data_2FIN
# 
_entry.id   2FIN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FIN         
RCSB  RCSB035922   
WWPDB D_1000035922 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2FFK 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FIN 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Zhang, L.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            103 
_citation.page_first                13985 
_citation.page_last                 13990 
_citation.year                      2006 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16963564 
_citation.pdbx_database_id_DOI      10.1073/pnas.0602142103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, L.'       1 
primary 'Derider, M.'     2 
primary 'McCornack, M.A.' 3 
primary 'Jao, S.C.'       4 
primary 'Isern, N.'       5 
primary 'Ness, T.'        6 
primary 'Moyer, R.'       7 
primary 'Liwang, P.J.'    8 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'rabbitpox encoded CC chemokine inhibitor' 26157.857 1 ? ?                  ? ? 
2 polymer man 'Small inducible cytokine A4'              7622.421  1 ? 'K45A, R46A, K48A' ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'vCCI, 35 kDa, p35'                                  
2 'Macrophage inflammatory protein 1-beta, MIP-1-beta' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MPASLQQSSSSSSSCTEEENKHHMGIDVIIKVTKQDQTPTNDKICQSVTEITESESDPDPEVESEDDSTSVEDVDPPTTY
YSIIGGGLRMNFGFTKCPQIKSISESADGNTVNARLSSVSPGQGKDSPAITHEEALAMIKDCEVSIDIRCSEEEKDSDIK
THPVLGSNISHKKVSYEDIIGSTIVDTKCVKNLEFSVRIGDMCKESSELEVKDGFKYVDGSASKGATDDTSLIDSTKLKA
CV
;
;MPASLQQSSSSSSSCTEEENKHHMGIDVIIKVTKQDQTPTNDKICQSVTEITESESDPDPEVESEDDSTSVEDVDPPTTY
YSIIGGGLRMNFGFTKCPQIKSISESADGNTVNARLSSVSPGQGKDSPAITHEEALAMIKDCEVSIDIRCSEEEKDSDIK
THPVLGSNISHKKVSYEDIIGSTIVDTKCVKNLEFSVRIGDMCKESSELEVKDGFKYVDGSASKGATDDTSLIDSTKLKA
CV
;
A ? 
2 'polypeptide(L)' no no APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTAASAQVCADPSESWVQEYVYDLELN 
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTAASAQVCADPSESWVQEYVYDLELN B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ALA n 
1 4   SER n 
1 5   LEU n 
1 6   GLN n 
1 7   GLN n 
1 8   SER n 
1 9   SER n 
1 10  SER n 
1 11  SER n 
1 12  SER n 
1 13  SER n 
1 14  SER n 
1 15  CYS n 
1 16  THR n 
1 17  GLU n 
1 18  GLU n 
1 19  GLU n 
1 20  ASN n 
1 21  LYS n 
1 22  HIS n 
1 23  HIS n 
1 24  MET n 
1 25  GLY n 
1 26  ILE n 
1 27  ASP n 
1 28  VAL n 
1 29  ILE n 
1 30  ILE n 
1 31  LYS n 
1 32  VAL n 
1 33  THR n 
1 34  LYS n 
1 35  GLN n 
1 36  ASP n 
1 37  GLN n 
1 38  THR n 
1 39  PRO n 
1 40  THR n 
1 41  ASN n 
1 42  ASP n 
1 43  LYS n 
1 44  ILE n 
1 45  CYS n 
1 46  GLN n 
1 47  SER n 
1 48  VAL n 
1 49  THR n 
1 50  GLU n 
1 51  ILE n 
1 52  THR n 
1 53  GLU n 
1 54  SER n 
1 55  GLU n 
1 56  SER n 
1 57  ASP n 
1 58  PRO n 
1 59  ASP n 
1 60  PRO n 
1 61  GLU n 
1 62  VAL n 
1 63  GLU n 
1 64  SER n 
1 65  GLU n 
1 66  ASP n 
1 67  ASP n 
1 68  SER n 
1 69  THR n 
1 70  SER n 
1 71  VAL n 
1 72  GLU n 
1 73  ASP n 
1 74  VAL n 
1 75  ASP n 
1 76  PRO n 
1 77  PRO n 
1 78  THR n 
1 79  THR n 
1 80  TYR n 
1 81  TYR n 
1 82  SER n 
1 83  ILE n 
1 84  ILE n 
1 85  GLY n 
1 86  GLY n 
1 87  GLY n 
1 88  LEU n 
1 89  ARG n 
1 90  MET n 
1 91  ASN n 
1 92  PHE n 
1 93  GLY n 
1 94  PHE n 
1 95  THR n 
1 96  LYS n 
1 97  CYS n 
1 98  PRO n 
1 99  GLN n 
1 100 ILE n 
1 101 LYS n 
1 102 SER n 
1 103 ILE n 
1 104 SER n 
1 105 GLU n 
1 106 SER n 
1 107 ALA n 
1 108 ASP n 
1 109 GLY n 
1 110 ASN n 
1 111 THR n 
1 112 VAL n 
1 113 ASN n 
1 114 ALA n 
1 115 ARG n 
1 116 LEU n 
1 117 SER n 
1 118 SER n 
1 119 VAL n 
1 120 SER n 
1 121 PRO n 
1 122 GLY n 
1 123 GLN n 
1 124 GLY n 
1 125 LYS n 
1 126 ASP n 
1 127 SER n 
1 128 PRO n 
1 129 ALA n 
1 130 ILE n 
1 131 THR n 
1 132 HIS n 
1 133 GLU n 
1 134 GLU n 
1 135 ALA n 
1 136 LEU n 
1 137 ALA n 
1 138 MET n 
1 139 ILE n 
1 140 LYS n 
1 141 ASP n 
1 142 CYS n 
1 143 GLU n 
1 144 VAL n 
1 145 SER n 
1 146 ILE n 
1 147 ASP n 
1 148 ILE n 
1 149 ARG n 
1 150 CYS n 
1 151 SER n 
1 152 GLU n 
1 153 GLU n 
1 154 GLU n 
1 155 LYS n 
1 156 ASP n 
1 157 SER n 
1 158 ASP n 
1 159 ILE n 
1 160 LYS n 
1 161 THR n 
1 162 HIS n 
1 163 PRO n 
1 164 VAL n 
1 165 LEU n 
1 166 GLY n 
1 167 SER n 
1 168 ASN n 
1 169 ILE n 
1 170 SER n 
1 171 HIS n 
1 172 LYS n 
1 173 LYS n 
1 174 VAL n 
1 175 SER n 
1 176 TYR n 
1 177 GLU n 
1 178 ASP n 
1 179 ILE n 
1 180 ILE n 
1 181 GLY n 
1 182 SER n 
1 183 THR n 
1 184 ILE n 
1 185 VAL n 
1 186 ASP n 
1 187 THR n 
1 188 LYS n 
1 189 CYS n 
1 190 VAL n 
1 191 LYS n 
1 192 ASN n 
1 193 LEU n 
1 194 GLU n 
1 195 PHE n 
1 196 SER n 
1 197 VAL n 
1 198 ARG n 
1 199 ILE n 
1 200 GLY n 
1 201 ASP n 
1 202 MET n 
1 203 CYS n 
1 204 LYS n 
1 205 GLU n 
1 206 SER n 
1 207 SER n 
1 208 GLU n 
1 209 LEU n 
1 210 GLU n 
1 211 VAL n 
1 212 LYS n 
1 213 ASP n 
1 214 GLY n 
1 215 PHE n 
1 216 LYS n 
1 217 TYR n 
1 218 VAL n 
1 219 ASP n 
1 220 GLY n 
1 221 SER n 
1 222 ALA n 
1 223 SER n 
1 224 LYS n 
1 225 GLY n 
1 226 ALA n 
1 227 THR n 
1 228 ASP n 
1 229 ASP n 
1 230 THR n 
1 231 SER n 
1 232 LEU n 
1 233 ILE n 
1 234 ASP n 
1 235 SER n 
1 236 THR n 
1 237 LYS n 
1 238 LEU n 
1 239 LYS n 
1 240 ALA n 
1 241 CYS n 
1 242 VAL n 
2 1   ALA n 
2 2   PRO n 
2 3   MET n 
2 4   GLY n 
2 5   SER n 
2 6   ASP n 
2 7   PRO n 
2 8   PRO n 
2 9   THR n 
2 10  ALA n 
2 11  CYS n 
2 12  CYS n 
2 13  PHE n 
2 14  SER n 
2 15  TYR n 
2 16  THR n 
2 17  ALA n 
2 18  ARG n 
2 19  LYS n 
2 20  LEU n 
2 21  PRO n 
2 22  ARG n 
2 23  ASN n 
2 24  PHE n 
2 25  VAL n 
2 26  VAL n 
2 27  ASP n 
2 28  TYR n 
2 29  TYR n 
2 30  GLU n 
2 31  THR n 
2 32  SER n 
2 33  SER n 
2 34  LEU n 
2 35  CYS n 
2 36  SER n 
2 37  GLN n 
2 38  PRO n 
2 39  ALA n 
2 40  VAL n 
2 41  VAL n 
2 42  PHE n 
2 43  GLN n 
2 44  THR n 
2 45  ALA n 
2 46  ALA n 
2 47  SER n 
2 48  ALA n 
2 49  GLN n 
2 50  VAL n 
2 51  CYS n 
2 52  ALA n 
2 53  ASP n 
2 54  PRO n 
2 55  SER n 
2 56  GLU n 
2 57  SER n 
2 58  TRP n 
2 59  VAL n 
2 60  GLN n 
2 61  GLU n 
2 62  TYR n 
2 63  VAL n 
2 64  TYR n 
2 65  ASP n 
2 66  LEU n 
2 67  GLU n 
2 68  LEU n 
2 69  ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ?     Orthopoxvirus ?                          'Vaccinia virus' ? ? ? ? ? 'Rabbitpox virus' 32606 ? ? ? ? ? ? ? ? 
'Pichia pastoris'            4922   Pichia      ? ? ?                  ? ? SMD1168  ? ? ? ? ? ? ? pPIC9K          ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo          'CCL4, LAG1, MIP1B, SCYA4' ?                ? ? ? ? ? 'Homo sapiens'    9606  ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? BL21-DE3 ? ? ? ? ? ? ? 'pET-32 Xa/LIC' ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 GB  AAS49897   44971547 1 
;MPASLQQSSSSSSSCTEEENKHHMGIDVIIKVTKQDQTPTNDKICQSVTEITESESDPDPEVESEDDSTSVEDVDPPTTY
YSIIGGGLRMNFGFTKCPQIKSISESADGNTVNARLSSVSPGQGKDSPAITHEEALAMIKDCEVSIDIRCSEEEKDSDIK
THPVLGSNISHKKVSYEDIIGSTIVDTKCVKNLEFSVRIGDMCKESSELEVKDGFKYVDGSASKGATDDTSLIDSTKLKA
CV
;
17 ? 
2 UNP CCL4_HUMAN P13236   2 APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN 24 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2FIN A 1 ? 242 ? 44971547 17 ? 258 ? 1 242 
2 2 2FIN B 1 ? 69  ? P13236   24 ? 92  ? 1 69  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 2FIN ALA B 45 ? UNP P13236 LYS 68 ENGINEERED 45 1 
2 2FIN ALA B 46 ? UNP P13236 ARG 69 ENGINEERED 46 2 
2 2FIN ALA B 48 ? UNP P13236 LYS 71 ENGINEERED 48 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY     1 
2 1 3D_15N-separated_NOESY     1 
3 1 4D_13C/15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '0.5-2.0 mM' 
_pdbx_nmr_sample_details.solvent_system   '93%water 7%D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 600 ? 
2 INOVA Varian 750 ? 
3 INOVA Varian 800 ? 
# 
_pdbx_nmr_ensemble.entry_id                                      2FIN 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations,structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
processing           NMRPipe Linux9 'Frank Delaglio' 1 
'structure solution' Dynamo  3.1    'Frank Delaglio' 2 
refinement           Dynamo  3.1    'Frank Delaglio' 3 
# 
_exptl.entry_id          2FIN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2FIN 
_struct.title                     
'Solution Structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta, ensemble structure' 
_struct.pdbx_descriptor           'rabbitpox encoded CC chemokine inhibitor, Small inducible cytokine A4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FIN 
_struct_keywords.pdbx_keywords   'VIRUS/VIRAL PROTEIN/CYTOKINE' 
_struct_keywords.text            
'protein-protein complex, Chemokine, pox virus, viral CC chemokine inhibitor, VIRUS-VIRAL PROTEIN-CYTOKINE COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 132 ? ASP A 141 ? HIS A 132 ASP A 141 1 ? 10 
HELX_P HELX_P2 2 SER B 57  ? LEU B 68  ? SER B 57  LEU B 68  1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 15  SG ? ? ? 1_555 A CYS 203 SG ? ? A CYS 15  A CYS 203 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf2 disulf ? ? A CYS 45  SG ? ? ? 1_555 A CYS 241 SG ? ? A CYS 45  A CYS 241 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf3 disulf ? ? A CYS 97  SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 97  A CYS 142 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf4 disulf ? ? A CYS 150 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 150 A CYS 189 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf5 disulf ? ? B CYS 11  SG ? ? ? 1_555 B CYS 35  SG ? ? B CYS 11  B CYS 35  1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf6 disulf ? ? B CYS 12  SG ? ? ? 1_555 B CYS 51  SG ? ? B CYS 12  B CYS 51  1_555 ? ? ? ? ? ? ? 2.016 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1  ? 1 ? 
