data_2FG5
# 
_entry.id   2FG5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FG5         
RCSB  RCSB035839   
WWPDB D_1000035839 
# 
_pdbx_database_status.entry_id                        2FG5 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-21 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tempel, W.'                           1  
'Wang, J.'                             2  
'Ismail, S.'                           3  
'Arrowsmith, C.'                       4  
'Edwards, A.'                          5  
'Sundstrom, M.'                        6  
'Weigelt, J.'                          7  
'Bochkarev, A.'                        8  
'Park, H.'                             9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human RAB31 in complex with a GTP analogue' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, J.'       1 
primary 'Tempel, W.'     2 
primary 'Ismail, S.'     3 
primary 'Arrowsmith, C.' 4 
primary 'Edwards, A.'    5 
primary 'Sundstrom, M.'  6 
primary 'Weigelt, J.'    7 
primary 'Bochkarev, A.'  8 
primary 'Park, H.'       9 
# 
_cell.length_a           87.769 
_cell.length_b           87.769 
_cell.length_c           87.769 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.entry_id           2FG5 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 3' 
_symmetry.Int_Tables_number                198 
_symmetry.entry_id                         2FG5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ras-related protein Rab-31'                  21320.277 1 ? ? 'residues 2-174' ? 
2 non-polymer syn 'MAGNESIUM ION'                               24.305    1 ? ? ?                ? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' 522.196   1 ? ? ?                ? 
4 water       nat water                                         18.015    8 ? ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Rab-22B 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTA
GQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGA
IVVETSAKNAINIEELFQGISRQIPPLDPHEN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTA
GQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGA
IVVETSAKNAINIEELFQGISRQIPPLDPHEN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  ALA n 
1 21  ILE n 
1 22  ARG n 
1 23  GLU n 
1 24  LEU n 
1 25  LYS n 
1 26  VAL n 
1 27  CYS n 
1 28  LEU n 
1 29  LEU n 
1 30  GLY n 
1 31  ASP n 
1 32  THR n 
1 33  GLY n 
1 34  VAL n 
1 35  GLY n 
1 36  LYS n 
1 37  SER n 
1 38  SER n 
1 39  ILE n 
1 40  VAL n 
1 41  CYS n 
1 42  ARG n 
1 43  PHE n 
1 44  VAL n 
1 45  GLN n 
1 46  ASP n 
1 47  HIS n 
1 48  PHE n 
1 49  ASP n 
1 50  HIS n 
1 51  ASN n 
1 52  ILE n 
1 53  SER n 
1 54  PRO n 
1 55  THR n 
1 56  ILE n 
1 57  GLY n 
1 58  ALA n 
1 59  SER n 
1 60  PHE n 
1 61  MET n 
1 62  THR n 
1 63  LYS n 
1 64  THR n 
1 65  VAL n 
1 66  PRO n 
1 67  CYS n 
1 68  GLY n 
1 69  ASN n 
1 70  GLU n 
1 71  LEU n 
1 72  HIS n 
1 73  LYS n 
1 74  PHE n 
1 75  LEU n 
1 76  ILE n 
1 77  TRP n 
1 78  ASP n 
1 79  THR n 
1 80  ALA n 
1 81  GLY n 
1 82  GLN n 
1 83  GLU n 
1 84  ARG n 
1 85  PHE n 
1 86  HIS n 
1 87  SER n 
1 88  LEU n 
1 89  ALA n 
1 90  PRO n 
1 91  MET n 
1 92  TYR n 
1 93  TYR n 
1 94  ARG n 
1 95  GLY n 
1 96  SER n 
1 97  ALA n 
1 98  ALA n 
1 99  ALA n 
1 100 VAL n 
1 101 ILE n 
1 102 VAL n 
1 103 TYR n 
1 104 ASP n 
1 105 ILE n 
1 106 THR n 
1 107 LYS n 
1 108 GLN n 
1 109 ASP n 
1 110 SER n 
1 111 PHE n 
1 112 TYR n 
1 113 THR n 
1 114 LEU n 
1 115 LYS n 
1 116 LYS n 
1 117 TRP n 
1 118 VAL n 
1 119 LYS n 
1 120 GLU n 
1 121 LEU n 
1 122 LYS n 
1 123 GLU n 
1 124 HIS n 
1 125 GLY n 
1 126 PRO n 
1 127 GLU n 
1 128 ASN n 
1 129 ILE n 
1 130 VAL n 
1 131 MET n 
1 132 ALA n 
1 133 ILE n 
1 134 ALA n 
1 135 GLY n 
1 136 ASN n 
1 137 LYS n 
1 138 CYS n 
1 139 ASP n 
1 140 LEU n 
1 141 SER n 
1 142 ASP n 
1 143 ILE n 
1 144 ARG n 
1 145 GLU n 
1 146 VAL n 
1 147 PRO n 
1 148 LEU n 
1 149 LYS n 
1 150 ASP n 
1 151 ALA n 
1 152 LYS n 
1 153 GLU n 
1 154 TYR n 
1 155 ALA n 
1 156 GLU n 
1 157 SER n 
1 158 ILE n 
1 159 GLY n 
1 160 ALA n 
1 161 ILE n 
1 162 VAL n 
1 163 VAL n 
1 164 GLU n 
1 165 THR n 
1 166 SER n 
1 167 ALA n 
1 168 LYS n 
1 169 ASN n 
1 170 ALA n 
1 171 ILE n 
1 172 ASN n 
1 173 ILE n 
1 174 GLU n 
1 175 GLU n 
1 176 LEU n 
1 177 PHE n 
1 178 GLN n 
1 179 GLY n 
1 180 ILE n 
1 181 SER n 
1 182 ARG n 
1 183 GLN n 
1 184 ILE n 
1 185 PRO n 
1 186 PRO n 
1 187 LEU n 
1 188 ASP n 
1 189 PRO n 
1 190 HIS n 
1 191 GLU n 
1 192 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'RAB31, RAB22B' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-CodonPlus(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       p28a-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RAB31_HUMAN 
_struct_ref.pdbx_db_accession          Q13636 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAA
VIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQG
ISRQIPPLDPHEN
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2FG5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 192 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13636 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  174 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       174 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2FG5 MET A 1  ? UNP Q13636 ? ? 'CLONING ARTIFACT' -17 1  
1 2FG5 GLY A 2  ? UNP Q13636 ? ? 'CLONING ARTIFACT' -16 2  
1 2FG5 SER A 3  ? UNP Q13636 ? ? 'CLONING ARTIFACT' -15 3  
1 2FG5 SER A 4  ? UNP Q13636 ? ? 'CLONING ARTIFACT' -14 4  
1 2FG5 HIS A 5  ? UNP Q13636 ? ? 'EXPRESSION TAG'   -13 5  
1 2FG5 HIS A 6  ? UNP Q13636 ? ? 'EXPRESSION TAG'   -12 6  
1 2FG5 HIS A 7  ? UNP Q13636 ? ? 'EXPRESSION TAG'   -11 7  
1 2FG5 HIS A 8  ? UNP Q13636 ? ? 'EXPRESSION TAG'   -10 8  
1 2FG5 HIS A 9  ? UNP Q13636 ? ? 'EXPRESSION TAG'   -9  9  
1 2FG5 HIS A 10 ? UNP Q13636 ? ? 'EXPRESSION TAG'   -8  10 
1 2FG5 SER A 11 ? UNP Q13636 ? ? 'CLONING ARTIFACT' -7  11 
1 2FG5 SER A 12 ? UNP Q13636 ? ? 'CLONING ARTIFACT' -6  12 
1 2FG5 GLY A 13 ? UNP Q13636 ? ? 'CLONING ARTIFACT' -5  13 
1 2FG5 LEU A 14 ? UNP Q13636 ? ? 'CLONING ARTIFACT' -4  14 
1 2FG5 VAL A 15 ? UNP Q13636 ? ? 'CLONING ARTIFACT' -3  15 
1 2FG5 PRO A 16 ? UNP Q13636 ? ? 'CLONING ARTIFACT' -2  16 
1 2FG5 ARG A 17 ? UNP Q13636 ? ? 'CLONING ARTIFACT' -1  17 
1 2FG5 GLY A 18 ? UNP Q13636 ? ? 'CLONING ARTIFACT' 0   18 
1 2FG5 SER A 19 ? UNP Q13636 ? ? 'CLONING ARTIFACT' 1   19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
GNP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' ? 'C10 H17 N6 O13 P3' 522.196 
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          2FG5 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   53.44 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
'20% isopropanol, 16% PEG 4k, 0.1M BisTris, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-12-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
# 
_reflns.entry_id                     2FG5 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   5772 
_reflns.percent_possible_obs         99.800 
_reflns.pdbx_Rmerge_I_obs            0.058 
_reflns.pdbx_chi_squared             1.165 
_reflns.pdbx_redundancy              9.000 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_low 
_reflns_shell.d_res_high 
_reflns_shell.number_measured_obs 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.number_unique_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.percent_possible_all 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.90  2.80 548 98.600  0.745 0.856 7.600 ? ? ? ? ? ? ? 1  
3.02  2.90 574 100.000 0.456 0.906 9.000 ? ? ? ? ? ? ? 2  
3.15  3.02 569 100.000 0.366 0.957 9.400 ? ? ? ? ? ? ? 3  
3.32  3.15 564 100.000 0.191 1.082 9.400 ? ? ? ? ? ? ? 4  
3.53  3.32 577 100.000 0.133 1.174 9.400 ? ? ? ? ? ? ? 5  
3.80  3.53 563 100.000 0.083 1.361 9.300 ? ? ? ? ? ? ? 6  
4.18  3.80 580 100.000 0.062 1.438 9.200 ? ? ? ? ? ? ? 7  
4.78  4.18 587 100.000 0.045 1.636 9.200 ? ? ? ? ? ? ? 8  
6.02  4.78 579 100.000 0.033 1.045 9.100 ? ? ? ? ? ? ? 9  
30.00 6.02 631 99.800  0.021 1.103 8.500 ? ? ? ? ? ? ? 10 
# 
_refine.details                                  ? 
_refine.B_iso_mean                               74.810 
_refine.solvent_model_details                    'MASK BULK SOLVENT' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_d_res_high                            2.801 
_refine.ls_d_res_low                             30.0 
_refine.ls_number_reflns_R_free                  260 
_refine.ls_number_reflns_obs                     5728 
_refine.ls_R_factor_R_work                       0.1999 
_refine.ls_R_factor_R_free                       0.2738 
_refine.ls_R_factor_all                          0.203 
_refine.ls_wR_factor_R_work                      0.185 
_refine.ls_wR_factor_R_free                      0.258 
_refine.ls_percent_reflns_obs                    99.427 
_refine.ls_percent_reflns_R_free                 4.539 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.pdbx_overall_ESU_R                       1.366 
_refine.pdbx_overall_ESU_R_Free                  0.382 
_refine.overall_SU_ML                            0.272 
_refine.overall_SU_B                             13.926 
_refine.entry_id                                 2FG5 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      PDB1YVD 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1265 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               1306 
_refine_hist.d_res_high                       2.801 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1329 0.015  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1809 1.240  1.982  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   164  3.722  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   52   29.927 24.423 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   222  13.083 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   5    9.162  15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           207  0.081  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     968  0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            577  0.208  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          889  0.305  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    50   0.146  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      1    0.085  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   16   0.189  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 3    0.089  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              851  1.757  2.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1326 3.011  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              562  1.525  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             483  2.239  3.000  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_low 
_refine_ls_shell.d_res_high 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
20 2.873  2.801  419 99.523  394 0.254 0.260 23 0.377 . . . . 'X-RAY DIFFRACTION' 
20 2.952  2.873  410 100.000 393 0.289 0.288 17 0.26  . . . . 'X-RAY DIFFRACTION' 
20 3.037  2.952  397 100.000 389 0.285 0.286 8  0.314 . . . . 'X-RAY DIFFRACTION' 
20 3.131  3.037  384 100.000 366 0.288 0.294 18 0.411 . . . . 'X-RAY DIFFRACTION' 
20 3.233  3.131  375 100.000 358 0.262 0.264 17 0.307 . . . . 'X-RAY DIFFRACTION' 
20 3.346  3.233  361 99.723  350 0.241 0.244 10 0.352 . . . . 'X-RAY DIFFRACTION' 
20 3.472  3.346  342 99.708  323 0.239 0.247 18 0.392 . . . . 'X-RAY DIFFRACTION' 
20 3.613  3.472  328 99.085  310 0.213 0.214 15 0.241 . . . . 'X-RAY DIFFRACTION' 
20 3.773  3.613  338 98.225  312 0.204 0.207 20 0.256 . . . . 'X-RAY DIFFRACTION' 
20 3.957  3.773  303 98.020  279 0.163 0.168 18 0.267 . . . . 'X-RAY DIFFRACTION' 
20 4.170  3.957  299 98.997  283 0.17  0.174 13 0.246 . . . . 'X-RAY DIFFRACTION' 
20 4.422  4.170  283 99.293  274 0.166 0.167 7  0.218 . . . . 'X-RAY DIFFRACTION' 
20 4.725  4.422  262 99.237  250 0.178 0.176 10 0.148 . . . . 'X-RAY DIFFRACTION' 
20 5.101  4.725  252 100.000 237 0.153 0.162 15 0.336 . . . . 'X-RAY DIFFRACTION' 
20 5.585  5.101  232 100.000 224 0.174 0.178 8  0.299 . . . . 'X-RAY DIFFRACTION' 
20 6.237  5.585  208 100.000 201 0.211 0.215 7  0.308 . . . . 'X-RAY DIFFRACTION' 
20 7.190  6.237  187 100.000 174 0.223 0.230 13 0.301 . . . . 'X-RAY DIFFRACTION' 
20 8.777  7.190  168 100.000 158 0.174 0.177 10 0.231 . . . . 'X-RAY DIFFRACTION' 
20 12.290 8.777  129 100.000 122 0.164 0.168 7  0.251 . . . . 'X-RAY DIFFRACTION' 
20 62.017 12.290 84  91.667  71  0.241 0.242 6  0.246 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2FG5 
_struct.title                     'Crystal structure of human RAB31 in complex with a GTP analogue' 
_struct.pdbx_descriptor           'Ras-related protein Rab-31' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
'G-PROTEIN, RAB, GTP ANALOGUE, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN' 
_struct_keywords.entry_id        2FG5 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'not known' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 35  ? ASP A 46  ? GLY A 17  ASP A 28  1 ? 12 
HELX_P HELX_P2 2 GLN A 82  ? LEU A 88  ? GLN A 64  LEU A 70  5 ? 7  
HELX_P HELX_P3 3 ALA A 89  ? ARG A 94  ? ALA A 71  ARG A 76  1 ? 6  
HELX_P HELX_P4 4 GLN A 108 ? GLY A 125 ? GLN A 90  GLY A 107 1 ? 18 
HELX_P HELX_P5 5 LYS A 137 ? ARG A 144 ? LYS A 119 ARG A 126 5 ? 8  
HELX_P HELX_P6 6 PRO A 147 ? SER A 157 ? PRO A 129 SER A 139 1 ? 11 
HELX_P HELX_P7 7 ASN A 172 ? GLN A 183 ? ASN A 154 GLN A 165 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 C GNP .  N3B ? ? A MG 301 A GNP 302 1_555 ? ? ? ? ? ? ? 3.053 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 301 A HOH 402 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 C GNP .  O2B ? ? A MG 301 A GNP 302 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 A THR 55 OG1 ? ? A MG 301 A THR 37  1_555 ? ? ? ? ? ? ? 2.138 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 C GNP .  O2G ? ? A MG 301 A GNP 302 1_555 ? ? ? ? ? ? ? 1.905 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 A SER 37 OG  ? ? A MG 301 A SER 19  1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc7 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 301 A HOH 401 1_555 ? ? ? ? ? ? ? 2.508 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 58  ? PRO A 66  ? ALA A 40  PRO A 48  
A 2 LEU A 71  ? THR A 79  ? LEU A 53  THR A 61  
A 3 ARG A 22  ? GLY A 30  ? ARG A 4   GLY A 12  
A 4 ALA A 98  ? ASP A 104 ? ALA A 80  ASP A 86  
A 5 VAL A 130 ? ASN A 136 ? VAL A 112 ASN A 118 
A 6 ILE A 161 ? GLU A 164 ? ILE A 143 GLU A 146 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 59  ? N SER A 41  O ASP A 78  ? O ASP A 60  
A 2 3 O LEU A 75  ? O LEU A 57  N LEU A 24  ? N LEU A 6   
A 3 4 N LEU A 29  ? N LEU A 11  O VAL A 100 ? O VAL A 82  
A 4 5 N ILE A 101 ? N ILE A 83  O ALA A 132 ? O ALA A 114 
A 5 6 N ILE A 133 ? N ILE A 115 O ILE A 161 ? O ILE A 143 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 301'  
AC2 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE GNP A 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  SER A 37  ? SER A 19  . ? 1_555 ? 
2  AC1 5  THR A 55  ? THR A 37  . ? 1_555 ? 
3  AC1 5  GNP C .   ? GNP A 302 . ? 1_555 ? 
4  AC1 5  HOH D .   ? HOH A 401 . ? 1_555 ? 
5  AC1 5  HOH D .   ? HOH A 402 . ? 1_555 ? 
6  AC2 28 ASP A 31  ? ASP A 13  . ? 1_555 ? 
7  AC2 28 THR A 32  ? THR A 14  . ? 1_555 ? 
8  AC2 28 GLY A 33  ? GLY A 15  . ? 1_555 ? 
9  AC2 28 VAL A 34  ? VAL A 16  . ? 1_555 ? 
10 AC2 28 GLY A 35  ? GLY A 17  . ? 1_555 ? 
11 AC2 28 LYS A 36  ? LYS A 18  . ? 1_555 ? 
12 AC2 28 SER A 37  ? SER A 19  . ? 1_555 ? 
13 AC2 28 SER A 38  ? SER A 20  . ? 1_555 ? 
14 AC2 28 PHE A 48  ? PHE A 30  . ? 1_555 ? 
15 AC2 28 ASP A 49  ? ASP A 31  . ? 1_555 ? 
16 AC2 28 HIS A 50  ? HIS A 32  . ? 1_555 ? 
17 AC2 28 ILE A 52  ? ILE A 34  . ? 1_555 ? 
18 AC2 28 PRO A 54  ? PRO A 36  . ? 1_555 ? 
19 AC2 28 THR A 55  ? THR A 37  . ? 1_555 ? 
20 AC2 28 GLY A 81  ? GLY A 63  . ? 1_555 ? 
21 AC2 28 ASN A 136 ? ASN A 118 . ? 1_555 ? 
22 AC2 28 LYS A 137 ? LYS A 119 . ? 1_555 ? 
23 AC2 28 ASP A 139 ? ASP A 121 . ? 1_555 ? 
24 AC2 28 LEU A 140 ? LEU A 122 . ? 1_555 ? 
25 AC2 28 SER A 141 ? SER A 123 . ? 5_555 ? 
26 AC2 28 ASP A 142 ? ASP A 124 . ? 5_555 ? 
27 AC2 28 SER A 166 ? SER A 148 . ? 1_555 ? 
28 AC2 28 ALA A 167 ? ALA A 149 . ? 1_555 ? 
29 AC2 28 LYS A 168 ? LYS A 150 . ? 1_555 ? 
30 AC2 28 MG  B .   ? MG  A 301 . ? 1_555 ? 
31 AC2 28 HOH D .   ? HOH A 401 . ? 1_555 ? 
32 AC2 28 HOH D .   ? HOH A 402 . ? 1_555 ? 
33 AC2 28 HOH D .   ? HOH A 407 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2FG5 
_atom_sites.fract_transf_matrix[1][1]   0.01139 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01139 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01139 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ILE A 1 21  ? 46.208 -11.561 0.915   1.00 88.27  ? 3   ILE A N     1 
ATOM   2    C  CA    . ILE A 1 21  ? 44.992 -10.828 0.463   1.00 89.48  ? 3   ILE A CA    1 
ATOM   3    C  C     . ILE A 1 21  ? 44.056 -11.766 -0.287  1.00 89.40  ? 3   ILE A C     1 
ATOM   4    O  O     . ILE A 1 21  ? 44.476 -12.472 -1.202  1.00 91.50  ? 3   ILE A O     1 
ATOM   5    C  CB    . ILE A 1 21  ? 45.340 -9.595  -0.431  1.00 89.82  ? 3   ILE A CB    1 
ATOM   6    C  CG1   . ILE A 1 21  ? 46.205 -8.578  0.351   1.00 90.92  ? 3   ILE A CG1   1 
ATOM   7    C  CG2   . ILE A 1 21  ? 44.048 -8.934  -0.969  1.00 90.39  ? 3   ILE A CG2   1 
ATOM   8    C  CD1   . ILE A 1 21  ? 46.761 -7.370  -0.484  1.00 90.14  ? 3   ILE A CD1   1 
ATOM   9    N  N     . ARG A 1 22  ? 42.791 -11.782 0.115   1.00 88.31  ? 4   ARG A N     1 
ATOM   10   C  CA    . ARG A 1 22  ? 41.797 -12.597 -0.550  1.00 86.64  ? 4   ARG A CA    1 
ATOM   11   C  C     . ARG A 1 22  ? 40.712 -11.673 -1.066  1.00 85.43  ? 4   ARG A C     1 
ATOM   12   O  O     . ARG A 1 22  ? 39.927 -11.108 -0.283  1.00 85.64  ? 4   ARG A O     1 
ATOM   13   C  CB    . ARG A 1 22  ? 41.243 -13.638 0.397   1.00 86.88  ? 4   ARG A CB    1 
ATOM   14   C  CG    . ARG A 1 22  ? 40.503 -14.751 -0.279  1.00 89.32  ? 4   ARG A CG    1 
ATOM   15   C  CD    . ARG A 1 22  ? 40.389 -15.902 0.688   1.00 91.25  ? 4   ARG A CD    1 
ATOM   16   N  NE    . ARG A 1 22  ? 39.503 -16.965 0.229   1.00 92.47  ? 4   ARG A NE    1 
ATOM   17   C  CZ    . ARG A 1 22  ? 39.057 -17.948 1.011   1.00 94.04  ? 4   ARG A CZ    1 
ATOM   18   N  NH1   . ARG A 1 22  ? 39.414 -18.000 2.300   1.00 95.11  ? 4   ARG A NH1   1 
ATOM   19   N  NH2   . ARG A 1 22  ? 38.244 -18.875 0.514   1.00 93.96  ? 4   ARG A NH2   1 
ATOM   20   N  N     . GLU A 1 23  ? 40.706 -11.495 -2.389  1.00 82.96  ? 5   GLU A N     1 
ATOM   21   C  CA    . GLU A 1 23  ? 39.768 -10.617 -3.073  1.00 81.33  ? 5   GLU A CA    1 
ATOM   22   C  C     . GLU A 1 23  ? 38.373 -11.236 -3.113  1.00 80.28  ? 5   GLU A C     1 
ATOM   23   O  O     . GLU A 1 23  ? 38.199 -12.367 -3.568  1.00 79.15  ? 5   GLU A O     1 
ATOM   24   C  CB    . GLU A 1 23  ? 40.264 -10.282 -4.498  1.00 81.71  ? 5   GLU A CB    1 
