HOH H . 
T 13 HOH 100 506 506 HOH HOH H . 
T 13 HOH 101 507 507 HOH HOH H . 
T 13 HOH 102 508 508 HOH HOH H . 
T 13 HOH 103 509 509 HOH HOH H . 
T 13 HOH 104 510 510 HOH HOH H . 
T 13 HOH 105 511 511 HOH HOH H . 
T 13 HOH 106 512 512 HOH HOH H . 
T 13 HOH 107 513 513 HOH HOH H . 
T 13 HOH 108 514 514 HOH HOH H . 
T 13 HOH 109 515 515 HOH HOH H . 
T 13 HOH 110 516 516 HOH HOH H . 
T 13 HOH 111 517 517 HOH HOH H . 
T 13 HOH 112 518 518 HOH HOH H . 
T 13 HOH 113 519 519 HOH HOH H . 
T 13 HOH 114 520 520 HOH HOH H . 
T 13 HOH 115 521 521 HOH HOH H . 
T 13 HOH 116 522 522 HOH HOH H . 
T 13 HOH 117 523 523 HOH HOH H . 
T 13 HOH 118 524 524 HOH HOH H . 
T 13 HOH 119 525 525 HOH HOH H . 
T 13 HOH 120 526 526 HOH HOH H . 
T 13 HOH 121 527 527 HOH HOH H . 
U 13 HOH 1   474 474 HOH HOH U . 
U 13 HOH 2   475 475 HOH HOH U . 
U 13 HOH 3   476 476 HOH HOH U . 
U 13 HOH 4   477 477 HOH HOH U . 
U 13 HOH 5   478 478 HOH HOH U . 
U 13 HOH 6   479 479 HOH HOH U . 
U 13 HOH 7   480 480 HOH HOH U . 
U 13 HOH 8   481 481 HOH HOH U . 
U 13 HOH 9   482 482 HOH HOH U . 
U 13 HOH 10  483 483 HOH HOH U . 
U 13 HOH 11  484 484 HOH HOH U . 
U 13 HOH 12  485 485 HOH HOH U . 
U 13 HOH 13  486 486 HOH HOH U . 
U 13 HOH 14  487 487 HOH HOH U . 
U 13 HOH 15  488 488 HOH HOH U . 
U 13 HOH 16  489 489 HOH HOH U . 
U 13 HOH 17  490 490 HOH HOH U . 
U 13 HOH 18  491 491 HOH HOH U . 
U 13 HOH 19  492 492 HOH HOH U . 
U 13 HOH 20  493 493 HOH HOH U . 
U 13 HOH 21  494 494 HOH HOH U . 
U 13 HOH 22  495 495 HOH HOH U . 
U 13 HOH 23  496 496 HOH HOH U . 
U 13 HOH 24  497 497 HOH HOH U . 
U 13 HOH 25  498 498 HOH HOH U . 
U 13 HOH 26  499 499 HOH HOH U . 
U 13 HOH 27  500 500 HOH HOH U . 
U 13 HOH 28  501 501 HOH HOH U . 
U 13 HOH 29  502 502 HOH HOH U . 
U 13 HOH 30  503 503 HOH HOH U . 
U 13 HOH 31  504 504 HOH HOH U . 
U 13 HOH 32  505 505 HOH HOH U . 
U 13 HOH 33  506 506 HOH HOH U . 
U 13 HOH 34  507 507 HOH HOH U . 
U 13 HOH 35  508 508 HOH HOH U . 
U 13 HOH 36  509 509 HOH HOH U . 
U 13 HOH 37  510 510 HOH HOH U . 
U 13 HOH 38  511 511 HOH HOH U . 
U 13 HOH 39  512 512 HOH HOH U . 
U 13 HOH 40  513 513 HOH HOH U . 
U 13 HOH 41  514 514 HOH HOH U . 
U 13 HOH 42  515 515 HOH HOH U . 
U 13 HOH 43  516 516 HOH HOH U . 
U 13 HOH 44  517 517 HOH HOH U . 
U 13 HOH 45  518 518 HOH HOH U . 
U 13 HOH 46  519 519 HOH HOH U . 
U 13 HOH 47  520 520 HOH HOH U . 
U 13 HOH 48  521 521 HOH HOH U . 
U 13 HOH 49  522 522 HOH HOH U . 
U 13 HOH 50  523 523 HOH HOH U . 
U 13 HOH 51  524 524 HOH HOH U . 
U 13 HOH 52  525 525 HOH HOH U . 
U 13 HOH 53  526 526 HOH HOH U . 
U 13 HOH 54  527 527 HOH HOH U . 
U 13 HOH 55  528 528 HOH HOH U . 
U 13 HOH 56  529 529 HOH HOH U . 
U 13 HOH 57  530 530 HOH HOH U . 
U 13 HOH 58  531 531 HOH HOH U . 
U 13 HOH 59  532 532 HOH HOH U . 