2  ? 1 ? 
3  ? 1 ? 
4  ? 1 ? 
5  ? 1 ? 
6  ? 1 ? 
7  ? 1 ? 
8  ? 1 ? 
9  ? 1 ? 
10 ? 1 ? 
11 ? 1 ? 
12 ? 1 ? 
13 ? 1 ? 
14 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1  1 MET A 24  ? THR A 33  ? MET A 24  THR A 33  
2  1 SER A 47  ? THR A 52  ? SER A 47  THR A 52  
3  1 THR A 79  ? GLY A 85  ? THR A 79  GLY A 85  
4  1 LEU A 88  ? THR A 95  ? LEU A 88  THR A 95  
5  1 SER A 102 ? ASP A 108 ? SER A 102 ASP A 108 
6  1 THR A 111 ? SER A 117 ? THR A 111 SER A 117 
7  1 GLU A 143 ? ARG A 149 ? GLU A 143 ARG A 149 
8  1 GLY A 181 ? ASP A 186 ? GLY A 181 ASP A 186 
9  1 ASN A 192 ? ASP A 201 ? ASN A 192 ASP A 201 
10 1 VAL A 211 ? VAL A 218 ? VAL A 211 VAL A 218 
11 1 SER A 221 ? SER A 223 ? SER A 221 SER A 223 
12 1 ASP B 27  ? GLU B 30  ? ASP B 27  GLU B 30  
13 1 VAL B 40  ? GLN B 43  ? VAL B 40  GLN B 43  
14 1 GLN B 49  ? ALA B 52  ? GLN B 49  ALA B 52  
# 
_database_PDB_matrix.entry_id          2FIN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FIN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 94.721  -2.108  -24.033 1.00 0.00 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 95.830  -2.109  -23.086 1.00 0.00 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 96.948  -1.152  -23.523 1.00 0.00 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 97.610  -0.553  -22.675 1.00 0.00 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 96.388  -3.534  -22.929 1.00 0.00 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 97.312  -3.623  -21.703 1.00 0.00 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 98.918  -2.884  -22.096 1.00 0.00 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 99.840  -3.596  -20.711 1.00 0.00 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 93.833  -2.300  -23.527 1.00 0.00 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? 94.879  -2.844  -24.751 1.00 0.00 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? 94.659  -1.178  -24.494 1.00 0.00 ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? 95.454  -1.778  -22.130 1.00 0.00 ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? 95.567  -4.225  -22.806 1.00 0.00 ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? 96.947  -3.801  -23.811 1.00 0.00 ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? 96.870  -3.100  -20.868 1.00 0.00 ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? 97.453  -4.661  -21.439 1.00 0.00 ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? 99.248  -3.525  -19.810 1.00 0.00 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? 100.764 -3.053  -20.578 1.00 0.00 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? 100.058 -4.633  -20.919 1.00 0.00 ? 1   MET A HE3  1  
ATOM 20    N N    . PRO A 1 2   ? 97.193  -0.986  -24.844 1.00 0.00 ? 2   PRO A N    1  
ATOM 21    C CA   . PRO A 1 2   ? 98.255  -0.085  -25.331 1.00 0.00 ? 2   PRO A CA   1  
ATOM 22    C C    . PRO A 1 2   ? 98.146  1.315   -24.722 1.00 0.00 ? 2   PRO A C    1  
ATOM 23    O O    . PRO A 1 2   ? 97.345  1.546   -23.815 1.00 0.00 ? 2   PRO A O    1  
ATOM 24    C CB   . PRO A 1 2   ? 98.048  -0.058  -26.857 1.00 0.00 ? 2   PRO A CB   1  
ATOM 25    C CG   . PRO A 1 2   ? 97.386  -1.362  -27.162 1.00 0.00 ? 2   PRO A CG   1  
ATOM 26    C CD   . PRO A 1 2   ? 96.478  -1.636  -25.964 1.00 0.00 ? 2   PRO A CD   1  
ATOM 27    H HA   . PRO A 1 2   ? 99.222  -0.508  -25.107 1.00 0.00 ? 2   PRO A HA   1  
ATOM 28    H HB2  . PRO A 1 2   ? 97.404  0.769   -27.140 1.00 0.00 ? 2   PRO A HB2  1  
ATOM 29    H HB3  . PRO A 1 2   ? 98.996  0.012   -27.374 1.00 0.00 ? 2   PRO A HB3  1  
ATOM 30    H HG2  . PRO A 1 2   ? 96.806  -1.288  -28.076 1.00 0.00 ? 2   PRO A HG2  1  
ATOM 31    H HG3  . PRO A 1 2   ? 98.123  -2.148  -27.250 1.00 0.00 ? 2   PRO A HG3  1  
ATOM 32    H HD2  . PRO A 1 2   ? 95.508  -1.179  -26.117 1.00 0.00 ? 2   PRO A HD2  1  
ATOM 33    H HD3  . PRO A 1 2   ? 96.381  -2.694  -25.787 1.00 0.00 ? 2   PRO A HD3  1  
ATOM 34    N N    . ALA A 1 3   ? 98.956  2.239   -25.227 1.00 0.00 ? 3   ALA A N    1  
ATOM 35    C CA   . ALA A 1 3   ? 98.942  3.608   -24.725 1.00 0.00 ? 3   ALA A CA   1  
ATOM 36    C C    . ALA A 1 3   ? 99.126  3.627   -23.212 1.00 0.00 ? 3   ALA A C    1  
ATOM 37    O O    . ALA A 1 3   ? 99.173  2.578   -22.569 1.00 0.00 ? 3   ALA A O    1  
ATOM 38    C CB   . ALA A 1 3   ? 97.629  4.279   -25.096 1.00 0.00 ? 3   ALA A CB   1  
ATOM 39    H H    . ALA A 1 3   ? 99.573  1.996   -25.947 1.00 0.00 ? 3   ALA A H    1  
ATOM 40    H HA   . ALA A 1 3   ? 99.754  4.155   -25.183 1.00 0.00 ? 3   ALA A HA   1  
ATOM 41    H HB1  . ALA A 1 3   ? 96.805  3.688   -24.723 1.00 0.00 ? 3   ALA A HB1  1  
ATOM 42    H HB2  . ALA A 1 3   ? 97.557  4.360   -26.171 1.00 0.00 ? 3   ALA A HB2  1  
ATOM 43    H HB3  . ALA A 1 3   ? 97.592  5.265   -24.658 1.00 0.00 ? 3   ALA A HB3  1  
ATOM 44    N N    . SER A 1 4   ? 99.230  4.827   -22.648 1.00 0.00 ? 4   SER A N    1  
ATOM 45    C CA   . SER A 1 4   ? 99.408  4.972   -21.207 1.00 0.00 ? 4   SER A CA   1  
ATOM 46    C C    . SER A 1 4   ? 99.145  6.412   -20.780 1.00 0.00 ? 4   SER A C    1  
ATOM 47    O O    . SER A 1 4   ? 99.082  6.715   -19.588 1.00 0.00 ? 4   SER A O    1  
ATOM 48    C CB   . SER A 1 4   ? 100.830 4.573   -20.815 1.00 0.00 ? 4   SER A CB   1  
ATOM 49    O OG   . SER A 1 4   ? 101.028 3.196   -21.104 1.00 0.00 ? 4   SER A OG   1  
ATOM 50    H H    . SER A 1 4   ? 99.184  5.628   -23.211 1.00 0.00 ? 4   SER A H    1  
ATOM 51    H HA   . SER A 1 4   ? 98.710  4.323   -20.699 1.00 0.00 ? 4   SER A HA   1  
ATOM 52    H HB2  . SER A 1 4   ? 101.539 5.160   -21.376 1.00 0.00 ? 4   SER A HB2  1  
ATOM 53    H HB3  . SER A 1 4   ? 100.975 4.754   -19.758 1.00 0.00 ? 4   SER A HB3  1  
ATOM 54    H HG   . SER A 1 4   ? 101.866 2.929   -20.717 1.00 0.00 ? 4   SER A HG   1  
ATOM 55    N N    . LEU A 1 5   ? 98.992  7.297   -21.760 1.00 0.00 ? 5   LEU A N    1  
ATOM 56    C CA   . LEU A 1 5   ? 98.735  8.704   -21.472 1.00 0.00 ? 5   LEU A CA   1  
ATOM 57    C C    . LEU A 1 5   ? 97.407  8.856   -20.730 1.00 0.00 ? 5   LEU A C    1  
ATOM 58    O O    . LEU A 1 5   ? 96.336  8.647   -21.301 1.00 0.00 ? 5   LEU A O    1  
ATOM 59    C CB   . LEU A 1 5   ? 98.708  9.502   -22.794 1.00 0.00 ? 5   LEU A CB   1  
ATOM 60    C CG   . LEU A 1 5   ? 99.084  10.972  -22.552 1.00 0.00 ? 5   LEU A CG   1  
ATOM 61    C CD1  . LEU A 1 5   ? 98.971  11.744  -23.870 1.00 0.00 ? 5   LEU A CD1  1  
ATOM 62    C CD2  . LEU A 1 5   ? 98.143  11.594  -21.508 1.00 0.00 ? 5   LEU A CD2  1  
ATOM 63    H H    . LEU A 1 5   ? 99.052  6.998   -22.691 1.00 0.00 ? 5   LEU A H    1  
ATOM 64    H HA   . LEU A 1 5   ? 99.532  9.079   -20.846 1.00 0.00 ? 5   LEU A HA   1  
ATOM 65    H HB2  . LEU A 1 5   ? 99.418  9.065   -23.482 1.00 0.00 ? 5   LEU A HB2  1  
ATOM 66    H HB3  . LEU A 1 5   ? 97.720  9.453   -23.231 1.00 0.00 ? 5   LEU A HB3  1  
ATOM 67    H HG   . LEU A 1 5   ? 100.104 11.025  -22.195 1.00 0.00 ? 5   LEU A HG   1  
ATOM 68    H HD11 . LEU A 1 5   ? 97.945  11.734  -24.205 1.00 0.00 ? 5   LEU A HD11 1  
ATOM 69    H HD12 . LEU A 1 5   ? 99.598  11.276  -24.615 1.00 0.00 ? 5   LEU A HD12 1  
ATOM 70    H HD13 . LEU A 1 5   ? 99.292  12.763  -23.718 1.00 0.00 ? 5   LEU A HD13 1  
ATOM 71    H HD21 . LEU A 1 5   ? 98.429  11.259  -20.522 1.00 0.00 ? 5   LEU A HD21 1  
ATOM 72    H HD22 . LEU A 1 5   ? 97.125  11.293  -21.710 1.00 0.00 ? 5   LEU A HD22 1  
ATOM 73    H HD23 . LEU A 1 5   ? 98.213  12.673  -21.551 1.00 0.00 ? 5   LEU A HD23 1  
ATOM 74    N N    . GLN A 1 6   ? 97.487  9.221   -19.453 1.00 0.00 ? 6   GLN A N    1  
ATOM 75    C CA   . GLN A 1 6   ? 96.288  9.398   -18.644 1.00 0.00 ? 6   GLN A CA   1  
ATOM 76    C C    . GLN A 1 6   ? 96.624  10.107  -17.335 1.00 0.00 ? 6   GLN A C    1  
ATOM 77    O O    . GLN A 1 6   ? 97.488  9.661   -16.581 1.00 0.00 ? 6   GLN A O    1  
ATOM 78    C CB   . GLN A 1 6   ? 95.654  8.038   -18.343 1.00 0.00 ? 6   GLN A CB   1  
ATOM 79    C CG   . GLN A 1 6   ? 94.362  8.239   -17.547 1.00 0.00 ? 6   GLN A CG   1  
ATOM 80    C CD   . GLN A 1 6   ? 93.593  6.918   -17.478 1.00 0.00 ? 6   GLN A CD   1  
ATOM 81    O OE1  . GLN A 1 6   ? 92.600  6.743   -18.157 1.00 0.00 ? 6   GLN A OE1  1  
ATOM 82    N NE2  . GLN A 1 6   ? 94.012  5.973   -16.682 1.00 0.00 ? 6   GLN A NE2  1  