ATOM   25   C  CG    . GLU A 1 23  ? 41.552 -9.401  -4.559  1.00 81.91  ? 5   GLU A CG    1 
ATOM   26   C  CD    . GLU A 1 23  ? 41.888 -8.868  -5.983  1.00 82.10  ? 5   GLU A CD    1 
ATOM   27   O  OE1   . GLU A 1 23  ? 41.463 -9.478  -6.996  1.00 81.99  ? 5   GLU A OE1   1 
ATOM   28   O  OE2   . GLU A 1 23  ? 42.588 -7.834  -6.079  1.00 82.00  ? 5   GLU A OE2   1 
ATOM   29   N  N     . LEU A 1 24  ? 37.385 -10.490 -2.619  1.00 80.27  ? 6   LEU A N     1 
ATOM   30   C  CA    . LEU A 1 24  ? 35.996 -10.964 -2.587  1.00 79.66  ? 6   LEU A CA    1 
ATOM   31   C  C     . LEU A 1 24  ? 35.041 -9.994  -3.275  1.00 79.41  ? 6   LEU A C     1 
ATOM   32   O  O     . LEU A 1 24  ? 34.851 -8.852  -2.818  1.00 79.45  ? 6   LEU A O     1 
ATOM   33   C  CB    . LEU A 1 24  ? 35.545 -11.232 -1.147  1.00 79.99  ? 6   LEU A CB    1 
ATOM   34   C  CG    . LEU A 1 24  ? 36.273 -12.338 -0.384  1.00 80.22  ? 6   LEU A CG    1 
ATOM   35   C  CD1   . LEU A 1 24  ? 35.735 -12.441 1.005   1.00 79.82  ? 6   LEU A CD1   1 
ATOM   36   C  CD2   . LEU A 1 24  ? 36.147 -13.689 -1.110  1.00 81.18  ? 6   LEU A CD2   1 
ATOM   37   N  N     . LYS A 1 25  ? 34.448 -10.450 -4.379  1.00 78.29  ? 7   LYS A N     1 
ATOM   38   C  CA    . LYS A 1 25  ? 33.501 -9.642  -5.112  1.00 77.82  ? 7   LYS A CA    1 
ATOM   39   C  C     . LYS A 1 25  ? 32.138 -9.728  -4.437  1.00 77.40  ? 7   LYS A C     1 
ATOM   40   O  O     . LYS A 1 25  ? 31.595 -10.822 -4.199  1.00 77.95  ? 7   LYS A O     1 
ATOM   41   C  CB    . LYS A 1 25  ? 33.443 -10.040 -6.593  1.00 78.21  ? 7   LYS A CB    1 
ATOM   42   C  CG    . LYS A 1 25  ? 32.642 -9.056  -7.488  1.00 79.30  ? 7   LYS A CG    1 
ATOM   43   C  CD    . LYS A 1 25  ? 33.212 -8.996  -8.919  1.00 79.02  ? 7   LYS A CD    1 
ATOM   44   C  CE    . LYS A 1 25  ? 32.250 -8.318  -9.892  1.00 78.23  ? 7   LYS A CE    1 
ATOM   45   N  NZ    . LYS A 1 25  ? 32.747 -8.381  -11.300 1.00 75.44  ? 7   LYS A NZ    1 
ATOM   46   N  N     . VAL A 1 26  ? 31.613 -8.556  -4.104  1.00 75.75  ? 8   VAL A N     1 
ATOM   47   C  CA    . VAL A 1 26  ? 30.338 -8.428  -3.443  1.00 74.77  ? 8   VAL A CA    1 
ATOM   48   C  C     . VAL A 1 26  ? 29.469 -7.484  -4.241  1.00 73.37  ? 8   VAL A C     1 
ATOM   49   O  O     . VAL A 1 26  ? 29.939 -6.433  -4.711  1.00 74.73  ? 8   VAL A O     1 
ATOM   50   C  CB    . VAL A 1 26  ? 30.502 -7.862  -1.998  1.00 74.71  ? 8   VAL A CB    1 
ATOM   51   C  CG1   . VAL A 1 26  ? 29.160 -7.799  -1.297  1.00 73.94  ? 8   VAL A CG1   1 
ATOM   52   C  CG2   . VAL A 1 26  ? 31.480 -8.717  -1.182  1.00 74.17  ? 8   VAL A CG2   1 
ATOM   53   N  N     . CYS A 1 27  ? 28.202 -7.845  -4.394  1.00 70.99  ? 9   CYS A N     1 
ATOM   54   C  CA    . CYS A 1 27  ? 27.266 -6.995  -5.103  1.00 69.74  ? 9   CYS A CA    1 
ATOM   55   C  C     . CYS A 1 27  ? 26.075 -6.608  -4.218  1.00 69.87  ? 9   CYS A C     1 
ATOM   56   O  O     . CYS A 1 27  ? 25.590 -7.410  -3.414  1.00 70.97  ? 9   CYS A O     1 
ATOM   57   C  CB    A CYS A 1 27  ? 26.788 -7.675  -6.371  0.65 67.73  ? 9   CYS A CB    1 
ATOM   58   C  CB    B CYS A 1 27  ? 26.779 -7.675  -6.382  0.35 70.04  ? 9   CYS A CB    1 
ATOM   59   S  SG    A CYS A 1 27  ? 25.997 -9.208  -6.060  0.65 67.50  ? 9   CYS A SG    1 
ATOM   60   S  SG    B CYS A 1 27  ? 25.837 -6.583  -7.473  0.35 72.12  ? 9   CYS A SG    1 
ATOM   61   N  N     . LEU A 1 28  ? 25.622 -5.365  -4.358  1.00 69.59  ? 10  LEU A N     1 
ATOM   62   C  CA    . LEU A 1 28  ? 24.480 -4.896  -3.592  1.00 70.72  ? 10  LEU A CA    1 
ATOM   63   C  C     . LEU A 1 28  ? 23.224 -4.854  -4.417  1.00 71.01  ? 10  LEU A C     1 
ATOM   64   O  O     . LEU A 1 28  ? 23.171 -4.225  -5.485  1.00 71.56  ? 10  LEU A O     1 
ATOM   65   C  CB    . LEU A 1 28  ? 24.747 -3.541  -2.939  1.00 70.50  ? 10  LEU A CB    1 
ATOM   66   C  CG    . LEU A 1 28  ? 25.529 -3.604  -1.624  1.00 70.61  ? 10  LEU A CG    1 
ATOM   67   C  CD1   . LEU A 1 28  ? 27.006 -3.791  -1.862  1.00 70.72  ? 10  LEU A CD1   1 
ATOM   68   C  CD2   . LEU A 1 28  ? 25.306 -2.364  -0.888  1.00 71.09  ? 10  LEU A CD2   1 
ATOM   69   N  N     . LEU A 1 29  ? 22.210 -5.545  -3.919  1.00 70.19  ? 11  LEU A N     1 
ATOM   70   C  CA    . LEU A 1 29  ? 20.944 -5.617  -4.600  1.00 69.91  ? 11  LEU A CA    1 
ATOM   71   C  C     . LEU A 1 29  ? 19.853 -5.137  -3.687  1.00 69.46  ? 11  LEU A C     1 
ATOM   72   O  O     . LEU A 1 29  ? 19.856 -5.418  -2.483  1.00 69.69  ? 11  LEU A O     1 
ATOM   73   C  CB    . LEU A 1 29  ? 20.653 -7.050  -5.032  1.00 71.12  ? 11  LEU A CB    1 
ATOM   74   C  CG    . LEU A 1 29  ? 21.740 -7.777  -5.824  1.00 71.53  ? 11  LEU A CG    1 
ATOM   75   C  CD1   . LEU A 1 29  ? 21.484 -9.267  -5.798  1.00 70.43  ? 11  LEU A CD1   1 
ATOM   76   C  CD2   . LEU A 1 29  ? 21.833 -7.232  -7.252  1.00 72.70  ? 11  LEU A CD2   1 
ATOM   77   N  N     . GLY A 1 30  ? 18.912 -4.412  -4.264  1.00 68.57  ? 12  GLY A N     1 
ATOM   78   C  CA    . GLY A 1 30  ? 17.794 -3.922  -3.516  1.00 69.62  ? 12  GLY A CA    1 
ATOM   79   C  C     . GLY A 1 30  ? 17.095 -2.814  -4.229  1.00 70.35  ? 12  GLY A C     1 
ATOM   80   O  O     . GLY A 1 30  ? 17.635 -2.205  -5.153  1.00 71.05  ? 12  GLY A O     1 
ATOM   81   N  N     . ASP A 1 31  ? 15.888 -2.538  -3.779  1.00 71.34  ? 13  ASP A N     1 
ATOM   82   C  CA    . ASP A 1 31  ? 15.066 -1.524  -4.370  1.00 72.98  ? 13  ASP A CA    1 
ATOM   83   C  C     . ASP A 1 31  ? 15.711 -0.137  -4.161  1.00 70.56  ? 13  ASP A C     1 
ATOM   84   O  O     . ASP A 1 31  ? 16.656 -0.007  -3.387  1.00 71.50  ? 13  ASP A O     1 
ATOM   85   C  CB    . ASP A 1 31  ? 13.698 -1.596  -3.725  1.00 76.45  ? 13  ASP A CB    1 
ATOM   86   C  CG    . ASP A 1 31  ? 12.593 -1.316  -4.692  1.00 81.76  ? 13  ASP A CG    1 
ATOM   87   O  OD1   . ASP A 1 31  ? 12.872 -0.780  -5.809  1.00 83.07  ? 13  ASP A OD1   1 
ATOM   88   O  OD2   . ASP A 1 31  ? 11.429 -1.638  -4.340  1.00 84.58  ? 13  ASP A OD2   1 
ATOM   89   N  N     . THR A 1 32  ? 15.224 0.879   -4.861  1.00 66.33  ? 14  THR A N     1 
ATOM   90   C  CA    . THR A 1 32  ? 15.752 2.232   -4.694  1.00 67.19  ? 14  THR A CA    1 
ATOM   91   C  C     . THR A 1 32  ? 15.413 2.750   -3.317  1.00 67.17  ? 14  THR A C     1 
ATOM   92   O  O     . THR A 1 32  ? 14.372 2.417   -2.765  1.00 70.34  ? 14  THR A O     1 
ATOM   93   C  CB    . THR A 1 32  ? 15.129 3.195   -5.711  1.00 68.23  ? 14  THR A CB    1 
ATOM   94   O  OG1   . THR A 1 32  ? 15.259 2.635   -7.005  1.00 71.74  ? 14  THR A OG1   1 
ATOM   95   C  CG2   . THR A 1 32  ? 15.810 4.563   -5.689  1.00 67.59  ? 14  THR A CG2   1 
ATOM   96   N  N     . GLY A 1 33  ? 16.289 3.562   -2.755  1.00 64.52  ? 15  GLY A N     1 
ATOM   97   C  CA    . GLY A 1 33  ? 16.001 4.191   -1.494  1.00 60.88  ? 15  GLY A CA    1 
ATOM   98   C  C     . GLY A 1 33  ? 16.247 3.359   -0.261  1.00 60.78  ? 15  GLY A C     1 
ATOM   99   O  O     . GLY A 1 33  ? 16.211 3.892   0.855   1.00 64.19  ? 15  GLY A O     1 
ATOM   100  N  N     . VAL A 1 34  ? 16.510 2.062   -0.429  1.00 58.92  ? 16  VAL A N     1 
ATOM   101  C  CA    . VAL A 1 34  ? 16.728 1.184   0.741   1.00 55.23  ? 16  VAL A CA    1 
ATOM   102  C  C     . VAL A 1 34  ? 17.993 1.483   1.511   1.00 53.40  ? 16  VAL A C     1 
ATOM   103  O  O     . VAL A 1 34  ? 18.021 1.267   2.700   1.00 54.87  ? 16  VAL A O     1 
ATOM   104  C  CB    . VAL A 1 34  ? 16.625 -0.331  0.429   1.00 55.65  ? 16  VAL A CB    1 
ATOM   105  C  CG1   . VAL A 1 34  ? 15.176 -0.714  0.081   1.00 52.74  ? 16  VAL A CG1   1 
ATOM   106  C  CG2   . VAL A 1 34  ? 17.615 -0.745  -0.669  1.00 56.30  ? 16  VAL A CG2   1 
ATOM   107  N  N     . GLY A 1 35  ? 19.032 2.002   0.841   1.00 53.98  ? 17  GLY A N     1 
ATOM   108  C  CA    . GLY A 1 35  ? 20.260 2.433   1.542   1.00 50.13  ? 17  GLY A CA    1 
ATOM   109  C  C     . GLY A 1 35  ? 21.520 1.698   1.162   1.00 50.13  ? 17  GLY A C     1 
ATOM   110  O  O     . GLY A 1 35  ? 22.521 1.680   1.924   1.00 48.66  ? 17  GLY A O     1 
ATOM   111  N  N     . LYS A 1 36  ? 21.491 1.099   -0.018  1.00 49.08  ? 18  LYS A N     1 
ATOM   112  C  CA    . LYS A 1 36  ? 22.639 0.348   -0.523  1.00 49.73  ? 18  LYS A CA    1 
ATOM   113  C  C     . LYS A 1 36  ? 23.897 1.216   -0.552  1.00 49.98  ? 18  LYS A C     1 
ATOM   114  O  O     . LYS A 1 36  ? 24.931 0.826   -0.025  1.00 52.07  ? 18  LYS A O     1 
ATOM   115  C  CB    . LYS A 1 36  ? 22.335 -0.194  -1.913  1.00 51.17  ? 18  LYS A CB    1 
ATOM   116  C  CG    . LYS A 1 36  ? 21.128 -1.142  -1.958  1.00 51.24  ? 18  LYS A CG    1 
ATOM   117  C  CD    . LYS A 1 36  ? 20.849 -1.609  -3.371  1.00 53.53  ? 18  LYS A CD    1 
ATOM   118  C  CE    . LYS A 1 36  ? 20.566 -0.454  -4.312  1.00 54.53  ? 18  LYS A CE    1 
ATOM   119  N  NZ    . LYS A 1 36  ? 19.280 0.204   -3.996  1.00 56.84  ? 18  LYS A NZ    1 
ATOM   120  N  N     . SER A 1 37  ? 23.798 2.405   -1.139  1.00 47.51  ? 19  SER A N     1 
ATOM   121  C  CA    . SER A 1 37  ? 24.928 3.294   -1.195  1.00 50.23  ? 19  SER A CA    1 
ATOM   122  C  C     . SER A 1 37  ? 25.297 3.812   0.162   1.00 52.87  ? 19  SER A C     1 
ATOM   123  O  O     . SER A 1 37  ? 26.476 4.053   0.431   1.00 52.02  ? 19  SER A O     1 
ATOM   124  C  CB    . SER A 1 37  ? 24.647 4.459   -2.103  1.00 51.20  ? 19  SER A CB    1 
ATOM   125  O  OG    . SER A 1 37  ? 24.202 3.979   -3.361  1.00 54.48  ? 19  SER A OG    1 
ATOM   126  N  N     . SER A 1 38  ? 24.306 3.979   1.035   1.00 53.66  ? 20  SER A N     1 
ATOM   127  C  CA    . SER A 1 38  ? 24.603 4.515   2.345   1.00 54.00  ? 20  SER A CA    1 
ATOM   128  C  C     . SER A 1 38  ? 25.381 3.516   3.133   1.00 53.12  ? 20  SER A C     1 
ATOM   129  O  O     . SER A 1 38  ? 26.309 3.875   3.836   1.00 54.46  ? 20  SER A O     1 
ATOM   130  C  CB    . SER A 1 38  ? 23.342 4.942   3.062   1.00 55.82  ? 20  SER A CB    1 
ATOM   131  O  OG    . SER A 1 38  ? 22.753 6.034   2.381   1.00 58.35  ? 20  SER A OG    1 
ATOM   132  N  N     . ILE A 1 39  ? 25.011 2.247   2.992   1.00 53.37  ? 21  ILE A N     1 
ATOM   133  C  CA    . ILE A 1 39  ? 25.711 1.150   3.671   1.00 51.90  ? 21  ILE A CA    1 
ATOM   134  C  C     . ILE A 1 39  ? 27.173 1.069   3.250   1.00 53.71  ? 21  ILE A C     1 
ATOM   135  O  O     . ILE A 1 39  ? 28.063 1.013   4.097   1.00 55.67  ? 21  ILE A O     1 
ATOM   136  C  CB    . ILE A 1 39  ? 25.024 -0.222  3.429   1.00 47.54  ? 21  ILE A CB    1 
ATOM   137  C  CG1   . ILE A 1 39  ? 23.696 -0.267  4.148   1.00 45.68  ? 21  ILE A CG1   1 
ATOM   138  C  CG2   . ILE A 1 39  ? 25.910 -1.375  3.927   1.00 46.20  ? 21  ILE A CG2   1 
ATOM   139  C  CD1   . ILE A 1 39  ? 22.864 -1.496  3.834   1.00 47.83  ? 21  ILE A CD1   1 
ATOM   140  N  N     . VAL A 1 40  ? 27.420 1.053   1.944   1.00 56.02  ? 22  VAL A N     1 
ATOM   141  C  CA    . VAL A 1 40  ? 28.800 0.953   1.429   1.00 57.21  ? 22  VAL A CA    1 
ATOM   142  C  C     . VAL A 1 40  ? 29.579 2.172   1.875   1.00 55.40  ? 22  VAL A C     1 
ATOM   143  O  O     . VAL A 1 40  ? 30.691 2.060   2.384   1.00 55.80  ? 22  VAL A O     1 
ATOM   144  C  CB    . VAL A 1 40  ? 28.840 0.813   -0.116  1.00 58.44  ? 22  VAL A CB    1 
ATOM   145  C  CG1   . VAL A 1 40  ? 30.245 0.646   -0.589  1.00 59.22  ? 22  VAL A CG1   1 
ATOM   146  C  CG2   . VAL A 1 40  ? 28.017 -0.387  -0.553  1.00 58.72  ? 22  VAL A CG2   1 
ATOM   147  N  N     . CYS A 1 41  ? 28.961 3.333   1.717   1.00 54.59  ? 23  CYS A N     1 
ATOM   148  C  CA    . CYS A 1 41  ? 29.558 4.582   2.125   1.00 52.78  ? 23  CYS A CA    1 
ATOM   149  C  C     . CYS A 1 41  ? 29.879 4.622   3.622   1.00 54.19  ? 23  CYS A C     1 
ATOM   150  O  O     . CYS A 1 41  ? 30.869 5.246   4.037   1.00 56.44  ? 23  CYS A O     1 
ATOM   151  C  CB    A CYS A 1 41  ? 28.637 5.717   1.732   0.65 54.66  ? 23  CYS A CB    1 
ATOM   152  C  CB    B CYS A 1 41  ? 28.668 5.767   1.766   0.35 48.80  ? 23  CYS A CB    1 
ATOM   153  S  SG    A CYS A 1 41  ? 29.194 7.271   2.244   0.65 58.24  ? 23  CYS A SG    1 
ATOM   154  S  SG    B CYS A 1 41  ? 28.673 6.191   0.042   0.35 40.70  ? 23  CYS A SG    1 
ATOM   155  N  N     . ARG A 1 42  ? 29.056 3.966   4.435   1.00 54.70  ? 24  ARG A N     1 
ATOM   156  C  CA    . ARG A 1 42  ? 29.353 3.892   5.856   1.00 55.26  ? 24  ARG A CA    1 
ATOM   157  C  C     . ARG A 1 42  ? 30.508 2.935   6.078   1.00 53.96  ? 24  ARG A C     1 
ATOM   158  O  O     . ARG A 1 42  ? 31.455 3.239   6.792   1.00 53.46  ? 24  ARG A O     1 
ATOM   159  C  CB    . ARG A 1 42  ? 28.148 3.434   6.655   1.00 55.75  ? 24  ARG A CB    1 
ATOM   160  C  CG    . ARG A 1 42  ? 28.507 3.012   8.094   1.00 59.77  ? 24  ARG A CG    1 
ATOM   161  C  CD    . ARG A 1 42  ? 29.144 4.148   8.891   1.00 59.77  ? 24  ARG A CD    1 
ATOM   162  N  NE    . ARG A 1 42  ? 28.147 5.149   9.233   1.00 63.69  ? 24  ARG A NE    1 
ATOM   163  C  CZ    . ARG A 1 42  ? 28.418 6.331   9.778   1.00 63.94  ? 24  ARG A CZ    1 
ATOM   164  N  NH1   . ARG A 1 42  ? 29.674 6.677   10.035  1.00 66.00  ? 24  ARG A NH1   1 
ATOM   165  N  NH2   . ARG A 1 42  ? 27.434 7.174   10.046  1.00 61.30  ? 24  ARG A NH2   1 
ATOM   166  N  N     . PHE A 1 43  ? 30.416 1.772   5.454   1.00 53.90  ? 25  PHE A N     1 
ATOM   167  C  CA    . PHE A 1 43  ? 31.408 0.756   5.618   1.00 53.61  ? 25  PHE A CA    1 
ATOM   168  C  C     . PHE A 1 43  ? 32.784 1.248   5.221   1.00 54.98  ? 25  PHE A C     1 
ATOM   169  O  O     . PHE A 1 43  ? 33.716 1.147   5.998   1.00 54.94  ? 25  PHE A O     1 
ATOM   170  C  CB    . PHE A 1 43  ? 31.036 -0.470  4.811   1.00 54.12  ? 25  PHE A CB    1 
ATOM   171  C  CG    . PHE A 1 43  ? 31.947 -1.632  5.030   1.00 56.95  ? 25  PHE A CG    1 
ATOM   172  C  CD1   . PHE A 1 43  ? 32.241 -2.077  6.335   1.00 58.09  ? 25  PHE A CD1   1 
ATOM   173  C  CD2   . PHE A 1 43  ? 32.500 -2.314  3.946   1.00 58.20  ? 25  PHE A CD2   1 
ATOM   174  C  CE1   . PHE A 1 43  ? 33.076 -3.151  6.548   1.00 56.24  ? 25  PHE A CE1   1 
ATOM   175  C  CE2   . PHE A 1 43  ? 33.343 -3.414  4.153   1.00 57.69  ? 25  PHE A CE2   1 
ATOM   176  C  CZ    . PHE A 1 43  ? 33.627 -3.831  5.455   1.00 56.37  ? 25  PHE A CZ    1 
ATOM   177  N  N     . VAL A 1 44  ? 32.892 1.814   4.018   1.00 56.81  ? 26  VAL A N     1 
ATOM   178  C  CA    . VAL A 1 44  ? 34.183 2.191   3.451   1.00 55.65  ? 26  VAL A CA    1 
ATOM   179  C  C     . VAL A 1 44  ? 34.675 3.504   3.956   1.00 56.77  ? 26  VAL A C     1 
ATOM   180  O  O     . VAL A 1 44  ? 35.832 3.613   4.356   1.00 59.87  ? 26  VAL A O     1 
ATOM   181  C  CB    . VAL A 1 44  ? 34.134 2.253   1.902   1.00 56.09  ? 26  VAL A CB    1 
ATOM   182  C  CG1   . VAL A 1 44  ? 35.496 2.652   1.336   1.00 56.21  ? 26  VAL A CG1   1 
ATOM   183  C  CG2   . VAL A 1 44  ? 33.682 0.927   1.320   1.00 53.73  ? 26  VAL A CG2   1 
ATOM   184  N  N     . GLN A 1 45  ? 33.800 4.502   3.960   1.00 58.05  ? 27  GLN A N     1 
ATOM   185  C  CA    . GLN A 1 45  ? 34.202 5.878   4.256   1.00 59.52  ? 27  GLN A CA    1 
ATOM   186  C  C     . GLN A 1 45  ? 33.839 6.405   5.644   1.00 62.81  ? 27  GLN A C     1 
ATOM   187  O  O     . GLN A 1 45  ? 34.197 7.545   5.985   1.00 64.87  ? 27  GLN A O     1 
ATOM   188  C  CB    . GLN A 1 45  ? 33.597 6.804   3.217   1.00 57.04  ? 27  GLN A CB    1 
ATOM   189  C  CG    . GLN A 1 45  ? 33.852 6.358   1.819   1.00 60.16  ? 27  GLN A CG    1 
ATOM   190  C  CD    . GLN A 1 45  ? 33.135 7.210   0.785   1.00 58.80  ? 27  GLN A CD    1 
ATOM   191  O  OE1   . GLN A 1 45  ? 32.208 7.956   1.104   1.00 57.17  ? 27  GLN A OE1   1 
ATOM   192  N  NE2   . GLN A 1 45  ? 33.561 7.091   -0.462  1.00 57.17  ? 27  GLN A NE2   1 
ATOM   193  N  N     . ASP A 1 46  ? 33.112 5.608   6.426   1.00 65.40  ? 28  ASP A N     1 
ATOM   194  C  CA    . ASP A 1 46  ? 32.622 6.033   7.751   1.00 68.10  ? 28  ASP A CA    1 
ATOM   195  C  C     . ASP A 1 46  ? 31.915 7.391   7.655   1.00 68.41  ? 28  ASP A C     1 
ATOM   196  O  O     . ASP A 1 46  ? 32.173 8.298   8.448   1.00 71.13  ? 28  ASP A O     1 
ATOM   197  C  CB    . ASP A 1 46  ? 33.768 6.078   8.772   1.00 69.48  ? 28  ASP A CB    1 
ATOM   198  C  CG    . ASP A 1 46  ? 33.273 6.263   10.215  1.00 70.68  ? 28  ASP A CG    1 
ATOM   199  O  OD1   . ASP A 1 46  ? 32.382 5.473   10.642  1.00 69.28  ? 28  ASP A OD1   1 
ATOM   200  O  OD2   . ASP A 1 46  ? 33.800 7.184   10.914  1.00 68.51  ? 28  ASP A OD2   1 
ATOM   201  N  N     . HIS A 1 47  ? 31.029 7.519   6.666   1.00 68.65  ? 29  HIS A N     1 
ATOM   202  C  CA    . HIS A 1 47  ? 30.325 8.772   6.405   1.00 67.01  ? 29  HIS A CA    1 
ATOM   203  C  C     . HIS A 1 47  ? 28.867 8.542   6.002   1.00 67.72  ? 29  HIS A C     1 
ATOM   204  O  O     . HIS A 1 47  ? 28.534 7.557   5.328   1.00 70.85  ? 29  HIS A O     1 
ATOM   205  C  CB    . HIS A 1 47  ? 31.062 9.564   5.324   1.00 66.42  ? 29  HIS A CB    1 
ATOM   206  C  CG    . HIS A 1 47  ? 30.409 10.865  4.971   1.00 68.24  ? 29  HIS A CG    1 
ATOM   207  N  ND1   . HIS A 1 47  ? 29.805 11.090  3.747   1.00 68.53  ? 29  HIS A ND1   1 
ATOM   208  C  CD2   . HIS A 1 47  ? 30.240 12.002  5.688   1.00 67.97  ? 29  HIS A CD2   1 
ATOM   209  C  CE1   . HIS A 1 47  ? 29.305 12.313  3.719   1.00 67.36  ? 29  HIS A CE1   1 
ATOM   210  N  NE2   . HIS A 1 47  ? 29.552 12.886  4.885   1.00 69.68  ? 29  HIS A NE2   1 
ATOM   211  N  N     . PHE A 1 48  ? 28.004 9.461   6.413   1.00 66.58  ? 30  PHE A N     1 
ATOM   212  C  CA    . PHE A 1 48  ? 26.601 9.393   6.086   1.00 65.79  ? 30  PHE A CA    1 
ATOM   213  C  C     . PHE A 1 48  ? 26.085 10.736  5.609   1.00 67.44  ? 30  PHE A C     1 
ATOM   214  O  O     . PHE A 1 48  ? 26.238 11.745  6.282   1.00 68.21  ? 30  PHE A O     1 
ATOM   215  C  CB    . PHE A 1 48  ? 25.801 8.929   7.296   1.00 65.58  ? 30  PHE A CB    1 
ATOM   216  C  CG    . PHE A 1 48  ? 24.322 8.927   7.076   1.00 65.65  ? 30  PHE A CG    1 
ATOM   217  C  CD1   . PHE A 1 48  ? 23.708 7.875   6.401   1.00 64.17  ? 30  PHE A CD1   1 
ATOM   218  C  CD2   . PHE A 1 48  ? 23.528 9.985   7.554   1.00 66.39  ? 30  PHE A CD2   1 
ATOM   219  C  CE1   . PHE A 1 48  ? 22.322 7.863   6.195   1.00 65.30  ? 30  PHE A CE1   1 
ATOM   220  C  CE2   . PHE A 1 48  ? 22.153 9.985   7.362   1.00 66.24  ? 30  PHE A CE2   1 
ATOM   221  C  CZ    . PHE A 1 48  ? 21.540 8.913   6.676   1.00 66.15  ? 30  PHE A CZ    1 
ATOM   222  N  N     . ASP A 1 49  ? 25.474 10.743  4.437   1.00 69.60  ? 31  ASP A N     1 
ATOM   223  C  CA    . ASP A 1 49  ? 24.887 11.941  3.916   1.00 71.24  ? 31  ASP A CA    1 
ATOM   224  C  C     . ASP A 1 49  ? 23.386 11.716  3.754   1.00 72.85  ? 31  ASP A C     1 
ATOM   225  O  O     . ASP A 1 49  ? 22.948 10.883  2.950   1.00 73.15  ? 31  ASP A O     1 
ATOM   226  C  CB    . ASP A 1 49  ? 25.540 12.345  2.584   1.00 72.88  ? 31  ASP A CB    1 
ATOM   227  C  CG    . ASP A 1 49  ? 24.954 13.641  2.005   1.00 75.37  ? 31  ASP A CG    1 
ATOM   228  O  OD1   . ASP A 1 49  ? 24.552 14.526  2.775   1.00 76.57  ? 31  ASP A OD1   1 
