data_2FIB
# 
_entry.id   2FIB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FIB         
WWPDB D_1000178092 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FIB 
_pdbx_database_status.recvd_initial_deposition_date   1997-06-03 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pratt, K.P.'    1 
'Cote, H.C.F.'   2 
'Chung, D.W.'    3 
'Stenkamp, R.E.' 4 
'Davie, E.W.'    5 
# 
_citation.id                        primary 
_citation.title                     
;The primary fibrin polymerization pocket: three-dimensional structure of a 30-kDa C-terminal gamma chain fragment complexed with the peptide Gly-Pro-Arg-Pro.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            94 
_citation.page_first                7176 
_citation.page_last                 7181 
_citation.year                      1997 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9207064 
_citation.pdbx_database_id_DOI      10.1073/pnas.94.14.7176 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pratt, K.P.'    1 
primary 'Cote, H.C.'     2 
primary 'Chung, D.W.'    3 
primary 'Stenkamp, R.E.' 4 
primary 'Davie, E.W.'    5 
# 
_cell.entry_id           2FIB 
_cell.length_a           37.330 
_cell.length_b           68.200 
_cell.length_c           47.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.02 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2FIB 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man FIBRINOGEN      30243.422 1   ? ? 'GAMMA CHAIN, CARBOXYL TERMINAL FRAGMENT RESIDUES 143 - 411' ? 
2 polymer     man GLY-PRO-ARG-PRO 426.490   1   ? ? ?                                                            ? 
3 non-polymer syn 'CALCIUM ION'   40.078    1   ? ? ?                                                            ? 
4 water       nat water           18.015    115 ? ? ?                                                            ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTG
TTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDK
FFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKT
TMKIIPFNRLTIGEGQQHHLGGAKQAGDV
;
;VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTG
TTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDK
FFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKT
TMKIIPFNRLTIGEGQQHHLGGAKQAGDV
;
A ? 
2 'polypeptide(L)' no no GPRP GPRP B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   GLN n 
1 3   ILE n 
1 4   HIS n 
1 5   ASP n 
1 6   ILE n 
1 7   THR n 
1 8   GLY n 
1 9   LYS n 
1 10  ASP n 
1 11  CYS n 
1 12  GLN n 
1 13  ASP n 
1 14  ILE n 
1 15  ALA n 
1 16  ASN n 
1 17  LYS n 
1 18  GLY n 
1 19  ALA n 
1 20  LYS n 
1 21  GLN n 
1 22  SER n 
1 23  GLY n 
1 24  LEU n 
1 25  TYR n 
1 26  PHE n 
1 27  ILE n 
1 28  LYS n 
1 29  PRO n 
1 30  LEU n 
1 31  LYS n 
1 32  ALA n 
1 33  ASN n 
1 34  GLN n 
1 35  GLN n 
1 36  PHE n 
1 37  LEU n 
1 38  VAL n 
1 39  TYR n 
1 40  CYS n 
1 41  GLU n 
1 42  ILE n 
1 43  ASP n 
1 44  GLY n 
1 45  SER n 
1 46  GLY n 
1 47  ASN n 
1 48  GLY n 
1 49  TRP n 
1 50  THR n 
1 51  VAL n 
1 52  PHE n 
1 53  GLN n 
1 54  LYS n 
1 55  ARG n 
1 56  LEU n 
1 57  ASP n 
1 58  GLY n 
1 59  SER n 
1 60  VAL n 
1 61  ASP n 
1 62  PHE n 
1 63  LYS n 
1 64  LYS n 
1 65  ASN n 
1 66  TRP n 
1 67  ILE n 
1 68  GLN n 
1 69  TYR n 
1 70  LYS n 
1 71  GLU n 
1 72  GLY n 
1 73  PHE n 
1 74  GLY n 
1 75  HIS n 
1 76  LEU n 
1 77  SER n 
1 78  PRO n 
1 79  THR n 
1 80  GLY n 
1 81  THR n 
1 82  THR n 
1 83  GLU n 
1 84  PHE n 
1 85  TRP n 
1 86  LEU n 
1 87  GLY n 
1 88  ASN n 
1 89  GLU n 
1 90  LYS n 
1 91  ILE n 
1 92  HIS n 
1 93  LEU n 
1 94  ILE n 
1 95  SER n 
1 96  THR n 
1 97  GLN n 
1 98  SER n 
1 99  ALA n 
1 100 ILE n 
1 101 PRO n 
1 102 TYR n 
1 103 ALA n 
1 104 LEU n 
1 105 ARG n 
1 106 VAL n 
1 107 GLU n 
1 108 LEU n 
1 109 GLU n 
1 110 ASP n 
1 111 TRP n 
1 112 ASN n 
1 113 GLY n 
1 114 ARG n 
1 115 THR n 
1 116 SER n 
1 117 THR n 
1 118 ALA n 
1 119 ASP n 
1 120 TYR n 
1 121 ALA n 
1 122 MET n 
1 123 PHE n 
1 124 LYS n 
1 125 VAL n 
1 126 GLY n 
1 127 PRO n 
1 128 GLU n 
1 129 ALA n 
1 130 ASP n 
1 131 LYS n 
1 132 TYR n 
1 133 ARG n 
1 134 LEU n 
1 135 THR n 
1 136 TYR n 
1 137 ALA n 
1 138 TYR n 
1 139 PHE n 
1 140 ALA n 
1 141 GLY n 
1 142 GLY n 
1 143 ASP n 
1 144 ALA n 
1 145 GLY n 
1 146 ASP n 
1 147 ALA n 
1 148 PHE n 
1 149 ASP n 
1 150 GLY n 
1 151 PHE n 
1 152 ASP n 
1 153 PHE n 
1 154 GLY n 
1 155 ASP n 
1 156 ASP n 
1 157 PRO n 
1 158 SER n 
1 159 ASP n 
1 160 LYS n 
1 161 PHE n 
1 162 PHE n 
1 163 THR n 
1 164 SER n 
1 165 HIS n 
1 166 ASN n 
1 167 GLY n 
1 168 MET n 
1 169 GLN n 
1 170 PHE n 
1 171 SER n 
1 172 THR n 
1 173 TRP n 
1 174 ASP n 
1 175 ASN n 
1 176 ASP n 
1 177 ASN n 
1 178 ASP n 
1 179 LYS n 
1 180 PHE n 
1 181 GLU n 
1 182 GLY n 
1 183 ASN n 
1 184 CYS n 
1 185 ALA n 
1 186 GLU n 
1 187 GLN n 
1 188 ASP n 
1 189 GLY n 
1 190 SER n 
1 191 GLY n 
1 192 TRP n 
1 193 TRP n 
1 194 MET n 
1 195 ASN n 
1 196 LYS n 
1 197 CYS n 
1 198 HIS n 
1 199 ALA n 
1 200 GLY n 
1 201 HIS n 
1 202 LEU n 
1 203 ASN n 
1 204 GLY n 
1 205 VAL n 
1 206 TYR n 
1 207 TYR n 
1 208 GLN n 
1 209 GLY n 
1 210 GLY n 
1 211 THR n 
1 212 TYR n 
1 213 SER n 
1 214 LYS n 
1 215 ALA n 
1 216 SER n 
1 217 THR n 
1 218 PRO n 
1 219 ASN n 
1 220 GLY n 
1 221 TYR n 
1 222 ASP n 
1 223 ASN n 
1 224 GLY n 
1 225 ILE n 
1 226 ILE n 
1 227 TRP n 
1 228 ALA n 
1 229 THR n 
1 230 TRP n 
1 231 LYS n 
1 232 THR n 
1 233 ARG n 
1 234 TRP n 
1 235 TYR n 
1 236 SER n 
1 237 MET n 
1 238 LYS n 
1 239 LYS n 
1 240 THR n 
1 241 THR n 
1 242 MET n 
1 243 LYS n 
1 244 ILE n 
1 245 ILE n 
1 246 PRO n 
1 247 PHE n 
1 248 ASN n 
1 249 ARG n 
1 250 LEU n 
1 251 THR n 
1 252 ILE n 
1 253 GLY n 
1 254 GLU n 
1 255 GLY n 
1 256 GLN n 
1 257 GLN n 
1 258 HIS n 
1 259 HIS n 
1 260 LEU n 
1 261 GLY n 
1 262 GLY n 
1 263 ALA n 
1 264 LYS n 
1 265 GLN n 
1 266 ALA n 
1 267 GLY n 
1 268 ASP n 
1 269 VAL n 
2 1   GLY n 
2 2   PRO n 
2 3   ARG n 
2 4   PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'HUMAN FIBRINOGEN GAMMA CHAIN CDNA ENCODING VAL 143 - VAL 411' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    'BLOOD PLASMA' 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                BLOOD 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     Pichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPIC9K 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP FIBG_HUMAN 1 P02679 1 
;MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKT
SEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRIMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQ
CQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFD
FGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKT
RWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQAGDV
;
? 
2 PDB 2FIB       2 2FIB   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2FIB A 1 ? 269 ? P02679 169 ? 437 ? 143 411 
2 2 2FIB B 1 ? 4   ? 2FIB   2   ? 5   ? 2   5   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2FIB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.91 
_exptl_crystal.density_percent_sol   35.52 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    'room temp' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLIZED FROM 12% PEG8000, 70MM CACL2, 0.1 M MES, PH 6.0, 0.02%NAN3, ROOM TEMPERATURE, SITTING DROPS. THE CRYSTAL WAS SOAKED OVERNIGHT IN THE ORIGINAL SOLUTION PLUS 0.01M GLY-PRO-ARG-PRO (SIGMA), THEN BACK-SOAKED FOR 10 MINUTES., vapor diffusion - sitting drop
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           300 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1995-09 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2FIB 
_reflns.observed_criterion_sigma_I   3. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             68.2 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   12275 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         76.9 
_reflns.pdbx_Rmerge_I_obs            0.054 
_reflns.pdbx_Rsym_value              0.052 
_reflns.pdbx_netI_over_sigmaI        11. 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.01 
_reflns_shell.d_res_low              2.25 
_reflns_shell.percent_possible_all   61.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.17 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2FIB 
_refine.ls_number_reflns_obs                     12275 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            2.01 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.186 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.186 
_refine.ls_R_factor_R_free                       0.282 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  1205 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               23.5 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;MODIFIED TOPOLOGY AND PARAMETER FILES WERE CREATED SO THAT X-PLOR WOULD ACCEPT A CIS PEPTIDE BOND THAT DID NOT PRECEDE A PROLINE RESIDUE. THE PDB INPUT FILE FOR X-PLOR SHOULD SPECIFY CYS 339 AS CCY 339.

THE BACKBONE ANGLES PHI AND PSI OF ASN 337 ARE STRAINED.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1FIB' 
_refine.pdbx_method_to_determine_struct          'ISOMORPHOUS WITH PDB ENTRY 1FIB' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2034 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             117 
_refine_hist.number_atoms_total               2152 
_refine_hist.d_res_high                       2.01 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.903 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      24.43 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.13  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.1 
_refine_ls_shell.d_res_low                        10. 
_refine_ls_shell.number_reflns_R_work             380 
_refine_ls_shell.R_factor_R_work                  0.2542 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3957 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             39 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM.CALCIUM   TOPCISPEP.PRO    'X-RAY DIFFRACTION' 
2 PARAM.TIPS3P    TOPOLOGY.CALCIUM 'X-RAY DIFFRACTION' 
3 PARAMCISPEP.PRO TOPOLOGY.TIPS3P  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2FIB 
_struct.title                     
'RECOMBINANT HUMAN GAMMA-FIBRINOGEN CARBOXYL TERMINAL FRAGMENT (RESIDUES 143-411) COMPLEXED TO THE PEPTIDE GLY-PRO-ARG-PRO AT PH 6.0' 
_struct.pdbx_descriptor           'FIBRINOGEN, GLY-PRO-ARG-PRO' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FIB 
_struct_keywords.pdbx_keywords   'COMPLEX (BLOOD COAGULATION/PEPTIDE)' 
_struct_keywords.text            
;FIBRINOGEN, BLOOD COAGULATION, FIBRIN POLYMERIZATION, COMPLEX (BLOOD COAGULATION-PEPTIDE), COMPLEX (BLOOD COAGULATION-PEPTIDE) complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 11  ? ASN A 16  ? CYS A 153 ASN A 158 1 ? 6 
HELX_P HELX_P2  2  TRP A 66  ? GLU A 71  ? TRP A 208 GLU A 213 1 ? 6 
HELX_P HELX_P3  3  ASN A 88  ? SER A 95  ? ASN A 230 SER A 237 1 ? 8 
HELX_P HELX_P4  4  GLN A 97  ? ALA A 99  ? GLN A 239 ALA A 241 5 ? 3 
HELX_P HELX_P5  5  GLU A 128 ? ASP A 130 ? GLU A 270 ASP A 272 5 ? 3 
HELX_P HELX_P6  6  ALA A 147 ? ASP A 149 ? ALA A 289 ASP A 291 5 ? 3 
HELX_P HELX_P7  7  ASP A 159 ? THR A 163 ? ASP A 301 THR A 305 1 ? 5 
HELX_P HELX_P8  8  CYS A 184 ? ASP A 188 ? CYS A 326 ASP A 330 1 ? 5 
HELX_P HELX_P9  9  LYS A 214 ? SER A 216 ? LYS A 356 SER A 358 5 ? 3 
HELX_P HELX_P10 10 PHE A 247 ? ARG A 249 ? PHE A 389 ARG A 391 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 11  SG ? ? ? 1_555 A CYS 40  SG  ? ? A CYS 153 A CYS 182 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? A CYS 184 SG ? ? ? 1_555 A CYS 197 SG  ? ? A CYS 326 A CYS 339 1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc1 metalc ? ? C CA  .   CA ? ? ? 1_555 A PHE 180 O   ? ? A CA  412 A PHE 322 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc2 metalc ? ? C CA  .   CA ? ? ? 1_555 A GLY 182 O   ? ? A CA  412 A GLY 324 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc3 metalc ? ? C CA  .   CA ? ? ? 1_555 A ASP 176 OD2 ? ? A CA  412 A ASP 318 1_555 ? ? ? ? ? ? ? 2.404 ? 
metalc4 metalc ? ? C CA  .   CA ? ? ? 1_555 A ASP 178 OD1 ? ? A CA  412 A ASP 320 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc5 metalc ? ? C CA  .   CA ? ? ? 1_555 D HOH .   O   ? ? A CA  412 A HOH 414 1_555 ? ? ? ? ? ? ? 2.472 ? 
metalc6 metalc ? ? C CA  .   CA ? ? ? 1_555 A ASP 176 OD1 ? ? A CA  412 A ASP 318 1_555 ? ? ? ? ? ? ? 2.962 ? 
metalc7 metalc ? ? C CA  .   CA ? ? ? 1_555 D HOH .   O   ? ? A CA  412 A HOH 413 1_555 ? ? ? ? ? ? ? 2.542 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           196 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            338 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   CYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    197 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    CYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     339 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.53 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 138 ? GLY A 141 ? TYR A 280 GLY A 283 
A 2 THR A 115 ? ALA A 121 ? THR A 257 ALA A 263 
A 3 TYR A 102 ? GLU A 109 ? TYR A 244 GLU A 251 
A 4 LYS A 239 ? PRO A 246 ? LYS A 381 PRO A 388 
A 5 GLY A 48  ? ARG A 55  ? GLY A 190 ARG A 197 
A 6 PHE A 36  ? ILE A 42  ? PHE A 178 ILE A 184 
A 7 GLY A 23  ? ILE A 27  ? GLY A 165 ILE A 169 
A 8 ILE A 3   ? GLY A 8   ? ILE A 145 GLY A 150 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 138 ? O TYR A 280 N ALA A 121 ? N ALA A 263 
A 2 3 O SER A 116 ? O SER A 258 N LEU A 108 ? N LEU A 250 
A 3 4 O ALA A 103 ? O ALA A 245 N ILE A 245 ? N ILE A 387 
A 4 5 O THR A 240 ? O THR A 382 N ARG A 55  ? N ARG A 197 
A 5 6 O TRP A 49  ? O TRP A 191 N GLU A 41  ? N GLU A 183 
A 6 7 O PHE A 36  ? O PHE A 178 N ILE A 27  ? N ILE A 169 
A 7 8 O LEU A 24  ? O LEU A 166 N HIS A 4   ? N HIS A 146 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE CA A 412' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 ASP A 176 ? ASP A 318 . ? 1_555 ? 
2 AC1 6 ASP A 178 ? ASP A 320 . ? 1_555 ? 
3 AC1 6 PHE A 180 ? PHE A 322 . ? 1_555 ? 
4 AC1 6 GLY A 182 ? GLY A 324 . ? 1_555 ? 
5 AC1 6 HOH D .   ? HOH A 413 . ? 1_555 ? 
6 AC1 6 HOH D .   ? HOH A 414 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FIB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FIB 
_atom_sites.fract_transf_matrix[1][1]   0.026788 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007188 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014663 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021752 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 1   ? -4.527  24.791 55.511 0.80 50.15 ? 143 VAL A N   1 
ATOM   2    C  CA  . VAL A 1 1   ? -3.232  24.861 54.761 0.80 50.13 ? 143 VAL A CA  1 
ATOM   3    C  C   . VAL A 1 1   ? -2.124  24.520 55.766 0.80 49.99 ? 143 VAL A C   1 
ATOM   4    O  O   . VAL A 1 1   ? -2.368  24.519 56.974 0.80 50.05 ? 143 VAL A O   1 
ATOM   5    C  CB  . VAL A 1 1   ? -3.015  26.289 54.094 0.80 50.12 ? 143 VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 1   ? -2.781  27.369 55.149 0.80 49.89 ? 143 VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 1   ? -1.877  26.251 53.056 0.80 50.00 ? 143 VAL A CG2 1 
ATOM   8    N  N   . GLN A 1 2   ? -0.936  24.183 55.277 0.80 49.81 ? 144 GLN A N   1 
ATOM   9    C  CA  . GLN A 1 2   ? 0.170   23.847 56.165 0.80 49.45 ? 144 GLN A CA  1 
ATOM   10   C  C   . GLN A 1 2   ? 1.488   23.811 55.389 0.80 48.98 ? 144 GLN A C   1 
ATOM   11   O  O   . GLN A 1 2   ? 1.953   22.743 54.977 0.80 48.92 ? 144 GLN A O   1 
ATOM   12   C  CB  . GLN A 1 2   ? -0.097  22.498 56.840 0.80 49.68 ? 144 GLN A CB  1 
ATOM   13   C  CG  . GLN A 1 2   ? 0.896   22.110 57.927 0.80 50.01 ? 144 GLN A CG  1 
ATOM   14   C  CD  . GLN A 1 2   ? 0.773   20.642 58.324 0.80 50.19 ? 144 GLN A CD  1 
ATOM   15   O  OE1 . GLN A 1 2   ? -0.140  19.939 57.881 0.80 50.23 ? 144 GLN A OE1 1 
ATOM   16   N  NE2 . GLN A 1 2   ? 1.697   20.172 59.158 0.80 50.23 ? 144 GLN A NE2 1 
ATOM   17   N  N   . ILE A 1 3   ? 2.058   24.989 55.150 0.80 48.31 ? 145 ILE A N   1 
ATOM   18   C  CA  . ILE A 1 3   ? 3.329   25.087 54.440 0.80 47.58 ? 145 ILE A CA  1 
ATOM   19   C  C   . ILE A 1 3   ? 4.428   24.928 55.484 0.80 46.98 ? 145 ILE A C   1 
ATOM   20   O  O   . ILE A 1 3   ? 4.318   25.466 56.592 0.80 46.94 ? 145 ILE A O   1 
ATOM   21   C  CB  . ILE A 1 3   ? 3.540   26.462 53.769 0.80 47.66 ? 145 ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1 3   ? 2.208   27.123 53.431 0.80 47.63 ? 145 ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1 3   ? 4.406   26.305 52.535 0.80 47.70 ? 145 ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1 3   ? 1.754   28.108 54.486 0.80 47.62 ? 145 ILE A CD1 1 
ATOM   25   N  N   . HIS A 1 4   ? 5.489   24.219 55.118 0.80 46.23 ? 146 HIS A N   1 
ATOM   26   C  CA  . HIS A 1 4   ? 6.614   23.981 56.012 0.80 45.48 ? 146 HIS A CA  1 
ATOM   27   C  C   . HIS A 1 4   ? 7.608   25.156 55.933 0.80 45.13 ? 146 HIS A C   1 
ATOM   28   O  O   . HIS A 1 4   ? 7.727   25.812 54.891 0.80 45.10 ? 146 HIS A O   1 
ATOM   29   C  CB  . HIS A 1 4   ? 7.296   22.652 55.665 0.80 45.21 ? 146 HIS A CB  1 
ATOM   30   C  CG  . HIS A 1 4   ? 6.411   21.447 55.797 0.80 44.86 ? 146 HIS A CG  1 
ATOM   31   N  ND1 . HIS A 1 4   ? 6.811   20.292 56.436 0.80 44.79 ? 146 HIS A ND1 1 
ATOM   32   C  CD2 . HIS A 1 4   ? 5.156   21.203 55.346 0.80 44.89 ? 146 HIS A CD2 1 
ATOM   33   C  CE1 . HIS A 1 4   ? 5.846   19.393 56.374 0.80 44.64 ? 146 HIS A CE1 1 
ATOM   34   N  NE2 . HIS A 1 4   ? 4.831   19.921 55.716 0.80 44.61 ? 146 HIS A NE2 1 
ATOM   35   N  N   . ASP A 1 5   ? 8.305   25.406 57.048 1.00 44.67 ? 147 ASP A N   1 
ATOM   36   C  CA  . ASP A 1 5   ? 9.280   26.507 57.191 1.00 43.99 ? 147 ASP A CA  1 
ATOM   37   C  C   . ASP A 1 5   ? 10.548  26.482 56.338 1.00 43.10 ? 147 ASP A C   1 
ATOM   38   O  O   . ASP A 1 5   ? 10.970  27.526 55.819 1.00 43.09 ? 147 ASP A O   1 
ATOM   39   C  CB  . ASP A 1 5   ? 9.679   26.684 58.664 1.00 44.55 ? 147 ASP A CB  1 
ATOM   40   C  CG  . ASP A 1 5   ? 8.941   27.828 59.329 1.00 45.00 ? 147 ASP A CG  1 
ATOM   41   O  OD1 . ASP A 1 5   ? 8.588   28.798 58.616 1.00 45.48 ? 147 ASP A OD1 1 
ATOM   42   O  OD2 . ASP A 1 5   ? 8.720   27.760 60.560 1.00 45.45 ? 147 ASP A OD2 1 
ATOM   43   N  N   . ILE A 1 6   ? 11.199  25.319 56.273 1.00 41.72 ? 148 ILE A N   1 
ATOM   44   C  CA  . ILE A 1 6   ? 12.406  25.169 55.473 1.00 39.94 ? 148 ILE A CA  1 
ATOM   45   C  C   . ILE A 1 6   ? 12.115  25.580 54.020 1.00 38.96 ? 148 ILE A C   1 
ATOM   46   O  O   . ILE A 1 6   ? 11.114  25.167 53.422 1.00 38.97 ? 148 ILE A O   1 
ATOM   47   C  CB  . ILE A 1 6   ? 12.928  23.718 55.510 1.00 39.71 ? 148 ILE A CB  1 
ATOM   48   C  CG1 . ILE A 1 6   ? 13.264  23.315 56.946 1.00 39.57 ? 148 ILE A CG1 1 
ATOM   49   C  CG2 . ILE A 1 6   ? 14.143  23.569 54.602 1.00 39.52 ? 148 ILE A CG2 1 
ATOM   50   C  CD1 . ILE A 1 6   ? 13.716  21.876 57.096 1.00 39.40 ? 148 ILE A CD1 1 
ATOM   51   N  N   . THR A 1 7   ? 12.960  26.453 53.493 1.00 37.47 ? 149 THR A N   1 
ATOM   52   C  CA  . THR A 1 7   ? 12.822  26.918 52.131 1.00 36.13 ? 149 THR A CA  1 
ATOM   53   C  C   . THR A 1 7   ? 14.121  26.597 51.369 1.00 34.82 ? 149 THR A C   1 
ATOM   54   O  O   . THR A 1 7   ? 15.102  26.151 51.970 1.00 34.69 ? 149 THR A O   1 
ATOM   55   C  CB  . THR A 1 7   ? 12.554  28.422 52.113 1.00 36.45 ? 149 THR A CB  1 
ATOM   56   O  OG1 . THR A 1 7   ? 12.334  28.841 50.769 1.00 36.86 ? 149 THR A OG1 1 
ATOM   57   C  CG2 . THR A 1 7   ? 13.744  29.192 52.688 1.00 36.81 ? 149 THR A CG2 1 
ATOM   58   N  N   . GLY A 1 8   ? 14.127  26.806 50.057 1.00 33.31 ? 150 GLY A N   1 
ATOM   59   C  CA  . GLY A 1 8   ? 15.317  26.530 49.270 1.00 31.37 ? 150 GLY A CA  1 
ATOM   60   C  C   . GLY A 1 8   ? 15.139  26.932 47.822 1.00 29.99 ? 150 GLY A C   1 
ATOM   61   O  O   . GLY A 1 8   ? 14.143  27.584 47.494 1.00 29.86 ? 150 GLY A O   1 
ATOM   62   N  N   . LYS A 1 9   ? 16.111  26.574 46.972 1.00 28.54 ? 151 LYS A N   1 
ATOM   63   C  CA  . LYS A 1 9   ? 16.078  26.886 45.533 1.00 26.86 ? 151 LYS A CA  1 
ATOM   64   C  C   . LYS A 1 9   ? 15.076  25.955 44.851 1.00 25.35 ? 151 LYS A C   1 
ATOM   65   O  O   . LYS A 1 9   ? 14.455  26.319 43.855 1.00 24.61 ? 151 LYS A O   1 
ATOM   66   C  CB  . LYS A 1 9   ? 17.475  26.731 44.906 1.00 27.37 ? 151 LYS A CB  1 
ATOM   67   C  CG  . LYS A 1 9   ? 18.089  25.346 45.089 1.00 28.11 ? 151 LYS A CG  1 
ATOM   68   C  CD  . LYS A 1 9   ? 19.361  25.126 44.275 1.00 28.35 ? 151 LYS A CD  1 
ATOM   69   C  CE  . LYS A 1 9   ? 20.036  23.801 44.685 1.00 28.89 ? 151 LYS A CE  1 
ATOM   70   N  NZ  . LYS A 1 9   ? 19.207  22.545 44.451 1.00 28.72 ? 151 LYS A NZ  1 
ATOM   71   N  N   . ASP A 1 10  ? 14.945  24.759 45.428 1.00 23.99 ? 152 ASP A N   1 
ATOM   72   C  CA  . ASP A 1 10  ? 14.039  23.713 44.987 1.00 22.86 ? 152 ASP A CA  1 
ATOM   73   C  C   . ASP A 1 10  ? 13.815  22.735 46.134 1.00 22.16 ? 152 ASP A C   1 
ATOM   74   O  O   . ASP A 1 10  ? 14.322  22.972 47.238 1.00 21.86 ? 152 ASP A O   1 
ATOM   75   C  CB  . ASP A 1 10  ? 14.518  23.002 43.694 1.00 22.54 ? 152 ASP A CB  1 
ATOM   76   C  CG  . ASP A 1 10  ? 15.891  22.345 43.806 1.00 22.31 ? 152 ASP A CG  1 
ATOM   77   O  OD1 . ASP A 1 10  ? 16.164  21.567 44.729 1.00 22.50 ? 152 ASP A OD1 1 
ATOM   78   O  OD2 . ASP A 1 10  ? 16.697  22.527 42.885 1.00 22.33 ? 152 ASP A OD2 1 
ATOM   79   N  N   . CYS A 1 11  ? 13.083  21.647 45.866 1.00 21.46 ? 153 CYS A N   1 
ATOM   80   C  CA  . CYS A 1 11  ? 12.773  20.610 46.855 1.00 21.06 ? 153 CYS A CA  1 
ATOM   81   C  C   . CYS A 1 11  ? 13.948  19.724 47.261 1.00 21.25 ? 153 CYS A C   1 
ATOM   82   O  O   . CYS A 1 11  ? 13.844  18.985 48.220 1.00 20.89 ? 153 CYS A O   1 
ATOM   83   C  CB  . CYS A 1 11  ? 11.626  19.715 46.383 1.00 20.39 ? 153 CYS A CB  1 
ATOM   84   S  SG  . CYS A 1 11  ? 9.995   20.521 46.338 1.00 20.31 ? 153 CYS A SG  1 
ATOM   85   N  N   . GLN A 1 12  ? 15.011  19.706 46.468 1.00 21.64 ? 154 GLN A N   1 
ATOM   86   C  CA  . GLN A 1 12  ? 16.188  18.927 46.814 1.00 22.23 ? 154 GLN A CA  1 
ATOM   87   C  C   . GLN A 1 12  ? 16.992  19.704 47.852 1.00 22.91 ? 154 GLN A C   1 
ATOM   88   O  O   . GLN A 1 12  ? 17.568  19.118 48.772 1.00 23.41 ? 154 GLN A O   1 
ATOM   89   C  CB  . GLN A 1 12  ? 17.058  18.672 45.596 1.00 21.86 ? 154 GLN A CB  1 
ATOM   90   C  CG  . GLN A 1 12  ? 18.192  17.741 45.895 1.00 21.47 ? 154 GLN A CG  1 
ATOM   91   C  CD  . GLN A 1 12  ? 17.708  16.507 46.578 1.00 21.58 ? 154 GLN A CD  1 
ATOM   92   O  OE1 . GLN A 1 12  ? 16.681  15.956 46.208 1.00 22.06 ? 154 GLN A OE1 1 
ATOM   93   N  NE2 . GLN A 1 12  ? 18.395  16.098 47.623 1.00 21.89 ? 154 GLN A NE2 1 
ATOM   94   N  N   . ASP A 1 13  ? 17.050  21.021 47.683 1.00 23.60 ? 155 ASP A N   1 
ATOM   95   C  CA  . ASP A 1 13  ? 17.759  21.911 48.601 1.00 24.52 ? 155 ASP A CA  1 
ATOM   96   C  C   . ASP A 1 13  ? 17.048  21.773 49.945 1.00 24.74 ? 155 ASP A C   1 
ATOM   97   O  O   . ASP A 1 13  ? 17.678  21.694 51.011 1.00 25.14 ? 155 ASP A O   1 
ATOM   98   C  CB  . ASP A 1 13  ? 17.650  23.350 48.094 1.00 25.49 ? 155 ASP A CB  1 
ATOM   99   C  CG  . ASP A 1 13  ? 18.735  24.271 48.639 1.00 26.38 ? 155 ASP A CG  1 
ATOM   100  O  OD1 . ASP A 1 13  ? 19.739  23.794 49.233 1.00 27.45 ? 155 ASP A OD1 1 
ATOM   101  O  OD2 . ASP A 1 13  ? 18.585  25.498 48.447 1.00 26.66 ? 155 ASP A OD2 1 
ATOM   102  N  N   . ILE A 1 14  ? 15.724  21.711 49.867 1.00 24.57 ? 156 ILE A N   1 
ATOM   103  C  CA  . ILE A 1 14  ? 14.875  21.541 51.035 1.00 24.40 ? 156 ILE A CA  1 
ATOM   104  C  C   . ILE A 1 14  ? 15.211  20.223 51.767 1.00 24.19 ? 156 ILE A C   1 
ATOM   105  O  O   . ILE A 1 14  ? 15.401  20.223 52.982 1.00 24.51 ? 156 ILE A O   1 
ATOM   106  C  CB  . ILE A 1 14  ? 13.349  21.648 50.627 1.00 24.07 ? 156 ILE A CB  1 
ATOM   107  C  CG1 . ILE A 1 14  ? 12.969  23.121 50.431 1.00 23.99 ? 156 ILE A CG1 1 
ATOM   108  C  CG2 . ILE A 1 14  ? 12.444  20.981 51.637 1.00 23.94 ? 156 ILE A CG2 1 
ATOM   109  C  CD1 . ILE A 1 14  ? 11.575  23.338 49.970 1.00 23.47 ? 156 ILE A CD1 1 
ATOM   110  N  N   . ALA A 1 15  ? 15.347  19.121 51.037 1.00 23.88 ? 157 ALA A N   1 
ATOM   111  C  CA  . ALA A 1 15  ? 15.667  17.841 51.661 1.00 23.51 ? 157 ALA A CA  1 
ATOM   112  C  C   . ALA A 1 15  ? 17.076  17.840 52.237 1.00 23.52 ? 157 ALA A C   1 
ATOM   113  O  O   . ALA A 1 15  ? 17.353  17.208 53.255 1.00 23.50 ? 157 ALA A O   1 
ATOM   114  C  CB  . ALA A 1 15  ? 15.503  16.707 50.667 1.00 23.37 ? 157 ALA A CB  1 
ATOM   115  N  N   . ASN A 1 16  ? 17.968  18.565 51.593 1.00 23.48 ? 158 ASN A N   1 
ATOM   116  C  CA  . ASN A 1 16  ? 19.337  18.630 52.053 1.00 23.76 ? 158 ASN A CA  1 
ATOM   117  C  C   . ASN A 1 16  ? 19.456  19.258 53.439 1.00 24.05 ? 158 ASN A C   1 
ATOM   118  O  O   . ASN A 1 16  ? 20.342  18.897 54.221 1.00 24.23 ? 158 ASN A O   1 
ATOM   119  C  CB  . ASN A 1 16  ? 20.193  19.387 51.044 1.00 23.56 ? 158 ASN A CB  1 
ATOM   120  C  CG  . ASN A 1 16  ? 20.452  18.587 49.798 1.00 23.41 ? 158 ASN A CG  1 
ATOM   121  O  OD1 . ASN A 1 16  ? 20.228  17.368 49.770 1.00 23.24 ? 158 ASN A OD1 1 
ATOM   122  N  ND2 . ASN A 1 16  ? 20.920  19.263 48.746 1.00 23.37 ? 158 ASN A ND2 1 
ATOM   123  N  N   . LYS A 1 17  ? 18.549  20.181 53.741 1.00 24.24 ? 159 LYS A N   1 
ATOM   124  C  CA  . LYS A 1 17  ? 18.538  20.855 55.031 1.00 24.41 ? 159 LYS A CA  1 
ATOM   125  C  C   . LYS A 1 17  ? 17.806  20.071 56.116 1.00 24.95 ? 159 LYS A C   1 
ATOM   126  O  O   . LYS A 1 17  ? 17.565  20.600 57.188 1.00 25.37 ? 159 LYS A O   1 
ATOM   127  C  CB  . LYS A 1 17  ? 17.926  22.241 54.909 1.00 23.75 ? 159 LYS A CB  1 
ATOM   128  C  CG  . LYS A 1 17  ? 18.577  23.108 53.898 1.00 23.50 ? 159 LYS A CG  1 
ATOM   129  C  CD  . LYS A 1 17  ? 17.897  24.443 53.864 1.00 23.48 ? 159 LYS A CD  1 
ATOM   130  C  CE  . LYS A 1 17  ? 18.506  25.364 52.828 1.00 23.20 ? 159 LYS A CE  1 
ATOM   131  N  NZ  . LYS A 1 17  ? 17.993  26.754 53.044 1.00 24.27 ? 159 LYS A NZ  1 
ATOM   132  N  N   . GLY A 1 18  ? 17.428  18.828 55.849 1.00 25.64 ? 160 GLY A N   1 
ATOM   133  C  CA  . GLY A 1 18  ? 16.748  18.058 56.877 1.00 26.50 ? 160 GLY A CA  1 
ATOM   134  C  C   . GLY A 1 18  ? 15.247  17.793 56.810 1.00 26.94 ? 160 GLY A C   1 
ATOM   135  O  O   . GLY A 1 18  ? 14.748  16.986 57.587 1.00 27.24 ? 160 GLY A O   1 
ATOM   136  N  N   . ALA A 1 19  ? 14.515  18.459 55.922 1.00 27.23 ? 161 ALA A N   1 
ATOM   137  C  CA  . ALA A 1 19  ? 13.077  18.229 55.813 1.00 27.31 ? 161 ALA A CA  1 
ATOM   138  C  C   . ALA A 1 19  ? 12.893  16.775 55.423 1.00 27.50 ? 161 ALA A C   1 
ATOM   139  O  O   . ALA A 1 19  ? 13.600  16.301 54.541 1.00 27.53 ? 161 ALA A O   1 
ATOM   140  C  CB  . ALA A 1 19  ? 12.482  19.139 54.752 1.00 27.26 ? 161 ALA A CB  1 
ATOM   141  N  N   . LYS A 1 20  ? 12.006  16.051 56.113 1.00 27.77 ? 162 LYS A N   1 
ATOM   142  C  CA  . LYS A 1 20  ? 11.764  14.639 55.787 1.00 28.47 ? 162 LYS A CA  1 
ATOM   143  C  C   . LYS A 1 20  ? 10.308  14.287 55.443 1.00 28.57 ? 162 LYS A C   1 
ATOM   144  O  O   . LYS A 1 20  ? 10.013  13.146 55.065 1.00 28.64 ? 162 LYS A O   1 
ATOM   145  C  CB  . LYS A 1 20  ? 12.295  13.733 56.903 1.00 29.13 ? 162 LYS A CB  1 
ATOM   146  C  CG  . LYS A 1 20  ? 13.779  13.939 57.113 1.00 30.26 ? 162 LYS A CG  1 
ATOM   147  C  CD  . LYS A 1 20  ? 14.423  12.988 58.090 1.00 31.26 ? 162 LYS A CD  1 
ATOM   148  C  CE  . LYS A 1 20  ? 15.951  13.255 58.186 1.00 31.89 ? 162 LYS A CE  1 
ATOM   149  N  NZ  . LYS A 1 20  ? 16.371  14.616 58.701 1.00 32.10 ? 162 LYS A NZ  1 