U 13 HOH 60  533 533 HOH HOH U . 
U 13 HOH 61  534 534 HOH HOH U . 
U 13 HOH 62  535 535 HOH HOH U . 
U 13 HOH 63  536 536 HOH HOH U . 
U 13 HOH 64  537 537 HOH HOH U . 
U 13 HOH 65  538 538 HOH HOH U . 
U 13 HOH 66  539 539 HOH HOH U . 
U 13 HOH 67  540 540 HOH HOH U . 
U 13 HOH 68  541 541 HOH HOH U . 
U 13 HOH 69  542 542 HOH HOH U . 
U 13 HOH 70  543 543 HOH HOH U . 
U 13 HOH 71  544 544 HOH HOH U . 
U 13 HOH 72  545 545 HOH HOH U . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 D ASN 53  U ASN 52  ? ASN 'GLYCOSYLATION SITE' 
2 D ASN 173 U ASN 172 ? ASN 'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U 
2 1 A,D,E,L,M,N,O,P,Q,R,U                     
2 2 B,C,F,G,H,I,J,K,S,T                       
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9780  ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  36920 ? 
2 'ABSA (A^2)' 8480  ? 
2 MORE         -18   ? 
2 'SSA (A^2)'  38220 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_645 -x+1,y-1/2,-z -1.0000000000 0.0000000000 0.0000000000 51.7920000000 0.0000000000 1.0000000000 
0.0000000000 -43.4025000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-02-21 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-07-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
The aminoacid sequence database reference is currently not 
available for Fab atn-615 anti-uPAR antibody, light and 
heavy chains 
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O6  U NAG 452 ? ? O1 U FUC 453 ? ? 0.65 
2  1 ND2 U ASN 172 ? ? O1 U NAG 472 ? ? 0.79 
3  1 C6  U NAG 452 ? ? O1 U FUC 453 ? ? 0.82 
4  1 CG  U ASN 172 ? ? O1 U NAG 472 ? ? 1.26 
5  1 O6  U NAG 452 ? ? O5 U FUC 453 ? ? 1.73 
6  1 OD1 U ASN 172 ? ? O1 U NAG 472 ? ? 1.78 
7  1 NE2 U HIS 143 ? ? O  U HOH 545 ? ? 1.87 
8  1 O   H ASN 128 ? ? OG H SER 180 ? ? 1.95 
9  1 NE2 U HIS 128 ? ? O  U HOH 545 ? ? 1.96 
10 1 NE2 A HIS 41  ? ? O  A HOH 523 ? ? 1.97 
11 1 ND2 U ASN 52  ? ? O1 U NAG 452 ? ? 2.00 
12 1 O4  U NAG 472 ? ? O5 U NAG 473 ? ? 2.00 
13 1 ND2 U ASN 172 ? ? O7 U NAG 472 ? ? 2.01 
14 1 C5  U NAG 452 ? ? O1 U FUC 453 ? ? 2.03 
15 1 NE2 A HIS 29  ? ? O  A HOH 523 ? ? 2.06 
16 1 C6  U NAG 452 ? ? C1 U FUC 453 ? ? 2.15 
17 1 OE1 U GLU 183 ? ? O  U HOH 545 ? ? 2.15 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            H 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLY 
_pdbx_validate_rmsd_bond.auth_seq_id_1             134 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            H 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             135 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.139 
_pdbx_validate_rmsd_bond.bond_target_value         1.336 
_pdbx_validate_rmsd_bond.bond_deviation            -0.197 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.023 
_pdbx_validate_rmsd_bond.linker_flag               Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  L TYR 93  ? ? N  L PRO 94  ? ? CA L PRO 94  ? ? 105.32 119.30 -13.98 1.50 Y 
2 1 C  H LEU 133 ? ? N  H GLY 134 ? ? CA H GLY 134 ? ? 107.08 122.30 -15.22 2.10 Y 
3 1 CA H GLY 134 ? ? C  H GLY 134 ? ? N  H CYS 135 ? ? 100.00 117.20 -17.20 2.20 Y 
4 1 O  H GLY 134 ? ? C  H GLY 134 ? ? N  H CYS 135 ? ? 133.11 122.70 10.41  1.60 Y 
5 1 CA H CYS 135 ? ? CB H CYS 135 ? ? SG H CYS 135 ? ? 122.01 114.20 7.81   1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 15  ? ? 61.77   -126.71 
2  1 PHE A 25  ? ? -117.39 60.58   