ATOM 83    H H    . GLN A 1 6   ? 98.368  9.374   -19.051 1.00 0.00 ? 6   GLN A H    1  
ATOM 84    H HA   . GLN A 1 6   ? 95.578  9.998   -19.194 1.00 0.00 ? 6   GLN A HA   1  
ATOM 85    H HB2  . GLN A 1 6   ? 95.432  7.533   -19.272 1.00 0.00 ? 6   GLN A HB2  1  
ATOM 86    H HB3  . GLN A 1 6   ? 96.342  7.440   -17.765 1.00 0.00 ? 6   GLN A HB3  1  
ATOM 87    H HG2  . GLN A 1 6   ? 94.603  8.568   -16.547 1.00 0.00 ? 6   GLN A HG2  1  
ATOM 88    H HG3  . GLN A 1 6   ? 93.750  8.983   -18.034 1.00 0.00 ? 6   GLN A HG3  1  
ATOM 89    H HE21 . GLN A 1 6   ? 94.813  6.113   -16.134 1.00 0.00 ? 6   GLN A HE21 1  
ATOM 90    H HE22 . GLN A 1 6   ? 93.526  5.123   -16.630 1.00 0.00 ? 6   GLN A HE22 1  
ATOM 91    N N    . GLN A 1 7   ? 95.936  11.215  -17.076 1.00 0.00 ? 7   GLN A N    1  
ATOM 92    C CA   . GLN A 1 7   ? 96.169  11.982  -15.857 1.00 0.00 ? 7   GLN A CA   1  
ATOM 93    C C    . GLN A 1 7   ? 95.874  11.131  -14.624 1.00 0.00 ? 7   GLN A C    1  
ATOM 94    O O    . GLN A 1 7   ? 96.151  9.932   -14.604 1.00 0.00 ? 7   GLN A O    1  
ATOM 95    C CB   . GLN A 1 7   ? 95.283  13.230  -15.851 1.00 0.00 ? 7   GLN A CB   1  
ATOM 96    C CG   . GLN A 1 7   ? 95.475  14.001  -17.160 1.00 0.00 ? 7   GLN A CG   1  
ATOM 97    C CD   . GLN A 1 7   ? 94.555  15.223  -17.173 1.00 0.00 ? 7   GLN A CD   1  
ATOM 98    O OE1  . GLN A 1 7   ? 94.325  15.835  -16.150 1.00 0.00 ? 7   GLN A OE1  1  
ATOM 99    N NE2  . GLN A 1 7   ? 94.016  15.606  -18.298 1.00 0.00 ? 7   GLN A NE2  1  
ATOM 100   H H    . GLN A 1 7   ? 95.261  11.523  -17.717 1.00 0.00 ? 7   GLN A H    1  
ATOM 101   H HA   . GLN A 1 7   ? 97.204  12.290  -15.830 1.00 0.00 ? 7   GLN A HA   1  
ATOM 102   H HB2  . GLN A 1 7   ? 94.248  12.937  -15.755 1.00 0.00 ? 7   GLN A HB2  1  
ATOM 103   H HB3  . GLN A 1 7   ? 95.557  13.863  -15.022 1.00 0.00 ? 7   GLN A HB3  1  
ATOM 104   H HG2  . GLN A 1 7   ? 96.504  14.323  -17.240 1.00 0.00 ? 7   GLN A HG2  1  
ATOM 105   H HG3  . GLN A 1 7   ? 95.232  13.361  -17.995 1.00 0.00 ? 7   GLN A HG3  1  
ATOM 106   H HE21 . GLN A 1 7   ? 94.201  15.112  -19.123 1.00 0.00 ? 7   GLN A HE21 1  
ATOM 107   H HE22 . GLN A 1 7   ? 93.425  16.388  -18.317 1.00 0.00 ? 7   GLN A HE22 1  
ATOM 108   N N    . SER A 1 8   ? 95.310  11.759  -13.592 1.00 0.00 ? 8   SER A N    1  
ATOM 109   C CA   . SER A 1 8   ? 94.980  11.052  -12.356 1.00 0.00 ? 8   SER A CA   1  
ATOM 110   C C    . SER A 1 8   ? 93.902  11.806  -11.583 1.00 0.00 ? 8   SER A C    1  
ATOM 111   O O    . SER A 1 8   ? 93.289  11.263  -10.663 1.00 0.00 ? 8   SER A O    1  
ATOM 112   C CB   . SER A 1 8   ? 96.229  10.911  -11.486 1.00 0.00 ? 8   SER A CB   1  
ATOM 113   O OG   . SER A 1 8   ? 96.789  12.198  -11.256 1.00 0.00 ? 8   SER A OG   1  
ATOM 114   H H    . SER A 1 8   ? 95.112  12.716  -13.664 1.00 0.00 ? 8   SER A H    1  
ATOM 115   H HA   . SER A 1 8   ? 94.609  10.066  -12.597 1.00 0.00 ? 8   SER A HA   1  
ATOM 116   H HB2  . SER A 1 8   ? 95.965  10.466  -10.542 1.00 0.00 ? 8   SER A HB2  1  
ATOM 117   H HB3  . SER A 1 8   ? 96.948  10.279  -11.991 1.00 0.00 ? 8   SER A HB3  1  
ATOM 118   H HG   . SER A 1 8   ? 96.150  12.715  -10.760 1.00 0.00 ? 8   SER A HG   1  
ATOM 119   N N    . SER A 1 9   ? 93.677  13.060  -11.964 1.00 0.00 ? 9   SER A N    1  
ATOM 120   C CA   . SER A 1 9   ? 92.669  13.884  -11.303 1.00 0.00 ? 9   SER A CA   1  
ATOM 121   C C    . SER A 1 9   ? 91.269  13.479  -11.750 1.00 0.00 ? 9   SER A C    1  
ATOM 122   O O    . SER A 1 9   ? 90.302  13.619  -11.001 1.00 0.00 ? 9   SER A O    1  
ATOM 123   C CB   . SER A 1 9   ? 92.905  15.358  -11.633 1.00 0.00 ? 9   SER A CB   1  
ATOM 124   O OG   . SER A 1 9   ? 92.078  16.163  -10.804 1.00 0.00 ? 9   SER A OG   1  
ATOM 125   H H    . SER A 1 9   ? 94.197  13.438  -12.704 1.00 0.00 ? 9   SER A H    1  
ATOM 126   H HA   . SER A 1 9   ? 92.749  13.750  -10.233 1.00 0.00 ? 9   SER A HA   1  
ATOM 127   H HB2  . SER A 1 9   ? 93.937  15.609  -11.455 1.00 0.00 ? 9   SER A HB2  1  
ATOM 128   H HB3  . SER A 1 9   ? 92.669  15.534  -12.675 1.00 0.00 ? 9   SER A HB3  1  
ATOM 129   H HG   . SER A 1 9   ? 92.582  16.939  -10.546 1.00 0.00 ? 9   SER A HG   1  
ATOM 130   N N    . SER A 1 10  ? 91.166  12.977  -12.978 1.00 0.00 ? 10  SER A N    1  
ATOM 131   C CA   . SER A 1 10  ? 89.877  12.555  -13.518 1.00 0.00 ? 10  SER A CA   1  
ATOM 132   C C    . SER A 1 10  ? 89.151  11.653  -12.525 1.00 0.00 ? 10  SER A C    1  
ATOM 133   O O    . SER A 1 10  ? 89.723  10.692  -12.012 1.00 0.00 ? 10  SER A O    1  
ATOM 134   C CB   . SER A 1 10  ? 90.082  11.806  -14.835 1.00 0.00 ? 10  SER A CB   1  
ATOM 135   O OG   . SER A 1 10  ? 90.595  12.704  -15.810 1.00 0.00 ? 10  SER A OG   1  
ATOM 136   H H    . SER A 1 10  ? 91.970  12.890  -13.531 1.00 0.00 ? 10  SER A H    1  
ATOM 137   H HA   . SER A 1 10  ? 89.272  13.430  -13.705 1.00 0.00 ? 10  SER A HA   1  
ATOM 138   H HB2  . SER A 1 10  ? 90.784  11.002  -14.688 1.00 0.00 ? 10  SER A HB2  1  
ATOM 139   H HB3  . SER A 1 10  ? 89.136  11.399  -15.167 1.00 0.00 ? 10  SER A HB3  1  
ATOM 140   H HG   . SER A 1 10  ? 91.167  13.332  -15.364 1.00 0.00 ? 10  SER A HG   1  
ATOM 141   N N    . SER A 1 11  ? 87.890  11.972  -12.253 1.00 0.00 ? 11  SER A N    1  
ATOM 142   C CA   . SER A 1 11  ? 87.103  11.183  -11.314 1.00 0.00 ? 11  SER A CA   1  
ATOM 143   C C    . SER A 1 11  ? 87.019  9.731   -11.774 1.00 0.00 ? 11  SER A C    1  
ATOM 144   O O    . SER A 1 11  ? 86.771  8.829   -10.973 1.00 0.00 ? 11  SER A O    1  
ATOM 145   C CB   . SER A 1 11  ? 85.698  11.770  -11.185 1.00 0.00 ? 11  SER A CB   1  
ATOM 146   O OG   . SER A 1 11  ? 85.789  13.184  -11.066 1.00 0.00 ? 11  SER A OG   1  
ATOM 147   H H    . SER A 1 11  ? 87.485  12.752  -12.687 1.00 0.00 ? 11  SER A H    1  
ATOM 148   H HA   . SER A 1 11  ? 87.582  11.214  -10.348 1.00 0.00 ? 11  SER A HA   1  
ATOM 149   H HB2  . SER A 1 11  ? 85.118  11.526  -12.060 1.00 0.00 ? 11  SER A HB2  1  
ATOM 150   H HB3  . SER A 1 11  ? 85.217  11.355  -10.309 1.00 0.00 ? 11  SER A HB3  1  
ATOM 151   H HG   . SER A 1 11  ? 84.921  13.519  -10.835 1.00 0.00 ? 11  SER A HG   1  
ATOM 152   N N    . SER A 1 12  ? 87.233  9.510   -13.067 1.00 0.00 ? 12  SER A N    1  
ATOM 153   C CA   . SER A 1 12  ? 87.185  8.162   -13.625 1.00 0.00 ? 12  SER A CA   1  
ATOM 154   C C    . SER A 1 12  ? 88.468  7.406   -13.293 1.00 0.00 ? 12  SER A C    1  
ATOM 155   O O    . SER A 1 12  ? 88.505  6.176   -13.339 1.00 0.00 ? 12  SER A O    1  
ATOM 156   C CB   . SER A 1 12  ? 87.014  8.233   -15.142 1.00 0.00 ? 12  SER A CB   1  
ATOM 157   O OG   . SER A 1 12  ? 88.093  8.970   -15.702 1.00 0.00 ? 12  SER A OG   1  
ATOM 158   H H    . SER A 1 12  ? 87.430  10.268  -13.657 1.00 0.00 ? 12  SER A H    1  
ATOM 159   H HA   . SER A 1 12  ? 86.344  7.632   -13.202 1.00 0.00 ? 12  SER A HA   1  
ATOM 160   H HB2  . SER A 1 12  ? 87.012  7.238   -15.554 1.00 0.00 ? 12  SER A HB2  1  
ATOM 161   H HB3  . SER A 1 12  ? 86.074  8.719   -15.374 1.00 0.00 ? 12  SER A HB3  1  
ATOM 162   H HG   . SER A 1 12  ? 87.771  9.418   -16.487 1.00 0.00 ? 12  SER A HG   1  
ATOM 163   N N    . SER A 1 13  ? 89.521  8.154   -12.965 1.00 0.00 ? 13  SER A N    1  
ATOM 164   C CA   . SER A 1 13  ? 90.812  7.553   -12.630 1.00 0.00 ? 13  SER A CA   1  
ATOM 165   C C    . SER A 1 13  ? 90.846  7.109   -11.170 1.00 0.00 ? 13  SER A C    1  
ATOM 166   O O    . SER A 1 13  ? 91.211  5.973   -10.868 1.00 0.00 ? 13  SER A O    1  
ATOM 167   C CB   . SER A 1 13  ? 91.934  8.562   -12.880 1.00 0.00 ? 13  SER A CB   1  
ATOM 168   O OG   . SER A 1 13  ? 91.981  8.878   -14.265 1.00 0.00 ? 13  SER A OG   1  
ATOM 169   H H    . SER A 1 13  ? 89.428  9.129   -12.951 1.00 0.00 ? 13  SER A H    1  
ATOM 170   H HA   . SER A 1 13  ? 90.977  6.690   -13.261 1.00 0.00 ? 13  SER A HA   1  
ATOM 171   H HB2  . SER A 1 13  ? 91.743  9.460   -12.318 1.00 0.00 ? 13  SER A HB2  1  
ATOM 172   H HB3  . SER A 1 13  ? 92.877  8.134   -12.564 1.00 0.00 ? 13  SER A HB3  1  
ATOM 173   H HG   . SER A 1 13  ? 91.174  8.553   -14.671 1.00 0.00 ? 13  SER A HG   1  
ATOM 174   N N    . SER A 1 14  ? 90.470  8.011   -10.265 1.00 0.00 ? 14  SER A N    1  