ATOM   150  N  N   . GLN A 1 21  ? 9.436   15.299 55.477 1.00 28.67 ? 163 GLN A N   1 
ATOM   151  C  CA  . GLN A 1 21  ? 8.001   15.140 55.203 1.00 28.58 ? 163 GLN A CA  1 
ATOM   152  C  C   . GLN A 1 21  ? 7.595   15.715 53.855 1.00 27.43 ? 163 GLN A C   1 
ATOM   153  O  O   . GLN A 1 21  ? 7.982   16.846 53.521 1.00 27.47 ? 163 GLN A O   1 
ATOM   154  C  CB  . GLN A 1 21  ? 7.147   15.889 56.256 1.00 30.02 ? 163 GLN A CB  1 
ATOM   155  C  CG  . GLN A 1 21  ? 7.402   15.578 57.720 1.00 32.28 ? 163 GLN A CG  1 
ATOM   156  C  CD  . GLN A 1 21  ? 7.376   14.086 58.024 1.00 33.89 ? 163 GLN A CD  1 
ATOM   157  O  OE1 . GLN A 1 21  ? 6.852   13.282 57.243 1.00 34.87 ? 163 GLN A OE1 1 
ATOM   158  N  NE2 . GLN A 1 21  ? 7.980   13.702 59.148 1.00 34.67 ? 163 GLN A NE2 1 
ATOM   159  N  N   . SER A 1 22  ? 6.747   14.982 53.129 1.00 25.99 ? 164 SER A N   1 
ATOM   160  C  CA  . SER A 1 22  ? 6.237   15.439 51.841 1.00 24.54 ? 164 SER A CA  1 
ATOM   161  C  C   . SER A 1 22  ? 5.193   16.488 52.167 1.00 24.11 ? 164 SER A C   1 
ATOM   162  O  O   . SER A 1 22  ? 4.468   16.339 53.143 1.00 24.59 ? 164 SER A O   1 
ATOM   163  C  CB  . SER A 1 22  ? 5.563   14.297 51.092 1.00 23.94 ? 164 SER A CB  1 
ATOM   164  O  OG  . SER A 1 22  ? 6.476   13.301 50.680 1.00 22.86 ? 164 SER A OG  1 
ATOM   165  N  N   . GLY A 1 23  ? 5.094   17.541 51.374 1.00 23.35 ? 165 GLY A N   1 
ATOM   166  C  CA  . GLY A 1 23  ? 4.097   18.548 51.668 1.00 22.69 ? 165 GLY A CA  1 
ATOM   167  C  C   . GLY A 1 23  ? 4.319   19.868 50.970 1.00 22.42 ? 165 GLY A C   1 
ATOM   168  O  O   . GLY A 1 23  ? 5.068   19.971 50.001 1.00 22.41 ? 165 GLY A O   1 
ATOM   169  N  N   . LEU A 1 24  ? 3.674   20.895 51.486 1.00 22.16 ? 166 LEU A N   1 
ATOM   170  C  CA  . LEU A 1 24  ? 3.779   22.216 50.924 1.00 22.04 ? 166 LEU A CA  1 
ATOM   171  C  C   . LEU A 1 24  ? 4.976   22.957 51.508 1.00 22.38 ? 166 LEU A C   1 
ATOM   172  O  O   . LEU A 1 24  ? 5.103   23.088 52.730 1.00 22.36 ? 166 LEU A O   1 
ATOM   173  C  CB  . LEU A 1 24  ? 2.482   22.996 51.185 1.00 21.82 ? 166 LEU A CB  1 
ATOM   174  C  CG  . LEU A 1 24  ? 1.208   22.424 50.538 1.00 21.90 ? 166 LEU A CG  1 
ATOM   175  C  CD1 . LEU A 1 24  ? 0.019   23.364 50.744 1.00 21.36 ? 166 LEU A CD1 1 
ATOM   176  C  CD2 . LEU A 1 24  ? 1.463   22.201 49.046 1.00 21.77 ? 166 LEU A CD2 1 
ATOM   177  N  N   . TYR A 1 25  ? 5.871   23.412 50.633 1.00 22.48 ? 167 TYR A N   1 
ATOM   178  C  CA  . TYR A 1 25  ? 7.049   24.167 51.055 1.00 22.51 ? 167 TYR A CA  1 
ATOM   179  C  C   . TYR A 1 25  ? 7.129   25.400 50.177 1.00 22.85 ? 167 TYR A C   1 
ATOM   180  O  O   . TYR A 1 25  ? 6.491   25.478 49.133 1.00 22.91 ? 167 TYR A O   1 
ATOM   181  C  CB  . TYR A 1 25  ? 8.359   23.351 50.874 1.00 21.84 ? 167 TYR A CB  1 
ATOM   182  C  CG  . TYR A 1 25  ? 8.544   22.170 51.797 1.00 20.94 ? 167 TYR A CG  1 
ATOM   183  C  CD1 . TYR A 1 25  ? 7.906   20.974 51.544 1.00 20.87 ? 167 TYR A CD1 1 
ATOM   184  C  CD2 . TYR A 1 25  ? 9.345   22.257 52.933 1.00 20.78 ? 167 TYR A CD2 1 
ATOM   185  C  CE1 . TYR A 1 25  ? 8.045   19.895 52.390 1.00 20.63 ? 167 TYR A CE1 1 
ATOM   186  C  CE2 . TYR A 1 25  ? 9.493   21.173 53.786 1.00 20.00 ? 167 TYR A CE2 1 
ATOM   187  C  CZ  . TYR A 1 25  ? 8.835   20.003 53.504 1.00 20.41 ? 167 TYR A CZ  1 
ATOM   188  O  OH  . TYR A 1 25  ? 8.924   18.914 54.327 1.00 20.71 ? 167 TYR A OH  1 
ATOM   189  N  N   . PHE A 1 26  ? 7.881   26.385 50.630 1.00 23.56 ? 168 PHE A N   1 
ATOM   190  C  CA  . PHE A 1 26  ? 8.097   27.585 49.850 1.00 24.28 ? 168 PHE A CA  1 
ATOM   191  C  C   . PHE A 1 26  ? 9.496   27.407 49.261 1.00 24.53 ? 168 PHE A C   1 
ATOM   192  O  O   . PHE A 1 26  ? 10.379  26.851 49.930 1.00 24.13 ? 168 PHE A O   1 
ATOM   193  C  CB  . PHE A 1 26  ? 8.119   28.820 50.749 1.00 24.77 ? 168 PHE A CB  1 
ATOM   194  C  CG  . PHE A 1 26  ? 6.778   29.442 50.961 1.00 25.04 ? 168 PHE A CG  1 
ATOM   195  C  CD1 . PHE A 1 26  ? 6.205   30.236 49.963 1.00 25.15 ? 168 PHE A CD1 1 
ATOM   196  C  CD2 . PHE A 1 26  ? 6.108   29.284 52.175 1.00 25.07 ? 168 PHE A CD2 1 
ATOM   197  C  CE1 . PHE A 1 26  ? 4.983   30.876 50.168 1.00 25.23 ? 168 PHE A CE1 1 
ATOM   198  C  CE2 . PHE A 1 26  ? 4.889   29.914 52.395 1.00 25.11 ? 168 PHE A CE2 1 
ATOM   199  C  CZ  . PHE A 1 26  ? 4.322   30.716 51.391 1.00 25.11 ? 168 PHE A CZ  1 
ATOM   200  N  N   . ILE A 1 27  ? 9.660   27.794 47.996 1.00 24.93 ? 169 ILE A N   1 
ATOM   201  C  CA  . ILE A 1 27  ? 10.958  27.753 47.314 1.00 25.46 ? 169 ILE A CA  1 
ATOM   202  C  C   . ILE A 1 27  ? 11.063  29.054 46.523 1.00 25.95 ? 169 ILE A C   1 
ATOM   203  O  O   . ILE A 1 27  ? 10.067  29.678 46.225 1.00 25.92 ? 169 ILE A O   1 
ATOM   204  C  CB  . ILE A 1 27  ? 11.181  26.501 46.377 1.00 25.02 ? 169 ILE A CB  1 
ATOM   205  C  CG1 . ILE A 1 27  ? 10.294  26.558 45.143 1.00 24.63 ? 169 ILE A CG1 1 
ATOM   206  C  CG2 . ILE A 1 27  ? 10.983  25.195 47.139 1.00 24.59 ? 169 ILE A CG2 1 
ATOM   207  C  CD1 . ILE A 1 27  ? 10.712  25.574 44.084 1.00 24.54 ? 169 ILE A CD1 1 
ATOM   208  N  N   . LYS A 1 28  ? 12.268  29.497 46.233 1.00 27.18 ? 170 LYS A N   1 
ATOM   209  C  CA  . LYS A 1 28  ? 12.453  30.742 45.505 1.00 28.54 ? 170 LYS A CA  1 
ATOM   210  C  C   . LYS A 1 28  ? 13.652  30.520 44.594 1.00 29.45 ? 170 LYS A C   1 
ATOM   211  O  O   . LYS A 1 28  ? 14.802  30.716 45.010 1.00 29.90 ? 170 LYS A O   1 
ATOM   212  C  CB  . LYS A 1 28  ? 12.769  31.882 46.498 1.00 28.75 ? 170 LYS A CB  1 
ATOM   213  C  CG  . LYS A 1 28  ? 12.556  33.327 45.999 1.00 29.07 ? 170 LYS A CG  1 
ATOM   214  C  CD  . LYS A 1 28  ? 13.405  34.309 46.823 1.00 29.77 ? 170 LYS A CD  1 
ATOM   215  C  CE  . LYS A 1 28  ? 12.702  35.629 47.165 1.00 30.43 ? 170 LYS A CE  1 
ATOM   216  N  NZ  . LYS A 1 28  ? 12.092  35.656 48.558 1.00 30.60 ? 170 LYS A NZ  1 
ATOM   217  N  N   . PRO A 1 29  ? 13.420  29.968 43.397 1.00 30.08 ? 171 PRO A N   1 
ATOM   218  C  CA  . PRO A 1 29  ? 14.527  29.737 42.466 1.00 30.70 ? 171 PRO A CA  1 
ATOM   219  C  C   . PRO A 1 29  ? 15.335  31.000 42.175 1.00 31.24 ? 171 PRO A C   1 
ATOM   220  O  O   . PRO A 1 29  ? 14.826  32.102 42.282 1.00 31.38 ? 171 PRO A O   1 
ATOM   221  C  CB  . PRO A 1 29  ? 13.822  29.195 41.216 1.00 30.54 ? 171 PRO A CB  1 
ATOM   222  C  CG  . PRO A 1 29  ? 12.350  29.486 41.446 1.00 30.20 ? 171 PRO A CG  1 
ATOM   223  C  CD  . PRO A 1 29  ? 12.199  29.313 42.915 1.00 30.16 ? 171 PRO A CD  1 
ATOM   224  N  N   . LEU A 1 30  ? 16.588  30.818 41.786 1.00 32.32 ? 172 LEU A N   1 
ATOM   225  C  CA  . LEU A 1 30  ? 17.523  31.905 41.481 1.00 33.45 ? 172 LEU A CA  1 
ATOM   226  C  C   . LEU A 1 30  ? 16.907  33.195 40.936 1.00 33.93 ? 172 LEU A C   1 
ATOM   227  O  O   . LEU A 1 30  ? 17.232  34.272 41.419 1.00 34.35 ? 172 LEU A O   1 
ATOM   228  C  CB  . LEU A 1 30  ? 18.612  31.407 40.507 1.00 33.81 ? 172 LEU A CB  1 
ATOM   229  C  CG  . LEU A 1 30  ? 20.061  31.924 40.576 1.00 34.07 ? 172 LEU A CG  1 
ATOM   230  C  CD1 . LEU A 1 30  ? 20.765  31.601 39.252 1.00 34.22 ? 172 LEU A CD1 1 
ATOM   231  C  CD2 . LEU A 1 30  ? 20.113  33.425 40.828 1.00 33.95 ? 172 LEU A CD2 1 
ATOM   232  N  N   . LYS A 1 31  ? 16.040  33.108 39.934 1.00 34.64 ? 173 LYS A N   1 
ATOM   233  C  CA  . LYS A 1 31  ? 15.453  34.331 39.383 1.00 35.56 ? 173 LYS A CA  1 
ATOM   234  C  C   . LYS A 1 31  ? 14.017  34.674 39.771 1.00 35.64 ? 173 LYS A C   1 
ATOM   235  O  O   . LYS A 1 31  ? 13.397  35.564 39.184 1.00 35.83 ? 173 LYS A O   1 
ATOM   236  C  CB  . LYS A 1 31  ? 15.650  34.399 37.864 1.00 36.22 ? 173 LYS A CB  1 
ATOM   237  C  CG  . LYS A 1 31  ? 17.091  34.784 37.477 1.00 37.77 ? 173 LYS A CG  1 
ATOM   238  C  CD  . LYS A 1 31  ? 17.527  36.133 38.135 1.00 39.02 ? 173 LYS A CD  1 
ATOM   239  C  CE  . LYS A 1 31  ? 19.054  36.396 38.036 1.00 39.70 ? 173 LYS A CE  1 
ATOM   240  N  NZ  . LYS A 1 31  ? 19.450  37.760 38.537 1.00 39.81 ? 173 LYS A NZ  1 
ATOM   241  N  N   . ALA A 1 32  ? 13.489  33.986 40.772 1.00 35.65 ? 174 ALA A N   1 
ATOM   242  C  CA  . ALA A 1 32  ? 12.145  34.268 41.220 1.00 35.80 ? 174 ALA A CA  1 
ATOM   243  C  C   . ALA A 1 32  ? 12.223  35.537 42.058 1.00 35.94 ? 174 ALA A C   1 
ATOM   244  O  O   . ALA A 1 32  ? 13.059  35.661 42.952 1.00 35.94 ? 174 ALA A O   1 
ATOM   245  C  CB  . ALA A 1 32  ? 11.584  33.108 42.037 1.00 35.64 ? 174 ALA A CB  1 
ATOM   246  N  N   . ASN A 1 33  ? 11.382  36.500 41.711 1.00 36.12 ? 175 ASN A N   1 
ATOM   247  C  CA  . ASN A 1 33  ? 11.319  37.774 42.414 1.00 36.09 ? 175 ASN A CA  1 
ATOM   248  C  C   . ASN A 1 33  ? 10.751  37.436 43.789 1.00 35.58 ? 175 ASN A C   1 
ATOM   249  O  O   . ASN A 1 33  ? 11.128  38.049 44.799 1.00 35.44 ? 175 ASN A O   1 
ATOM   250  C  CB  . ASN A 1 33  ? 10.376  38.760 41.688 1.00 37.11 ? 175 ASN A CB  1 
ATOM   251  C  CG  . ASN A 1 33  ? 10.392  38.603 40.146 1.00 37.94 ? 175 ASN A CG  1 
ATOM   252  O  OD1 . ASN A 1 33  ? 10.156  37.503 39.608 1.00 38.71 ? 175 ASN A OD1 1 
ATOM   253  N  ND2 . ASN A 1 33  ? 10.626  39.712 39.435 1.00 38.04 ? 175 ASN A ND2 1 
ATOM   254  N  N   . GLN A 1 34  ? 9.839   36.458 43.812 1.00 34.80 ? 176 GLN A N   1 
ATOM   255  C  CA  . GLN A 1 34  ? 9.221   36.012 45.055 1.00 33.97 ? 176 GLN A CA  1 
ATOM   256  C  C   . GLN A 1 34  ? 9.008   34.521 45.185 1.00 32.75 ? 176 GLN A C   1 
ATOM   257  O  O   . GLN A 1 34  ? 8.794   33.813 44.202 1.00 32.86 ? 176 GLN A O   1 
ATOM   258  C  CB  . GLN A 1 34  ? 7.905   36.736 45.341 1.00 34.96 ? 176 GLN A CB  1 
ATOM   259  C  CG  . GLN A 1 34  ? 7.750   37.036 46.851 1.00 36.18 ? 176 GLN A CG  1 
ATOM   260  C  CD  . GLN A 1 34  ? 9.055   37.575 47.457 1.00 36.97 ? 176 GLN A CD  1 
ATOM   261  O  OE1 . GLN A 1 34  ? 9.497   38.682 47.123 1.00 37.60 ? 176 GLN A OE1 1 
ATOM   262  N  NE2 . GLN A 1 34  ? 9.697   36.772 48.314 1.00 37.28 ? 176 GLN A NE2 1 
ATOM   263  N  N   . GLN A 1 35  ? 9.089   34.056 46.426 1.00 31.04 ? 177 GLN A N   1 
ATOM   264  C  CA  . GLN A 1 35  ? 8.907   32.652 46.731 1.00 29.37 ? 177 GLN A CA  1 
ATOM   265  C  C   . GLN A 1 35  ? 7.528   32.199 46.332 1.00 27.97 ? 177 GLN A C   1 
ATOM   266  O  O   . GLN A 1 35  ? 6.627   33.014 46.133 1.00 27.94 ? 177 GLN A O   1 
ATOM   267  C  CB  . GLN A 1 35  ? 9.088   32.372 48.219 1.00 29.42 ? 177 GLN A CB  1 
ATOM   268  C  CG  . GLN A 1 35  ? 9.197   33.584 49.103 1.00 30.22 ? 177 GLN A CG  1 
ATOM   269  C  CD  . GLN A 1 35  ? 8.895   33.252 50.536 1.00 30.62 ? 177 GLN A CD  1 
ATOM   270  O  OE1 . GLN A 1 35  ? 7.797   33.524 51.011 1.00 30.96 ? 177 GLN A OE1 1 
ATOM   271  N  NE2 . GLN A 1 35  ? 9.852   32.642 51.232 1.00 30.58 ? 177 GLN A NE2 1 
ATOM   272  N  N   . PHE A 1 36  ? 7.373   30.890 46.235 1.00 26.16 ? 178 PHE A N   1 
ATOM   273  C  CA  . PHE A 1 36  ? 6.104   30.308 45.891 1.00 24.50 ? 178 PHE A CA  1 
ATOM   274  C  C   . PHE A 1 36  ? 5.983   28.912 46.443 1.00 23.70 ? 178 PHE A C   1 
ATOM   275  O  O   . PHE A 1 36  ? 6.980   28.262 46.769 1.00 23.22 ? 178 PHE A O   1 
ATOM   276  C  CB  . PHE A 1 36  ? 5.798   30.374 44.381 1.00 23.97 ? 178 PHE A CB  1 
ATOM   277  C  CG  . PHE A 1 36  ? 6.928   29.929 43.474 1.00 23.65 ? 178 PHE A CG  1 
ATOM   278  C  CD1 . PHE A 1 36  ? 7.143   28.576 43.198 1.00 23.31 ? 178 PHE A CD1 1 
ATOM   279  C  CD2 . PHE A 1 36  ? 7.711   30.872 42.805 1.00 23.28 ? 178 PHE A CD2 1 
ATOM   280  C  CE1 . PHE A 1 36  ? 8.111   28.177 42.267 1.00 22.80 ? 178 PHE A CE1 1 
ATOM   281  C  CE2 . PHE A 1 36  ? 8.675   30.474 41.877 1.00 22.92 ? 178 PHE A CE2 1 
ATOM   282  C  CZ  . PHE A 1 36  ? 8.871   29.127 41.610 1.00 22.57 ? 178 PHE A CZ  1 
ATOM   283  N  N   . LEU A 1 37  ? 4.731   28.529 46.664 1.00 22.86 ? 179 LEU A N   1 
ATOM   284  C  CA  . LEU A 1 37  ? 4.354   27.234 47.194 1.00 21.70 ? 179 LEU A CA  1 
ATOM   285  C  C   . LEU A 1 37  ? 4.549   26.154 46.149 1.00 21.12 ? 179 LEU A C   1 
ATOM   286  O  O   . LEU A 1 37  ? 4.263   26.362 44.971 1.00 20.82 ? 179 LEU A O   1 
ATOM   287  C  CB  . LEU A 1 37  ? 2.872   27.266 47.532 1.00 22.06 ? 179 LEU A CB  1 
ATOM   288  C  CG  . LEU A 1 37  ? 2.362   26.922 48.922 1.00 21.96 ? 179 LEU A CG  1 
ATOM   289  C  CD1 . LEU A 1 37  ? 2.895   25.597 49.319 1.00 21.63 ? 179 LEU A CD1 1 
ATOM   290  C  CD2 . LEU A 1 37  ? 2.788   27.978 49.886 1.00 22.08 ? 179 LEU A CD2 1 
ATOM   291  N  N   . VAL A 1 38  ? 5.075   25.012 46.573 1.00 20.56 ? 180 VAL A N   1 
ATOM   292  C  CA  . VAL A 1 38  ? 5.250   23.863 45.686 1.00 19.65 ? 180 VAL A CA  1 
ATOM   293  C  C   . VAL A 1 38  ? 4.957   22.679 46.561 1.00 19.33 ? 180 VAL A C   1 
ATOM   294  O  O   . VAL A 1 38  ? 4.837   22.823 47.777 1.00 19.45 ? 180 VAL A O   1 
ATOM   295  C  CB  . VAL A 1 38  ? 6.693   23.710 45.120 1.00 19.56 ? 180 VAL A CB  1 
ATOM   296  C  CG1 . VAL A 1 38  ? 7.088   24.936 44.327 1.00 19.40 ? 180 VAL A CG1 1 
ATOM   297  C  CG2 . VAL A 1 38  ? 7.705   23.385 46.229 1.00 18.98 ? 180 VAL A CG2 1 
ATOM   298  N  N   . TYR A 1 39  ? 4.751   21.529 45.953 1.00 19.00 ? 181 TYR A N   1 
ATOM   299  C  CA  . TYR A 1 39  ? 4.537   20.330 46.720 1.00 18.83 ? 181 TYR A CA  1 
ATOM   300  C  C   . TYR A 1 39  ? 5.828   19.532 46.531 1.00 19.12 ? 181 TYR A C   1 
ATOM   301  O  O   . TYR A 1 39  ? 6.265   19.304 45.405 1.00 19.19 ? 181 TYR A O   1 
ATOM   302  C  CB  . TYR A 1 39  ? 3.328   19.535 46.199 1.00 18.09 ? 181 TYR A CB  1 
ATOM   303  C  CG  . TYR A 1 39  ? 3.129   18.210 46.907 1.00 17.24 ? 181 TYR A CG  1 
ATOM   304  C  CD1 . TYR A 1 39  ? 2.432   18.135 48.099 1.00 17.12 ? 181 TYR A CD1 1 
ATOM   305  C  CD2 . TYR A 1 39  ? 3.671   17.041 46.400 1.00 17.08 ? 181 TYR A CD2 1 
ATOM   306  C  CE1 . TYR A 1 39  ? 2.284   16.933 48.756 1.00 16.56 ? 181 TYR A CE1 1 
ATOM   307  C  CE2 . TYR A 1 39  ? 3.529   15.841 47.054 1.00 16.55 ? 181 TYR A CE2 1 
ATOM   308  C  CZ  . TYR A 1 39  ? 2.838   15.799 48.231 1.00 16.42 ? 181 TYR A CZ  1 
ATOM   309  O  OH  . TYR A 1 39  ? 2.726   14.614 48.900 1.00 16.70 ? 181 TYR A OH  1 
ATOM   310  N  N   . CYS A 1 40  ? 6.473   19.178 47.628 1.00 19.46 ? 182 CYS A N   1 
ATOM   311  C  CA  . CYS A 1 40  ? 7.688   18.391 47.560 1.00 20.10 ? 182 CYS A CA  1 
ATOM   312  C  C   . CYS A 1 40  ? 7.355   16.976 47.916 1.00 20.57 ? 182 CYS A C   1 
ATOM   313  O  O   . CYS A 1 40  ? 6.635   16.716 48.872 1.00 20.18 ? 182 CYS A O   1 
ATOM   314  C  CB  . CYS A 1 40  ? 8.766   18.884 48.540 1.00 19.87 ? 182 CYS A CB  1 
ATOM   315  S  SG  . CYS A 1 40  ? 9.337   20.569 48.260 1.00 19.65 ? 182 CYS A SG  1 
ATOM   316  N  N   . GLU A 1 41  ? 7.913   16.066 47.143 1.00 21.87 ? 183 GLU A N   1 
ATOM   317  C  CA  . GLU A 1 41  ? 7.745   14.651 47.353 1.00 23.60 ? 183 GLU A CA  1 
ATOM   318  C  C   . GLU A 1 41  ? 9.118   14.254 47.914 1.00 24.43 ? 183 GLU A C   1 
ATOM   319  O  O   . GLU A 1 41  ? 10.100  14.240 47.175 1.00 24.64 ? 183 GLU A O   1 
ATOM   320  C  CB  . GLU A 1 41  ? 7.496   13.992 45.999 1.00 24.33 ? 183 GLU A CB  1 
ATOM   321  C  CG  . GLU A 1 41  ? 6.689   12.713 46.056 1.00 25.98 ? 183 GLU A CG  1 
ATOM   322  C  CD  . GLU A 1 41  ? 6.458   12.121 44.680 1.00 26.49 ? 183 GLU A CD  1 
ATOM   323  O  OE1 . GLU A 1 41  ? 7.345   11.382 44.229 1.00 27.21 ? 183 GLU A OE1 1 
ATOM   324  O  OE2 . GLU A 1 41  ? 5.410   12.398 44.049 1.00 27.00 ? 183 GLU A OE2 1 
ATOM   325  N  N   . ILE A 1 42  ? 9.201   14.018 49.221 1.00 25.37 ? 184 ILE A N   1 
ATOM   326  C  CA  . ILE A 1 42  ? 10.467  13.662 49.874 1.00 26.62 ? 184 ILE A CA  1 
ATOM   327  C  C   . ILE A 1 42  ? 10.500  12.201 50.342 1.00 27.82 ? 184 ILE A C   1 
ATOM   328  O  O   . ILE A 1 42  ? 9.767   11.811 51.259 1.00 28.22 ? 184 ILE A O   1 
ATOM   329  C  CB  . ILE A 1 42  ? 10.767  14.624 51.074 1.00 26.06 ? 184 ILE A CB  1 
ATOM   330  C  CG1 . ILE A 1 42  ? 10.880  16.066 50.564 1.00 25.73 ? 184 ILE A CG1 1 
ATOM   331  C  CG2 . ILE A 1 42  ? 12.053  14.215 51.769 1.00 26.19 ? 184 ILE A CG2 1 
ATOM   332  C  CD1 . ILE A 1 42  ? 10.872  17.133 51.623 1.00 25.02 ? 184 ILE A CD1 1 
ATOM   333  N  N   . ASP A 1 43  ? 11.299  11.371 49.673 1.00 28.98 ? 185 ASP A N   1 
ATOM   334  C  CA  . ASP A 1 43  ? 11.387  9.975  50.071 1.00 29.90 ? 185 ASP A CA  1 
ATOM   335  C  C   . ASP A 1 43  ? 12.413  9.780  51.185 1.00 30.67 ? 185 ASP A C   1 
ATOM   336  O  O   . ASP A 1 43  ? 13.117  10.717 51.579 1.00 30.76 ? 185 ASP A O   1 
ATOM   337  C  CB  . ASP A 1 43  ? 11.650  9.045  48.871 1.00 30.38 ? 185 ASP A CB  1 
ATOM   338  C  CG  . ASP A 1 43  ? 12.997  9.290  48.175 1.00 30.75 ? 185 ASP A CG  1 
ATOM   339  O  OD1 . ASP A 1 43  ? 14.031  9.498  48.837 1.00 31.00 ? 185 ASP A OD1 1 
ATOM   340  O  OD2 . ASP A 1 43  ? 13.030  9.212  46.933 1.00 31.24 ? 185 ASP A OD2 1 
ATOM   341  N  N   . GLY A 1 44  ? 12.523  8.549  51.666 1.00 31.39 ? 186 GLY A N   1 
ATOM   342  C  CA  . GLY A 1 44  ? 13.459  8.254  52.743 1.00 32.18 ? 186 GLY A CA  1 
ATOM   343  C  C   . GLY A 1 44  ? 14.943  8.477  52.458 1.00 32.51 ? 186 GLY A C   1 
ATOM   344  O  O   . GLY A 1 44  ? 15.712  8.884  53.351 1.00 33.15 ? 186 GLY A O   1 
ATOM   345  N  N   . SER A 1 45  ? 15.361  8.238  51.219 1.00 32.10 ? 187 SER A N   1 
ATOM   346  C  CA  . SER A 1 45  ? 16.767  8.396  50.876 1.00 31.37 ? 187 SER A CA  1 
ATOM   347  C  C   . SER A 1 45  ? 17.241  9.848  50.699 1.00 30.52 ? 187 SER A C   1 
ATOM   348  O  O   . SER A 1 45  ? 18.353  10.094 50.229 1.00 30.74 ? 187 SER A O   1 
ATOM   349  C  CB  . SER A 1 45  ? 17.084  7.525  49.657 1.00 31.94 ? 187 SER A CB  1 
ATOM   350  O  OG  . SER A 1 45  ? 16.844  6.144  49.952 1.00 32.35 ? 187 SER A OG  1 
ATOM   351  N  N   . GLY A 1 46  ? 16.422  10.809 51.119 1.00 29.27 ? 188 GLY A N   1 
ATOM   352  C  CA  . GLY A 1 46  ? 16.816  12.200 50.992 1.00 27.58 ? 188 GLY A CA  1 
ATOM   353  C  C   . GLY A 1 46  ? 16.454  12.823 49.657 1.00 26.46 ? 188 GLY A C   1 
ATOM   354  O  O   . GLY A 1 46  ? 16.739  13.994 49.426 1.00 26.29 ? 188 GLY A O   1 
ATOM   355  N  N   . ASN A 1 47  ? 15.859  12.044 48.761 1.00 25.31 ? 189 ASN A N   1 
ATOM   356  C  CA  . ASN A 1 47  ? 15.453  12.587 47.479 1.00 24.24 ? 189 ASN A CA  1 
ATOM   357  C  C   . ASN A 1 47  ? 14.249  13.495 47.685 1.00 23.42 ? 189 ASN A C   1 
ATOM   358  O  O   . ASN A 1 47  ? 13.274  13.096 48.331 1.00 23.60 ? 189 ASN A O   1 
ATOM   359  C  CB  . ASN A 1 47  ? 15.066  11.485 46.504 1.00 24.35 ? 189 ASN A CB  1 
ATOM   360  C  CG  . ASN A 1 47  ? 16.245  10.678 46.024 1.00 24.46 ? 189 ASN A CG  1 
ATOM   361  O  OD1 . ASN A 1 47  ? 17.384  11.108 46.084 1.00 24.61 ? 189 ASN A OD1 1 
ATOM   362  N  ND2 . ASN A 1 47  ? 15.967  9.493  45.525 1.00 25.29 ? 189 ASN A ND2 1 
ATOM   363  N  N   . GLY A 1 48  ? 14.339  14.714 47.159 1.00 22.32 ? 190 GLY A N   1 
ATOM   364  C  CA  . GLY A 1 48  ? 13.252  15.676 47.244 1.00 20.94 ? 190 GLY A CA  1 
ATOM   365  C  C   . GLY A 1 48  ? 12.835  16.128 45.843 1.00 19.99 ? 190 GLY A C   1 
ATOM   366  O  O   . GLY A 1 48  ? 13.529  16.932 45.222 1.00 19.79 ? 190 GLY A O   1 
ATOM   367  N  N   . TRP A 1 49  ? 11.728  15.588 45.326 1.00 19.01 ? 191 TRP A N   1 
ATOM   368  C  CA  . TRP A 1 49  ? 11.222  15.947 43.986 1.00 17.52 ? 191 TRP A CA  1 
ATOM   369  C  C   . TRP A 1 49  ? 10.239  17.104 44.012 1.00 16.67 ? 191 TRP A C   1 
ATOM   370  O  O   . TRP A 1 49  ? 9.303   17.096 44.812 1.00 16.67 ? 191 TRP A O   1 
ATOM   371  C  CB  . TRP A 1 49  ? 10.489  14.769 43.351 1.00 17.16 ? 191 TRP A CB  1 
ATOM   372  C  CG  . TRP A 1 49  ? 11.260  13.520 43.288 1.00 16.38 ? 191 TRP A CG  1 
ATOM   373  C  CD1 . TRP A 1 49  ? 11.437  12.623 44.290 1.00 16.10 ? 191 TRP A CD1 1 
ATOM   374  C  CD2 . TRP A 1 49  ? 11.875  12.964 42.132 1.00 16.13 ? 191 TRP A CD2 1 
ATOM   375  N  NE1 . TRP A 1 49  ? 12.103  11.528 43.831 1.00 16.10 ? 191 TRP A NE1 1 
ATOM   376  C  CE2 . TRP A 1 49  ? 12.392  11.709 42.503 1.00 16.08 ? 191 TRP A CE2 1 
ATOM   377  C  CE3 . TRP A 1 49  ? 12.039  13.404 40.810 1.00 16.05 ? 191 TRP A CE3 1 
ATOM   378  C  CZ2 . TRP A 1 49  ? 13.068  10.878 41.602 1.00 15.54 ? 191 TRP A CZ2 1 
ATOM   379  C  CZ3 . TRP A 1 49  ? 12.711  12.577 39.911 1.00 15.98 ? 191 TRP A CZ3 1 
ATOM   380  C  CH2 . TRP A 1 49  ? 13.215  11.327 40.316 1.00 15.50 ? 191 TRP A CH2 1 
ATOM   381  N  N   . THR A 1 50  ? 10.447  18.091 43.149 1.00 15.60 ? 192 THR A N   1 
ATOM   382  C  CA  . THR A 1 50  ? 9.537   19.225 43.043 1.00 15.06 ? 192 THR A CA  1 
ATOM   383  C  C   . THR A 1 50  ? 8.460   18.752 42.046 1.00 14.95 ? 192 THR A C   1 
ATOM   384  O  O   . THR A 1 50  ? 8.739   18.496 40.867 1.00 15.08 ? 192 THR A O   1 
ATOM   385  C  CB  . THR A 1 50  ? 10.250  20.494 42.497 1.00 14.66 ? 192 THR A CB  1 
ATOM   386  O  OG1 . THR A 1 50  ? 11.371  20.800 43.323 1.00 15.36 ? 192 THR A OG1 1 
ATOM   387  C  CG2 . THR A 1 50  ? 9.323   21.696 42.479 1.00 14.32 ? 192 THR A CG2 1 
ATOM   388  N  N   . VAL A 1 51  ? 7.238   18.569 42.521 1.00 14.97 ? 193 VAL A N   1 
ATOM   389  C  CA  . VAL A 1 51  ? 6.172   18.096 41.644 1.00 14.39 ? 193 VAL A CA  1 
ATOM   390  C  C   . VAL A 1 51  ? 5.541   19.293 40.960 1.00 14.09 ? 193 VAL A C   1 
ATOM   391  O  O   . VAL A 1 51  ? 5.262   20.289 41.623 1.00 14.01 ? 193 VAL A O   1 
ATOM   392  C  CB  . VAL A 1 51  ? 5.131   17.284 42.446 1.00 14.30 ? 193 VAL A CB  1 
ATOM   393  C  CG1 . VAL A 1 51  ? 3.990   16.824 41.549 1.00 14.10 ? 193 VAL A CG1 1 
ATOM   394  C  CG2 . VAL A 1 51  ? 5.827   16.077 43.106 1.00 14.25 ? 193 VAL A CG2 1 
ATOM   395  N  N   . PHE A 1 52  ? 5.446   19.244 39.625 1.00 14.01 ? 194 PHE A N   1 
ATOM   396  C  CA  . PHE A 1 52  ? 4.829   20.338 38.858 1.00 13.22 ? 194 PHE A CA  1 
ATOM   397  C  C   . PHE A 1 52  ? 3.513   20.015 38.121 1.00 13.09 ? 194 PHE A C   1 
ATOM   398  O  O   . PHE A 1 52  ? 2.833   20.932 37.631 1.00 12.91 ? 194 PHE A O   1 
ATOM   399  C  CB  . PHE A 1 52  ? 5.852   21.068 37.951 1.00 13.38 ? 194 PHE A CB  1 
ATOM   400  C  CG  . PHE A 1 52  ? 6.333   20.278 36.726 1.00 13.27 ? 194 PHE A CG  1 
ATOM   401  C  CD1 . PHE A 1 52  ? 5.575   20.230 35.555 1.00 12.70 ? 194 PHE A CD1 1 
ATOM   402  C  CD2 . PHE A 1 52  ? 7.601   19.703 36.705 1.00 12.80 ? 194 PHE A CD2 1 
ATOM   403  C  CE1 . PHE A 1 52  ? 6.081   19.631 34.386 1.00 12.16 ? 194 PHE A CE1 1 
ATOM   404  C  CE2 . PHE A 1 52  ? 8.106   19.107 35.547 1.00 12.12 ? 194 PHE A CE2 1 
ATOM   405  C  CZ  . PHE A 1 52  ? 7.344   19.075 34.391 1.00 12.59 ? 194 PHE A CZ  1 
ATOM   406  N  N   . GLN A 1 53  ? 3.128   18.738 38.078 1.00 12.73 ? 195 GLN A N   1 
ATOM   407  C  CA  . GLN A 1 53  ? 1.884   18.345 37.440 1.00 12.93 ? 195 GLN A CA  1 
ATOM   408  C  C   . GLN A 1 53  ? 1.366   17.103 38.140 1.00 13.43 ? 195 GLN A C   1 
ATOM   409  O  O   . GLN A 1 53  ? 2.144   16.216 38.491 1.00 13.43 ? 195 GLN A O   1 
ATOM   410  C  CB  . GLN A 1 53  ? 2.077   18.048 35.940 1.00 13.06 ? 195 GLN A CB  1 
ATOM   411  C  CG  . GLN A 1 53  ? 0.773   17.832 35.149 1.00 12.37 ? 195 GLN A CG  1 
ATOM   412  C  CD  . GLN A 1 53  ? 0.438   16.379 34.847 1.00 12.39 ? 195 GLN A CD  1 
ATOM   413  O  OE1 . GLN A 1 53  ? 0.741   15.461 35.615 1.00 11.98 ? 195 GLN A OE1 1 
ATOM   414  N  NE2 . GLN A 1 53  ? -0.225  16.167 33.719 1.00 12.48 ? 195 GLN A NE2 1 
ATOM   415  N  N   . LYS A 1 54  ? 0.052   17.049 38.344 1.00 13.92 ? 196 LYS A N   1 
ATOM   416  C  CA  . LYS A 1 54  ? -0.587  15.901 38.980 1.00 14.76 ? 196 LYS A CA  1 
ATOM   417  C  C   . LYS A 1 54  ? -2.015  15.677 38.438 1.00 14.65 ? 196 LYS A C   1 
ATOM   418  O  O   . LYS A 1 54  ? -2.782  16.620 38.342 1.00 14.83 ? 196 LYS A O   1 
ATOM   419  C  CB  . LYS A 1 54  ? -0.651  16.117 40.488 1.00 15.07 ? 196 LYS A CB  1 
ATOM   420  C  CG  . LYS A 1 54  ? -1.089  14.894 41.268 1.00 16.31 ? 196 LYS A CG  1 
ATOM   421  C  CD  . LYS A 1 54  ? 0.102   14.133 41.813 1.00 16.73 ? 196 LYS A CD  1 
ATOM   422  C  CE  . LYS A 1 54  ? -0.319  12.773 42.349 1.00 17.39 ? 196 LYS A CE  1 
ATOM   423  N  NZ  . LYS A 1 54  ? -0.898  11.936 41.250 1.00 18.03 ? 196 LYS A NZ  1 
ATOM   424  N  N   . ARG A 1 55  ? -2.313  14.460 37.986 1.00 14.80 ? 197 ARG A N   1 
ATOM   425  C  CA  . ARG A 1 55  ? -3.660  14.081 37.516 1.00 14.96 ? 197 ARG A CA  1 
ATOM   426  C  C   . ARG A 1 55  ? -4.025  12.872 38.379 1.00 14.78 ? 197 ARG A C   1 
ATOM   427  O  O   . ARG A 1 55  ? -3.176  12.024 38.635 1.00 14.57 ? 197 ARG A O   1 
ATOM   428  C  CB  . ARG A 1 55  ? -3.672  13.624 36.052 1.00 14.85 ? 197 ARG A CB  1 
ATOM   429  C  CG  . ARG A 1 55  ? -3.249  14.648 35.036 1.00 15.37 ? 197 ARG A CG  1 
ATOM   430  C  CD  . ARG A 1 55  ? -4.126  15.876 35.001 1.00 15.30 ? 197 ARG A CD  1 
ATOM   431  N  NE  . ARG A 1 55  ? -5.448  15.630 34.439 1.00 15.49 ? 197 ARG A NE  1 
ATOM   432  C  CZ  . ARG A 1 55  ? -5.717  15.547 33.140 1.00 15.40 ? 197 ARG A CZ  1 
ATOM   433  N  NH1 . ARG A 1 55  ? -4.754  15.661 32.251 1.00 15.53 ? 197 ARG A NH1 1 
ATOM   434  N  NH2 . ARG A 1 55  ? -6.980  15.485 32.723 1.00 15.67 ? 197 ARG A NH2 1 
ATOM   435  N  N   . LEU A 1 56  ? -5.251  12.808 38.878 1.00 15.05 ? 198 LEU A N   1 
ATOM   436  C  CA  . LEU A 1 56  ? -5.638  11.659 39.697 1.00 15.36 ? 198 LEU A CA  1 
ATOM   437  C  C   . LEU A 1 56  ? -7.129  11.321 39.813 1.00 15.52 ? 198 LEU A C   1 
ATOM   438  O  O   . LEU A 1 56  ? -7.462  10.207 40.197 1.00 15.71 ? 198 LEU A O   1 
ATOM   439  C  CB  . LEU A 1 56  ? -5.000  11.766 41.096 1.00 15.59 ? 198 LEU A CB  1 
ATOM   440  C  CG  . LEU A 1 56  ? -4.956  13.142 41.763 1.00 15.28 ? 198 LEU A CG  1 
ATOM   441  C  CD1 . LEU A 1 56  ? -6.329  13.571 42.221 1.00 15.37 ? 198 LEU A CD1 1 
ATOM   442  C  CD2 . LEU A 1 56  ? -4.020  13.088 42.928 1.00 15.28 ? 198 LEU A CD2 1 
ATOM   443  N  N   . ASP A 1 57  ? -8.020  12.266 39.495 1.00 15.89 ? 199 ASP A N   1 
ATOM   444  C  CA  . ASP A 1 57  ? -9.465  12.017 39.582 1.00 16.01 ? 199 ASP A CA  1 
ATOM   445  C  C   . ASP A 1 57  ? -10.416 12.794 38.657 1.00 16.14 ? 199 ASP A C   1 
ATOM   446  O  O   . ASP A 1 57  ? -11.624 12.600 38.768 1.00 16.58 ? 199 ASP A O   1 
ATOM   447  C  CB  . ASP A 1 57  ? -9.950  12.174 41.030 1.00 16.21 ? 199 ASP A CB  1 
ATOM   448  C  CG  . ASP A 1 57  ? -9.821  13.604 41.551 1.00 16.40 ? 199 ASP A CG  1 
ATOM   449  O  OD1 . ASP A 1 57  ? -9.363  14.502 40.819 1.00 17.29 ? 199 ASP A OD1 1 
ATOM   450  O  OD2 . ASP A 1 57  ? -10.189 13.853 42.713 1.00 17.32 ? 199 ASP A OD2 1 
ATOM   451  N  N   . GLY A 1 58  ? -9.911  13.701 37.812 1.00 15.90 ? 200 GLY A N   1 
ATOM   452  C  CA  . GLY A 1 58  ? -10.769 14.462 36.887 1.00 15.69 ? 200 GLY A CA  1 
ATOM   453  C  C   . GLY A 1 58  ? -11.459 15.741 37.365 1.00 15.46 ? 200 GLY A C   1 
ATOM   454  O  O   . GLY A 1 58  ? -12.291 16.317 36.661 1.00 15.02 ? 200 GLY A O   1 
ATOM   455  N  N   . SER A 1 59  ? -11.040 16.219 38.537 1.00 15.91 ? 201 SER A N   1 
ATOM   456  C  CA  . SER A 1 59  ? -11.567 17.413 39.209 1.00 15.74 ? 201 SER A CA  1 
ATOM   457  C  C   . SER A 1 59  ? -11.282 18.794 38.604 1.00 16.03 ? 201 SER A C   1 
ATOM   458  O  O   . SER A 1 59  ? -11.940 19.772 38.975 1.00 16.04 ? 201 SER A O   1 
ATOM   459  C  CB  . SER A 1 59  ? -11.083 17.394 40.647 1.00 15.71 ? 201 SER A CB  1 
ATOM   460  O  OG  . SER A 1 59  ? -9.702  17.088 40.700 1.00 15.25 ? 201 SER A OG  1 
ATOM   461  N  N   . VAL A 1 60  ? -10.263 18.880 37.739 1.00 15.89 ? 202 VAL A N   1 
ATOM   462  C  CA  . VAL A 1 60  ? -9.878  20.122 37.083 1.00 15.49 ? 202 VAL A CA  1 
ATOM   463  C  C   . VAL A 1 60  ? -9.853  19.926 35.562 1.00 15.90 ? 202 VAL A C   1 
ATOM   464  O  O   . VAL A 1 60  ? -9.318  18.936 35.051 1.00 16.08 ? 202 VAL A O   1 
ATOM   465  C  CB  . VAL A 1 60  ? -8.454  20.618 37.531 1.00 15.36 ? 202 VAL A CB  1 