ATOM   229  O  OD2   . ASP A 1 49  ? 24.894 13.775  0.772   1.00 78.28  ? 31  ASP A OD2   1 
ATOM   230  N  N     . HIS A 1 50  ? 22.606 12.450  4.542   1.00 73.84  ? 32  HIS A N     1 
ATOM   231  C  CA    . HIS A 1 50  ? 21.150 12.420  4.447   1.00 75.55  ? 32  HIS A CA    1 
ATOM   232  C  C     . HIS A 1 50  ? 20.693 12.780  3.017   1.00 72.92  ? 32  HIS A C     1 
ATOM   233  O  O     . HIS A 1 50  ? 19.659 12.307  2.549   1.00 69.83  ? 32  HIS A O     1 
ATOM   234  C  CB    . HIS A 1 50  ? 20.538 13.370  5.493   1.00 79.30  ? 32  HIS A CB    1 
ATOM   235  C  CG    . HIS A 1 50  ? 19.043 13.427  5.464   1.00 84.64  ? 32  HIS A CG    1 
ATOM   236  N  ND1   . HIS A 1 50  ? 18.248 12.524  6.142   1.00 86.83  ? 32  HIS A ND1   1 
ATOM   237  C  CD2   . HIS A 1 50  ? 18.191 14.286  4.841   1.00 86.46  ? 32  HIS A CD2   1 
ATOM   238  C  CE1   . HIS A 1 50  ? 16.972 12.820  5.932   1.00 87.81  ? 32  HIS A CE1   1 
ATOM   239  N  NE2   . HIS A 1 50  ? 16.911 13.883  5.144   1.00 86.29  ? 32  HIS A NE2   1 
ATOM   240  N  N     . ASN A 1 51  ? 21.489 13.595  2.325   1.00 74.21  ? 33  ASN A N     1 
ATOM   241  C  CA    . ASN A 1 51  ? 21.143 14.035  0.961   1.00 75.77  ? 33  ASN A CA    1 
ATOM   242  C  C     . ASN A 1 51  ? 21.923 13.366  -0.154  1.00 74.83  ? 33  ASN A C     1 
ATOM   243  O  O     . ASN A 1 51  ? 22.097 13.935  -1.233  1.00 75.33  ? 33  ASN A O     1 
ATOM   244  C  CB    . ASN A 1 51  ? 21.193 15.544  0.863   1.00 76.39  ? 33  ASN A CB    1 
ATOM   245  C  CG    . ASN A 1 51  ? 20.135 16.181  1.696   1.00 77.94  ? 33  ASN A CG    1 
ATOM   246  O  OD1   . ASN A 1 51  ? 18.932 16.016  1.431   1.00 78.61  ? 33  ASN A OD1   1 
ATOM   247  N  ND2   . ASN A 1 51  ? 20.551 16.880  2.745   1.00 78.01  ? 33  ASN A ND2   1 
ATOM   248  N  N     . ILE A 1 52  ? 22.382 12.151  0.121   1.00 74.71  ? 34  ILE A N     1 
ATOM   249  C  CA    . ILE A 1 52  ? 23.044 11.324  -0.874  1.00 74.40  ? 34  ILE A CA    1 
ATOM   250  C  C     . ILE A 1 52  ? 22.085 11.156  -2.076  1.00 76.45  ? 34  ILE A C     1 
ATOM   251  O  O     . ILE A 1 52  ? 20.914 10.783  -1.914  1.00 77.85  ? 34  ILE A O     1 
ATOM   252  C  CB    . ILE A 1 52  ? 23.529 9.923   -0.258  1.00 72.03  ? 34  ILE A CB    1 
ATOM   253  C  CG1   . ILE A 1 52  ? 24.274 9.070   -1.293  1.00 71.95  ? 34  ILE A CG1   1 
ATOM   254  C  CG2   . ILE A 1 52  ? 22.376 9.144   0.354   1.00 69.26  ? 34  ILE A CG2   1 
ATOM   255  C  CD1   . ILE A 1 52  ? 24.947 7.812   -0.718  1.00 71.53  ? 34  ILE A CD1   1 
ATOM   256  N  N     . SER A 1 53  ? 22.571 11.480  -3.265  1.00 76.45  ? 35  SER A N     1 
ATOM   257  C  CA    . SER A 1 53  ? 21.759 11.350  -4.473  1.00 76.90  ? 35  SER A CA    1 
ATOM   258  C  C     . SER A 1 53  ? 21.703 9.874   -4.927  1.00 76.86  ? 35  SER A C     1 
ATOM   259  O  O     . SER A 1 53  ? 22.517 9.062   -4.465  1.00 75.93  ? 35  SER A O     1 
ATOM   260  C  CB    . SER A 1 53  ? 22.286 12.295  -5.580  1.00 76.37  ? 35  SER A CB    1 
ATOM   261  O  OG    . SER A 1 53  ? 23.700 12.340  -5.598  1.00 72.89  ? 35  SER A OG    1 
ATOM   262  N  N     . PRO A 1 54  ? 20.714 9.510   -5.798  1.00 77.95  ? 36  PRO A N     1 
ATOM   263  C  CA    . PRO A 1 54  ? 20.648 8.118   -6.304  1.00 78.42  ? 36  PRO A CA    1 
ATOM   264  C  C     . PRO A 1 54  ? 21.846 7.751   -7.200  1.00 79.56  ? 36  PRO A C     1 
ATOM   265  O  O     . PRO A 1 54  ? 22.536 8.639   -7.728  1.00 80.20  ? 36  PRO A O     1 
ATOM   266  C  CB    . PRO A 1 54  ? 19.344 8.097   -7.131  1.00 76.58  ? 36  PRO A CB    1 
ATOM   267  C  CG    . PRO A 1 54  ? 18.583 9.298   -6.703  1.00 75.53  ? 36  PRO A CG    1 
ATOM   268  C  CD    . PRO A 1 54  ? 19.605 10.325  -6.333  1.00 76.61  ? 36  PRO A CD    1 
ATOM   269  N  N     . THR A 1 55  ? 22.077 6.451   -7.351  1.00 79.34  ? 37  THR A N     1 
ATOM   270  C  CA    . THR A 1 55  ? 23.162 5.931   -8.137  1.00 78.50  ? 37  THR A CA    1 
ATOM   271  C  C     . THR A 1 55  ? 22.684 5.766   -9.563  1.00 80.49  ? 37  THR A C     1 
ATOM   272  O  O     . THR A 1 55  ? 21.605 5.231   -9.795  1.00 78.82  ? 37  THR A O     1 
ATOM   273  C  CB    . THR A 1 55  ? 23.602 4.549   -7.596  1.00 77.92  ? 37  THR A CB    1 
ATOM   274  O  OG1   . THR A 1 55  ? 23.712 4.610   -6.177  1.00 77.33  ? 37  THR A OG1   1 
ATOM   275  C  CG2   . THR A 1 55  ? 24.937 4.119   -8.163  1.00 79.20  ? 37  THR A CG2   1 
ATOM   276  N  N     . ILE A 1 56  ? 23.489 6.251   -10.513 1.00 83.49  ? 38  ILE A N     1 
ATOM   277  C  CA    . ILE A 1 56  ? 23.222 6.073   -11.943 1.00 86.59  ? 38  ILE A CA    1 
ATOM   278  C  C     . ILE A 1 56  ? 24.288 5.138   -12.494 1.00 87.73  ? 38  ILE A C     1 
ATOM   279  O  O     . ILE A 1 56  ? 25.468 5.498   -12.573 1.00 88.18  ? 38  ILE A O     1 
ATOM   280  C  CB    . ILE A 1 56  ? 23.264 7.418   -12.741 1.00 88.91  ? 38  ILE A CB    1 
ATOM   281  C  CG1   . ILE A 1 56  ? 22.504 8.560   -12.007 1.00 89.50  ? 38  ILE A CG1   1 
ATOM   282  C  CG2   . ILE A 1 56  ? 22.791 7.202   -14.219 1.00 88.77  ? 38  ILE A CG2   1 
ATOM   283  C  CD1   . ILE A 1 56  ? 20.970 8.326   -11.786 1.00 89.41  ? 38  ILE A CD1   1 
ATOM   284  N  N     . GLY A 1 57  ? 23.870 3.934   -12.867 1.00 88.48  ? 39  GLY A N     1 
ATOM   285  C  CA    . GLY A 1 57  ? 24.797 2.903   -13.334 1.00 89.16  ? 39  GLY A CA    1 
ATOM   286  C  C     . GLY A 1 57  ? 25.248 2.036   -12.164 1.00 89.54  ? 39  GLY A C     1 
ATOM   287  O  O     . GLY A 1 57  ? 24.471 1.211   -11.648 1.00 92.28  ? 39  GLY A O     1 
ATOM   288  N  N     . ALA A 1 58  ? 26.497 2.214   -11.742 1.00 86.10  ? 40  ALA A N     1 
ATOM   289  C  CA    . ALA A 1 58  ? 27.035 1.476   -10.606 1.00 84.07  ? 40  ALA A CA    1 
ATOM   290  C  C     . ALA A 1 58  ? 28.158 2.256   -9.955  1.00 84.17  ? 40  ALA A C     1 
ATOM   291  O  O     . ALA A 1 58  ? 28.666 3.234   -10.521 1.00 85.68  ? 40  ALA A O     1 
ATOM   292  C  CB    . ALA A 1 58  ? 27.512 0.122   -11.025 1.00 83.81  ? 40  ALA A CB    1 
ATOM   293  N  N     . SER A 1 59  ? 28.540 1.819   -8.759  1.00 81.31  ? 41  SER A N     1 
ATOM   294  C  CA    . SER A 1 59  ? 29.555 2.483   -7.969  1.00 77.32  ? 41  SER A CA    1 
ATOM   295  C  C     . SER A 1 59  ? 30.412 1.410   -7.326  1.00 74.49  ? 41  SER A C     1 
ATOM   296  O  O     . SER A 1 59  ? 29.887 0.459   -6.740  1.00 74.09  ? 41  SER A O     1 
ATOM   297  C  CB    . SER A 1 59  ? 28.883 3.357   -6.906  1.00 77.27  ? 41  SER A CB    1 
ATOM   298  O  OG    . SER A 1 59  ? 29.821 3.921   -6.013  1.00 78.12  ? 41  SER A OG    1 
ATOM   299  N  N     . PHE A 1 60  ? 31.729 1.551   -7.449  1.00 70.15  ? 42  PHE A N     1 
ATOM   300  C  CA    . PHE A 1 60  ? 32.652 0.575   -6.886  1.00 67.07  ? 42  PHE A CA    1 
ATOM   301  C  C     . PHE A 1 60  ? 33.473 1.172   -5.775  1.00 68.17  ? 42  PHE A C     1 
ATOM   302  O  O     . PHE A 1 60  ? 34.035 2.271   -5.911  1.00 66.12  ? 42  PHE A O     1 
ATOM   303  C  CB    . PHE A 1 60  ? 33.588 0.010   -7.963  1.00 65.08  ? 42  PHE A CB    1 
ATOM   304  C  CG    . PHE A 1 60  ? 34.691 -0.875  -7.421  1.00 62.80  ? 42  PHE A CG    1 
ATOM   305  C  CD1   . PHE A 1 60  ? 34.534 -2.247  -7.378  1.00 61.94  ? 42  PHE A CD1   1 
ATOM   306  C  CD2   . PHE A 1 60  ? 35.902 -0.317  -6.957  1.00 63.53  ? 42  PHE A CD2   1 
ATOM   307  C  CE1   . PHE A 1 60  ? 35.545 -3.061  -6.881  1.00 62.69  ? 42  PHE A CE1   1 
ATOM   308  C  CE2   . PHE A 1 60  ? 36.922 -1.123  -6.448  1.00 62.20  ? 42  PHE A CE2   1 
ATOM   309  C  CZ    . PHE A 1 60  ? 36.751 -2.492  -6.415  1.00 62.62  ? 42  PHE A CZ    1 
ATOM   310  N  N     . MET A 1 61  ? 33.556 0.428   -4.675  1.00 68.36  ? 43  MET A N     1 
ATOM   311  C  CA    . MET A 1 61  ? 34.374 0.809   -3.535  1.00 67.30  ? 43  MET A CA    1 
ATOM   312  C  C     . MET A 1 61  ? 35.006 -0.432  -2.975  1.00 67.90  ? 43  MET A C     1 
ATOM   313  O  O     . MET A 1 61  ? 34.536 -1.561  -3.227  1.00 70.20  ? 43  MET A O     1 
ATOM   314  C  CB    . MET A 1 61  ? 33.539 1.490   -2.471  1.00 66.96  ? 43  MET A CB    1 
ATOM   315  C  CG    . MET A 1 61  ? 32.910 2.756   -2.927  1.00 67.43  ? 43  MET A CG    1 
ATOM   316  S  SD    . MET A 1 61  ? 32.119 3.584   -1.573  1.00 68.37  ? 43  MET A SD    1 
ATOM   317  C  CE    . MET A 1 61  ? 31.551 5.069   -2.410  1.00 66.97  ? 43  MET A CE    1 
ATOM   318  N  N     . THR A 1 62  ? 36.069 -0.246  -2.217  1.00 66.87  ? 44  THR A N     1 
ATOM   319  C  CA    . THR A 1 62  ? 36.757 -1.375  -1.655  1.00 67.17  ? 44  THR A CA    1 
ATOM   320  C  C     . THR A 1 62  ? 37.270 -1.132  -0.221  1.00 66.43  ? 44  THR A C     1 
ATOM   321  O  O     . THR A 1 62  ? 37.637 -0.003  0.162   1.00 63.55  ? 44  THR A O     1 
ATOM   322  C  CB    . THR A 1 62  ? 37.896 -1.868  -2.611  1.00 69.65  ? 44  THR A CB    1 
ATOM   323  O  OG1   . THR A 1 62  ? 38.436 -3.107  -2.130  1.00 71.41  ? 44  THR A OG1   1 
ATOM   324  C  CG2   . THR A 1 62  ? 39.025 -0.804  -2.766  1.00 69.77  ? 44  THR A CG2   1 
ATOM   325  N  N     . LYS A 1 63  ? 37.266 -2.201  0.566   1.00 65.35  ? 45  LYS A N     1 
ATOM   326  C  CA    . LYS A 1 63  ? 37.774 -2.168  1.919   1.00 63.51  ? 45  LYS A CA    1 
ATOM   327  C  C     . LYS A 1 63  ? 38.388 -3.504  2.248   1.00 64.40  ? 45  LYS A C     1 
ATOM   328  O  O     . LYS A 1 63  ? 37.805 -4.569  1.953   1.00 63.68  ? 45  LYS A O     1 
ATOM   329  C  CB    . LYS A 1 63  ? 36.659 -1.826  2.911   1.00 63.84  ? 45  LYS A CB    1 
ATOM   330  C  CG    . LYS A 1 63  ? 37.085 -1.857  4.390   1.00 61.95  ? 45  LYS A CG    1 
ATOM   331  C  CD    . LYS A 1 63  ? 36.074 -1.163  5.284   1.00 61.38  ? 45  LYS A CD    1 
ATOM   332  C  CE    . LYS A 1 63  ? 36.431 -1.332  6.754   1.00 59.67  ? 45  LYS A CE    1 
ATOM   333  N  NZ    . LYS A 1 63  ? 35.590 -0.482  7.631   1.00 59.35  ? 45  LYS A NZ    1 
ATOM   334  N  N     . THR A 1 64  ? 39.570 -3.454  2.849   1.00 66.72  ? 46  THR A N     1 
ATOM   335  C  CA    . THR A 1 64  ? 40.254 -4.665  3.291   1.00 69.72  ? 46  THR A CA    1 
ATOM   336  C  C     . THR A 1 64  ? 40.071 -4.839  4.801   1.00 70.26  ? 46  THR A C     1 
ATOM   337  O  O     . THR A 1 64  ? 40.307 -3.907  5.585   1.00 69.78  ? 46  THR A O     1 
ATOM   338  C  CB    . THR A 1 64  ? 41.743 -4.662  2.888   1.00 69.98  ? 46  THR A CB    1 
ATOM   339  O  OG1   . THR A 1 64  ? 41.836 -4.484  1.473   1.00 71.28  ? 46  THR A OG1   1 
ATOM   340  C  CG2   . THR A 1 64  ? 42.406 -5.980  3.254   1.00 71.47  ? 46  THR A CG2   1 
ATOM   341  N  N     . VAL A 1 65  ? 39.634 -6.034  5.185   1.00 72.16  ? 47  VAL A N     1 
ATOM   342  C  CA    . VAL A 1 65  ? 39.328 -6.365  6.574   1.00 74.82  ? 47  VAL A CA    1 
ATOM   343  C  C     . VAL A 1 65  ? 40.007 -7.685  6.999   1.00 77.20  ? 47  VAL A C     1 
ATOM   344  O  O     . VAL A 1 65  ? 39.845 -8.719  6.320   1.00 77.71  ? 47  VAL A O     1 
ATOM   345  C  CB    . VAL A 1 65  ? 37.766 -6.411  6.803   1.00 74.39  ? 47  VAL A CB    1 
ATOM   346  C  CG1   . VAL A 1 65  ? 37.381 -7.318  7.943   1.00 74.95  ? 47  VAL A CG1   1 
ATOM   347  C  CG2   . VAL A 1 65  ? 37.229 -5.024  7.043   1.00 74.60  ? 47  VAL A CG2   1 
ATOM   348  N  N     . PRO A 1 66  ? 40.792 -7.649  8.110   1.00 79.42  ? 48  PRO A N     1 
ATOM   349  C  CA    . PRO A 1 66  ? 41.409 -8.880  8.620   1.00 80.23  ? 48  PRO A CA    1 
ATOM   350  C  C     . PRO A 1 66  ? 40.326 -9.816  9.099   1.00 81.88  ? 48  PRO A C     1 
ATOM   351  O  O     . PRO A 1 66  ? 39.418 -9.391  9.819   1.00 81.85  ? 48  PRO A O     1 
ATOM   352  C  CB    . PRO A 1 66  ? 42.257 -8.396  9.809   1.00 79.84  ? 48  PRO A CB    1 
ATOM   353  C  CG    . PRO A 1 66  ? 42.400 -6.910  9.625   1.00 80.98  ? 48  PRO A CG    1 
ATOM   354  C  CD    . PRO A 1 66  ? 41.151 -6.472  8.930   1.00 80.18  ? 48  PRO A CD    1 
ATOM   355  N  N     . CYS A 1 67  ? 40.400 -11.072 8.677   1.00 84.42  ? 49  CYS A N     1 
ATOM   356  C  CA    . CYS A 1 67  ? 39.427 -12.078 9.089   1.00 87.26  ? 49  CYS A CA    1 
ATOM   357  C  C     . CYS A 1 67  ? 40.102 -13.419 9.352   1.00 90.86  ? 49  CYS A C     1 
ATOM   358  O  O     . CYS A 1 67  ? 40.577 -14.085 8.418   1.00 92.84  ? 49  CYS A O     1 
ATOM   359  C  CB    . CYS A 1 67  ? 38.349 -12.240 8.038   1.00 86.68  ? 49  CYS A CB    1 
ATOM   360  S  SG    . CYS A 1 67  ? 37.321 -13.665 8.359   1.00 86.39  ? 49  CYS A SG    1 
ATOM   361  N  N     . GLY A 1 68  ? 40.124 -13.830 10.619  1.00 93.82  ? 50  GLY A N     1 
ATOM   362  C  CA    . GLY A 1 68  ? 40.841 -15.048 11.006  1.00 96.11  ? 50  GLY A CA    1 
ATOM   363  C  C     . GLY A 1 68  ? 42.328 -14.796 10.782  1.00 97.51  ? 50  GLY A C     1 
ATOM   364  O  O     . GLY A 1 68  ? 42.869 -13.776 11.240  1.00 96.11  ? 50  GLY A O     1 
ATOM   365  N  N     . ASN A 1 69  ? 42.984 -15.702 10.061  1.00 98.77  ? 51  ASN A N     1 
ATOM   366  C  CA    . ASN A 1 69  ? 44.398 -15.522 9.747   1.00 100.47 ? 51  ASN A CA    1 
ATOM   367  C  C     . ASN A 1 69  ? 44.607 -15.248 8.243   1.00 99.82  ? 51  ASN A C     1 
ATOM   368  O  O     . ASN A 1 69  ? 45.405 -15.921 7.579   1.00 100.93 ? 51  ASN A O     1 
ATOM   369  C  CB    . ASN A 1 69  ? 45.226 -16.724 10.244  1.00 101.93 ? 51  ASN A CB    1 
ATOM   370  C  CG    . ASN A 1 69  ? 46.683 -16.356 10.527  1.00 102.45 ? 51  ASN A CG    1 
ATOM   371  O  OD1   . ASN A 1 69  ? 47.428 -15.977 9.626   1.00 103.08 ? 51  ASN A OD1   1 
ATOM   372  N  ND2   . ASN A 1 69  ? 47.090 -16.474 11.789  1.00 102.02 ? 51  ASN A ND2   1 
ATOM   373  N  N     . GLU A 1 70  ? 43.863 -14.261 7.724   1.00 96.81  ? 52  GLU A N     1 
ATOM   374  C  CA    . GLU A 1 70  ? 43.914 -13.850 6.302   1.00 93.55  ? 52  GLU A CA    1 
ATOM   375  C  C     . GLU A 1 70  ? 43.168 -12.524 6.083   1.00 90.85  ? 52  GLU A C     1 
ATOM   376  O  O     . GLU A 1 70  ? 42.243 -12.203 6.833   1.00 90.91  ? 52  GLU A O     1 
ATOM   377  C  CB    . GLU A 1 70  ? 43.351 -14.947 5.372   1.00 92.93  ? 52  GLU A CB    1 
ATOM   378  C  CG    . GLU A 1 70  ? 41.917 -15.409 5.676   1.00 93.28  ? 52  GLU A CG    1 
ATOM   379  C  CD    . GLU A 1 70  ? 41.376 -16.409 4.640   1.00 94.38  ? 52  GLU A CD    1 
ATOM   380  O  OE1   . GLU A 1 70  ? 42.127 -16.787 3.720   1.00 95.59  ? 52  GLU A OE1   1 
ATOM   381  O  OE2   . GLU A 1 70  ? 40.195 -16.819 4.742   1.00 94.93  ? 52  GLU A OE2   1 
ATOM   382  N  N     . LEU A 1 71  ? 43.579 -11.758 5.063   1.00 87.59  ? 53  LEU A N     1 
ATOM   383  C  CA    . LEU A 1 71  ? 42.922 -10.474 4.727   1.00 84.53  ? 53  LEU A CA    1 
ATOM   384  C  C     . LEU A 1 71  ? 41.813 -10.633 3.677   1.00 83.01  ? 53  LEU A C     1 
ATOM   385  O  O     . LEU A 1 71  ? 41.970 -11.366 2.695   1.00 82.75  ? 53  LEU A O     1 
ATOM   386  C  CB    . LEU A 1 71  ? 43.935 -9.429  4.254   1.00 83.96  ? 53  LEU A CB    1 
ATOM   387  C  CG    . LEU A 1 71  ? 45.017 -8.920  5.208   1.00 84.90  ? 53  LEU A CG    1 
ATOM   388  C  CD1   . LEU A 1 71  ? 45.787 -7.780  4.554   1.00 84.30  ? 53  LEU A CD1   1 
ATOM   389  C  CD2   . LEU A 1 71  ? 44.443 -8.465  6.560   1.00 86.13  ? 53  LEU A CD2   1 
ATOM   390  N  N     . HIS A 1 72  ? 40.693 -9.946  3.902   1.00 80.89  ? 54  HIS A N     1 
ATOM   391  C  CA    . HIS A 1 72  ? 39.558 -9.974  2.984   1.00 79.18  ? 54  HIS A CA    1 
ATOM   392  C  C     . HIS A 1 72  ? 39.393 -8.616  2.324   1.00 77.67  ? 54  HIS A C     1 
ATOM   393  O  O     . HIS A 1 72  ? 38.947 -7.666  2.961   1.00 76.49  ? 54  HIS A O     1 
ATOM   394  C  CB    . HIS A 1 72  ? 38.299 -10.341 3.738   1.00 79.72  ? 54  HIS A CB    1 
ATOM   395  C  CG    . HIS A 1 72  ? 38.153 -11.802 3.993   1.00 82.27  ? 54  HIS A CG    1 
ATOM   396  N  ND1   . HIS A 1 72  ? 36.926 -12.431 4.018   1.00 83.68  ? 54  HIS A ND1   1 
ATOM   397  C  CD2   . HIS A 1 72  ? 39.076 -12.770 4.205   1.00 83.64  ? 54  HIS A CD2   1 
ATOM   398  C  CE1   . HIS A 1 72  ? 37.097 -13.720 4.255   1.00 83.91  ? 54  HIS A CE1   1 
ATOM   399  N  NE2   . HIS A 1 72  ? 38.392 -13.953 4.369   1.00 84.31  ? 54  HIS A NE2   1 
ATOM   400  N  N     . LYS A 1 73  ? 39.790 -8.512  1.057   1.00 75.77  ? 55  LYS A N     1 
ATOM   401  C  CA    . LYS A 1 73  ? 39.610 -7.265  0.324   1.00 74.33  ? 55  LYS A CA    1 
ATOM   402  C  C     . LYS A 1 73  ? 38.287 -7.341  -0.413  1.00 71.67  ? 55  LYS A C     1 
ATOM   403  O  O     . LYS A 1 73  ? 38.173 -8.037  -1.431  1.00 70.45  ? 55  LYS A O     1 
ATOM   404  C  CB    . LYS A 1 73  ? 40.760 -7.006  -0.655  1.00 75.55  ? 55  LYS A CB    1 
ATOM   405  C  CG    . LYS A 1 73  ? 40.683 -5.634  -1.359  1.00 76.35  ? 55  LYS A CG    1 
ATOM   406  C  CD    . LYS A 1 73  ? 41.827 -5.430  -2.352  1.00 76.95  ? 55  LYS A CD    1 
ATOM   407  C  CE    . LYS A 1 73  ? 42.027 -3.946  -2.659  1.00 78.83  ? 55  LYS A CE    1 
ATOM   408  N  NZ    . LYS A 1 73  ? 43.202 -3.699  -3.554  1.00 79.66  ? 55  LYS A NZ    1 
ATOM   409  N  N     . PHE A 1 74  ? 37.277 -6.648  0.114   1.00 67.72  ? 56  PHE A N     1 
ATOM   410  C  CA    . PHE A 1 74  ? 35.976 -6.638  -0.524  1.00 65.60  ? 56  PHE A CA    1 
ATOM   411  C  C     . PHE A 1 74  ? 35.977 -5.716  -1.718  1.00 65.51  ? 56  PHE A C     1 
ATOM   412  O  O     . PHE A 1 74  ? 36.374 -4.544  -1.610  1.00 66.30  ? 56  PHE A O     1 
ATOM   413  C  CB    . PHE A 1 74  ? 34.892 -6.182  0.438   1.00 63.86  ? 56  PHE A CB    1 
ATOM   414  C  CG    . PHE A 1 74  ? 34.651 -7.121  1.573   1.00 62.44  ? 56  PHE A CG    1 
ATOM   415  C  CD1   . PHE A 1 74  ? 35.229 -6.884  2.822   1.00 59.95  ? 56  PHE A CD1   1 
ATOM   416  C  CD2   . PHE A 1 74  ? 33.835 -8.241  1.405   1.00 61.46  ? 56  PHE A CD2   1 
ATOM   417  C  CE1   . PHE A 1 74  ? 35.004 -7.753  3.882   1.00 59.36  ? 56  PHE A CE1   1 
ATOM   418  C  CE2   . PHE A 1 74  ? 33.612 -9.111  2.454   1.00 60.29  ? 56  PHE A CE2   1 
ATOM   419  C  CZ    . PHE A 1 74  ? 34.196 -8.864  3.700   1.00 60.47  ? 56  PHE A CZ    1 
ATOM   420  N  N     . LEU A 1 75  ? 35.539 -6.248  -2.858  1.00 63.10  ? 57  LEU A N     1 
ATOM   421  C  CA    . LEU A 1 75  ? 35.383 -5.458  -4.067  1.00 62.30  ? 57  LEU A CA    1 
ATOM   422  C  C     . LEU A 1 75  ? 33.905 -5.227  -4.171  1.00 62.01  ? 57  LEU A C     1 
ATOM   423  O  O     . LEU A 1 75  ? 33.149 -6.100  -4.627  1.00 63.22  ? 57  LEU A O     1 
ATOM   424  C  CB    . LEU A 1 75  ? 35.911 -6.214  -5.289  1.00 60.55  ? 57  LEU A CB    1 
ATOM   425  C  CG    . LEU A 1 75  ? 37.300 -6.851  -5.139  1.00 58.69  ? 57  LEU A CG    1 
ATOM   426  C  CD1   . LEU A 1 75  ? 37.588 -7.667  -6.367  1.00 61.81  ? 57  LEU A CD1   1 
ATOM   427  C  CD2   . LEU A 1 75  ? 38.398 -5.840  -4.899  1.00 56.98  ? 57  LEU A CD2   1 
ATOM   428  N  N     . ILE A 1 76  ? 33.474 -4.057  -3.725  1.00 59.88  ? 58  ILE A N     1 
ATOM   429  C  CA    . ILE A 1 76  ? 32.044 -3.805  -3.622  1.00 59.59  ? 58  ILE A CA    1 
ATOM   430  C  C     . ILE A 1 76  ? 31.427 -3.082  -4.824  1.00 61.05  ? 58  ILE A C     1 
ATOM   431  O  O     . ILE A 1 76  ? 31.817 -1.929  -5.164  1.00 57.77  ? 58  ILE A O     1 
ATOM   432  C  CB    . ILE A 1 76  ? 31.699 -3.052  -2.319  1.00 56.98  ? 58  ILE A CB    1 
ATOM   433  C  CG1   . ILE A 1 76  ? 32.338 -3.750  -1.114  1.00 54.07  ? 58  ILE A CG1   1 