ATOM 175   C CA   . SER A 1 14  ? 90.473  7.689   -8.840  1.00 0.00 ? 14  SER A CA   1  
ATOM 176   C C    . SER A 1 14  ? 89.681  8.721   -8.042  1.00 0.00 ? 14  SER A C    1  
ATOM 177   O O    . SER A 1 14  ? 89.239  9.735   -8.581  1.00 0.00 ? 14  SER A O    1  
ATOM 178   C CB   . SER A 1 14  ? 91.910  7.639   -8.322  1.00 0.00 ? 14  SER A CB   1  
ATOM 179   O OG   . SER A 1 14  ? 92.605  6.579   -8.967  1.00 0.00 ? 14  SER A OG   1  
ATOM 180   H H    . SER A 1 14  ? 90.192  8.904   -10.558 1.00 0.00 ? 14  SER A H    1  
ATOM 181   H HA   . SER A 1 14  ? 90.020  6.718   -8.698  1.00 0.00 ? 14  SER A HA   1  
ATOM 182   H HB2  . SER A 1 14  ? 92.405  8.570   -8.538  1.00 0.00 ? 14  SER A HB2  1  
ATOM 183   H HB3  . SER A 1 14  ? 91.901  7.478   -7.252  1.00 0.00 ? 14  SER A HB3  1  
ATOM 184   H HG   . SER A 1 14  ? 92.907  6.899   -9.820  1.00 0.00 ? 14  SER A HG   1  
ATOM 185   N N    . CYS A 1 15  ? 89.507  8.447   -6.751  1.00 0.00 ? 15  CYS A N    1  
ATOM 186   C CA   . CYS A 1 15  ? 88.768  9.350   -5.873  1.00 0.00 ? 15  CYS A CA   1  
ATOM 187   C C    . CYS A 1 15  ? 89.370  10.751  -5.907  1.00 0.00 ? 15  CYS A C    1  
ATOM 188   O O    . CYS A 1 15  ? 90.533  10.930  -6.269  1.00 0.00 ? 15  CYS A O    1  
ATOM 189   C CB   . CYS A 1 15  ? 88.803  8.824   -4.434  1.00 0.00 ? 15  CYS A CB   1  
ATOM 190   S SG   . CYS A 1 15  ? 87.807  7.320   -4.306  1.00 0.00 ? 15  CYS A SG   1  
ATOM 191   H H    . CYS A 1 15  ? 89.883  7.622   -6.381  1.00 0.00 ? 15  CYS A H    1  
ATOM 192   H HA   . CYS A 1 15  ? 87.741  9.400   -6.202  1.00 0.00 ? 15  CYS A HA   1  
ATOM 193   H HB2  . CYS A 1 15  ? 89.824  8.601   -4.159  1.00 0.00 ? 15  CYS A HB2  1  
ATOM 194   H HB3  . CYS A 1 15  ? 88.406  9.574   -3.766  1.00 0.00 ? 15  CYS A HB3  1  
ATOM 195   N N    . THR A 1 16  ? 88.571  11.739  -5.512  1.00 0.00 ? 16  THR A N    1  
ATOM 196   C CA   . THR A 1 16  ? 89.030  13.126  -5.481  1.00 0.00 ? 16  THR A CA   1  
ATOM 197   C C    . THR A 1 16  ? 89.750  13.406  -4.165  1.00 0.00 ? 16  THR A C    1  
ATOM 198   O O    . THR A 1 16  ? 89.774  12.561  -3.271  1.00 0.00 ? 16  THR A O    1  
ATOM 199   C CB   . THR A 1 16  ? 87.843  14.101  -5.607  1.00 0.00 ? 16  THR A CB   1  
ATOM 200   O OG1  . THR A 1 16  ? 86.859  13.774  -4.637  1.00 0.00 ? 16  THR A OG1  1  
ATOM 201   C CG2  . THR A 1 16  ? 87.239  13.990  -7.008  1.00 0.00 ? 16  THR A CG2  1  
ATOM 202   H H    . THR A 1 16  ? 87.658  11.531  -5.224  1.00 0.00 ? 16  THR A H    1  
ATOM 203   H HA   . THR A 1 16  ? 89.712  13.300  -6.301  1.00 0.00 ? 16  THR A HA   1  
ATOM 204   H HB   . THR A 1 16  ? 88.187  15.111  -5.446  1.00 0.00 ? 16  THR A HB   1  
ATOM 205   H HG1  . THR A 1 16  ? 86.012  14.095  -4.954  1.00 0.00 ? 16  THR A HG1  1  
ATOM 206   H HG21 . THR A 1 16  ? 88.004  14.179  -7.746  1.00 0.00 ? 16  THR A HG21 1  
ATOM 207   H HG22 . THR A 1 16  ? 86.447  14.717  -7.115  1.00 0.00 ? 16  THR A HG22 1  
ATOM 208   H HG23 . THR A 1 16  ? 86.838  12.998  -7.150  1.00 0.00 ? 16  THR A HG23 1  
ATOM 209   N N    . GLU A 1 17  ? 90.336  14.600  -4.053  1.00 0.00 ? 17  GLU A N    1  
ATOM 210   C CA   . GLU A 1 17  ? 91.063  15.001  -2.840  1.00 0.00 ? 17  GLU A CA   1  
ATOM 211   C C    . GLU A 1 17  ? 90.418  16.235  -2.220  1.00 0.00 ? 17  GLU A C    1  
ATOM 212   O O    . GLU A 1 17  ? 90.933  16.795  -1.252  1.00 0.00 ? 17  GLU A O    1  
ATOM 213   C CB   . GLU A 1 17  ? 92.518  15.318  -3.193  1.00 0.00 ? 17  GLU A CB   1  
ATOM 214   C CG   . GLU A 1 17  ? 93.192  14.066  -3.759  1.00 0.00 ? 17  GLU A CG   1  
ATOM 215   C CD   . GLU A 1 17  ? 94.676  14.348  -3.998  1.00 0.00 ? 17  GLU A CD   1  
ATOM 216   O OE1  . GLU A 1 17  ? 95.366  14.637  -3.035  1.00 0.00 ? 17  GLU A OE1  1  
ATOM 217   O OE2  . GLU A 1 17  ? 95.097  14.271  -5.141  1.00 0.00 ? 17  GLU A OE2  1  
ATOM 218   H H    . GLU A 1 17  ? 90.280  15.229  -4.803  1.00 0.00 ? 17  GLU A H    1  
ATOM 219   H HA   . GLU A 1 17  ? 91.049  14.198  -2.116  1.00 0.00 ? 17  GLU A HA   1  
ATOM 220   H HB2  . GLU A 1 17  ? 92.546  16.106  -3.931  1.00 0.00 ? 17  GLU A HB2  1  
ATOM 221   H HB3  . GLU A 1 17  ? 93.042  15.638  -2.305  1.00 0.00 ? 17  GLU A HB3  1  
ATOM 222   H HG2  . GLU A 1 17  ? 93.088  13.252  -3.055  1.00 0.00 ? 17  GLU A HG2  1  
ATOM 223   H HG3  . GLU A 1 17  ? 92.724  13.796  -4.693  1.00 0.00 ? 17  GLU A HG3  1  
ATOM 224   N N    . GLU A 1 18  ? 89.288  16.658  -2.786  1.00 0.00 ? 18  GLU A N    1  
ATOM 225   C CA   . GLU A 1 18  ? 88.576  17.834  -2.285  1.00 0.00 ? 18  GLU A CA   1  
ATOM 226   C C    . GLU A 1 18  ? 87.699  17.467  -1.089  1.00 0.00 ? 18  GLU A C    1  
ATOM 227   O O    . GLU A 1 18  ? 86.555  17.044  -1.255  1.00 0.00 ? 18  GLU A O    1  
ATOM 228   C CB   . GLU A 1 18  ? 87.707  18.430  -3.398  1.00 0.00 ? 18  GLU A CB   1  
ATOM 229   C CG   . GLU A 1 18  ? 88.602  19.066  -4.466  1.00 0.00 ? 18  GLU A CG   1  
ATOM 230   C CD   . GLU A 1 18  ? 87.731  19.758  -5.515  1.00 0.00 ? 18  GLU A CD   1  
ATOM 231   O OE1  . GLU A 1 18  ? 87.017  20.678  -5.151  1.00 0.00 ? 18  GLU A OE1  1  
ATOM 232   O OE2  . GLU A 1 18  ? 87.792  19.356  -6.666  1.00 0.00 ? 18  GLU A OE2  1  
ATOM 233   H H    . GLU A 1 18  ? 88.927  16.170  -3.556  1.00 0.00 ? 18  GLU A H    1  
ATOM 234   H HA   . GLU A 1 18  ? 89.296  18.577  -1.970  1.00 0.00 ? 18  GLU A HA   1  
ATOM 235   H HB2  . GLU A 1 18  ? 87.115  17.648  -3.848  1.00 0.00 ? 18  GLU A HB2  1  
ATOM 236   H HB3  . GLU A 1 18  ? 87.054  19.184  -2.982  1.00 0.00 ? 18  GLU A HB3  1  
ATOM 237   H HG2  . GLU A 1 18  ? 89.254  19.793  -4.003  1.00 0.00 ? 18  GLU A HG2  1  
ATOM 238   H HG3  . GLU A 1 18  ? 89.196  18.300  -4.941  1.00 0.00 ? 18  GLU A HG3  1  
ATOM 239   N N    . GLU A 1 19  ? 88.268  17.624  0.111   1.00 0.00 ? 19  GLU A N    1  
ATOM 240   C CA   . GLU A 1 19  ? 87.577  17.309  1.373   1.00 0.00 ? 19  GLU A CA   1  
ATOM 241   C C    . GLU A 1 19  ? 86.055  17.448  1.259   1.00 0.00 ? 19  GLU A C    1  
ATOM 242   O O    . GLU A 1 19  ? 85.322  16.472  1.416   1.00 0.00 ? 19  GLU A O    1  
ATOM 243   C CB   . GLU A 1 19  ? 88.079  18.234  2.489   1.00 0.00 ? 19  GLU A CB   1  
ATOM 244   C CG   . GLU A 1 19  ? 89.566  17.969  2.776   1.00 0.00 ? 19  GLU A CG   1  
ATOM 245   C CD   . GLU A 1 19  ? 90.430  18.586  1.674   1.00 0.00 ? 19  GLU A CD   1  
ATOM 246   O OE1  . GLU A 1 19  ? 90.204  19.740  1.347   1.00 0.00 ? 19  GLU A OE1  1  
ATOM 247   O OE2  . GLU A 1 19  ? 91.302  17.894  1.175   1.00 0.00 ? 19  GLU A OE2  1  
ATOM 248   H H    . GLU A 1 19  ? 89.191  17.944  0.141   1.00 0.00 ? 19  GLU A H    1  
ATOM 249   H HA   . GLU A 1 19  ? 87.806  16.290  1.644   1.00 0.00 ? 19  GLU A HA   1  
ATOM 250   H HB2  . GLU A 1 19  ? 87.947  19.264  2.186   1.00 0.00 ? 19  GLU A HB2  1  
ATOM 251   H HB3  . GLU A 1 19  ? 87.505  18.052  3.386   1.00 0.00 ? 19  GLU A HB3  1  
ATOM 252   H HG2  . GLU A 1 19  ? 89.830  18.412  3.726   1.00 0.00 ? 19  GLU A HG2  1  
ATOM 253   H HG3  . GLU A 1 19  ? 89.745  16.905  2.819   1.00 0.00 ? 19  GLU A HG3  1  
ATOM 254   N N    . ASN A 1 20  ? 85.589  18.664  0.992   1.00 0.00 ? 20  ASN A N    1  
ATOM 255   C CA   . ASN A 1 20  ? 84.154  18.916  0.868   1.00 0.00 ? 20  ASN A CA   1  
ATOM 256   C C    . ASN A 1 20  ? 83.633  18.431  -0.482  1.00 0.00 ? 20  ASN A C    1  
ATOM 257   O O    . ASN A 1 20  ? 83.008  19.190  -1.223  1.00 0.00 ? 20  ASN A O    1  
ATOM 258   C CB   . ASN A 1 20  ? 83.874  20.413  1.012   1.00 0.00 ? 20  ASN A CB   1  
ATOM 259   C CG   . ASN A 1 20  ? 84.486  20.924  2.317   1.00 0.00 ? 20  ASN A CG   1  
ATOM 260   O OD1  . ASN A 1 20  ? 83.955  20.688  3.384   1.00 0.00 ? 20  ASN A OD1  1  
ATOM 261   N ND2  . ASN A 1 20  ? 85.589  21.618  2.278   1.00 0.00 ? 20  ASN A ND2  1  
ATOM 262   H H    . ASN A 1 20  ? 86.217  19.407  0.880   1.00 0.00 ? 20  ASN A H    1  
ATOM 263   H HA   . ASN A 1 20  ? 83.633  18.388  1.653   1.00 0.00 ? 20  ASN A HA   1  
ATOM 264   H HB2  . ASN A 1 20  ? 84.309  20.943  0.178   1.00 0.00 ? 20  ASN A HB2  1  
ATOM 265   H HB3  . ASN A 1 20  ? 82.807  20.580  1.027   1.00 0.00 ? 20  ASN A HB3  1  
ATOM 266   H HD21 . ASN A 1 20  ? 86.018  21.809  1.417   1.00 0.00 ? 20  ASN A HD21 1  
ATOM 267   H HD22 . ASN A 1 20  ? 85.990  21.950  3.108   1.00 0.00 ? 20  ASN A HD22 1  