ATOM   466  C  CG1 . VAL A 1 60  ? -8.147  21.977 36.921 1.00 14.43 ? 202 VAL A CG1 1 
ATOM   467  C  CG2 . VAL A 1 60  ? -8.358  20.699 39.049 1.00 15.10 ? 202 VAL A CG2 1 
ATOM   468  N  N   . ASP A 1 61  ? -10.443 20.867 34.841 1.00 16.04 ? 203 ASP A N   1 
ATOM   469  C  CA  . ASP A 1 61  ? -10.462 20.823 33.389 1.00 16.30 ? 203 ASP A CA  1 
ATOM   470  C  C   . ASP A 1 61  ? -9.097  21.344 32.888 1.00 16.23 ? 203 ASP A C   1 
ATOM   471  O  O   . ASP A 1 61  ? -8.720  22.479 33.182 1.00 15.65 ? 203 ASP A O   1 
ATOM   472  C  CB  . ASP A 1 61  ? -11.595 21.731 32.902 1.00 17.32 ? 203 ASP A CB  1 
ATOM   473  C  CG  . ASP A 1 61  ? -11.799 21.684 31.404 1.00 18.05 ? 203 ASP A CG  1 
ATOM   474  O  OD1 . ASP A 1 61  ? -11.383 20.704 30.740 1.00 19.06 ? 203 ASP A OD1 1 
ATOM   475  O  OD2 . ASP A 1 61  ? -12.419 22.639 30.900 1.00 19.11 ? 203 ASP A OD2 1 
ATOM   476  N  N   . PHE A 1 62  ? -8.350  20.530 32.146 1.00 16.08 ? 204 PHE A N   1 
ATOM   477  C  CA  . PHE A 1 62  ? -7.056  20.992 31.665 1.00 16.30 ? 204 PHE A CA  1 
ATOM   478  C  C   . PHE A 1 62  ? -7.053  21.812 30.371 1.00 16.69 ? 204 PHE A C   1 
ATOM   479  O  O   . PHE A 1 62  ? -6.002  22.197 29.858 1.00 16.08 ? 204 PHE A O   1 
ATOM   480  C  CB  . PHE A 1 62  ? -6.066  19.848 31.617 1.00 16.32 ? 204 PHE A CB  1 
ATOM   481  C  CG  . PHE A 1 62  ? -5.356  19.624 32.920 1.00 16.02 ? 204 PHE A CG  1 
ATOM   482  C  CD1 . PHE A 1 62  ? -6.061  19.234 34.049 1.00 15.81 ? 204 PHE A CD1 1 
ATOM   483  C  CD2 . PHE A 1 62  ? -3.990  19.838 33.025 1.00 15.86 ? 204 PHE A CD2 1 
ATOM   484  C  CE1 . PHE A 1 62  ? -5.416  19.065 35.257 1.00 16.10 ? 204 PHE A CE1 1 
ATOM   485  C  CE2 . PHE A 1 62  ? -3.337  19.669 34.232 1.00 15.80 ? 204 PHE A CE2 1 
ATOM   486  C  CZ  . PHE A 1 62  ? -4.052  19.281 35.349 1.00 16.09 ? 204 PHE A CZ  1 
ATOM   487  N  N   . LYS A 1 63  ? -8.242  22.089 29.847 1.00 17.59 ? 205 LYS A N   1 
ATOM   488  C  CA  . LYS A 1 63  ? -8.362  22.920 28.654 1.00 18.29 ? 205 LYS A CA  1 
ATOM   489  C  C   . LYS A 1 63  ? -8.352  24.357 29.150 1.00 18.03 ? 205 LYS A C   1 
ATOM   490  O  O   . LYS A 1 63  ? -9.396  24.949 29.368 1.00 18.05 ? 205 LYS A O   1 
ATOM   491  C  CB  . LYS A 1 63  ? -9.660  22.657 27.881 1.00 19.05 ? 205 LYS A CB  1 
ATOM   492  C  CG  . LYS A 1 63  ? -9.592  23.191 26.459 1.00 20.89 ? 205 LYS A CG  1 
ATOM   493  C  CD  . LYS A 1 63  ? -10.921 23.710 25.920 1.00 22.64 ? 205 LYS A CD  1 
ATOM   494  C  CE  . LYS A 1 63  ? -10.741 24.115 24.429 1.00 24.26 ? 205 LYS A CE  1 
ATOM   495  N  NZ  . LYS A 1 63  ? -11.856 24.948 23.842 1.00 25.30 ? 205 LYS A NZ  1 
ATOM   496  N  N   . LYS A 1 64  ? -7.163  24.870 29.424 1.00 18.20 ? 206 LYS A N   1 
ATOM   497  C  CA  . LYS A 1 64  ? -6.987  26.234 29.888 1.00 18.43 ? 206 LYS A CA  1 
ATOM   498  C  C   . LYS A 1 64  ? -6.237  27.026 28.817 1.00 18.81 ? 206 LYS A C   1 
ATOM   499  O  O   . LYS A 1 64  ? -5.620  26.444 27.921 1.00 19.39 ? 206 LYS A O   1 
ATOM   500  C  CB  . LYS A 1 64  ? -6.205  26.229 31.201 1.00 18.30 ? 206 LYS A CB  1 
ATOM   501  C  CG  . LYS A 1 64  ? -6.940  25.551 32.335 1.00 18.11 ? 206 LYS A CG  1 
ATOM   502  C  CD  . LYS A 1 64  ? -7.572  26.565 33.272 1.00 18.23 ? 206 LYS A CD  1 
ATOM   503  C  CE  . LYS A 1 64  ? -8.234  25.905 34.500 1.00 18.71 ? 206 LYS A CE  1 
ATOM   504  N  NZ  . LYS A 1 64  ? -9.524  25.172 34.216 1.00 18.50 ? 206 LYS A NZ  1 
ATOM   505  N  N   . ASN A 1 65  ? -6.302  28.342 28.894 1.00 19.17 ? 207 ASN A N   1 
ATOM   506  C  CA  . ASN A 1 65  ? -5.619  29.196 27.937 1.00 19.98 ? 207 ASN A CA  1 
ATOM   507  C  C   . ASN A 1 65  ? -4.141  29.448 28.316 1.00 20.16 ? 207 ASN A C   1 
ATOM   508  O  O   . ASN A 1 65  ? -3.659  28.946 29.341 1.00 20.40 ? 207 ASN A O   1 
ATOM   509  C  CB  . ASN A 1 65  ? -6.390  30.521 27.752 1.00 20.73 ? 207 ASN A CB  1 
ATOM   510  C  CG  . ASN A 1 65  ? -6.349  31.431 28.999 1.00 21.84 ? 207 ASN A CG  1 
ATOM   511  O  OD1 . ASN A 1 65  ? -5.319  31.576 29.658 1.00 21.95 ? 207 ASN A OD1 1 
ATOM   512  N  ND2 . ASN A 1 65  ? -7.479  32.068 29.299 1.00 22.65 ? 207 ASN A ND2 1 
ATOM   513  N  N   . TRP A 1 66  ? -3.446  30.244 27.497 1.00 20.15 ? 208 TRP A N   1 
ATOM   514  C  CA  . TRP A 1 66  ? -2.032  30.592 27.676 1.00 20.00 ? 208 TRP A CA  1 
ATOM   515  C  C   . TRP A 1 66  ? -1.688  31.196 29.031 1.00 19.95 ? 208 TRP A C   1 
ATOM   516  O  O   . TRP A 1 66  ? -0.761  30.737 29.701 1.00 20.55 ? 208 TRP A O   1 
ATOM   517  C  CB  . TRP A 1 66  ? -1.566  31.548 26.563 1.00 20.21 ? 208 TRP A CB  1 
ATOM   518  C  CG  . TRP A 1 66  ? -0.040  31.746 26.504 1.00 20.42 ? 208 TRP A CG  1 
ATOM   519  C  CD1 . TRP A 1 66  ? 0.681   32.786 27.030 1.00 20.22 ? 208 TRP A CD1 1 
ATOM   520  C  CD2 . TRP A 1 66  ? 0.927   30.849 25.912 1.00 20.11 ? 208 TRP A CD2 1 
ATOM   521  N  NE1 . TRP A 1 66  ? 2.028   32.587 26.810 1.00 20.32 ? 208 TRP A NE1 1 
ATOM   522  C  CE2 . TRP A 1 66  ? 2.204   31.411 26.127 1.00 19.97 ? 208 TRP A CE2 1 
ATOM   523  C  CE3 . TRP A 1 66  ? 0.832   29.633 25.228 1.00 19.92 ? 208 TRP A CE3 1 
ATOM   524  C  CZ2 . TRP A 1 66  ? 3.372   30.797 25.683 1.00 19.35 ? 208 TRP A CZ2 1 
ATOM   525  C  CZ3 . TRP A 1 66  ? 1.997   29.026 24.789 1.00 19.54 ? 208 TRP A CZ3 1 
ATOM   526  C  CH2 . TRP A 1 66  ? 3.243   29.610 25.020 1.00 19.31 ? 208 TRP A CH2 1 
ATOM   527  N  N   . ILE A 1 67  ? -2.406  32.241 29.421 1.00 19.66 ? 209 ILE A N   1 
ATOM   528  C  CA  . ILE A 1 67  ? -2.168  32.900 30.691 1.00 19.10 ? 209 ILE A CA  1 
ATOM   529  C  C   . ILE A 1 67  ? -2.390  31.955 31.873 1.00 18.92 ? 209 ILE A C   1 
ATOM   530  O  O   . ILE A 1 67  ? -1.613  31.968 32.831 1.00 19.00 ? 209 ILE A O   1 
ATOM   531  C  CB  . ILE A 1 67  ? -3.001  34.178 30.797 1.00 19.18 ? 209 ILE A CB  1 
ATOM   532  C  CG1 . ILE A 1 67  ? -2.527  35.153 29.709 1.00 19.54 ? 209 ILE A CG1 1 
ATOM   533  C  CG2 . ILE A 1 67  ? -2.907  34.773 32.191 1.00 18.71 ? 209 ILE A CG2 1 
ATOM   534  C  CD1 . ILE A 1 67  ? -2.993  36.582 29.877 1.00 20.17 ? 209 ILE A CD1 1 
ATOM   535  N  N   . GLN A 1 68  ? -3.383  31.073 31.763 1.00 18.54 ? 210 GLN A N   1 
ATOM   536  C  CA  . GLN A 1 68  ? -3.673  30.096 32.813 1.00 17.55 ? 210 GLN A CA  1 
ATOM   537  C  C   . GLN A 1 68  ? -2.583  29.036 32.875 1.00 16.87 ? 210 GLN A C   1 
ATOM   538  O  O   . GLN A 1 68  ? -2.204  28.584 33.952 1.00 16.59 ? 210 GLN A O   1 
ATOM   539  C  CB  . GLN A 1 68  ? -5.012  29.447 32.559 1.00 17.87 ? 210 GLN A CB  1 
ATOM   540  C  CG  . GLN A 1 68  ? -6.108  30.469 32.391 1.00 19.07 ? 210 GLN A CG  1 
ATOM   541  C  CD  . GLN A 1 68  ? -7.475  29.850 32.304 1.00 19.68 ? 210 GLN A CD  1 
ATOM   542  O  OE1 . GLN A 1 68  ? -7.730  28.995 31.473 1.00 20.17 ? 210 GLN A OE1 1 
ATOM   543  N  NE2 . GLN A 1 68  ? -8.363  30.262 33.191 1.00 21.21 ? 210 GLN A NE2 1 
ATOM   544  N  N   . TYR A 1 69  ? -2.079  28.623 31.720 1.00 16.30 ? 211 TYR A N   1 
ATOM   545  C  CA  . TYR A 1 69  ? -1.007  27.644 31.717 1.00 15.85 ? 211 TYR A CA  1 
ATOM   546  C  C   . TYR A 1 69  ? 0.314   28.303 32.113 1.00 15.93 ? 211 TYR A C   1 
ATOM   547  O  O   . TYR A 1 69  ? 1.198   27.656 32.651 1.00 15.73 ? 211 TYR A O   1 
ATOM   548  C  CB  . TYR A 1 69  ? -0.915  26.920 30.375 1.00 14.66 ? 211 TYR A CB  1 
ATOM   549  C  CG  . TYR A 1 69  ? -1.608  25.575 30.376 1.00 13.44 ? 211 TYR A CG  1 
ATOM   550  C  CD1 . TYR A 1 69  ? -1.034  24.470 31.004 1.00 12.82 ? 211 TYR A CD1 1 
ATOM   551  C  CD2 . TYR A 1 69  ? -2.817  25.398 29.731 1.00 12.51 ? 211 TYR A CD2 1 
ATOM   552  C  CE1 . TYR A 1 69  ? -1.662  23.222 30.975 1.00 11.73 ? 211 TYR A CE1 1 
ATOM   553  C  CE2 . TYR A 1 69  ? -3.444  24.158 29.697 1.00 11.95 ? 211 TYR A CE2 1 
ATOM   554  C  CZ  . TYR A 1 69  ? -2.865  23.085 30.316 1.00 11.46 ? 211 TYR A CZ  1 
ATOM   555  O  OH  . TYR A 1 69  ? -3.500  21.884 30.269 1.00 10.68 ? 211 TYR A OH  1 
ATOM   556  N  N   . LYS A 1 70  ? 0.442   29.596 31.853 1.00 16.62 ? 212 LYS A N   1 
ATOM   557  C  CA  . LYS A 1 70  ? 1.644   30.325 32.237 1.00 17.52 ? 212 LYS A CA  1 
ATOM   558  C  C   . LYS A 1 70  ? 1.766   30.475 33.769 1.00 18.41 ? 212 LYS A C   1 
ATOM   559  O  O   . LYS A 1 70  ? 2.824   30.215 34.351 1.00 18.99 ? 212 LYS A O   1 
ATOM   560  C  CB  . LYS A 1 70  ? 1.647   31.720 31.617 1.00 16.95 ? 212 LYS A CB  1 
ATOM   561  C  CG  . LYS A 1 70  ? 2.642   32.637 32.308 1.00 16.37 ? 212 LYS A CG  1 
ATOM   562  C  CD  . LYS A 1 70  ? 2.717   33.998 31.687 1.00 16.46 ? 212 LYS A CD  1 
ATOM   563  C  CE  . LYS A 1 70  ? 3.827   34.801 32.325 1.00 16.10 ? 212 LYS A CE  1 
ATOM   564  N  NZ  . LYS A 1 70  ? 4.206   35.986 31.498 1.00 16.02 ? 212 LYS A NZ  1 
ATOM   565  N  N   . GLU A 1 71  ? 0.661   30.862 34.408 1.00 19.54 ? 213 GLU A N   1 
ATOM   566  C  CA  . GLU A 1 71  ? 0.585   31.108 35.851 1.00 20.29 ? 213 GLU A CA  1 
ATOM   567  C  C   . GLU A 1 71  ? 0.291   29.941 36.786 1.00 20.34 ? 213 GLU A C   1 
ATOM   568  O  O   . GLU A 1 71  ? 0.630   30.015 37.968 1.00 20.59 ? 213 GLU A O   1 
ATOM   569  C  CB  . GLU A 1 71  ? -0.415  32.221 36.111 1.00 21.14 ? 213 GLU A CB  1 
ATOM   570  C  CG  . GLU A 1 71  ? -0.203  33.386 35.189 1.00 22.74 ? 213 GLU A CG  1 
ATOM   571  C  CD  . GLU A 1 71  ? -0.686  34.680 35.773 1.00 24.26 ? 213 GLU A CD  1 
ATOM   572  O  OE1 . GLU A 1 71  ? -1.840  34.729 36.275 1.00 25.21 ? 213 GLU A OE1 1 
ATOM   573  O  OE2 . GLU A 1 71  ? 0.100   35.656 35.730 1.00 25.24 ? 213 GLU A OE2 1 
ATOM   574  N  N   . GLY A 1 72  ? -0.370  28.899 36.275 1.00 20.13 ? 214 GLY A N   1 
ATOM   575  C  CA  . GLY A 1 72  ? -0.693  27.739 37.080 1.00 19.65 ? 214 GLY A CA  1 
ATOM   576  C  C   . GLY A 1 72  ? -2.177  27.647 37.391 1.00 19.52 ? 214 GLY A C   1 
ATOM   577  O  O   . GLY A 1 72  ? -2.892  28.635 37.359 1.00 19.63 ? 214 GLY A O   1 
ATOM   578  N  N   . PHE A 1 73  ? -2.671  26.447 37.630 1.00 19.32 ? 215 PHE A N   1 
ATOM   579  C  CA  . PHE A 1 73  ? -4.076  26.279 37.960 1.00 18.99 ? 215 PHE A CA  1 
ATOM   580  C  C   . PHE A 1 73  ? -4.281  25.017 38.757 1.00 19.21 ? 215 PHE A C   1 
ATOM   581  O  O   . PHE A 1 73  ? -3.386  24.173 38.850 1.00 19.45 ? 215 PHE A O   1 
ATOM   582  C  CB  . PHE A 1 73  ? -4.984  26.306 36.718 1.00 18.15 ? 215 PHE A CB  1 
ATOM   583  C  CG  . PHE A 1 73  ? -4.623  25.308 35.660 1.00 17.23 ? 215 PHE A CG  1 
ATOM   584  C  CD1 . PHE A 1 73  ? -5.133  24.027 35.695 1.00 16.70 ? 215 PHE A CD1 1 
ATOM   585  C  CD2 . PHE A 1 73  ? -3.800  25.675 34.595 1.00 17.05 ? 215 PHE A CD2 1 
ATOM   586  C  CE1 . PHE A 1 73  ? -4.835  23.122 34.690 1.00 16.70 ? 215 PHE A CE1 1 
ATOM   587  C  CE2 . PHE A 1 73  ? -3.495  24.778 33.583 1.00 16.52 ? 215 PHE A CE2 1 
ATOM   588  C  CZ  . PHE A 1 73  ? -4.008  23.501 33.625 1.00 16.56 ? 215 PHE A CZ  1 
ATOM   589  N  N   . GLY A 1 74  ? -5.457  24.884 39.341 1.00 19.37 ? 216 GLY A N   1 
ATOM   590  C  CA  . GLY A 1 74  ? -5.721  23.703 40.126 1.00 20.35 ? 216 GLY A CA  1 
ATOM   591  C  C   . GLY A 1 74  ? -5.387  23.997 41.568 1.00 20.76 ? 216 GLY A C   1 
ATOM   592  O  O   . GLY A 1 74  ? -5.181  25.155 41.918 1.00 20.96 ? 216 GLY A O   1 
ATOM   593  N  N   . HIS A 1 75  ? -5.285  22.969 42.395 1.00 21.28 ? 217 HIS A N   1 
ATOM   594  C  CA  . HIS A 1 75  ? -5.016  23.200 43.809 1.00 22.07 ? 217 HIS A CA  1 
ATOM   595  C  C   . HIS A 1 75  ? -3.899  22.363 44.408 1.00 21.55 ? 217 HIS A C   1 
ATOM   596  O  O   . HIS A 1 75  ? -3.800  21.169 44.155 1.00 21.32 ? 217 HIS A O   1 
ATOM   597  C  CB  . HIS A 1 75  ? -6.293  22.965 44.644 1.00 23.38 ? 217 HIS A CB  1 
ATOM   598  C  CG  . HIS A 1 75  ? -7.557  22.902 43.835 1.00 24.93 ? 217 HIS A CG  1 
ATOM   599  N  ND1 . HIS A 1 75  ? -8.555  23.852 43.930 1.00 25.49 ? 217 HIS A ND1 1 
ATOM   600  C  CD2 . HIS A 1 75  ? -7.990  21.997 42.917 1.00 25.50 ? 217 HIS A CD2 1 
ATOM   601  C  CE1 . HIS A 1 75  ? -9.544  23.537 43.109 1.00 25.71 ? 217 HIS A CE1 1 
ATOM   602  N  NE2 . HIS A 1 75  ? -9.227  22.417 42.483 1.00 25.74 ? 217 HIS A NE2 1 
ATOM   603  N  N   . LEU A 1 76  ? -3.093  22.991 45.252 1.00 21.33 ? 218 LEU A N   1 
ATOM   604  C  CA  . LEU A 1 76  ? -2.012  22.300 45.937 1.00 21.29 ? 218 LEU A CA  1 
ATOM   605  C  C   . LEU A 1 76  ? -2.560  21.804 47.280 1.00 21.38 ? 218 LEU A C   1 
ATOM   606  O  O   . LEU A 1 76  ? -3.284  22.529 47.964 1.00 21.24 ? 218 LEU A O   1 
ATOM   607  C  CB  . LEU A 1 76  ? -0.849  23.250 46.186 1.00 21.14 ? 218 LEU A CB  1 
ATOM   608  C  CG  . LEU A 1 76  ? -0.027  23.708 44.994 1.00 21.19 ? 218 LEU A CG  1 
ATOM   609  C  CD1 . LEU A 1 76  ? 0.968   24.789 45.444 1.00 21.19 ? 218 LEU A CD1 1 
ATOM   610  C  CD2 . LEU A 1 76  ? 0.694   22.507 44.432 1.00 21.14 ? 218 LEU A CD2 1 
ATOM   611  N  N   . SER A 1 77  ? -2.254  20.570 47.653 1.00 21.56 ? 219 SER A N   1 
ATOM   612  C  CA  . SER A 1 77  ? -2.742  20.054 48.925 1.00 21.64 ? 219 SER A CA  1 
ATOM   613  C  C   . SER A 1 77  ? -1.610  19.421 49.722 1.00 21.91 ? 219 SER A C   1 
ATOM   614  O  O   . SER A 1 77  ? -0.721  18.751 49.160 1.00 21.88 ? 219 SER A O   1 
ATOM   615  C  CB  . SER A 1 77  ? -3.843  19.030 48.708 1.00 21.52 ? 219 SER A CB  1 
ATOM   616  O  OG  . SER A 1 77  ? -3.340  17.948 47.953 1.00 22.18 ? 219 SER A OG  1 
ATOM   617  N  N   . PRO A 1 78  ? -1.597  19.659 51.045 1.00 21.78 ? 220 PRO A N   1 
ATOM   618  C  CA  . PRO A 1 78  ? -0.544  19.081 51.866 1.00 21.43 ? 220 PRO A CA  1 
ATOM   619  C  C   . PRO A 1 78  ? -0.476  17.577 51.738 1.00 21.21 ? 220 PRO A C   1 
ATOM   620  O  O   . PRO A 1 78  ? 0.595   17.006 51.810 1.00 21.23 ? 220 PRO A O   1 
ATOM   621  C  CB  . PRO A 1 78  ? -0.907  19.556 53.281 1.00 21.92 ? 220 PRO A CB  1 
ATOM   622  C  CG  . PRO A 1 78  ? -2.328  20.060 53.172 1.00 22.12 ? 220 PRO A CG  1 
ATOM   623  C  CD  . PRO A 1 78  ? -2.372  20.646 51.812 1.00 21.76 ? 220 PRO A CD  1 
ATOM   624  N  N   . THR A 1 79  ? -1.610  16.942 51.488 1.00 21.12 ? 221 THR A N   1 
ATOM   625  C  CA  . THR A 1 79  ? -1.659  15.492 51.348 1.00 21.24 ? 221 THR A CA  1 
ATOM   626  C  C   . THR A 1 79  ? -1.277  14.961 49.957 1.00 21.00 ? 221 THR A C   1 
ATOM   627  O  O   . THR A 1 79  ? -1.168  13.749 49.764 1.00 20.91 ? 221 THR A O   1 
ATOM   628  C  CB  . THR A 1 79  ? -3.066  14.976 51.674 1.00 21.89 ? 221 THR A CB  1 
ATOM   629  O  OG1 . THR A 1 79  ? -4.041  15.741 50.941 1.00 22.52 ? 221 THR A OG1 1 
ATOM   630  C  CG2 . THR A 1 79  ? -3.351  15.108 53.156 1.00 22.07 ? 221 THR A CG2 1 
ATOM   631  N  N   . GLY A 1 80  ? -1.117  15.865 48.992 1.00 20.92 ? 222 GLY A N   1 
ATOM   632  C  CA  . GLY A 1 80  ? -0.776  15.477 47.625 1.00 20.86 ? 222 GLY A CA  1 
ATOM   633  C  C   . GLY A 1 80  ? -1.898  14.738 46.896 1.00 20.63 ? 222 GLY A C   1 
ATOM   634  O  O   . GLY A 1 80  ? -1.631  13.820 46.119 1.00 20.66 ? 222 GLY A O   1 
ATOM   635  N  N   . THR A 1 81  ? -3.150  15.157 47.116 1.00 20.47 ? 223 THR A N   1 
ATOM   636  C  CA  . THR A 1 81  ? -4.320  14.499 46.512 1.00 19.63 ? 223 THR A CA  1 
ATOM   637  C  C   . THR A 1 81  ? -5.176  15.412 45.661 1.00 18.74 ? 223 THR A C   1 
ATOM   638  O  O   . THR A 1 81  ? -6.384  15.213 45.566 1.00 18.78 ? 223 THR A O   1 
ATOM   639  C  CB  . THR A 1 81  ? -5.251  13.925 47.590 1.00 19.78 ? 223 THR A CB  1 
ATOM   640  O  OG1 . THR A 1 81  ? -5.649  14.987 48.465 1.00 20.74 ? 223 THR A OG1 1 
ATOM   641  C  CG2 . THR A 1 81  ? -4.535  12.862 48.396 1.00 20.03 ? 223 THR A CG2 1 
ATOM   642  N  N   . THR A 1 82  ? -4.569  16.428 45.076 1.00 17.55 ? 224 THR A N   1 
ATOM   643  C  CA  . THR A 1 82  ? -5.297  17.353 44.236 1.00 16.47 ? 224 THR A CA  1 
ATOM   644  C  C   . THR A 1 82  ? -4.584  17.435 42.863 1.00 16.06 ? 224 THR A C   1 
ATOM   645  O  O   . THR A 1 82  ? -3.424  17.058 42.740 1.00 15.71 ? 224 THR A O   1 
ATOM   646  C  CB  . THR A 1 82  ? -5.393  18.719 44.934 1.00 16.27 ? 224 THR A CB  1 
ATOM   647  O  OG1 . THR A 1 82  ? -4.095  19.124 45.371 1.00 16.49 ? 224 THR A OG1 1 
ATOM   648  C  CG2 . THR A 1 82  ? -6.263  18.625 46.154 1.00 16.05 ? 224 THR A CG2 1 
ATOM   649  N  N   . GLU A 1 83  ? -5.297  17.855 41.825 1.00 15.62 ? 225 GLU A N   1 
ATOM   650  C  CA  . GLU A 1 83  ? -4.727  17.962 40.489 1.00 14.87 ? 225 GLU A CA  1 
ATOM   651  C  C   . GLU A 1 83  ? -4.295  19.392 40.275 1.00 14.95 ? 225 GLU A C   1 
ATOM   652  O  O   . GLU A 1 83  ? -4.945  20.304 40.767 1.00 15.43 ? 225 GLU A O   1 
ATOM   653  C  CB  . GLU A 1 83  ? -5.788  17.605 39.457 1.00 14.27 ? 225 GLU A CB  1 
ATOM   654  C  CG  . GLU A 1 83  ? -6.335  16.198 39.575 1.00 13.28 ? 225 GLU A CG  1 
ATOM   655  C  CD  . GLU A 1 83  ? -7.075  15.785 38.329 1.00 12.96 ? 225 GLU A CD  1 
ATOM   656  O  OE1 . GLU A 1 83  ? -7.678  16.653 37.694 1.00 13.32 ? 225 GLU A OE1 1 
ATOM   657  O  OE2 . GLU A 1 83  ? -7.044  14.611 37.950 1.00 12.48 ? 225 GLU A OE2 1 
ATOM   658  N  N   . PHE A 1 84  ? -3.202  19.617 39.562 1.00 14.79 ? 226 PHE A N   1 
ATOM   659  C  CA  . PHE A 1 84  ? -2.755  20.988 39.311 1.00 14.66 ? 226 PHE A CA  1 
ATOM   660  C  C   . PHE A 1 84  ? -1.697  21.114 38.209 1.00 14.55 ? 226 PHE A C   1 
ATOM   661  O  O   . PHE A 1 84  ? -1.143  20.113 37.739 1.00 13.97 ? 226 PHE A O   1 
ATOM   662  C  CB  . PHE A 1 84  ? -2.184  21.600 40.608 1.00 15.07 ? 226 PHE A CB  1 
ATOM   663  C  CG  . PHE A 1 84  ? -0.930  20.916 41.119 1.00 15.31 ? 226 PHE A CG  1 
ATOM   664  C  CD1 . PHE A 1 84  ? -1.022  19.766 41.914 1.00 15.51 ? 226 PHE A CD1 1 
ATOM   665  C  CD2 . PHE A 1 84  ? 0.331   21.390 40.762 1.00 15.25 ? 226 PHE A CD2 1 
ATOM   666  C  CE1 . PHE A 1 84  ? 0.119   19.094 42.338 1.00 15.80 ? 226 PHE A CE1 1 
ATOM   667  C  CE2 . PHE A 1 84  ? 1.486   20.730 41.176 1.00 15.32 ? 226 PHE A CE2 1 
ATOM   668  C  CZ  . PHE A 1 84  ? 1.385   19.579 41.962 1.00 15.62 ? 226 PHE A CZ  1 
ATOM   669  N  N   . TRP A 1 85  ? -1.464  22.345 37.759 1.00 14.60 ? 227 TRP A N   1 
ATOM   670  C  CA  . TRP A 1 85  ? -0.384  22.612 36.799 1.00 14.48 ? 227 TRP A CA  1 
ATOM   671  C  C   . TRP A 1 85  ? 0.309   23.789 37.450 1.00 14.45 ? 227 TRP A C   1 
ATOM   672  O  O   . TRP A 1 85  ? -0.262  24.871 37.520 1.00 14.54 ? 227 TRP A O   1 
ATOM   673  C  CB  . TRP A 1 85  ? -0.874  23.005 35.413 1.00 14.07 ? 227 TRP A CB  1 
ATOM   674  C  CG  . TRP A 1 85  ? 0.263   23.247 34.460 1.00 13.70 ? 227 TRP A CG  1 
ATOM   675  C  CD1 . TRP A 1 85  ? 0.712   24.457 34.022 1.00 13.99 ? 227 TRP A CD1 1 
ATOM   676  C  CD2 . TRP A 1 85  ? 1.102   22.260 33.836 1.00 13.35 ? 227 TRP A CD2 1 
ATOM   677  N  NE1 . TRP A 1 85  ? 1.775   24.289 33.167 1.00 13.69 ? 227 TRP A NE1 1 
ATOM   678  C  CE2 . TRP A 1 85  ? 2.034   22.951 33.035 1.00 13.67 ? 227 TRP A CE2 1 
ATOM   679  C  CE3 . TRP A 1 85  ? 1.150   20.863 33.871 1.00 13.32 ? 227 TRP A CE3 1 
ATOM   680  C  CZ2 . TRP A 1 85  ? 3.005   22.293 32.276 1.00 13.12 ? 227 TRP A CZ2 1 
ATOM   681  C  CZ3 . TRP A 1 85  ? 2.107   20.209 33.120 1.00 12.92 ? 227 TRP A CZ3 1 
ATOM   682  C  CH2 . TRP A 1 85  ? 3.023   20.924 32.332 1.00 13.09 ? 227 TRP A CH2 1 
ATOM   683  N  N   . LEU A 1 86  ? 1.535   23.566 37.930 1.00 14.93 ? 228 LEU A N   1 
ATOM   684  C  CA  . LEU A 1 86  ? 2.307   24.590 38.640 1.00 14.88 ? 228 LEU A CA  1 
ATOM   685  C  C   . LEU A 1 86  ? 2.413   25.921 37.928 1.00 15.02 ? 228 LEU A C   1 
ATOM   686  O  O   . LEU A 1 86  ? 2.380   26.978 38.541 1.00 15.04 ? 228 LEU A O   1 
ATOM   687  C  CB  . LEU A 1 86  ? 3.716   24.073 38.968 1.00 14.56 ? 228 LEU A CB  1 
ATOM   688  C  CG  . LEU A 1 86  ? 4.573   24.974 39.873 1.00 14.42 ? 228 LEU A CG  1 
ATOM   689  C  CD1 . LEU A 1 86  ? 3.874   25.151 41.192 1.00 14.35 ? 228 LEU A CD1 1 
ATOM   690  C  CD2 . LEU A 1 86  ? 5.958   24.384 40.081 1.00 14.69 ? 228 LEU A CD2 1 
ATOM   691  N  N   . GLY A 1 87  ? 2.597   25.861 36.629 1.00 15.35 ? 229 GLY A N   1 
ATOM   692  C  CA  . GLY A 1 87  ? 2.728   27.078 35.876 1.00 16.24 ? 229 GLY A CA  1 
ATOM   693  C  C   . GLY A 1 87  ? 3.996   27.011 35.056 1.00 16.45 ? 229 GLY A C   1 
ATOM   694  O  O   . GLY A 1 87  ? 5.062   26.650 35.587 1.00 16.36 ? 229 GLY A O   1 
ATOM   695  N  N   . ASN A 1 88  ? 3.872   27.362 33.772 1.00 16.64 ? 230 ASN A N   1 
ATOM   696  C  CA  . ASN A 1 88  ? 4.989   27.360 32.831 1.00 16.45 ? 230 ASN A CA  1 
ATOM   697  C  C   . ASN A 1 88  ? 6.109   28.285 33.223 1.00 16.57 ? 230 ASN A C   1 
ATOM   698  O  O   . ASN A 1 88  ? 7.249   27.991 32.922 1.00 16.74 ? 230 ASN A O   1 
ATOM   699  C  CB  . ASN A 1 88  ? 4.533   27.707 31.427 1.00 15.94 ? 230 ASN A CB  1 
ATOM   700  C  CG  . ASN A 1 88  ? 3.908   26.542 30.728 1.00 16.02 ? 230 ASN A CG  1 
ATOM   701  O  OD1 . ASN A 1 88  ? 4.206   25.400 31.030 1.00 15.86 ? 230 ASN A OD1 1 
ATOM   702  N  ND2 . ASN A 1 88  ? 3.007   26.821 29.807 1.00 15.82 ? 230 ASN A ND2 1 
ATOM   703  N  N   . GLU A 1 89  ? 5.796   29.403 33.876 1.00 17.24 ? 231 GLU A N   1 
ATOM   704  C  CA  . GLU A 1 89  ? 6.824   30.360 34.307 1.00 17.78 ? 231 GLU A CA  1 
ATOM   705  C  C   . GLU A 1 89  ? 7.664   29.792 35.474 1.00 17.73 ? 231 GLU A C   1 
ATOM   706  O  O   . GLU A 1 89  ? 8.894   29.903 35.477 1.00 17.87 ? 231 GLU A O   1 
ATOM   707  C  CB  . GLU A 1 89  ? 6.195   31.716 34.680 1.00 18.31 ? 231 GLU A CB  1 
ATOM   708  C  CG  . GLU A 1 89  ? 7.199   32.842 35.021 1.00 19.17 ? 231 GLU A CG  1 
ATOM   709  C  CD  . GLU A 1 89  ? 8.050   33.327 33.834 1.00 20.23 ? 231 GLU A CD  1 
ATOM   710  O  OE1 . GLU A 1 89  ? 7.643   33.170 32.660 1.00 20.75 ? 231 GLU A OE1 1 
ATOM   711  O  OE2 . GLU A 1 89  ? 9.135   33.907 34.076 1.00 20.87 ? 231 GLU A OE2 1 
ATOM   712  N  N   . LYS A 1 90  ? 6.995   29.149 36.425 1.00 17.61 ? 232 LYS A N   1 
ATOM   713  C  CA  . LYS A 1 90  ? 7.652   28.534 37.585 1.00 17.56 ? 232 LYS A CA  1 
ATOM   714  C  C   . LYS A 1 90  ? 8.466   27.319 37.160 1.00 17.23 ? 232 LYS A C   1 
ATOM   715  O  O   . LYS A 1 90  ? 9.564   27.103 37.672 1.00 17.18 ? 232 LYS A O   1 
ATOM   716  C  CB  . LYS A 1 90  ? 6.622   28.133 38.654 1.00 17.42 ? 232 LYS A CB  1 
ATOM   717  C  CG  . LYS A 1 90  ? 6.025   29.328 39.384 1.00 18.48 ? 232 LYS A CG  1 
ATOM   718  C  CD  . LYS A 1 90  ? 4.772   28.971 40.160 1.00 19.37 ? 232 LYS A CD  1 
ATOM   719  C  CE  . LYS A 1 90  ? 3.946   30.209 40.496 1.00 20.13 ? 232 LYS A CE  1 
ATOM   720  N  NZ  . LYS A 1 90  ? 2.608   29.881 41.097 1.00 21.18 ? 232 LYS A NZ  1 
ATOM   721  N  N   . ILE A 1 91  ? 7.929   26.520 36.241 1.00 16.92 ? 233 ILE A N   1 
ATOM   722  C  CA  . ILE A 1 91  ? 8.658   25.354 35.764 1.00 16.89 ? 233 ILE A CA  1 
ATOM   723  C  C   . ILE A 1 91  ? 9.918   25.854 35.058 1.00 16.76 ? 233 ILE A C   1 
ATOM   724  O  O   . ILE A 1 91  ? 10.966  25.240 35.118 1.00 17.04 ? 233 ILE A O   1 
ATOM   725  C  CB  . ILE A 1 91  ? 7.811   24.485 34.795 1.00 17.10 ? 233 ILE A CB  1 
ATOM   726  C  CG1 . ILE A 1 91  ? 6.618   23.878 35.539 1.00 16.85 ? 233 ILE A CG1 1 
ATOM   727  C  CG2 . ILE A 1 91  ? 8.670   23.367 34.195 1.00 16.54 ? 233 ILE A CG2 1 
ATOM   728  C  CD1 . ILE A 1 91  ? 5.548   23.339 34.626 1.00 16.88 ? 233 ILE A CD1 1 
ATOM   729  N  N   . HIS A 1 92  ? 9.814   27.008 34.423 1.00 17.00 ? 234 HIS A N   1 
ATOM   730  C  CA  . HIS A 1 92  ? 10.948  27.589 33.722 1.00 16.86 ? 234 HIS A CA  1 
ATOM   731  C  C   . HIS A 1 92  ? 11.979  28.110 34.703 1.00 16.97 ? 234 HIS A C   1 
ATOM   732  O  O   . HIS A 1 92  ? 13.169  27.857 34.548 1.00 17.10 ? 234 HIS A O   1 
ATOM   733  C  CB  . HIS A 1 92  ? 10.482  28.728 32.813 1.00 16.66 ? 234 HIS A CB  1 
ATOM   734  C  CG  . HIS A 1 92  ? 11.591  29.586 32.325 1.00 16.17 ? 234 HIS A CG  1 
ATOM   735  N  ND1 . HIS A 1 92  ? 12.730  29.065 31.755 1.00 16.23 ? 234 HIS A ND1 1 
ATOM   736  C  CD2 . HIS A 1 92  ? 11.774  30.923 32.385 1.00 16.41 ? 234 HIS A CD2 1 
ATOM   737  C  CE1 . HIS A 1 92  ? 13.573  30.044 31.491 1.00 16.55 ? 234 HIS A CE1 1 
ATOM   738  N  NE2 . HIS A 1 92  ? 13.017  31.183 31.865 1.00 16.60 ? 234 HIS A NE2 1 
ATOM   739  N  N   . LEU A 1 93  ? 11.522  28.852 35.704 1.00 16.88 ? 235 LEU A N   1 
ATOM   740  C  CA  . LEU A 1 93  ? 12.417  29.408 36.708 1.00 16.93 ? 235 LEU A CA  1 
ATOM   741  C  C   . LEU A 1 93  ? 13.221  28.337 37.477 1.00 17.33 ? 235 LEU A C   1 
ATOM   742  O  O   . LEU A 1 93  ? 14.379  28.573 37.852 1.00 17.43 ? 235 LEU A O   1 
ATOM   743  C  CB  . LEU A 1 93  ? 11.630  30.284 37.685 1.00 16.31 ? 235 LEU A CB  1 
ATOM   744  C  CG  . LEU A 1 93  ? 10.930  31.519 37.141 1.00 16.07 ? 235 LEU A CG  1 
ATOM   745  C  CD1 . LEU A 1 93  ? 10.202  32.208 38.263 1.00 15.97 ? 235 LEU A CD1 1 
ATOM   746  C  CD2 . LEU A 1 93  ? 11.955  32.450 36.557 1.00 16.50 ? 235 LEU A CD2 1 
ATOM   747  N  N   . ILE A 1 94  ? 12.617  27.172 37.711 1.00 17.41 ? 236 ILE A N   1 
ATOM   748  C  CA  . ILE A 1 94  ? 13.291  26.104 38.437 1.00 17.70 ? 236 ILE A CA  1 
ATOM   749  C  C   . ILE A 1 94  ? 14.258  25.279 37.572 1.00 18.04 ? 236 ILE A C   1 
ATOM   750  O  O   . ILE A 1 94  ? 15.444  25.160 37.911 1.00 18.48 ? 236 ILE A O   1 
ATOM   751  C  CB  . ILE A 1 94  ? 12.269  25.125 39.128 1.00 17.57 ? 236 ILE A CB  1 
ATOM   752  C  CG1 . ILE A 1 94  ? 11.317  25.893 40.063 1.00 17.23 ? 236 ILE A CG1 1 
ATOM   753  C  CG2 . ILE A 1 94  ? 13.022  24.019 39.912 1.00 16.97 ? 236 ILE A CG2 1 
ATOM   754  C  CD1 . ILE A 1 94  ? 9.962   25.216 40.244 1.00 17.27 ? 236 ILE A CD1 1 
ATOM   755  N  N   . SER A 1 95  ? 13.771  24.755 36.449 1.00 18.05 ? 237 SER A N   1 
ATOM   756  C  CA  . SER A 1 95  ? 14.568  23.901 35.579 1.00 18.04 ? 237 SER A CA  1 
ATOM   757  C  C   . SER A 1 95  ? 15.778  24.573 34.936 1.00 18.29 ? 237 SER A C   1 
ATOM   758  O  O   . SER A 1 95  ? 16.665  23.889 34.418 1.00 18.27 ? 237 SER A O   1 
ATOM   759  C  CB  . SER A 1 95  ? 13.687  23.271 34.493 1.00 17.85 ? 237 SER A CB  1 
ATOM   760  O  OG  . SER A 1 95  ? 13.241  24.244 33.566 1.00 17.13 ? 237 SER A OG  1 
ATOM   761  N  N   . THR A 1 96  ? 15.800  25.902 34.932 1.00 18.57 ? 238 THR A N   1 
ATOM   762  C  CA  . THR A 1 96  ? 16.924  26.604 34.341 1.00 18.99 ? 238 THR A CA  1 
ATOM   763  C  C   . THR A 1 96  ? 17.752  27.399 35.360 1.00 19.15 ? 238 THR A C   1 
ATOM   764  O  O   . THR A 1 96  ? 18.584  28.225 34.983 1.00 19.69 ? 238 THR A O   1 
ATOM   765  C  CB  . THR A 1 96  ? 16.465  27.539 33.191 1.00 19.16 ? 238 THR A CB  1 
ATOM   766  O  OG1 . THR A 1 96  ? 15.670  28.603 33.726 1.00 19.72 ? 238 THR A OG1 1 
ATOM   767  C  CG2 . THR A 1 96  ? 15.628  26.776 32.141 1.00 19.47 ? 238 THR A CG2 1 
ATOM   768  N  N   . GLN A 1 97  ? 17.547  27.179 36.650 1.00 19.20 ? 239 GLN A N   1 
ATOM   769  C  CA  . GLN A 1 97  ? 18.317  27.951 37.605 1.00 19.23 ? 239 GLN A CA  1 
ATOM   770  C  C   . GLN A 1 97  ? 19.757  27.482 37.743 1.00 19.40 ? 239 GLN A C   1 
ATOM   771  O  O   . GLN A 1 97  ? 20.029  26.285 37.780 1.00 19.15 ? 239 GLN A O   1 
ATOM   772  C  CB  . GLN A 1 97  ? 17.635  28.028 38.981 1.00 19.17 ? 239 GLN A CB  1 
ATOM   773  C  CG  . GLN A 1 97  ? 17.521  26.753 39.760 1.00 18.58 ? 239 GLN A CG  1 
ATOM   774  C  CD  . GLN A 1 97  ? 16.840  26.997 41.070 1.00 18.95 ? 239 GLN A CD  1 
ATOM   775  O  OE1 . GLN A 1 97  ? 17.083  28.004 41.713 1.00 19.44 ? 239 GLN A OE1 1 
ATOM   776  N  NE2 . GLN A 1 97  ? 15.977  26.085 41.478 1.00 18.97 ? 239 GLN A NE2 1 
ATOM   777  N  N   . SER A 1 98  ? 20.677  28.443 37.709 1.00 19.51 ? 240 SER A N   1 
ATOM   778  C  CA  . SER A 1 98  ? 22.103  28.185 37.862 1.00 19.63 ? 240 SER A CA  1 
ATOM   779  C  C   . SER A 1 98  ? 22.655  27.034 37.019 1.00 19.45 ? 240 SER A C   1 
ATOM   780  O  O   . SER A 1 98  ? 23.564  26.322 37.461 1.00 20.10 ? 240 SER A O   1 
ATOM   781  C  CB  . SER A 1 98  ? 22.412  27.952 39.351 1.00 20.16 ? 240 SER A CB  1 
ATOM   782  O  OG  . SER A 1 98  ? 22.206  29.150 40.116 1.00 21.39 ? 240 SER A OG  1 