ATOM   434  C  CG2   . ILE A 1 76  ? 30.196 -2.956  -2.165  1.00 54.00  ? 58  ILE A CG2   1 
ATOM   435  C  CD1   . ILE A 1 76  ? 32.573 -2.835  0.042   1.00 54.51  ? 58  ILE A CD1   1 
ATOM   436  N  N     . TRP A 1 77  ? 30.460 -3.773  -5.452  1.00 63.26  ? 59  TRP A N     1 
ATOM   437  C  CA    . TRP A 1 77  ? 29.647 -3.205  -6.543  1.00 64.54  ? 59  TRP A CA    1 
ATOM   438  C  C     . TRP A 1 77  ? 28.262 -2.809  -6.071  1.00 64.52  ? 59  TRP A C     1 
ATOM   439  O  O     . TRP A 1 77  ? 27.379 -3.649  -5.892  1.00 63.16  ? 59  TRP A O     1 
ATOM   440  C  CB    . TRP A 1 77  ? 29.598 -4.123  -7.775  1.00 65.72  ? 59  TRP A CB    1 
ATOM   441  C  CG    . TRP A 1 77  ? 30.851 -3.988  -8.589  1.00 66.18  ? 59  TRP A CG    1 
ATOM   442  C  CD1   . TRP A 1 77  ? 31.899 -4.888  -8.670  1.00 66.41  ? 59  TRP A CD1   1 
ATOM   443  C  CD2   . TRP A 1 77  ? 31.225 -2.863  -9.391  1.00 65.68  ? 59  TRP A CD2   1 
ATOM   444  N  NE1   . TRP A 1 77  ? 32.890 -4.384  -9.485  1.00 65.89  ? 59  TRP A NE1   1 
ATOM   445  C  CE2   . TRP A 1 77  ? 32.499 -3.147  -9.946  1.00 66.53  ? 59  TRP A CE2   1 
ATOM   446  C  CE3   . TRP A 1 77  ? 30.603 -1.639  -9.706  1.00 66.28  ? 59  TRP A CE3   1 
ATOM   447  C  CZ2   . TRP A 1 77  ? 33.161 -2.248  -10.806 1.00 66.67  ? 59  TRP A CZ2   1 
ATOM   448  C  CZ3   . TRP A 1 77  ? 31.254 -0.751  -10.561 1.00 66.25  ? 59  TRP A CZ3   1 
ATOM   449  C  CH2   . TRP A 1 77  ? 32.523 -1.059  -11.102 1.00 66.33  ? 59  TRP A CH2   1 
ATOM   450  N  N     . ASP A 1 78  ? 28.113 -1.509  -5.846  1.00 67.81  ? 60  ASP A N     1 
ATOM   451  C  CA    . ASP A 1 78  ? 26.870 -0.884  -5.415  1.00 71.56  ? 60  ASP A CA    1 
ATOM   452  C  C     . ASP A 1 78  ? 26.075 -0.497  -6.656  1.00 73.94  ? 60  ASP A C     1 
ATOM   453  O  O     . ASP A 1 78  ? 26.389 0.486   -7.345  1.00 74.49  ? 60  ASP A O     1 
ATOM   454  C  CB    . ASP A 1 78  ? 27.198 0.340   -4.552  1.00 72.86  ? 60  ASP A CB    1 
ATOM   455  C  CG    . ASP A 1 78  ? 25.990 1.232   -4.281  1.00 73.65  ? 60  ASP A CG    1 
ATOM   456  O  OD1   . ASP A 1 78  ? 24.845 0.729   -4.199  1.00 74.94  ? 60  ASP A OD1   1 
ATOM   457  O  OD2   . ASP A 1 78  ? 26.207 2.452   -4.130  1.00 73.36  ? 60  ASP A OD2   1 
ATOM   458  N  N     . THR A 1 79  ? 25.055 -1.289  -6.948  1.00 77.44  ? 61  THR A N     1 
ATOM   459  C  CA    . THR A 1 79  ? 24.234 -1.085  -8.148  1.00 80.97  ? 61  THR A CA    1 
ATOM   460  C  C     . THR A 1 79  ? 23.102 -0.094  -7.911  1.00 83.53  ? 61  THR A C     1 
ATOM   461  O  O     . THR A 1 79  ? 22.598 0.036   -6.779  1.00 83.81  ? 61  THR A O     1 
ATOM   462  C  CB    . THR A 1 79  ? 23.646 -2.411  -8.653  1.00 80.34  ? 61  THR A CB    1 
ATOM   463  O  OG1   . THR A 1 79  ? 23.138 -3.160  -7.536  1.00 79.93  ? 61  THR A OG1   1 
ATOM   464  C  CG2   . THR A 1 79  ? 24.717 -3.233  -9.366  1.00 80.69  ? 61  THR A CG2   1 
ATOM   465  N  N     . ALA A 1 80  ? 22.716 0.612   -8.978  1.00 85.38  ? 62  ALA A N     1 
ATOM   466  C  CA    . ALA A 1 80  ? 21.595 1.547   -8.930  1.00 86.31  ? 62  ALA A CA    1 
ATOM   467  C  C     . ALA A 1 80  ? 20.311 0.736   -8.789  1.00 86.94  ? 62  ALA A C     1 
ATOM   468  O  O     . ALA A 1 80  ? 20.086 -0.216  -9.548  1.00 87.06  ? 62  ALA A O     1 
ATOM   469  C  CB    . ALA A 1 80  ? 21.565 2.389   -10.174 1.00 85.84  ? 62  ALA A CB    1 
ATOM   470  N  N     . GLY A 1 81  ? 19.486 1.099   -7.806  1.00 88.11  ? 63  GLY A N     1 
ATOM   471  C  CA    . GLY A 1 81  ? 18.252 0.360   -7.514  1.00 90.45  ? 63  GLY A CA    1 
ATOM   472  C  C     . GLY A 1 81  ? 17.087 0.638   -8.446  1.00 92.69  ? 63  GLY A C     1 
ATOM   473  O  O     . GLY A 1 81  ? 16.209 -0.214  -8.604  1.00 93.16  ? 63  GLY A O     1 
ATOM   474  N  N     . GLN A 1 82  ? 17.081 1.831   -9.061  1.00 94.59  ? 64  GLN A N     1 
ATOM   475  C  CA    . GLN A 1 82  ? 15.996 2.267   -9.974  1.00 96.31  ? 64  GLN A CA    1 
ATOM   476  C  C     . GLN A 1 82  ? 15.682 1.280   -11.113 1.00 98.65  ? 64  GLN A C     1 
ATOM   477  O  O     . GLN A 1 82  ? 16.593 0.669   -11.682 1.00 98.55  ? 64  GLN A O     1 
ATOM   478  C  CB    . GLN A 1 82  ? 16.231 3.710   -10.471 1.00 95.36  ? 64  GLN A CB    1 
ATOM   479  C  CG    . GLN A 1 82  ? 15.688 4.777   -9.475  1.00 95.83  ? 64  GLN A CG    1 
ATOM   480  C  CD    . GLN A 1 82  ? 16.209 6.194   -9.716  1.00 95.68  ? 64  GLN A CD    1 
ATOM   481  O  OE1   . GLN A 1 82  ? 17.397 6.481   -9.532  1.00 94.98  ? 64  GLN A OE1   1 
ATOM   482  N  NE2   . GLN A 1 82  ? 15.307 7.092   -10.088 1.00 95.32  ? 64  GLN A NE2   1 
ATOM   483  N  N     . GLU A 1 83  ? 14.375 1.141   -11.404 1.00 101.52 ? 65  GLU A N     1 
ATOM   484  C  CA    . GLU A 1 83  ? 13.804 0.172   -12.390 1.00 103.30 ? 65  GLU A CA    1 
ATOM   485  C  C     . GLU A 1 83  ? 14.562 0.008   -13.733 1.00 104.80 ? 65  GLU A C     1 
ATOM   486  O  O     . GLU A 1 83  ? 14.758 -1.125  -14.194 1.00 106.48 ? 65  GLU A O     1 
ATOM   487  C  CB    . GLU A 1 83  ? 12.304 0.471   -12.637 1.00 103.17 ? 65  GLU A CB    1 
ATOM   488  C  CG    . GLU A 1 83  ? 11.542 -0.601  -13.434 1.00 102.84 ? 65  GLU A CG    1 
ATOM   489  N  N     . ARG A 1 84  ? 14.979 1.132   -14.341 1.00 104.76 ? 66  ARG A N     1 
ATOM   490  C  CA    . ARG A 1 84  ? 15.717 1.134   -15.637 1.00 104.15 ? 66  ARG A CA    1 
ATOM   491  C  C     . ARG A 1 84  ? 17.085 0.410   -15.604 1.00 105.81 ? 66  ARG A C     1 
ATOM   492  O  O     . ARG A 1 84  ? 17.647 0.084   -16.657 1.00 107.29 ? 66  ARG A O     1 
ATOM   493  C  CB    . ARG A 1 84  ? 15.877 2.574   -16.175 1.00 102.53 ? 66  ARG A CB    1 
ATOM   494  C  CG    . ARG A 1 84  ? 16.459 3.559   -15.176 1.00 102.37 ? 66  ARG A CG    1 
ATOM   495  C  CD    . ARG A 1 84  ? 16.261 5.006   -15.604 1.00 103.01 ? 66  ARG A CD    1 
ATOM   496  N  NE    . ARG A 1 84  ? 16.106 5.901   -14.438 1.00 104.29 ? 66  ARG A NE    1 
ATOM   497  C  CZ    . ARG A 1 84  ? 17.052 6.709   -13.938 1.00 104.32 ? 66  ARG A CZ    1 
ATOM   498  N  NH1   . ARG A 1 84  ? 18.257 6.783   -14.495 1.00 104.14 ? 66  ARG A NH1   1 
ATOM   499  N  NH2   . ARG A 1 84  ? 16.780 7.462   -12.876 1.00 103.73 ? 66  ARG A NH2   1 
ATOM   500  N  N     . PHE A 1 85  ? 17.593 0.150   -14.398 1.00 107.18 ? 67  PHE A N     1 
ATOM   501  C  CA    . PHE A 1 85  ? 18.914 -0.471  -14.209 1.00 107.80 ? 67  PHE A CA    1 
ATOM   502  C  C     . PHE A 1 85  ? 18.896 -1.983  -13.949 1.00 108.55 ? 67  PHE A C     1 
ATOM   503  O  O     . PHE A 1 85  ? 19.950 -2.617  -13.991 1.00 108.60 ? 67  PHE A O     1 
ATOM   504  C  CB    . PHE A 1 85  ? 19.695 0.244   -13.086 1.00 107.66 ? 67  PHE A CB    1 
ATOM   505  C  CG    . PHE A 1 85  ? 19.880 1.721   -13.317 1.00 107.30 ? 67  PHE A CG    1 
ATOM   506  C  CD1   . PHE A 1 85  ? 19.085 2.653   -12.636 1.00 106.65 ? 67  PHE A CD1   1 
ATOM   507  C  CD2   . PHE A 1 85  ? 20.848 2.188   -14.224 1.00 107.09 ? 67  PHE A CD2   1 
ATOM   508  C  CE1   . PHE A 1 85  ? 19.253 4.037   -12.847 1.00 106.57 ? 67  PHE A CE1   1 
ATOM   509  C  CE2   . PHE A 1 85  ? 21.022 3.572   -14.449 1.00 106.76 ? 67  PHE A CE2   1 
ATOM   510  C  CZ    . PHE A 1 85  ? 20.228 4.495   -13.758 1.00 106.81 ? 67  PHE A CZ    1 
ATOM   511  N  N     . HIS A 1 86  ? 17.718 -2.559  -13.679 1.00 110.57 ? 68  HIS A N     1 
ATOM   512  C  CA    . HIS A 1 86  ? 17.610 -4.015  -13.449 1.00 113.83 ? 68  HIS A CA    1 
ATOM   513  C  C     . HIS A 1 86  ? 18.228 -4.789  -14.612 1.00 115.13 ? 68  HIS A C     1 
ATOM   514  O  O     . HIS A 1 86  ? 18.840 -5.848  -14.418 1.00 115.81 ? 68  HIS A O     1 
ATOM   515  C  CB    . HIS A 1 86  ? 16.152 -4.467  -13.249 1.00 115.39 ? 68  HIS A CB    1 
ATOM   516  C  CG    . HIS A 1 86  ? 15.415 -3.718  -12.178 1.00 117.55 ? 68  HIS A CG    1 
ATOM   517  N  ND1   . HIS A 1 86  ? 16.025 -3.255  -11.029 1.00 118.08 ? 68  HIS A ND1   1 
ATOM   518  C  CD2   . HIS A 1 86  ? 14.104 -3.396  -12.060 1.00 117.91 ? 68  HIS A CD2   1 
ATOM   519  C  CE1   . HIS A 1 86  ? 15.128 -2.654  -10.266 1.00 117.66 ? 68  HIS A CE1   1 
ATOM   520  N  NE2   . HIS A 1 86  ? 13.955 -2.729  -10.867 1.00 118.22 ? 68  HIS A NE2   1 
ATOM   521  N  N     . SER A 1 87  ? 18.065 -4.232  -15.819 1.00 116.53 ? 69  SER A N     1 
ATOM   522  C  CA    . SER A 1 87  ? 18.590 -4.801  -17.070 1.00 116.51 ? 69  SER A CA    1 
ATOM   523  C  C     . SER A 1 87  ? 20.134 -4.841  -17.126 1.00 117.08 ? 69  SER A C     1 
ATOM   524  O  O     . SER A 1 87  ? 20.709 -5.407  -18.064 1.00 117.63 ? 69  SER A O     1 
ATOM   525  C  CB    . SER A 1 87  ? 18.037 -4.017  -18.277 1.00 115.93 ? 69  SER A CB    1 
ATOM   526  O  OG    . SER A 1 87  ? 18.447 -2.650  -18.247 1.00 115.02 ? 69  SER A OG    1 
ATOM   527  N  N     . LEU A 1 88  ? 20.789 -4.240  -16.124 1.00 116.70 ? 70  LEU A N     1 
ATOM   528  C  CA    . LEU A 1 88  ? 22.263 -4.190  -16.050 1.00 115.43 ? 70  LEU A CA    1 
ATOM   529  C  C     . LEU A 1 88  ? 22.816 -5.022  -14.872 1.00 114.07 ? 70  LEU A C     1 
ATOM   530  O  O     . LEU A 1 88  ? 24.030 -5.222  -14.759 1.00 113.58 ? 70  LEU A O     1 
ATOM   531  C  CB    . LEU A 1 88  ? 22.756 -2.728  -15.941 1.00 115.04 ? 70  LEU A CB    1 
ATOM   532  C  CG    . LEU A 1 88  ? 22.211 -1.630  -16.877 1.00 115.47 ? 70  LEU A CG    1 
ATOM   533  C  CD1   . LEU A 1 88  ? 22.761 -0.264  -16.458 1.00 115.61 ? 70  LEU A CD1   1 
ATOM   534  C  CD2   . LEU A 1 88  ? 22.487 -1.901  -18.370 1.00 114.99 ? 70  LEU A CD2   1 
ATOM   535  N  N     . ALA A 1 89  ? 21.909 -5.510  -14.020 1.00 112.65 ? 71  ALA A N     1 
ATOM   536  C  CA    . ALA A 1 89  ? 22.261 -6.247  -12.791 1.00 111.15 ? 71  ALA A CA    1 
ATOM   537  C  C     . ALA A 1 89  ? 23.088 -7.558  -12.940 1.00 110.17 ? 71  ALA A C     1 
ATOM   538  O  O     . ALA A 1 89  ? 24.062 -7.746  -12.197 1.00 110.42 ? 71  ALA A O     1 
ATOM   539  C  CB    . ALA A 1 89  ? 21.005 -6.485  -11.926 1.00 111.07 ? 71  ALA A CB    1 
ATOM   540  N  N     . PRO A 1 90  ? 22.710 -8.468  -13.885 1.00 108.36 ? 72  PRO A N     1 
ATOM   541  C  CA    . PRO A 1 90  ? 23.480 -9.736  -13.972 1.00 106.61 ? 72  PRO A CA    1 
ATOM   542  C  C     . PRO A 1 90  ? 24.985 -9.549  -14.217 1.00 104.54 ? 72  PRO A C     1 
ATOM   543  O  O     . PRO A 1 90  ? 25.795 -10.397 -13.807 1.00 105.65 ? 72  PRO A O     1 
ATOM   544  C  CB    . PRO A 1 90  ? 22.810 -10.492 -15.131 1.00 107.50 ? 72  PRO A CB    1 
ATOM   545  C  CG    . PRO A 1 90  ? 22.018 -9.463  -15.871 1.00 108.95 ? 72  PRO A CG    1 
ATOM   546  C  CD    . PRO A 1 90  ? 21.616 -8.425  -14.875 1.00 108.40 ? 72  PRO A CD    1 
ATOM   547  N  N     . MET A 1 91  ? 25.343 -8.441  -14.861 1.00 100.61 ? 73  MET A N     1 
ATOM   548  C  CA    . MET A 1 91  ? 26.740 -8.087  -15.119 1.00 97.52  ? 73  MET A CA    1 
ATOM   549  C  C     . MET A 1 91  ? 27.578 -8.003  -13.838 1.00 95.47  ? 73  MET A C     1 
ATOM   550  O  O     . MET A 1 91  ? 28.752 -8.392  -13.827 1.00 94.88  ? 73  MET A O     1 
ATOM   551  C  CB    . MET A 1 91  ? 26.809 -6.756  -15.889 1.00 96.86  ? 73  MET A CB    1 
ATOM   552  C  CG    . MET A 1 91  ? 28.165 -6.069  -15.849 1.00 95.64  ? 73  MET A CG    1 
ATOM   553  S  SD    . MET A 1 91  ? 28.327 -4.622  -16.915 1.00 96.92  ? 73  MET A SD    1 
ATOM   554  C  CE    . MET A 1 91  ? 26.915 -3.619  -16.461 1.00 96.73  ? 73  MET A CE    1 
ATOM   555  N  N     . TYR A 1 92  ? 26.967 -7.500  -12.767 1.00 93.40  ? 74  TYR A N     1 
ATOM   556  C  CA    . TYR A 1 92  ? 27.672 -7.291  -11.508 1.00 90.43  ? 74  TYR A CA    1 
ATOM   557  C  C     . TYR A 1 92  ? 27.589 -8.460  -10.557 1.00 90.20  ? 74  TYR A C     1 
ATOM   558  O  O     . TYR A 1 92  ? 28.543 -8.730  -9.840  1.00 89.75  ? 74  TYR A O     1 
ATOM   559  C  CB    . TYR A 1 92  ? 27.185 -6.012  -10.819 1.00 87.34  ? 74  TYR A CB    1 
ATOM   560  C  CG    . TYR A 1 92  ? 27.404 -4.756  -11.630 1.00 86.19  ? 74  TYR A CG    1 
ATOM   561  C  CD1   . TYR A 1 92  ? 26.357 -4.180  -12.341 1.00 86.51  ? 74  TYR A CD1   1 
ATOM   562  C  CD2   . TYR A 1 92  ? 28.670 -4.143  -11.696 1.00 85.25  ? 74  TYR A CD2   1 
ATOM   563  C  CE1   . TYR A 1 92  ? 26.545 -3.012  -13.098 1.00 86.45  ? 74  TYR A CE1   1 
ATOM   564  C  CE2   . TYR A 1 92  ? 28.874 -2.980  -12.454 1.00 85.47  ? 74  TYR A CE2   1 
ATOM   565  C  CZ    . TYR A 1 92  ? 27.803 -2.421  -13.157 1.00 86.37  ? 74  TYR A CZ    1 
ATOM   566  O  OH    . TYR A 1 92  ? 27.976 -1.268  -13.912 1.00 85.85  ? 74  TYR A OH    1 
ATOM   567  N  N     . TYR A 1 93  ? 26.460 -9.163  -10.544 1.00 92.97  ? 75  TYR A N     1 
ATOM   568  C  CA    . TYR A 1 93  ? 26.312 -10.282 -9.603  1.00 96.04  ? 75  TYR A CA    1 
ATOM   569  C  C     . TYR A 1 93  ? 26.904 -11.594 -10.060 1.00 97.26  ? 75  TYR A C     1 
ATOM   570  O  O     . TYR A 1 93  ? 27.167 -12.470 -9.239  1.00 98.67  ? 75  TYR A O     1 
ATOM   571  C  CB    . TYR A 1 93  ? 24.870 -10.452 -9.062  1.00 97.38  ? 75  TYR A CB    1 
ATOM   572  C  CG    . TYR A 1 93  ? 23.770 -10.837 -10.035 1.00 97.97  ? 75  TYR A CG    1 
ATOM   573  C  CD1   . TYR A 1 93  ? 23.806 -12.056 -10.730 1.00 98.08  ? 75  TYR A CD1   1 
ATOM   574  C  CD2   . TYR A 1 93  ? 22.638 -10.015 -10.190 1.00 97.69  ? 75  TYR A CD2   1 
ATOM   575  C  CE1   . TYR A 1 93  ? 22.771 -12.423 -11.600 1.00 98.61  ? 75  TYR A CE1   1 
ATOM   576  C  CE2   . TYR A 1 93  ? 21.596 -10.369 -11.049 1.00 98.11  ? 75  TYR A CE2   1 
ATOM   577  C  CZ    . TYR A 1 93  ? 21.667 -11.576 -11.753 1.00 98.43  ? 75  TYR A CZ    1 
ATOM   578  O  OH    . TYR A 1 93  ? 20.652 -11.931 -12.605 1.00 97.92  ? 75  TYR A OH    1 
ATOM   579  N  N     . ARG A 1 94  ? 27.114 -11.753 -11.357 1.00 98.94  ? 76  ARG A N     1 
ATOM   580  C  CA    . ARG A 1 94  ? 27.763 -12.955 -11.815 1.00 99.74  ? 76  ARG A CA    1 
ATOM   581  C  C     . ARG A 1 94  ? 29.260 -12.804 -11.489 1.00 99.17  ? 76  ARG A C     1 
ATOM   582  O  O     . ARG A 1 94  ? 29.849 -11.724 -11.666 1.00 98.94  ? 76  ARG A O     1 
ATOM   583  C  CB    . ARG A 1 94  ? 27.491 -13.212 -13.294 1.00 102.18 ? 76  ARG A CB    1 
ATOM   584  C  CG    . ARG A 1 94  ? 27.444 -14.701 -13.625 1.00 105.55 ? 76  ARG A CG    1 
ATOM   585  C  CD    . ARG A 1 94  ? 26.538 -14.987 -14.814 1.00 107.77 ? 76  ARG A CD    1 
ATOM   586  N  NE    . ARG A 1 94  ? 25.959 -16.338 -14.732 1.00 109.12 ? 76  ARG A NE    1 
ATOM   587  C  CZ    . ARG A 1 94  ? 25.070 -16.847 -15.595 1.00 108.93 ? 76  ARG A CZ    1 
ATOM   588  N  NH1   . ARG A 1 94  ? 24.639 -16.132 -16.636 1.00 108.31 ? 76  ARG A NH1   1 
ATOM   589  N  NH2   . ARG A 1 94  ? 24.611 -18.080 -15.416 1.00 108.08 ? 76  ARG A NH2   1 
ATOM   590  N  N     . GLY A 1 95  ? 29.856 -13.868 -10.965 1.00 97.98  ? 77  GLY A N     1 
ATOM   591  C  CA    . GLY A 1 95  ? 31.253 -13.819 -10.548 1.00 95.43  ? 77  GLY A CA    1 
ATOM   592  C  C     . GLY A 1 95  ? 31.420 -13.243 -9.149  1.00 93.83  ? 77  GLY A C     1 
ATOM   593  O  O     . GLY A 1 95  ? 32.544 -12.987 -8.711  1.00 93.50  ? 77  GLY A O     1 
ATOM   594  N  N     . SER A 1 96  ? 30.296 -13.048 -8.447  1.00 91.27  ? 78  SER A N     1 
ATOM   595  C  CA    . SER A 1 96  ? 30.296 -12.512 -7.080  1.00 87.92  ? 78  SER A CA    1 
ATOM   596  C  C     . SER A 1 96  ? 30.381 -13.604 -6.017  1.00 85.57  ? 78  SER A C     1 
ATOM   597  O  O     . SER A 1 96  ? 29.642 -14.601 -6.057  1.00 85.84  ? 78  SER A O     1 
ATOM   598  C  CB    . SER A 1 96  ? 29.057 -11.628 -6.826  1.00 87.58  ? 78  SER A CB    1 
ATOM   599  O  OG    . SER A 1 96  ? 29.183 -10.350 -7.442  1.00 87.24  ? 78  SER A OG    1 
ATOM   600  N  N     . ALA A 1 97  ? 31.286 -13.404 -5.064  1.00 82.21  ? 79  ALA A N     1 
ATOM   601  C  CA    . ALA A 1 97  ? 31.457 -14.330 -3.956  1.00 80.19  ? 79  ALA A CA    1 
ATOM   602  C  C     . ALA A 1 97  ? 30.270 -14.205 -3.052  1.00 79.81  ? 79  ALA A C     1 
ATOM   603  O  O     . ALA A 1 97  ? 29.828 -15.190 -2.435  1.00 82.09  ? 79  ALA A O     1 
ATOM   604  C  CB    . ALA A 1 97  ? 32.726 -14.014 -3.191  1.00 78.69  ? 79  ALA A CB    1 
ATOM   605  N  N     . ALA A 1 98  ? 29.747 -12.982 -2.965  1.00 77.00  ? 80  ALA A N     1 
ATOM   606  C  CA    . ALA A 1 98  ? 28.608 -12.709 -2.116  1.00 73.48  ? 80  ALA A CA    1 
ATOM   607  C  C     . ALA A 1 98  ? 27.714 -11.621 -2.689  1.00 71.51  ? 80  ALA A C     1 
ATOM   608  O  O     . ALA A 1 98  ? 28.120 -10.849 -3.580  1.00 69.21  ? 80  ALA A O     1 
ATOM   609  C  CB    . ALA A 1 98  ? 29.073 -12.351 -0.707  1.00 71.41  ? 80  ALA A CB    1 
ATOM   610  N  N     . ALA A 1 99  ? 26.486 -11.585 -2.181  1.00 70.60  ? 81  ALA A N     1 
ATOM   611  C  CA    . ALA A 1 99  ? 25.499 -10.579 -2.559  1.00 71.90  ? 81  ALA A CA    1 
ATOM   612  C  C     . ALA A 1 99  ? 24.782 -10.070 -1.316  1.00 72.16  ? 81  ALA A C     1 
ATOM   613  O  O     . ALA A 1 99  ? 24.233 -10.861 -0.537  1.00 72.35  ? 81  ALA A O     1 
ATOM   614  C  CB    . ALA A 1 99  ? 24.498 -11.155 -3.534  1.00 70.74  ? 81  ALA A CB    1 
ATOM   615  N  N     . VAL A 1 100 ? 24.813 -8.756  -1.112  1.00 71.72  ? 82  VAL A N     1 
ATOM   616  C  CA    . VAL A 1 100 ? 24.082 -8.145  -0.003  1.00 68.86  ? 82  VAL A CA    1 
ATOM   617  C  C     . VAL A 1 100 ? 22.759 -7.644  -0.558  1.00 69.48  ? 82  VAL A C     1 
ATOM   618  O  O     . VAL A 1 100 ? 22.723 -6.808  -1.499  1.00 70.24  ? 82  VAL A O     1 
ATOM   619  C  CB    . VAL A 1 100 ? 24.861 -7.001  0.648   1.00 67.10  ? 82  VAL A CB    1 
ATOM   620  C  CG1   . VAL A 1 100 ? 24.033 -6.337  1.735   1.00 64.64  ? 82  VAL A CG1   1 
ATOM   621  C  CG2   . VAL A 1 100 ? 26.176 -7.522  1.216   1.00 66.40  ? 82  VAL A CG2   1 
ATOM   622  N  N     . ILE A 1 101 ? 21.674 -8.182  -0.017  1.00 66.14  ? 83  ILE A N     1 
ATOM   623  C  CA    . ILE A 1 101 ? 20.349 -7.790  -0.455  1.00 65.55  ? 83  ILE A CA    1 
ATOM   624  C  C     . ILE A 1 101 ? 19.725 -6.988  0.672   1.00 64.55  ? 83  ILE A C     1 
ATOM   625  O  O     . ILE A 1 101 ? 19.588 -7.474  1.807   1.00 63.95  ? 83  ILE A O     1 
ATOM   626  C  CB    . ILE A 1 101 ? 19.491 -8.991  -0.853  1.00 66.23  ? 83  ILE A CB    1 
ATOM   627  C  CG1   . ILE A 1 101 ? 20.362 -10.050 -1.551  1.00 66.40  ? 83  ILE A CG1   1 
ATOM   628  C  CG2   . ILE A 1 101 ? 18.359 -8.532  -1.771  1.00 67.26  ? 83  ILE A CG2   1 
ATOM   629  C  CD1   . ILE A 1 101 ? 19.858 -11.434 -1.414  1.00 66.24  ? 83  ILE A CD1   1 
ATOM   630  N  N     . VAL A 1 102 ? 19.359 -5.749  0.347   1.00 62.43  ? 84  VAL A N     1 
ATOM   631  C  CA    . VAL A 1 102 ? 18.939 -4.783  1.338   1.00 58.97  ? 84  VAL A CA    1 
ATOM   632  C  C     . VAL A 1 102 ? 17.485 -4.425  1.196   1.00 58.54  ? 84  VAL A C     1 
ATOM   633  O  O     . VAL A 1 102 ? 17.008 -4.168  0.094   1.00 60.00  ? 84  VAL A O     1 
ATOM   634  C  CB    . VAL A 1 102 ? 19.764 -3.463  1.195   1.00 57.62  ? 84  VAL A CB    1 
ATOM   635  C  CG1   . VAL A 1 102 ? 19.494 -2.551  2.332   1.00 57.28  ? 84  VAL A CG1   1 
ATOM   636  C  CG2   . VAL A 1 102 ? 21.269 -3.747  1.086   1.00 55.72  ? 84  VAL A CG2   1 
ATOM   637  N  N     . TYR A 1 103 ? 16.774 -4.409  2.316   1.00 57.27  ? 85  TYR A N     1 