ATOM 268   N N    . LYS A 1 21  ? 83.891  17.164  -0.799  1.00 0.00 ? 21  LYS A N    1  
ATOM 269   C CA   . LYS A 1 21  ? 83.438  16.598  -2.066  1.00 0.00 ? 21  LYS A CA   1  
ATOM 270   C C    . LYS A 1 21  ? 83.483  15.069  -2.009  1.00 0.00 ? 21  LYS A C    1  
ATOM 271   O O    . LYS A 1 21  ? 84.441  14.487  -1.500  1.00 0.00 ? 21  LYS A O    1  
ATOM 272   C CB   . LYS A 1 21  ? 84.328  17.130  -3.215  1.00 0.00 ? 21  LYS A CB   1  
ATOM 273   C CG   . LYS A 1 21  ? 83.504  17.322  -4.496  1.00 0.00 ? 21  LYS A CG   1  
ATOM 274   C CD   . LYS A 1 21  ? 84.409  17.851  -5.616  1.00 0.00 ? 21  LYS A CD   1  
ATOM 275   C CE   . LYS A 1 21  ? 83.550  18.352  -6.780  1.00 0.00 ? 21  LYS A CE   1  
ATOM 276   N NZ   . LYS A 1 21  ? 82.854  19.607  -6.378  1.00 0.00 ? 21  LYS A NZ   1  
ATOM 277   H H    . LYS A 1 21  ? 84.394  16.603  -0.173  1.00 0.00 ? 21  LYS A H    1  
ATOM 278   H HA   . LYS A 1 21  ? 82.417  16.903  -2.232  1.00 0.00 ? 21  LYS A HA   1  
ATOM 279   H HB2  . LYS A 1 21  ? 84.748  18.080  -2.921  1.00 0.00 ? 21  LYS A HB2  1  
ATOM 280   H HB3  . LYS A 1 21  ? 85.134  16.435  -3.411  1.00 0.00 ? 21  LYS A HB3  1  
ATOM 281   H HG2  . LYS A 1 21  ? 83.076  16.375  -4.793  1.00 0.00 ? 21  LYS A HG2  1  
ATOM 282   H HG3  . LYS A 1 21  ? 82.711  18.032  -4.309  1.00 0.00 ? 21  LYS A HG3  1  
ATOM 283   H HD2  . LYS A 1 21  ? 85.012  18.664  -5.239  1.00 0.00 ? 21  LYS A HD2  1  
ATOM 284   H HD3  . LYS A 1 21  ? 85.053  17.057  -5.962  1.00 0.00 ? 21  LYS A HD3  1  
ATOM 285   H HE2  . LYS A 1 21  ? 84.181  18.547  -7.634  1.00 0.00 ? 21  LYS A HE2  1  
ATOM 286   H HE3  . LYS A 1 21  ? 82.819  17.601  -7.037  1.00 0.00 ? 21  LYS A HE3  1  
ATOM 287   H HZ1  . LYS A 1 21  ? 82.735  20.219  -7.210  1.00 0.00 ? 21  LYS A HZ1  1  
ATOM 288   H HZ2  . LYS A 1 21  ? 83.421  20.103  -5.660  1.00 0.00 ? 21  LYS A HZ2  1  
ATOM 289   H HZ3  . LYS A 1 21  ? 81.921  19.375  -5.985  1.00 0.00 ? 21  LYS A HZ3  1  
ATOM 290   N N    . HIS A 1 22  ? 82.439  14.425  -2.530  1.00 0.00 ? 22  HIS A N    1  
ATOM 291   C CA   . HIS A 1 22  ? 82.373  12.960  -2.525  1.00 0.00 ? 22  HIS A CA   1  
ATOM 292   C C    . HIS A 1 22  ? 81.432  12.457  -3.612  1.00 0.00 ? 22  HIS A C    1  
ATOM 293   O O    . HIS A 1 22  ? 80.261  12.836  -3.654  1.00 0.00 ? 22  HIS A O    1  
ATOM 294   C CB   . HIS A 1 22  ? 81.886  12.467  -1.161  1.00 0.00 ? 22  HIS A CB   1  
ATOM 295   C CG   . HIS A 1 22  ? 82.869  12.875  -0.099  1.00 0.00 ? 22  HIS A CG   1  
ATOM 296   N ND1  . HIS A 1 22  ? 82.622  13.927  0.770   1.00 0.00 ? 22  HIS A ND1  1  
ATOM 297   C CD2  . HIS A 1 22  ? 84.104  12.385  0.246   1.00 0.00 ? 22  HIS A CD2  1  
ATOM 298   C CE1  . HIS A 1 22  ? 83.686  14.035  1.588   1.00 0.00 ? 22  HIS A CE1  1  
ATOM 299   N NE2  . HIS A 1 22  ? 84.617  13.118  1.311   1.00 0.00 ? 22  HIS A NE2  1  
ATOM 300   H H    . HIS A 1 22  ? 81.699  14.943  -2.921  1.00 0.00 ? 22  HIS A H    1  
ATOM 301   H HA   . HIS A 1 22  ? 83.360  12.559  -2.708  1.00 0.00 ? 22  HIS A HA   1  
ATOM 302   H HB2  . HIS A 1 22  ? 80.920  12.900  -0.945  1.00 0.00 ? 22  HIS A HB2  1  
ATOM 303   H HB3  . HIS A 1 22  ? 81.801  11.390  -1.178  1.00 0.00 ? 22  HIS A HB3  1  
ATOM 304   H HD1  . HIS A 1 22  ? 81.820  14.490  0.786   1.00 0.00 ? 22  HIS A HD1  1  
ATOM 305   H HD2  . HIS A 1 22  ? 84.573  11.519  -0.196  1.00 0.00 ? 22  HIS A HD2  1  
ATOM 306   H HE1  . HIS A 1 22  ? 83.774  14.772  2.372   1.00 0.00 ? 22  HIS A HE1  1  
ATOM 307   N N    . HIS A 1 23  ? 81.949  11.609  -4.498  1.00 0.00 ? 23  HIS A N    1  
ATOM 308   C CA   . HIS A 1 23  ? 81.138  11.077  -5.584  1.00 0.00 ? 23  HIS A CA   1  
ATOM 309   C C    . HIS A 1 23  ? 80.009  10.208  -5.053  1.00 0.00 ? 23  HIS A C    1  
ATOM 310   O O    . HIS A 1 23  ? 80.233  9.096   -4.576  1.00 0.00 ? 23  HIS A O    1  
ATOM 311   C CB   . HIS A 1 23  ? 81.998  10.256  -6.548  1.00 0.00 ? 23  HIS A CB   1  
ATOM 312   C CG   . HIS A 1 23  ? 81.133  9.748   -7.673  1.00 0.00 ? 23  HIS A CG   1  
ATOM 313   N ND1  . HIS A 1 23  ? 79.906  10.319  -7.971  1.00 0.00 ? 23  HIS A ND1  1  
ATOM 314   C CD2  . HIS A 1 23  ? 81.299  8.722   -8.570  1.00 0.00 ? 23  HIS A CD2  1  
ATOM 315   C CE1  . HIS A 1 23  ? 79.385  9.643   -9.009  1.00 0.00 ? 23  HIS A CE1  1  
ATOM 316   N NE2  . HIS A 1 23  ? 80.193  8.660   -9.415  1.00 0.00 ? 23  HIS A NE2  1  
ATOM 317   H H    . HIS A 1 23  ? 82.891  11.346  -4.433  1.00 0.00 ? 23  HIS A H    1  
ATOM 318   H HA   . HIS A 1 23  ? 80.705  11.900  -6.127  1.00 0.00 ? 23  HIS A HA   1  
ATOM 319   H HB2  . HIS A 1 23  ? 82.784  10.879  -6.949  1.00 0.00 ? 23  HIS A HB2  1  
ATOM 320   H HB3  . HIS A 1 23  ? 82.433  9.419   -6.022  1.00 0.00 ? 23  HIS A HB3  1  
ATOM 321   H HD1  . HIS A 1 23  ? 79.493  11.078  -7.509  1.00 0.00 ? 23  HIS A HD1  1  
ATOM 322   H HD2  . HIS A 1 23  ? 82.061  7.964   -8.501  1.00 0.00 ? 23  HIS A HD2  1  
ATOM 323   H HE1  . HIS A 1 23  ? 78.431  9.866   -9.461  1.00 0.00 ? 23  HIS A HE1  1  
ATOM 324   N N    . MET A 1 24  ? 78.790  10.722  -5.166  1.00 0.00 ? 24  MET A N    1  
ATOM 325   C CA   . MET A 1 24  ? 77.612  9.990   -4.723  1.00 0.00 ? 24  MET A CA   1  
ATOM 326   C C    . MET A 1 24  ? 77.159  9.047   -5.827  1.00 0.00 ? 24  MET A C    1  
ATOM 327   O O    . MET A 1 24  ? 77.142  9.415   -7.001  1.00 0.00 ? 24  MET A O    1  
ATOM 328   C CB   . MET A 1 24  ? 76.487  10.970  -4.385  1.00 0.00 ? 24  MET A CB   1  
ATOM 329   C CG   . MET A 1 24  ? 76.866  11.773  -3.138  1.00 0.00 ? 24  MET A CG   1  
ATOM 330   S SD   . MET A 1 24  ? 76.814  10.692  -1.686  1.00 0.00 ? 24  MET A SD   1  
ATOM 331   C CE   . MET A 1 24  ? 75.069  10.939  -1.277  1.00 0.00 ? 24  MET A CE   1  
ATOM 332   H H    . MET A 1 24  ? 78.679  11.607  -5.572  1.00 0.00 ? 24  MET A H    1  
ATOM 333   H HA   . MET A 1 24  ? 77.853  9.413   -3.841  1.00 0.00 ? 24  MET A HA   1  
ATOM 334   H HB2  . MET A 1 24  ? 76.336  11.644  -5.216  1.00 0.00 ? 24  MET A HB2  1  
ATOM 335   H HB3  . MET A 1 24  ? 75.577  10.422  -4.197  1.00 0.00 ? 24  MET A HB3  1  
ATOM 336   H HG2  . MET A 1 24  ? 77.863  12.170  -3.254  1.00 0.00 ? 24  MET A HG2  1  
ATOM 337   H HG3  . MET A 1 24  ? 76.168  12.586  -3.008  1.00 0.00 ? 24  MET A HG3  1  
ATOM 338   H HE1  . MET A 1 24  ? 74.701  10.086  -0.727  1.00 0.00 ? 24  MET A HE1  1  
ATOM 339   H HE2  . MET A 1 24  ? 74.498  11.056  -2.186  1.00 0.00 ? 24  MET A HE2  1  
ATOM 340   H HE3  . MET A 1 24  ? 74.967  11.825  -0.674  1.00 0.00 ? 24  MET A HE3  1  
ATOM 341   N N    . GLY A 1 25  ? 76.796  7.826   -5.444  1.00 0.00 ? 25  GLY A N    1  
ATOM 342   C CA   . GLY A 1 25  ? 76.346  6.823   -6.400  1.00 0.00 ? 25  GLY A CA   1  
ATOM 343   C C    . GLY A 1 25  ? 75.105  6.115   -5.914  1.00 0.00 ? 25  GLY A C    1  
ATOM 344   O O    . GLY A 1 25  ? 74.839  6.070   -4.718  1.00 0.00 ? 25  GLY A O    1  
ATOM 345   H H    . GLY A 1 25  ? 76.833  7.596   -4.492  1.00 0.00 ? 25  GLY A H    1  
ATOM 346   H HA2  . GLY A 1 25  ? 76.130  7.288   -7.353  1.00 0.00 ? 25  GLY A HA2  1  
ATOM 347   H HA3  . GLY A 1 25  ? 77.131  6.095   -6.537  1.00 0.00 ? 25  GLY A HA3  1  
ATOM 348   N N    . ILE A 1 26  ? 74.344  5.558   -6.853  1.00 0.00 ? 26  ILE A N    1  
ATOM 349   C CA   . ILE A 1 26  ? 73.110  4.836   -6.527  1.00 0.00 ? 26  ILE A CA   1  
ATOM 350   C C    . ILE A 1 26  ? 73.312  3.352   -6.797  1.00 0.00 ? 26  ILE A C    1  
ATOM 351   O O    . ILE A 1 26  ? 74.104  2.978   -7.660  1.00 0.00 ? 26  ILE A O    1  
ATOM 352   C CB   . ILE A 1 26  ? 71.943  5.353   -7.402  1.00 0.00 ? 26  ILE A CB   1  
ATOM 353   C CG1  . ILE A 1 26  ? 70.629  4.623   -7.062  1.00 0.00 ? 26  ILE A CG1  1  
ATOM 354   C CG2  . ILE A 1 26  ? 72.274  5.120   -8.878  1.00 0.00 ? 26  ILE A CG2  1  
ATOM 355   C CD1  . ILE A 1 26  ? 70.229  4.872   -5.595  1.00 0.00 ? 26  ILE A CD1  1  
ATOM 356   H H    . ILE A 1 26  ? 74.617  5.630   -7.791  1.00 0.00 ? 26  ILE A H    1  
ATOM 357   H HA   . ILE A 1 26  ? 72.862  4.978   -5.485  1.00 0.00 ? 26  ILE A HA   1  
ATOM 358   H HB   . ILE A 1 26  ? 71.819  6.414   -7.232  1.00 0.00 ? 26  ILE A HB   1  
ATOM 359   H HG12 . ILE A 1 26  ? 69.847  4.994   -7.711  1.00 0.00 ? 26  ILE A HG12 1  