ATOM   783  N  N   . ALA A 1 99  ? 22.098  26.854 35.817 1.00 18.57 ? 241 ALA A N   1 
ATOM   784  C  CA  . ALA A 1 99  ? 22.490  25.788 34.886 1.00 17.26 ? 241 ALA A CA  1 
ATOM   785  C  C   . ALA A 1 99  ? 22.472  24.442 35.553 1.00 16.73 ? 241 ALA A C   1 
ATOM   786  O  O   . ALA A 1 99  ? 23.150  23.516 35.100 1.00 17.08 ? 241 ALA A O   1 
ATOM   787  C  CB  . ALA A 1 99  ? 23.873  26.054 34.307 1.00 17.54 ? 241 ALA A CB  1 
ATOM   788  N  N   . ILE A 1 100 ? 21.720  24.313 36.639 1.00 15.73 ? 242 ILE A N   1 
ATOM   789  C  CA  . ILE A 1 100 ? 21.669  23.045 37.344 1.00 15.16 ? 242 ILE A CA  1 
ATOM   790  C  C   . ILE A 1 100 ? 21.054  21.995 36.433 1.00 14.82 ? 242 ILE A C   1 
ATOM   791  O  O   . ILE A 1 100 ? 20.021  22.239 35.794 1.00 14.60 ? 242 ILE A O   1 
ATOM   792  C  CB  . ILE A 1 100 ? 20.829  23.122 38.657 1.00 14.76 ? 242 ILE A CB  1 
ATOM   793  C  CG1 . ILE A 1 100 ? 21.394  24.172 39.593 1.00 14.41 ? 242 ILE A CG1 1 
ATOM   794  C  CG2 . ILE A 1 100 ? 20.886  21.793 39.397 1.00 14.70 ? 242 ILE A CG2 1 
ATOM   795  C  CD1 . ILE A 1 100 ? 20.552  24.381 40.834 1.00 14.38 ? 242 ILE A CD1 1 
ATOM   796  N  N   . PRO A 1 101 ? 21.730  20.846 36.293 1.00 14.64 ? 243 PRO A N   1 
ATOM   797  C  CA  . PRO A 1 101 ? 21.198  19.785 35.445 1.00 14.99 ? 243 PRO A CA  1 
ATOM   798  C  C   . PRO A 1 101 ? 20.051  19.030 36.140 1.00 15.46 ? 243 PRO A C   1 
ATOM   799  O  O   . PRO A 1 101 ? 20.259  18.398 37.181 1.00 16.13 ? 243 PRO A O   1 
ATOM   800  C  CB  . PRO A 1 101 ? 22.421  18.905 35.200 1.00 14.86 ? 243 PRO A CB  1 
ATOM   801  C  CG  . PRO A 1 101 ? 23.244  19.127 36.422 1.00 14.64 ? 243 PRO A CG  1 
ATOM   802  C  CD  . PRO A 1 101 ? 23.135  20.583 36.646 1.00 14.33 ? 243 PRO A CD  1 
ATOM   803  N  N   . TYR A 1 102 ? 18.840  19.130 35.583 1.00 15.54 ? 244 TYR A N   1 
ATOM   804  C  CA  . TYR A 1 102 ? 17.658  18.466 36.125 1.00 15.47 ? 244 TYR A CA  1 
ATOM   805  C  C   . TYR A 1 102 ? 17.195  17.265 35.286 1.00 15.80 ? 244 TYR A C   1 
ATOM   806  O  O   . TYR A 1 102 ? 17.316  17.258 34.049 1.00 16.49 ? 244 TYR A O   1 
ATOM   807  C  CB  . TYR A 1 102 ? 16.476  19.459 36.234 1.00 15.43 ? 244 TYR A CB  1 
ATOM   808  C  CG  . TYR A 1 102 ? 16.565  20.469 37.351 1.00 14.83 ? 244 TYR A CG  1 
ATOM   809  C  CD1 . TYR A 1 102 ? 16.106  20.162 38.638 1.00 15.32 ? 244 TYR A CD1 1 
ATOM   810  C  CD2 . TYR A 1 102 ? 17.113  21.724 37.131 1.00 14.77 ? 244 TYR A CD2 1 
ATOM   811  C  CE1 . TYR A 1 102 ? 16.196  21.083 39.671 1.00 14.94 ? 244 TYR A CE1 1 
ATOM   812  C  CE2 . TYR A 1 102 ? 17.208  22.643 38.142 1.00 15.03 ? 244 TYR A CE2 1 
ATOM   813  C  CZ  . TYR A 1 102 ? 16.749  22.318 39.415 1.00 15.07 ? 244 TYR A CZ  1 
ATOM   814  O  OH  . TYR A 1 102 ? 16.866  23.256 40.416 1.00 15.66 ? 244 TYR A OH  1 
ATOM   815  N  N   . ALA A 1 103 ? 16.650  16.258 35.966 1.00 15.58 ? 245 ALA A N   1 
ATOM   816  C  CA  . ALA A 1 103 ? 16.098  15.073 35.329 1.00 15.26 ? 245 ALA A CA  1 
ATOM   817  C  C   . ALA A 1 103 ? 14.595  15.157 35.560 1.00 15.34 ? 245 ALA A C   1 
ATOM   818  O  O   . ALA A 1 103 ? 14.138  15.578 36.631 1.00 15.47 ? 245 ALA A O   1 
ATOM   819  C  CB  . ALA A 1 103 ? 16.626  13.836 35.968 1.00 15.45 ? 245 ALA A CB  1 
ATOM   820  N  N   . LEU A 1 104 ? 13.819  14.763 34.563 1.00 15.07 ? 246 LEU A N   1 
ATOM   821  C  CA  . LEU A 1 104 ? 12.374  14.804 34.677 1.00 14.46 ? 246 LEU A CA  1 
ATOM   822  C  C   . LEU A 1 104 ? 11.867  13.398 34.752 1.00 14.59 ? 246 LEU A C   1 
ATOM   823  O  O   . LEU A 1 104 ? 12.258  12.565 33.947 1.00 14.46 ? 246 LEU A O   1 
ATOM   824  C  CB  . LEU A 1 104 ? 11.773  15.474 33.443 1.00 14.11 ? 246 LEU A CB  1 
ATOM   825  C  CG  . LEU A 1 104 ? 10.341  15.080 33.064 1.00 13.75 ? 246 LEU A CG  1 
ATOM   826  C  CD1 . LEU A 1 104 ? 9.374   15.706 34.070 1.00 13.09 ? 246 LEU A CD1 1 
ATOM   827  C  CD2 . LEU A 1 104 ? 10.044  15.531 31.634 1.00 13.16 ? 246 LEU A CD2 1 
ATOM   828  N  N   . ARG A 1 105 ? 10.995  13.137 35.716 1.00 14.80 ? 247 ARG A N   1 
ATOM   829  C  CA  . ARG A 1 105 ? 10.393  11.833 35.865 1.00 15.17 ? 247 ARG A CA  1 
ATOM   830  C  C   . ARG A 1 105 ? 8.908   12.011 35.648 1.00 15.67 ? 247 ARG A C   1 
ATOM   831  O  O   . ARG A 1 105 ? 8.289   12.954 36.154 1.00 15.60 ? 247 ARG A O   1 
ATOM   832  C  CB  . ARG A 1 105 ? 10.652  11.216 37.248 1.00 15.13 ? 247 ARG A CB  1 
ATOM   833  C  CG  . ARG A 1 105 ? 9.884   9.912  37.469 1.00 14.87 ? 247 ARG A CG  1 
ATOM   834  C  CD  . ARG A 1 105 ? 10.440  9.069  38.631 1.00 15.30 ? 247 ARG A CD  1 
ATOM   835  N  NE  . ARG A 1 105 ? 11.768  8.548  38.316 1.00 15.52 ? 247 ARG A NE  1 
ATOM   836  C  CZ  . ARG A 1 105 ? 12.454  7.674  39.051 1.00 15.87 ? 247 ARG A CZ  1 
ATOM   837  N  NH1 . ARG A 1 105 ? 11.957  7.182  40.181 1.00 16.11 ? 247 ARG A NH1 1 
ATOM   838  N  NH2 . ARG A 1 105 ? 13.673  7.332  38.673 1.00 15.81 ? 247 ARG A NH2 1 
ATOM   839  N  N   . VAL A 1 106 ? 8.390   11.167 34.778 1.00 16.45 ? 248 VAL A N   1 
ATOM   840  C  CA  . VAL A 1 106 ? 6.988   11.121 34.404 1.00 17.37 ? 248 VAL A CA  1 
ATOM   841  C  C   . VAL A 1 106 ? 6.640   9.796  35.056 1.00 18.38 ? 248 VAL A C   1 
ATOM   842  O  O   . VAL A 1 106 ? 7.332   8.796  34.828 1.00 18.78 ? 248 VAL A O   1 
ATOM   843  C  CB  . VAL A 1 106 ? 6.846   11.030 32.838 1.00 17.19 ? 248 VAL A CB  1 
ATOM   844  C  CG1 . VAL A 1 106 ? 5.455   10.602 32.436 1.00 17.11 ? 248 VAL A CG1 1 
ATOM   845  C  CG2 . VAL A 1 106 ? 7.199   12.361 32.192 1.00 16.45 ? 248 VAL A CG2 1 
ATOM   846  N  N   . GLU A 1 107 ? 5.632   9.797  35.918 1.00 19.56 ? 249 GLU A N   1 
ATOM   847  C  CA  . GLU A 1 107 ? 5.234   8.599  36.643 1.00 20.70 ? 249 GLU A CA  1 
ATOM   848  C  C   . GLU A 1 107 ? 3.796   8.372  36.303 1.00 20.97 ? 249 GLU A C   1 
ATOM   849  O  O   . GLU A 1 107 ? 2.978   9.261  36.464 1.00 21.19 ? 249 GLU A O   1 
ATOM   850  C  CB  . GLU A 1 107 ? 5.395   8.857  38.118 1.00 21.79 ? 249 GLU A CB  1 
ATOM   851  C  CG  . GLU A 1 107 ? 5.345   7.648  38.977 1.00 24.08 ? 249 GLU A CG  1 
ATOM   852  C  CD  . GLU A 1 107 ? 5.606   8.018  40.415 1.00 25.32 ? 249 GLU A CD  1 
ATOM   853  O  OE1 . GLU A 1 107 ? 6.783   8.299  40.738 1.00 25.93 ? 249 GLU A OE1 1 
ATOM   854  O  OE2 . GLU A 1 107 ? 4.625   8.059  41.202 1.00 26.59 ? 249 GLU A OE2 1 
ATOM   855  N  N   . LEU A 1 108 ? 3.481   7.164  35.881 1.00 21.64 ? 250 LEU A N   1 
ATOM   856  C  CA  . LEU A 1 108 ? 2.141   6.857  35.417 1.00 22.19 ? 250 LEU A CA  1 
ATOM   857  C  C   . LEU A 1 108 ? 1.457   5.716  36.116 1.00 23.20 ? 250 LEU A C   1 
ATOM   858  O  O   . LEU A 1 108 ? 2.091   4.702  36.448 1.00 23.05 ? 250 LEU A O   1 
ATOM   859  C  CB  . LEU A 1 108 ? 2.210   6.513  33.931 1.00 21.27 ? 250 LEU A CB  1 
ATOM   860  C  CG  . LEU A 1 108 ? 2.903   7.498  32.998 1.00 20.34 ? 250 LEU A CG  1 
ATOM   861  C  CD1 . LEU A 1 108 ? 2.988   6.875  31.632 1.00 19.99 ? 250 LEU A CD1 1 
ATOM   862  C  CD2 . LEU A 1 108 ? 2.175   8.824  32.980 1.00 19.39 ? 250 LEU A CD2 1 
ATOM   863  N  N   . GLU A 1 109 ? 0.146   5.855  36.286 1.00 24.51 ? 251 GLU A N   1 
ATOM   864  C  CA  . GLU A 1 109 ? -0.620  4.794  36.901 1.00 25.74 ? 251 GLU A CA  1 
ATOM   865  C  C   . GLU A 1 109 ? -1.790  4.314  36.081 1.00 26.79 ? 251 GLU A C   1 
ATOM   866  O  O   . GLU A 1 109 ? -2.533  5.073  35.444 1.00 26.76 ? 251 GLU A O   1 
ATOM   867  C  CB  . GLU A 1 109 ? -1.082  5.121  38.301 1.00 25.81 ? 251 GLU A CB  1 
ATOM   868  C  CG  . GLU A 1 109 ? -1.489  3.847  39.023 1.00 26.52 ? 251 GLU A CG  1 
ATOM   869  C  CD  . GLU A 1 109 ? -2.008  4.072  40.422 1.00 26.85 ? 251 GLU A CD  1 
ATOM   870  O  OE1 . GLU A 1 109 ? -1.317  4.739  41.234 1.00 27.02 ? 251 GLU A OE1 1 
ATOM   871  O  OE2 . GLU A 1 109 ? -3.109  3.551  40.704 1.00 27.38 ? 251 GLU A OE2 1 
ATOM   872  N  N   . ASP A 1 110 ? -1.923  3.008  36.123 1.00 28.15 ? 252 ASP A N   1 
ATOM   873  C  CA  . ASP A 1 110 ? -2.948  2.267  35.426 1.00 29.58 ? 252 ASP A CA  1 
ATOM   874  C  C   . ASP A 1 110 ? -4.270  2.315  36.120 1.00 30.04 ? 252 ASP A C   1 
ATOM   875  O  O   . ASP A 1 110 ? -4.396  2.762  37.260 1.00 30.18 ? 252 ASP A O   1 
ATOM   876  C  CB  . ASP A 1 110 ? -2.553  0.792  35.433 1.00 30.11 ? 252 ASP A CB  1 
ATOM   877  C  CG  . ASP A 1 110 ? -2.513  0.217  34.089 1.00 30.90 ? 252 ASP A CG  1 
ATOM   878  O  OD1 . ASP A 1 110 ? -2.701  0.990  33.114 1.00 31.38 ? 252 ASP A OD1 1 
ATOM   879  O  OD2 . ASP A 1 110 ? -2.277  -1.003 34.005 1.00 31.40 ? 252 ASP A OD2 1 
ATOM   880  N  N   . TRP A 1 111 ? -5.246  1.745  35.438 1.00 30.84 ? 253 TRP A N   1 
ATOM   881  C  CA  . TRP A 1 111 ? -6.554  1.594  36.022 1.00 31.65 ? 253 TRP A CA  1 
ATOM   882  C  C   . TRP A 1 111 ? -6.521  0.209  36.669 1.00 32.39 ? 253 TRP A C   1 
ATOM   883  O  O   . TRP A 1 111 ? -7.450  -0.169 37.376 1.00 32.77 ? 253 TRP A O   1 
ATOM   884  C  CB  . TRP A 1 111 ? -7.635  1.710  34.960 1.00 31.08 ? 253 TRP A CB  1 
ATOM   885  C  CG  . TRP A 1 111 ? -7.853  3.120  34.578 1.00 30.30 ? 253 TRP A CG  1 
ATOM   886  C  CD1 . TRP A 1 111 ? -7.302  3.777  33.523 1.00 30.13 ? 253 TRP A CD1 1 
ATOM   887  C  CD2 . TRP A 1 111 ? -8.663  4.075  35.275 1.00 30.13 ? 253 TRP A CD2 1 
ATOM   888  N  NE1 . TRP A 1 111 ? -7.719  5.089  33.513 1.00 30.04 ? 253 TRP A NE1 1 
ATOM   889  C  CE2 . TRP A 1 111 ? -8.555  5.299  34.578 1.00 29.98 ? 253 TRP A CE2 1 
ATOM   890  C  CE3 . TRP A 1 111 ? -9.470  4.015  36.423 1.00 29.80 ? 253 TRP A CE3 1 
ATOM   891  C  CZ2 . TRP A 1 111 ? -9.222  6.454  34.989 1.00 29.80 ? 253 TRP A CZ2 1 
ATOM   892  C  CZ3 . TRP A 1 111 ? -10.132 5.168  36.830 1.00 29.69 ? 253 TRP A CZ3 1 
ATOM   893  C  CH2 . TRP A 1 111 ? -10.004 6.367  36.113 1.00 29.50 ? 253 TRP A CH2 1 
ATOM   894  N  N   . ASN A 1 112 ? -5.399  -0.497 36.475 1.00 33.20 ? 254 ASN A N   1 
ATOM   895  C  CA  . ASN A 1 112 ? -5.163  -1.845 37.025 1.00 33.90 ? 254 ASN A CA  1 
ATOM   896  C  C   . ASN A 1 112 ? -4.127  -1.889 38.159 1.00 33.99 ? 254 ASN A C   1 
ATOM   897  O  O   . ASN A 1 112 ? -3.624  -2.971 38.495 1.00 34.23 ? 254 ASN A O   1 
ATOM   898  C  CB  . ASN A 1 112 ? -4.693  -2.812 35.924 1.00 34.27 ? 254 ASN A CB  1 
ATOM   899  C  CG  . ASN A 1 112 ? -5.780  -3.135 34.917 1.00 34.76 ? 254 ASN A CG  1 
ATOM   900  O  OD1 . ASN A 1 112 ? -6.585  -4.054 35.123 1.00 35.41 ? 254 ASN A OD1 1 
ATOM   901  N  ND2 . ASN A 1 112 ? -5.796  -2.402 33.802 1.00 34.71 ? 254 ASN A ND2 1 
ATOM   902  N  N   . GLY A 1 113 ? -3.777  -0.723 38.711 1.00 34.09 ? 255 GLY A N   1 
ATOM   903  C  CA  . GLY A 1 113 ? -2.792  -0.652 39.789 1.00 33.69 ? 255 GLY A CA  1 
ATOM   904  C  C   . GLY A 1 113 ? -1.310  -0.555 39.404 1.00 33.68 ? 255 GLY A C   1 
ATOM   905  O  O   . GLY A 1 113 ? -0.463  -0.202 40.243 1.00 33.99 ? 255 GLY A O   1 
ATOM   906  N  N   . ARG A 1 114 ? -0.979  -0.849 38.148 1.00 33.23 ? 256 ARG A N   1 
ATOM   907  C  CA  . ARG A 1 114 ? 0.405   -0.810 37.695 1.00 32.92 ? 256 ARG A CA  1 
ATOM   908  C  C   . ARG A 1 114 ? 0.969   0.581  37.459 1.00 32.30 ? 256 ARG A C   1 
ATOM   909  O  O   . ARG A 1 114 ? 0.384   1.389  36.745 1.00 32.26 ? 256 ARG A O   1 
ATOM   910  C  CB  . ARG A 1 114 ? 0.563   -1.662 36.442 1.00 33.53 ? 256 ARG A CB  1 
ATOM   911  C  CG  . ARG A 1 114 ? 0.116   -3.073 36.676 1.00 34.53 ? 256 ARG A CG  1 
ATOM   912  C  CD  . ARG A 1 114 ? 0.460   -3.988 35.538 1.00 35.54 ? 256 ARG A CD  1 
ATOM   913  N  NE  . ARG A 1 114 ? -0.709  -4.357 34.748 1.00 36.66 ? 256 ARG A NE  1 
ATOM   914  C  CZ  . ARG A 1 114 ? -0.962  -3.877 33.534 1.00 37.45 ? 256 ARG A CZ  1 
ATOM   915  N  NH1 . ARG A 1 114 ? -0.125  -2.998 32.984 1.00 38.02 ? 256 ARG A NH1 1 
ATOM   916  N  NH2 . ARG A 1 114 ? -2.019  -4.308 32.844 1.00 37.69 ? 256 ARG A NH2 1 
ATOM   917  N  N   . THR A 1 115 ? 2.131   0.835  38.041 1.00 31.57 ? 257 THR A N   1 
ATOM   918  C  CA  . THR A 1 115 ? 2.799   2.116  37.906 1.00 30.99 ? 257 THR A CA  1 
ATOM   919  C  C   . THR A 1 115 ? 4.007   1.956  36.971 1.00 30.04 ? 257 THR A C   1 
ATOM   920  O  O   . THR A 1 115 ? 4.631   0.903  36.973 1.00 30.59 ? 257 THR A O   1 
ATOM   921  C  CB  . THR A 1 115 ? 3.245   2.607  39.307 1.00 31.39 ? 257 THR A CB  1 
ATOM   922  O  OG1 . THR A 1 115 ? 2.120   2.563  40.203 1.00 32.14 ? 257 THR A OG1 1 
ATOM   923  C  CG2 . THR A 1 115 ? 3.760   4.054  39.254 1.00 31.69 ? 257 THR A CG2 1 
ATOM   924  N  N   . SER A 1 116 ? 4.271   2.940  36.107 1.00 28.74 ? 258 SER A N   1 
ATOM   925  C  CA  . SER A 1 116 ? 5.427   2.903  35.189 1.00 27.06 ? 258 SER A CA  1 
ATOM   926  C  C   . SER A 1 116 ? 6.140   4.259  35.206 1.00 25.87 ? 258 SER A C   1 
ATOM   927  O  O   . SER A 1 116 ? 5.517   5.291  35.464 1.00 25.29 ? 258 SER A O   1 
ATOM   928  C  CB  . SER A 1 116 ? 5.008   2.582  33.750 1.00 26.93 ? 258 SER A CB  1 
ATOM   929  O  OG  . SER A 1 116 ? 4.428   3.718  33.114 1.00 27.44 ? 258 SER A OG  1 
ATOM   930  N  N   . THR A 1 117 ? 7.433   4.258  34.906 1.00 24.60 ? 259 THR A N   1 
ATOM   931  C  CA  . THR A 1 117 ? 8.205   5.489  34.906 1.00 23.56 ? 259 THR A CA  1 
ATOM   932  C  C   . THR A 1 117 ? 8.970   5.751  33.612 1.00 22.74 ? 259 THR A C   1 
ATOM   933  O  O   . THR A 1 117 ? 9.131   4.870  32.758 1.00 22.25 ? 259 THR A O   1 
ATOM   934  C  CB  . THR A 1 117 ? 9.176   5.544  36.107 1.00 23.60 ? 259 THR A CB  1 
ATOM   935  O  OG1 . THR A 1 117 ? 10.103  4.458  36.036 1.00 24.27 ? 259 THR A OG1 1 
ATOM   936  C  CG2 . THR A 1 117 ? 8.409   5.416  37.410 1.00 23.82 ? 259 THR A CG2 1 
ATOM   937  N  N   . ALA A 1 118 ? 9.321   7.011  33.416 1.00 21.91 ? 260 ALA A N   1 
ATOM   938  C  CA  . ALA A 1 118 ? 10.083  7.401  32.252 1.00 21.26 ? 260 ALA A CA  1 
ATOM   939  C  C   . ALA A 1 118 ? 10.872  8.617  32.693 1.00 20.55 ? 260 ALA A C   1 
ATOM   940  O  O   . ALA A 1 118 ? 10.287  9.583  33.157 1.00 20.48 ? 260 ALA A O   1 
ATOM   941  C  CB  . ALA A 1 118 ? 9.160   7.732  31.070 1.00 21.12 ? 260 ALA A CB  1 
ATOM   942  N  N   . ASP A 1 119 ? 12.199  8.511  32.652 1.00 20.03 ? 261 ASP A N   1 
ATOM   943  C  CA  . ASP A 1 119 ? 13.111  9.599  33.034 1.00 19.32 ? 261 ASP A CA  1 
ATOM   944  C  C   . ASP A 1 119 ? 13.775  10.283 31.827 1.00 18.56 ? 261 ASP A C   1 
ATOM   945  O  O   . ASP A 1 119 ? 14.107  9.650  30.831 1.00 18.78 ? 261 ASP A O   1 
ATOM   946  C  CB  . ASP A 1 119 ? 14.199  9.071  33.984 1.00 19.61 ? 261 ASP A CB  1 
ATOM   947  C  CG  . ASP A 1 119 ? 13.629  8.484  35.268 1.00 19.52 ? 261 ASP A CG  1 
ATOM   948  O  OD1 . ASP A 1 119 ? 12.539  8.917  35.665 1.00 19.63 ? 261 ASP A OD1 1 
ATOM   949  O  OD2 . ASP A 1 119 ? 14.266  7.607  35.888 1.00 19.97 ? 261 ASP A OD2 1 
ATOM   950  N  N   . TYR A 1 120 ? 13.961  11.586 31.929 1.00 17.98 ? 262 TYR A N   1 
ATOM   951  C  CA  . TYR A 1 120 ? 14.598  12.382 30.892 1.00 17.23 ? 262 TYR A CA  1 
ATOM   952  C  C   . TYR A 1 120 ? 15.698  13.151 31.562 1.00 17.46 ? 262 TYR A C   1 
ATOM   953  O  O   . TYR A 1 120 ? 15.460  13.807 32.563 1.00 17.69 ? 262 TYR A O   1 
ATOM   954  C  CB  . TYR A 1 120 ? 13.589  13.339 30.259 1.00 16.12 ? 262 TYR A CB  1 
ATOM   955  C  CG  . TYR A 1 120 ? 12.593  12.584 29.432 1.00 14.77 ? 262 TYR A CG  1 
ATOM   956  C  CD1 . TYR A 1 120 ? 11.473  11.993 30.018 1.00 14.15 ? 262 TYR A CD1 1 
ATOM   957  C  CD2 . TYR A 1 120 ? 12.848  12.343 28.092 1.00 14.07 ? 262 TYR A CD2 1 
ATOM   958  C  CE1 . TYR A 1 120 ? 10.648  11.161 29.276 1.00 14.11 ? 262 TYR A CE1 1 
ATOM   959  C  CE2 . TYR A 1 120 ? 12.040  11.528 27.354 1.00 13.78 ? 262 TYR A CE2 1 
ATOM   960  C  CZ  . TYR A 1 120 ? 10.950  10.933 27.936 1.00 13.82 ? 262 TYR A CZ  1 
ATOM   961  O  OH  . TYR A 1 120 ? 10.205  10.070 27.174 1.00 13.65 ? 262 TYR A OH  1 
ATOM   962  N  N   . ALA A 1 121 ? 16.908  13.035 31.037 1.00 17.88 ? 263 ALA A N   1 
ATOM   963  C  CA  . ALA A 1 121 ? 18.062  13.725 31.600 1.00 18.36 ? 263 ALA A CA  1 
ATOM   964  C  C   . ALA A 1 121 ? 18.264  15.121 31.010 1.00 18.81 ? 263 ALA A C   1 
ATOM   965  O  O   . ALA A 1 121 ? 18.061  15.329 29.820 1.00 19.13 ? 263 ALA A O   1 
ATOM   966  C  CB  . ALA A 1 121 ? 19.301  12.879 31.414 1.00 17.79 ? 263 ALA A CB  1 
ATOM   967  N  N   . MET A 1 122 ? 18.651  16.073 31.857 1.00 19.63 ? 264 MET A N   1 
ATOM   968  C  CA  . MET A 1 122 ? 18.886  17.472 31.465 1.00 20.22 ? 264 MET A CA  1 
ATOM   969  C  C   . MET A 1 122 ? 17.651  18.135 30.890 1.00 19.79 ? 264 MET A C   1 
ATOM   970  O  O   . MET A 1 122 ? 17.701  18.737 29.817 1.00 19.31 ? 264 MET A O   1 
ATOM   971  C  CB  . MET A 1 122 ? 20.051  17.605 30.481 1.00 21.81 ? 264 MET A CB  1 
ATOM   972  C  CG  . MET A 1 122 ? 21.386  17.964 31.112 1.00 23.58 ? 264 MET A CG  1 
ATOM   973  S  SD  . MET A 1 122 ? 21.895  16.652 32.186 1.00 26.49 ? 264 MET A SD  1 
ATOM   974  C  CE  . MET A 1 122 ? 22.968  15.665 31.042 1.00 25.21 ? 264 MET A CE  1 
ATOM   975  N  N   . PHE A 1 123 ? 16.548  17.995 31.616 1.00 19.37 ? 265 PHE A N   1 
ATOM   976  C  CA  . PHE A 1 123 ? 15.265  18.555 31.234 1.00 19.26 ? 265 PHE A CA  1 
ATOM   977  C  C   . PHE A 1 123 ? 15.182  20.051 31.520 1.00 19.12 ? 265 PHE A C   1 
ATOM   978  O  O   . PHE A 1 123 ? 15.572  20.498 32.600 1.00 18.81 ? 265 PHE A O   1 
ATOM   979  C  CB  . PHE A 1 123 ? 14.150  17.800 31.977 1.00 19.37 ? 265 PHE A CB  1 
ATOM   980  C  CG  . PHE A 1 123 ? 12.867  18.584 32.131 1.00 19.51 ? 265 PHE A CG  1 
ATOM   981  C  CD1 . PHE A 1 123 ? 11.858  18.510 31.153 1.00 19.47 ? 265 PHE A CD1 1 
ATOM   982  C  CD2 . PHE A 1 123 ? 12.664  19.387 33.250 1.00 18.92 ? 265 PHE A CD2 1 
ATOM   983  C  CE1 . PHE A 1 123 ? 10.677  19.227 31.297 1.00 19.18 ? 265 PHE A CE1 1 
ATOM   984  C  CE2 . PHE A 1 123 ? 11.490  20.112 33.405 1.00 19.36 ? 265 PHE A CE2 1 
ATOM   985  C  CZ  . PHE A 1 123 ? 10.489  20.035 32.426 1.00 19.48 ? 265 PHE A CZ  1 
ATOM   986  N  N   . LYS A 1 124 ? 14.687  20.814 30.545 1.00 19.07 ? 266 LYS A N   1 
ATOM   987  C  CA  . LYS A 1 124 ? 14.521  22.260 30.670 1.00 19.35 ? 266 LYS A CA  1 
ATOM   988  C  C   . LYS A 1 124 ? 13.271  22.757 29.927 1.00 19.09 ? 266 LYS A C   1 
ATOM   989  O  O   . LYS A 1 124 ? 12.842  22.190 28.913 1.00 18.88 ? 266 LYS A O   1 
ATOM   990  C  CB  . LYS A 1 124 ? 15.706  23.027 30.071 1.00 20.35 ? 266 LYS A CB  1 
ATOM   991  C  CG  . LYS A 1 124 ? 17.113  22.764 30.605 1.00 21.89 ? 266 LYS A CG  1 
ATOM   992  C  CD  . LYS A 1 124 ? 18.122  23.512 29.705 1.00 23.08 ? 266 LYS A CD  1 
ATOM   993  C  CE  . LYS A 1 124 ? 17.903  23.141 28.205 1.00 24.79 ? 266 LYS A CE  1 
ATOM   994  N  NZ  . LYS A 1 124 ? 18.412  24.095 27.103 1.00 25.75 ? 266 LYS A NZ  1 
ATOM   995  N  N   . VAL A 1 125 ? 12.716  23.856 30.421 1.00 18.92 ? 267 VAL A N   1 
ATOM   996  C  CA  . VAL A 1 125 ? 11.563  24.498 29.794 1.00 18.50 ? 267 VAL A CA  1 
ATOM   997  C  C   . VAL A 1 125 ? 12.019  25.943 29.602 1.00 18.62 ? 267 VAL A C   1 
ATOM   998  O  O   . VAL A 1 125 ? 12.419  26.616 30.558 1.00 18.49 ? 267 VAL A O   1 
ATOM   999  C  CB  . VAL A 1 125 ? 10.297  24.386 30.671 1.00 18.00 ? 267 VAL A CB  1 
ATOM   1000 C  CG1 . VAL A 1 125 ? 9.213   25.280 30.160 1.00 17.33 ? 267 VAL A CG1 1 
ATOM   1001 C  CG2 . VAL A 1 125 ? 9.805   22.946 30.660 1.00 17.58 ? 267 VAL A CG2 1 
ATOM   1002 N  N   . GLY A 1 126 ? 12.106  26.345 28.340 1.00 18.79 ? 268 GLY A N   1 
ATOM   1003 C  CA  . GLY A 1 126 ? 12.550  27.675 27.991 1.00 19.12 ? 268 GLY A CA  1 
ATOM   1004 C  C   . GLY A 1 126 ? 11.621  28.771 28.441 1.00 19.86 ? 268 GLY A C   1 
ATOM   1005 O  O   . GLY A 1 126 ? 10.550  28.498 28.952 1.00 19.41 ? 268 GLY A O   1 
ATOM   1006 N  N   . PRO A 1 127 ? 12.016  30.038 28.274 1.00 20.67 ? 269 PRO A N   1 
ATOM   1007 C  CA  . PRO A 1 127 ? 11.236  31.214 28.657 1.00 21.60 ? 269 PRO A CA  1 
ATOM   1008 C  C   . PRO A 1 127 ? 10.061  31.511 27.695 1.00 22.73 ? 269 PRO A C   1 
ATOM   1009 O  O   . PRO A 1 127 ? 9.971   30.950 26.604 1.00 22.78 ? 269 PRO A O   1 
ATOM   1010 C  CB  . PRO A 1 127 ? 12.271  32.315 28.609 1.00 21.05 ? 269 PRO A CB  1 
ATOM   1011 C  CG  . PRO A 1 127 ? 13.087  31.912 27.428 1.00 21.00 ? 269 PRO A CG  1 
ATOM   1012 C  CD  . PRO A 1 127 ? 13.303  30.444 27.671 1.00 20.66 ? 269 PRO A CD  1 
ATOM   1013 N  N   . GLU A 1 128 ? 9.198   32.427 28.097 1.00 23.86 ? 270 GLU A N   1 
ATOM   1014 C  CA  . GLU A 1 128 ? 8.038   32.810 27.312 1.00 25.62 ? 270 GLU A CA  1 
ATOM   1015 C  C   . GLU A 1 128 ? 8.374   33.296 25.895 1.00 26.08 ? 270 GLU A C   1 
ATOM   1016 O  O   . GLU A 1 128 ? 7.588   33.111 24.948 1.00 26.71 ? 270 GLU A O   1 
ATOM   1017 C  CB  . GLU A 1 128 ? 7.298   33.897 28.076 1.00 26.70 ? 270 GLU A CB  1 
ATOM   1018 C  CG  . GLU A 1 128 ? 5.946   34.286 27.527 1.00 28.19 ? 270 GLU A CG  1 
ATOM   1019 C  CD  . GLU A 1 128 ? 5.169   35.079 28.552 1.00 29.32 ? 270 GLU A CD  1 
ATOM   1020 O  OE1 . GLU A 1 128 ? 5.760   35.958 29.230 1.00 29.98 ? 270 GLU A OE1 1 
ATOM   1021 O  OE2 . GLU A 1 128 ? 3.963   34.797 28.707 1.00 30.98 ? 270 GLU A OE2 1 
ATOM   1022 N  N   . ALA A 1 129 ? 9.523   33.954 25.770 1.00 26.35 ? 271 ALA A N   1 
ATOM   1023 C  CA  . ALA A 1 129 ? 10.018  34.473 24.492 1.00 26.24 ? 271 ALA A CA  1 
ATOM   1024 C  C   . ALA A 1 129 ? 10.206  33.352 23.462 1.00 26.08 ? 271 ALA A C   1 
ATOM   1025 O  O   . ALA A 1 129 ? 10.175  33.594 22.253 1.00 26.58 ? 271 ALA A O   1 
ATOM   1026 C  CB  . ALA A 1 129 ? 11.345  35.213 24.709 1.00 26.32 ? 271 ALA A CB  1 
ATOM   1027 N  N   . ASP A 1 130 ? 10.465  32.138 23.933 1.00 25.44 ? 272 ASP A N   1 
ATOM   1028 C  CA  . ASP A 1 130 ? 10.634  31.010 23.036 1.00 24.82 ? 272 ASP A CA  1 
ATOM   1029 C  C   . ASP A 1 130 ? 9.462   30.034 23.235 1.00 24.19 ? 272 ASP A C   1 
ATOM   1030 O  O   . ASP A 1 130 ? 9.553   28.851 22.923 1.00 24.11 ? 272 ASP A O   1 
ATOM   1031 C  CB  . ASP A 1 130 ? 11.985  30.343 23.297 1.00 25.18 ? 272 ASP A CB  1 
ATOM   1032 C  CG  . ASP A 1 130 ? 12.295  29.240 22.317 1.00 25.48 ? 272 ASP A CG  1 
ATOM   1033 O  OD1 . ASP A 1 130 ? 11.891  29.364 21.143 1.00 25.76 ? 272 ASP A OD1 1 
ATOM   1034 O  OD2 . ASP A 1 130 ? 12.933  28.241 22.727 1.00 25.82 ? 272 ASP A OD2 1 
ATOM   1035 N  N   . LYS A 1 131 ? 8.350   30.566 23.732 1.00 23.78 ? 273 LYS A N   1 
ATOM   1036 C  CA  . LYS A 1 131 ? 7.117   29.818 23.971 1.00 23.01 ? 273 LYS A CA  1 
ATOM   1037 C  C   . LYS A 1 131 ? 7.275   28.595 24.866 1.00 22.20 ? 273 LYS A C   1 
ATOM   1038 O  O   . LYS A 1 131 ? 6.693   27.549 24.585 1.00 22.37 ? 273 LYS A O   1 
ATOM   1039 C  CB  . LYS A 1 131 ? 6.470   29.402 22.649 1.00 23.45 ? 273 LYS A CB  1 
ATOM   1040 C  CG  . LYS A 1 131 ? 6.188   30.541 21.664 1.00 24.31 ? 273 LYS A CG  1 
ATOM   1041 C  CD  . LYS A 1 131 ? 5.214   31.525 22.237 1.00 25.26 ? 273 LYS A CD  1 
ATOM   1042 C  CE  . LYS A 1 131 ? 4.615   32.387 21.151 1.00 25.76 ? 273 LYS A CE  1 
ATOM   1043 N  NZ  . LYS A 1 131 ? 3.653   33.356 21.736 1.00 26.43 ? 273 LYS A NZ  1 
ATOM   1044 N  N   . TYR A 1 132 ? 8.069   28.724 25.930 1.00 21.04 ? 274 TYR A N   1 
ATOM   1045 C  CA  . TYR A 1 132 ? 8.289   27.640 26.901 1.00 19.67 ? 274 TYR A CA  1 
ATOM   1046 C  C   . TYR A 1 132 ? 8.616   26.323 26.240 1.00 19.18 ? 274 TYR A C   1 
ATOM   1047 O  O   . TYR A 1 132 ? 8.016   25.305 26.540 1.00 19.34 ? 274 TYR A O   1 
ATOM   1048 C  CB  . TYR A 1 132 ? 7.063   27.484 27.807 1.00 18.41 ? 274 TYR A CB  1 
ATOM   1049 C  CG  . TYR A 1 132 ? 6.762   28.729 28.596 1.00 17.68 ? 274 TYR A CG  1 
ATOM   1050 C  CD1 . TYR A 1 132 ? 7.648   29.188 29.571 1.00 17.49 ? 274 TYR A CD1 1 
ATOM   1051 C  CD2 . TYR A 1 132 ? 5.593   29.465 28.369 1.00 17.48 ? 274 TYR A CD2 1 
ATOM   1052 C  CE1 . TYR A 1 132 ? 7.377   30.346 30.301 1.00 17.13 ? 274 TYR A CE1 1 
ATOM   1053 C  CE2 . TYR A 1 132 ? 5.313   30.627 29.092 1.00 16.66 ? 274 TYR A CE2 1 
ATOM   1054 C  CZ  . TYR A 1 132 ? 6.204   31.055 30.049 1.00 16.81 ? 274 TYR A CZ  1 
ATOM   1055 O  OH  . TYR A 1 132 ? 5.940   32.184 30.771 1.00 16.88 ? 274 TYR A OH  1 
ATOM   1056 N  N   . ARG A 1 133 ? 9.575   26.353 25.335 1.00 19.00 ? 275 ARG A N   1 
ATOM   1057 C  CA  . ARG A 1 133 ? 9.991   25.168 24.611 1.00 18.93 ? 275 ARG A CA  1 
ATOM   1058 C  C   . ARG A 1 133 ? 10.537  24.079 25.528 1.00 18.72 ? 275 ARG A C   1 
ATOM   1059 O  O   . ARG A 1 133 ? 11.188  24.352 26.531 1.00 18.55 ? 275 ARG A O   1 
ATOM   1060 C  CB  . ARG A 1 133 ? 11.037  25.565 23.579 1.00 19.50 ? 275 ARG A CB  1 
ATOM   1061 C  CG  . ARG A 1 133 ? 11.549  24.428 22.776 1.00 20.78 ? 275 ARG A CG  1 
ATOM   1062 C  CD  . ARG A 1 133 ? 12.786  24.845 22.041 1.00 22.23 ? 275 ARG A CD  1 
ATOM   1063 N  NE  . ARG A 1 133 ? 12.577  24.681 20.619 1.00 23.96 ? 275 ARG A NE  1 
ATOM   1064 C  CZ  . ARG A 1 133 ? 12.269  25.660 19.772 1.00 24.42 ? 275 ARG A CZ  1 
ATOM   1065 N  NH1 . ARG A 1 133 ? 12.151  26.918 20.185 1.00 24.48 ? 275 ARG A NH1 1 
ATOM   1066 N  NH2 . ARG A 1 133 ? 11.967  25.345 18.523 1.00 24.97 ? 275 ARG A NH2 1 
ATOM   1067 N  N   . LEU A 1 134 ? 10.220  22.840 25.202 1.00 18.43 ? 276 LEU A N   1 
ATOM   1068 C  CA  . LEU A 1 134 ? 10.676  21.702 25.971 1.00 18.55 ? 276 LEU A CA  1 
ATOM   1069 C  C   . LEU A 1 134 ? 11.951  21.165 25.339 1.00 18.86 ? 276 LEU A C   1 
ATOM   1070 O  O   . LEU A 1 134 ? 11.995  20.954 24.122 1.00 19.16 ? 276 LEU A O   1 
ATOM   1071 C  CB  . LEU A 1 134 ? 9.607   20.600 25.928 1.00 18.33 ? 276 LEU A CB  1 
ATOM   1072 C  CG  . LEU A 1 134 ? 9.951   19.255 26.561 1.00 18.32 ? 276 LEU A CG  1 
ATOM   1073 C  CD1 . LEU A 1 134 ? 9.040   19.030 27.753 1.00 18.44 ? 276 LEU A CD1 1 
ATOM   1074 C  CD2 . LEU A 1 134 ? 9.809   18.118 25.556 1.00 18.30 ? 276 LEU A CD2 1 
ATOM   1075 N  N   . THR A 1 135 ? 12.993  20.944 26.131 1.00 18.62 ? 277 THR A N   1 
ATOM   1076 C  CA  . THR A 1 135 ? 14.221  20.379 25.580 1.00 18.84 ? 277 THR A CA  1 
ATOM   1077 C  C   . THR A 1 135 ? 14.840  19.488 26.639 1.00 18.78 ? 277 THR A C   1 
ATOM   1078 O  O   . THR A 1 135 ? 14.668  19.720 27.833 1.00 19.21 ? 277 THR A O   1 
ATOM   1079 C  CB  . THR A 1 135 ? 15.248  21.465 25.201 1.00 18.92 ? 277 THR A CB  1 
ATOM   1080 O  OG1 . THR A 1 135 ? 15.593  22.216 26.368 1.00 19.27 ? 277 THR A OG1 1 
ATOM   1081 C  CG2 . THR A 1 135 ? 14.687  22.430 24.142 1.00 18.73 ? 277 THR A CG2 1 
ATOM   1082 N  N   . TYR A 1 136 ? 15.496  18.429 26.211 1.00 18.39 ? 278 TYR A N   1 
ATOM   1083 C  CA  . TYR A 1 136 ? 16.166  17.531 27.134 1.00 18.11 ? 278 TYR A CA  1 
ATOM   1084 C  C   . TYR A 1 136 ? 17.267  16.860 26.316 1.00 18.40 ? 278 TYR A C   1 
ATOM   1085 O  O   . TYR A 1 136 ? 17.214  16.847 25.069 1.00 18.76 ? 278 TYR A O   1 
ATOM   1086 C  CB  . TYR A 1 136 ? 15.195  16.498 27.760 1.00 17.65 ? 278 TYR A CB  1 
ATOM   1087 C  CG  . TYR A 1 136 ? 14.595  15.516 26.796 1.00 17.07 ? 278 TYR A CG  1 
ATOM   1088 C  CD1 . TYR A 1 136 ? 15.257  14.328 26.489 1.00 16.64 ? 278 TYR A CD1 1 
ATOM   1089 C  CD2 . TYR A 1 136 ? 13.411  15.805 26.126 1.00 16.73 ? 278 TYR A CD2 1 
ATOM   1090 C  CE1 . TYR A 1 136 ? 14.775  13.463 25.542 1.00 15.88 ? 278 TYR A CE1 1 
ATOM   1091 C  CE2 . TYR A 1 136 ? 12.917  14.937 25.171 1.00 16.52 ? 278 TYR A CE2 1 
ATOM   1092 C  CZ  . TYR A 1 136 ? 13.617  13.773 24.892 1.00 16.26 ? 278 TYR A CZ  1 
ATOM   1093 O  OH  . TYR A 1 136 ? 13.157  12.901 23.960 1.00 16.81 ? 278 TYR A OH  1 
ATOM   1094 N  N   . ALA A 1 137 ? 18.285  16.348 26.998 1.00 18.15 ? 279 ALA A N   1 
ATOM   1095 C  CA  . ALA A 1 137 ? 19.391  15.693 26.313 1.00 17.63 ? 279 ALA A CA  1 
ATOM   1096 C  C   . ALA A 1 137 ? 19.054  14.282 25.845 1.00 17.47 ? 279 ALA A C   1 
ATOM   1097 O  O   . ALA A 1 137 ? 19.120  13.974 24.669 1.00 17.55 ? 279 ALA A O   1 
ATOM   1098 C  CB  . ALA A 1 137 ? 20.640  15.678 27.214 1.00 17.42 ? 279 ALA A CB  1 
ATOM   1099 N  N   . TYR A 1 138 ? 18.639  13.425 26.748 1.00 17.42 ? 280 TYR A N   1 