ATOM   638  C  CA    . TYR A 1 103 ? 15.429 -3.853  2.339   1.00 55.70  ? 85  TYR A CA    1 
ATOM   639  C  C     . TYR A 1 103 ? 15.420 -2.669  3.333   1.00 56.16  ? 85  TYR A C     1 
ATOM   640  O  O     . TYR A 1 103 ? 16.438 -2.380  3.977   1.00 55.02  ? 85  TYR A O     1 
ATOM   641  C  CB    . TYR A 1 103 ? 14.356 -4.922  2.646   1.00 53.91  ? 85  TYR A CB    1 
ATOM   642  C  CG    . TYR A 1 103 ? 14.441 -5.523  4.022   1.00 53.80  ? 85  TYR A CG    1 
ATOM   643  C  CD1   . TYR A 1 103 ? 13.541 -5.142  5.025   1.00 53.41  ? 85  TYR A CD1   1 
ATOM   644  C  CD2   . TYR A 1 103 ? 15.437 -6.459  4.344   1.00 53.85  ? 85  TYR A CD2   1 
ATOM   645  C  CE1   . TYR A 1 103 ? 13.622 -5.682  6.316   1.00 52.38  ? 85  TYR A CE1   1 
ATOM   646  C  CE2   . TYR A 1 103 ? 15.523 -7.013  5.647   1.00 53.21  ? 85  TYR A CE2   1 
ATOM   647  C  CZ    . TYR A 1 103 ? 14.606 -6.613  6.618   1.00 52.48  ? 85  TYR A CZ    1 
ATOM   648  O  OH    . TYR A 1 103 ? 14.683 -7.130  7.886   1.00 52.75  ? 85  TYR A OH    1 
ATOM   649  N  N     . ASP A 1 104 ? 14.287 -1.976  3.409   1.00 57.21  ? 86  ASP A N     1 
ATOM   650  C  CA    . ASP A 1 104 ? 14.089 -0.841  4.295   1.00 56.00  ? 86  ASP A CA    1 
ATOM   651  C  C     . ASP A 1 104 ? 13.041 -1.316  5.286   1.00 56.72  ? 86  ASP A C     1 
ATOM   652  O  O     . ASP A 1 104 ? 11.889 -1.555  4.897   1.00 58.74  ? 86  ASP A O     1 
ATOM   653  C  CB    . ASP A 1 104 ? 13.595 0.346   3.447   1.00 57.33  ? 86  ASP A CB    1 
ATOM   654  C  CG    . ASP A 1 104 ? 13.110 1.559   4.279   1.00 59.11  ? 86  ASP A CG    1 
ATOM   655  O  OD1   . ASP A 1 104 ? 12.984 1.467   5.517   1.00 61.08  ? 86  ASP A OD1   1 
ATOM   656  O  OD2   . ASP A 1 104 ? 12.831 2.621   3.660   1.00 59.12  ? 86  ASP A OD2   1 
ATOM   657  N  N     . ILE A 1 105 ? 13.426 -1.457  6.562   1.00 55.30  ? 87  ILE A N     1 
ATOM   658  C  CA    . ILE A 1 105 ? 12.511 -1.995  7.620   1.00 55.06  ? 87  ILE A CA    1 
ATOM   659  C  C     . ILE A 1 105 ? 11.226 -1.215  7.781   1.00 57.76  ? 87  ILE A C     1 
ATOM   660  O  O     . ILE A 1 105 ? 10.316 -1.655  8.494   1.00 59.54  ? 87  ILE A O     1 
ATOM   661  C  CB    . ILE A 1 105 ? 13.177 -2.088  9.048   1.00 54.18  ? 87  ILE A CB    1 
ATOM   662  C  CG1   . ILE A 1 105 ? 13.327 -0.704  9.693   1.00 54.60  ? 87  ILE A CG1   1 
ATOM   663  C  CG2   . ILE A 1 105 ? 14.523 -2.831  8.996   1.00 54.94  ? 87  ILE A CG2   1 
ATOM   664  C  CD1   . ILE A 1 105 ? 13.330 -0.719  11.255  1.00 55.26  ? 87  ILE A CD1   1 
ATOM   665  N  N     . THR A 1 106 ? 11.150 -0.054  7.130   1.00 58.92  ? 88  THR A N     1 
ATOM   666  C  CA    . THR A 1 106 ? 10.026 0.851   7.317   1.00 59.28  ? 88  THR A CA    1 
ATOM   667  C  C     . THR A 1 106 ? 9.009  0.762   6.200   1.00 59.78  ? 88  THR A C     1 
ATOM   668  O  O     . THR A 1 106 ? 7.944  1.345   6.296   1.00 60.76  ? 88  THR A O     1 
ATOM   669  C  CB    . THR A 1 106 ? 10.500 2.346   7.525   1.00 58.57  ? 88  THR A CB    1 
ATOM   670  O  OG1   . THR A 1 106 ? 10.909 2.911   6.283   1.00 56.81  ? 88  THR A OG1   1 
ATOM   671  C  CG2   . THR A 1 106 ? 11.655 2.417   8.515   1.00 56.80  ? 88  THR A CG2   1 
ATOM   672  N  N     . LYS A 1 107 ? 9.351  0.024   5.146   1.00 63.78  ? 89  LYS A N     1 
ATOM   673  C  CA    . LYS A 1 107 ? 8.474  -0.178  3.969   1.00 65.71  ? 89  LYS A CA    1 
ATOM   674  C  C     . LYS A 1 107 ? 8.434  -1.657  3.615   1.00 68.05  ? 89  LYS A C     1 
ATOM   675  O  O     . LYS A 1 107 ? 9.411  -2.197  3.087   1.00 66.71  ? 89  LYS A O     1 
ATOM   676  C  CB    . LYS A 1 107 ? 8.992  0.615   2.772   1.00 65.68  ? 89  LYS A CB    1 
ATOM   677  C  CG    . LYS A 1 107 ? 9.162  2.074   3.056   1.00 66.82  ? 89  LYS A CG    1 
ATOM   678  C  CD    . LYS A 1 107 ? 9.857  2.811   1.934   1.00 67.16  ? 89  LYS A CD    1 
ATOM   679  C  CE    . LYS A 1 107 ? 10.134 4.263   2.345   1.00 68.10  ? 89  LYS A CE    1 
ATOM   680  N  NZ    . LYS A 1 107 ? 8.895  5.018   2.718   1.00 66.94  ? 89  LYS A NZ    1 
ATOM   681  N  N     . GLN A 1 108 ? 7.304  -2.309  3.905   1.00 72.18  ? 90  GLN A N     1 
ATOM   682  C  CA    . GLN A 1 108 ? 7.151  -3.755  3.659   1.00 75.97  ? 90  GLN A CA    1 
ATOM   683  C  C     . GLN A 1 108 ? 7.326  -4.149  2.183   1.00 73.57  ? 90  GLN A C     1 
ATOM   684  O  O     . GLN A 1 108 ? 7.860  -5.214  1.903   1.00 70.08  ? 90  GLN A O     1 
ATOM   685  C  CB    . GLN A 1 108 ? 5.840  -4.307  4.265   1.00 78.49  ? 90  GLN A CB    1 
ATOM   686  C  CG    . GLN A 1 108 ? 4.549  -3.550  3.857   1.00 81.71  ? 90  GLN A CG    1 
ATOM   687  C  CD    . GLN A 1 108 ? 3.288  -4.010  4.643   1.00 82.00  ? 90  GLN A CD    1 
ATOM   688  O  OE1   . GLN A 1 108 ? 3.301  -5.035  5.345   1.00 84.06  ? 90  GLN A OE1   1 
ATOM   689  N  NE2   . GLN A 1 108 ? 2.200  -3.238  4.519   1.00 83.84  ? 90  GLN A NE2   1 
ATOM   690  N  N     . ASP A 1 109 ? 6.892  -3.276  1.256   1.00 74.39  ? 91  ASP A N     1 
ATOM   691  C  CA    . ASP A 1 109 ? 7.142  -3.474  -0.198  1.00 76.57  ? 91  ASP A CA    1 
ATOM   692  C  C     . ASP A 1 109 ? 8.595  -3.834  -0.482  1.00 76.57  ? 91  ASP A C     1 
ATOM   693  O  O     . ASP A 1 109 ? 8.863  -4.751  -1.270  1.00 78.14  ? 91  ASP A O     1 
ATOM   694  C  CB    . ASP A 1 109 ? 6.837  -2.208  -1.004  1.00 79.13  ? 91  ASP A CB    1 
ATOM   695  C  CG    . ASP A 1 109 ? 5.361  -1.896  -1.091  1.00 82.99  ? 91  ASP A CG    1 
ATOM   696  O  OD1   . ASP A 1 109 ? 4.536  -2.620  -0.456  1.00 84.54  ? 91  ASP A OD1   1 
ATOM   697  O  OD2   . ASP A 1 109 ? 5.026  -0.909  -1.810  1.00 82.89  ? 91  ASP A OD2   1 
ATOM   698  N  N     . SER A 1 110 ? 9.530  -3.109  0.160   1.00 73.77  ? 92  SER A N     1 
ATOM   699  C  CA    . SER A 1 110 ? 10.963 -3.333  -0.034  1.00 71.57  ? 92  SER A CA    1 
ATOM   700  C  C     . SER A 1 110 ? 11.375 -4.729  0.397   1.00 71.61  ? 92  SER A C     1 
ATOM   701  O  O     . SER A 1 110 ? 12.406 -5.225  -0.049  1.00 71.67  ? 92  SER A O     1 
ATOM   702  C  CB    . SER A 1 110 ? 11.796 -2.281  0.697   1.00 69.71  ? 92  SER A CB    1 
ATOM   703  O  OG    . SER A 1 110 ? 11.732 -2.459  2.088   1.00 67.85  ? 92  SER A OG    1 
ATOM   704  N  N     . PHE A 1 111 ? 10.551 -5.362  1.245   1.00 72.88  ? 93  PHE A N     1 
ATOM   705  C  CA    . PHE A 1 111 ? 10.799 -6.731  1.717   1.00 74.46  ? 93  PHE A CA    1 
ATOM   706  C  C     . PHE A 1 111 ? 10.341 -7.816  0.725   1.00 79.00  ? 93  PHE A C     1 
ATOM   707  O  O     . PHE A 1 111 ? 10.888 -8.933  0.733   1.00 80.61  ? 93  PHE A O     1 
ATOM   708  C  CB    . PHE A 1 111 ? 10.188 -6.962  3.102   1.00 71.84  ? 93  PHE A CB    1 
ATOM   709  C  CG    . PHE A 1 111 ? 10.626 -8.267  3.765   1.00 72.80  ? 93  PHE A CG    1 
ATOM   710  C  CD1   . PHE A 1 111 ? 11.996 -8.551  3.974   1.00 71.59  ? 93  PHE A CD1   1 
ATOM   711  C  CD2   . PHE A 1 111 ? 9.669  -9.206  4.212   1.00 73.18  ? 93  PHE A CD2   1 
ATOM   712  C  CE1   . PHE A 1 111 ? 12.406 -9.745  4.595   1.00 69.91  ? 93  PHE A CE1   1 
ATOM   713  C  CE2   . PHE A 1 111 ? 10.074 -10.420 4.838   1.00 71.68  ? 93  PHE A CE2   1 
ATOM   714  C  CZ    . PHE A 1 111 ? 11.441 -10.682 5.031   1.00 71.38  ? 93  PHE A CZ    1 
ATOM   715  N  N     . TYR A 1 112 ? 9.347  -7.504  -0.116  1.00 82.60  ? 94  TYR A N     1 
ATOM   716  C  CA    . TYR A 1 112 ? 8.909  -8.453  -1.167  1.00 85.73  ? 94  TYR A CA    1 
ATOM   717  C  C     . TYR A 1 112 ? 9.826  -8.350  -2.396  1.00 85.27  ? 94  TYR A C     1 
ATOM   718  O  O     . TYR A 1 112 ? 10.048 -9.333  -3.089  1.00 85.84  ? 94  TYR A O     1 
ATOM   719  C  CB    . TYR A 1 112 ? 7.432  -8.262  -1.539  1.00 90.34  ? 94  TYR A CB    1 
ATOM   720  C  CG    . TYR A 1 112 ? 6.516  -8.103  -0.332  1.00 92.19  ? 94  TYR A CG    1 
ATOM   721  C  CD1   . TYR A 1 112 ? 6.595  -9.000  0.760   1.00 92.90  ? 94  TYR A CD1   1 
ATOM   722  C  CD2   . TYR A 1 112 ? 5.558  -7.065  -0.280  1.00 92.24  ? 94  TYR A CD2   1 
ATOM   723  C  CE1   . TYR A 1 112 ? 5.760  -8.861  1.879   1.00 92.90  ? 94  TYR A CE1   1 
ATOM   724  C  CE2   . TYR A 1 112 ? 4.709  -6.915  0.834   1.00 92.33  ? 94  TYR A CE2   1 
ATOM   725  C  CZ    . TYR A 1 112 ? 4.820  -7.822  1.913   1.00 93.16  ? 94  TYR A CZ    1 
ATOM   726  O  OH    . TYR A 1 112 ? 4.003  -7.697  3.021   1.00 93.76  ? 94  TYR A OH    1 
ATOM   727  N  N     . THR A 1 113 ? 10.358 -7.151  -2.645  1.00 84.59  ? 95  THR A N     1 
ATOM   728  C  CA    . THR A 1 113 ? 11.369 -6.933  -3.683  1.00 84.75  ? 95  THR A CA    1 
ATOM   729  C  C     . THR A 1 113 ? 12.628 -7.735  -3.339  1.00 85.74  ? 95  THR A C     1 
ATOM   730  O  O     . THR A 1 113 ? 13.328 -8.238  -4.222  1.00 86.06  ? 95  THR A O     1 
ATOM   731  C  CB    . THR A 1 113 ? 11.721 -5.449  -3.792  1.00 84.20  ? 95  THR A CB    1 
ATOM   732  O  OG1   . THR A 1 113 ? 10.552 -4.728  -4.161  1.00 85.94  ? 95  THR A OG1   1 
ATOM   733  C  CG2   . THR A 1 113 ? 12.795 -5.197  -4.848  1.00 84.40  ? 95  THR A CG2   1 
ATOM   734  N  N     . LEU A 1 114 ? 12.909 -7.854  -2.049  1.00 86.45  ? 96  LEU A N     1 
ATOM   735  C  CA    . LEU A 1 114 ? 14.041 -8.635  -1.592  1.00 88.36  ? 96  LEU A CA    1 
ATOM   736  C  C     . LEU A 1 114 ? 13.877 -10.083 -2.053  1.00 88.60  ? 96  LEU A C     1 
ATOM   737  O  O     . LEU A 1 114 ? 14.837 -10.724 -2.456  1.00 89.73  ? 96  LEU A O     1 
ATOM   738  C  CB    . LEU A 1 114 ? 14.128 -8.596  -0.076  1.00 88.35  ? 96  LEU A CB    1 
ATOM   739  C  CG    . LEU A 1 114 ? 15.291 -9.341  0.544   1.00 87.87  ? 96  LEU A CG    1 
ATOM   740  C  CD1   . LEU A 1 114 ? 16.322 -8.352  0.949   1.00 89.59  ? 96  LEU A CD1   1 
ATOM   741  C  CD2   . LEU A 1 114 ? 14.791 -10.048 1.742   1.00 88.32  ? 96  LEU A CD2   1 
ATOM   742  N  N     . LYS A 1 115 ? 12.646 -10.581 -1.992  1.00 88.57  ? 97  LYS A N     1 
ATOM   743  C  CA    . LYS A 1 115 ? 12.345 -11.960 -2.376  1.00 88.34  ? 97  LYS A CA    1 
ATOM   744  C  C     . LYS A 1 115 ? 12.489 -12.177 -3.875  1.00 88.23  ? 97  LYS A C     1 
ATOM   745  O  O     . LYS A 1 115 ? 12.975 -13.223 -4.304  1.00 89.99  ? 97  LYS A O     1 
ATOM   746  C  CB    . LYS A 1 115 ? 10.969 -12.366 -1.860  1.00 87.84  ? 97  LYS A CB    1 
ATOM   747  C  CG    . LYS A 1 115 ? 10.907 -12.253 -0.350  1.00 88.86  ? 97  LYS A CG    1 
ATOM   748  C  CD    . LYS A 1 115 ? 9.567  -12.571 0.228   1.00 91.00  ? 97  LYS A CD    1 
ATOM   749  C  CE    . LYS A 1 115 ? 9.611  -12.421 1.757   1.00 91.41  ? 97  LYS A CE    1 
ATOM   750  N  NZ    . LYS A 1 115 ? 8.264  -12.584 2.396   1.00 92.73  ? 97  LYS A NZ    1 
ATOM   751  N  N     . LYS A 1 116 ? 12.097 -11.169 -4.661  1.00 86.54  ? 98  LYS A N     1 
ATOM   752  C  CA    . LYS A 1 116 ? 12.241 -11.200 -6.117  1.00 84.96  ? 98  LYS A CA    1 
ATOM   753  C  C     . LYS A 1 116 ? 13.712 -11.130 -6.535  1.00 85.17  ? 98  LYS A C     1 
ATOM   754  O  O     . LYS A 1 116 ? 14.078 -11.652 -7.580  1.00 87.68  ? 98  LYS A O     1 
ATOM   755  C  CB    . LYS A 1 116 ? 11.440 -10.070 -6.778  1.00 84.35  ? 98  LYS A CB    1 
ATOM   756  N  N     . TRP A 1 117 ? 14.547 -10.476 -5.724  1.00 84.74  ? 99  TRP A N     1 
ATOM   757  C  CA    . TRP A 1 117 ? 15.994 -10.418 -5.994  1.00 84.46  ? 99  TRP A CA    1 
ATOM   758  C  C     . TRP A 1 117 ? 16.670 -11.746 -5.648  1.00 84.92  ? 99  TRP A C     1 
ATOM   759  O  O     . TRP A 1 117 ? 17.560 -12.192 -6.363  1.00 85.19  ? 99  TRP A O     1 
ATOM   760  C  CB    . TRP A 1 117 ? 16.674 -9.259  -5.241  1.00 83.18  ? 99  TRP A CB    1 
ATOM   761  C  CG    . TRP A 1 117 ? 16.608 -7.916  -5.950  1.00 82.45  ? 99  TRP A CG    1 
ATOM   762  C  CD1   . TRP A 1 117 ? 15.890 -6.813  -5.563  1.00 81.87  ? 99  TRP A CD1   1 
ATOM   763  C  CD2   . TRP A 1 117 ? 17.282 -7.548  -7.164  1.00 82.34  ? 99  TRP A CD2   1 
ATOM   764  N  NE1   . TRP A 1 117 ? 16.082 -5.779  -6.452  1.00 81.20  ? 99  TRP A NE1   1 
ATOM   765  C  CE2   . TRP A 1 117 ? 16.927 -6.198  -7.447  1.00 82.21  ? 99  TRP A CE2   1 
ATOM   766  C  CE3   . TRP A 1 117 ? 18.153 -8.226  -8.047  1.00 82.67  ? 99  TRP A CE3   1 
ATOM   767  C  CZ2   . TRP A 1 117 ? 17.414 -5.504  -8.585  1.00 82.70  ? 99  TRP A CZ2   1 
ATOM   768  C  CZ3   . TRP A 1 117 ? 18.644 -7.533  -9.186  1.00 82.10  ? 99  TRP A CZ3   1 
ATOM   769  C  CH2   . TRP A 1 117 ? 18.268 -6.185  -9.437  1.00 82.60  ? 99  TRP A CH2   1 
ATOM   770  N  N     . VAL A 1 118 ? 16.243 -12.354 -4.537  1.00 86.19  ? 100 VAL A N     1 
ATOM   771  C  CA    . VAL A 1 118 ? 16.725 -13.668 -4.088  1.00 86.22  ? 100 VAL A CA    1 
ATOM   772  C  C     . VAL A 1 118 ? 16.477 -14.714 -5.171  1.00 87.46  ? 100 VAL A C     1 
ATOM   773  O  O     . VAL A 1 118 ? 17.354 -15.524 -5.478  1.00 86.77  ? 100 VAL A O     1 
ATOM   774  C  CB    . VAL A 1 118 ? 16.022 -14.107 -2.760  1.00 85.87  ? 100 VAL A CB    1 
ATOM   775  C  CG1   . VAL A 1 118 ? 16.167 -15.625 -2.507  1.00 86.74  ? 100 VAL A CG1   1 
ATOM   776  C  CG2   . VAL A 1 118 ? 16.554 -13.319 -1.589  1.00 85.19  ? 100 VAL A CG2   1 
ATOM   777  N  N     . LYS A 1 119 ? 15.275 -14.679 -5.747  1.00 89.23  ? 101 LYS A N     1 
ATOM   778  C  CA    . LYS A 1 119 ? 14.893 -15.602 -6.810  1.00 91.98  ? 101 LYS A CA    1 
ATOM   779  C  C     . LYS A 1 119 ? 15.842 -15.490 -8.010  1.00 91.22  ? 101 LYS A C     1 
ATOM   780  O  O     . LYS A 1 119 ? 16.514 -16.468 -8.375  1.00 92.12  ? 101 LYS A O     1 
ATOM   781  C  CB    . LYS A 1 119 ? 13.420 -15.393 -7.216  1.00 93.42  ? 101 LYS A CB    1 
ATOM   782  C  CG    . LYS A 1 119 ? 12.431 -15.839 -6.134  1.00 93.65  ? 101 LYS A CG    1 
ATOM   783  C  CD    . LYS A 1 119 ? 10.992 -15.480 -6.472  1.00 94.65  ? 101 LYS A CD    1 
ATOM   784  C  CE    . LYS A 1 119 ? 10.057 -15.778 -5.269  1.00 95.91  ? 101 LYS A CE    1 
ATOM   785  N  NZ    . LYS A 1 119 ? 8.663  -15.255 -5.461  1.00 96.16  ? 101 LYS A NZ    1 
ATOM   786  N  N     . GLU A 1 120 ? 15.919 -14.293 -8.592  1.00 89.26  ? 102 GLU A N     1 
ATOM   787  C  CA    . GLU A 1 120 ? 16.803 -14.032 -9.721  1.00 88.17  ? 102 GLU A CA    1 
ATOM   788  C  C     . GLU A 1 120 ? 18.237 -14.439 -9.403  1.00 89.18  ? 102 GLU A C     1 
ATOM   789  O  O     . GLU A 1 120 ? 18.969 -14.907 -10.268 1.00 89.25  ? 102 GLU A O     1 
ATOM   790  C  CB    . GLU A 1 120 ? 16.745 -12.558 -10.099 1.00 86.14  ? 102 GLU A CB    1 
ATOM   791  C  CG    . GLU A 1 120 ? 17.645 -12.162 -11.264 1.00 85.12  ? 102 GLU A CG    1 
ATOM   792  C  CD    . GLU A 1 120 ? 17.387 -10.746 -11.734 1.00 85.66  ? 102 GLU A CD    1 
ATOM   793  O  OE1   . GLU A 1 120 ? 16.314 -10.190 -11.396 1.00 88.10  ? 102 GLU A OE1   1 
ATOM   794  O  OE2   . GLU A 1 120 ? 18.240 -10.185 -12.447 1.00 83.32  ? 102 GLU A OE2   1 
ATOM   795  N  N     . LEU A 1 121 ? 18.617 -14.281 -8.149  1.00 91.93  ? 103 LEU A N     1 
ATOM   796  C  CA    . LEU A 1 121 ? 19.967 -14.577 -7.722  1.00 94.72  ? 103 LEU A CA    1 
ATOM   797  C  C     . LEU A 1 121 ? 20.254 -16.096 -7.691  1.00 97.30  ? 103 LEU A C     1 
ATOM   798  O  O     . LEU A 1 121 ? 21.348 -16.537 -8.077  1.00 97.72  ? 103 LEU A O     1 
ATOM   799  C  CB    . LEU A 1 121 ? 20.233 -13.915 -6.368  1.00 94.43  ? 103 LEU A CB    1 
ATOM   800  C  CG    . LEU A 1 121 ? 21.661 -13.527 -5.987  1.00 93.55  ? 103 LEU A CG    1 
ATOM   801  C  CD1   . LEU A 1 121 ? 22.313 -12.596 -7.037  1.00 92.35  ? 103 LEU A CD1   1 
ATOM   802  C  CD2   . LEU A 1 121 ? 21.632 -12.875 -4.632  1.00 93.09  ? 103 LEU A CD2   1 
ATOM   803  N  N     . LYS A 1 122 ? 19.271 -16.883 -7.249  1.00 99.32  ? 104 LYS A N     1 
ATOM   804  C  CA    . LYS A 1 122 ? 19.401 -18.349 -7.236  1.00 102.33 ? 104 LYS A CA    1 
ATOM   805  C  C     . LYS A 1 122 ? 19.275 -18.961 -8.648  1.00 103.56 ? 104 LYS A C     1 
ATOM   806  O  O     . LYS A 1 122 ? 19.654 -20.117 -8.869  1.00 104.19 ? 104 LYS A O     1 
ATOM   807  C  CB    . LYS A 1 122 ? 18.396 -18.988 -6.260  1.00 102.20 ? 104 LYS A CB    1 
ATOM   808  C  CG    . LYS A 1 122 ? 18.766 -18.769 -4.801  1.00 103.02 ? 104 LYS A CG    1 
ATOM   809  C  CD    . LYS A 1 122 ? 17.841 -19.492 -3.829  1.00 103.62 ? 104 LYS A CD    1 
ATOM   810  C  CE    . LYS A 1 122 ? 18.406 -19.401 -2.401  1.00 104.36 ? 104 LYS A CE    1 
ATOM   811  N  NZ    . LYS A 1 122 ? 17.538 -20.020 -1.381  1.00 104.93 ? 104 LYS A NZ    1 
ATOM   812  N  N     . GLU A 1 123 ? 18.766 -18.170 -9.593  1.00 104.21 ? 105 GLU A N     1 
ATOM   813  C  CA    . GLU A 1 123 ? 18.574 -18.618 -10.964 1.00 104.39 ? 105 GLU A CA    1 
ATOM   814  C  C     . GLU A 1 123 ? 19.687 -18.173 -11.938 1.00 106.07 ? 105 GLU A C     1 
ATOM   815  O  O     . GLU A 1 123 ? 19.979 -18.879 -12.906 1.00 107.63 ? 105 GLU A O     1 
ATOM   816  C  CB    . GLU A 1 123 ? 17.199 -18.171 -11.482 1.00 103.33 ? 105 GLU A CB    1 
ATOM   817  N  N     . HIS A 1 124 ? 20.312 -17.020 -11.680 1.00 106.27 ? 106 HIS A N     1 
ATOM   818  C  CA    . HIS A 1 124 ? 21.312 -16.460 -12.619 1.00 106.09 ? 106 HIS A CA    1 
ATOM   819  C  C     . HIS A 1 124 ? 22.714 -16.160 -12.022 1.00 105.98 ? 106 HIS A C     1 
ATOM   820  O  O     . HIS A 1 124 ? 23.599 -15.653 -12.723 1.00 106.28 ? 106 HIS A O     1 
ATOM   821  C  CB    . HIS A 1 124 ? 20.749 -15.200 -13.295 1.00 108.02 ? 106 HIS A CB    1 
ATOM   822  C  CG    . HIS A 1 124 ? 19.496 -15.435 -14.094 1.00 109.86 ? 106 HIS A CG    1 
ATOM   823  N  ND1   . HIS A 1 124 ? 18.281 -15.733 -13.510 1.00 110.32 ? 106 HIS A ND1   1 
ATOM   824  C  CD2   . HIS A 1 124 ? 19.265 -15.377 -15.428 1.00 110.27 ? 106 HIS A CD2   1 
ATOM   825  C  CE1   . HIS A 1 124 ? 17.362 -15.867 -14.450 1.00 110.41 ? 106 HIS A CE1   1 
ATOM   826  N  NE2   . HIS A 1 124 ? 17.933 -15.654 -15.623 1.00 110.39 ? 106 HIS A NE2   1 
ATOM   827  N  N     . GLY A 1 125 ? 22.914 -16.471 -10.744 1.00 105.55 ? 107 GLY A N     1 
ATOM   828  C  CA    . GLY A 1 125 ? 24.199 -16.214 -10.093 1.00 105.24 ? 107 GLY A CA    1 
ATOM   829  C  C     . GLY A 1 125 ? 24.908 -17.472 -9.637  1.00 105.50 ? 107 GLY A C     1 
ATOM   830  O  O     . GLY A 1 125 ? 24.284 -18.518 -9.532  1.00 105.11 ? 107 GLY A O     1 
ATOM   831  N  N     . PRO A 1 126 ? 26.228 -17.373 -9.374  1.00 106.83 ? 108 PRO A N     1 
ATOM   832  C  CA    . PRO A 1 126 ? 27.099 -18.456 -8.885  1.00 109.07 ? 108 PRO A CA    1 
ATOM   833  C  C     . PRO A 1 126 ? 26.389 -19.473 -7.980  1.00 110.44 ? 108 PRO A C     1 
ATOM   834  O  O     . PRO A 1 126 ? 25.733 -19.079 -7.004  1.00 111.30 ? 108 PRO A O     1 
ATOM   835  C  CB    . PRO A 1 126 ? 28.169 -17.704 -8.079  1.00 109.48 ? 108 PRO A CB    1 
ATOM   836  C  CG    . PRO A 1 126 ? 28.129 -16.247 -8.602  1.00 109.16 ? 108 PRO A CG    1 
ATOM   837  C  CD    . PRO A 1 126 ? 26.990 -16.129 -9.582  1.00 108.32 ? 108 PRO A CD    1 
ATOM   838  N  N     . GLU A 1 127 ? 26.535 -20.765 -8.307  1.00 111.19 ? 109 GLU A N     1 
ATOM   839  C  CA    . GLU A 1 127 ? 25.888 -21.877 -7.554  1.00 110.97 ? 109 GLU A CA    1 
ATOM   840  C  C     . GLU A 1 127 ? 26.118 -21.777 -6.048  1.00 110.77 ? 109 GLU A C     1 
ATOM   841  O  O     . GLU A 1 127 ? 25.204 -22.025 -5.248  1.00 110.94 ? 109 GLU A O     1 
ATOM   842  C  CB    . GLU A 1 127 ? 26.359 -23.246 -8.077  1.00 110.35 ? 109 GLU A CB    1 