ATOM 360   H HG13 . ILE A 1 26  ? 70.747  3.563   -7.228  1.00 0.00 ? 26  ILE A HG13 1  
ATOM 361   H HG21 . ILE A 1 26  ? 71.565  5.652   -9.494  1.00 0.00 ? 26  ILE A HG21 1  
ATOM 362   H HG22 . ILE A 1 26  ? 72.221  4.064   -9.097  1.00 0.00 ? 26  ILE A HG22 1  
ATOM 363   H HG23 . ILE A 1 26  ? 73.272  5.480   -9.085  1.00 0.00 ? 26  ILE A HG23 1  
ATOM 364   H HD11 . ILE A 1 26  ? 70.500  5.878   -5.307  1.00 0.00 ? 26  ILE A HD11 1  
ATOM 365   H HD12 . ILE A 1 26  ? 70.736  4.165   -4.954  1.00 0.00 ? 26  ILE A HD12 1  
ATOM 366   H HD13 . ILE A 1 26  ? 69.161  4.747   -5.486  1.00 0.00 ? 26  ILE A HD13 1  
ATOM 367   N N    . ASP A 1 27  ? 72.598  2.510   -6.056  1.00 0.00 ? 27  ASP A N    1  
ATOM 368   C CA   . ASP A 1 27  ? 72.712  1.063   -6.232  1.00 0.00 ? 27  ASP A CA   1  
ATOM 369   C C    . ASP A 1 27  ? 71.459  0.369   -5.716  1.00 0.00 ? 27  ASP A C    1  
ATOM 370   O O    . ASP A 1 27  ? 71.238  0.282   -4.508  1.00 0.00 ? 27  ASP A O    1  
ATOM 371   C CB   . ASP A 1 27  ? 73.935  0.539   -5.475  1.00 0.00 ? 27  ASP A CB   1  
ATOM 372   C CG   . ASP A 1 27  ? 74.190  -0.920  -5.858  1.00 0.00 ? 27  ASP A CG   1  
ATOM 373   O OD1  . ASP A 1 27  ? 73.227  -1.662  -5.956  1.00 0.00 ? 27  ASP A OD1  1  
ATOM 374   O OD2  . ASP A 1 27  ? 75.343  -1.270  -6.045  1.00 0.00 ? 27  ASP A OD2  1  
ATOM 375   H H    . ASP A 1 27  ? 71.984  2.865   -5.381  1.00 0.00 ? 27  ASP A H    1  
ATOM 376   H HA   . ASP A 1 27  ? 72.827  0.838   -7.282  1.00 0.00 ? 27  ASP A HA   1  
ATOM 377   H HB2  . ASP A 1 27  ? 74.799  1.136   -5.731  1.00 0.00 ? 27  ASP A HB2  1  
ATOM 378   H HB3  . ASP A 1 27  ? 73.755  0.604   -4.412  1.00 0.00 ? 27  ASP A HB3  1  
ATOM 379   N N    . VAL A 1 28  ? 70.631  -0.112  -6.645  1.00 0.00 ? 28  VAL A N    1  
ATOM 380   C CA   . VAL A 1 28  ? 69.382  -0.790  -6.288  1.00 0.00 ? 28  VAL A CA   1  
ATOM 381   C C    . VAL A 1 28  ? 69.498  -2.301  -6.474  1.00 0.00 ? 28  VAL A C    1  
ATOM 382   O O    . VAL A 1 28  ? 70.208  -2.782  -7.357  1.00 0.00 ? 28  VAL A O    1  
ATOM 383   C CB   . VAL A 1 28  ? 68.214  -0.275  -7.161  1.00 0.00 ? 28  VAL A CB   1  
ATOM 384   C CG1  . VAL A 1 28  ? 68.555  -0.464  -8.641  1.00 0.00 ? 28  VAL A CG1  1  
ATOM 385   C CG2  . VAL A 1 28  ? 66.929  -1.050  -6.829  1.00 0.00 ? 28  VAL A CG2  1  
ATOM 386   H H    . VAL A 1 28  ? 70.857  0.005   -7.592  1.00 0.00 ? 28  VAL A H    1  
ATOM 387   H HA   . VAL A 1 28  ? 69.144  -0.589  -5.254  1.00 0.00 ? 28  VAL A HA   1  
ATOM 388   H HB   . VAL A 1 28  ? 68.061  0.776   -6.963  1.00 0.00 ? 28  VAL A HB   1  
ATOM 389   H HG11 . VAL A 1 28  ? 67.749  -0.077  -9.248  1.00 0.00 ? 28  VAL A HG11 1  
ATOM 390   H HG12 . VAL A 1 28  ? 68.689  -1.515  -8.850  1.00 0.00 ? 28  VAL A HG12 1  
ATOM 391   H HG13 . VAL A 1 28  ? 69.465  0.068   -8.872  1.00 0.00 ? 28  VAL A HG13 1  
ATOM 392   H HG21 . VAL A 1 28  ? 66.819  -1.125  -5.758  1.00 0.00 ? 28  VAL A HG21 1  
ATOM 393   H HG22 . VAL A 1 28  ? 66.984  -2.043  -7.253  1.00 0.00 ? 28  VAL A HG22 1  
ATOM 394   H HG23 . VAL A 1 28  ? 66.079  -0.529  -7.243  1.00 0.00 ? 28  VAL A HG23 1  
ATOM 395   N N    . ILE A 1 29  ? 68.764  -3.035  -5.638  1.00 0.00 ? 29  ILE A N    1  
ATOM 396   C CA   . ILE A 1 29  ? 68.733  -4.497  -5.691  1.00 0.00 ? 29  ILE A CA   1  
ATOM 397   C C    . ILE A 1 29  ? 67.312  -4.941  -6.017  1.00 0.00 ? 29  ILE A C    1  
ATOM 398   O O    . ILE A 1 29  ? 66.349  -4.294  -5.605  1.00 0.00 ? 29  ILE A O    1  
ATOM 399   C CB   . ILE A 1 29  ? 69.147  -5.109  -4.335  1.00 0.00 ? 29  ILE A CB   1  
ATOM 400   C CG1  . ILE A 1 29  ? 70.399  -4.385  -3.817  1.00 0.00 ? 29  ILE A CG1  1  
ATOM 401   C CG2  . ILE A 1 29  ? 69.444  -6.604  -4.504  1.00 0.00 ? 29  ILE A CG2  1  
ATOM 402   C CD1  . ILE A 1 29  ? 70.909  -5.061  -2.538  1.00 0.00 ? 29  ILE A CD1  1  
ATOM 403   H H    . ILE A 1 29  ? 68.210  -2.577  -4.974  1.00 0.00 ? 29  ILE A H    1  
ATOM 404   H HA   . ILE A 1 29  ? 69.403  -4.856  -6.465  1.00 0.00 ? 29  ILE A HA   1  
ATOM 405   H HB   . ILE A 1 29  ? 68.343  -4.987  -3.623  1.00 0.00 ? 29  ILE A HB   1  
ATOM 406   H HG12 . ILE A 1 29  ? 71.171  -4.419  -4.574  1.00 0.00 ? 29  ILE A HG12 1  
ATOM 407   H HG13 . ILE A 1 29  ? 70.154  -3.356  -3.604  1.00 0.00 ? 29  ILE A HG13 1  
ATOM 408   H HG21 . ILE A 1 29  ? 70.399  -6.729  -4.993  1.00 0.00 ? 29  ILE A HG21 1  
ATOM 409   H HG22 . ILE A 1 29  ? 68.670  -7.061  -5.105  1.00 0.00 ? 29  ILE A HG22 1  
ATOM 410   H HG23 . ILE A 1 29  ? 69.471  -7.078  -3.535  1.00 0.00 ? 29  ILE A HG23 1  
ATOM 411   H HD11 . ILE A 1 29  ? 70.077  -5.295  -1.891  1.00 0.00 ? 29  ILE A HD11 1  
ATOM 412   H HD12 . ILE A 1 29  ? 71.584  -4.394  -2.024  1.00 0.00 ? 29  ILE A HD12 1  
ATOM 413   H HD13 . ILE A 1 29  ? 71.433  -5.971  -2.795  1.00 0.00 ? 29  ILE A HD13 1  
ATOM 414   N N    . ILE A 1 30  ? 67.173  -6.033  -6.764  1.00 0.00 ? 30  ILE A N    1  
ATOM 415   C CA   . ILE A 1 30  ? 65.844  -6.522  -7.138  1.00 0.00 ? 30  ILE A CA   1  
ATOM 416   C C    . ILE A 1 30  ? 65.821  -8.046  -7.204  1.00 0.00 ? 30  ILE A C    1  
ATOM 417   O O    . ILE A 1 30  ? 66.371  -8.640  -8.127  1.00 0.00 ? 30  ILE A O    1  
ATOM 418   C CB   . ILE A 1 30  ? 65.432  -5.958  -8.521  1.00 0.00 ? 30  ILE A CB   1  
ATOM 419   C CG1  . ILE A 1 30  ? 65.853  -4.482  -8.610  1.00 0.00 ? 30  ILE A CG1  1  
ATOM 420   C CG2  . ILE A 1 30  ? 63.911  -6.074  -8.707  1.00 0.00 ? 30  ILE A CG2  1  
ATOM 421   C CD1  . ILE A 1 30  ? 65.355  -3.872  -9.925  1.00 0.00 ? 30  ILE A CD1  1  
ATOM 422   H H    . ILE A 1 30  ? 67.970  -6.511  -7.078  1.00 0.00 ? 30  ILE A H    1  
ATOM 423   H HA   . ILE A 1 30  ? 65.120  -6.200  -6.399  1.00 0.00 ? 30  ILE A HA   1  
ATOM 424   H HB   . ILE A 1 30  ? 65.929  -6.517  -9.302  1.00 0.00 ? 30  ILE A HB   1  
ATOM 425   H HG12 . ILE A 1 30  ? 65.431  -3.937  -7.779  1.00 0.00 ? 30  ILE A HG12 1  
ATOM 426   H HG13 . ILE A 1 30  ? 66.931  -4.415  -8.574  1.00 0.00 ? 30  ILE A HG13 1  
ATOM 427   H HG21 . ILE A 1 30  ? 63.416  -5.302  -8.137  1.00 0.00 ? 30  ILE A HG21 1  
ATOM 428   H HG22 . ILE A 1 30  ? 63.578  -7.044  -8.365  1.00 0.00 ? 30  ILE A HG22 1  
ATOM 429   H HG23 . ILE A 1 30  ? 63.667  -5.962  -9.753  1.00 0.00 ? 30  ILE A HG23 1  
ATOM 430   H HD11 . ILE A 1 30  ? 65.546  -4.556  -10.740 1.00 0.00 ? 30  ILE A HD11 1  
ATOM 431   H HD12 . ILE A 1 30  ? 65.874  -2.943  -10.110 1.00 0.00 ? 30  ILE A HD12 1  
ATOM 432   H HD13 . ILE A 1 30  ? 64.294  -3.682  -9.855  1.00 0.00 ? 30  ILE A HD13 1  
ATOM 433   N N    . LYS A 1 31  ? 65.160  -8.673  -6.226  1.00 0.00 ? 31  LYS A N    1  
ATOM 434   C CA   . LYS A 1 31  ? 65.043  -10.135 -6.185  1.00 0.00 ? 31  LYS A CA   1  
ATOM 435   C C    . LYS A 1 31  ? 63.625  -10.540 -6.570  1.00 0.00 ? 31  LYS A C    1  
ATOM 436   O O    . LYS A 1 31  ? 62.716  -10.528 -5.741  1.00 0.00 ? 31  LYS A O    1  
ATOM 437   C CB   . LYS A 1 31  ? 65.354  -10.647 -4.777  1.00 0.00 ? 31  LYS A CB   1  
ATOM 438   C CG   . LYS A 1 31  ? 65.406  -12.177 -4.790  1.00 0.00 ? 31  LYS A CG   1  
ATOM 439   C CD   . LYS A 1 31  ? 65.816  -12.686 -3.405  1.00 0.00 ? 31  LYS A CD   1  
ATOM 440   C CE   . LYS A 1 31  ? 66.073  -14.193 -3.472  1.00 0.00 ? 31  LYS A CE   1  
ATOM 441   N NZ   . LYS A 1 31  ? 64.829  -14.891 -3.905  1.00 0.00 ? 31  LYS A NZ   1  
ATOM 442   H H    . LYS A 1 31  ? 64.730  -8.144  -5.523  1.00 0.00 ? 31  LYS A H    1  
ATOM 443   H HA   . LYS A 1 31  ? 65.738  -10.584 -6.883  1.00 0.00 ? 31  LYS A HA   1  
ATOM 444   H HB2  . LYS A 1 31  ? 66.308  -10.256 -4.455  1.00 0.00 ? 31  LYS A HB2  1  
ATOM 445   H HB3  . LYS A 1 31  ? 64.583  -10.321 -4.096  1.00 0.00 ? 31  LYS A HB3  1  
ATOM 446   H HG2  . LYS A 1 31  ? 64.432  -12.568 -5.044  1.00 0.00 ? 31  LYS A HG2  1  
ATOM 447   H HG3  . LYS A 1 31  ? 66.129  -12.506 -5.520  1.00 0.00 ? 31  LYS A HG3  1  
ATOM 448   H HD2  . LYS A 1 31  ? 66.716  -12.180 -3.088  1.00 0.00 ? 31  LYS A HD2  1  
ATOM 449   H HD3  . LYS A 1 31  ? 65.023  -12.489 -2.701  1.00 0.00 ? 31  LYS A HD3  1  
ATOM 450   H HE2  . LYS A 1 31  ? 66.863  -14.392 -4.181  1.00 0.00 ? 31  LYS A HE2  1  
ATOM 451   H HE3  . LYS A 1 31  ? 66.366  -14.551 -2.496  1.00 0.00 ? 31  LYS A HE3  1  
ATOM 452   H HZ1  . LYS A 1 31  ? 64.733  -15.785 -3.384  1.00 0.00 ? 31  LYS A HZ1  1  