ATOM   1100 C  CA  . TYR A 1 138 ? 18.360  12.081 26.328 1.00 17.37 ? 280 TYR A CA  1 
ATOM   1101 C  C   . TYR A 1 138 ? 17.447  11.389 27.322 1.00 17.77 ? 280 TYR A C   1 
ATOM   1102 O  O   . TYR A 1 138 ? 17.249  11.872 28.424 1.00 17.52 ? 280 TYR A O   1 
ATOM   1103 C  CB  . TYR A 1 138 ? 19.690  11.326 26.225 1.00 16.95 ? 280 TYR A CB  1 
ATOM   1104 C  CG  . TYR A 1 138 ? 20.428  11.170 27.548 1.00 16.50 ? 280 TYR A CG  1 
ATOM   1105 C  CD1 . TYR A 1 138 ? 21.277  12.170 28.029 1.00 16.28 ? 280 TYR A CD1 1 
ATOM   1106 C  CD2 . TYR A 1 138 ? 20.271  10.013 28.324 1.00 16.64 ? 280 TYR A CD2 1 
ATOM   1107 C  CE1 . TYR A 1 138 ? 21.952  12.022 29.252 1.00 15.94 ? 280 TYR A CE1 1 
ATOM   1108 C  CE2 . TYR A 1 138 ? 20.939  9.856  29.539 1.00 16.52 ? 280 TYR A CE2 1 
ATOM   1109 C  CZ  . TYR A 1 138 ? 21.777  10.865 29.998 1.00 16.26 ? 280 TYR A CZ  1 
ATOM   1110 O  OH  . TYR A 1 138 ? 22.426  10.691 31.209 1.00 16.59 ? 280 TYR A OH  1 
ATOM   1111 N  N   . PHE A 1 139 ? 16.869  10.279 26.889 1.00 18.40 ? 281 PHE A N   1 
ATOM   1112 C  CA  . PHE A 1 139 ? 16.014  9.458  27.706 1.00 18.92 ? 281 PHE A CA  1 
ATOM   1113 C  C   . PHE A 1 139 ? 16.974  8.635  28.587 1.00 19.59 ? 281 PHE A C   1 
ATOM   1114 O  O   . PHE A 1 139 ? 17.969  8.088  28.103 1.00 19.48 ? 281 PHE A O   1 
ATOM   1115 C  CB  . PHE A 1 139 ? 15.174  8.553  26.792 1.00 18.81 ? 281 PHE A CB  1 
ATOM   1116 C  CG  . PHE A 1 139 ? 14.241  7.591  27.522 1.00 19.16 ? 281 PHE A CG  1 
ATOM   1117 C  CD1 . PHE A 1 139 ? 13.154  8.054  28.258 1.00 18.86 ? 281 PHE A CD1 1 
ATOM   1118 C  CD2 . PHE A 1 139 ? 14.411  6.217  27.398 1.00 19.00 ? 281 PHE A CD2 1 
ATOM   1119 C  CE1 . PHE A 1 139 ? 12.255  7.162  28.845 1.00 19.30 ? 281 PHE A CE1 1 
ATOM   1120 C  CE2 . PHE A 1 139 ? 13.504  5.317  27.988 1.00 19.16 ? 281 PHE A CE2 1 
ATOM   1121 C  CZ  . PHE A 1 139 ? 12.431  5.792  28.707 1.00 18.95 ? 281 PHE A CZ  1 
ATOM   1122 N  N   . ALA A 1 140 ? 16.649  8.560  29.876 1.00 20.03 ? 282 ALA A N   1 
ATOM   1123 C  CA  . ALA A 1 140 ? 17.425  7.855  30.875 1.00 20.49 ? 282 ALA A CA  1 
ATOM   1124 C  C   . ALA A 1 140 ? 16.769  6.537  31.277 1.00 21.11 ? 282 ALA A C   1 
ATOM   1125 O  O   . ALA A 1 140 ? 17.193  5.891  32.230 1.00 21.33 ? 282 ALA A O   1 
ATOM   1126 C  CB  . ALA A 1 140 ? 17.595  8.745  32.090 1.00 20.53 ? 282 ALA A CB  1 
ATOM   1127 N  N   . GLY A 1 141 ? 15.676  6.176  30.617 1.00 21.66 ? 283 GLY A N   1 
ATOM   1128 C  CA  . GLY A 1 141 ? 15.042  4.908  30.928 1.00 22.38 ? 283 GLY A CA  1 
ATOM   1129 C  C   . GLY A 1 141 ? 13.773  4.917  31.762 1.00 22.67 ? 283 GLY A C   1 
ATOM   1130 O  O   . GLY A 1 141 ? 13.369  5.922  32.321 1.00 22.67 ? 283 GLY A O   1 
ATOM   1131 N  N   . GLY A 1 142 ? 13.171  3.743  31.872 1.00 23.19 ? 284 GLY A N   1 
ATOM   1132 C  CA  . GLY A 1 142 ? 11.943  3.593  32.621 1.00 23.42 ? 284 GLY A CA  1 
ATOM   1133 C  C   . GLY A 1 142 ? 11.008  2.777  31.753 1.00 23.72 ? 284 GLY A C   1 
ATOM   1134 O  O   . GLY A 1 142 ? 11.024  2.896  30.518 1.00 23.64 ? 284 GLY A O   1 
ATOM   1135 N  N   . ASP A 1 143 ? 10.205  1.944  32.400 1.00 24.01 ? 285 ASP A N   1 
ATOM   1136 C  CA  . ASP A 1 143 ? 9.263   1.061  31.708 1.00 24.40 ? 285 ASP A CA  1 
ATOM   1137 C  C   . ASP A 1 143 ? 8.114   1.663  30.881 1.00 23.95 ? 285 ASP A C   1 
ATOM   1138 O  O   . ASP A 1 143 ? 7.529   0.959  30.050 1.00 23.80 ? 285 ASP A O   1 
ATOM   1139 C  CB  . ASP A 1 143 ? 8.746   -0.057 32.649 1.00 25.26 ? 285 ASP A CB  1 
ATOM   1140 C  CG  . ASP A 1 143 ? 8.374   0.437  34.067 1.00 26.24 ? 285 ASP A CG  1 
ATOM   1141 O  OD1 . ASP A 1 143 ? 8.575   1.622  34.423 1.00 26.77 ? 285 ASP A OD1 1 
ATOM   1142 O  OD2 . ASP A 1 143 ? 7.879   -0.403 34.856 1.00 27.33 ? 285 ASP A OD2 1 
ATOM   1143 N  N   . ALA A 1 144 ? 7.816   2.952  31.071 1.00 23.37 ? 286 ALA A N   1 
ATOM   1144 C  CA  . ALA A 1 144 ? 6.737   3.594  30.319 1.00 22.59 ? 286 ALA A CA  1 
ATOM   1145 C  C   . ALA A 1 144 ? 7.143   3.753  28.857 1.00 22.38 ? 286 ALA A C   1 
ATOM   1146 O  O   . ALA A 1 144 ? 6.290   3.887  27.961 1.00 22.59 ? 286 ALA A O   1 
ATOM   1147 C  CB  . ALA A 1 144 ? 6.380   4.955  30.934 1.00 22.60 ? 286 ALA A CB  1 
ATOM   1148 N  N   . GLY A 1 145 ? 8.448   3.717  28.607 1.00 21.63 ? 287 GLY A N   1 
ATOM   1149 C  CA  . GLY A 1 145 ? 8.939   3.854  27.250 1.00 20.61 ? 287 GLY A CA  1 
ATOM   1150 C  C   . GLY A 1 145 ? 9.222   5.304  26.957 1.00 20.08 ? 287 GLY A C   1 
ATOM   1151 O  O   . GLY A 1 145 ? 8.848   6.158  27.749 1.00 20.51 ? 287 GLY A O   1 
ATOM   1152 N  N   . ASP A 1 146 ? 9.800   5.600  25.802 1.00 19.19 ? 288 ASP A N   1 
ATOM   1153 C  CA  . ASP A 1 146 ? 10.134  6.969  25.478 1.00 18.80 ? 288 ASP A CA  1 
ATOM   1154 C  C   . ASP A 1 146 ? 9.141   7.596  24.516 1.00 18.93 ? 288 ASP A C   1 
ATOM   1155 O  O   . ASP A 1 146 ? 9.439   7.742  23.350 1.00 19.49 ? 288 ASP A O   1 
ATOM   1156 C  CB  . ASP A 1 146 ? 11.559  7.004  24.906 1.00 18.05 ? 288 ASP A CB  1 
ATOM   1157 C  CG  . ASP A 1 146 ? 12.092  8.406  24.686 1.00 17.35 ? 288 ASP A CG  1 
ATOM   1158 O  OD1 . ASP A 1 146 ? 11.443  9.387  25.088 1.00 17.24 ? 288 ASP A OD1 1 
ATOM   1159 O  OD2 . ASP A 1 146 ? 13.190  8.530  24.110 1.00 16.96 ? 288 ASP A OD2 1 
ATOM   1160 N  N   . ALA A 1 147 ? 7.987   8.033  25.006 1.00 19.08 ? 289 ALA A N   1 
ATOM   1161 C  CA  . ALA A 1 147 ? 6.984   8.641  24.141 1.00 18.67 ? 289 ALA A CA  1 
ATOM   1162 C  C   . ALA A 1 147 ? 7.420   9.973  23.577 1.00 19.08 ? 289 ALA A C   1 
ATOM   1163 O  O   . ALA A 1 147 ? 6.918   10.388 22.538 1.00 18.30 ? 289 ALA A O   1 
ATOM   1164 C  CB  . ALA A 1 147 ? 5.678   8.792  24.877 1.00 18.45 ? 289 ALA A CB  1 
ATOM   1165 N  N   . PHE A 1 148 ? 8.360   10.647 24.249 1.00 20.02 ? 290 PHE A N   1 
ATOM   1166 C  CA  . PHE A 1 148 ? 8.841   11.954 23.794 1.00 21.24 ? 290 PHE A CA  1 
ATOM   1167 C  C   . PHE A 1 148 ? 9.724   11.880 22.538 1.00 22.62 ? 290 PHE A C   1 
ATOM   1168 O  O   . PHE A 1 148 ? 9.944   12.889 21.852 1.00 22.18 ? 290 PHE A O   1 
ATOM   1169 C  CB  . PHE A 1 148 ? 9.554   12.725 24.916 1.00 21.33 ? 290 PHE A CB  1 
ATOM   1170 C  CG  . PHE A 1 148 ? 8.612   13.380 25.932 1.00 21.51 ? 290 PHE A CG  1 
ATOM   1171 C  CD1 . PHE A 1 148 ? 7.220   13.324 25.782 1.00 21.67 ? 290 PHE A CD1 1 
ATOM   1172 C  CD2 . PHE A 1 148 ? 9.123   14.057 27.033 1.00 21.17 ? 290 PHE A CD2 1 
ATOM   1173 C  CE1 . PHE A 1 148 ? 6.367   13.936 26.707 1.00 21.13 ? 290 PHE A CE1 1 
ATOM   1174 C  CE2 . PHE A 1 148 ? 8.276   14.668 27.962 1.00 20.96 ? 290 PHE A CE2 1 
ATOM   1175 C  CZ  . PHE A 1 148 ? 6.901   14.606 27.795 1.00 21.08 ? 290 PHE A CZ  1 
ATOM   1176 N  N   . ASP A 1 149 ? 10.183  10.673 22.214 1.00 24.15 ? 291 ASP A N   1 
ATOM   1177 C  CA  . ASP A 1 149 ? 10.999  10.467 21.028 1.00 25.80 ? 291 ASP A CA  1 
ATOM   1178 C  C   . ASP A 1 149 ? 10.111  10.379 19.786 1.00 26.89 ? 291 ASP A C   1 
ATOM   1179 O  O   . ASP A 1 149 ? 10.615  10.417 18.663 1.00 27.22 ? 291 ASP A O   1 
ATOM   1180 C  CB  . ASP A 1 149 ? 11.818  9.187  21.162 1.00 26.05 ? 291 ASP A CB  1 
ATOM   1181 C  CG  . ASP A 1 149 ? 12.943  9.089  20.134 1.00 26.85 ? 291 ASP A CG  1 
ATOM   1182 O  OD1 . ASP A 1 149 ? 13.525  10.137 19.746 1.00 27.38 ? 291 ASP A OD1 1 
ATOM   1183 O  OD2 . ASP A 1 149 ? 13.255  7.947  19.727 1.00 27.13 ? 291 ASP A OD2 1 
ATOM   1184 N  N   . GLY A 1 150 ? 8.796   10.319 19.975 1.00 27.81 ? 292 GLY A N   1 
ATOM   1185 C  CA  . GLY A 1 150 ? 7.917   10.217 18.835 1.00 29.10 ? 292 GLY A CA  1 
ATOM   1186 C  C   . GLY A 1 150 ? 7.494   8.776  18.724 1.00 30.13 ? 292 GLY A C   1 
ATOM   1187 O  O   . GLY A 1 150 ? 8.131   7.889  19.292 1.00 30.00 ? 292 GLY A O   1 
ATOM   1188 N  N   . PHE A 1 151 ? 6.455   8.527  17.944 1.00 31.52 ? 293 PHE A N   1 
ATOM   1189 C  CA  . PHE A 1 151 ? 5.923   7.182  17.814 1.00 33.03 ? 293 PHE A CA  1 
ATOM   1190 C  C   . PHE A 1 151 ? 5.271   6.951  16.447 1.00 34.31 ? 293 PHE A C   1 
ATOM   1191 O  O   . PHE A 1 151 ? 4.577   7.821  15.911 1.00 34.36 ? 293 PHE A O   1 
ATOM   1192 C  CB  . PHE A 1 151 ? 4.915   6.966  18.947 1.00 32.89 ? 293 PHE A CB  1 
ATOM   1193 C  CG  . PHE A 1 151 ? 4.356   5.586  19.023 1.00 32.90 ? 293 PHE A CG  1 
ATOM   1194 C  CD1 . PHE A 1 151 ? 3.186   5.257  18.336 1.00 32.83 ? 293 PHE A CD1 1 
ATOM   1195 C  CD2 . PHE A 1 151 ? 4.961   4.626  19.820 1.00 32.92 ? 293 PHE A CD2 1 
ATOM   1196 C  CE1 . PHE A 1 151 ? 2.615   3.985  18.442 1.00 32.79 ? 293 PHE A CE1 1 
ATOM   1197 C  CE2 . PHE A 1 151 ? 4.400   3.341  19.939 1.00 33.26 ? 293 PHE A CE2 1 
ATOM   1198 C  CZ  . PHE A 1 151 ? 3.218   3.023  19.245 1.00 33.02 ? 293 PHE A CZ  1 
ATOM   1199 N  N   . ASP A 1 152 ? 5.534   5.781  15.867 1.00 36.00 ? 294 ASP A N   1 
ATOM   1200 C  CA  . ASP A 1 152 ? 4.972   5.417  14.573 1.00 37.46 ? 294 ASP A CA  1 
ATOM   1201 C  C   . ASP A 1 152 ? 3.684   4.640  14.832 1.00 38.14 ? 294 ASP A C   1 
ATOM   1202 O  O   . ASP A 1 152 ? 3.689   3.410  14.903 1.00 38.15 ? 294 ASP A O   1 
ATOM   1203 C  CB  . ASP A 1 152 ? 5.964   4.563  13.773 1.00 38.14 ? 294 ASP A CB  1 
ATOM   1204 C  CG  . ASP A 1 152 ? 5.612   4.496  12.286 1.00 38.85 ? 294 ASP A CG  1 
ATOM   1205 O  OD1 . ASP A 1 152 ? 4.710   3.701  11.932 1.00 39.25 ? 294 ASP A OD1 1 
ATOM   1206 O  OD2 . ASP A 1 152 ? 6.223   5.251  11.481 1.00 39.09 ? 294 ASP A OD2 1 
ATOM   1207 N  N   . PHE A 1 153 ? 2.589   5.376  15.008 1.00 39.07 ? 295 PHE A N   1 
ATOM   1208 C  CA  . PHE A 1 153 ? 1.287   4.776  15.280 1.00 39.84 ? 295 PHE A CA  1 
ATOM   1209 C  C   . PHE A 1 153 ? 0.913   3.840  14.153 1.00 40.72 ? 295 PHE A C   1 
ATOM   1210 O  O   . PHE A 1 153 ? 0.180   2.873  14.363 1.00 40.44 ? 295 PHE A O   1 
ATOM   1211 C  CB  . PHE A 1 153 ? 0.219   5.862  15.439 1.00 39.68 ? 295 PHE A CB  1 
ATOM   1212 C  CG  . PHE A 1 153 ? 0.395   6.716  16.668 1.00 39.35 ? 295 PHE A CG  1 
ATOM   1213 C  CD1 . PHE A 1 153 ? 1.194   7.859  16.633 1.00 39.15 ? 295 PHE A CD1 1 
ATOM   1214 C  CD2 . PHE A 1 153 ? -0.215  6.361  17.866 1.00 39.23 ? 295 PHE A CD2 1 
ATOM   1215 C  CE1 . PHE A 1 153 ? 1.387   8.632  17.773 1.00 38.99 ? 295 PHE A CE1 1 
ATOM   1216 C  CE2 . PHE A 1 153 ? -0.028  7.130  19.020 1.00 39.18 ? 295 PHE A CE2 1 
ATOM   1217 C  CZ  . PHE A 1 153 ? 0.777   8.268  18.970 1.00 39.02 ? 295 PHE A CZ  1 
ATOM   1218 N  N   . GLY A 1 154 ? 1.425   4.155  12.958 1.00 41.88 ? 296 GLY A N   1 
ATOM   1219 C  CA  . GLY A 1 154 ? 1.175   3.363  11.760 1.00 43.00 ? 296 GLY A CA  1 
ATOM   1220 C  C   . GLY A 1 154 ? 0.584   4.199  10.641 1.00 43.81 ? 296 GLY A C   1 
ATOM   1221 O  O   . GLY A 1 154 ? 0.908   4.012  9.478  1.00 44.07 ? 296 GLY A O   1 
ATOM   1222 N  N   . ASP A 1 155 ? -0.261  5.150  11.027 1.00 44.64 ? 297 ASP A N   1 
ATOM   1223 C  CA  . ASP A 1 155 ? -0.969  6.069  10.126 1.00 45.33 ? 297 ASP A CA  1 
ATOM   1224 C  C   . ASP A 1 155 ? -0.187  6.636  8.945  1.00 45.62 ? 297 ASP A C   1 
ATOM   1225 O  O   . ASP A 1 155 ? -0.762  6.882  7.867  1.00 46.10 ? 297 ASP A O   1 
ATOM   1226 C  CB  . ASP A 1 155 ? -1.495  7.285  10.914 1.00 45.84 ? 297 ASP A CB  1 
ATOM   1227 C  CG  . ASP A 1 155 ? -2.607  6.939  11.907 1.00 46.17 ? 297 ASP A CG  1 
ATOM   1228 O  OD1 . ASP A 1 155 ? -2.536  5.893  12.608 1.00 45.95 ? 297 ASP A OD1 1 
ATOM   1229 O  OD2 . ASP A 1 155 ? -3.543  7.766  11.996 1.00 46.46 ? 297 ASP A OD2 1 
ATOM   1230 N  N   . ASP A 1 156 ? 1.106   6.872  9.140  1.00 45.45 ? 298 ASP A N   1 
ATOM   1231 C  CA  . ASP A 1 156 ? 1.916   7.488  8.095  1.00 45.03 ? 298 ASP A CA  1 
ATOM   1232 C  C   . ASP A 1 156 ? 3.369   7.146  8.364  1.00 44.38 ? 298 ASP A C   1 
ATOM   1233 O  O   . ASP A 1 156 ? 3.689   6.488  9.360  1.00 44.45 ? 298 ASP A O   1 
ATOM   1234 C  CB  . ASP A 1 156 ? 1.724   9.012  8.205  1.00 45.55 ? 298 ASP A CB  1 
ATOM   1235 C  CG  . ASP A 1 156 ? 1.965   9.750  6.906  1.00 45.95 ? 298 ASP A CG  1 
ATOM   1236 O  OD1 . ASP A 1 156 ? 1.379   9.333  5.882  1.00 46.38 ? 298 ASP A OD1 1 
ATOM   1237 O  OD2 . ASP A 1 156 ? 2.715   10.762 6.916  1.00 45.81 ? 298 ASP A OD2 1 
ATOM   1238 N  N   . PRO A 1 157 ? 4.247   7.449  7.402  1.00 43.75 ? 299 PRO A N   1 
ATOM   1239 C  CA  . PRO A 1 157 ? 5.669   7.169  7.601  1.00 43.19 ? 299 PRO A CA  1 
ATOM   1240 C  C   . PRO A 1 157 ? 6.257   8.242  8.529  1.00 42.39 ? 299 PRO A C   1 
ATOM   1241 O  O   . PRO A 1 157 ? 7.030   7.943  9.458  1.00 42.52 ? 299 PRO A O   1 
ATOM   1242 C  CB  . PRO A 1 157 ? 6.235   7.301  6.186  1.00 43.47 ? 299 PRO A CB  1 
ATOM   1243 C  CG  . PRO A 1 157 ? 5.121   6.829  5.338  1.00 43.62 ? 299 PRO A CG  1 
ATOM   1244 C  CD  . PRO A 1 157 ? 3.947   7.542  5.961  1.00 43.75 ? 299 PRO A CD  1 
ATOM   1245 N  N   . SER A 1 158 ? 5.840   9.486  8.297  1.00 41.17 ? 300 SER A N   1 
ATOM   1246 C  CA  . SER A 1 158 ? 6.311   10.615 9.081  1.00 39.86 ? 300 SER A CA  1 
ATOM   1247 C  C   . SER A 1 158 ? 5.627   10.762 10.439 1.00 38.86 ? 300 SER A C   1 
ATOM   1248 O  O   . SER A 1 158 ? 5.728   11.815 11.074 1.00 38.75 ? 300 SER A O   1 
ATOM   1249 C  CB  . SER A 1 158 ? 6.183   11.916 8.273  1.00 39.94 ? 300 SER A CB  1 
ATOM   1250 O  OG  . SER A 1 158 ? 6.975   11.881 7.092  1.00 39.79 ? 300 SER A OG  1 
ATOM   1251 N  N   . ASP A 1 159 ? 4.943   9.718  10.893 1.00 37.70 ? 301 ASP A N   1 
ATOM   1252 C  CA  . ASP A 1 159 ? 4.276   9.778  12.192 1.00 36.82 ? 301 ASP A CA  1 
ATOM   1253 C  C   . ASP A 1 159 ? 5.334   10.104 13.236 1.00 36.53 ? 301 ASP A C   1 
ATOM   1254 O  O   . ASP A 1 159 ? 5.302   11.182 13.806 1.00 36.94 ? 301 ASP A O   1 
ATOM   1255 C  CB  . ASP A 1 159 ? 3.580   8.459  12.542 1.00 35.89 ? 301 ASP A CB  1 
ATOM   1256 C  CG  . ASP A 1 159 ? 2.270   8.266  11.800 1.00 35.11 ? 301 ASP A CG  1 
ATOM   1257 O  OD1 . ASP A 1 159 ? 1.746   9.231  11.194 1.00 34.45 ? 301 ASP A OD1 1 
ATOM   1258 O  OD2 . ASP A 1 159 ? 1.762   7.132  11.843 1.00 34.34 ? 301 ASP A OD2 1 
ATOM   1259 N  N   . LYS A 1 160 ? 6.317   9.218  13.405 1.00 35.99 ? 302 LYS A N   1 
ATOM   1260 C  CA  . LYS A 1 160 ? 7.413   9.411  14.360 1.00 35.01 ? 302 LYS A CA  1 
ATOM   1261 C  C   . LYS A 1 160 ? 7.941   10.841 14.314 1.00 34.37 ? 302 LYS A C   1 
ATOM   1262 O  O   . LYS A 1 160 ? 7.986   11.524 15.331 1.00 34.42 ? 302 LYS A O   1 
ATOM   1263 C  CB  . LYS A 1 160 ? 8.542   8.436  14.049 1.00 35.18 ? 302 LYS A CB  1 
ATOM   1264 C  CG  . LYS A 1 160 ? 9.641   8.390  15.085 1.00 35.54 ? 302 LYS A CG  1 
ATOM   1265 C  CD  . LYS A 1 160 ? 9.768   6.980  15.660 1.00 35.77 ? 302 LYS A CD  1 
ATOM   1266 C  CE  . LYS A 1 160 ? 10.882  6.916  16.697 1.00 36.23 ? 302 LYS A CE  1 
ATOM   1267 N  NZ  . LYS A 1 160 ? 10.874  5.630  17.463 1.00 36.62 ? 302 LYS A NZ  1 
ATOM   1268 N  N   . PHE A 1 161 ? 8.295   11.314 13.127 1.00 33.51 ? 303 PHE A N   1 
ATOM   1269 C  CA  . PHE A 1 161 ? 8.797   12.677 12.981 1.00 32.69 ? 303 PHE A CA  1 
ATOM   1270 C  C   . PHE A 1 161 ? 7.833   13.720 13.566 1.00 31.88 ? 303 PHE A C   1 
ATOM   1271 O  O   . PHE A 1 161 ? 8.250   14.714 14.177 1.00 31.49 ? 303 PHE A O   1 
ATOM   1272 C  CB  . PHE A 1 161 ? 9.057   12.991 11.491 1.00 32.98 ? 303 PHE A CB  1 
ATOM   1273 C  CG  . PHE A 1 161 ? 9.504   14.415 11.231 1.00 33.30 ? 303 PHE A CG  1 
ATOM   1274 C  CD1 . PHE A 1 161 ? 10.847  14.776 11.349 1.00 33.42 ? 303 PHE A CD1 1 
ATOM   1275 C  CD2 . PHE A 1 161 ? 8.574   15.408 10.917 1.00 33.50 ? 303 PHE A CD2 1 
ATOM   1276 C  CE1 . PHE A 1 161 ? 11.250  16.116 11.161 1.00 33.62 ? 303 PHE A CE1 1 
ATOM   1277 C  CE2 . PHE A 1 161 ? 8.968   16.749 10.729 1.00 33.46 ? 303 PHE A CE2 1 
ATOM   1278 C  CZ  . PHE A 1 161 ? 10.300  17.102 10.851 1.00 33.40 ? 303 PHE A CZ  1 
ATOM   1279 N  N   . PHE A 1 162 ? 6.542   13.486 13.347 1.00 31.08 ? 304 PHE A N   1 
ATOM   1280 C  CA  . PHE A 1 162 ? 5.476   14.389 13.776 1.00 29.83 ? 304 PHE A CA  1 
ATOM   1281 C  C   . PHE A 1 162 ? 4.929   14.252 15.195 1.00 28.44 ? 304 PHE A C   1 
ATOM   1282 O  O   . PHE A 1 162 ? 4.202   15.139 15.652 1.00 28.43 ? 304 PHE A O   1 
ATOM   1283 C  CB  . PHE A 1 162 ? 4.322   14.307 12.789 1.00 30.63 ? 304 PHE A CB  1 
ATOM   1284 C  CG  . PHE A 1 162 ? 4.627   14.910 11.457 1.00 31.50 ? 304 PHE A CG  1 
ATOM   1285 C  CD1 . PHE A 1 162 ? 5.244   16.157 11.372 1.00 32.05 ? 304 PHE A CD1 1 
ATOM   1286 C  CD2 . PHE A 1 162 ? 4.247   14.264 10.288 1.00 31.84 ? 304 PHE A CD2 1 
ATOM   1287 C  CE1 . PHE A 1 162 ? 5.475   16.765 10.131 1.00 32.47 ? 304 PHE A CE1 1 
ATOM   1288 C  CE2 . PHE A 1 162 ? 4.470   14.851 9.047  1.00 32.31 ? 304 PHE A CE2 1 
ATOM   1289 C  CZ  . PHE A 1 162 ? 5.084   16.107 8.966  1.00 32.41 ? 304 PHE A CZ  1 
ATOM   1290 N  N   . THR A 1 163 ? 5.250   13.159 15.886 1.00 26.74 ? 305 THR A N   1 
ATOM   1291 C  CA  . THR A 1 163 ? 4.766   12.971 17.250 1.00 25.00 ? 305 THR A CA  1 
ATOM   1292 C  C   . THR A 1 163 ? 5.876   13.009 18.318 1.00 24.05 ? 305 THR A C   1 
ATOM   1293 O  O   . THR A 1 163 ? 5.663   12.619 19.477 1.00 23.94 ? 305 THR A O   1 
ATOM   1294 C  CB  . THR A 1 163 ? 3.881   11.702 17.378 1.00 24.65 ? 305 THR A CB  1 
ATOM   1295 O  OG1 . THR A 1 163 ? 4.658   10.530 17.132 1.00 24.17 ? 305 THR A OG1 1 
ATOM   1296 C  CG2 . THR A 1 163 ? 2.718   11.751 16.394 1.00 24.23 ? 305 THR A CG2 1 
ATOM   1297 N  N   . SER A 1 164 ? 7.056   13.498 17.938 1.00 22.73 ? 306 SER A N   1 
ATOM   1298 C  CA  . SER A 1 164 ? 8.170   13.615 18.891 1.00 21.51 ? 306 SER A CA  1 
ATOM   1299 C  C   . SER A 1 164 ? 7.985   14.941 19.617 1.00 20.28 ? 306 SER A C   1 
ATOM   1300 O  O   . SER A 1 164 ? 7.371   15.852 19.073 1.00 20.42 ? 306 SER A O   1 
ATOM   1301 C  CB  . SER A 1 164 ? 9.537   13.520 18.189 1.00 21.01 ? 306 SER A CB  1 
ATOM   1302 O  OG  . SER A 1 164 ? 9.727   14.555 17.245 1.00 21.46 ? 306 SER A OG  1 
ATOM   1303 N  N   . HIS A 1 165 ? 8.486   15.039 20.843 1.00 19.10 ? 307 HIS A N   1 
ATOM   1304 C  CA  . HIS A 1 165 ? 8.313   16.247 21.660 1.00 17.85 ? 307 HIS A CA  1 
ATOM   1305 C  C   . HIS A 1 165 ? 9.516   17.148 21.955 1.00 17.64 ? 307 HIS A C   1 
ATOM   1306 O  O   . HIS A 1 165 ? 9.337   18.307 22.360 1.00 17.25 ? 307 HIS A O   1 
ATOM   1307 C  CB  . HIS A 1 165 ? 7.612   15.872 22.970 1.00 16.65 ? 307 HIS A CB  1 
ATOM   1308 C  CG  . HIS A 1 165 ? 6.257   15.306 22.749 1.00 15.52 ? 307 HIS A CG  1 
ATOM   1309 N  ND1 . HIS A 1 165 ? 5.145   16.099 22.584 1.00 14.91 ? 307 HIS A ND1 1 
ATOM   1310 C  CD2 . HIS A 1 165 ? 5.853   14.037 22.518 1.00 15.41 ? 307 HIS A CD2 1 
ATOM   1311 C  CE1 . HIS A 1 165 ? 4.113   15.345 22.251 1.00 14.55 ? 307 HIS A CE1 1 
ATOM   1312 N  NE2 . HIS A 1 165 ? 4.517   14.089 22.204 1.00 14.67 ? 307 HIS A NE2 1 
ATOM   1313 N  N   . ASN A 1 166 ? 10.724  16.629 21.747 1.00 17.36 ? 308 ASN A N   1 
ATOM   1314 C  CA  . ASN A 1 166 ? 11.932  17.397 21.992 1.00 17.39 ? 308 ASN A CA  1 
ATOM   1315 C  C   . ASN A 1 166 ? 12.033  18.616 21.066 1.00 17.75 ? 308 ASN A C   1 
ATOM   1316 O  O   . ASN A 1 166 ? 11.877  18.498 19.845 1.00 18.16 ? 308 ASN A O   1 
ATOM   1317 C  CB  . ASN A 1 166 ? 13.159  16.503 21.825 1.00 17.17 ? 308 ASN A CB  1 
ATOM   1318 C  CG  . ASN A 1 166 ? 14.348  16.945 22.704 1.00 16.91 ? 308 ASN A CG  1 
ATOM   1319 O  OD1 . ASN A 1 166 ? 14.317  18.000 23.342 1.00 16.75 ? 308 ASN A OD1 1 
ATOM   1320 N  ND2 . ASN A 1 166 ? 15.396  16.133 22.725 1.00 16.50 ? 308 ASN A ND2 1 
ATOM   1321 N  N   . GLY A 1 167 ? 12.237  19.792 21.652 1.00 17.66 ? 309 GLY A N   1 
ATOM   1322 C  CA  . GLY A 1 167 ? 12.372  21.003 20.868 1.00 17.69 ? 309 GLY A CA  1 
ATOM   1323 C  C   . GLY A 1 167 ? 11.064  21.695 20.553 1.00 18.01 ? 309 GLY A C   1 
ATOM   1324 O  O   . GLY A 1 167 ? 11.058  22.791 19.978 1.00 17.79 ? 309 GLY A O   1 
ATOM   1325 N  N   . MET A 1 168 ? 9.957   21.066 20.935 1.00 18.22 ? 310 MET A N   1 
ATOM   1326 C  CA  . MET A 1 168 ? 8.621   21.616 20.693 1.00 18.24 ? 310 MET A CA  1 
ATOM   1327 C  C   . MET A 1 168 ? 8.272   22.760 21.631 1.00 18.01 ? 310 MET A C   1 
ATOM   1328 O  O   . MET A 1 168 ? 8.614   22.743 22.805 1.00 18.01 ? 310 MET A O   1 
ATOM   1329 C  CB  . MET A 1 168 ? 7.559   20.516 20.822 1.00 18.88 ? 310 MET A CB  1 
ATOM   1330 C  CG  . MET A 1 168 ? 7.587   19.476 19.718 1.00 19.20 ? 310 MET A CG  1 
ATOM   1331 S  SD  . MET A 1 168 ? 7.445   20.266 18.105 1.00 20.39 ? 310 MET A SD  1 
ATOM   1332 C  CE  . MET A 1 168 ? 9.000   19.747 17.391 1.00 19.49 ? 310 MET A CE  1 
ATOM   1333 N  N   . GLN A 1 169 ? 7.617   23.777 21.103 1.00 17.87 ? 311 GLN A N   1 
ATOM   1334 C  CA  . GLN A 1 169 ? 7.217   24.889 21.924 1.00 17.85 ? 311 GLN A CA  1 
ATOM   1335 C  C   . GLN A 1 169 ? 5.881   24.494 22.528 1.00 17.72 ? 311 GLN A C   1 
ATOM   1336 O  O   . GLN A 1 169 ? 5.301   23.489 22.123 1.00 17.50 ? 311 GLN A O   1 
ATOM   1337 C  CB  . GLN A 1 169 ? 7.055   26.123 21.066 1.00 18.34 ? 311 GLN A CB  1 
ATOM   1338 C  CG  . GLN A 1 169 ? 8.337   26.643 20.466 1.00 19.34 ? 311 GLN A CG  1 
ATOM   1339 C  CD  . GLN A 1 169 ? 8.152   28.001 19.803 1.00 20.20 ? 311 GLN A CD  1 
ATOM   1340 O  OE1 . GLN A 1 169 ? 7.344   28.156 18.898 1.00 21.32 ? 311 GLN A OE1 1 
ATOM   1341 N  NE2 . GLN A 1 169 ? 8.882   28.991 20.270 1.00 20.86 ? 311 GLN A NE2 1 
ATOM   1342 N  N   . PHE A 1 170 ? 5.417   25.248 23.519 1.00 17.56 ? 312 PHE A N   1 
ATOM   1343 C  CA  . PHE A 1 170 ? 4.130   24.981 24.170 1.00 17.50 ? 312 PHE A CA  1 
ATOM   1344 C  C   . PHE A 1 170 ? 3.015   25.607 23.334 1.00 17.94 ? 312 PHE A C   1 
ATOM   1345 O  O   . PHE A 1 170 ? 3.199   26.671 22.745 1.00 17.89 ? 312 PHE A O   1 
ATOM   1346 C  CB  . PHE A 1 170 ? 4.106   25.599 25.578 1.00 16.71 ? 312 PHE A CB  1 
ATOM   1347 C  CG  . PHE A 1 170 ? 3.101   24.966 26.534 1.00 15.89 ? 312 PHE A CG  1 
ATOM   1348 C  CD1 . PHE A 1 170 ? 3.312   23.679 27.048 1.00 15.30 ? 312 PHE A CD1 1 
ATOM   1349 C  CD2 . PHE A 1 170 ? 1.990   25.681 26.974 1.00 15.34 ? 312 PHE A CD2 1 
ATOM   1350 C  CE1 . PHE A 1 170 ? 2.445   23.116 27.987 1.00 14.53 ? 312 PHE A CE1 1 
ATOM   1351 C  CE2 . PHE A 1 170 ? 1.119   25.125 27.909 1.00 14.70 ? 312 PHE A CE2 1 
ATOM   1352 C  CZ  . PHE A 1 170 ? 1.352   23.842 28.415 1.00 14.59 ? 312 PHE A CZ  1 
ATOM   1353 N  N   . SER A 1 171 ? 1.859   24.946 23.310 1.00 18.64 ? 313 SER A N   1 
ATOM   1354 C  CA  . SER A 1 171 ? 0.675   25.414 22.583 1.00 19.06 ? 313 SER A CA  1 
ATOM   1355 C  C   . SER A 1 171 ? -0.596  25.259 23.425 1.00 19.13 ? 313 SER A C   1 
ATOM   1356 O  O   . SER A 1 171 ? -0.794  24.229 24.077 1.00 18.78 ? 313 SER A O   1 
ATOM   1357 C  CB  . SER A 1 171 ? 0.448   24.572 21.315 1.00 19.37 ? 313 SER A CB  1 
ATOM   1358 O  OG  . SER A 1 171 ? 1.525   24.612 20.397 1.00 20.63 ? 313 SER A OG  1 
ATOM   1359 N  N   . THR A 1 172 ? -1.421  26.300 23.454 1.00 19.71 ? 314 THR A N   1 
ATOM   1360 C  CA  . THR A 1 172 ? -2.724  26.224 24.105 1.00 20.24 ? 314 THR A CA  1 
ATOM   1361 C  C   . THR A 1 172 ? -3.668  26.533 22.944 1.00 20.80 ? 314 THR A C   1 
ATOM   1362 O  O   . THR A 1 172 ? -3.230  27.047 21.914 1.00 20.77 ? 314 THR A O   1 
ATOM   1363 C  CB  . THR A 1 172 ? -2.901  27.198 25.292 1.00 19.98 ? 314 THR A CB  1 
ATOM   1364 O  OG1 . THR A 1 172 ? -2.495  28.512 24.928 1.00 19.77 ? 314 THR A OG1 1 
ATOM   1365 C  CG2 . THR A 1 172 ? -2.053  26.744 26.464 1.00 19.64 ? 314 THR A CG2 1 
ATOM   1366 N  N   . TRP A 1 173 ? -4.942  26.201 23.064 1.00 21.35 ? 315 TRP A N   1 
ATOM   1367 C  CA  . TRP A 1 173 ? -5.856  26.451 21.960 1.00 21.87 ? 315 TRP A CA  1 
ATOM   1368 C  C   . TRP A 1 173 ? -5.832  27.912 21.464 1.00 22.58 ? 315 TRP A C   1 
ATOM   1369 O  O   . TRP A 1 173 ? -6.195  28.190 20.327 1.00 22.82 ? 315 TRP A O   1 
ATOM   1370 C  CB  . TRP A 1 173 ? -7.266  26.000 22.337 1.00 21.27 ? 315 TRP A CB  1 
ATOM   1371 C  CG  . TRP A 1 173 ? -7.817  26.738 23.463 1.00 20.71 ? 315 TRP A CG  1 
ATOM   1372 C  CD1 . TRP A 1 173 ? -7.789  26.375 24.772 1.00 20.78 ? 315 TRP A CD1 1 
ATOM   1373 C  CD2 . TRP A 1 173 ? -8.412  28.027 23.412 1.00 20.34 ? 315 TRP A CD2 1 
ATOM   1374 N  NE1 . TRP A 1 173 ? -8.315  27.373 25.547 1.00 20.36 ? 315 TRP A NE1 1 
ATOM   1375 C  CE2 . TRP A 1 173 ? -8.706  28.402 24.734 1.00 20.19 ? 315 TRP A CE2 1 
ATOM   1376 C  CE3 . TRP A 1 173 ? -8.720  28.912 22.371 1.00 20.43 ? 315 TRP A CE3 1 
ATOM   1377 C  CZ2 . TRP A 1 173 ? -9.293  29.626 25.051 1.00 20.55 ? 315 TRP A CZ2 1 
ATOM   1378 C  CZ3 . TRP A 1 173 ? -9.301  30.126 22.681 1.00 20.45 ? 315 TRP A CZ3 1 
ATOM   1379 C  CH2 . TRP A 1 173 ? -9.583  30.475 24.011 1.00 20.42 ? 315 TRP A CH2 1 
ATOM   1380 N  N   . ASP A 1 174 ? -5.367  28.838 22.298 1.00 23.31 ? 316 ASP A N   1 
ATOM   1381 C  CA  . ASP A 1 174 ? -5.292  30.248 21.911 1.00 23.71 ? 316 ASP A CA  1 
ATOM   1382 C  C   . ASP A 1 174 ? -3.860  30.733 21.724 1.00 24.15 ? 316 ASP A C   1 
ATOM   1383 O  O   . ASP A 1 174 ? -3.576  31.919 21.877 1.00 24.28 ? 316 ASP A O   1 
ATOM   1384 C  CB  . ASP A 1 174 ? -5.971  31.142 22.944 1.00 23.55 ? 316 ASP A CB  1 
ATOM   1385 C  CG  . ASP A 1 174 ? -5.291  31.087 24.299 1.00 24.07 ? 316 ASP A CG  1 
ATOM   1386 O  OD1 . ASP A 1 174 ? -4.847  29.981 24.685 1.00 24.12 ? 316 ASP A OD1 1 
ATOM   1387 O  OD2 . ASP A 1 174 ? -5.201  32.144 24.977 1.00 23.92 ? 316 ASP A OD2 1 
ATOM   1388 N  N   . ASN A 1 175 ? -2.947  29.819 21.452 1.00 24.46 ? 317 ASN A N   1 
ATOM   1389 C  CA  . ASN A 1 175 ? -1.556  30.191 21.234 1.00 25.05 ? 317 ASN A CA  1 
ATOM   1390 C  C   . ASN A 1 175 ? -0.958  28.979 20.599 1.00 25.39 ? 317 ASN A C   1 
ATOM   1391 O  O   . ASN A 1 175 ? -0.398  28.109 21.270 1.00 25.64 ? 317 ASN A O   1 
ATOM   1392 C  CB  . ASN A 1 175 ? -0.845  30.542 22.535 1.00 24.88 ? 317 ASN A CB  1 
ATOM   1393 C  CG  . ASN A 1 175 ? 0.151   31.673 22.352 1.00 24.97 ? 317 ASN A CG  1 
ATOM   1394 O  OD1 . ASN A 1 175 ? 0.975   31.653 21.439 1.00 25.37 ? 317 ASN A OD1 1 
ATOM   1395 N  ND2 . ASN A 1 175 ? 0.038   32.697 23.181 1.00 25.48 ? 317 ASN A ND2 1 
ATOM   1396 N  N   . ASP A 1 176 ? -1.226  28.875 19.308 1.00 25.82 ? 318 ASP A N   1 
ATOM   1397 C  CA  . ASP A 1 176 ? -0.805  27.757 18.493 1.00 26.52 ? 318 ASP A CA  1 
ATOM   1398 C  C   . ASP A 1 176 ? 0.615   27.895 17.988 1.00 26.91 ? 318 ASP A C   1 
ATOM   1399 O  O   . ASP A 1 176 ? 0.893   28.666 17.068 1.00 27.21 ? 318 ASP A O   1 
ATOM   1400 C  CB  . ASP A 1 176 ? -1.769  27.617 17.324 1.00 26.70 ? 318 ASP A CB  1 
ATOM   1401 C  CG  . ASP A 1 176 ? -1.455  26.449 16.442 1.00 27.22 ? 318 ASP A CG  1 
ATOM   1402 O  OD1 . ASP A 1 176 ? -0.455  25.737 16.642 1.00 28.03 ? 318 ASP A OD1 1 
ATOM   1403 O  OD2 . ASP A 1 176 ? -2.237  26.223 15.521 1.00 27.86 ? 318 ASP A OD2 1 
ATOM   1404 N  N   . ASN A 1 177 ? 1.485   27.039 18.504 1.00 27.25 ? 319 ASN A N   1 
ATOM   1405 C  CA  . ASN A 1 177 ? 2.878   27.070 18.115 1.00 27.31 ? 319 ASN A CA  1 
ATOM   1406 C  C   . ASN A 1 177 ? 3.295   25.673 17.675 1.00 27.57 ? 319 ASN A C   1 
ATOM   1407 O  O   . ASN A 1 177 ? 4.475   25.341 17.723 1.00 27.45 ? 319 ASN A O   1 
ATOM   1408 C  CB  . ASN A 1 177 ? 3.742   27.550 19.297 1.00 27.28 ? 319 ASN A CB  1 
ATOM   1409 C  CG  . ASN A 1 177 ? 3.290   28.898 19.860 1.00 27.36 ? 319 ASN A CG  1 
ATOM   1410 O  OD1 . ASN A 1 177 ? 3.455   29.942 19.230 1.00 27.60 ? 319 ASN A OD1 1 
ATOM   1411 N  ND2 . ASN A 1 177 ? 2.725   28.878 21.056 1.00 27.12 ? 319 ASN A ND2 1 
ATOM   1412 N  N   . ASP A 1 178 ? 2.333   24.851 17.246 1.00 28.05 ? 320 ASP A N   1 
ATOM   1413 C  CA  . ASP A 1 178 ? 2.654   23.490 16.812 1.00 28.62 ? 320 ASP A CA  1 
ATOM   1414 C  C   . ASP A 1 178 ? 3.161   23.403 15.373 1.00 28.84 ? 320 ASP A C   1 
ATOM   1415 O  O   . ASP A 1 178 ? 3.384   24.419 14.729 1.00 28.83 ? 320 ASP A O   1 