ATOM   843  N  N     . ASN A 1 128 ? 27.344 -21.416 -5.673  1.00 109.62 ? 110 ASN A N     1 
ATOM   844  C  CA    . ASN A 1 128 ? 27.691 -21.201 -4.286  1.00 107.94 ? 110 ASN A CA    1 
ATOM   845  C  C     . ASN A 1 128 ? 27.964 -19.706 -4.039  1.00 106.47 ? 110 ASN A C     1 
ATOM   846  O  O     . ASN A 1 128 ? 29.126 -19.273 -4.003  1.00 106.60 ? 110 ASN A O     1 
ATOM   847  C  CB    . ASN A 1 128 ? 28.896 -22.070 -3.889  1.00 107.84 ? 110 ASN A CB    1 
ATOM   848  N  N     . ILE A 1 129 ? 26.887 -18.918 -3.911  1.00 103.20 ? 111 ILE A N     1 
ATOM   849  C  CA    . ILE A 1 129 ? 27.007 -17.478 -3.601  1.00 98.70  ? 111 ILE A CA    1 
ATOM   850  C  C     . ILE A 1 129 ? 26.522 -17.206 -2.195  1.00 97.13  ? 111 ILE A C     1 
ATOM   851  O  O     . ILE A 1 129 ? 25.467 -17.709 -1.788  1.00 96.80  ? 111 ILE A O     1 
ATOM   852  C  CB    . ILE A 1 129 ? 26.242 -16.562 -4.607  1.00 98.00  ? 111 ILE A CB    1 
ATOM   853  C  CG1   . ILE A 1 129 ? 26.658 -15.094 -4.405  1.00 96.96  ? 111 ILE A CG1   1 
ATOM   854  C  CG2   . ILE A 1 129 ? 24.717 -16.752 -4.487  1.00 96.97  ? 111 ILE A CG2   1 
ATOM   855  C  CD1   . ILE A 1 129 ? 26.319 -14.167 -5.554  1.00 96.61  ? 111 ILE A CD1   1 
ATOM   856  N  N     . VAL A 1 130 ? 27.292 -16.416 -1.451  1.00 94.72  ? 112 VAL A N     1 
ATOM   857  C  CA    . VAL A 1 130 ? 26.920 -16.073 -0.079  1.00 93.57  ? 112 VAL A CA    1 
ATOM   858  C  C     . VAL A 1 130 ? 25.827 -14.998 -0.070  1.00 90.99  ? 112 VAL A C     1 
ATOM   859  O  O     . VAL A 1 130 ? 25.972 -13.937 -0.661  1.00 90.10  ? 112 VAL A O     1 
ATOM   860  C  CB    . VAL A 1 130 ? 28.132 -15.640 0.764   1.00 94.77  ? 112 VAL A CB    1 
ATOM   861  C  CG1   . VAL A 1 130 ? 27.709 -15.344 2.195   1.00 94.31  ? 112 VAL A CG1   1 
ATOM   862  C  CG2   . VAL A 1 130 ? 29.209 -16.726 0.745   1.00 95.85  ? 112 VAL A CG2   1 
ATOM   863  N  N     . MET A 1 131 ? 24.736 -15.314 0.610   1.00 89.25  ? 113 MET A N     1 
ATOM   864  C  CA    . MET A 1 131 ? 23.569 -14.467 0.706   1.00 87.27  ? 113 MET A CA    1 
ATOM   865  C  C     . MET A 1 131 ? 23.546 -13.783 2.052   1.00 85.29  ? 113 MET A C     1 
ATOM   866  O  O     . MET A 1 131 ? 23.596 -14.452 3.092   1.00 86.27  ? 113 MET A O     1 
ATOM   867  C  CB    . MET A 1 131 ? 22.328 -15.336 0.617   1.00 89.09  ? 113 MET A CB    1 
ATOM   868  C  CG    . MET A 1 131 ? 22.238 -16.163 -0.615  1.00 90.66  ? 113 MET A CG    1 
ATOM   869  S  SD    . MET A 1 131 ? 21.377 -15.265 -1.879  1.00 92.38  ? 113 MET A SD    1 
ATOM   870  C  CE    . MET A 1 131 ? 19.685 -15.434 -1.288  1.00 91.48  ? 113 MET A CE    1 
ATOM   871  N  N     . ALA A 1 132 ? 23.468 -12.453 2.040   1.00 82.00  ? 114 ALA A N     1 
ATOM   872  C  CA    . ALA A 1 132 ? 23.349 -11.656 3.275   1.00 76.44  ? 114 ALA A CA    1 
ATOM   873  C  C     . ALA A 1 132 ? 22.231 -10.643 3.107   1.00 73.71  ? 114 ALA A C     1 
ATOM   874  O  O     . ALA A 1 132 ? 22.173 -9.926  2.104   1.00 74.26  ? 114 ALA A O     1 
ATOM   875  C  CB    . ALA A 1 132 ? 24.663 -10.958 3.610   1.00 74.23  ? 114 ALA A CB    1 
ATOM   876  N  N     . ILE A 1 133 ? 21.329 -10.599 4.078   1.00 70.79  ? 115 ILE A N     1 
ATOM   877  C  CA    . ILE A 1 133 ? 20.235 -9.646  4.041   1.00 66.13  ? 115 ILE A CA    1 
ATOM   878  C  C     . ILE A 1 133 ? 20.483 -8.545  5.051   1.00 64.09  ? 115 ILE A C     1 
ATOM   879  O  O     . ILE A 1 133 ? 20.858 -8.819  6.201   1.00 64.19  ? 115 ILE A O     1 
ATOM   880  C  CB    . ILE A 1 133 ? 18.896 -10.306 4.343   1.00 66.22  ? 115 ILE A CB    1 
ATOM   881  C  CG1   . ILE A 1 133 ? 18.673 -11.507 3.432   1.00 66.53  ? 115 ILE A CG1   1 
ATOM   882  C  CG2   . ILE A 1 133 ? 17.759 -9.300  4.179   1.00 67.69  ? 115 ILE A CG2   1 
ATOM   883  C  CD1   . ILE A 1 133 ? 17.329 -12.194 3.642   1.00 67.78  ? 115 ILE A CD1   1 
ATOM   884  N  N     . ALA A 1 134 ? 20.289 -7.298  4.622   1.00 59.88  ? 116 ALA A N     1 
ATOM   885  C  CA    . ALA A 1 134 ? 20.412 -6.177  5.526   1.00 56.35  ? 116 ALA A CA    1 
ATOM   886  C  C     . ALA A 1 134 ? 19.055 -5.497  5.648   1.00 54.82  ? 116 ALA A C     1 
ATOM   887  O  O     . ALA A 1 134 ? 18.464 -5.095  4.649   1.00 55.54  ? 116 ALA A O     1 
ATOM   888  C  CB    . ALA A 1 134 ? 21.504 -5.198  5.050   1.00 54.92  ? 116 ALA A CB    1 
ATOM   889  N  N     . GLY A 1 135 ? 18.540 -5.426  6.874   1.00 53.96  ? 117 GLY A N     1 
ATOM   890  C  CA    . GLY A 1 135 ? 17.292 -4.740  7.149   1.00 53.64  ? 117 GLY A CA    1 
ATOM   891  C  C     . GLY A 1 135 ? 17.658 -3.336  7.508   1.00 55.50  ? 117 GLY A C     1 
ATOM   892  O  O     . GLY A 1 135 ? 17.760 -2.996  8.686   1.00 58.15  ? 117 GLY A O     1 
ATOM   893  N  N     . ASN A 1 136 ? 17.882 -2.517  6.490   1.00 55.23  ? 118 ASN A N     1 
ATOM   894  C  CA    . ASN A 1 136 ? 18.396 -1.159  6.693   1.00 55.37  ? 118 ASN A CA    1 
ATOM   895  C  C     . ASN A 1 136 ? 17.410 -0.180  7.334   1.00 55.38  ? 118 ASN A C     1 
ATOM   896  O  O     . ASN A 1 136 ? 16.193 -0.438  7.352   1.00 56.49  ? 118 ASN A O     1 
ATOM   897  C  CB    . ASN A 1 136 ? 18.898 -0.595  5.370   1.00 54.49  ? 118 ASN A CB    1 
ATOM   898  C  CG    . ASN A 1 136 ? 19.838 0.553   5.563   1.00 55.74  ? 118 ASN A CG    1 
ATOM   899  O  OD1   . ASN A 1 136 ? 20.656 0.557   6.492   1.00 54.39  ? 118 ASN A OD1   1 
ATOM   900  N  ND2   . ASN A 1 136 ? 19.740 1.545   4.692   1.00 57.55  ? 118 ASN A ND2   1 
ATOM   901  N  N     . LYS A 1 137 ? 17.948 0.943   7.848   1.00 54.46  ? 119 LYS A N     1 
ATOM   902  C  CA    . LYS A 1 137 ? 17.170 2.041   8.494   1.00 52.43  ? 119 LYS A CA    1 
ATOM   903  C  C     . LYS A 1 137 ? 16.566 1.629   9.848   1.00 55.18  ? 119 LYS A C     1 
ATOM   904  O  O     . LYS A 1 137 ? 15.478 2.097   10.239  1.00 55.33  ? 119 LYS A O     1 
ATOM   905  C  CB    . LYS A 1 137 ? 16.072 2.576   7.563   1.00 51.71  ? 119 LYS A CB    1 
ATOM   906  C  CG    . LYS A 1 137 ? 16.575 3.044   6.206   1.00 53.97  ? 119 LYS A CG    1 
ATOM   907  C  CD    . LYS A 1 137 ? 15.510 3.793   5.447   1.00 52.01  ? 119 LYS A CD    1 
ATOM   908  C  CE    . LYS A 1 137 ? 15.919 3.986   4.021   1.00 52.76  ? 119 LYS A CE    1 
ATOM   909  N  NZ    . LYS A 1 137 ? 14.823 4.542   3.198   1.00 53.20  ? 119 LYS A NZ    1 
ATOM   910  N  N     . CYS A 1 138 ? 17.279 0.780   10.581  1.00 56.06  ? 120 CYS A N     1 
ATOM   911  C  CA    . CYS A 1 138 ? 16.753 0.282   11.835  1.00 57.50  ? 120 CYS A CA    1 
ATOM   912  C  C     . CYS A 1 138 ? 16.615 1.387   12.878  1.00 56.54  ? 120 CYS A C     1 
ATOM   913  O  O     . CYS A 1 138 ? 15.979 1.198   13.889  1.00 60.13  ? 120 CYS A O     1 
ATOM   914  C  CB    . CYS A 1 138 ? 17.566 -0.912  12.353  1.00 57.40  ? 120 CYS A CB    1 
ATOM   915  S  SG    . CYS A 1 138 ? 19.180 -0.501  12.951  1.00 61.56  ? 120 CYS A SG    1 
ATOM   916  N  N     . ASP A 1 139 ? 17.183 2.548   12.600  1.00 56.10  ? 121 ASP A N     1 
ATOM   917  C  CA    . ASP A 1 139 ? 17.038 3.714   13.477  1.00 58.13  ? 121 ASP A CA    1 
ATOM   918  C  C     . ASP A 1 139 ? 15.625 4.339   13.343  1.00 61.81  ? 121 ASP A C     1 
ATOM   919  O  O     . ASP A 1 139 ? 15.198 5.139   14.195  1.00 62.22  ? 121 ASP A O     1 
ATOM   920  C  CB    . ASP A 1 139 ? 18.112 4.760   13.163  1.00 56.02  ? 121 ASP A CB    1 
ATOM   921  C  CG    . ASP A 1 139 ? 18.132 5.159   11.695  1.00 54.77  ? 121 ASP A CG    1 
ATOM   922  O  OD1   . ASP A 1 139 ? 18.643 4.388   10.853  1.00 54.61  ? 121 ASP A OD1   1 
ATOM   923  O  OD2   . ASP A 1 139 ? 17.654 6.255   11.382  1.00 56.40  ? 121 ASP A OD2   1 
ATOM   924  N  N     . LEU A 1 140 ? 14.913 3.975   12.263  1.00 62.88  ? 122 LEU A N     1 
ATOM   925  C  CA    . LEU A 1 140 ? 13.539 4.431   12.040  1.00 61.76  ? 122 LEU A CA    1 
ATOM   926  C  C     . LEU A 1 140 ? 12.558 3.365   12.550  1.00 62.47  ? 122 LEU A C     1 
ATOM   927  O  O     . LEU A 1 140 ? 11.558 3.029   11.883  1.00 64.00  ? 122 LEU A O     1 
ATOM   928  C  CB    . LEU A 1 140 ? 13.301 4.732   10.547  1.00 60.30  ? 122 LEU A CB    1 
ATOM   929  C  CG    . LEU A 1 140 ? 14.228 5.705   9.783   1.00 61.12  ? 122 LEU A CG    1 
ATOM   930  C  CD1   . LEU A 1 140 ? 13.763 5.844   8.344   1.00 60.22  ? 122 LEU A CD1   1 
ATOM   931  C  CD2   . LEU A 1 140 ? 14.331 7.096   10.440  1.00 59.23  ? 122 LEU A CD2   1 
ATOM   932  N  N     . SER A 1 141 ? 12.839 2.839   13.737  1.00 62.65  ? 123 SER A N     1 
ATOM   933  C  CA    . SER A 1 141 ? 12.043 1.735   14.287  1.00 64.25  ? 123 SER A CA    1 
ATOM   934  C  C     . SER A 1 141 ? 10.624 2.141   14.653  1.00 62.24  ? 123 SER A C     1 
ATOM   935  O  O     . SER A 1 141 ? 9.709  1.322   14.571  1.00 60.64  ? 123 SER A O     1 
ATOM   936  C  CB    . SER A 1 141 ? 12.745 1.066   15.470  1.00 64.15  ? 123 SER A CB    1 
ATOM   937  O  OG    . SER A 1 141 ? 12.820 1.947   16.563  1.00 69.26  ? 123 SER A OG    1 
ATOM   938  N  N     . ASP A 1 142 ? 10.431 3.409   15.023  1.00 61.87  ? 124 ASP A N     1 
ATOM   939  C  CA    . ASP A 1 142 ? 9.071  3.888   15.336  1.00 62.00  ? 124 ASP A CA    1 
ATOM   940  C  C     . ASP A 1 142 ? 8.127  3.897   14.125  1.00 59.13  ? 124 ASP A C     1 
ATOM   941  O  O     . ASP A 1 142 ? 6.948  4.210   14.259  1.00 59.50  ? 124 ASP A O     1 
ATOM   942  C  CB    . ASP A 1 142 ? 9.070  5.238   16.081  1.00 64.78  ? 124 ASP A CB    1 
ATOM   943  C  CG    . ASP A 1 142 ? 9.711  6.342   15.307  1.00 67.02  ? 124 ASP A CG    1 
ATOM   944  O  OD1   . ASP A 1 142 ? 10.592 6.069   14.466  1.00 70.56  ? 124 ASP A OD1   1 
ATOM   945  O  OD2   . ASP A 1 142 ? 9.345  7.508   15.557  1.00 67.44  ? 124 ASP A OD2   1 
ATOM   946  N  N     . ILE A 1 143 ? 8.655  3.552   12.946  1.00 56.33  ? 125 ILE A N     1 
ATOM   947  C  CA    . ILE A 1 143 ? 7.818  3.360   11.766  1.00 50.39  ? 125 ILE A CA    1 
ATOM   948  C  C     . ILE A 1 143 ? 8.114  2.039   11.100  1.00 50.69  ? 125 ILE A C     1 
ATOM   949  O  O     . ILE A 1 143 ? 7.793  1.848   9.924   1.00 50.83  ? 125 ILE A O     1 
ATOM   950  C  CB    . ILE A 1 143 ? 7.855  4.541   10.749  1.00 49.00  ? 125 ILE A CB    1 
ATOM   951  C  CG1   . ILE A 1 143 ? 9.290  4.905   10.352  1.00 48.64  ? 125 ILE A CG1   1 
ATOM   952  C  CG2   . ILE A 1 143 ? 7.087  5.749   11.310  1.00 48.40  ? 125 ILE A CG2   1 
ATOM   953  C  CD1   . ILE A 1 143 ? 9.375  6.115   9.343   1.00 46.68  ? 125 ILE A CD1   1 
ATOM   954  N  N     . ARG A 1 144 ? 8.721  1.118   11.854  1.00 49.89  ? 126 ARG A N     1 
ATOM   955  C  CA    . ARG A 1 144 ? 8.935  -0.250  11.365  1.00 52.03  ? 126 ARG A CA    1 
ATOM   956  C  C     . ARG A 1 144 ? 7.681  -0.855  10.688  1.00 52.01  ? 126 ARG A C     1 
ATOM   957  O  O     . ARG A 1 144 ? 6.570  -0.691  11.181  1.00 51.84  ? 126 ARG A O     1 
ATOM   958  C  CB    . ARG A 1 144 ? 9.342  -1.174  12.527  1.00 52.81  ? 126 ARG A CB    1 
ATOM   959  C  CG    . ARG A 1 144 ? 9.411  -2.704  12.118  1.00 53.42  ? 126 ARG A CG    1 
ATOM   960  C  CD    . ARG A 1 144 ? 9.789  -3.578  13.265  1.00 52.13  ? 126 ARG A CD    1 
ATOM   961  N  NE    . ARG A 1 144 ? 11.074 -3.190  13.858  1.00 51.54  ? 126 ARG A NE    1 
ATOM   962  C  CZ    . ARG A 1 144 ? 12.253 -3.708  13.510  1.00 50.63  ? 126 ARG A CZ    1 
ATOM   963  N  NH1   . ARG A 1 144 ? 12.322 -4.629  12.557  1.00 51.81  ? 126 ARG A NH1   1 
ATOM   964  N  NH2   . ARG A 1 144 ? 13.367 -3.304  14.111  1.00 46.58  ? 126 ARG A NH2   1 
ATOM   965  N  N     . GLU A 1 145 ? 7.877  -1.553  9.571   1.00 54.05  ? 127 GLU A N     1 
ATOM   966  C  CA    . GLU A 1 145 ? 6.789  -2.294  8.903   1.00 54.28  ? 127 GLU A CA    1 
ATOM   967  C  C     . GLU A 1 145 ? 7.133  -3.750  8.710   1.00 59.10  ? 127 GLU A C     1 
ATOM   968  O  O     . GLU A 1 145 ? 6.253  -4.548  8.368   1.00 62.21  ? 127 GLU A O     1 
ATOM   969  C  CB    . GLU A 1 145 ? 6.419  -1.679  7.574   1.00 54.09  ? 127 GLU A CB    1 
ATOM   970  C  CG    . GLU A 1 145 ? 5.615  -0.435  7.749   1.00 57.08  ? 127 GLU A CG    1 
ATOM   971  C  CD    . GLU A 1 145 ? 5.121  0.181   6.462   1.00 57.83  ? 127 GLU A CD    1 
ATOM   972  O  OE1   . GLU A 1 145 ? 5.319  -0.398  5.362   1.00 56.89  ? 127 GLU A OE1   1 
ATOM   973  O  OE2   . GLU A 1 145 ? 4.514  1.275   6.566   1.00 60.67  ? 127 GLU A OE2   1 
ATOM   974  N  N     . VAL A 1 146 ? 8.408  -4.100  8.945   1.00 60.14  ? 128 VAL A N     1 
ATOM   975  C  CA    . VAL A 1 146 ? 8.896  -5.474  8.797   1.00 60.70  ? 128 VAL A CA    1 
ATOM   976  C  C     . VAL A 1 146 ? 9.511  -5.982  10.106  1.00 63.72  ? 128 VAL A C     1 
ATOM   977  O  O     . VAL A 1 146 ? 10.645 -5.625  10.450  1.00 63.03  ? 128 VAL A O     1 
ATOM   978  C  CB    . VAL A 1 146 ? 9.956  -5.593  7.666   1.00 59.45  ? 128 VAL A CB    1 
ATOM   979  C  CG1   . VAL A 1 146 ? 10.459 -7.050  7.536   1.00 58.91  ? 128 VAL A CG1   1 
ATOM   980  C  CG2   . VAL A 1 146 ? 9.401  -5.102  6.351   1.00 58.62  ? 128 VAL A CG2   1 
ATOM   981  N  N     . PRO A 1 147 ? 8.768  -6.819  10.846  1.00 66.54  ? 129 PRO A N     1 
ATOM   982  C  CA    . PRO A 1 147 ? 9.294  -7.371  12.111  1.00 66.44  ? 129 PRO A CA    1 
ATOM   983  C  C     . PRO A 1 147 ? 10.567 -8.184  11.886  1.00 67.67  ? 129 PRO A C     1 
ATOM   984  O  O     . PRO A 1 147 ? 10.706 -8.852  10.853  1.00 68.49  ? 129 PRO A O     1 
ATOM   985  C  CB    . PRO A 1 147 ? 8.164  -8.277  12.589  1.00 66.17  ? 129 PRO A CB    1 
ATOM   986  C  CG    . PRO A 1 147 ? 6.930  -7.738  11.899  1.00 66.73  ? 129 PRO A CG    1 
ATOM   987  C  CD    . PRO A 1 147 ? 7.396  -7.287  10.565  1.00 66.70  ? 129 PRO A CD    1 
ATOM   988  N  N     . LEU A 1 148 ? 11.488 -8.117  12.842  1.00 69.73  ? 130 LEU A N     1 
ATOM   989  C  CA    . LEU A 1 148 ? 12.755 -8.826  12.746  1.00 71.96  ? 130 LEU A CA    1 
ATOM   990  C  C     . LEU A 1 148 ? 12.573 -10.344 12.593  1.00 75.34  ? 130 LEU A C     1 
ATOM   991  O  O     . LEU A 1 148 ? 13.272 -10.969 11.775  1.00 76.71  ? 130 LEU A O     1 
ATOM   992  C  CB    . LEU A 1 148 ? 13.663 -8.489  13.944  1.00 71.78  ? 130 LEU A CB    1 
ATOM   993  C  CG    . LEU A 1 148 ? 15.024 -9.211  14.119  1.00 71.50  ? 130 LEU A CG    1 
ATOM   994  C  CD1   . LEU A 1 148 ? 15.943 -9.096  12.889  1.00 70.82  ? 130 LEU A CD1   1 
ATOM   995  C  CD2   . LEU A 1 148 ? 15.746 -8.708  15.379  1.00 72.66  ? 130 LEU A CD2   1 
ATOM   996  N  N     . LYS A 1 149 ? 11.630 -10.917 13.368  1.00 77.45  ? 131 LYS A N     1 
ATOM   997  C  CA    . LYS A 1 149 ? 11.290 -12.369 13.335  1.00 78.07  ? 131 LYS A CA    1 
ATOM   998  C  C     . LYS A 1 149 ? 10.883 -12.872 11.927  1.00 79.79  ? 131 LYS A C     1 
ATOM   999  O  O     . LYS A 1 149 ? 11.241 -13.991 11.549  1.00 81.33  ? 131 LYS A O     1 
ATOM   1000 C  CB    . LYS A 1 149 ? 10.187 -12.698 14.368  1.00 77.82  ? 131 LYS A CB    1 
ATOM   1001 C  CG    . LYS A 1 149 ? 10.005 -14.195 14.678  1.00 76.67  ? 131 LYS A CG    1 
ATOM   1002 N  N     . ASP A 1 150 ? 10.137 -12.051 11.169  1.00 80.39  ? 132 ASP A N     1 
ATOM   1003 C  CA    . ASP A 1 150 ? 9.754  -12.394 9.782   1.00 81.54  ? 132 ASP A CA    1 
ATOM   1004 C  C     . ASP A 1 150 ? 10.952 -12.431 8.847   1.00 83.98  ? 132 ASP A C     1 
ATOM   1005 O  O     . ASP A 1 150 ? 10.996 -13.246 7.912   1.00 86.63  ? 132 ASP A O     1 
ATOM   1006 C  CB    . ASP A 1 150 ? 8.739  -11.407 9.224   1.00 80.94  ? 132 ASP A CB    1 
ATOM   1007 C  CG    . ASP A 1 150 ? 7.342  -11.671 9.708   1.00 81.68  ? 132 ASP A CG    1 
ATOM   1008 O  OD1   . ASP A 1 150 ? 7.183  -12.298 10.776  1.00 82.93  ? 132 ASP A OD1   1 
ATOM   1009 O  OD2   . ASP A 1 150 ? 6.390  -11.241 9.021   1.00 80.82  ? 132 ASP A OD2   1 
ATOM   1010 N  N     . ALA A 1 151 ? 11.913 -11.538 9.085   1.00 83.90  ? 133 ALA A N     1 
ATOM   1011 C  CA    . ALA A 1 151 ? 13.121 -11.472 8.271   1.00 82.83  ? 133 ALA A CA    1 
ATOM   1012 C  C     . ALA A 1 151 ? 14.105 -12.566 8.674   1.00 82.25  ? 133 ALA A C     1 
ATOM   1013 O  O     . ALA A 1 151 ? 14.811 -13.101 7.827   1.00 80.41  ? 133 ALA A O     1 
ATOM   1014 C  CB    . ALA A 1 151 ? 13.756 -10.115 8.382   1.00 83.63  ? 133 ALA A CB    1 
ATOM   1015 N  N     . LYS A 1 152 ? 14.150 -12.887 9.970   1.00 82.54  ? 134 LYS A N     1 
ATOM   1016 C  CA    . LYS A 1 152 ? 15.000 -13.974 10.468  1.00 84.49  ? 134 LYS A CA    1 
ATOM   1017 C  C     . LYS A 1 152 ? 14.608 -15.330 9.890   1.00 87.34  ? 134 LYS A C     1 
ATOM   1018 O  O     . LYS A 1 152 ? 15.480 -16.118 9.506   1.00 89.38  ? 134 LYS A O     1 
ATOM   1019 C  CB    . LYS A 1 152 ? 15.000 -14.044 11.992  1.00 81.83  ? 134 LYS A CB    1 
ATOM   1020 C  CG    . LYS A 1 152 ? 16.027 -13.167 12.621  1.00 81.84  ? 134 LYS A CG    1 
ATOM   1021 C  CD    . LYS A 1 152 ? 16.069 -13.350 14.114  1.00 82.52  ? 134 LYS A CD    1 
ATOM   1022 C  CE    . LYS A 1 152 ? 17.182 -12.522 14.708  1.00 84.06  ? 134 LYS A CE    1 
ATOM   1023 N  NZ    . LYS A 1 152 ? 17.179 -12.603 16.182  1.00 85.39  ? 134 LYS A NZ    1 
ATOM   1024 N  N     . GLU A 1 153 ? 13.306 -15.598 9.824   1.00 88.88  ? 135 GLU A N     1 
ATOM   1025 C  CA    . GLU A 1 153 ? 12.819 -16.861 9.281   1.00 92.28  ? 135 GLU A CA    1 
ATOM   1026 C  C     . GLU A 1 153 ? 13.123 -16.995 7.814   1.00 92.09  ? 135 GLU A C     1 
ATOM   1027 O  O     . GLU A 1 153 ? 13.610 -18.039 7.371   1.00 94.50  ? 135 GLU A O     1 
ATOM   1028 C  CB    . GLU A 1 153 ? 11.332 -17.010 9.513   1.00 95.85  ? 135 GLU A CB    1 
ATOM   1029 C  CG    . GLU A 1 153 ? 10.988 -17.264 10.963  1.00 99.63  ? 135 GLU A CG    1 
ATOM   1030 C  CD    . GLU A 1 153 ? 9.514  -17.155 11.230  1.00 101.36 ? 135 GLU A CD    1 
ATOM   1031 O  OE1   . GLU A 1 153 ? 8.731  -16.974 10.254  1.00 102.35 ? 135 GLU A OE1   1 
ATOM   1032 O  OE2   . GLU A 1 153 ? 9.135  -17.248 12.421  1.00 102.45 ? 135 GLU A OE2   1 
ATOM   1033 N  N     . TYR A 1 154 ? 12.849 -15.935 7.063   1.00 90.03  ? 136 TYR A N     1 
ATOM   1034 C  CA    . TYR A 1 154 ? 13.124 -15.926 5.650   1.00 89.12  ? 136 TYR A CA    1 
ATOM   1035 C  C     . TYR A 1 154 ? 14.607 -16.201 5.372   1.00 88.82  ? 136 TYR A C     1 
ATOM   1036 O  O     . TYR A 1 154 ? 14.949 -16.976 4.481   1.00 89.13  ? 136 TYR A O     1 
ATOM   1037 C  CB    . TYR A 1 154 ? 12.701 -14.602 5.040   1.00 90.50  ? 136 TYR A CB    1 
ATOM   1038 C  CG    . TYR A 1 154 ? 12.910 -14.549 3.556   1.00 91.16  ? 136 TYR A CG    1 
ATOM   1039 C  CD1   . TYR A 1 154 ? 12.068 -15.250 2.695   1.00 91.55  ? 136 TYR A CD1   1 
ATOM   1040 C  CD2   . TYR A 1 154 ? 13.950 -13.805 3.003   1.00 91.10  ? 136 TYR A CD2   1 
ATOM   1041 C  CE1   . TYR A 1 154 ? 12.252 -15.212 1.323   1.00 91.64  ? 136 TYR A CE1   1 
ATOM   1042 C  CE2   . TYR A 1 154 ? 14.143 -13.760 1.623   1.00 91.52  ? 136 TYR A CE2   1 
ATOM   1043 C  CZ    . TYR A 1 154 ? 13.287 -14.469 0.791   1.00 91.19  ? 136 TYR A CZ    1 
ATOM   1044 O  OH    . TYR A 1 154 ? 13.457 -14.437 -0.572  1.00 91.76  ? 136 TYR A OH    1 
ATOM   1045 N  N     . ALA A 1 155 ? 15.474 -15.568 6.150   1.00 88.95  ? 137 ALA A N     1 
ATOM   1046 C  CA    . ALA A 1 155 ? 16.914 -15.727 6.000   1.00 89.90  ? 137 ALA A CA    1 
ATOM   1047 C  C     . ALA A 1 155 ? 17.333 -17.160 6.259   1.00 91.06  ? 137 ALA A C     1 