ATOM 453   H HZ2  . LYS A 1 31  ? 64.880  -15.086 -4.926  1.00 0.00 ? 31  LYS A HZ2  1  
ATOM 454   H HZ3  . LYS A 1 31  ? 64.006  -14.288 -3.707  1.00 0.00 ? 31  LYS A HZ3  1  
ATOM 455   N N    . VAL A 1 32  ? 63.443  -10.874 -7.844  1.00 0.00 ? 32  VAL A N    1  
ATOM 456   C CA   . VAL A 1 32  ? 62.127  -11.257 -8.360  1.00 0.00 ? 32  VAL A CA   1  
ATOM 457   C C    . VAL A 1 32  ? 61.907  -12.767 -8.266  1.00 0.00 ? 32  VAL A C    1  
ATOM 458   O O    . VAL A 1 32  ? 62.775  -13.557 -8.636  1.00 0.00 ? 32  VAL A O    1  
ATOM 459   C CB   . VAL A 1 32  ? 61.988  -10.825 -9.838  1.00 0.00 ? 32  VAL A CB   1  
ATOM 460   C CG1  . VAL A 1 32  ? 60.516  -10.847 -10.262 1.00 0.00 ? 32  VAL A CG1  1  
ATOM 461   C CG2  . VAL A 1 32  ? 62.544  -9.407  -10.003 1.00 0.00 ? 32  VAL A CG2  1  
ATOM 462   H H    . VAL A 1 32  ? 64.211  -10.840 -8.452  1.00 0.00 ? 32  VAL A H    1  
ATOM 463   H HA   . VAL A 1 32  ? 61.362  -10.759 -7.781  1.00 0.00 ? 32  VAL A HA   1  
ATOM 464   H HB   . VAL A 1 32  ? 62.549  -11.502 -10.465 1.00 0.00 ? 32  VAL A HB   1  
ATOM 465   H HG11 . VAL A 1 32  ? 59.925  -10.277 -9.563  1.00 0.00 ? 32  VAL A HG11 1  
ATOM 466   H HG12 . VAL A 1 32  ? 60.163  -11.867 -10.284 1.00 0.00 ? 32  VAL A HG12 1  
ATOM 467   H HG13 . VAL A 1 32  ? 60.423  -10.413 -11.245 1.00 0.00 ? 32  VAL A HG13 1  
ATOM 468   H HG21 . VAL A 1 32  ? 62.065  -8.747  -9.297  1.00 0.00 ? 32  VAL A HG21 1  
ATOM 469   H HG22 . VAL A 1 32  ? 62.354  -9.059  -11.007 1.00 0.00 ? 32  VAL A HG22 1  
ATOM 470   H HG23 . VAL A 1 32  ? 63.609  -9.416  -9.821  1.00 0.00 ? 32  VAL A HG23 1  
ATOM 471   N N    . THR A 1 33  ? 60.726  -13.154 -7.779  1.00 0.00 ? 33  THR A N    1  
ATOM 472   C CA   . THR A 1 33  ? 60.358  -14.568 -7.643  1.00 0.00 ? 33  THR A CA   1  
ATOM 473   C C    . THR A 1 33  ? 59.207  -14.893 -8.590  1.00 0.00 ? 33  THR A C    1  
ATOM 474   O O    . THR A 1 33  ? 58.141  -14.282 -8.518  1.00 0.00 ? 33  THR A O    1  
ATOM 475   C CB   . THR A 1 33  ? 59.905  -14.881 -6.204  1.00 0.00 ? 33  THR A CB   1  
ATOM 476   O OG1  . THR A 1 33  ? 60.897  -14.439 -5.290  1.00 0.00 ? 33  THR A OG1  1  
ATOM 477   C CG2  . THR A 1 33  ? 59.693  -16.387 -6.044  1.00 0.00 ? 33  THR A CG2  1  
ATOM 478   H H    . THR A 1 33  ? 60.076  -12.469 -7.514  1.00 0.00 ? 33  THR A H    1  
ATOM 479   H HA   . THR A 1 33  ? 61.204  -15.198 -7.887  1.00 0.00 ? 33  THR A HA   1  
ATOM 480   H HB   . THR A 1 33  ? 58.978  -14.370 -6.005  1.00 0.00 ? 33  THR A HB   1  
ATOM 481   H HG1  . THR A 1 33  ? 61.294  -15.213 -4.885  1.00 0.00 ? 33  THR A HG1  1  
ATOM 482   H HG21 . THR A 1 33  ? 58.898  -16.711 -6.696  1.00 0.00 ? 33  THR A HG21 1  
ATOM 483   H HG22 . THR A 1 33  ? 59.431  -16.606 -5.019  1.00 0.00 ? 33  THR A HG22 1  
ATOM 484   H HG23 . THR A 1 33  ? 60.603  -16.907 -6.300  1.00 0.00 ? 33  THR A HG23 1  
ATOM 485   N N    . LYS A 1 34  ? 59.429  -15.854 -9.481  1.00 0.00 ? 34  LYS A N    1  
ATOM 486   C CA   . LYS A 1 34  ? 58.404  -16.247 -10.444 1.00 0.00 ? 34  LYS A CA   1  
ATOM 487   C C    . LYS A 1 34  ? 57.350  -17.128 -9.781  1.00 0.00 ? 34  LYS A C    1  
ATOM 488   O O    . LYS A 1 34  ? 57.641  -17.853 -8.830  1.00 0.00 ? 34  LYS A O    1  
ATOM 489   C CB   . LYS A 1 34  ? 59.043  -17.016 -11.607 1.00 0.00 ? 34  LYS A CB   1  
ATOM 490   C CG   . LYS A 1 34  ? 60.128  -16.155 -12.271 1.00 0.00 ? 34  LYS A CG   1  
ATOM 491   C CD   . LYS A 1 34  ? 61.017  -17.029 -13.165 1.00 0.00 ? 34  LYS A CD   1  
ATOM 492   C CE   . LYS A 1 34  ? 60.167  -17.722 -14.236 1.00 0.00 ? 34  LYS A CE   1  
ATOM 493   N NZ   . LYS A 1 34  ? 59.208  -16.746 -14.825 1.00 0.00 ? 34  LYS A NZ   1  
ATOM 494   H H    . LYS A 1 34  ? 60.300  -16.305 -9.492  1.00 0.00 ? 34  LYS A H    1  
ATOM 495   H HA   . LYS A 1 34  ? 57.926  -15.361 -10.835 1.00 0.00 ? 34  LYS A HA   1  
ATOM 496   H HB2  . LYS A 1 34  ? 59.482  -17.930 -11.233 1.00 0.00 ? 34  LYS A HB2  1  
ATOM 497   H HB3  . LYS A 1 34  ? 58.282  -17.254 -12.335 1.00 0.00 ? 34  LYS A HB3  1  
ATOM 498   H HG2  . LYS A 1 34  ? 59.661  -15.388 -12.868 1.00 0.00 ? 34  LYS A HG2  1  
ATOM 499   H HG3  . LYS A 1 34  ? 60.740  -15.692 -11.510 1.00 0.00 ? 34  LYS A HG3  1  
ATOM 500   H HD2  . LYS A 1 34  ? 61.762  -16.411 -13.643 1.00 0.00 ? 34  LYS A HD2  1  
ATOM 501   H HD3  . LYS A 1 34  ? 61.507  -17.777 -12.560 1.00 0.00 ? 34  LYS A HD3  1  
ATOM 502   H HE2  . LYS A 1 34  ? 60.813  -18.103 -15.013 1.00 0.00 ? 34  LYS A HE2  1  
ATOM 503   H HE3  . LYS A 1 34  ? 59.623  -18.541 -13.790 1.00 0.00 ? 34  LYS A HE3  1  
ATOM 504   H HZ1  . LYS A 1 34  ? 58.542  -16.429 -14.092 1.00 0.00 ? 34  LYS A HZ1  1  
ATOM 505   H HZ2  . LYS A 1 34  ? 58.681  -17.203 -15.598 1.00 0.00 ? 34  LYS A HZ2  1  
ATOM 506   H HZ3  . LYS A 1 34  ? 59.728  -15.927 -15.194 1.00 0.00 ? 34  LYS A HZ3  1  
ATOM 507   N N    . GLN A 1 35  ? 56.125  -17.069 -10.299 1.00 0.00 ? 35  GLN A N    1  
ATOM 508   C CA   . GLN A 1 35  ? 55.031  -17.875 -9.760  1.00 0.00 ? 35  GLN A CA   1  
ATOM 509   C C    . GLN A 1 35  ? 55.135  -19.302 -10.303 1.00 0.00 ? 35  GLN A C    1  
ATOM 510   O O    . GLN A 1 35  ? 55.615  -19.512 -11.415 1.00 0.00 ? 35  GLN A O    1  
ATOM 511   C CB   . GLN A 1 35  ? 53.681  -17.242 -10.159 1.00 0.00 ? 35  GLN A CB   1  
ATOM 512   C CG   . GLN A 1 35  ? 52.562  -17.678 -9.200  1.00 0.00 ? 35  GLN A CG   1  
ATOM 513   C CD   . GLN A 1 35  ? 52.251  -19.162 -9.403  1.00 0.00 ? 35  GLN A CD   1  
ATOM 514   O OE1  . GLN A 1 35  ? 52.371  -19.676 -10.498 1.00 0.00 ? 35  GLN A OE1  1  
ATOM 515   N NE2  . GLN A 1 35  ? 51.857  -19.878 -8.386  1.00 0.00 ? 35  GLN A NE2  1  
ATOM 516   H H    . GLN A 1 35  ? 55.956  -16.481 -11.064 1.00 0.00 ? 35  GLN A H    1  
ATOM 517   H HA   . GLN A 1 35  ? 55.111  -17.902 -8.683  1.00 0.00 ? 35  GLN A HA   1  
ATOM 518   H HB2  . GLN A 1 35  ? 53.775  -16.166 -10.125 1.00 0.00 ? 35  GLN A HB2  1  
ATOM 519   H HB3  . GLN A 1 35  ? 53.423  -17.541 -11.166 1.00 0.00 ? 35  GLN A HB3  1  
ATOM 520   H HG2  . GLN A 1 35  ? 52.869  -17.510 -8.179  1.00 0.00 ? 35  GLN A HG2  1  
ATOM 521   H HG3  . GLN A 1 35  ? 51.673  -17.099 -9.405  1.00 0.00 ? 35  GLN A HG3  1  
ATOM 522   H HE21 . GLN A 1 35  ? 51.761  -19.464 -7.503  1.00 0.00 ? 35  GLN A HE21 1  
ATOM 523   H HE22 . GLN A 1 35  ? 51.655  -20.830 -8.505  1.00 0.00 ? 35  GLN A HE22 1  
ATOM 524   N N    . ASP A 1 36  ? 54.694  -20.275 -9.512  1.00 0.00 ? 36  ASP A N    1  
ATOM 525   C CA   . ASP A 1 36  ? 54.753  -21.674 -9.930  1.00 0.00 ? 36  ASP A CA   1  
ATOM 526   C C    . ASP A 1 36  ? 53.708  -21.961 -11.005 1.00 0.00 ? 36  ASP A C    1  
ATOM 527   O O    . ASP A 1 36  ? 52.772  -22.729 -10.784 1.00 0.00 ? 36  ASP A O    1  
ATOM 528   C CB   . ASP A 1 36  ? 54.513  -22.588 -8.727  1.00 0.00 ? 36  ASP A CB   1  
ATOM 529   C CG   . ASP A 1 36  ? 54.755  -24.042 -9.134  1.00 0.00 ? 36  ASP A CG   1  
ATOM 530   O OD1  . ASP A 1 36  ? 53.841  -24.648 -9.671  1.00 0.00 ? 36  ASP A OD1  1  
ATOM 531   O OD2  . ASP A 1 36  ? 55.851  -24.528 -8.902  1.00 0.00 ? 36  ASP A OD2  1  
ATOM 532   H H    . ASP A 1 36  ? 54.327  -20.051 -8.631  1.00 0.00 ? 36  ASP A H    1  
ATOM 533   H HA   . ASP A 1 36  ? 55.734  -21.878 -10.332 1.00 0.00 ? 36  ASP A HA   1  
ATOM 534   H HB2  . ASP A 1 36  ? 55.189  -22.319 -7.929  1.00 0.00 ? 36  ASP A HB2  1  
ATOM 535   H HB3  . ASP A 1 36  ? 53.493  -22.477 -8.388  1.00 0.00 ? 36  ASP A HB3  1  
ATOM 536   N N    . GLN A 1 37  ? 53.875  -21.343 -12.168 1.00 0.00 ? 37  GLN A N    1  
ATOM 537   C CA   . GLN A 1 37  ? 52.945  -21.538 -13.273 1.00 0.00 ? 37  GLN A CA   1  
ATOM 538   C C    . GLN A 1 37  ? 53.481  -20.870 -14.533 1.00 0.00 ? 37  GLN A C    1  
ATOM 539   O O    . GLN A 1 37  ? 53.118  -21.240 -15.649 1.00 0.00 ? 37  GLN A O    1  
ATOM 540   C CB   . GLN A 1 37  ? 51.577  -20.946 -12.919 1.00 0.00 ? 37  GLN A CB   1  
ATOM 541   C CG   . GLN A 1 37  ? 50.594  -21.212 -14.061 1.00 0.00 ? 37  GLN A CG   1  
ATOM 542   C CD   . GLN A 1 37  ? 49.178  -20.848 -13.610 1.00 0.00 ? 37  GLN A CD   1  
ATOM 543   O OE1  . GLN A 1 37  ? 48.210  -21.362 -14.135 1.00 0.00 ? 37  GLN A OE1  1  
ATOM 544   N NE2  . GLN A 1 37  ? 49.014  -19.977 -12.652 1.00 0.00 ? 37  GLN A NE2  1  
ATOM 545   H H    . GLN A 1 37  ? 54.639  -20.746 -12.288 1.00 0.00 ? 37  GLN A H    1  