ATOM   1416 C  CB  . ASP A 1 178 ? 1.493   22.503 17.070 1.00 29.12 ? 320 ASP A CB  1 
ATOM   1417 C  CG  . ASP A 1 178 ? 0.236   22.777 16.212 1.00 29.90 ? 320 ASP A CG  1 
ATOM   1418 O  OD1 . ASP A 1 178 ? 0.315   23.455 15.167 1.00 29.69 ? 320 ASP A OD1 1 
ATOM   1419 O  OD2 . ASP A 1 178 ? -0.848  22.278 16.585 1.00 30.17 ? 320 ASP A OD2 1 
ATOM   1420 N  N   . LYS A 1 179 ? 3.312   22.183 14.875 1.00 29.42 ? 321 LYS A N   1 
ATOM   1421 C  CA  . LYS A 1 179 ? 3.799   21.923 13.526 1.00 30.35 ? 321 LYS A CA  1 
ATOM   1422 C  C   . LYS A 1 179 ? 2.684   21.392 12.605 1.00 30.82 ? 321 LYS A C   1 
ATOM   1423 O  O   . LYS A 1 179 ? 2.949   20.824 11.544 1.00 30.97 ? 321 LYS A O   1 
ATOM   1424 C  CB  . LYS A 1 179 ? 4.935   20.894 13.605 1.00 30.79 ? 321 LYS A CB  1 
ATOM   1425 C  CG  . LYS A 1 179 ? 6.175   21.375 14.373 1.00 31.45 ? 321 LYS A CG  1 
ATOM   1426 C  CD  . LYS A 1 179 ? 7.350   21.683 13.421 1.00 31.98 ? 321 LYS A CD  1 
ATOM   1427 C  CE  . LYS A 1 179 ? 8.517   22.368 14.140 1.00 32.10 ? 321 LYS A CE  1 
ATOM   1428 N  NZ  . LYS A 1 179 ? 8.147   23.751 14.604 1.00 32.47 ? 321 LYS A NZ  1 
ATOM   1429 N  N   . PHE A 1 180 ? 1.437   21.583 13.022 1.00 31.51 ? 322 PHE A N   1 
ATOM   1430 C  CA  . PHE A 1 180 ? 0.255   21.108 12.289 1.00 32.03 ? 322 PHE A CA  1 
ATOM   1431 C  C   . PHE A 1 180 ? -0.471  22.327 11.755 1.00 32.26 ? 322 PHE A C   1 
ATOM   1432 O  O   . PHE A 1 180 ? -0.535  23.334 12.456 1.00 32.27 ? 322 PHE A O   1 
ATOM   1433 C  CB  . PHE A 1 180 ? -0.640  20.333 13.276 1.00 32.01 ? 322 PHE A CB  1 
ATOM   1434 C  CG  . PHE A 1 180 ? -1.949  19.871 12.705 1.00 32.12 ? 322 PHE A CG  1 
ATOM   1435 C  CD1 . PHE A 1 180 ? -2.002  19.176 11.501 1.00 32.30 ? 322 PHE A CD1 1 
ATOM   1436 C  CD2 . PHE A 1 180 ? -3.135  20.104 13.396 1.00 31.94 ? 322 PHE A CD2 1 
ATOM   1437 C  CE1 . PHE A 1 180 ? -3.220  18.715 10.993 1.00 32.23 ? 322 PHE A CE1 1 
ATOM   1438 C  CE2 . PHE A 1 180 ? -4.345  19.653 12.901 1.00 31.69 ? 322 PHE A CE2 1 
ATOM   1439 C  CZ  . PHE A 1 180 ? -4.390  18.956 11.699 1.00 32.07 ? 322 PHE A CZ  1 
ATOM   1440 N  N   . GLU A 1 181 ? -1.036  22.261 10.551 1.00 32.48 ? 323 GLU A N   1 
ATOM   1441 C  CA  . GLU A 1 181 ? -1.729  23.435 10.033 1.00 32.91 ? 323 GLU A CA  1 
ATOM   1442 C  C   . GLU A 1 181 ? -3.085  23.689 10.677 1.00 32.44 ? 323 GLU A C   1 
ATOM   1443 O  O   . GLU A 1 181 ? -3.744  24.694 10.392 1.00 32.46 ? 323 GLU A O   1 
ATOM   1444 C  CB  . GLU A 1 181 ? -1.856  23.421 8.530  1.00 34.38 ? 323 GLU A CB  1 
ATOM   1445 C  CG  . GLU A 1 181 ? -0.785  22.667 7.839  1.00 35.90 ? 323 GLU A CG  1 
ATOM   1446 C  CD  . GLU A 1 181 ? -1.356  21.412 7.286  1.00 36.92 ? 323 GLU A CD  1 
ATOM   1447 O  OE1 . GLU A 1 181 ? -1.874  21.491 6.141  1.00 37.66 ? 323 GLU A OE1 1 
ATOM   1448 O  OE2 . GLU A 1 181 ? -1.340  20.383 8.015  1.00 37.32 ? 323 GLU A OE2 1 
ATOM   1449 N  N   . GLY A 1 182 ? -3.519  22.754 11.511 1.00 31.80 ? 324 GLY A N   1 
ATOM   1450 C  CA  . GLY A 1 182 ? -4.744  22.951 12.268 1.00 30.92 ? 324 GLY A CA  1 
ATOM   1451 C  C   . GLY A 1 182 ? -4.253  23.377 13.648 1.00 30.15 ? 324 GLY A C   1 
ATOM   1452 O  O   . GLY A 1 182 ? -3.093  23.806 13.806 1.00 30.34 ? 324 GLY A O   1 
ATOM   1453 N  N   . ASN A 1 183 ? -5.094  23.291 14.661 1.00 29.20 ? 325 ASN A N   1 
ATOM   1454 C  CA  . ASN A 1 183 ? -4.641  23.660 15.990 1.00 28.12 ? 325 ASN A CA  1 
ATOM   1455 C  C   . ASN A 1 183 ? -4.779  22.408 16.849 1.00 27.13 ? 325 ASN A C   1 
ATOM   1456 O  O   . ASN A 1 183 ? -5.907  22.003 17.138 1.00 26.91 ? 325 ASN A O   1 
ATOM   1457 C  CB  . ASN A 1 183 ? -5.488  24.809 16.540 1.00 28.83 ? 325 ASN A CB  1 
ATOM   1458 C  CG  . ASN A 1 183 ? -4.973  25.333 17.886 1.00 29.56 ? 325 ASN A CG  1 
ATOM   1459 O  OD1 . ASN A 1 183 ? -4.300  24.616 18.634 1.00 30.13 ? 325 ASN A OD1 1 
ATOM   1460 N  ND2 . ASN A 1 183 ? -5.300  26.580 18.200 1.00 29.76 ? 325 ASN A ND2 1 
ATOM   1461 N  N   . CYS A 1 184 ? -3.652  21.756 17.177 1.00 25.73 ? 326 CYS A N   1 
ATOM   1462 C  CA  . CYS A 1 184 ? -3.645  20.527 17.994 1.00 24.23 ? 326 CYS A CA  1 
ATOM   1463 C  C   . CYS A 1 184 ? -4.206  20.760 19.387 1.00 24.21 ? 326 CYS A C   1 
ATOM   1464 O  O   . CYS A 1 184 ? -5.049  20.010 19.865 1.00 24.28 ? 326 CYS A O   1 
ATOM   1465 C  CB  . CYS A 1 184 ? -2.231  19.993 18.206 1.00 23.02 ? 326 CYS A CB  1 
ATOM   1466 S  SG  . CYS A 1 184 ? -1.346  19.318 16.784 1.00 21.25 ? 326 CYS A SG  1 
ATOM   1467 N  N   . ALA A 1 185 ? -3.672  21.770 20.061 1.00 24.39 ? 327 ALA A N   1 
ATOM   1468 C  CA  . ALA A 1 185 ? -4.092  22.093 21.407 1.00 24.30 ? 327 ALA A CA  1 
ATOM   1469 C  C   . ALA A 1 185 ? -5.590  22.285 21.414 1.00 24.59 ? 327 ALA A C   1 
ATOM   1470 O  O   . ALA A 1 185 ? -6.286  21.669 22.206 1.00 24.43 ? 327 ALA A O   1 
ATOM   1471 C  CB  . ALA A 1 185 ? -3.390  23.332 21.885 1.00 23.90 ? 327 ALA A CB  1 
ATOM   1472 N  N   . GLU A 1 186 ? -6.093  23.073 20.471 1.00 25.20 ? 328 GLU A N   1 
ATOM   1473 C  CA  . GLU A 1 186 ? -7.529  23.323 20.379 1.00 25.93 ? 328 GLU A CA  1 
ATOM   1474 C  C   . GLU A 1 186 ? -8.391  22.078 20.112 1.00 25.63 ? 328 GLU A C   1 
ATOM   1475 O  O   . GLU A 1 186 ? -9.429  21.904 20.737 1.00 25.25 ? 328 GLU A O   1 
ATOM   1476 C  CB  . GLU A 1 186 ? -7.818  24.402 19.347 1.00 27.20 ? 328 GLU A CB  1 
ATOM   1477 C  CG  . GLU A 1 186 ? -9.281  24.760 19.207 1.00 29.11 ? 328 GLU A CG  1 
ATOM   1478 C  CD  . GLU A 1 186 ? -9.618  25.146 17.778 1.00 30.54 ? 328 GLU A CD  1 
ATOM   1479 O  OE1 . GLU A 1 186 ? -9.752  24.228 16.913 1.00 31.30 ? 328 GLU A OE1 1 
ATOM   1480 O  OE2 . GLU A 1 186 ? -9.713  26.372 17.510 1.00 31.27 ? 328 GLU A OE2 1 
ATOM   1481 N  N   . GLN A 1 187 ? -7.970  21.195 19.216 1.00 25.72 ? 329 GLN A N   1 
ATOM   1482 C  CA  . GLN A 1 187 ? -8.782  20.013 18.975 1.00 25.76 ? 329 GLN A CA  1 
ATOM   1483 C  C   . GLN A 1 187 ? -8.625  18.879 19.971 1.00 25.54 ? 329 GLN A C   1 
ATOM   1484 O  O   . GLN A 1 187 ? -9.513  18.039 20.080 1.00 25.65 ? 329 GLN A O   1 
ATOM   1485 C  CB  . GLN A 1 187 ? -8.745  19.527 17.515 1.00 26.20 ? 329 GLN A CB  1 
ATOM   1486 C  CG  . GLN A 1 187 ? -7.409  19.382 16.854 1.00 26.62 ? 329 GLN A CG  1 
ATOM   1487 C  CD  . GLN A 1 187 ? -7.549  19.205 15.346 1.00 26.90 ? 329 GLN A CD  1 
ATOM   1488 O  OE1 . GLN A 1 187 ? -7.416  18.097 14.827 1.00 26.85 ? 329 GLN A OE1 1 
ATOM   1489 N  NE2 . GLN A 1 187 ? -7.823  20.306 14.634 1.00 27.38 ? 329 GLN A NE2 1 
ATOM   1490 N  N   . ASP A 1 188 ? -7.526  18.848 20.721 1.00 25.15 ? 330 ASP A N   1 
ATOM   1491 C  CA  . ASP A 1 188 ? -7.373  17.799 21.731 1.00 24.28 ? 330 ASP A CA  1 
ATOM   1492 C  C   . ASP A 1 188 ? -7.708  18.332 23.130 1.00 23.58 ? 330 ASP A C   1 
ATOM   1493 O  O   . ASP A 1 188 ? -7.661  17.592 24.122 1.00 23.79 ? 330 ASP A O   1 
ATOM   1494 C  CB  . ASP A 1 188 ? -5.999  17.124 21.648 1.00 24.32 ? 330 ASP A CB  1 
ATOM   1495 C  CG  . ASP A 1 188 ? -5.861  16.257 20.401 1.00 24.29 ? 330 ASP A CG  1 
ATOM   1496 O  OD1 . ASP A 1 188 ? -6.779  16.254 19.570 1.00 24.39 ? 330 ASP A OD1 1 
ATOM   1497 O  OD2 . ASP A 1 188 ? -4.848  15.573 20.234 1.00 24.29 ? 330 ASP A OD2 1 
ATOM   1498 N  N   . GLY A 1 189 ? -8.111  19.603 23.162 1.00 22.53 ? 331 GLY A N   1 
ATOM   1499 C  CA  . GLY A 1 189 ? -8.507  20.285 24.382 1.00 21.70 ? 331 GLY A CA  1 
ATOM   1500 C  C   . GLY A 1 189 ? -7.530  20.334 25.539 1.00 21.05 ? 331 GLY A C   1 
ATOM   1501 O  O   . GLY A 1 189 ? -7.918  20.085 26.681 1.00 21.32 ? 331 GLY A O   1 
ATOM   1502 N  N   . SER A 1 190 ? -6.299  20.763 25.278 1.00 20.38 ? 332 SER A N   1 
ATOM   1503 C  CA  . SER A 1 190 ? -5.274  20.831 26.321 1.00 19.01 ? 332 SER A CA  1 
ATOM   1504 C  C   . SER A 1 190 ? -4.232  21.891 26.035 1.00 18.23 ? 332 SER A C   1 
ATOM   1505 O  O   . SER A 1 190 ? -4.387  22.717 25.132 1.00 18.18 ? 332 SER A O   1 
ATOM   1506 C  CB  . SER A 1 190 ? -4.564  19.493 26.418 1.00 19.02 ? 332 SER A CB  1 
ATOM   1507 O  OG  . SER A 1 190 ? -3.957  19.178 25.180 1.00 18.82 ? 332 SER A OG  1 
ATOM   1508 N  N   . GLY A 1 191 ? -3.207  21.904 26.875 1.00 17.23 ? 333 GLY A N   1 
ATOM   1509 C  CA  . GLY A 1 191 ? -2.083  22.804 26.716 1.00 15.78 ? 333 GLY A CA  1 
ATOM   1510 C  C   . GLY A 1 191 ? -0.941  21.812 26.730 1.00 14.88 ? 333 GLY A C   1 
ATOM   1511 O  O   . GLY A 1 191 ? -0.868  21.017 27.664 1.00 14.43 ? 333 GLY A O   1 
ATOM   1512 N  N   . TRP A 1 192 ? -0.098  21.790 25.699 1.00 14.10 ? 334 TRP A N   1 
ATOM   1513 C  CA  . TRP A 1 192 ? 0.991   20.822 25.662 1.00 13.72 ? 334 TRP A CA  1 
ATOM   1514 C  C   . TRP A 1 192 ? 2.066   21.206 24.662 1.00 14.03 ? 334 TRP A C   1 
ATOM   1515 O  O   . TRP A 1 192 ? 1.893   22.154 23.891 1.00 14.01 ? 334 TRP A O   1 
ATOM   1516 C  CB  . TRP A 1 192 ? 0.433   19.450 25.283 1.00 12.89 ? 334 TRP A CB  1 
ATOM   1517 C  CG  . TRP A 1 192 ? 1.332   18.308 25.595 1.00 12.82 ? 334 TRP A CG  1 
ATOM   1518 C  CD1 . TRP A 1 192 ? 1.892   17.432 24.707 1.00 12.74 ? 334 TRP A CD1 1 
ATOM   1519 C  CD2 . TRP A 1 192 ? 1.716   17.856 26.902 1.00 12.87 ? 334 TRP A CD2 1 
ATOM   1520 N  NE1 . TRP A 1 192 ? 2.592   16.461 25.383 1.00 12.70 ? 334 TRP A NE1 1 
ATOM   1521 C  CE2 . TRP A 1 192 ? 2.501   16.700 26.730 1.00 12.76 ? 334 TRP A CE2 1 
ATOM   1522 C  CE3 . TRP A 1 192 ? 1.467   18.318 28.209 1.00 12.76 ? 334 TRP A CE3 1 
ATOM   1523 C  CZ2 . TRP A 1 192 ? 3.043   15.995 27.816 1.00 12.44 ? 334 TRP A CZ2 1 
ATOM   1524 C  CZ3 . TRP A 1 192 ? 2.007   17.610 29.284 1.00 12.27 ? 334 TRP A CZ3 1 
ATOM   1525 C  CH2 . TRP A 1 192 ? 2.783   16.472 29.075 1.00 12.07 ? 334 TRP A CH2 1 
ATOM   1526 N  N   . TRP A 1 193 ? 3.190   20.488 24.696 1.00 14.23 ? 335 TRP A N   1 
ATOM   1527 C  CA  . TRP A 1 193 ? 4.259   20.719 23.740 1.00 14.25 ? 335 TRP A CA  1 
ATOM   1528 C  C   . TRP A 1 193 ? 3.875   19.910 22.505 1.00 14.58 ? 335 TRP A C   1 
ATOM   1529 O  O   . TRP A 1 193 ? 4.342   18.790 22.325 1.00 14.99 ? 335 TRP A O   1 
ATOM   1530 C  CB  . TRP A 1 193 ? 5.597   20.252 24.307 1.00 13.49 ? 335 TRP A CB  1 
ATOM   1531 C  CG  . TRP A 1 193 ? 5.994   21.063 25.472 1.00 12.91 ? 335 TRP A CG  1 
ATOM   1532 C  CD1 . TRP A 1 193 ? 6.553   22.294 25.446 1.00 12.60 ? 335 TRP A CD1 1 
ATOM   1533 C  CD2 . TRP A 1 193 ? 5.823   20.726 26.857 1.00 12.60 ? 335 TRP A CD2 1 
ATOM   1534 N  NE1 . TRP A 1 193 ? 6.741   22.764 26.728 1.00 12.30 ? 335 TRP A NE1 1 
ATOM   1535 C  CE2 . TRP A 1 193 ? 6.302   21.817 27.615 1.00 12.69 ? 335 TRP A CE2 1 
ATOM   1536 C  CE3 . TRP A 1 193 ? 5.306   19.613 27.529 1.00 12.29 ? 335 TRP A CE3 1 
ATOM   1537 C  CZ2 . TRP A 1 193 ? 6.280   21.828 29.018 1.00 12.47 ? 335 TRP A CZ2 1 
ATOM   1538 C  CZ3 . TRP A 1 193 ? 5.283   19.623 28.921 1.00 11.95 ? 335 TRP A CZ3 1 
ATOM   1539 C  CH2 . TRP A 1 193 ? 5.766   20.721 29.649 1.00 11.98 ? 335 TRP A CH2 1 
ATOM   1540 N  N   . MET A 1 194 ? 2.976   20.472 21.693 1.00 15.08 ? 336 MET A N   1 
ATOM   1541 C  CA  . MET A 1 194 ? 2.475   19.834 20.466 1.00 15.39 ? 336 MET A CA  1 
ATOM   1542 C  C   . MET A 1 194 ? 3.400   19.901 19.249 1.00 15.40 ? 336 MET A C   1 
ATOM   1543 O  O   . MET A 1 194 ? 3.981   20.944 18.960 1.00 15.26 ? 336 MET A O   1 
ATOM   1544 C  CB  . MET A 1 194 ? 1.140   20.479 20.024 1.00 15.85 ? 336 MET A CB  1 
ATOM   1545 C  CG  . MET A 1 194 ? -0.004  20.396 21.010 1.00 16.12 ? 336 MET A CG  1 
ATOM   1546 S  SD  . MET A 1 194 ? -0.453  18.710 21.456 1.00 17.42 ? 336 MET A SD  1 
ATOM   1547 C  CE  . MET A 1 194 ? -2.112  19.008 22.160 1.00 16.94 ? 336 MET A CE  1 
ATOM   1548 N  N   . ASN A 1 195 ? 3.440   18.799 18.508 1.00 15.89 ? 337 ASN A N   1 
ATOM   1549 C  CA  . ASN A 1 195 ? 4.190   18.671 17.253 1.00 16.40 ? 337 ASN A CA  1 
ATOM   1550 C  C   . ASN A 1 195 ? 3.035   18.536 16.231 1.00 16.52 ? 337 ASN A C   1 
ATOM   1551 O  O   . ASN A 1 195 ? 2.368   19.516 15.902 1.00 15.92 ? 337 ASN A O   1 
ATOM   1552 C  CB  . ASN A 1 195 ? 5.081   17.398 17.264 1.00 16.51 ? 337 ASN A CB  1 
ATOM   1553 C  CG  . ASN A 1 195 ? 6.032   17.303 16.046 1.00 16.79 ? 337 ASN A CG  1 
ATOM   1554 O  OD1 . ASN A 1 195 ? 5.952   18.097 15.116 1.00 17.05 ? 337 ASN A OD1 1 
ATOM   1555 N  ND2 . ASN A 1 195 ? 6.943   16.331 16.072 1.00 16.44 ? 337 ASN A ND2 1 
ATOM   1556 N  N   . LYS A 1 196 ? 2.710   17.309 15.855 1.00 17.07 ? 338 LYS A N   1 
ATOM   1557 C  CA  . LYS A 1 196 ? 1.634   17.058 14.905 1.00 17.99 ? 338 LYS A CA  1 
ATOM   1558 C  C   . LYS A 1 196 ? 1.089   15.626 15.052 1.00 18.04 ? 338 LYS A C   1 
ATOM   1559 O  O   . LYS A 1 196 ? 1.344   14.777 14.208 1.00 18.00 ? 338 LYS A O   1 
ATOM   1560 C  CB  . LYS A 1 196 ? 2.152   17.313 13.476 1.00 18.78 ? 338 LYS A CB  1 
ATOM   1561 C  CG  . LYS A 1 196 ? 1.173   17.015 12.342 1.00 19.98 ? 338 LYS A CG  1 
ATOM   1562 C  CD  . LYS A 1 196 ? 1.783   17.323 10.967 1.00 20.46 ? 338 LYS A CD  1 
ATOM   1563 C  CE  . LYS A 1 196 ? 0.941   16.717 9.860  1.00 21.05 ? 338 LYS A CE  1 
ATOM   1564 N  NZ  . LYS A 1 196 ? 0.418   17.765 8.911  1.00 21.70 ? 338 LYS A NZ  1 
ATOM   1565 N  N   . CYS A 1 197 ? 0.514   15.295 16.209 1.00 18.29 ? 339 CYS A N   1 
ATOM   1566 C  CA  . CYS A 1 197 ? 0.388   16.219 17.341 1.00 17.93 ? 339 CYS A CA  1 
ATOM   1567 C  C   . CYS A 1 197 ? 1.127   15.698 18.571 1.00 17.11 ? 339 CYS A C   1 
ATOM   1568 O  O   . CYS A 1 197 ? 1.851   16.442 19.214 1.00 16.93 ? 339 CYS A O   1 
ATOM   1569 C  CB  . CYS A 1 197 ? -1.068  16.440 17.727 1.00 18.88 ? 339 CYS A CB  1 
ATOM   1570 S  SG  . CYS A 1 197 ? -2.022  17.431 16.565 1.00 19.52 ? 339 CYS A SG  1 
ATOM   1571 N  N   . HIS A 1 198 ? 0.999   14.408 18.860 1.00 16.49 ? 340 HIS A N   1 
ATOM   1572 C  CA  . HIS A 1 198 ? 1.634   13.881 20.043 1.00 15.97 ? 340 HIS A CA  1 
ATOM   1573 C  C   . HIS A 1 198 ? 1.624   12.376 20.198 1.00 15.84 ? 340 HIS A C   1 
ATOM   1574 O  O   . HIS A 1 198 ? 0.775   11.686 19.634 1.00 15.63 ? 340 HIS A O   1 
ATOM   1575 C  CB  . HIS A 1 198 ? 0.976   14.512 21.274 1.00 16.30 ? 340 HIS A CB  1 
ATOM   1576 C  CG  . HIS A 1 198 ? -0.500  14.279 21.357 1.00 16.30 ? 340 HIS A CG  1 
ATOM   1577 N  ND1 . HIS A 1 198 ? -1.041  13.124 21.885 1.00 16.65 ? 340 HIS A ND1 1 
ATOM   1578 C  CD2 . HIS A 1 198 ? -1.551  15.031 20.945 1.00 16.71 ? 340 HIS A CD2 1 
ATOM   1579 C  CE1 . HIS A 1 198 ? -2.359  13.171 21.788 1.00 16.84 ? 340 HIS A CE1 1 
ATOM   1580 N  NE2 . HIS A 1 198 ? -2.693  14.317 21.223 1.00 16.56 ? 340 HIS A NE2 1 
ATOM   1581 N  N   . ALA A 1 199 ? 2.600   11.896 20.973 1.00 15.44 ? 341 ALA A N   1 
ATOM   1582 C  CA  . ALA A 1 199 ? 2.779   10.485 21.324 1.00 15.40 ? 341 ALA A CA  1 
ATOM   1583 C  C   . ALA A 1 199 ? 2.700   10.387 22.850 1.00 15.13 ? 341 ALA A C   1 
ATOM   1584 O  O   . ALA A 1 199 ? 2.508   9.319  23.406 1.00 15.68 ? 341 ALA A O   1 
ATOM   1585 C  CB  . ALA A 1 199 ? 4.135   9.969  20.832 1.00 14.85 ? 341 ALA A CB  1 
ATOM   1586 N  N   . GLY A 1 200 ? 2.842   11.525 23.514 1.00 15.26 ? 342 GLY A N   1 
ATOM   1587 C  CA  . GLY A 1 200 ? 2.767   11.598 24.968 1.00 14.97 ? 342 GLY A CA  1 
ATOM   1588 C  C   . GLY A 1 200 ? 1.969   12.852 25.242 1.00 14.57 ? 342 GLY A C   1 
ATOM   1589 O  O   . GLY A 1 200 ? 2.379   13.950 24.844 1.00 15.24 ? 342 GLY A O   1 
ATOM   1590 N  N   . HIS A 1 201 ? 0.864   12.712 25.960 1.00 14.13 ? 343 HIS A N   1 
ATOM   1591 C  CA  . HIS A 1 201 ? -0.060  13.828 26.204 1.00 13.47 ? 343 HIS A CA  1 
ATOM   1592 C  C   . HIS A 1 201 ? -0.659  13.674 27.597 1.00 13.38 ? 343 HIS A C   1 
ATOM   1593 O  O   . HIS A 1 201 ? -1.720  13.073 27.747 1.00 13.86 ? 343 HIS A O   1 
ATOM   1594 C  CB  . HIS A 1 201 ? -1.157  13.654 25.151 1.00 13.25 ? 343 HIS A CB  1 
ATOM   1595 C  CG  . HIS A 1 201 ? -2.162  14.748 25.108 1.00 12.72 ? 343 HIS A CG  1 
ATOM   1596 N  ND1 . HIS A 1 201 ? -3.512  14.502 25.217 1.00 12.98 ? 343 HIS A ND1 1 
ATOM   1597 C  CD2 . HIS A 1 201 ? -2.027  16.076 24.926 1.00 12.45 ? 343 HIS A CD2 1 
ATOM   1598 C  CE1 . HIS A 1 201 ? -4.166  15.641 25.103 1.00 12.91 ? 343 HIS A CE1 1 
ATOM   1599 N  NE2 . HIS A 1 201 ? -3.290  16.612 24.926 1.00 12.91 ? 343 HIS A NE2 1 
ATOM   1600 N  N   . LEU A 1 202 ? -0.034  14.247 28.613 1.00 12.97 ? 344 LEU A N   1 
ATOM   1601 C  CA  . LEU A 1 202 ? -0.547  14.065 29.975 1.00 12.46 ? 344 LEU A CA  1 
ATOM   1602 C  C   . LEU A 1 202 ? -1.540  15.097 30.467 1.00 12.14 ? 344 LEU A C   1 
ATOM   1603 O  O   . LEU A 1 202 ? -2.011  15.011 31.591 1.00 12.18 ? 344 LEU A O   1 
ATOM   1604 C  CB  . LEU A 1 202 ? 0.618   13.926 30.965 1.00 11.71 ? 344 LEU A CB  1 
ATOM   1605 C  CG  . LEU A 1 202 ? 1.646   12.887 30.524 1.00 11.49 ? 344 LEU A CG  1 
ATOM   1606 C  CD1 . LEU A 1 202 ? 2.862   12.977 31.431 1.00 11.52 ? 344 LEU A CD1 1 
ATOM   1607 C  CD2 . LEU A 1 202 ? 1.042   11.477 30.533 1.00 11.12 ? 344 LEU A CD2 1 
ATOM   1608 N  N   . ASN A 1 203 ? -1.816  16.100 29.652 1.00 11.71 ? 345 ASN A N   1 
ATOM   1609 C  CA  . ASN A 1 203 ? -2.788  17.125 30.022 1.00 11.73 ? 345 ASN A CA  1 
ATOM   1610 C  C   . ASN A 1 203 ? -4.084  16.956 29.224 1.00 11.81 ? 345 ASN A C   1 
ATOM   1611 O  O   . ASN A 1 203 ? -4.809  17.906 29.003 1.00 11.23 ? 345 ASN A O   1 
ATOM   1612 C  CB  . ASN A 1 203 ? -2.209  18.513 29.768 1.00 11.21 ? 345 ASN A CB  1 
ATOM   1613 C  CG  . ASN A 1 203 ? -1.110  18.860 30.732 1.00 11.36 ? 345 ASN A CG  1 
ATOM   1614 O  OD1 . ASN A 1 203 ? -0.817  18.095 31.653 1.00 11.47 ? 345 ASN A OD1 1 
ATOM   1615 N  ND2 . ASN A 1 203 ? -0.483  20.007 30.529 1.00 10.78 ? 345 ASN A ND2 1 
ATOM   1616 N  N   . GLY A 1 204 ? -4.330  15.743 28.756 1.00 12.40 ? 346 GLY A N   1 
ATOM   1617 C  CA  . GLY A 1 204 ? -5.509  15.462 27.961 1.00 13.26 ? 346 GLY A CA  1 
ATOM   1618 C  C   . GLY A 1 204 ? -6.751  15.192 28.792 1.00 13.92 ? 346 GLY A C   1 
ATOM   1619 O  O   . GLY A 1 204 ? -6.730  15.329 30.019 1.00 13.69 ? 346 GLY A O   1 
ATOM   1620 N  N   . VAL A 1 205 ? -7.830  14.814 28.111 1.00 14.22 ? 347 VAL A N   1 
ATOM   1621 C  CA  . VAL A 1 205 ? -9.105  14.524 28.749 1.00 14.61 ? 347 VAL A CA  1 
ATOM   1622 C  C   . VAL A 1 205 ? -9.084  13.268 29.602 1.00 15.13 ? 347 VAL A C   1 
ATOM   1623 O  O   . VAL A 1 205 ? -8.716  12.184 29.144 1.00 15.18 ? 347 VAL A O   1 
ATOM   1624 C  CB  . VAL A 1 205 ? -10.242 14.401 27.711 1.00 13.90 ? 347 VAL A CB  1 
ATOM   1625 C  CG1 . VAL A 1 205 ? -11.525 13.987 28.369 1.00 14.00 ? 347 VAL A CG1 1 
ATOM   1626 C  CG2 . VAL A 1 205 ? -10.437 15.718 27.032 1.00 14.12 ? 347 VAL A CG2 1 
ATOM   1627 N  N   . TYR A 1 206 ? -9.546  13.433 30.836 1.00 15.65 ? 348 TYR A N   1 
ATOM   1628 C  CA  . TYR A 1 206 ? -9.639  12.360 31.800 1.00 16.20 ? 348 TYR A CA  1 
ATOM   1629 C  C   . TYR A 1 206 ? -10.833 11.475 31.454 1.00 17.13 ? 348 TYR A C   1 
ATOM   1630 O  O   . TYR A 1 206 ? -11.977 11.898 31.617 1.00 17.12 ? 348 TYR A O   1 
ATOM   1631 C  CB  . TYR A 1 206 ? -9.819  12.964 33.185 1.00 15.50 ? 348 TYR A CB  1 
ATOM   1632 C  CG  . TYR A 1 206 ? -9.506  11.993 34.288 1.00 15.44 ? 348 TYR A CG  1 
ATOM   1633 C  CD1 . TYR A 1 206 ? -10.468 11.077 34.727 1.00 14.95 ? 348 TYR A CD1 1 
ATOM   1634 C  CD2 . TYR A 1 206 ? -8.219  11.933 34.843 1.00 14.82 ? 348 TYR A CD2 1 
ATOM   1635 C  CE1 . TYR A 1 206 ? -10.159 10.125 35.676 1.00 15.10 ? 348 TYR A CE1 1 
ATOM   1636 C  CE2 . TYR A 1 206 ? -7.903  10.979 35.791 1.00 14.88 ? 348 TYR A CE2 1 
ATOM   1637 C  CZ  . TYR A 1 206 ? -8.871  10.081 36.195 1.00 14.80 ? 348 TYR A CZ  1 
ATOM   1638 O  OH  . TYR A 1 206 ? -8.551  9.102  37.098 1.00 15.49 ? 348 TYR A OH  1 
ATOM   1639 N  N   . TYR A 1 207 ? -10.559 10.254 30.985 1.00 18.28 ? 349 TYR A N   1 
ATOM   1640 C  CA  . TYR A 1 207 ? -11.586 9.282  30.595 1.00 19.52 ? 349 TYR A CA  1 
ATOM   1641 C  C   . TYR A 1 207 ? -11.682 8.237  31.682 1.00 20.97 ? 349 TYR A C   1 
ATOM   1642 O  O   . TYR A 1 207 ? -10.710 7.562  32.002 1.00 21.36 ? 349 TYR A O   1 
ATOM   1643 C  CB  . TYR A 1 207 ? -11.251 8.598  29.249 1.00 18.77 ? 349 TYR A CB  1 
ATOM   1644 C  CG  . TYR A 1 207 ? -11.469 9.480  28.026 1.00 17.73 ? 349 TYR A CG  1 
ATOM   1645 C  CD1 . TYR A 1 207 ? -12.747 9.707  27.535 1.00 17.57 ? 349 TYR A CD1 1 
ATOM   1646 C  CD2 . TYR A 1 207 ? -10.418 10.140 27.411 1.00 16.90 ? 349 TYR A CD2 1 
ATOM   1647 C  CE1 . TYR A 1 207 ? -12.973 10.589 26.469 1.00 17.19 ? 349 TYR A CE1 1 
ATOM   1648 C  CE2 . TYR A 1 207 ? -10.641 11.017 26.338 1.00 16.74 ? 349 TYR A CE2 1 
ATOM   1649 C  CZ  . TYR A 1 207 ? -11.927 11.237 25.884 1.00 16.86 ? 349 TYR A CZ  1 
ATOM   1650 O  OH  . TYR A 1 207 ? -12.191 12.143 24.884 1.00 17.12 ? 349 TYR A OH  1 
ATOM   1651 N  N   . GLN A 1 208 ? -12.855 8.112  32.272 1.00 22.74 ? 350 GLN A N   1 
ATOM   1652 C  CA  . GLN A 1 208 ? -13.037 7.146  33.330 1.00 24.49 ? 350 GLN A CA  1 
ATOM   1653 C  C   . GLN A 1 208 ? -12.907 5.728  32.750 1.00 25.14 ? 350 GLN A C   1 
ATOM   1654 O  O   . GLN A 1 208 ? -13.461 5.424  31.690 1.00 25.40 ? 350 GLN A O   1 
ATOM   1655 C  CB  . GLN A 1 208 ? -14.401 7.358  33.999 1.00 25.41 ? 350 GLN A CB  1 
ATOM   1656 C  CG  . GLN A 1 208 ? -14.435 6.937  35.459 1.00 27.20 ? 350 GLN A CG  1 
ATOM   1657 C  CD  . GLN A 1 208 ? -15.842 6.909  36.026 1.00 28.33 ? 350 GLN A CD  1 
ATOM   1658 O  OE1 . GLN A 1 208 ? -16.829 7.156  35.310 1.00 29.09 ? 350 GLN A OE1 1 
ATOM   1659 N  NE2 . GLN A 1 208 ? -15.948 6.623  37.322 1.00 28.82 ? 350 GLN A NE2 1 
ATOM   1660 N  N   . GLY A 1 209 ? -12.110 4.895  33.419 1.00 25.82 ? 351 GLY A N   1 
ATOM   1661 C  CA  . GLY A 1 209 ? -11.916 3.519  32.989 1.00 26.54 ? 351 GLY A CA  1 
ATOM   1662 C  C   . GLY A 1 209 ? -10.679 3.194  32.152 1.00 26.98 ? 351 GLY A C   1 
ATOM   1663 O  O   . GLY A 1 209 ? -10.278 2.028  32.081 1.00 27.16 ? 351 GLY A O   1 
ATOM   1664 N  N   . GLY A 1 210 ? -10.069 4.204  31.534 1.00 27.12 ? 352 GLY A N   1 
ATOM   1665 C  CA  . GLY A 1 210 ? -8.904  3.966  30.710 1.00 27.51 ? 352 GLY A CA  1 
ATOM   1666 C  C   . GLY A 1 210 ? -9.248  3.841  29.239 1.00 27.91 ? 352 GLY A C   1 
ATOM   1667 O  O   . GLY A 1 210 ? -8.986  4.753  28.462 1.00 27.61 ? 352 GLY A O   1 
ATOM   1668 N  N   . THR A 1 211 ? -9.800  2.697  28.847 1.00 28.90 ? 353 THR A N   1 
ATOM   1669 C  CA  . THR A 1 211 ? -10.182 2.466  27.453 1.00 30.27 ? 353 THR A CA  1 
ATOM   1670 C  C   . THR A 1 211 ? -11.304 3.402  26.983 1.00 30.89 ? 353 THR A C   1 
ATOM   1671 O  O   . THR A 1 211 ? -12.289 3.600  27.680 1.00 31.13 ? 353 THR A O   1 
ATOM   1672 C  CB  . THR A 1 211 ? -10.612 1.012  27.220 1.00 30.39 ? 353 THR A CB  1 
ATOM   1673 O  OG1 . THR A 1 211 ? -9.468  0.144  27.312 1.00 31.05 ? 353 THR A OG1 1 
ATOM   1674 C  CG2 . THR A 1 211 ? -11.262 0.862  25.858 1.00 30.79 ? 353 THR A CG2 1 
ATOM   1675 N  N   . TYR A 1 212 ? -11.134 3.986  25.802 1.00 31.66 ? 354 TYR A N   1 
ATOM   1676 C  CA  . TYR A 1 212 ? -12.117 4.895  25.239 1.00 32.55 ? 354 TYR A CA  1 
ATOM   1677 C  C   . TYR A 1 212 ? -12.118 4.780  23.709 1.00 34.10 ? 354 TYR A C   1 
ATOM   1678 O  O   . TYR A 1 212 ? -11.122 4.389  23.095 1.00 34.03 ? 354 TYR A O   1 
ATOM   1679 C  CB  . TYR A 1 212 ? -11.846 6.337  25.702 1.00 31.25 ? 354 TYR A CB  1 
ATOM   1680 C  CG  . TYR A 1 212 ? -10.552 6.963  25.206 1.00 30.10 ? 354 TYR A CG  1 
ATOM   1681 C  CD1 . TYR A 1 212 ? -9.318  6.697  25.827 1.00 29.32 ? 354 TYR A CD1 1 
ATOM   1682 C  CD2 . TYR A 1 212 ? -10.568 7.865  24.137 1.00 29.58 ? 354 TYR A CD2 1 
ATOM   1683 C  CE1 . TYR A 1 212 ? -8.135  7.324  25.391 1.00 28.65 ? 354 TYR A CE1 1 
ATOM   1684 C  CE2 . TYR A 1 212 ? -9.397  8.495  23.698 1.00 29.00 ? 354 TYR A CE2 1 
ATOM   1685 C  CZ  . TYR A 1 212 ? -8.190  8.228  24.325 1.00 28.68 ? 354 TYR A CZ  1 
ATOM   1686 O  OH  . TYR A 1 212 ? -7.070  8.912  23.887 1.00 28.32 ? 354 TYR A OH  1 
ATOM   1687 N  N   . SER A 1 213 ? -13.243 5.115  23.091 1.00 36.18 ? 355 SER A N   1 
ATOM   1688 C  CA  . SER A 1 213 ? -13.350 5.006  21.642 1.00 38.09 ? 355 SER A CA  1 
ATOM   1689 C  C   . SER A 1 213 ? -13.205 6.322  20.906 1.00 39.38 ? 355 SER A C   1 
ATOM   1690 O  O   . SER A 1 213 ? -13.259 7.402  21.504 1.00 39.72 ? 355 SER A O   1 
ATOM   1691 C  CB  . SER A 1 213 ? -14.679 4.340  21.248 1.00 38.21 ? 355 SER A CB  1 
ATOM   1692 O  OG  . SER A 1 213 ? -15.796 5.018  21.800 1.00 38.30 ? 355 SER A OG  1 
ATOM   1693 N  N   . LYS A 1 214 ? -13.080 6.210  19.588 1.00 40.80 ? 356 LYS A N   1 
ATOM   1694 C  CA  . LYS A 1 214 ? -12.946 7.349  18.693 1.00 42.08 ? 356 LYS A CA  1 
ATOM   1695 C  C   . LYS A 1 214 ? -14.216 8.196  18.758 1.00 42.57 ? 356 LYS A C   1 
ATOM   1696 O  O   . LYS A 1 214 ? -14.198 9.387  18.437 1.00 42.77 ? 356 LYS A O   1 
ATOM   1697 C  CB  . LYS A 1 214 ? -12.744 6.833  17.265 1.00 42.70 ? 356 LYS A CB  1 
ATOM   1698 C  CG  . LYS A 1 214 ? -12.461 7.912  16.228 1.00 43.89 ? 356 LYS A CG  1 
ATOM   1699 C  CD  . LYS A 1 214 ? -12.467 7.340  14.794 1.00 45.03 ? 356 LYS A CD  1 
ATOM   1700 C  CE  . LYS A 1 214 ? -11.484 6.146  14.590 1.00 45.44 ? 356 LYS A CE  1 
ATOM   1701 N  NZ  . LYS A 1 214 ? -10.027 6.524  14.518 1.00 45.72 ? 356 LYS A NZ  1 
ATOM   1702 N  N   . ALA A 1 215 ? -15.307 7.571  19.197 1.00 43.05 ? 357 ALA A N   1 
ATOM   1703 C  CA  . ALA A 1 215 ? -16.609 8.229  19.296 1.00 43.75 ? 357 ALA A CA  1 
ATOM   1704 C  C   . ALA A 1 215 ? -16.754 9.186  20.477 1.00 44.22 ? 357 ALA A C   1 
ATOM   1705 O  O   . ALA A 1 215 ? -17.413 10.227 20.355 1.00 44.18 ? 357 ALA A O   1 
ATOM   1706 C  CB  . ALA A 1 215 ? -17.705 7.189  19.328 1.00 43.65 ? 357 ALA A CB  1 
ATOM   1707 N  N   . SER A 1 216 ? -16.105 8.845  21.594 1.00 44.78 ? 358 SER A N   1 
ATOM   1708 C  CA  . SER A 1 216 ? -16.122 9.637  22.828 1.00 45.32 ? 358 SER A CA  1 
ATOM   1709 C  C   . SER A 1 216 ? -15.635 11.063 22.560 1.00 45.78 ? 358 SER A C   1 
ATOM   1710 O  O   . SER A 1 216 ? -15.613 11.915 23.452 1.00 45.64 ? 358 SER A O   1 
ATOM   1711 C  CB  . SER A 1 216 ? -15.223 8.979  23.885 1.00 45.59 ? 358 SER A CB  1 
ATOM   1712 O  OG  . SER A 1 216 ? -15.575 7.622  24.151 1.00 45.98 ? 358 SER A OG  1 
ATOM   1713 N  N   . THR A 1 217 ? -15.195 11.284 21.330 1.00 46.46 ? 359 THR A N   1 
ATOM   1714 C  CA  . THR A 1 217 ? -14.712 12.558 20.856 1.00 47.10 ? 359 THR A CA  1 
ATOM   1715 C  C   . THR A 1 217 ? -15.207 12.598 19.401 1.00 47.72 ? 359 THR A C   1 
ATOM   1716 O  O   . THR A 1 217 ? -14.649 11.919 18.534 1.00 47.87 ? 359 THR A O   1 
ATOM   1717 C  CB  . THR A 1 217 ? -13.165 12.607 20.947 1.00 47.14 ? 359 THR A CB  1 
ATOM   1718 O  OG1 . THR A 1 217 ? -12.667 13.660 20.117 1.00 47.81 ? 359 THR A OG1 1 
ATOM   1719 C  CG2 . THR A 1 217 ? -12.535 11.266 20.558 1.00 46.93 ? 359 THR A CG2 1 
ATOM   1720 N  N   . PRO A 1 218 ? -16.333 13.313 19.142 1.00 48.28 ? 360 PRO A N   1 
ATOM   1721 C  CA  . PRO A 1 218 ? -16.981 13.480 17.823 1.00 48.22 ? 360 PRO A CA  1 
ATOM   1722 C  C   . PRO A 1 218 ? -16.081 13.653 16.593 1.00 47.88 ? 360 PRO A C   1 
ATOM   1723 O  O   . PRO A 1 218 ? -16.422 13.159 15.510 1.00 47.99 ? 360 PRO A O   1 
ATOM   1724 C  CB  . PRO A 1 218 ? -17.904 14.684 18.044 1.00 48.41 ? 360 PRO A CB  1 
ATOM   1725 C  CG  . PRO A 1 218 ? -18.421 14.410 19.430 1.00 48.51 ? 360 PRO A CG  1 
ATOM   1726 C  CD  . PRO A 1 218 ? -17.131 13.998 20.184 1.00 48.58 ? 360 PRO A CD  1 
ATOM   1727 N  N   . ASN A 1 219 ? -14.963 14.372 16.719 1.00 47.34 ? 361 ASN A N   1 
ATOM   1728 C  CA  . ASN A 1 219 ? -14.074 14.508 15.561 1.00 46.40 ? 361 ASN A CA  1 
ATOM   1729 C  C   . ASN A 1 219 ? -12.877 13.538 15.602 1.00 45.35 ? 361 ASN A C   1 
ATOM   1730 O  O   . ASN A 1 219 ? -11.783 13.872 15.169 1.00 45.45 ? 361 ASN A O   1 
ATOM   1731 C  CB  . ASN A 1 219 ? -13.646 15.964 15.327 1.00 46.79 ? 361 ASN A CB  1 
ATOM   1732 C  CG  . ASN A 1 219 ? -14.722 16.792 14.596 1.00 47.14 ? 361 ASN A CG  1 