ATOM   1048 O  O     . ALA A 1 155 ? 18.204 -17.702 5.565   1.00 90.62  ? 137 ALA A O     1 
ATOM   1049 C  CB    . ALA A 1 155 ? 17.631 -14.812 6.939   1.00 89.66  ? 137 ALA A CB    1 
ATOM   1050 N  N     . GLU A 1 156 ? 16.714 -17.762 7.271   1.00 92.39  ? 138 GLU A N     1 
ATOM   1051 C  CA    . GLU A 1 156 ? 16.990 -19.135 7.640   1.00 94.60  ? 138 GLU A CA    1 
ATOM   1052 C  C     . GLU A 1 156 ? 16.467 -20.089 6.560   1.00 94.15  ? 138 GLU A C     1 
ATOM   1053 O  O     . GLU A 1 156 ? 17.131 -21.082 6.224   1.00 95.20  ? 138 GLU A O     1 
ATOM   1054 C  CB    . GLU A 1 156 ? 16.361 -19.452 8.981   1.00 97.03  ? 138 GLU A CB    1 
ATOM   1055 C  CG    . GLU A 1 156 ? 16.935 -20.674 9.648   1.00 100.87 ? 138 GLU A CG    1 
ATOM   1056 C  CD    . GLU A 1 156 ? 16.326 -20.927 11.015  1.00 103.78 ? 138 GLU A CD    1 
ATOM   1057 O  OE1   . GLU A 1 156 ? 15.263 -20.332 11.321  1.00 104.44 ? 138 GLU A OE1   1 
ATOM   1058 O  OE2   . GLU A 1 156 ? 16.908 -21.726 11.787  1.00 105.55 ? 138 GLU A OE2   1 
ATOM   1059 N  N     . SER A 1 157 ? 15.298 -19.762 5.998   1.00 90.96  ? 139 SER A N     1 
ATOM   1060 C  CA    . SER A 1 157 ? 14.678 -20.577 4.957   1.00 87.31  ? 139 SER A CA    1 
ATOM   1061 C  C     . SER A 1 157 ? 15.337 -20.409 3.577   1.00 87.17  ? 139 SER A C     1 
ATOM   1062 O  O     . SER A 1 157 ? 14.803 -20.895 2.576   1.00 89.30  ? 139 SER A O     1 
ATOM   1063 C  CB    . SER A 1 157 ? 13.189 -20.255 4.844   1.00 85.26  ? 139 SER A CB    1 
ATOM   1064 O  OG    . SER A 1 157 ? 12.973 -19.241 3.884   1.00 81.86  ? 139 SER A OG    1 
ATOM   1065 N  N     . ILE A 1 158 ? 16.462 -19.699 3.513   1.00 85.42  ? 140 ILE A N     1 
ATOM   1066 C  CA    . ILE A 1 158 ? 17.206 -19.521 2.242   1.00 83.22  ? 140 ILE A CA    1 
ATOM   1067 C  C     . ILE A 1 158 ? 18.713 -19.611 2.479   1.00 82.73  ? 140 ILE A C     1 
ATOM   1068 O  O     . ILE A 1 158 ? 19.513 -19.295 1.586   1.00 81.67  ? 140 ILE A O     1 
ATOM   1069 C  CB    . ILE A 1 158 ? 16.873 -18.167 1.505   1.00 83.06  ? 140 ILE A CB    1 
ATOM   1070 C  CG1   . ILE A 1 158 ? 17.275 -16.944 2.375   1.00 82.87  ? 140 ILE A CG1   1 
ATOM   1071 C  CG2   . ILE A 1 158 ? 15.400 -18.128 1.036   1.00 81.40  ? 140 ILE A CG2   1 
ATOM   1072 C  CD1   . ILE A 1 158 ? 17.356 -15.615 1.617   1.00 81.52  ? 140 ILE A CD1   1 
ATOM   1073 N  N     . GLY A 1 159 ? 19.087 -20.034 3.692   1.00 81.88  ? 141 GLY A N     1 
ATOM   1074 C  CA    . GLY A 1 159 ? 20.489 -20.192 4.074   1.00 82.50  ? 141 GLY A CA    1 
ATOM   1075 C  C     . GLY A 1 159 ? 21.268 -18.901 3.951   1.00 83.89  ? 141 GLY A C     1 
ATOM   1076 O  O     . GLY A 1 159 ? 22.389 -18.884 3.410   1.00 83.25  ? 141 GLY A O     1 
ATOM   1077 N  N     . ALA A 1 160 ? 20.653 -17.815 4.440   1.00 84.01  ? 142 ALA A N     1 
ATOM   1078 C  CA    . ALA A 1 160 ? 21.259 -16.480 4.448   1.00 81.53  ? 142 ALA A CA    1 
ATOM   1079 C  C     . ALA A 1 160 ? 21.322 -15.947 5.866   1.00 80.57  ? 142 ALA A C     1 
ATOM   1080 O  O     . ALA A 1 160 ? 20.600 -16.433 6.749   1.00 80.07  ? 142 ALA A O     1 
ATOM   1081 C  CB    . ALA A 1 160 ? 20.453 -15.542 3.584   1.00 81.92  ? 142 ALA A CB    1 
ATOM   1082 N  N     . ILE A 1 161 ? 22.208 -14.975 6.104   1.00 79.64  ? 143 ILE A N     1 
ATOM   1083 C  CA    . ILE A 1 161 ? 22.213 -14.272 7.394   1.00 78.94  ? 143 ILE A CA    1 
ATOM   1084 C  C     . ILE A 1 161 ? 21.371 -13.012 7.290   1.00 76.79  ? 143 ILE A C     1 
ATOM   1085 O  O     . ILE A 1 161 ? 21.116 -12.512 6.187   1.00 76.60  ? 143 ILE A O     1 
ATOM   1086 C  CB    . ILE A 1 161 ? 23.632 -13.890 7.916   1.00 79.51  ? 143 ILE A CB    1 
ATOM   1087 C  CG1   . ILE A 1 161 ? 24.391 -13.014 6.895   1.00 80.65  ? 143 ILE A CG1   1 
ATOM   1088 C  CG2   . ILE A 1 161 ? 24.406 -15.151 8.359   1.00 80.10  ? 143 ILE A CG2   1 
ATOM   1089 C  CD1   . ILE A 1 161 ? 25.534 -12.167 7.510   1.00 79.15  ? 143 ILE A CD1   1 
ATOM   1090 N  N     . VAL A 1 162 ? 20.926 -12.516 8.435   1.00 74.04  ? 144 VAL A N     1 
ATOM   1091 C  CA    . VAL A 1 162 ? 20.184 -11.288 8.486   1.00 72.29  ? 144 VAL A CA    1 
ATOM   1092 C  C     . VAL A 1 162 ? 20.671 -10.450 9.605   1.00 70.76  ? 144 VAL A C     1 
ATOM   1093 O  O     . VAL A 1 162 ? 20.853 -10.935 10.726  1.00 71.52  ? 144 VAL A O     1 
ATOM   1094 C  CB    . VAL A 1 162 ? 18.682 -11.515 8.681   1.00 73.45  ? 144 VAL A CB    1 
ATOM   1095 C  CG1   . VAL A 1 162 ? 18.018 -10.266 9.266   1.00 76.69  ? 144 VAL A CG1   1 
ATOM   1096 C  CG2   . VAL A 1 162 ? 18.047 -11.823 7.392   1.00 75.72  ? 144 VAL A CG2   1 
ATOM   1097 N  N     . VAL A 1 163 ? 20.897 -9.179  9.300   1.00 68.53  ? 145 VAL A N     1 
ATOM   1098 C  CA    . VAL A 1 163 ? 21.188 -8.185  10.318  1.00 64.66  ? 145 VAL A CA    1 
ATOM   1099 C  C     . VAL A 1 163 ? 20.402 -6.950  10.001  1.00 63.78  ? 145 VAL A C     1 
ATOM   1100 O  O     . VAL A 1 163 ? 20.222 -6.611  8.833   1.00 65.95  ? 145 VAL A O     1 
ATOM   1101 C  CB    . VAL A 1 163 ? 22.694 -7.871  10.464  1.00 62.95  ? 145 VAL A CB    1 
ATOM   1102 C  CG1   . VAL A 1 163 ? 23.385 -8.986  11.217  1.00 63.76  ? 145 VAL A CG1   1 
ATOM   1103 C  CG2   . VAL A 1 163 ? 23.336 -7.673  9.135   1.00 62.87  ? 145 VAL A CG2   1 
ATOM   1104 N  N     . GLU A 1 164 ? 19.871 -6.308  11.039  1.00 61.85  ? 146 GLU A N     1 
ATOM   1105 C  CA    . GLU A 1 164 ? 19.209 -5.023  10.880  1.00 58.55  ? 146 GLU A CA    1 
ATOM   1106 C  C     . GLU A 1 164 ? 20.318 -3.990  10.985  1.00 55.95  ? 146 GLU A C     1 
ATOM   1107 O  O     . GLU A 1 164 ? 21.150 -4.053  11.887  1.00 55.54  ? 146 GLU A O     1 
ATOM   1108 C  CB    . GLU A 1 164 ? 18.126 -4.810  11.946  1.00 56.93  ? 146 GLU A CB    1 
ATOM   1109 C  CG    . GLU A 1 164 ? 16.893 -5.671  11.739  1.00 59.19  ? 146 GLU A CG    1 
ATOM   1110 C  CD    . GLU A 1 164 ? 15.630 -5.140  12.443  1.00 61.22  ? 146 GLU A CD    1 
ATOM   1111 O  OE1   . GLU A 1 164 ? 15.740 -4.601  13.573  1.00 64.33  ? 146 GLU A OE1   1 
ATOM   1112 O  OE2   . GLU A 1 164 ? 14.526 -5.276  11.864  1.00 59.12  ? 146 GLU A OE2   1 
ATOM   1113 N  N     . THR A 1 165 ? 20.364 -3.059  10.051  1.00 53.92  ? 147 THR A N     1 
ATOM   1114 C  CA    . THR A 1 165 ? 21.454 -2.077  10.051  1.00 51.77  ? 147 THR A CA    1 
ATOM   1115 C  C     . THR A 1 165 ? 20.950 -0.665  10.057  1.00 52.16  ? 147 THR A C     1 
ATOM   1116 O  O     . THR A 1 165 ? 19.748 -0.408  9.812   1.00 54.08  ? 147 THR A O     1 
ATOM   1117 C  CB    . THR A 1 165 ? 22.309 -2.203  8.784   1.00 50.63  ? 147 THR A CB    1 
ATOM   1118 O  OG1   . THR A 1 165 ? 21.473 -1.976  7.640   1.00 51.70  ? 147 THR A OG1   1 
ATOM   1119 C  CG2   . THR A 1 165 ? 22.989 -3.597  8.676   1.00 48.42  ? 147 THR A CG2   1 
ATOM   1120 N  N     . SER A 1 166 ? 21.864 0.254   10.344  1.00 51.87  ? 148 SER A N     1 
ATOM   1121 C  CA    . SER A 1 166 ? 21.635 1.687   10.157  1.00 54.88  ? 148 SER A CA    1 
ATOM   1122 C  C     . SER A 1 166 ? 22.931 2.323   9.701   1.00 56.01  ? 148 SER A C     1 
ATOM   1123 O  O     . SER A 1 166 ? 23.885 2.471   10.506  1.00 56.98  ? 148 SER A O     1 
ATOM   1124 C  CB    . SER A 1 166 ? 21.167 2.382   11.438  1.00 56.56  ? 148 SER A CB    1 
ATOM   1125 O  OG    . SER A 1 166 ? 21.214 3.808   11.262  1.00 55.70  ? 148 SER A OG    1 
ATOM   1126 N  N     . ALA A 1 167 ? 22.986 2.685   8.421   1.00 54.37  ? 149 ALA A N     1 
ATOM   1127 C  CA    . ALA A 1 167 ? 24.141 3.411   7.869   1.00 53.55  ? 149 ALA A CA    1 
ATOM   1128 C  C     . ALA A 1 167 ? 24.265 4.751   8.585   1.00 55.21  ? 149 ALA A C     1 
ATOM   1129 O  O     . ALA A 1 167 ? 25.374 5.242   8.837   1.00 55.53  ? 149 ALA A O     1 
ATOM   1130 C  CB    . ALA A 1 167 ? 23.984 3.618   6.386   1.00 50.18  ? 149 ALA A CB    1 
ATOM   1131 N  N     . LYS A 1 168 ? 23.112 5.309   8.947   1.00 58.29  ? 150 LYS A N     1 
ATOM   1132 C  CA    . LYS A 1 168 ? 23.023 6.590   9.651   1.00 61.17  ? 150 LYS A CA    1 
ATOM   1133 C  C     . LYS A 1 168 ? 23.725 6.586   11.009  1.00 61.18  ? 150 LYS A C     1 
ATOM   1134 O  O     . LYS A 1 168 ? 24.544 7.464   11.286  1.00 62.35  ? 150 LYS A O     1 
ATOM   1135 C  CB    . LYS A 1 168 ? 21.564 6.986   9.846   1.00 60.23  ? 150 LYS A CB    1 
ATOM   1136 C  CG    . LYS A 1 168 ? 21.436 8.364   10.287  1.00 61.01  ? 150 LYS A CG    1 
ATOM   1137 C  CD    . LYS A 1 168 ? 20.041 8.724   10.691  1.00 62.84  ? 150 LYS A CD    1 
ATOM   1138 C  CE    . LYS A 1 168 ? 19.946 10.246  10.814  1.00 61.23  ? 150 LYS A CE    1 
ATOM   1139 N  NZ    . LYS A 1 168 ? 19.018 10.614  11.863  1.00 63.24  ? 150 LYS A NZ    1 
ATOM   1140 N  N     . ASN A 1 169 ? 23.381 5.603   11.846  1.00 59.95  ? 151 ASN A N     1 
ATOM   1141 C  CA    . ASN A 1 169 ? 23.937 5.489   13.195  1.00 59.53  ? 151 ASN A CA    1 
ATOM   1142 C  C     . ASN A 1 169 ? 25.076 4.480   13.310  1.00 61.47  ? 151 ASN A C     1 
ATOM   1143 O  O     . ASN A 1 169 ? 25.533 4.191   14.427  1.00 63.58  ? 151 ASN A O     1 
ATOM   1144 C  CB    . ASN A 1 169 ? 22.839 5.121   14.213  1.00 58.13  ? 151 ASN A CB    1 
ATOM   1145 C  CG    . ASN A 1 169 ? 21.799 6.250   14.422  1.00 56.88  ? 151 ASN A CG    1 
ATOM   1146 O  OD1   . ASN A 1 169 ? 21.938 7.341   13.894  1.00 55.62  ? 151 ASN A OD1   1 
ATOM   1147 N  ND2   . ASN A 1 169 ? 20.753 5.959   15.202  1.00 55.41  ? 151 ASN A ND2   1 
ATOM   1148 N  N     . ALA A 1 170 ? 25.531 3.941   12.164  1.00 59.81  ? 152 ALA A N     1 
ATOM   1149 C  CA    . ALA A 1 170 ? 26.612 2.934   12.124  1.00 55.87  ? 152 ALA A CA    1 
ATOM   1150 C  C     . ALA A 1 170 ? 26.317 1.749   13.038  1.00 57.06  ? 152 ALA A C     1 
ATOM   1151 O  O     . ALA A 1 170 ? 27.073 1.467   13.955  1.00 58.75  ? 152 ALA A O     1 
ATOM   1152 C  CB    . ALA A 1 170 ? 27.968 3.558   12.455  1.00 53.18  ? 152 ALA A CB    1 
ATOM   1153 N  N     . ILE A 1 171 ? 25.194 1.076   12.786  1.00 57.68  ? 153 ILE A N     1 
ATOM   1154 C  CA    . ILE A 1 171 ? 24.806 -0.098  13.541  1.00 56.78  ? 153 ILE A CA    1 
ATOM   1155 C  C     . ILE A 1 171 ? 24.884 -1.306  12.612  1.00 59.11  ? 153 ILE A C     1 
ATOM   1156 O  O     . ILE A 1 171 ? 24.236 -1.334  11.574  1.00 58.07  ? 153 ILE A O     1 
ATOM   1157 C  CB    . ILE A 1 171 ? 23.365 0.040   14.142  1.00 56.53  ? 153 ILE A CB    1 
ATOM   1158 C  CG1   . ILE A 1 171 ? 23.301 1.234   15.131  1.00 56.87  ? 153 ILE A CG1   1 
ATOM   1159 C  CG2   . ILE A 1 171 ? 22.907 -1.286  14.794  1.00 52.78  ? 153 ILE A CG2   1 
ATOM   1160 C  CD1   . ILE A 1 171 ? 21.882 1.620   15.605  1.00 56.50  ? 153 ILE A CD1   1 
ATOM   1161 N  N     . ASN A 1 172 ? 25.718 -2.279  12.989  1.00 61.94  ? 154 ASN A N     1 
ATOM   1162 C  CA    . ASN A 1 172 ? 25.876 -3.542  12.261  1.00 62.79  ? 154 ASN A CA    1 
ATOM   1163 C  C     . ASN A 1 172 ? 26.345 -3.466  10.816  1.00 65.55  ? 154 ASN A C     1 
ATOM   1164 O  O     . ASN A 1 172 ? 26.111 -4.406  10.042  1.00 68.85  ? 154 ASN A O     1 
ATOM   1165 C  CB    . ASN A 1 172 ? 24.594 -4.384  12.354  1.00 64.10  ? 154 ASN A CB    1 
ATOM   1166 C  CG    . ASN A 1 172 ? 24.400 -5.002  13.731  1.00 63.91  ? 154 ASN A CG    1 
ATOM   1167 O  OD1   . ASN A 1 172 ? 25.362 -5.170  14.508  1.00 63.16  ? 154 ASN A OD1   1 
ATOM   1168 N  ND2   . ASN A 1 172 ? 23.162 -5.355  14.038  1.00 62.16  ? 154 ASN A ND2   1 
ATOM   1169 N  N     . ILE A 1 173 ? 27.003 -2.371  10.439  1.00 65.82  ? 155 ILE A N     1 
ATOM   1170 C  CA    . ILE A 1 173 ? 27.545 -2.275  9.097   1.00 64.80  ? 155 ILE A CA    1 
ATOM   1171 C  C     . ILE A 1 173 ? 28.791 -3.171  9.010   1.00 66.96  ? 155 ILE A C     1 
ATOM   1172 O  O     . ILE A 1 173 ? 28.889 -4.041  8.122   1.00 68.05  ? 155 ILE A O     1 
ATOM   1173 C  CB    . ILE A 1 173 ? 27.829 -0.824  8.677   1.00 64.10  ? 155 ILE A CB    1 
ATOM   1174 C  CG1   . ILE A 1 173 ? 26.526 0.008   8.679   1.00 62.53  ? 155 ILE A CG1   1 
ATOM   1175 C  CG2   . ILE A 1 173 ? 28.487 -0.784  7.294   1.00 64.30  ? 155 ILE A CG2   1 
ATOM   1176 C  CD1   . ILE A 1 173 ? 25.427 -0.478  7.728   1.00 58.16  ? 155 ILE A CD1   1 
ATOM   1177 N  N     . GLU A 1 174 ? 29.713 -2.985  9.950   1.00 67.85  ? 156 GLU A N     1 
ATOM   1178 C  CA    . GLU A 1 174 ? 30.905 -3.835  10.047  1.00 69.77  ? 156 GLU A CA    1 
ATOM   1179 C  C     . GLU A 1 174 ? 30.497 -5.329  10.181  1.00 68.54  ? 156 GLU A C     1 
ATOM   1180 O  O     . GLU A 1 174 ? 31.062 -6.203  9.511   1.00 67.44  ? 156 GLU A O     1 
ATOM   1181 C  CB    . GLU A 1 174 ? 31.781 -3.392  11.234  1.00 70.22  ? 156 GLU A CB    1 
ATOM   1182 C  CG    . GLU A 1 174 ? 33.294 -3.659  11.063  1.00 74.93  ? 156 GLU A CG    1 
ATOM   1183 C  CD    . GLU A 1 174 ? 33.996 -2.711  10.025  1.00 77.36  ? 156 GLU A CD    1 
ATOM   1184 O  OE1   . GLU A 1 174 ? 33.457 -1.602  9.726   1.00 77.22  ? 156 GLU A OE1   1 
ATOM   1185 O  OE2   . GLU A 1 174 ? 35.095 -3.085  9.524   1.00 77.00  ? 156 GLU A OE2   1 
ATOM   1186 N  N     . GLU A 1 175 ? 29.489 -5.582  11.023  1.00 69.84  ? 157 GLU A N     1 
ATOM   1187 C  CA    . GLU A 1 175 ? 28.958 -6.943  11.308  1.00 71.37  ? 157 GLU A CA    1 
ATOM   1188 C  C     . GLU A 1 175 ? 28.338 -7.605  10.078  1.00 71.54  ? 157 GLU A C     1 
ATOM   1189 O  O     . GLU A 1 175 ? 28.455 -8.821  9.891   1.00 72.99  ? 157 GLU A O     1 
ATOM   1190 C  CB    . GLU A 1 175 ? 27.941 -6.922  12.478  1.00 70.20  ? 157 GLU A CB    1 
ATOM   1191 C  CG    . GLU A 1 175 ? 28.527 -6.528  13.853  1.00 70.41  ? 157 GLU A CG    1 
ATOM   1192 C  CD    . GLU A 1 175 ? 28.706 -5.003  14.060  1.00 71.45  ? 157 GLU A CD    1 
ATOM   1193 O  OE1   . GLU A 1 175 ? 28.936 -4.262  13.079  1.00 72.32  ? 157 GLU A OE1   1 
ATOM   1194 O  OE2   . GLU A 1 175 ? 28.617 -4.543  15.222  1.00 70.76  ? 157 GLU A OE2   1 
ATOM   1195 N  N     . LEU A 1 176 ? 27.682 -6.806  9.241   1.00 70.70  ? 158 LEU A N     1 
ATOM   1196 C  CA    . LEU A 1 176 ? 27.130 -7.308  7.994   1.00 70.37  ? 158 LEU A CA    1 
ATOM   1197 C  C     . LEU A 1 176 ? 28.232 -7.952  7.154   1.00 71.92  ? 158 LEU A C     1 
ATOM   1198 O  O     . LEU A 1 176 ? 28.039 -9.017  6.573   1.00 73.35  ? 158 LEU A O     1 
ATOM   1199 C  CB    . LEU A 1 176 ? 26.465 -6.169  7.210   1.00 69.24  ? 158 LEU A CB    1 
ATOM   1200 C  CG    . LEU A 1 176 ? 25.962 -6.453  5.786   1.00 67.87  ? 158 LEU A CG    1 
ATOM   1201 C  CD1   . LEU A 1 176 ? 24.812 -7.443  5.769   1.00 67.38  ? 158 LEU A CD1   1 
ATOM   1202 C  CD2   . LEU A 1 176 ? 25.558 -5.159  5.125   1.00 68.95  ? 158 LEU A CD2   1 
ATOM   1203 N  N     . PHE A 1 177 ? 29.388 -7.296  7.101   1.00 73.12  ? 159 PHE A N     1 
ATOM   1204 C  CA    . PHE A 1 177 ? 30.514 -7.805  6.336   1.00 73.95  ? 159 PHE A CA    1 
ATOM   1205 C  C     . PHE A 1 177 ? 31.280 -8.903  7.060   1.00 74.31  ? 159 PHE A C     1 
ATOM   1206 O  O     . PHE A 1 177 ? 31.836 -9.795  6.420   1.00 75.18  ? 159 PHE A O     1 
ATOM   1207 C  CB    . PHE A 1 177 ? 31.408 -6.660  5.856   1.00 73.56  ? 159 PHE A CB    1 
ATOM   1208 C  CG    . PHE A 1 177 ? 30.758 -5.821  4.796   1.00 73.70  ? 159 PHE A CG    1 
ATOM   1209 C  CD1   . PHE A 1 177 ? 30.005 -4.688  5.142   1.00 73.67  ? 159 PHE A CD1   1 
ATOM   1210 C  CD2   . PHE A 1 177 ? 30.843 -6.187  3.450   1.00 72.50  ? 159 PHE A CD2   1 
ATOM   1211 C  CE1   . PHE A 1 177 ? 29.367 -3.914  4.153   1.00 72.53  ? 159 PHE A CE1   1 
ATOM   1212 C  CE2   . PHE A 1 177 ? 30.214 -5.426  2.466   1.00 72.23  ? 159 PHE A CE2   1 
ATOM   1213 C  CZ    . PHE A 1 177 ? 29.475 -4.277  2.823   1.00 72.04  ? 159 PHE A CZ    1 
ATOM   1214 N  N     . GLN A 1 178 ? 31.300 -8.848  8.387   1.00 74.66  ? 160 GLN A N     1 
ATOM   1215 C  CA    . GLN A 1 178 ? 31.855 -9.949  9.175   1.00 75.97  ? 160 GLN A CA    1 
ATOM   1216 C  C     . GLN A 1 178 ? 31.030 -11.202 8.939   1.00 77.56  ? 160 GLN A C     1 
ATOM   1217 O  O     . GLN A 1 178 ? 31.535 -12.315 9.071   1.00 78.59  ? 160 GLN A O     1 
ATOM   1218 C  CB    . GLN A 1 178 ? 31.856 -9.617  10.654  1.00 74.75  ? 160 GLN A CB    1 
ATOM   1219 C  CG    . GLN A 1 178 ? 33.005 -8.746  11.058  1.00 76.17  ? 160 GLN A CG    1 
ATOM   1220 C  CD    . GLN A 1 178 ? 32.859 -8.180  12.454  1.00 76.88  ? 160 GLN A CD    1 
ATOM   1221 O  OE1   . GLN A 1 178 ? 31.938 -8.540  13.210  1.00 78.15  ? 160 GLN A OE1   1 
ATOM   1222 N  NE2   . GLN A 1 178 ? 33.760 -7.279  12.807  1.00 75.94  ? 160 GLN A NE2   1 
ATOM   1223 N  N     . GLY A 1 179 ? 29.754 -11.009 8.597   1.00 78.36  ? 161 GLY A N     1 
ATOM   1224 C  CA    . GLY A 1 179 ? 28.860 -12.115 8.261   1.00 80.77  ? 161 GLY A CA    1 
ATOM   1225 C  C     . GLY A 1 179 ? 29.290 -12.823 6.979   1.00 81.43  ? 161 GLY A C     1 
ATOM   1226 O  O     . GLY A 1 179 ? 29.339 -14.056 6.926   1.00 83.47  ? 161 GLY A O     1 
ATOM   1227 N  N     . ILE A 1 180 ? 29.596 -12.038 5.949   1.00 80.28  ? 162 ILE A N     1 
ATOM   1228 C  CA    . ILE A 1 180 ? 30.123 -12.563 4.691   1.00 79.85  ? 162 ILE A CA    1 
ATOM   1229 C  C     . ILE A 1 180 ? 31.469 -13.289 4.922   1.00 80.26  ? 162 ILE A C     1 
ATOM   1230 O  O     . ILE A 1 180 ? 31.638 -14.443 4.504   1.00 80.74  ? 162 ILE A O     1 
ATOM   1231 C  CB    . ILE A 1 180 ? 30.280 -11.438 3.664   1.00 79.78  ? 162 ILE A CB    1 
ATOM   1232 C  CG1   . ILE A 1 180 ? 28.893 -10.893 3.280   1.00 80.53  ? 162 ILE A CG1   1 
ATOM   1233 C  CG2   . ILE A 1 180 ? 31.039 -11.923 2.438   1.00 78.33  ? 162 ILE A CG2   1 
ATOM   1234 C  CD1   . ILE A 1 180 ? 28.923 -9.506  2.653   1.00 80.48  ? 162 ILE A CD1   1 
ATOM   1235 N  N     . SER A 1 181 ? 32.403 -12.611 5.598   1.00 79.25  ? 163 SER A N     1 
ATOM   1236 C  CA    . SER A 1 181 ? 33.710 -13.176 5.931   1.00 78.15  ? 163 SER A CA    1 
ATOM   1237 C  C     . SER A 1 181 ? 33.625 -14.532 6.631   1.00 79.57  ? 163 SER A C     1 
ATOM   1238 O  O     . SER A 1 181 ? 34.343 -15.454 6.272   1.00 80.77  ? 163 SER A O     1 
ATOM   1239 C  CB    . SER A 1 181 ? 34.495 -12.209 6.794   1.00 77.40  ? 163 SER A CB    1 
ATOM   1240 O  OG    . SER A 1 181 ? 34.980 -11.135 6.030   1.00 78.63  ? 163 SER A OG    1 
ATOM   1241 N  N     . ARG A 1 182 ? 32.735 -14.647 7.618   1.00 81.56  ? 164 ARG A N     1 
ATOM   1242 C  CA    . ARG A 1 182 ? 32.573 -15.884 8.396   1.00 82.69  ? 164 ARG A CA    1 
ATOM   1243 C  C     . ARG A 1 182 ? 32.159 -17.097 7.538   1.00 85.58  ? 164 ARG A C     1 
ATOM   1244 O  O     . ARG A 1 182 ? 32.610 -18.215 7.795   1.00 86.36  ? 164 ARG A O     1 
ATOM   1245 C  CB    . ARG A 1 182 ? 31.591 -15.673 9.558   1.00 81.11  ? 164 ARG A CB    1 
ATOM   1246 N  N     . GLN A 1 183 ? 31.325 -16.867 6.518   1.00 87.73  ? 165 GLN A N     1 
ATOM   1247 C  CA    . GLN A 1 183 ? 30.835 -17.948 5.634   1.00 90.84  ? 165 GLN A CA    1 
ATOM   1248 C  C     . GLN A 1 183 ? 31.771 -18.325 4.463   1.00 91.62  ? 165 GLN A C     1 
ATOM   1249 O  O     . GLN A 1 183 ? 31.298 -18.772 3.409   1.00 91.16  ? 165 GLN A O     1 
ATOM   1250 C  CB    . GLN A 1 183 ? 29.471 -17.591 5.059   1.00 92.72  ? 165 GLN A CB    1 
ATOM   1251 C  CG    . GLN A 1 183 ? 28.337 -17.625 6.021   1.00 96.35  ? 165 GLN A CG    1 