3  1 SER A 26  ? ? 54.31   13.72   
4  1 GLU A 52  ? ? -64.77  -136.01 
5  1 ALA A 62  ? ? 167.26  50.69   
6  1 MET A 67  ? ? -112.16 54.73   
7  1 TRP A 74  ? ? -55.11  -5.84   
8  1 ASN A 107 ? ? -67.85  90.79   
9  1 ARG A 109 ? ? -46.69  7.83    
10 1 TRP A 112 ? ? -136.17 -158.14 
11 1 CYS A 113 ? ? 179.27  162.49  
12 1 VAL A 128 ? ? -39.02  127.72  
13 1 CYS A 131 ? ? -73.97  22.67   
14 1 ILE L 51  ? ? 64.82   -46.87  
15 1 ALA L 84  ? ? 179.56  -171.97 
16 1 TYR L 93  ? ? -4.40   -57.80  
17 1 PRO L 140 ? ? -68.79  -178.62 
18 1 ALA L 213 ? ? 174.58  122.98  
19 1 LYS L 214 ? ? 52.94   -172.60 
20 1 HIS H 52  A ? 69.58   -56.20  
21 1 THR H 83  ? ? -119.02 -169.20 
22 1 ALA H 88  ? ? -172.78 -177.81 
23 1 LEU H 133 ? ? -178.55 139.31  
24 1 CYS H 135 ? ? 175.61  127.46  
25 1 SER U 44  ? ? 172.65  178.36  
26 1 LEU U 75  ? ? 50.84   18.70   
27 1 PRO U 118 ? ? -59.54  -4.02   
28 1 CYS U 153 ? ? -65.01  -70.08  
29 1 PRO U 154 ? ? -38.07  94.18   
30 1 ASN U 162 ? ? -44.38  -15.47  
31 1 ASP U 163 ? ? -157.21 21.16   
32 1 THR U 174 ? ? -37.28  124.58  
33 1 CYS U 197 ? ? 178.12  171.47  
34 1 HIS U 229 ? ? -128.41 -155.58 
35 1 GLU U 230 ? ? 48.71   -162.38 
36 1 LYS U 232 ? ? -79.30  -158.29 
37 1 ASN U 233 ? ? -85.49  41.51   
38 1 CYS U 247 ? ? -97.83  38.97   
39 1 ASN U 259 ? ? -111.72 -97.95  
40 1 THR U 267 ? ? -116.36 57.10   
41 1 PRO U 274 ? ? -62.37  66.38   
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1 ? U NAG 452 ? 'WRONG HAND' . 
2 1 C1 ? U FUC 453 ? 'WRONG HAND' . 
3 1 C1 ? U NAG 473 ? 'WRONG HAND' . 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   H 
_pdbx_validate_polymer_linkage.auth_comp_id_1   GLY 
_pdbx_validate_polymer_linkage.auth_seq_id_1    134 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   H 
_pdbx_validate_polymer_linkage.auth_comp_id_2   CYS 
_pdbx_validate_polymer_linkage.auth_seq_id_2    135 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.14 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 H GLY 127 ? C GLY 132 
2  1 Y 1 U GLU 34  ? D GLU 35  
3  1 Y 1 U GLY 35  ? D GLY 36  
4  1 Y 1 U GLU 36  ? D GLU 37  
5  1 Y 1 U SER 81  ? D SER 82  
6  1 Y 1 U GLY 82  ? D GLY 83  
7  1 Y 1 U ARG 83  ? D ARG 84  
8  1 Y 1 U ALA 84  ? D ALA 85  
9  1 Y 1 U VAL 85  ? D VAL 86  
10 1 Y 1 U THR 86  ? D THR 87  
11 1 Y 1 U TYR 87  ? D TYR 88  
12 1 Y 1 U SER 88  ? D SER 89  
13 1 Y 1 U ARG 89  ? D ARG 90  
14 1 Y 1 U SER 90  ? D SER 91  
15 1 Y 1 U ARG 91  ? D ARG 92  
16 1 Y 1 U ILE 130 ? D ILE 131 
17 1 Y 1 U GLN 131 ? D GLN 132 
18 1 Y 1 U GLU 132 ? D GLU 133 
19 1 Y 1 U GLY 133 ? D GLY 134 
20 1 Y 1 U GLU 134 ? D GLU 135 
21 1 Y 1 U GLU 135 ? D GLU 136 
22 1 Y 1 U GLY 136 ? D GLY 137 
23 1 Y 1 U ARG 137 ? D ARG 138 
24 1 Y 1 U PRO 138 ? D PRO 139 
25 1 Y 1 U LYS 139 ? D LYS 140 
26 1 Y 1 U HIS 249 ? D HIS 250 
27 1 Y 1 U ALA 250 ? D ALA 251 
28 1 Y 1 U HIS 251 ? D HIS 252 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  'SULFATE ION'                               SO4 
6  2-ETHOXYETHANOL                             ETX 
7  1,2-ETHANEDIOL                              EDO 
8  'TRIETHYLENE GLYCOL'                        PGE 
9  N-ACETYL-D-GLUCOSAMINE                      NAG 
10 ALPHA-L-FUCOSE                              FUC 
11 '2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE' NDG 
12 'TETRAETHYLENE GLYCOL'                      PG4 
13 water                                       HOH 
#