ATOM   1733 O  OD1 . ASN A 1 219 ? -14.684 16.955 13.371 1.00 47.13 ? 361 ASN A OD1 1 
ATOM   1734 N  ND2 . ASN A 1 219 ? -15.674 17.326 15.353 1.00 47.27 ? 361 ASN A ND2 1 
ATOM   1735 N  N   . GLY A 1 220 ? -13.117 12.341 16.146 1.00 44.16 ? 362 GLY A N   1 
ATOM   1736 C  CA  . GLY A 1 220 ? -12.124 11.274 16.220 1.00 42.42 ? 362 GLY A CA  1 
ATOM   1737 C  C   . GLY A 1 220 ? -10.730 11.526 16.778 1.00 41.19 ? 362 GLY A C   1 
ATOM   1738 O  O   . GLY A 1 220 ? -9.791  10.776 16.469 1.00 41.24 ? 362 GLY A O   1 
ATOM   1739 N  N   . TYR A 1 221 ? -10.595 12.546 17.624 1.00 39.57 ? 363 TYR A N   1 
ATOM   1740 C  CA  . TYR A 1 221 ? -9.314  12.890 18.225 1.00 37.56 ? 363 TYR A CA  1 
ATOM   1741 C  C   . TYR A 1 221 ? -8.903  11.883 19.297 1.00 35.60 ? 363 TYR A C   1 
ATOM   1742 O  O   . TYR A 1 221 ? -9.718  11.509 20.143 1.00 35.46 ? 363 TYR A O   1 
ATOM   1743 C  CB  . TYR A 1 221 ? -9.399  14.238 18.959 1.00 38.69 ? 363 TYR A CB  1 
ATOM   1744 C  CG  . TYR A 1 221 ? -10.271 15.327 18.362 1.00 39.79 ? 363 TYR A CG  1 
ATOM   1745 C  CD1 . TYR A 1 221 ? -10.109 15.767 17.036 1.00 40.35 ? 363 TYR A CD1 1 
ATOM   1746 C  CD2 . TYR A 1 221 ? -11.195 15.997 19.161 1.00 40.28 ? 363 TYR A CD2 1 
ATOM   1747 C  CE1 . TYR A 1 221 ? -10.849 16.861 16.535 1.00 40.50 ? 363 TYR A CE1 1 
ATOM   1748 C  CE2 . TYR A 1 221 ? -11.931 17.088 18.671 1.00 40.69 ? 363 TYR A CE2 1 
ATOM   1749 C  CZ  . TYR A 1 221 ? -11.752 17.516 17.372 1.00 40.61 ? 363 TYR A CZ  1 
ATOM   1750 O  OH  . TYR A 1 221 ? -12.453 18.626 16.953 1.00 41.12 ? 363 TYR A OH  1 
ATOM   1751 N  N   . ASP A 1 222 ? -7.654  11.443 19.274 1.00 32.99 ? 364 ASP A N   1 
ATOM   1752 C  CA  . ASP A 1 222 ? -7.179  10.583 20.348 1.00 30.33 ? 364 ASP A CA  1 
ATOM   1753 C  C   . ASP A 1 222 ? -6.611  11.616 21.357 1.00 28.39 ? 364 ASP A C   1 
ATOM   1754 O  O   . ASP A 1 222 ? -5.453  12.042 21.293 1.00 28.00 ? 364 ASP A O   1 
ATOM   1755 C  CB  . ASP A 1 222 ? -6.141  9.564  19.847 1.00 30.64 ? 364 ASP A CB  1 
ATOM   1756 C  CG  . ASP A 1 222 ? -4.794  10.177 19.543 1.00 30.80 ? 364 ASP A CG  1 
ATOM   1757 O  OD1 . ASP A 1 222 ? -4.712  11.089 18.683 1.00 30.84 ? 364 ASP A OD1 1 
ATOM   1758 O  OD2 . ASP A 1 222 ? -3.817  9.743  20.196 1.00 30.76 ? 364 ASP A OD2 1 
ATOM   1759 N  N   . ASN A 1 223 ? -7.497  12.119 22.205 1.00 26.07 ? 365 ASN A N   1 
ATOM   1760 C  CA  . ASN A 1 223 ? -7.139  13.154 23.163 1.00 23.85 ? 365 ASN A CA  1 
ATOM   1761 C  C   . ASN A 1 223 ? -7.081  12.785 24.640 1.00 22.22 ? 365 ASN A C   1 
ATOM   1762 O  O   . ASN A 1 223 ? -7.125  13.676 25.487 1.00 22.03 ? 365 ASN A O   1 
ATOM   1763 C  CB  . ASN A 1 223 ? -8.061  14.362 22.986 1.00 23.57 ? 365 ASN A CB  1 
ATOM   1764 C  CG  . ASN A 1 223 ? -9.518  14.035 23.268 1.00 22.94 ? 365 ASN A CG  1 
ATOM   1765 O  OD1 . ASN A 1 223 ? -9.913  12.876 23.409 1.00 22.24 ? 365 ASN A OD1 1 
ATOM   1766 N  ND2 . ASN A 1 223 ? -10.327 15.064 23.328 1.00 23.32 ? 365 ASN A ND2 1 
ATOM   1767 N  N   . GLY A 1 224 ? -6.937  11.502 24.945 1.00 20.60 ? 366 GLY A N   1 
ATOM   1768 C  CA  . GLY A 1 224 ? -6.858  11.079 26.330 1.00 18.83 ? 366 GLY A CA  1 
ATOM   1769 C  C   . GLY A 1 224 ? -5.520  11.438 26.959 1.00 17.92 ? 366 GLY A C   1 
ATOM   1770 O  O   . GLY A 1 224 ? -4.749  12.253 26.441 1.00 18.00 ? 366 GLY A O   1 
ATOM   1771 N  N   . ILE A 1 225 ? -5.281  10.870 28.126 1.00 16.98 ? 367 ILE A N   1 
ATOM   1772 C  CA  . ILE A 1 225 ? -4.051  11.066 28.864 1.00 16.23 ? 367 ILE A CA  1 
ATOM   1773 C  C   . ILE A 1 225 ? -3.287  9.828  28.418 1.00 16.37 ? 367 ILE A C   1 
ATOM   1774 O  O   . ILE A 1 225 ? -3.351  8.786  29.053 1.00 16.10 ? 367 ILE A O   1 
ATOM   1775 C  CB  . ILE A 1 225 ? -4.312  11.024 30.393 1.00 15.28 ? 367 ILE A CB  1 
ATOM   1776 C  CG1 . ILE A 1 225 ? -5.294  12.113 30.795 1.00 14.12 ? 367 ILE A CG1 1 
ATOM   1777 C  CG2 . ILE A 1 225 ? -3.035  11.191 31.160 1.00 14.67 ? 367 ILE A CG2 1 
ATOM   1778 C  CD1 . ILE A 1 225 ? -5.713  12.021 32.241 1.00 13.85 ? 367 ILE A CD1 1 
ATOM   1779 N  N   . ILE A 1 226 ? -2.583  9.944  27.295 1.00 17.02 ? 368 ILE A N   1 
ATOM   1780 C  CA  . ILE A 1 226 ? -1.847  8.813  26.722 1.00 17.07 ? 368 ILE A CA  1 
ATOM   1781 C  C   . ILE A 1 226 ? -0.321  8.901  26.769 1.00 17.12 ? 368 ILE A C   1 
ATOM   1782 O  O   . ILE A 1 226 ? 0.261   9.994  26.798 1.00 17.18 ? 368 ILE A O   1 
ATOM   1783 C  CB  . ILE A 1 226 ? -2.213  8.630  25.243 1.00 16.99 ? 368 ILE A CB  1 
ATOM   1784 C  CG1 . ILE A 1 226 ? -1.687  9.813  24.432 1.00 16.82 ? 368 ILE A CG1 1 
ATOM   1785 C  CG2 . ILE A 1 226 ? -3.718  8.559  25.087 1.00 17.37 ? 368 ILE A CG2 1 
ATOM   1786 C  CD1 . ILE A 1 226 ? -1.275  9.457  23.063 1.00 16.79 ? 368 ILE A CD1 1 
ATOM   1787 N  N   . TRP A 1 227 ? 0.309   7.734  26.732 1.00 16.74 ? 369 TRP A N   1 
ATOM   1788 C  CA  . TRP A 1 227 ? 1.751   7.618  26.686 1.00 16.65 ? 369 TRP A CA  1 
ATOM   1789 C  C   . TRP A 1 227 ? 1.879   6.425  25.748 1.00 17.01 ? 369 TRP A C   1 
ATOM   1790 O  O   . TRP A 1 227 ? 1.890   5.289  26.179 1.00 16.87 ? 369 TRP A O   1 
ATOM   1791 C  CB  . TRP A 1 227 ? 2.321   7.314  28.057 1.00 16.33 ? 369 TRP A CB  1 
ATOM   1792 C  CG  . TRP A 1 227 ? 3.818   7.510  28.111 1.00 16.17 ? 369 TRP A CG  1 
ATOM   1793 C  CD1 . TRP A 1 227 ? 4.777   6.534  28.062 1.00 15.97 ? 369 TRP A CD1 1 
ATOM   1794 C  CD2 . TRP A 1 227 ? 4.524   8.763  28.204 1.00 15.49 ? 369 TRP A CD2 1 
ATOM   1795 N  NE1 . TRP A 1 227 ? 6.030   7.103  28.111 1.00 16.14 ? 369 TRP A NE1 1 
ATOM   1796 C  CE2 . TRP A 1 227 ? 5.905   8.464  28.203 1.00 15.34 ? 369 TRP A CE2 1 
ATOM   1797 C  CE3 . TRP A 1 227 ? 4.123   10.103 28.288 1.00 15.02 ? 369 TRP A CE3 1 
ATOM   1798 C  CZ2 . TRP A 1 227 ? 6.884   9.452  28.283 1.00 14.69 ? 369 TRP A CZ2 1 
ATOM   1799 C  CZ3 . TRP A 1 227 ? 5.091   11.076 28.364 1.00 14.78 ? 369 TRP A CZ3 1 
ATOM   1800 C  CH2 . TRP A 1 227 ? 6.463   10.743 28.360 1.00 14.31 ? 369 TRP A CH2 1 
ATOM   1801 N  N   . ALA A 1 228 ? 1.926   6.721  24.453 1.00 17.93 ? 370 ALA A N   1 
ATOM   1802 C  CA  . ALA A 1 228 ? 1.969   5.737  23.372 1.00 18.70 ? 370 ALA A CA  1 
ATOM   1803 C  C   . ALA A 1 228 ? 2.872   4.560  23.541 1.00 19.40 ? 370 ALA A C   1 
ATOM   1804 O  O   . ALA A 1 228 ? 2.596   3.477  23.042 1.00 19.59 ? 370 ALA A O   1 
ATOM   1805 C  CB  . ALA A 1 228 ? 2.276   6.415  22.054 1.00 18.87 ? 370 ALA A CB  1 
ATOM   1806 N  N   . THR A 1 229 ? 3.954   4.750  24.268 1.00 20.26 ? 371 THR A N   1 
ATOM   1807 C  CA  . THR A 1 229 ? 4.901   3.674  24.439 1.00 20.67 ? 371 THR A CA  1 
ATOM   1808 C  C   . THR A 1 229 ? 4.515   2.609  25.456 1.00 21.16 ? 371 THR A C   1 
ATOM   1809 O  O   . THR A 1 229 ? 4.993   1.482  25.388 1.00 21.35 ? 371 THR A O   1 
ATOM   1810 C  CB  . THR A 1 229 ? 6.284   4.275  24.713 1.00 20.61 ? 371 THR A CB  1 
ATOM   1811 O  OG1 . THR A 1 229 ? 6.158   5.324  25.690 1.00 20.86 ? 371 THR A OG1 1 
ATOM   1812 C  CG2 . THR A 1 229 ? 6.867   4.855  23.405 1.00 20.50 ? 371 THR A CG2 1 
ATOM   1813 N  N   . TRP A 1 230 ? 3.617   2.954  26.373 1.00 21.96 ? 372 TRP A N   1 
ATOM   1814 C  CA  . TRP A 1 230 ? 3.180   2.037  27.435 1.00 22.28 ? 372 TRP A CA  1 
ATOM   1815 C  C   . TRP A 1 230 ? 1.802   1.467  27.120 1.00 23.02 ? 372 TRP A C   1 
ATOM   1816 O  O   . TRP A 1 230 ? 1.587   0.262  27.200 1.00 23.51 ? 372 TRP A O   1 
ATOM   1817 C  CB  . TRP A 1 230 ? 3.148   2.775  28.792 1.00 21.14 ? 372 TRP A CB  1 
ATOM   1818 C  CG  . TRP A 1 230 ? 3.090   1.879  30.014 1.00 20.34 ? 372 TRP A CG  1 
ATOM   1819 C  CD1 . TRP A 1 230 ? 3.695   0.659  30.174 1.00 20.03 ? 372 TRP A CD1 1 
ATOM   1820 C  CD2 . TRP A 1 230 ? 2.321   2.105  31.215 1.00 19.77 ? 372 TRP A CD2 1 
ATOM   1821 N  NE1 . TRP A 1 230 ? 3.334   0.107  31.384 1.00 19.83 ? 372 TRP A NE1 1 
ATOM   1822 C  CE2 . TRP A 1 230 ? 2.490   0.968  32.039 1.00 19.58 ? 372 TRP A CE2 1 
ATOM   1823 C  CE3 . TRP A 1 230 ? 1.496   3.149  31.663 1.00 19.52 ? 372 TRP A CE3 1 
ATOM   1824 C  CZ2 . TRP A 1 230 ? 1.862   0.846  33.280 1.00 19.03 ? 372 TRP A CZ2 1 
ATOM   1825 C  CZ3 . TRP A 1 230 ? 0.874   3.024  32.896 1.00 19.21 ? 372 TRP A CZ3 1 
ATOM   1826 C  CH2 . TRP A 1 230 ? 1.059   1.881  33.690 1.00 19.12 ? 372 TRP A CH2 1 
ATOM   1827 N  N   . LYS A 1 231 ? 0.884   2.337  26.718 1.00 23.86 ? 373 LYS A N   1 
ATOM   1828 C  CA  . LYS A 1 231 ? -0.477  1.925  26.423 1.00 24.33 ? 373 LYS A CA  1 
ATOM   1829 C  C   . LYS A 1 231 ? -0.933  2.442  25.084 1.00 24.40 ? 373 LYS A C   1 
ATOM   1830 O  O   . LYS A 1 231 ? -0.359  3.360  24.532 1.00 24.25 ? 373 LYS A O   1 
ATOM   1831 C  CB  . LYS A 1 231 ? -1.433  2.452  27.495 1.00 24.69 ? 373 LYS A CB  1 
ATOM   1832 C  CG  . LYS A 1 231 ? -1.118  2.004  28.911 1.00 25.06 ? 373 LYS A CG  1 
ATOM   1833 C  CD  . LYS A 1 231 ? -1.470  0.530  29.162 1.00 25.56 ? 373 LYS A CD  1 
ATOM   1834 C  CE  . LYS A 1 231 ? -1.146  0.159  30.601 1.00 25.68 ? 373 LYS A CE  1 
ATOM   1835 N  NZ  . LYS A 1 231 ? -1.943  -0.974 31.110 1.00 26.10 ? 373 LYS A NZ  1 
ATOM   1836 N  N   . THR A 1 232 ? -2.017  1.853  24.601 1.00 25.03 ? 374 THR A N   1 
ATOM   1837 C  CA  . THR A 1 232 ? -2.624  2.222  23.333 1.00 25.16 ? 374 THR A CA  1 
ATOM   1838 C  C   . THR A 1 232 ? -3.159  3.665  23.449 1.00 25.41 ? 374 THR A C   1 
ATOM   1839 O  O   . THR A 1 232 ? -3.493  4.145  24.552 1.00 25.71 ? 374 THR A O   1 
ATOM   1840 C  CB  . THR A 1 232 ? -3.750  1.183  22.962 1.00 25.18 ? 374 THR A CB  1 
ATOM   1841 O  OG1 . THR A 1 232 ? -4.473  1.600  21.798 1.00 25.38 ? 374 THR A OG1 1 
ATOM   1842 C  CG2 . THR A 1 232 ? -4.710  0.979  24.127 1.00 25.46 ? 374 THR A CG2 1 
ATOM   1843 N  N   . ARG A 1 233 ? -3.191  4.362  22.318 1.00 25.19 ? 375 ARG A N   1 
ATOM   1844 C  CA  . ARG A 1 233 ? -3.679  5.731  22.233 1.00 25.14 ? 375 ARG A CA  1 
ATOM   1845 C  C   . ARG A 1 233 ? -5.124  5.846  22.708 1.00 24.74 ? 375 ARG A C   1 
ATOM   1846 O  O   . ARG A 1 233 ? -5.621  6.957  22.921 1.00 25.12 ? 375 ARG A O   1 
ATOM   1847 C  CB  . ARG A 1 233 ? -3.596  6.219  20.786 1.00 26.17 ? 375 ARG A CB  1 
ATOM   1848 C  CG  . ARG A 1 233 ? -4.535  5.457  19.825 1.00 27.40 ? 375 ARG A CG  1 
ATOM   1849 C  CD  . ARG A 1 233 ? -4.010  5.414  18.383 1.00 28.12 ? 375 ARG A CD  1 
ATOM   1850 N  NE  . ARG A 1 233 ? -4.053  6.711  17.718 1.00 28.54 ? 375 ARG A NE  1 
ATOM   1851 C  CZ  . ARG A 1 233 ? -3.749  6.885  16.433 1.00 29.34 ? 375 ARG A CZ  1 
ATOM   1852 N  NH1 . ARG A 1 233 ? -3.380  5.846  15.679 1.00 29.06 ? 375 ARG A NH1 1 
ATOM   1853 N  NH2 . ARG A 1 233 ? -3.831  8.099  15.898 1.00 30.02 ? 375 ARG A NH2 1 
ATOM   1854 N  N   . TRP A 1 234 ? -5.805  4.706  22.804 1.00 23.82 ? 376 TRP A N   1 
ATOM   1855 C  CA  . TRP A 1 234 ? -7.188  4.631  23.260 1.00 22.72 ? 376 TRP A CA  1 
ATOM   1856 C  C   . TRP A 1 234 ? -7.218  4.180  24.713 1.00 22.63 ? 376 TRP A C   1 
ATOM   1857 O  O   . TRP A 1 234 ? -8.111  3.452  25.149 1.00 23.11 ? 376 TRP A O   1 
ATOM   1858 C  CB  . TRP A 1 234 ? -7.987  3.677  22.359 1.00 21.92 ? 376 TRP A CB  1 
ATOM   1859 C  CG  . TRP A 1 234 ? -8.014  4.189  20.988 1.00 20.54 ? 376 TRP A CG  1 
ATOM   1860 C  CD1 . TRP A 1 234 ? -7.391  3.661  19.900 1.00 20.35 ? 376 TRP A CD1 1 
ATOM   1861 C  CD2 . TRP A 1 234 ? -8.544  5.453  20.579 1.00 19.95 ? 376 TRP A CD2 1 
ATOM   1862 N  NE1 . TRP A 1 234 ? -7.480  4.541  18.837 1.00 19.99 ? 376 TRP A NE1 1 
ATOM   1863 C  CE2 . TRP A 1 234 ? -8.183  5.644  19.234 1.00 19.68 ? 376 TRP A CE2 1 
ATOM   1864 C  CE3 . TRP A 1 234 ? -9.281  6.446  21.227 1.00 19.49 ? 376 TRP A CE3 1 
ATOM   1865 C  CZ2 . TRP A 1 234 ? -8.534  6.787  18.531 1.00 20.12 ? 376 TRP A CZ2 1 
ATOM   1866 C  CZ3 . TRP A 1 234 ? -9.631  7.580  20.528 1.00 19.52 ? 376 TRP A CZ3 1 
ATOM   1867 C  CH2 . TRP A 1 234 ? -9.261  7.746  19.198 1.00 19.81 ? 376 TRP A CH2 1 
ATOM   1868 N  N   . TYR A 1 235 ? -6.186  4.546  25.451 1.00 22.02 ? 377 TYR A N   1 
ATOM   1869 C  CA  . TYR A 1 235 ? -6.142  4.216  26.861 1.00 21.33 ? 377 TYR A CA  1 
ATOM   1870 C  C   . TYR A 1 235 ? -5.697  5.484  27.549 1.00 20.64 ? 377 TYR A C   1 
ATOM   1871 O  O   . TYR A 1 235 ? -4.664  6.043  27.211 1.00 19.65 ? 377 TYR A O   1 
ATOM   1872 C  CB  . TYR A 1 235 ? -5.162  3.093  27.154 1.00 21.55 ? 377 TYR A CB  1 
ATOM   1873 C  CG  . TYR A 1 235 ? -5.280  2.577  28.567 1.00 21.52 ? 377 TYR A CG  1 
ATOM   1874 C  CD1 . TYR A 1 235 ? -4.578  3.170  29.617 1.00 21.45 ? 377 TYR A CD1 1 
ATOM   1875 C  CD2 . TYR A 1 235 ? -6.126  1.513  28.861 1.00 21.39 ? 377 TYR A CD2 1 
ATOM   1876 C  CE1 . TYR A 1 235 ? -4.724  2.718  30.900 1.00 21.09 ? 377 TYR A CE1 1 
ATOM   1877 C  CE2 . TYR A 1 235 ? -6.274  1.061  30.145 1.00 21.24 ? 377 TYR A CE2 1 
ATOM   1878 C  CZ  . TYR A 1 235 ? -5.578  1.665  31.148 1.00 21.32 ? 377 TYR A CZ  1 
ATOM   1879 O  OH  . TYR A 1 235 ? -5.754  1.199  32.418 1.00 22.72 ? 377 TYR A OH  1 
ATOM   1880 N  N   . SER A 1 236 ? -6.566  5.974  28.420 1.00 20.40 ? 378 SER A N   1 
ATOM   1881 C  CA  . SER A 1 236 ? -6.343  7.179  29.198 1.00 20.18 ? 378 SER A CA  1 
ATOM   1882 C  C   . SER A 1 236 ? -5.896  6.708  30.601 1.00 20.15 ? 378 SER A C   1 
ATOM   1883 O  O   . SER A 1 236 ? -6.465  5.773  31.161 1.00 19.77 ? 378 SER A O   1 
ATOM   1884 C  CB  . SER A 1 236 ? -7.646  7.987  29.253 1.00 20.02 ? 378 SER A CB  1 
ATOM   1885 O  OG  . SER A 1 236 ? -7.407  9.360  29.478 1.00 19.47 ? 378 SER A OG  1 
ATOM   1886 N  N   . MET A 1 237 ? -4.833  7.320  31.128 1.00 20.28 ? 379 MET A N   1 
ATOM   1887 C  CA  . MET A 1 237 ? -4.275  6.945  32.435 1.00 20.33 ? 379 MET A CA  1 
ATOM   1888 C  C   . MET A 1 237 ? -5.120  7.323  33.656 1.00 19.84 ? 379 MET A C   1 
ATOM   1889 O  O   . MET A 1 237 ? -5.971  8.206  33.600 1.00 19.69 ? 379 MET A O   1 
ATOM   1890 C  CB  . MET A 1 237 ? -2.840  7.496  32.592 1.00 20.84 ? 379 MET A CB  1 
ATOM   1891 C  CG  . MET A 1 237 ? -1.877  7.305  31.384 1.00 21.76 ? 379 MET A CG  1 
ATOM   1892 S  SD  . MET A 1 237 ? -1.446  5.622  30.765 1.00 23.64 ? 379 MET A SD  1 
ATOM   1893 C  CE  . MET A 1 237 ? -2.086  4.599  32.028 1.00 23.00 ? 379 MET A CE  1 
ATOM   1894 N  N   . LYS A 1 238 ? -4.872  6.629  34.755 1.00 19.40 ? 380 LYS A N   1 
ATOM   1895 C  CA  . LYS A 1 238 ? -5.578  6.853  36.004 1.00 19.35 ? 380 LYS A CA  1 
ATOM   1896 C  C   . LYS A 1 238 ? -4.919  8.001  36.792 1.00 18.96 ? 380 LYS A C   1 
ATOM   1897 O  O   . LYS A 1 238 ? -5.587  8.871  37.343 1.00 18.95 ? 380 LYS A O   1 
ATOM   1898 C  CB  . LYS A 1 238 ? -5.572  5.531  36.781 1.00 20.01 ? 380 LYS A CB  1 
ATOM   1899 C  CG  . LYS A 1 238 ? -5.788  5.607  38.261 1.00 21.00 ? 380 LYS A CG  1 
ATOM   1900 C  CD  . LYS A 1 238 ? -7.215  5.881  38.601 1.00 22.09 ? 380 LYS A CD  1 
ATOM   1901 C  CE  . LYS A 1 238 ? -7.398  5.934  40.109 1.00 23.26 ? 380 LYS A CE  1 
ATOM   1902 N  NZ  . LYS A 1 238 ? -7.246  4.568  40.742 1.00 24.23 ? 380 LYS A NZ  1 
ATOM   1903 N  N   . LYS A 1 239 ? -3.598  8.015  36.813 1.00 18.52 ? 381 LYS A N   1 
ATOM   1904 C  CA  . LYS A 1 239 ? -2.860  9.054  37.502 1.00 18.17 ? 381 LYS A CA  1 
ATOM   1905 C  C   . LYS A 1 239 ? -1.589  9.344  36.745 1.00 17.16 ? 381 LYS A C   1 
ATOM   1906 O  O   . LYS A 1 239 ? -1.052  8.457  36.081 1.00 16.62 ? 381 LYS A O   1 
ATOM   1907 C  CB  . LYS A 1 239 ? -2.476  8.602  38.911 1.00 19.26 ? 381 LYS A CB  1 
ATOM   1908 C  CG  . LYS A 1 239 ? -3.628  8.152  39.752 1.00 20.49 ? 381 LYS A CG  1 
ATOM   1909 C  CD  . LYS A 1 239 ? -3.264  8.165  41.206 1.00 21.79 ? 381 LYS A CD  1 
ATOM   1910 C  CE  . LYS A 1 239 ? -4.273  7.328  42.001 1.00 22.85 ? 381 LYS A CE  1 
ATOM   1911 N  NZ  . LYS A 1 239 ? -4.103  7.481  43.487 1.00 24.17 ? 381 LYS A NZ  1 
ATOM   1912 N  N   . THR A 1 240 ? -1.140  10.591 36.809 1.00 16.46 ? 382 THR A N   1 
ATOM   1913 C  CA  . THR A 1 240 ? 0.113   10.988 36.175 1.00 16.05 ? 382 THR A CA  1 
ATOM   1914 C  C   . THR A 1 240 ? 0.816   11.964 37.096 1.00 15.92 ? 382 THR A C   1 
ATOM   1915 O  O   . THR A 1 240 ? 0.156   12.722 37.813 1.00 15.75 ? 382 THR A O   1 
ATOM   1916 C  CB  . THR A 1 240 ? -0.061  11.709 34.790 1.00 15.91 ? 382 THR A CB  1 
ATOM   1917 O  OG1 . THR A 1 240 ? -0.519  13.055 34.974 1.00 15.45 ? 382 THR A OG1 1 
ATOM   1918 C  CG2 . THR A 1 240 ? -1.015  10.958 33.885 1.00 16.15 ? 382 THR A CG2 1 
ATOM   1919 N  N   . THR A 1 241 ? 2.143   11.928 37.102 1.00 15.60 ? 383 THR A N   1 
ATOM   1920 C  CA  . THR A 1 241 ? 2.916   12.874 37.878 1.00 15.30 ? 383 THR A CA  1 
ATOM   1921 C  C   . THR A 1 241 ? 4.137   13.265 37.058 1.00 15.10 ? 383 THR A C   1 
ATOM   1922 O  O   . THR A 1 241 ? 4.755   12.418 36.425 1.00 15.43 ? 383 THR A O   1 
ATOM   1923 C  CB  . THR A 1 241 ? 3.361   12.275 39.200 1.00 15.52 ? 383 THR A CB  1 
ATOM   1924 O  OG1 . THR A 1 241 ? 2.259   11.572 39.794 1.00 15.56 ? 383 THR A OG1 1 
ATOM   1925 C  CG2 . THR A 1 241 ? 3.819   13.383 40.148 1.00 15.80 ? 383 THR A CG2 1 
ATOM   1926 N  N   . MET A 1 242 ? 4.405   14.555 36.971 1.00 14.90 ? 384 MET A N   1 
ATOM   1927 C  CA  . MET A 1 242 ? 5.577   15.054 36.266 1.00 14.77 ? 384 MET A CA  1 
ATOM   1928 C  C   . MET A 1 242 ? 6.356   15.822 37.325 1.00 14.76 ? 384 MET A C   1 
ATOM   1929 O  O   . MET A 1 242 ? 5.858   16.800 37.865 1.00 14.90 ? 384 MET A O   1 
ATOM   1930 C  CB  . MET A 1 242 ? 5.158   15.998 35.156 1.00 14.97 ? 384 MET A CB  1 
ATOM   1931 C  CG  . MET A 1 242 ? 4.379   15.321 34.028 1.00 15.23 ? 384 MET A CG  1 
ATOM   1932 S  SD  . MET A 1 242 ? 4.008   16.505 32.725 1.00 15.38 ? 384 MET A SD  1 
ATOM   1933 C  CE  . MET A 1 242 ? 5.548   16.425 31.785 1.00 14.64 ? 384 MET A CE  1 
ATOM   1934 N  N   . LYS A 1 243 ? 7.544   15.358 37.681 1.00 14.75 ? 385 LYS A N   1 
ATOM   1935 C  CA  . LYS A 1 243 ? 8.319   16.035 38.728 1.00 14.88 ? 385 LYS A CA  1 
ATOM   1936 C  C   . LYS A 1 243 ? 9.795   16.121 38.375 1.00 14.95 ? 385 LYS A C   1 
ATOM   1937 O  O   . LYS A 1 243 ? 10.295  15.346 37.557 1.00 15.03 ? 385 LYS A O   1 
ATOM   1938 C  CB  . LYS A 1 243 ? 8.139   15.311 40.064 1.00 14.49 ? 385 LYS A CB  1 
ATOM   1939 C  CG  . LYS A 1 243 ? 8.448   13.847 39.978 1.00 13.85 ? 385 LYS A CG  1 
ATOM   1940 C  CD  . LYS A 1 243 ? 7.912   13.063 41.134 1.00 13.42 ? 385 LYS A CD  1 
ATOM   1941 C  CE  . LYS A 1 243 ? 8.106   11.608 40.805 1.00 13.79 ? 385 LYS A CE  1 
ATOM   1942 N  NZ  . LYS A 1 243 ? 8.147   10.698 41.971 1.00 13.73 ? 385 LYS A NZ  1 
ATOM   1943 N  N   . ILE A 1 244 ? 10.499  17.045 39.019 1.00 15.02 ? 386 ILE A N   1 
ATOM   1944 C  CA  . ILE A 1 244 ? 11.912  17.237 38.733 1.00 15.04 ? 386 ILE A CA  1 
ATOM   1945 C  C   . ILE A 1 244 ? 12.888  17.142 39.941 1.00 15.27 ? 386 ILE A C   1 
ATOM   1946 O  O   . ILE A 1 244 ? 12.552  17.507 41.071 1.00 15.17 ? 386 ILE A O   1 
ATOM   1947 C  CB  . ILE A 1 244 ? 12.115  18.553 37.892 1.00 14.86 ? 386 ILE A CB  1 
ATOM   1948 C  CG1 . ILE A 1 244 ? 11.536  19.765 38.591 1.00 14.53 ? 386 ILE A CG1 1 
ATOM   1949 C  CG2 . ILE A 1 244 ? 11.393  18.441 36.550 1.00 15.24 ? 386 ILE A CG2 1 
ATOM   1950 C  CD1 . ILE A 1 244 ? 11.835  21.034 37.867 1.00 14.47 ? 386 ILE A CD1 1 
ATOM   1951 N  N   . ILE A 1 245 ? 14.109  16.676 39.678 1.00 15.36 ? 387 ILE A N   1 
ATOM   1952 C  CA  . ILE A 1 245 ? 15.129  16.507 40.715 1.00 15.33 ? 387 ILE A CA  1 
ATOM   1953 C  C   . ILE A 1 245 ? 16.487  16.645 40.069 1.00 15.65 ? 387 ILE A C   1 
ATOM   1954 O  O   . ILE A 1 245 ? 16.637  16.295 38.912 1.00 15.32 ? 387 ILE A O   1 
ATOM   1955 C  CB  . ILE A 1 245 ? 15.031  15.081 41.318 1.00 14.63 ? 387 ILE A CB  1 
ATOM   1956 C  CG1 . ILE A 1 245 ? 15.579  15.040 42.737 1.00 14.25 ? 387 ILE A CG1 1 
ATOM   1957 C  CG2 . ILE A 1 245 ? 15.792  14.080 40.485 1.00 14.62 ? 387 ILE A CG2 1 
ATOM   1958 C  CD1 . ILE A 1 245 ? 15.317  13.734 43.406 1.00 13.32 ? 387 ILE A CD1 1 
ATOM   1959 N  N   . PRO A 1 246 ? 17.475  17.219 40.778 1.00 16.47 ? 388 PRO A N   1 
ATOM   1960 C  CA  . PRO A 1 246 ? 18.812  17.357 40.193 1.00 16.90 ? 388 PRO A CA  1 
ATOM   1961 C  C   . PRO A 1 246 ? 19.269  15.989 39.708 1.00 17.47 ? 388 PRO A C   1 
ATOM   1962 O  O   . PRO A 1 246 ? 19.154  14.987 40.429 1.00 17.51 ? 388 PRO A O   1 
ATOM   1963 C  CB  . PRO A 1 246 ? 19.634  17.843 41.369 1.00 16.80 ? 388 PRO A CB  1 
ATOM   1964 C  CG  . PRO A 1 246 ? 18.680  18.767 42.029 1.00 16.76 ? 388 PRO A CG  1 
ATOM   1965 C  CD  . PRO A 1 246 ? 17.414  17.930 42.064 1.00 16.50 ? 388 PRO A CD  1 
ATOM   1966 N  N   . PHE A 1 247 ? 19.787  15.968 38.483 1.00 18.15 ? 389 PHE A N   1 
ATOM   1967 C  CA  . PHE A 1 247 ? 20.219  14.754 37.821 1.00 18.78 ? 389 PHE A CA  1 
ATOM   1968 C  C   . PHE A 1 247 ? 21.044  13.799 38.637 1.00 19.35 ? 389 PHE A C   1 
ATOM   1969 O  O   . PHE A 1 247 ? 20.883  12.596 38.515 1.00 19.06 ? 389 PHE A O   1 
ATOM   1970 C  CB  . PHE A 1 247 ? 20.958  15.091 36.537 1.00 19.06 ? 389 PHE A CB  1 
ATOM   1971 C  CG  . PHE A 1 247 ? 21.433  13.886 35.786 1.00 20.00 ? 389 PHE A CG  1 
ATOM   1972 C  CD1 . PHE A 1 247 ? 20.534  12.963 35.281 1.00 20.49 ? 389 PHE A CD1 1 
ATOM   1973 C  CD2 . PHE A 1 247 ? 22.790  13.658 35.595 1.00 20.53 ? 389 PHE A CD2 1 
ATOM   1974 C  CE1 . PHE A 1 247 ? 20.979  11.843 34.605 1.00 20.53 ? 389 PHE A CE1 1 
ATOM   1975 C  CE2 . PHE A 1 247 ? 23.236  12.536 34.918 1.00 20.11 ? 389 PHE A CE2 1 
ATOM   1976 C  CZ  . PHE A 1 247 ? 22.334  11.634 34.427 1.00 20.48 ? 389 PHE A CZ  1 
ATOM   1977 N  N   . ASN A 1 248 ? 21.925  14.323 39.472 1.00 20.19 ? 390 ASN A N   1 
ATOM   1978 C  CA  . ASN A 1 248 ? 22.792  13.466 40.279 1.00 21.37 ? 390 ASN A CA  1 
ATOM   1979 C  C   . ASN A 1 248 ? 22.073  12.590 41.290 1.00 22.24 ? 390 ASN A C   1 
ATOM   1980 O  O   . ASN A 1 248 ? 22.667  11.644 41.826 1.00 22.16 ? 390 ASN A O   1 
ATOM   1981 C  CB  . ASN A 1 248 ? 23.944  14.270 40.931 1.00 21.42 ? 390 ASN A CB  1 
ATOM   1982 C  CG  . ASN A 1 248 ? 23.499  15.165 42.093 1.00 21.80 ? 390 ASN A CG  1 
ATOM   1983 O  OD1 . ASN A 1 248 ? 23.969  15.006 43.222 1.00 22.35 ? 390 ASN A OD1 1 
ATOM   1984 N  ND2 . ASN A 1 248 ? 22.675  16.159 41.805 1.00 22.08 ? 390 ASN A ND2 1 
ATOM   1985 N  N   . ARG A 1 249 ? 20.794  12.881 41.534 1.00 23.29 ? 391 ARG A N   1 
ATOM   1986 C  CA  . ARG A 1 249 ? 20.014  12.094 42.479 1.00 24.60 ? 391 ARG A CA  1 
ATOM   1987 C  C   . ARG A 1 249 ? 19.544  10.790 41.855 1.00 25.28 ? 391 ARG A C   1 
ATOM   1988 O  O   . ARG A 1 249 ? 18.879  10.014 42.518 1.00 25.72 ? 391 ARG A O   1 
ATOM   1989 C  CB  . ARG A 1 249 ? 18.790  12.858 42.972 1.00 24.90 ? 391 ARG A CB  1 
ATOM   1990 C  CG  . ARG A 1 249 ? 19.052  14.226 43.583 1.00 26.09 ? 391 ARG A CG  1 
ATOM   1991 C  CD  . ARG A 1 249 ? 19.909  14.186 44.841 1.00 26.80 ? 391 ARG A CD  1 
ATOM   1992 N  NE  . ARG A 1 249 ? 19.446  13.205 45.826 1.00 27.93 ? 391 ARG A NE  1 
ATOM   1993 C  CZ  . ARG A 1 249 ? 20.052  12.963 46.992 1.00 28.59 ? 391 ARG A CZ  1 
ATOM   1994 N  NH1 . ARG A 1 249 ? 21.144  13.643 47.333 1.00 29.26 ? 391 ARG A NH1 1 
ATOM   1995 N  NH2 . ARG A 1 249 ? 19.611  11.995 47.795 1.00 28.85 ? 391 ARG A NH2 1 
ATOM   1996 N  N   . LEU A 1 250 ? 19.848  10.572 40.579 1.00 26.24 ? 392 LEU A N   1 
ATOM   1997 C  CA  . LEU A 1 250 ? 19.440  9.353  39.878 1.00 27.56 ? 392 LEU A CA  1 
ATOM   1998 C  C   . LEU A 1 250 ? 20.501  8.222  39.850 1.00 28.19 ? 392 LEU A C   1 
ATOM   1999 O  O   . LEU A 1 250 ? 20.117  7.032  40.042 1.00 28.57 ? 392 LEU A O   1 
ATOM   2000 C  CB  . LEU A 1 250 ? 19.004  9.673  38.436 1.00 27.76 ? 392 LEU A CB  1 
ATOM   2001 C  CG  . LEU A 1 250 ? 17.771  10.530 38.141 1.00 28.12 ? 392 LEU A CG  1 
ATOM   2002 C  CD1 . LEU A 1 250 ? 17.562  10.548 36.620 1.00 27.92 ? 392 LEU A CD1 1 
ATOM   2003 C  CD2 . LEU A 1 250 ? 16.538  9.987  38.864 1.00 28.00 ? 392 LEU A CD2 1 
ATOM   2004 N  N   . GLY B 2 1   ? -1.797  11.288 18.893 0.80 34.02 ? 2   GLY B N   1 
ATOM   2005 C  CA  . GLY B 2 1   ? -1.450  10.560 17.674 0.80 34.38 ? 2   GLY B CA  1 
ATOM   2006 C  C   . GLY B 2 1   ? -1.016  11.524 16.593 0.80 34.72 ? 2   GLY B C   1 
ATOM   2007 O  O   . GLY B 2 1   ? -0.753  12.704 16.888 0.80 34.22 ? 2   GLY B O   1 
ATOM   2008 N  N   . PRO B 2 2   ? -0.918  11.042 15.336 0.80 35.22 ? 3   PRO B N   1 
ATOM   2009 C  CA  . PRO B 2 2   ? -0.524  11.783 14.133 0.80 35.73 ? 3   PRO B CA  1 
ATOM   2010 C  C   . PRO B 2 2   ? -1.668  12.622 13.551 0.80 36.53 ? 3   PRO B C   1 
ATOM   2011 O  O   . PRO B 2 2   ? -2.724  12.780 14.179 0.80 36.51 ? 3   PRO B O   1 
ATOM   2012 C  CB  . PRO B 2 2   ? -0.139  10.657 13.181 0.80 35.57 ? 3   PRO B CB  1 
ATOM   2013 C  CG  . PRO B 2 2   ? -1.145  9.625  13.488 0.80 35.32 ? 3   PRO B CG  1 
ATOM   2014 C  CD  . PRO B 2 2   ? -1.152  9.626  15.007 0.80 35.29 ? 3   PRO B CD  1 
ATOM   2015 N  N   . ARG B 2 3   ? -1.454  13.136 12.339 0.80 37.32 ? 4   ARG B N   1 
ATOM   2016 C  CA  . ARG B 2 3   ? -2.427  13.960 11.617 0.80 38.14 ? 4   ARG B CA  1 
ATOM   2017 C  C   . ARG B 2 3   ? -2.236  13.673 10.112 0.80 39.25 ? 4   ARG B C   1 
ATOM   2018 O  O   . ARG B 2 3   ? -1.396  12.831 9.753  0.80 39.33 ? 4   ARG B O   1 
ATOM   2019 C  CB  . ARG B 2 3   ? -2.200  15.454 11.924 0.80 37.56 ? 4   ARG B CB  1 
ATOM   2020 C  CG  . ARG B 2 3   ? -2.747  15.953 13.267 0.80 36.72 ? 4   ARG B CG  1 
ATOM   2021 C  CD  . ARG B 2 3   ? -4.258  15.830 13.342 0.80 36.17 ? 4   ARG B CD  1 
ATOM   2022 N  NE  . ARG B 2 3   ? -4.839  16.548 14.476 0.80 35.68 ? 4   ARG B NE  1 
ATOM   2023 C  CZ  . ARG B 2 3   ? -4.938  16.056 15.710 0.80 35.42 ? 4   ARG B CZ  1 
ATOM   2024 N  NH1 . ARG B 2 3   ? -4.489  14.840 15.989 0.80 35.13 ? 4   ARG B NH1 1 
ATOM   2025 N  NH2 . ARG B 2 3   ? -5.518  16.771 16.665 0.80 34.99 ? 4   ARG B NH2 1 
ATOM   2026 N  N   . PRO B 2 4   ? -3.078  14.274 9.229  0.80 40.23 ? 5   PRO B N   1 
ATOM   2027 C  CA  . PRO B 2 4   ? -2.942  14.045 7.781  0.80 40.82 ? 5   PRO B CA  1 
ATOM   2028 C  C   . PRO B 2 4   ? -1.670  14.717 7.239  0.80 41.28 ? 5   PRO B C   1 
ATOM   2029 O  O   . PRO B 2 4   ? -0.847  14.019 6.591  0.80 41.33 ? 5   PRO B O   1 
ATOM   2030 C  CB  . PRO B 2 4   ? -4.201  14.715 7.201  0.80 40.82 ? 5   PRO B CB  1 
ATOM   2031 C  CG  . PRO B 2 4   ? -5.176  14.703 8.340  0.80 40.73 ? 5   PRO B CG  1 
ATOM   2032 C  CD  . PRO B 2 4   ? -4.292  15.069 9.504  0.80 40.52 ? 5   PRO B CD  1 
ATOM   2033 O  OXT . PRO B 2 4   ? -1.522  15.945 7.472  0.80 41.80 ? 5   PRO B OXT 1 
HETATM 2034 CA CA  . CA  C 3 .   ? -1.062  24.954 13.851 1.00 31.40 ? 412 CA  A CA  1 
HETATM 2035 O  O   . HOH D 4 .   ? 1.342   25.778 13.777 1.00 17.48 ? 413 HOH A O   1 
HETATM 2036 O  O   . HOH D 4 .   ? -1.642  26.937 12.494 1.00 37.76 ? 414 HOH A O   1 
HETATM 2037 O  O   . HOH D 4 .   ? -15.434 18.804 11.714 1.00 46.80 ? 415 HOH A O   1 
HETATM 2038 O  O   . HOH D 4 .   ? -14.799 1.220  21.044 1.00 42.33 ? 416 HOH A O   1 
HETATM 2039 O  O   . HOH D 4 .   ? -14.934 22.640 32.745 1.00 29.64 ? 417 HOH A O   1 
HETATM 2040 O  O   . HOH D 4 .   ? -7.191  5.333  14.741 1.00 23.63 ? 418 HOH A O   1 
HETATM 2041 O  O   . HOH D 4 .   ? -9.329  18.196 30.855 1.00 15.43 ? 419 HOH A O   1 
HETATM 2042 O  O   . HOH D 4 .   ? -11.407 23.448 36.167 1.00 9.53  ? 420 HOH A O   1 
HETATM 2043 O  O   . HOH D 4 .   ? -7.712  18.338 28.853 1.00 23.46 ? 421 HOH A O   1 
HETATM 2044 O  O   . HOH D 4 .   ? -4.019  28.114 13.866 1.00 50.74 ? 422 HOH A O   1 
HETATM 2045 O  O   . HOH D 4 .   ? -8.150  9.134  32.043 1.00 11.93 ? 423 HOH A O   1 
HETATM 2046 O  O   . HOH D 4 .   ? -8.290  16.377 35.219 1.00 14.02 ? 424 HOH A O   1 
HETATM 2047 O  O   . HOH D 4 .   ? -5.449  25.155 25.782 1.00 16.65 ? 425 HOH A O   1 
HETATM 2048 O  O   . HOH D 4 .   ? -8.122  18.364 42.479 1.00 15.95 ? 426 HOH A O   1 
HETATM 2049 O  O   . HOH D 4 .   ? -1.844  5.833  26.156 1.00 20.73 ? 427 HOH A O   1 