ATOM   1252 C  CD    . GLN A 1 183 ? 27.020 -17.231 5.351   1.00 99.59  ? 165 GLN A CD    1 
ATOM   1253 O  OE1   . GLN A 1 183 ? 26.708 -17.675 4.236   1.00 100.08 ? 165 GLN A OE1   1 
ATOM   1254 N  NE2   . GLN A 1 183 ? 26.240 -16.395 6.032   1.00 101.50 ? 165 GLN A NE2   1 
ATOM   1255 N  N     . ILE A 1 184 ? 33.080 -18.150 4.648   1.00 92.94  ? 166 ILE A N     1 
ATOM   1256 C  CA    . ILE A 1 184 ? 34.072 -18.460 3.607   1.00 93.37  ? 166 ILE A CA    1 
ATOM   1257 C  C     . ILE A 1 184 ? 35.360 -19.132 4.213   1.00 94.36  ? 166 ILE A C     1 
ATOM   1258 O  O     . ILE A 1 184 ? 35.952 -18.591 5.170   1.00 93.35  ? 166 ILE A O     1 
ATOM   1259 C  CB    . ILE A 1 184 ? 34.410 -17.168 2.751   1.00 93.46  ? 166 ILE A CB    1 
ATOM   1260 C  CG1   . ILE A 1 184 ? 33.175 -16.702 1.964   1.00 92.72  ? 166 ILE A CG1   1 
ATOM   1261 C  CG2   . ILE A 1 184 ? 35.564 -17.420 1.795   1.00 94.53  ? 166 ILE A CG2   1 
ATOM   1262 C  CD1   . ILE A 1 184 ? 33.331 -15.393 1.261   1.00 92.50  ? 166 ILE A CD1   1 
ATOM   1263 N  N     . PRO A 1 185 ? 35.778 -20.315 3.654   1.00 94.96  ? 167 PRO A N     1 
ATOM   1264 C  CA    . PRO A 1 185 ? 36.970 -21.117 4.068   1.00 93.84  ? 167 PRO A CA    1 
ATOM   1265 C  C     . PRO A 1 185 ? 38.234 -20.293 4.347   1.00 92.96  ? 167 PRO A C     1 
ATOM   1266 O  O     . PRO A 1 185 ? 39.226 -20.828 4.856   1.00 89.74  ? 167 PRO A O     1 
ATOM   1267 C  CB    . PRO A 1 185 ? 37.216 -22.034 2.851   1.00 94.70  ? 167 PRO A CB    1 
ATOM   1268 C  CG    . PRO A 1 185 ? 36.203 -21.572 1.774   1.00 94.72  ? 167 PRO A CG    1 
ATOM   1269 C  CD    . PRO A 1 185 ? 35.079 -20.967 2.531   1.00 95.13  ? 167 PRO A CD    1 
HETATM 1270 MG MG    . MG  B 2 .   ? 22.501 4.352   -4.434  1.00 51.98  ? 301 MG  A MG    1 
HETATM 1271 P  PG    . GNP C 3 .   ? 19.619 3.930   -5.184  1.00 72.88  ? 302 GNP A PG    1 
HETATM 1272 O  O1G   . GNP C 3 .   ? 18.662 4.813   -5.972  1.00 72.73  ? 302 GNP A O1G   1 
HETATM 1273 O  O2G   . GNP C 3 .   ? 21.054 4.058   -5.638  1.00 71.30  ? 302 GNP A O2G   1 
HETATM 1274 O  O3G   . GNP C 3 .   ? 19.042 2.524   -5.246  1.00 71.99  ? 302 GNP A O3G   1 
HETATM 1275 N  N3B   . GNP C 3 .   ? 19.557 4.359   -3.625  1.00 66.03  ? 302 GNP A N3B   1 
HETATM 1276 P  PB    . GNP C 3 .   ? 20.062 3.448   -2.424  1.00 59.17  ? 302 GNP A PB    1 
HETATM 1277 O  O1B   . GNP C 3 .   ? 19.327 2.171   -2.362  1.00 59.93  ? 302 GNP A O1B   1 
HETATM 1278 O  O2B   . GNP C 3 .   ? 21.523 3.362   -2.542  1.00 59.15  ? 302 GNP A O2B   1 
HETATM 1279 O  O3A   . GNP C 3 .   ? 19.743 4.171   -1.115  1.00 59.03  ? 302 GNP A O3A   1 
HETATM 1280 P  PA    . GNP C 3 .   ? 20.573 5.355   -0.601  1.00 57.12  ? 302 GNP A PA    1 
HETATM 1281 O  O1A   . GNP C 3 .   ? 21.761 4.866   0.157   1.00 56.37  ? 302 GNP A O1A   1 
HETATM 1282 O  O2A   . GNP C 3 .   ? 20.822 6.278   -1.708  1.00 54.12  ? 302 GNP A O2A   1 
HETATM 1283 O  "O5'" . GNP C 3 .   ? 19.705 6.082   0.489   1.00 54.29  ? 302 GNP A "O5'" 1 
HETATM 1284 C  "C5'" . GNP C 3 .   ? 18.404 6.537   0.203   1.00 54.84  ? 302 GNP A "C5'" 1 
HETATM 1285 C  "C4'" . GNP C 3 .   ? 17.946 7.513   1.274   1.00 54.88  ? 302 GNP A "C4'" 1 
HETATM 1286 O  "O4'" . GNP C 3 .   ? 17.822 6.816   2.549   1.00 55.89  ? 302 GNP A "O4'" 1 
HETATM 1287 C  "C3'" . GNP C 3 .   ? 18.901 8.668   1.525   1.00 54.59  ? 302 GNP A "C3'" 1 
HETATM 1288 O  "O3'" . GNP C 3 .   ? 18.189 9.810   1.888   1.00 58.39  ? 302 GNP A "O3'" 1 
HETATM 1289 C  "C2'" . GNP C 3 .   ? 19.724 8.163   2.698   1.00 55.50  ? 302 GNP A "C2'" 1 
HETATM 1290 O  "O2'" . GNP C 3 .   ? 20.371 9.176   3.452   1.00 54.62  ? 302 GNP A "O2'" 1 
HETATM 1291 C  "C1'" . GNP C 3 .   ? 18.650 7.446   3.513   1.00 55.12  ? 302 GNP A "C1'" 1 
HETATM 1292 N  N9    . GNP C 3 .   ? 19.196 6.429   4.403   1.00 54.87  ? 302 GNP A N9    1 
HETATM 1293 C  C8    . GNP C 3 .   ? 20.088 5.436   4.067   1.00 54.59  ? 302 GNP A C8    1 
HETATM 1294 N  N7    . GNP C 3 .   ? 20.430 4.674   5.068   1.00 55.33  ? 302 GNP A N7    1 
HETATM 1295 C  C5    . GNP C 3 .   ? 19.708 5.188   6.139   1.00 54.96  ? 302 GNP A C5    1 
HETATM 1296 C  C6    . GNP C 3 .   ? 19.653 4.772   7.484   1.00 54.35  ? 302 GNP A C6    1 
HETATM 1297 O  O6    . GNP C 3 .   ? 20.241 3.837   8.031   1.00 56.65  ? 302 GNP A O6    1 
HETATM 1298 N  N1    . GNP C 3 .   ? 18.812 5.556   8.246   1.00 54.86  ? 302 GNP A N1    1 
HETATM 1299 C  C2    . GNP C 3 .   ? 18.095 6.624   7.775   1.00 54.85  ? 302 GNP A C2    1 
HETATM 1300 N  N2    . GNP C 3 .   ? 17.343 7.252   8.687   1.00 54.72  ? 302 GNP A N2    1 
HETATM 1301 N  N3    . GNP C 3 .   ? 18.128 7.041   6.506   1.00 54.58  ? 302 GNP A N3    1 
HETATM 1302 C  C4    . GNP C 3 .   ? 18.951 6.279   5.745   1.00 55.02  ? 302 GNP A C4    1 
HETATM 1303 O  O     . HOH D 4 .   ? 22.606 6.566   -3.260  1.00 60.34  ? 401 HOH A O     1 
HETATM 1304 O  O     . HOH D 4 .   ? 22.899 2.144   -5.303  1.00 61.93  ? 402 HOH A O     1 
HETATM 1305 O  O     . HOH D 4 .   ? 15.005 -4.065  -1.667  1.00 58.55  ? 403 HOH A O     1 
HETATM 1306 O  O     . HOH D 4 .   ? 25.063 12.983  -2.912  1.00 69.36  ? 404 HOH A O     1 
HETATM 1307 O  O     . HOH D 4 .   ? 40.327 -2.184  -0.100  1.00 68.93  ? 405 HOH A O     1 
HETATM 1308 O  O     . HOH D 4 .   ? 38.109 2.011   4.763   1.00 68.15  ? 406 HOH A O     1 
HETATM 1309 O  O     . HOH D 4 .   ? 19.285 4.672   -8.860  1.00 65.78  ? 407 HOH A O     1 
HETATM 1310 O  O     . HOH D 4 .   ? 13.004 -6.164  9.744   1.00 44.84  ? 408 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -17 ?   ?   ?   A . n 
A 1 2   GLY 2   -16 ?   ?   ?   A . n 
A 1 3   SER 3   -15 ?   ?   ?   A . n 
A 1 4   SER 4   -14 ?   ?   ?   A . n 
A 1 5   HIS 5   -13 ?   ?   ?   A . n 
A 1 6   HIS 6   -12 ?   ?   ?   A . n 
A 1 7   HIS 7   -11 ?   ?   ?   A . n 
A 1 8   HIS 8   -10 ?   ?   ?   A . n 
A 1 9   HIS 9   -9  ?   ?   ?   A . n 
A 1 10  HIS 10  -8  ?   ?   ?   A . n 
A 1 11  SER 11  -7  ?   ?   ?   A . n 
A 1 12  SER 12  -6  ?   ?   ?   A . n 
A 1 13  GLY 13  -5  ?   ?   ?   A . n 
A 1 14  LEU 14  -4  ?   ?   ?   A . n 
A 1 15  VAL 15  -3  ?   ?   ?   A . n 
A 1 16  PRO 16  -2  ?   ?   ?   A . n 
A 1 17  ARG 17  -1  ?   ?   ?   A . n 
A 1 18  GLY 18  0   ?   ?   ?   A . n 
A 1 19  SER 19  1   ?   ?   ?   A . n 
A 1 20  ALA 20  2   ?   ?   ?   A . n 
A 1 21  ILE 21  3   3   ILE ILE A . n 
A 1 22  ARG 22  4   4   ARG ARG A . n 
A 1 23  GLU 23  5   5   GLU GLU A . n 
A 1 24  LEU 24  6   6   LEU LEU A . n 
A 1 25  LYS 25  7   7   LYS LYS A . n 
A 1 26  VAL 26  8   8   VAL VAL A . n 
A 1 27  CYS 27  9   9   CYS CYS A . n 
A 1 28  LEU 28  10  10  LEU LEU A . n 
A 1 29  LEU 29  11  11  LEU LEU A . n 
A 1 30  GLY 30  12  12  GLY GLY A . n 
A 1 31  ASP 31  13  13  ASP ASP A . n 
A 1 32  THR 32  14  14  THR THR A . n 
A 1 33  GLY 33  15  15  GLY GLY A . n 
A 1 34  VAL 34  16  16  VAL VAL A . n 
A 1 35  GLY 35  17  17  GLY GLY A . n 
A 1 36  LYS 36  18  18  LYS LYS A . n 
A 1 37  SER 37  19  19  SER SER A . n 
A 1 38  SER 38  20  20  SER SER A . n 
A 1 39  ILE 39  21  21  ILE ILE A . n 
A 1 40  VAL 40  22  22  VAL VAL A . n 
A 1 41  CYS 41  23  23  CYS CYS A . n 
A 1 42  ARG 42  24  24  ARG ARG A . n 
A 1 43  PHE 43  25  25  PHE PHE A . n 
A 1 44  VAL 44  26  26  VAL VAL A . n 
A 1 45  GLN 45  27  27  GLN GLN A . n 
A 1 46  ASP 46  28  28  ASP ASP A . n 
A 1 47  HIS 47  29  29  HIS HIS A . n 
A 1 48  PHE 48  30  30  PHE PHE A . n 
A 1 49  ASP 49  31  31  ASP ASP A . n 
A 1 50  HIS 50  32  32  HIS HIS A . n 
A 1 51  ASN 51  33  33  ASN ASN A . n 
A 1 52  ILE 52  34  34  ILE ILE A . n 
A 1 53  SER 53  35  35  SER SER A . n 
A 1 54  PRO 54  36  36  PRO PRO A . n 
A 1 55  THR 55  37  37  THR THR A . n 
A 1 56  ILE 56  38  38  ILE ILE A . n 
A 1 57  GLY 57  39  39  GLY GLY A . n 
A 1 58  ALA 58  40  40  ALA ALA A . n 
A 1 59  SER 59  41  41  SER SER A . n 
A 1 60  PHE 60  42  42  PHE PHE A . n 
A 1 61  MET 61  43  43  MET MET A . n 
A 1 62  THR 62  44  44  THR THR A . n 
A 1 63  LYS 63  45  45  LYS LYS A . n 
A 1 64  THR 64  46  46  THR THR A . n 
A 1 65  VAL 65  47  47  VAL VAL A . n 
A 1 66  PRO 66  48  48  PRO PRO A . n 
A 1 67  CYS 67  49  49  CYS CYS A . n 
A 1 68  GLY 68  50  50  GLY GLY A . n 
A 1 69  ASN 69  51  51  ASN ASN A . n 
A 1 70  GLU 70  52  52  GLU GLU A . n 
A 1 71  LEU 71  53  53  LEU LEU A . n 
A 1 72  HIS 72  54  54  HIS HIS A . n 
A 1 73  LYS 73  55  55  LYS LYS A . n 
A 1 74  PHE 74  56  56  PHE PHE A . n 
A 1 75  LEU 75  57  57  LEU LEU A . n 
A 1 76  ILE 76  58  58  ILE ILE A . n 
A 1 77  TRP 77  59  59  TRP TRP A . n 
A 1 78  ASP 78  60  60  ASP ASP A . n 
A 1 79  THR 79  61  61  THR THR A . n 
A 1 80  ALA 80  62  62  ALA ALA A . n 
A 1 81  GLY 81  63  63  GLY GLY A . n 
A 1 82  GLN 82  64  64  GLN GLN A . n 
A 1 83  GLU 83  65  65  GLU GLU A . n 
A 1 84  ARG 84  66  66  ARG ARG A . n 
A 1 85  PHE 85  67  67  PHE PHE A . n 
A 1 86  HIS 86  68  68  HIS HIS A . n 
A 1 87  SER 87  69  69  SER SER A . n 
A 1 88  LEU 88  70  70  LEU LEU A . n 
A 1 89  ALA 89  71  71  ALA ALA A . n 
A 1 90  PRO 90  72  72  PRO PRO A . n 
A 1 91  MET 91  73  73  MET MET A . n 
A 1 92  TYR 92  74  74  TYR TYR A . n 
A 1 93  TYR 93  75  75  TYR TYR A . n 
A 1 94  ARG 94  76  76  ARG ARG A . n 
A 1 95  GLY 95  77  77  GLY GLY A . n 
A 1 96  SER 96  78  78  SER SER A . n 
A 1 97  ALA 97  79  79  ALA ALA A . n 
A 1 98  ALA 98  80  80  ALA ALA A . n 
A 1 99  ALA 99  81  81  ALA ALA A . n 
A 1 100 VAL 100 82  82  VAL VAL A . n 
A 1 101 ILE 101 83  83  ILE ILE A . n 
A 1 102 VAL 102 84  84  VAL VAL A . n 
A 1 103 TYR 103 85  85  TYR TYR A . n 
A 1 104 ASP 104 86  86  ASP ASP A . n 
A 1 105 ILE 105 87  87  ILE ILE A . n 
A 1 106 THR 106 88  88  THR THR A . n 
A 1 107 LYS 107 89  89  LYS LYS A . n 
A 1 108 GLN 108 90  90  GLN GLN A . n 
A 1 109 ASP 109 91  91  ASP ASP A . n 
A 1 110 SER 110 92  92  SER SER A . n 
A 1 111 PHE 111 93  93  PHE PHE A . n 
A 1 112 TYR 112 94  94  TYR TYR A . n 
A 1 113 THR 113 95  95  THR THR A . n 
A 1 114 LEU 114 96  96  LEU LEU A . n 
A 1 115 LYS 115 97  97  LYS LYS A . n 
A 1 116 LYS 116 98  98  LYS LYS A . n 
A 1 117 TRP 117 99  99  TRP TRP A . n 
A 1 118 VAL 118 100 100 VAL VAL A . n 
A 1 119 LYS 119 101 101 LYS LYS A . n 
A 1 120 GLU 120 102 102 GLU GLU A . n 
A 1 121 LEU 121 103 103 LEU LEU A . n 
A 1 122 LYS 122 104 104 LYS LYS A . n 
A 1 123 GLU 123 105 105 GLU GLU A . n 
A 1 124 HIS 124 106 106 HIS HIS A . n 
A 1 125 GLY 125 107 107 GLY GLY A . n 
A 1 126 PRO 126 108 108 PRO PRO A . n 
A 1 127 GLU 127 109 109 GLU GLU A . n 
A 1 128 ASN 128 110 110 ASN ASN A . n 
A 1 129 ILE 129 111 111 ILE ILE A . n 
A 1 130 VAL 130 112 112 VAL VAL A . n 
A 1 131 MET 131 113 113 MET MET A . n 
A 1 132 ALA 132 114 114 ALA ALA A . n 
A 1 133 ILE 133 115 115 ILE ILE A . n 
A 1 134 ALA 134 116 116 ALA ALA A . n 
A 1 135 GLY 135 117 117 GLY GLY A . n 
A 1 136 ASN 136 118 118 ASN ASN A . n 
A 1 137 LYS 137 119 119 LYS LYS A . n 
A 1 138 CYS 138 120 120 CYS CYS A . n 
A 1 139 ASP 139 121 121 ASP ASP A . n 
A 1 140 LEU 140 122 122 LEU LEU A . n 
A 1 141 SER 141 123 123 SER SER A . n 
A 1 142 ASP 142 124 124 ASP ASP A . n 
A 1 143 ILE 143 125 125 ILE ILE A . n 
A 1 144 ARG 144 126 126 ARG ARG A . n 
A 1 145 GLU 145 127 127 GLU GLU A . n 
A 1 146 VAL 146 128 128 VAL VAL A . n 
A 1 147 PRO 147 129 129 PRO PRO A . n 
A 1 148 LEU 148 130 130 LEU LEU A . n 
A 1 149 LYS 149 131 131 LYS LYS A . n 
A 1 150 ASP 150 132 132 ASP ASP A . n 
A 1 151 ALA 151 133 133 ALA ALA A . n 
A 1 152 LYS 152 134 134 LYS LYS A . n 
A 1 153 GLU 153 135 135 GLU GLU A . n 
A 1 154 TYR 154 136 136 TYR TYR A . n 
A 1 155 ALA 155 137 137 ALA ALA A . n 
A 1 156 GLU 156 138 138 GLU GLU A . n 
A 1 157 SER 157 139 139 SER SER A . n 
A 1 158 ILE 158 140 140 ILE ILE A . n 
A 1 159 GLY 159 141 141 GLY GLY A . n 
A 1 160 ALA 160 142 142 ALA ALA A . n 
A 1 161 ILE 161 143 143 ILE ILE A . n 
A 1 162 VAL 162 144 144 VAL VAL A . n 
A 1 163 VAL 163 145 145 VAL VAL A . n 
A 1 164 GLU 164 146 146 GLU GLU A . n 
A 1 165 THR 165 147 147 THR THR A . n 
A 1 166 SER 166 148 148 SER SER A . n 
A 1 167 ALA 167 149 149 ALA ALA A . n 
A 1 168 LYS 168 150 150 LYS LYS A . n 
A 1 169 ASN 169 151 151 ASN ASN A . n 
A 1 170 ALA 170 152 152 ALA ALA A . n 
A 1 171 ILE 171 153 153 ILE ILE A . n 
A 1 172 ASN 172 154 154 ASN ASN A . n 
A 1 173 ILE 173 155 155 ILE ILE A . n 
A 1 174 GLU 174 156 156 GLU GLU A . n 
A 1 175 GLU 175 157 157 GLU GLU A . n 
A 1 176 LEU 176 158 158 LEU LEU A . n 
A 1 177 PHE 177 159 159 PHE PHE A . n 
A 1 178 GLN 178 160 160 GLN GLN A . n 
A 1 179 GLY 179 161 161 GLY GLY A . n 
A 1 180 ILE 180 162 162 ILE ILE A . n 
A 1 181 SER 181 163 163 SER SER A . n 
A 1 182 ARG 182 164 164 ARG ARG A . n 
A 1 183 GLN 183 165 165 GLN GLN A . n 
A 1 184 ILE 184 166 166 ILE ILE A . n 
A 1 185 PRO 185 167 167 PRO PRO A . n 
A 1 186 PRO 186 168 ?   ?   ?   A . n 
A 1 187 LEU 187 169 ?   ?   ?   A . n 
A 1 188 ASP 188 170 ?   ?   ?   A . n 
A 1 189 PRO 189 171 ?   ?   ?   A . n 
A 1 190 HIS 190 172 ?   ?   ?   A . n 
A 1 191 GLU 191 173 ?   ?   ?   A . n 
A 1 192 ASN 192 174 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1 301 301 MG  MG  A . 
C 3 GNP 1 302 302 GNP GNP A . 
D 4 HOH 1 401 401 HOH HOH A . 
D 4 HOH 2 402 402 HOH HOH A . 
D 4 HOH 3 403 403 HOH HOH A . 
D 4 HOH 4 404 404 HOH HOH A . 
D 4 HOH 5 405 405 HOH HOH A . 
D 4 HOH 6 406 406 HOH HOH A . 
D 4 HOH 7 407 407 HOH HOH A . 
D 4 HOH 8 408 408 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  N3B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .  ? A HOH 402 ? 1_555 104.9 ? 
2  N3B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2B ? C GNP .  ? A GNP 302 ? 1_555 52.1  ? 
3  O   ? D HOH .  ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2B ? C GNP .  ? A GNP 302 ? 1_555 88.5  ? 
4  N3B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OG1 ? A THR 55 ? A THR 37  ? 1_555 139.6 ? 
5  O   ? D HOH .  ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OG1 ? A THR 55 ? A THR 37  ? 1_555 73.9  ? 
6  O2B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OG1 ? A THR 55 ? A THR 37  ? 1_555 160.6 ? 
7  N3B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2G ? C GNP .  ? A GNP 302 ? 1_555 55.6  ? 
8  O   ? D HOH .  ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2G ? C GNP .  ? A GNP 302 ? 1_555 75.9  ? 
9  O2B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2G ? C GNP .  ? A GNP 302 ? 1_555 97.3  ? 
10 OG1 ? A THR 55 ? A THR 37  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2G ? C GNP .  ? A GNP 302 ? 1_555 86.2  ? 
11 N3B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OG  ? A SER 37 ? A SER 19  ? 1_555 131.6 ? 
12 O   ? D HOH .  ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OG  ? A SER 37 ? A SER 19  ? 1_555 83.4  ? 
13 O2B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OG  ? A SER 37 ? A SER 19  ? 1_555 81.2  ? 
14 OG1 ? A THR 55 ? A THR 37  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OG  ? A SER 37 ? A SER 19  ? 1_555 88.8  ? 
15 O2G ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OG  ? A SER 37 ? A SER 19  ? 1_555 159.2 ? 
16 N3B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .  ? A HOH 401 ? 1_555 85.1  ? 
17 O   ? D HOH .  ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .  ? A HOH 401 ? 1_555 166.5 ? 
18 O2B ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .  ? A HOH 401 ? 1_555 90.7  ? 
19 OG1 ? A THR 55 ? A THR 37  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .  ? A HOH 401 ? 1_555 104.6 ? 
20 O2G ? C GNP .  ? A GNP 302 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .  ? A HOH 401 ? 1_555 117.6 ? 
21 OG  ? A SER 37 ? A SER 19  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .  ? A HOH 401 ? 1_555 83.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-01-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
_phasing.method   mr 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .               ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?       ? 1 
SCALEPACK   .               ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?       ? 2 
PHASER      .               ?               ?       'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?       ? 3 
REFMAC      refmac_5.2.0019 24/04/2001      ?       'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran ? 4 
PDB_EXTRACT 1.700           'Jul. 11, 2005' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++     ? 5 
# 
_pdbx_database_remark.id     300 
_pdbx_database_remark.text   
;BIOMOLECULE:
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT
WHICH CONSISTS OF 1 CHAIN(S). THE BIOLOGICAL MOLECULE
FOR THE PROTEIN IS UNKNOWN.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 51  ? ? -111.13 51.70  
2 1 ILE A 87  ? ? -57.39  -9.88  
3 1 PRO A 108 ? ? -31.76  128.60 
4 1 ASN A 110 ? ? -111.39 78.71  
5 1 LEU A 122 ? ? -95.88  44.73  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 65  ? CD  ? A GLU 83  CD  
2  1 Y 1 A GLU 65  ? OE1 ? A GLU 83  OE1 
3  1 Y 1 A GLU 65  ? OE2 ? A GLU 83  OE2 
4  1 Y 1 A LYS 98  ? CG  ? A LYS 116 CG  
5  1 Y 1 A LYS 98  ? CD  ? A LYS 116 CD  
6  1 Y 1 A LYS 98  ? CE  ? A LYS 116 CE  
7  1 Y 1 A LYS 98  ? NZ  ? A LYS 116 NZ  
8  1 Y 1 A GLU 105 ? CG  ? A GLU 123 CG  
9  1 Y 1 A GLU 105 ? CD  ? A GLU 123 CD  
10 1 Y 1 A GLU 105 ? OE1 ? A GLU 123 OE1 
11 1 Y 1 A GLU 105 ? OE2 ? A GLU 123 OE2 
12 1 Y 1 A GLU 109 ? CG  ? A GLU 127 CG  
13 1 Y 1 A GLU 109 ? CD  ? A GLU 127 CD  
14 1 Y 1 A GLU 109 ? OE1 ? A GLU 127 OE1 
15 1 Y 1 A GLU 109 ? OE2 ? A GLU 127 OE2 
16 1 Y 1 A ASN 110 ? CG  ? A ASN 128 CG  
17 1 Y 1 A ASN 110 ? OD1 ? A ASN 128 OD1 
18 1 Y 1 A ASN 110 ? ND2 ? A ASN 128 ND2 
19 1 Y 1 A LYS 131 ? CD  ? A LYS 149 CD  
20 1 Y 1 A LYS 131 ? CE  ? A LYS 149 CE  
21 1 Y 1 A LYS 131 ? NZ  ? A LYS 149 NZ  
22 1 Y 1 A ARG 164 ? CG  ? A ARG 182 CG  
23 1 Y 1 A ARG 164 ? CD  ? A ARG 182 CD  
24 1 Y 1 A ARG 164 ? NE  ? A ARG 182 NE  
25 1 Y 1 A ARG 164 ? CZ  ? A ARG 182 CZ  
26 1 Y 1 A ARG 164 ? NH1 ? A ARG 182 NH1 
27 1 Y 1 A ARG 164 ? NH2 ? A ARG 182 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -17 ? A MET 1   
2  1 Y 1 A GLY -16 ? A GLY 2   
3  1 Y 1 A SER -15 ? A SER 3   
4  1 Y 1 A SER -14 ? A SER 4   
5  1 Y 1 A HIS -13 ? A HIS 5   
6  1 Y 1 A HIS -12 ? A HIS 6   
7  1 Y 1 A HIS -11 ? A HIS 7   
8  1 Y 1 A HIS -10 ? A HIS 8   
9  1 Y 1 A HIS -9  ? A HIS 9   
10 1 Y 1 A HIS -8  ? A HIS 10  
11 1 Y 1 A SER -7  ? A SER 11  
12 1 Y 1 A SER -6  ? A SER 12  
13 1 Y 1 A GLY -5  ? A GLY 13  
14 1 Y 1 A LEU -4  ? A LEU 14  
15 1 Y 1 A VAL -3  ? A VAL 15  
16 1 Y 1 A PRO -2  ? A PRO 16  
17 1 Y 1 A ARG -1  ? A ARG 17  
18 1 Y 1 A GLY 0   ? A GLY 18  
19 1 Y 1 A SER 1   ? A SER 19  
20 1 Y 1 A ALA 2   ? A ALA 20  
21 1 Y 1 A PRO 168 ? A PRO 186 
22 1 Y 1 A LEU 169 ? A LEU 187 
23 1 Y 1 A ASP 170 ? A ASP 188 
24 1 Y 1 A PRO 171 ? A PRO 189 
25 1 Y 1 A HIS 172 ? A HIS 190 
26 1 Y 1 A GLU 173 ? A GLU 191 
27 1 Y 1 A ASN 174 ? A ASN 192 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                               MG  
3 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' GNP 
4 water                                         HOH 
#