HETATM 2050 O  O   . HOH D 4 .   ? 1.783   29.077 28.651 1.00 11.97 ? 428 HOH A O   1 
HETATM 2051 O  O   . HOH D 4 .   ? 8.938   9.394  10.844 1.00 59.38 ? 429 HOH A O   1 
HETATM 2052 O  O   . HOH D 4 .   ? -1.343  17.062 44.787 1.00 12.70 ? 430 HOH A O   1 
HETATM 2053 O  O   . HOH D 4 .   ? 1.333   9.232  39.591 1.00 31.13 ? 431 HOH A O   1 
HETATM 2054 O  O   . HOH D 4 .   ? 6.193   23.303 18.489 1.00 24.06 ? 432 HOH A O   1 
HETATM 2055 O  O   . HOH D 4 .   ? -0.303  19.072 46.091 1.00 17.90 ? 433 HOH A O   1 
HETATM 2056 O  O   . HOH D 4 .   ? 2.782   28.047 43.685 1.00 18.12 ? 434 HOH A O   1 
HETATM 2057 O  O   . HOH D 4 .   ? 2.139   14.309 51.248 1.00 23.25 ? 435 HOH A O   1 
HETATM 2058 O  O   . HOH D 4 .   ? 4.027   22.066 43.384 1.00 16.50 ? 436 HOH A O   1 
HETATM 2059 O  O   . HOH D 4 .   ? 2.341   20.287 54.044 1.00 25.66 ? 437 HOH A O   1 
HETATM 2060 O  O   . HOH D 4 .   ? 12.148  13.898 19.865 1.00 40.29 ? 438 HOH A O   1 
HETATM 2061 O  O   . HOH D 4 .   ? 9.610   33.946 31.050 1.00 21.95 ? 439 HOH A O   1 
HETATM 2062 O  O   . HOH D 4 .   ? 9.007   35.858 36.185 1.00 32.09 ? 440 HOH A O   1 
HETATM 2063 O  O   . HOH D 4 .   ? 15.320  13.114 21.218 1.00 27.72 ? 441 HOH A O   1 
HETATM 2064 O  O   . HOH D 4 .   ? 15.244  25.825 23.896 1.00 37.84 ? 442 HOH A O   1 
HETATM 2065 O  O   . HOH D 4 .   ? 14.446  24.489 26.285 1.00 21.50 ? 443 HOH A O   1 
HETATM 2066 O  O   . HOH D 4 .   ? 13.901  18.844 43.085 1.00 9.24  ? 444 HOH A O   1 
HETATM 2067 O  O   . HOH D 4 .   ? 16.327  31.124 35.543 1.00 35.77 ? 445 HOH A O   1 
HETATM 2068 O  O   . HOH D 4 .   ? 18.280  20.952 33.422 1.00 14.59 ? 446 HOH A O   1 
HETATM 2069 O  O   . HOH D 4 .   ? -20.420 9.788  24.041 1.00 30.44 ? 447 HOH A O   1 
HETATM 2070 O  O   . HOH D 4 .   ? -19.207 11.734 22.778 1.00 46.18 ? 448 HOH A O   1 
HETATM 2071 O  O   . HOH D 4 .   ? -14.084 13.841 24.850 1.00 28.04 ? 449 HOH A O   1 
HETATM 2072 O  O   . HOH D 4 .   ? -10.506 16.120 31.942 1.00 17.63 ? 450 HOH A O   1 
HETATM 2073 O  O   . HOH D 4 .   ? -9.929  29.081 28.956 1.00 34.54 ? 451 HOH A O   1 
HETATM 2074 O  O   . HOH D 4 .   ? -8.150  34.667 30.221 1.00 41.61 ? 452 HOH A O   1 
HETATM 2075 O  O   . HOH D 4 .   ? -12.108 24.061 39.170 1.00 50.49 ? 453 HOH A O   1 
HETATM 2076 O  O   . HOH D 4 .   ? -0.750  36.323 25.840 1.00 36.28 ? 454 HOH A O   1 
HETATM 2077 O  O   . HOH D 4 .   ? -4.835  30.475 36.519 1.00 31.42 ? 455 HOH A O   1 
HETATM 2078 O  O   . HOH D 4 .   ? -7.252  14.474 50.930 1.00 33.60 ? 456 HOH A O   1 
HETATM 2079 O  O   . HOH D 4 .   ? -5.196  17.962 52.100 1.00 42.41 ? 457 HOH A O   1 
HETATM 2080 O  O   . HOH D 4 .   ? -4.851  28.451 45.016 1.00 41.60 ? 458 HOH A O   1 
HETATM 2081 O  O   . HOH D 4 .   ? -2.908  27.167 41.659 1.00 45.55 ? 459 HOH A O   1 
HETATM 2082 O  O   . HOH D 4 .   ? 1.638   36.858 27.864 1.00 39.21 ? 460 HOH A O   1 
HETATM 2083 O  O   . HOH D 4 .   ? -0.267  26.259 41.526 1.00 42.92 ? 461 HOH A O   1 
HETATM 2084 O  O   . HOH D 4 .   ? 5.671   30.672 17.299 1.00 41.01 ? 462 HOH A O   1 
HETATM 2085 O  O   . HOH D 4 .   ? 1.093   6.421  44.619 1.00 46.54 ? 463 HOH A O   1 
HETATM 2086 O  O   . HOH D 4 .   ? 9.812   11.550 7.502  1.00 35.94 ? 464 HOH A O   1 
HETATM 2087 O  O   . HOH D 4 .   ? 3.734   -3.714 37.137 1.00 31.91 ? 465 HOH A O   1 
HETATM 2088 O  O   . HOH D 4 .   ? 1.034   15.990 44.561 1.00 28.79 ? 466 HOH A O   1 
HETATM 2089 O  O   . HOH D 4 .   ? 10.417  15.880 15.005 1.00 52.89 ? 467 HOH A O   1 
HETATM 2090 O  O   . HOH D 4 .   ? 2.606   13.420 44.393 1.00 30.11 ? 468 HOH A O   1 
HETATM 2091 O  O   . HOH D 4 .   ? 13.027  36.399 20.950 1.00 39.48 ? 469 HOH A O   1 
HETATM 2092 O  O   . HOH D 4 .   ? 13.108  11.565 17.641 1.00 43.86 ? 470 HOH A O   1 
HETATM 2093 O  O   . HOH D 4 .   ? 8.892   35.536 41.160 1.00 43.67 ? 471 HOH A O   1 
HETATM 2094 O  O   . HOH D 4 .   ? 9.861   8.653  42.171 1.00 21.77 ? 472 HOH A O   1 
HETATM 2095 O  O   . HOH D 4 .   ? 17.643  22.900 21.875 1.00 43.37 ? 473 HOH A O   1 
HETATM 2096 O  O   . HOH D 4 .   ? 11.965  8.739  44.610 1.00 35.60 ? 474 HOH A O   1 
HETATM 2097 O  O   . HOH D 4 .   ? 20.318  24.133 31.696 1.00 31.22 ? 475 HOH A O   1 
HETATM 2098 O  O   . HOH D 4 .   ? 19.030  30.573 36.442 1.00 33.80 ? 476 HOH A O   1 
HETATM 2099 O  O   . HOH D 4 .   ? 22.392  17.095 39.220 1.00 55.49 ? 477 HOH A O   1 
HETATM 2100 O  O   . HOH D 4 .   ? 21.869  20.397 43.226 1.00 40.19 ? 478 HOH A O   1 
HETATM 2101 O  O   . HOH D 4 .   ? 23.189  26.784 43.301 1.00 46.96 ? 479 HOH A O   1 
HETATM 2102 O  O   . HOH D 4 .   ? -13.851 19.052 40.629 1.00 33.66 ? 480 HOH A O   1 
HETATM 2103 O  O   . HOH D 4 .   ? 5.231   -2.577 32.324 1.00 35.31 ? 481 HOH A O   1 
HETATM 2104 O  O   . HOH D 4 .   ? 16.342  29.252 28.537 1.00 37.65 ? 482 HOH A O   1 
HETATM 2105 O  O   . HOH D 4 .   ? 18.227  20.129 27.574 1.00 25.29 ? 483 HOH A O   1 
HETATM 2106 O  O   . HOH D 4 .   ? 28.429  15.870 44.298 1.00 31.20 ? 484 HOH A O   1 
HETATM 2107 O  O   . HOH D 4 .   ? 0.682   11.092 47.706 1.00 46.30 ? 485 HOH A O   1 
HETATM 2108 O  O   . HOH D 4 .   ? 3.276   12.216 47.304 1.00 38.48 ? 486 HOH A O   1 
HETATM 2109 O  O   . HOH D 4 .   ? 18.347  17.873 22.547 1.00 34.34 ? 487 HOH A O   1 
HETATM 2110 O  O   . HOH D 4 .   ? 15.366  22.439 20.124 1.00 42.61 ? 488 HOH A O   1 
HETATM 2111 O  O   . HOH D 4 .   ? 11.796  16.742 17.835 1.00 32.11 ? 489 HOH A O   1 
HETATM 2112 O  O   . HOH D 4 .   ? 13.501  39.289 37.734 1.00 25.89 ? 490 HOH A O   1 
HETATM 2113 O  O   . HOH D 4 .   ? -4.329  25.998 46.242 1.00 28.42 ? 491 HOH A O   1 
HETATM 2114 O  O   . HOH D 4 .   ? 5.875   26.616 58.722 1.00 41.81 ? 492 HOH A O   1 
HETATM 2115 O  O   . HOH D 4 .   ? 3.936   15.435 61.208 1.00 51.03 ? 493 HOH A O   1 
HETATM 2116 O  O   . HOH D 4 .   ? 3.846   16.639 65.707 1.00 51.97 ? 494 HOH A O   1 
HETATM 2117 O  O   . HOH D 4 .   ? 2.269   17.757 54.788 1.00 49.39 ? 495 HOH A O   1 
HETATM 2118 O  O   . HOH D 4 .   ? 0.917   19.526 62.851 1.00 43.75 ? 496 HOH A O   1 
HETATM 2119 O  O   . HOH D 4 .   ? -4.898  18.380 58.719 1.00 38.00 ? 497 HOH A O   1 
HETATM 2120 O  O   . HOH D 4 .   ? 15.846  35.676 43.696 1.00 52.06 ? 498 HOH A O   1 
HETATM 2121 O  O   . HOH D 4 .   ? 20.479  34.921 44.939 1.00 38.07 ? 499 HOH A O   1 
HETATM 2122 O  O   . HOH D 4 .   ? -9.900  23.170 47.712 1.00 48.59 ? 500 HOH A O   1 
HETATM 2123 O  O   . HOH D 4 .   ? -6.548  21.541 49.133 1.00 38.81 ? 501 HOH A O   1 
HETATM 2124 O  O   . HOH D 4 .   ? 3.512   20.720 8.799  1.00 31.34 ? 502 HOH A O   1 
HETATM 2125 O  O   . HOH D 4 .   ? -1.834  23.983 19.077 1.00 17.00 ? 503 HOH A O   1 
HETATM 2126 O  O   . HOH D 4 .   ? -17.463 18.741 20.539 1.00 44.77 ? 504 HOH A O   1 
HETATM 2127 O  O   . HOH D 4 .   ? -3.218  26.752 48.511 1.00 42.73 ? 505 HOH A O   1 
HETATM 2128 O  O   . HOH D 4 .   ? 8.409   9.241  45.707 1.00 42.94 ? 506 HOH A O   1 
HETATM 2129 O  O   . HOH D 4 .   ? 12.210  -4.608 30.087 1.00 29.83 ? 507 HOH A O   1 
HETATM 2130 O  O   . HOH D 4 .   ? 12.780  42.962 37.972 1.00 61.05 ? 508 HOH A O   1 
HETATM 2131 O  O   . HOH D 4 .   ? -0.450  22.770 63.033 1.00 42.39 ? 509 HOH A O   1 
HETATM 2132 O  O   . HOH D 4 .   ? -2.184  19.171 60.153 1.00 31.62 ? 510 HOH A O   1 
HETATM 2133 O  O   . HOH D 4 .   ? -5.491  21.309 54.606 1.00 44.15 ? 511 HOH A O   1 
HETATM 2134 O  O   . HOH D 4 .   ? 4.633   12.256 61.035 1.00 47.20 ? 512 HOH A O   1 
HETATM 2135 O  O   . HOH D 4 .   ? -10.668 4.935  9.146  1.00 37.74 ? 513 HOH A O   1 
HETATM 2136 O  O   . HOH D 4 .   ? -5.255  4.012  12.831 1.00 40.57 ? 514 HOH A O   1 
HETATM 2137 O  O   . HOH D 4 .   ? 15.581  28.606 18.695 1.00 35.20 ? 515 HOH A O   1 
HETATM 2138 O  O   . HOH D 4 .   ? 15.930  25.781 18.239 1.00 34.69 ? 516 HOH A O   1 
HETATM 2139 O  O   . HOH D 4 .   ? 16.118  19.006 17.052 1.00 54.30 ? 517 HOH A O   1 
HETATM 2140 O  O   . HOH D 4 .   ? 24.633  9.771  38.500 1.00 23.76 ? 518 HOH A O   1 
HETATM 2141 O  O   . HOH D 4 .   ? 20.055  20.960 31.608 1.00 24.73 ? 519 HOH A O   1 
HETATM 2142 O  O   . HOH D 4 .   ? 4.916   24.915 10.783 1.00 32.72 ? 520 HOH A O   1 
HETATM 2143 O  O   . HOH D 4 .   ? -7.231  12.714 15.861 1.00 46.58 ? 521 HOH A O   1 
HETATM 2144 O  O   . HOH D 4 .   ? -12.642 21.397 23.529 1.00 60.22 ? 522 HOH A O   1 
HETATM 2145 O  O   . HOH D 4 .   ? -14.756 16.220 20.233 1.00 42.37 ? 523 HOH A O   1 
HETATM 2146 O  O   . HOH D 4 .   ? -6.171  6.634  8.907  1.00 50.11 ? 524 HOH A O   1 
HETATM 2147 O  O   . HOH D 4 .   ? 6.219   10.885 50.399 1.00 41.79 ? 525 HOH A O   1 
HETATM 2148 O  O   . HOH D 4 .   ? 11.895  30.845 49.609 1.00 40.30 ? 526 HOH A O   1 
HETATM 2149 O  O   . HOH E 4 .   ? -2.185  14.942 3.926  1.00 61.14 ? 440 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   143 143 VAL VAL A . n 
A 1 2   GLN 2   144 144 GLN GLN A . n 
A 1 3   ILE 3   145 145 ILE ILE A . n 
A 1 4   HIS 4   146 146 HIS HIS A . n 
A 1 5   ASP 5   147 147 ASP ASP A . n 
A 1 6   ILE 6   148 148 ILE ILE A . n 
A 1 7   THR 7   149 149 THR THR A . n 
A 1 8   GLY 8   150 150 GLY GLY A . n 
A 1 9   LYS 9   151 151 LYS LYS A . n 
A 1 10  ASP 10  152 152 ASP ASP A . n 
A 1 11  CYS 11  153 153 CYS CYS A . n 
A 1 12  GLN 12  154 154 GLN GLN A . n 
A 1 13  ASP 13  155 155 ASP ASP A . n 
A 1 14  ILE 14  156 156 ILE ILE A . n 
A 1 15  ALA 15  157 157 ALA ALA A . n 
A 1 16  ASN 16  158 158 ASN ASN A . n 
A 1 17  LYS 17  159 159 LYS LYS A . n 
A 1 18  GLY 18  160 160 GLY GLY A . n 
A 1 19  ALA 19  161 161 ALA ALA A . n 
A 1 20  LYS 20  162 162 LYS LYS A . n 
A 1 21  GLN 21  163 163 GLN GLN A . n 
A 1 22  SER 22  164 164 SER SER A . n 
A 1 23  GLY 23  165 165 GLY GLY A . n 
A 1 24  LEU 24  166 166 LEU LEU A . n 
A 1 25  TYR 25  167 167 TYR TYR A . n 
A 1 26  PHE 26  168 168 PHE PHE A . n 
A 1 27  ILE 27  169 169 ILE ILE A . n 
A 1 28  LYS 28  170 170 LYS LYS A . n 
A 1 29  PRO 29  171 171 PRO PRO A . n 
A 1 30  LEU 30  172 172 LEU LEU A . n 
A 1 31  LYS 31  173 173 LYS LYS A . n 
A 1 32  ALA 32  174 174 ALA ALA A . n 
A 1 33  ASN 33  175 175 ASN ASN A . n 
A 1 34  GLN 34  176 176 GLN GLN A . n 
A 1 35  GLN 35  177 177 GLN GLN A . n 
A 1 36  PHE 36  178 178 PHE PHE A . n 
A 1 37  LEU 37  179 179 LEU LEU A . n 
A 1 38  VAL 38  180 180 VAL VAL A . n 
A 1 39  TYR 39  181 181 TYR TYR A . n 
A 1 40  CYS 40  182 182 CYS CYS A . n 
A 1 41  GLU 41  183 183 GLU GLU A . n 
A 1 42  ILE 42  184 184 ILE ILE A . n 
A 1 43  ASP 43  185 185 ASP ASP A . n 
A 1 44  GLY 44  186 186 GLY GLY A . n 
A 1 45  SER 45  187 187 SER SER A . n 
A 1 46  GLY 46  188 188 GLY GLY A . n 
A 1 47  ASN 47  189 189 ASN ASN A . n 
A 1 48  GLY 48  190 190 GLY GLY A . n 
A 1 49  TRP 49  191 191 TRP TRP A . n 
A 1 50  THR 50  192 192 THR THR A . n 
A 1 51  VAL 51  193 193 VAL VAL A . n 
A 1 52  PHE 52  194 194 PHE PHE A . n 
A 1 53  GLN 53  195 195 GLN GLN A . n 
A 1 54  LYS 54  196 196 LYS LYS A . n 
A 1 55  ARG 55  197 197 ARG ARG A . n 
A 1 56  LEU 56  198 198 LEU LEU A . n 
A 1 57  ASP 57  199 199 ASP ASP A . n 
A 1 58  GLY 58  200 200 GLY GLY A . n 
A 1 59  SER 59  201 201 SER SER A . n 
A 1 60  VAL 60  202 202 VAL VAL A . n 
A 1 61  ASP 61  203 203 ASP ASP A . n 
A 1 62  PHE 62  204 204 PHE PHE A . n 
A 1 63  LYS 63  205 205 LYS LYS A . n 
A 1 64  LYS 64  206 206 LYS LYS A . n 
A 1 65  ASN 65  207 207 ASN ASN A . n 
A 1 66  TRP 66  208 208 TRP TRP A . n 
A 1 67  ILE 67  209 209 ILE ILE A . n 
A 1 68  GLN 68  210 210 GLN GLN A . n 
A 1 69  TYR 69  211 211 TYR TYR A . n 
A 1 70  LYS 70  212 212 LYS LYS A . n 
A 1 71  GLU 71  213 213 GLU GLU A . n 
A 1 72  GLY 72  214 214 GLY GLY A . n 
A 1 73  PHE 73  215 215 PHE PHE A . n 
A 1 74  GLY 74  216 216 GLY GLY A . n 
A 1 75  HIS 75  217 217 HIS HIS A . n 
A 1 76  LEU 76  218 218 LEU LEU A . n 
A 1 77  SER 77  219 219 SER SER A . n 
A 1 78  PRO 78  220 220 PRO PRO A . n 
A 1 79  THR 79  221 221 THR THR A . n 
A 1 80  GLY 80  222 222 GLY GLY A . n 
A 1 81  THR 81  223 223 THR THR A . n 
A 1 82  THR 82  224 224 THR THR A . n 
A 1 83  GLU 83  225 225 GLU GLU A . n 
A 1 84  PHE 84  226 226 PHE PHE A . n 
A 1 85  TRP 85  227 227 TRP TRP A . n 
A 1 86  LEU 86  228 228 LEU LEU A . n 
A 1 87  GLY 87  229 229 GLY GLY A . n 
A 1 88  ASN 88  230 230 ASN ASN A . n 
A 1 89  GLU 89  231 231 GLU GLU A . n 
A 1 90  LYS 90  232 232 LYS LYS A . n 
A 1 91  ILE 91  233 233 ILE ILE A . n 
A 1 92  HIS 92  234 234 HIS HIS A . n 
A 1 93  LEU 93  235 235 LEU LEU A . n 
A 1 94  ILE 94  236 236 ILE ILE A . n 
A 1 95  SER 95  237 237 SER SER A . n 
A 1 96  THR 96  238 238 THR THR A . n 
A 1 97  GLN 97  239 239 GLN GLN A . n 
A 1 98  SER 98  240 240 SER SER A . n 
A 1 99  ALA 99  241 241 ALA ALA A . n 
A 1 100 ILE 100 242 242 ILE ILE A . n 
A 1 101 PRO 101 243 243 PRO PRO A . n 
A 1 102 TYR 102 244 244 TYR TYR A . n 
A 1 103 ALA 103 245 245 ALA ALA A . n 
A 1 104 LEU 104 246 246 LEU LEU A . n 
A 1 105 ARG 105 247 247 ARG ARG A . n 
A 1 106 VAL 106 248 248 VAL VAL A . n 
A 1 107 GLU 107 249 249 GLU GLU A . n 
A 1 108 LEU 108 250 250 LEU LEU A . n 
A 1 109 GLU 109 251 251 GLU GLU A . n 
A 1 110 ASP 110 252 252 ASP ASP A . n 
A 1 111 TRP 111 253 253 TRP TRP A . n 
A 1 112 ASN 112 254 254 ASN ASN A . n 
A 1 113 GLY 113 255 255 GLY GLY A . n 
A 1 114 ARG 114 256 256 ARG ARG A . n 
A 1 115 THR 115 257 257 THR THR A . n 
A 1 116 SER 116 258 258 SER SER A . n 
A 1 117 THR 117 259 259 THR THR A . n 
A 1 118 ALA 118 260 260 ALA ALA A . n 
A 1 119 ASP 119 261 261 ASP ASP A . n 
A 1 120 TYR 120 262 262 TYR TYR A . n 
A 1 121 ALA 121 263 263 ALA ALA A . n 
A 1 122 MET 122 264 264 MET MET A . n 
A 1 123 PHE 123 265 265 PHE PHE A . n 
A 1 124 LYS 124 266 266 LYS LYS A . n 
A 1 125 VAL 125 267 267 VAL VAL A . n 
A 1 126 GLY 126 268 268 GLY GLY A . n 
A 1 127 PRO 127 269 269 PRO PRO A . n 
A 1 128 GLU 128 270 270 GLU GLU A . n 
A 1 129 ALA 129 271 271 ALA ALA A . n 
A 1 130 ASP 130 272 272 ASP ASP A . n 
A 1 131 LYS 131 273 273 LYS LYS A . n 
A 1 132 TYR 132 274 274 TYR TYR A . n 
A 1 133 ARG 133 275 275 ARG ARG A . n 
A 1 134 LEU 134 276 276 LEU LEU A . n 
A 1 135 THR 135 277 277 THR THR A . n 
A 1 136 TYR 136 278 278 TYR TYR A . n 
A 1 137 ALA 137 279 279 ALA ALA A . n 
A 1 138 TYR 138 280 280 TYR TYR A . n 
A 1 139 PHE 139 281 281 PHE PHE A . n 
A 1 140 ALA 140 282 282 ALA ALA A . n 
A 1 141 GLY 141 283 283 GLY GLY A . n 
A 1 142 GLY 142 284 284 GLY GLY A . n 
A 1 143 ASP 143 285 285 ASP ASP A . n 
A 1 144 ALA 144 286 286 ALA ALA A . n 
A 1 145 GLY 145 287 287 GLY GLY A . n 
A 1 146 ASP 146 288 288 ASP ASP A . n 
A 1 147 ALA 147 289 289 ALA ALA A . n 
A 1 148 PHE 148 290 290 PHE PHE A . n 
A 1 149 ASP 149 291 291 ASP ASP A . n 
A 1 150 GLY 150 292 292 GLY GLY A . n 
A 1 151 PHE 151 293 293 PHE PHE A . n 
A 1 152 ASP 152 294 294 ASP ASP A . n 
A 1 153 PHE 153 295 295 PHE PHE A . n 
A 1 154 GLY 154 296 296 GLY GLY A . n 
A 1 155 ASP 155 297 297 ASP ASP A . n 
A 1 156 ASP 156 298 298 ASP ASP A . n 
A 1 157 PRO 157 299 299 PRO PRO A . n 
A 1 158 SER 158 300 300 SER SER A . n 
A 1 159 ASP 159 301 301 ASP ASP A . n 
A 1 160 LYS 160 302 302 LYS LYS A . n 
A 1 161 PHE 161 303 303 PHE PHE A . n 
A 1 162 PHE 162 304 304 PHE PHE A . n 
A 1 163 THR 163 305 305 THR THR A . n 
A 1 164 SER 164 306 306 SER SER A . n 
A 1 165 HIS 165 307 307 HIS HIS A . n 
A 1 166 ASN 166 308 308 ASN ASN A . n 
A 1 167 GLY 167 309 309 GLY GLY A . n 
A 1 168 MET 168 310 310 MET MET A . n 
A 1 169 GLN 169 311 311 GLN GLN A . n 
A 1 170 PHE 170 312 312 PHE PHE A . n 
A 1 171 SER 171 313 313 SER SER A . n 
A 1 172 THR 172 314 314 THR THR A . n 
A 1 173 TRP 173 315 315 TRP TRP A . n 
A 1 174 ASP 174 316 316 ASP ASP A . n 
A 1 175 ASN 175 317 317 ASN ASN A . n 
A 1 176 ASP 176 318 318 ASP ASP A . n 
A 1 177 ASN 177 319 319 ASN ASN A . n 
A 1 178 ASP 178 320 320 ASP ASP A . n 
A 1 179 LYS 179 321 321 LYS LYS A . n 
A 1 180 PHE 180 322 322 PHE PHE A . n 
A 1 181 GLU 181 323 323 GLU GLU A . n 
A 1 182 GLY 182 324 324 GLY GLY A . n 
A 1 183 ASN 183 325 325 ASN ASN A . n 
A 1 184 CYS 184 326 326 CYS CYS A . n 
A 1 185 ALA 185 327 327 ALA ALA A . n 
A 1 186 GLU 186 328 328 GLU GLU A . n 
A 1 187 GLN 187 329 329 GLN GLN A . n 
A 1 188 ASP 188 330 330 ASP ASP A . n 
A 1 189 GLY 189 331 331 GLY GLY A . n 
A 1 190 SER 190 332 332 SER SER A . n 
A 1 191 GLY 191 333 333 GLY GLY A . n 
A 1 192 TRP 192 334 334 TRP TRP A . n 
A 1 193 TRP 193 335 335 TRP TRP A . n 
A 1 194 MET 194 336 336 MET MET A . n 
A 1 195 ASN 195 337 337 ASN ASN A . n 
A 1 196 LYS 196 338 338 LYS LYS A . n 
A 1 197 CYS 197 339 339 CYS CYS A . n 
A 1 198 HIS 198 340 340 HIS HIS A . n 
A 1 199 ALA 199 341 341 ALA ALA A . n 
A 1 200 GLY 200 342 342 GLY GLY A . n 
A 1 201 HIS 201 343 343 HIS HIS A . n 
A 1 202 LEU 202 344 344 LEU LEU A . n 
A 1 203 ASN 203 345 345 ASN ASN A . n 
A 1 204 GLY 204 346 346 GLY GLY A . n 
A 1 205 VAL 205 347 347 VAL VAL A . n 
A 1 206 TYR 206 348 348 TYR TYR A . n 
A 1 207 TYR 207 349 349 TYR TYR A . n 
A 1 208 GLN 208 350 350 GLN GLN A . n 
A 1 209 GLY 209 351 351 GLY GLY A . n 
A 1 210 GLY 210 352 352 GLY GLY A . n 
A 1 211 THR 211 353 353 THR THR A . n 
A 1 212 TYR 212 354 354 TYR TYR A . n 
A 1 213 SER 213 355 355 SER SER A . n 
A 1 214 LYS 214 356 356 LYS LYS A . n 
A 1 215 ALA 215 357 357 ALA ALA A . n 
A 1 216 SER 216 358 358 SER SER A . n 
A 1 217 THR 217 359 359 THR THR A . n 
A 1 218 PRO 218 360 360 PRO PRO A . n 
A 1 219 ASN 219 361 361 ASN ASN A . n 
A 1 220 GLY 220 362 362 GLY GLY A . n 
A 1 221 TYR 221 363 363 TYR TYR A . n 
A 1 222 ASP 222 364 364 ASP ASP A . n 
A 1 223 ASN 223 365 365 ASN ASN A . n 
A 1 224 GLY 224 366 366 GLY GLY A . n 
A 1 225 ILE 225 367 367 ILE ILE A . n 
A 1 226 ILE 226 368 368 ILE ILE A . n 
A 1 227 TRP 227 369 369 TRP TRP A . n 
A 1 228 ALA 228 370 370 ALA ALA A . n 
A 1 229 THR 229 371 371 THR THR A . n 
A 1 230 TRP 230 372 372 TRP TRP A . n 
A 1 231 LYS 231 373 373 LYS LYS A . n 
A 1 232 THR 232 374 374 THR THR A . n 
A 1 233 ARG 233 375 375 ARG ARG A . n 
A 1 234 TRP 234 376 376 TRP TRP A . n 
A 1 235 TYR 235 377 377 TYR TYR A . n 
A 1 236 SER 236 378 378 SER SER A . n 
A 1 237 MET 237 379 379 MET MET A . n 
A 1 238 LYS 238 380 380 LYS LYS A . n 
A 1 239 LYS 239 381 381 LYS LYS A . n 
A 1 240 THR 240 382 382 THR THR A . n 
A 1 241 THR 241 383 383 THR THR A . n 
A 1 242 MET 242 384 384 MET MET A . n 
A 1 243 LYS 243 385 385 LYS LYS A . n 
A 1 244 ILE 244 386 386 ILE ILE A . n 
A 1 245 ILE 245 387 387 ILE ILE A . n 
A 1 246 PRO 246 388 388 PRO PRO A . n 
A 1 247 PHE 247 389 389 PHE PHE A . n 
A 1 248 ASN 248 390 390 ASN ASN A . n 
A 1 249 ARG 249 391 391 ARG ARG A . n 
A 1 250 LEU 250 392 392 LEU LEU A . n 
A 1 251 THR 251 393 ?   ?   ?   A . n 
A 1 252 ILE 252 394 ?   ?   ?   A . n 
A 1 253 GLY 253 395 ?   ?   ?   A . n 
A 1 254 GLU 254 396 ?   ?   ?   A . n 
A 1 255 GLY 255 397 ?   ?   ?   A . n 
A 1 256 GLN 256 398 ?   ?   ?   A . n 
A 1 257 GLN 257 399 ?   ?   ?   A . n 
A 1 258 HIS 258 400 ?   ?   ?   A . n 
A 1 259 HIS 259 401 ?   ?   ?   A . n 
A 1 260 LEU 260 402 ?   ?   ?   A . n 
A 1 261 GLY 261 403 ?   ?   ?   A . n 
A 1 262 GLY 262 404 ?   ?   ?   A . n 
A 1 263 ALA 263 405 ?   ?   ?   A . n 
A 1 264 LYS 264 406 ?   ?   ?   A . n 
A 1 265 GLN 265 407 ?   ?   ?   A . n 
A 1 266 ALA 266 408 ?   ?   ?   A . n 
A 1 267 GLY 267 409 ?   ?   ?   A . n 
A 1 268 ASP 268 410 ?   ?   ?   A . n 
A 1 269 VAL 269 411 ?   ?   ?   A . n 
B 2 1   GLY 1   2   2   GLY GLY B . n 
B 2 2   PRO 2   3   3   PRO PRO B . n 
B 2 3   ARG 3   4   4   ARG ARG B . n 
B 2 4   PRO 4   5   5   PRO PRO B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 770   ? 
1 MORE         -13   ? 
1 'SSA (A^2)'  10460 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A PHE 180 ? A PHE 322 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? A GLY 182 ? A GLY 324 ? 1_555 80.5  ? 
2  O   ? A PHE 180 ? A PHE 322 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD2 ? A ASP 176 ? A ASP 318 ? 1_555 161.0 ? 
3  O   ? A GLY 182 ? A GLY 324 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD2 ? A ASP 176 ? A ASP 318 ? 1_555 81.2  ? 
4  O   ? A PHE 180 ? A PHE 322 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD1 ? A ASP 178 ? A ASP 320 ? 1_555 75.7  ? 
5  O   ? A GLY 182 ? A GLY 324 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD1 ? A ASP 178 ? A ASP 320 ? 1_555 101.6 ? 
6  OD2 ? A ASP 176 ? A ASP 318 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD1 ? A ASP 178 ? A ASP 320 ? 1_555 103.1 ? 
7  O   ? A PHE 180 ? A PHE 322 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 414 ? 1_555 107.4 ? 
8  O   ? A GLY 182 ? A GLY 324 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 414 ? 1_555 100.4 ? 
9  OD2 ? A ASP 176 ? A ASP 318 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 414 ? 1_555 81.0  ? 
10 OD1 ? A ASP 178 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 414 ? 1_555 158.0 ? 
11 O   ? A PHE 180 ? A PHE 322 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD1 ? A ASP 176 ? A ASP 318 ? 1_555 137.9 ? 
12 O   ? A GLY 182 ? A GLY 324 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD1 ? A ASP 176 ? A ASP 318 ? 1_555 109.1 ? 
13 OD2 ? A ASP 176 ? A ASP 318 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD1 ? A ASP 176 ? A ASP 318 ? 1_555 46.1  ? 
14 OD1 ? A ASP 178 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD1 ? A ASP 176 ? A ASP 318 ? 1_555 62.3  ? 
15 O   ? D HOH .   ? A HOH 414 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 OD1 ? A ASP 176 ? A ASP 318 ? 1_555 110.7 ? 
16 O   ? A PHE 180 ? A PHE 322 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 89.6  ? 
17 O   ? A GLY 182 ? A GLY 324 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 169.1 ? 
18 OD2 ? A ASP 176 ? A ASP 318 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 108.1 ? 
19 OD1 ? A ASP 178 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 71.3  ? 
20 O   ? D HOH .   ? A HOH 414 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 86.9  ? 
21 OD1 ? A ASP 176 ? A ASP 318 ? 1_555 CA ? C CA . ? A CA 412 ? 1_555 O   ? D HOH .   ? A HOH 413 ? 1_555 75.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-10-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
RIGAKU   'data collection' SOFTWARE ? 1 
RIGAKU   'data reduction'  SOFTWARE ? 2 
X-PLOR   'model building'  3.1      ? 3 
XTALVIEW refinement        .        ? 4 
X-PLOR   refinement        3.1      ? 5 
RIGAKU   'data scaling'    .        ? 6 
X-PLOR   phasing           3.1      ? 7 
# 
_pdbx_entry_details.entry_id             2FIB 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;NO DENSITY FOR RESIDUES BEYOND LEU 392 WAS OBSERVED.
MASS SPECTROMETRY SHOWED HETEROGENEITY AT THE C-TERMINUS.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 144 ? ? -167.07 80.26   
2  1 LEU A 198 ? ? -157.00 -18.44  
3  1 ASP A 199 ? ? -152.07 -1.40   
4  1 ASP A 288 ? ? -101.99 79.29   
5  1 ASN A 317 ? ? -164.82 79.49   
6  1 ASN A 337 ? ? -112.52 -97.35  
7  1 LYS A 338 ? ? -157.46 63.21   
8  1 SER A 358 ? ? -56.60  -5.27   
9  1 PRO A 360 ? ? -38.92  -37.62  
10 1 ASN A 361 ? ? -98.91  34.39   
11 1 PRO B 3   ? ? -79.85  -168.90 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A THR 393 ? A THR 251 
2  1 Y 1 A ILE 394 ? A ILE 252 
3  1 Y 1 A GLY 395 ? A GLY 253 
4  1 Y 1 A GLU 396 ? A GLU 254 
5  1 Y 1 A GLY 397 ? A GLY 255 
6  1 Y 1 A GLN 398 ? A GLN 256 
7  1 Y 1 A GLN 399 ? A GLN 257 
8  1 Y 1 A HIS 400 ? A HIS 258 
9  1 Y 1 A HIS 401 ? A HIS 259 
10 1 Y 1 A LEU 402 ? A LEU 260 
11 1 Y 1 A GLY 403 ? A GLY 261 
12 1 Y 1 A GLY 404 ? A GLY 262 
13 1 Y 1 A ALA 405 ? A ALA 263 
14 1 Y 1 A LYS 406 ? A LYS 264 
15 1 Y 1 A GLN 407 ? A GLN 265 
16 1 Y 1 A ALA 408 ? A ALA 266 
17 1 Y 1 A GLY 409 ? A GLY 267 
18 1 Y 1 A ASP 410 ? A ASP 268 
19 1 Y 1 A VAL 411 ? A VAL 269 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CALCIUM ION' CA  
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CA  1   412 400 CA  CA  A . 
D 4 HOH 1   413 401 HOH HOH A . 
D 4 HOH 2   414 402 HOH HOH A . 
D 4 HOH 3   415 403 HOH HOH A . 
D 4 HOH 4   416 404 HOH HOH A . 
D 4 HOH 5   417 405 HOH HOH A . 
D 4 HOH 6   418 406 HOH HOH A . 
D 4 HOH 7   419 407 HOH HOH A . 
D 4 HOH 8   420 408 HOH HOH A . 
D 4 HOH 9   421 409 HOH HOH A . 
D 4 HOH 10  422 410 HOH HOH A . 
D 4 HOH 11  423 411 HOH HOH A . 
D 4 HOH 12  424 412 HOH HOH A . 
D 4 HOH 13  425 413 HOH HOH A . 
D 4 HOH 14  426 414 HOH HOH A . 
D 4 HOH 15  427 415 HOH HOH A . 
D 4 HOH 16  428 416 HOH HOH A . 
D 4 HOH 17  429 417 HOH HOH A . 
D 4 HOH 18  430 418 HOH HOH A . 
D 4 HOH 19  431 419 HOH HOH A . 
D 4 HOH 20  432 420 HOH HOH A . 
D 4 HOH 21  433 421 HOH HOH A . 
D 4 HOH 22  434 422 HOH HOH A . 
D 4 HOH 23  435 423 HOH HOH A . 
D 4 HOH 24  436 424 HOH HOH A . 
D 4 HOH 25  437 425 HOH HOH A . 
D 4 HOH 26  438 426 HOH HOH A . 
D 4 HOH 27  439 427 HOH HOH A . 
D 4 HOH 28  440 428 HOH HOH A . 
D 4 HOH 29  441 429 HOH HOH A . 
D 4 HOH 30  442 430 HOH HOH A . 
D 4 HOH 31  443 431 HOH HOH A . 
D 4 HOH 32  444 432 HOH HOH A . 
D 4 HOH 33  445 433 HOH HOH A . 
D 4 HOH 34  446 434 HOH HOH A . 
D 4 HOH 35  447 435 HOH HOH A . 
D 4 HOH 36  448 436 HOH HOH A . 
D 4 HOH 37  449 437 HOH HOH A . 
D 4 HOH 38  450 438 HOH HOH A . 
D 4 HOH 39  451 439 HOH HOH A . 
D 4 HOH 40  452 441 HOH HOH A . 
D 4 HOH 41  453 442 HOH HOH A . 
D 4 HOH 42  454 443 HOH HOH A . 
D 4 HOH 43  455 444 HOH HOH A . 
D 4 HOH 44  456 445 HOH HOH A . 
D 4 HOH 45  457 446 HOH HOH A . 
D 4 HOH 46  458 447 HOH HOH A . 
D 4 HOH 47  459 448 HOH HOH A . 
D 4 HOH 48  460 449 HOH HOH A . 
D 4 HOH 49  461 450 HOH HOH A . 
D 4 HOH 50  462 451 HOH HOH A . 
D 4 HOH 51  463 452 HOH HOH A . 
D 4 HOH 52  464 453 HOH HOH A . 
D 4 HOH 53  465 454 HOH HOH A . 
D 4 HOH 54  466 455 HOH HOH A . 
D 4 HOH 55  467 456 HOH HOH A . 
D 4 HOH 56  468 457 HOH HOH A . 
D 4 HOH 57  469 458 HOH HOH A . 
D 4 HOH 58  470 459 HOH HOH A . 
D 4 HOH 59  471 460 HOH HOH A . 
D 4 HOH 60  472 461 HOH HOH A . 
D 4 HOH 61  473 462 HOH HOH A . 
D 4 HOH 62  474 463 HOH HOH A . 
D 4 HOH 63  475 464 HOH HOH A . 
D 4 HOH 64  476 465 HOH HOH A . 
D 4 HOH 65  477 466 HOH HOH A . 
D 4 HOH 66  478 467 HOH HOH A . 
D 4 HOH 67  479 468 HOH HOH A . 
D 4 HOH 68  480 469 HOH HOH A . 
D 4 HOH 69  481 470 HOH HOH A . 
D 4 HOH 70  482 471 HOH HOH A . 
D 4 HOH 71  483 472 HOH HOH A . 
D 4 HOH 72  484 473 HOH HOH A . 
D 4 HOH 73  485 474 HOH HOH A . 
D 4 HOH 74  486 475 HOH HOH A . 
D 4 HOH 75  487 476 HOH HOH A . 
D 4 HOH 76  488 477 HOH HOH A . 
D 4 HOH 77  489 478 HOH HOH A . 
D 4 HOH 78  490 479 HOH HOH A . 
D 4 HOH 79  491 480 HOH HOH A . 
D 4 HOH 80  492 481 HOH HOH A . 
D 4 HOH 81  493 482 HOH HOH A . 
D 4 HOH 82  494 483 HOH HOH A . 
D 4 HOH 83  495 484 HOH HOH A . 
D 4 HOH 84  496 485 HOH HOH A . 
D 4 HOH 85  497 486 HOH HOH A . 
D 4 HOH 86  498 487 HOH HOH A . 
D 4 HOH 87  499 488 HOH HOH A . 
D 4 HOH 88  500 489 HOH HOH A . 
D 4 HOH 89  501 490 HOH HOH A . 
D 4 HOH 90  502 491 HOH HOH A . 
D 4 HOH 91  503 492 HOH HOH A . 
D 4 HOH 92  504 493 HOH HOH A . 
D 4 HOH 93  505 494 HOH HOH A . 
D 4 HOH 94  506 495 HOH HOH A . 
D 4 HOH 95  507 496 HOH HOH A . 
D 4 HOH 96  508 497 HOH HOH A . 
D 4 HOH 97  509 498 HOH HOH A . 
D 4 HOH 98  510 499 HOH HOH A . 
D 4 HOH 99  511 500 HOH HOH A . 
D 4 HOH 100 512 501 HOH HOH A . 
D 4 HOH 101 513 502 HOH HOH A . 
D 4 HOH 102 514 503 HOH HOH A . 
D 4 HOH 103 515 504 HOH HOH A . 
D 4 HOH 104 516 505 HOH HOH A . 
D 4 HOH 105 517 506 HOH HOH A . 
D 4 HOH 106 518 507 HOH HOH A . 
D 4 HOH 107 519 508 HOH HOH A . 
D 4 HOH 108 520 509 HOH HOH A . 
D 4 HOH 109 521 510 HOH HOH A . 
D 4 HOH 110 522 511 HOH HOH A . 
D 4 HOH 111 523 512 HOH HOH A . 
D 4 HOH 112 524 513 HOH HOH A . 
D 4 HOH 113 525 514 HOH HOH A . 
D 4 HOH 114 526 515 HOH HOH A . 
E 4 HOH 1   440 440 HOH HOH B . 
#