ATOM 546   H HA   . GLN A 1 37  ? 52.831  -22.595 -13.456 1.00 0.00 ? 37  GLN A HA   1  
ATOM 547   H HB2  . GLN A 1 37  ? 51.211  -21.405 -12.013 1.00 0.00 ? 37  GLN A HB2  1  
ATOM 548   H HB3  . GLN A 1 37  ? 51.674  -19.881 -12.770 1.00 0.00 ? 37  GLN A HB3  1  
ATOM 549   H HG2  . GLN A 1 37  ? 50.866  -20.610 -14.917 1.00 0.00 ? 37  GLN A HG2  1  
ATOM 550   H HG3  . GLN A 1 37  ? 50.628  -22.256 -14.330 1.00 0.00 ? 37  GLN A HG3  1  
ATOM 551   H HE21 . GLN A 1 37  ? 49.793  -19.562 -12.228 1.00 0.00 ? 37  GLN A HE21 1  
ATOM 552   H HE22 . GLN A 1 37  ? 48.110  -19.739 -12.357 1.00 0.00 ? 37  GLN A HE22 1  
ATOM 553   N N    . THR A 1 38  ? 54.349  -19.879 -14.343 1.00 0.00 ? 38  THR A N    1  
ATOM 554   C CA   . THR A 1 38  ? 54.937  -19.158 -15.466 1.00 0.00 ? 38  THR A CA   1  
ATOM 555   C C    . THR A 1 38  ? 56.013  -20.022 -16.148 1.00 0.00 ? 38  THR A C    1  
ATOM 556   O O    . THR A 1 38  ? 56.973  -20.426 -15.491 1.00 0.00 ? 38  THR A O    1  
ATOM 557   C CB   . THR A 1 38  ? 55.600  -17.855 -14.985 1.00 0.00 ? 38  THR A CB   1  
ATOM 558   O OG1  . THR A 1 38  ? 54.666  -17.104 -14.222 1.00 0.00 ? 38  THR A OG1  1  
ATOM 559   C CG2  . THR A 1 38  ? 56.053  -17.034 -16.194 1.00 0.00 ? 38  THR A CG2  1  
ATOM 560   H H    . THR A 1 38  ? 54.599  -19.629 -13.429 1.00 0.00 ? 38  THR A H    1  
ATOM 561   H HA   . THR A 1 38  ? 54.157  -18.910 -16.162 1.00 0.00 ? 38  THR A HA   1  
ATOM 562   H HB   . THR A 1 38  ? 56.458  -18.090 -14.374 1.00 0.00 ? 38  THR A HB   1  
ATOM 563   H HG1  . THR A 1 38  ? 54.420  -17.627 -13.456 1.00 0.00 ? 38  THR A HG1  1  
ATOM 564   H HG21 . THR A 1 38  ? 56.399  -16.066 -15.862 1.00 0.00 ? 38  THR A HG21 1  
ATOM 565   H HG22 . THR A 1 38  ? 55.222  -16.907 -16.873 1.00 0.00 ? 38  THR A HG22 1  
ATOM 566   H HG23 . THR A 1 38  ? 56.856  -17.549 -16.699 1.00 0.00 ? 38  THR A HG23 1  
ATOM 567   N N    . PRO A 1 39  ? 55.891  -20.326 -17.465 1.00 0.00 ? 39  PRO A N    1  
ATOM 568   C CA   . PRO A 1 39  ? 56.890  -21.146 -18.169 1.00 0.00 ? 39  PRO A CA   1  
ATOM 569   C C    . PRO A 1 39  ? 58.321  -20.814 -17.740 1.00 0.00 ? 39  PRO A C    1  
ATOM 570   O O    . PRO A 1 39  ? 58.585  -19.734 -17.213 1.00 0.00 ? 39  PRO A O    1  
ATOM 571   C CB   . PRO A 1 39  ? 56.653  -20.802 -19.644 1.00 0.00 ? 39  PRO A CB   1  
ATOM 572   C CG   . PRO A 1 39  ? 55.184  -20.540 -19.727 1.00 0.00 ? 39  PRO A CG   1  
ATOM 573   C CD   . PRO A 1 39  ? 54.796  -19.916 -18.375 1.00 0.00 ? 39  PRO A CD   1  
ATOM 574   H HA   . PRO A 1 39  ? 56.690  -22.193 -18.009 1.00 0.00 ? 39  PRO A HA   1  
ATOM 575   H HB2  . PRO A 1 39  ? 57.215  -19.914 -19.919 1.00 0.00 ? 39  PRO A HB2  1  
ATOM 576   H HB3  . PRO A 1 39  ? 56.925  -21.632 -20.281 1.00 0.00 ? 39  PRO A HB3  1  
ATOM 577   H HG2  . PRO A 1 39  ? 54.968  -19.857 -20.541 1.00 0.00 ? 39  PRO A HG2  1  
ATOM 578   H HG3  . PRO A 1 39  ? 54.645  -21.467 -19.868 1.00 0.00 ? 39  PRO A HG3  1  
ATOM 579   H HD2  . PRO A 1 39  ? 54.751  -18.836 -18.453 1.00 0.00 ? 39  PRO A HD2  1  
ATOM 580   H HD3  . PRO A 1 39  ? 53.852  -20.310 -18.026 1.00 0.00 ? 39  PRO A HD3  1  
ATOM 581   N N    . THR A 1 40  ? 59.236  -21.750 -17.974 1.00 0.00 ? 40  THR A N    1  
ATOM 582   C CA   . THR A 1 40  ? 60.635  -21.546 -17.611 1.00 0.00 ? 40  THR A CA   1  
ATOM 583   C C    . THR A 1 40  ? 61.294  -20.560 -18.571 1.00 0.00 ? 40  THR A C    1  
ATOM 584   O O    . THR A 1 40  ? 60.950  -20.506 -19.752 1.00 0.00 ? 40  THR A O    1  
ATOM 585   C CB   . THR A 1 40  ? 61.414  -22.873 -17.657 1.00 0.00 ? 40  THR A CB   1  
ATOM 586   O OG1  . THR A 1 40  ? 62.775  -22.633 -17.325 1.00 0.00 ? 40  THR A OG1  1  
ATOM 587   C CG2  . THR A 1 40  ? 61.327  -23.471 -19.061 1.00 0.00 ? 40  THR A CG2  1  
ATOM 588   H H    . THR A 1 40  ? 58.967  -22.591 -18.399 1.00 0.00 ? 40  THR A H    1  
ATOM 589   H HA   . THR A 1 40  ? 60.684  -21.147 -16.609 1.00 0.00 ? 40  THR A HA   1  
ATOM 590   H HB   . THR A 1 40  ? 60.988  -23.566 -16.948 1.00 0.00 ? 40  THR A HB   1  
ATOM 591   H HG1  . THR A 1 40  ? 63.156  -22.083 -18.014 1.00 0.00 ? 40  THR A HG1  1  
ATOM 592   H HG21 . THR A 1 40  ? 61.708  -24.482 -19.046 1.00 0.00 ? 40  THR A HG21 1  
ATOM 593   H HG22 . THR A 1 40  ? 61.916  -22.876 -19.744 1.00 0.00 ? 40  THR A HG22 1  
ATOM 594   H HG23 . THR A 1 40  ? 60.297  -23.479 -19.386 1.00 0.00 ? 40  THR A HG23 1  
ATOM 595   N N    . ASN A 1 41  ? 62.240  -19.780 -18.057 1.00 0.00 ? 41  ASN A N    1  
ATOM 596   C CA   . ASN A 1 41  ? 62.935  -18.799 -18.883 1.00 0.00 ? 41  ASN A CA   1  
ATOM 597   C C    . ASN A 1 41  ? 64.068  -18.140 -18.093 1.00 0.00 ? 41  ASN A C    1  
ATOM 598   O O    . ASN A 1 41  ? 63.833  -17.246 -17.282 1.00 0.00 ? 41  ASN A O    1  
ATOM 599   C CB   . ASN A 1 41  ? 61.939  -17.734 -19.367 1.00 0.00 ? 41  ASN A CB   1  
ATOM 600   C CG   . ASN A 1 41  ? 60.983  -17.375 -18.227 1.00 0.00 ? 41  ASN A CG   1  
ATOM 601   O OD1  . ASN A 1 41  ? 59.852  -17.817 -18.206 1.00 0.00 ? 41  ASN A OD1  1  
ATOM 602   N ND2  . ASN A 1 41  ? 61.391  -16.586 -17.271 1.00 0.00 ? 41  ASN A ND2  1  
ATOM 603   H H    . ASN A 1 41  ? 62.473  -19.864 -17.110 1.00 0.00 ? 41  ASN A H    1  
ATOM 604   H HA   . ASN A 1 41  ? 63.357  -19.300 -19.742 1.00 0.00 ? 41  ASN A HA   1  
ATOM 605   H HB2  . ASN A 1 41  ? 62.471  -16.847 -19.687 1.00 0.00 ? 41  ASN A HB2  1  
ATOM 606   H HB3  . ASN A 1 41  ? 61.368  -18.126 -20.197 1.00 0.00 ? 41  ASN A HB3  1  
ATOM 607   H HD21 . ASN A 1 41  ? 62.302  -16.227 -17.287 1.00 0.00 ? 41  ASN A HD21 1  
ATOM 608   H HD22 . ASN A 1 41  ? 60.786  -16.352 -16.537 1.00 0.00 ? 41  ASN A HD22 1  
ATOM 609   N N    . ASP A 1 42  ? 65.299  -18.594 -18.343 1.00 0.00 ? 42  ASP A N    1  
ATOM 610   C CA   . ASP A 1 42  ? 66.481  -18.054 -17.658 1.00 0.00 ? 42  ASP A CA   1  
ATOM 611   C C    . ASP A 1 42  ? 67.367  -17.294 -18.641 1.00 0.00 ? 42  ASP A C    1  
ATOM 612   O O    . ASP A 1 42  ? 68.574  -17.169 -18.435 1.00 0.00 ? 42  ASP A O    1  
ATOM 613   C CB   . ASP A 1 42  ? 67.285  -19.201 -17.038 1.00 0.00 ? 42  ASP A CB   1  
ATOM 614   C CG   . ASP A 1 42  ? 67.601  -20.242 -18.113 1.00 0.00 ? 42  ASP A CG   1  
ATOM 615   O OD1  . ASP A 1 42  ? 67.483  -19.914 -19.282 1.00 0.00 ? 42  ASP A OD1  1  
ATOM 616   O OD2  . ASP A 1 42  ? 67.958  -21.351 -17.749 1.00 0.00 ? 42  ASP A OD2  1  
ATOM 617   H H    . ASP A 1 42  ? 65.416  -19.310 -19.000 1.00 0.00 ? 42  ASP A H    1  
ATOM 618   H HA   . ASP A 1 42  ? 66.176  -17.379 -16.869 1.00 0.00 ? 42  ASP A HA   1  
ATOM 619   H HB2  . ASP A 1 42  ? 68.207  -18.813 -16.628 1.00 0.00 ? 42  ASP A HB2  1  
ATOM 620   H HB3  . ASP A 1 42  ? 66.706  -19.662 -16.252 1.00 0.00 ? 42  ASP A HB3  1  
ATOM 621   N N    . LYS A 1 43  ? 66.760  -16.791 -19.715 1.00 0.00 ? 43  LYS A N    1  
ATOM 622   C CA   . LYS A 1 43  ? 67.499  -16.044 -20.735 1.00 0.00 ? 43  LYS A CA   1  
ATOM 623   C C    . LYS A 1 43  ? 67.608  -14.568 -20.358 1.00 0.00 ? 43  LYS A C    1  
ATOM 624   O O    . LYS A 1 43  ? 67.226  -13.692 -21.134 1.00 0.00 ? 43  LYS A O    1  
ATOM 625   C CB   . LYS A 1 43  ? 66.788  -16.172 -22.083 1.00 0.00 ? 43  LYS A CB   1  
ATOM 626   C CG   . LYS A 1 43  ? 66.719  -17.646 -22.485 1.00 0.00 ? 43  LYS A CG   1  
ATOM 627   C CD   . LYS A 1 43  ? 65.812  -17.801 -23.707 1.00 0.00 ? 43  LYS A CD   1  
ATOM 628   C CE   . LYS A 1 43  ? 65.640  -19.288 -24.030 1.00 0.00 ? 43  LYS A CE   1  
ATOM 629   N NZ   . LYS A 1 43  ? 66.978  -19.941 -24.084 1.00 0.00 ? 43  LYS A NZ   1  
ATOM 630   H H    . LYS A 1 43  ? 65.795  -16.925 -19.826 1.00 0.00 ? 43  LYS A H    1  
ATOM 631   H HA   . LYS A 1 43  ? 68.494  -16.455 -20.829 1.00 0.00 ? 43  LYS A HA   1  
ATOM 632   H HB2  . LYS A 1 43  ? 65.788  -15.772 -22.001 1.00 0.00 ? 43  LYS A HB2  1  
ATOM 633   H HB3  . LYS A 1 43  ? 67.336  -15.621 -22.833 1.00 0.00 ? 43  LYS A HB3  1  
ATOM 634   H HG2  . LYS A 1 43  ? 67.712  -18.000 -22.725 1.00 0.00 ? 43  LYS A HG2  1  
ATOM 635   H HG3  . LYS A 1 43  ? 66.319  -18.225 -21.666 1.00 0.00 ? 43  LYS A HG3  1  
ATOM 636   H HD2  . LYS A 1 43  ? 64.846  -17.364 -23.496 1.00 0.00 ? 43  LYS A HD2  1  
ATOM 637   H HD3  . LYS A 1 43  ? 66.257  -17.301 -24.553 1.00 0.00 ? 43  LYS A HD3  1  
ATOM 638   H HE2  . LYS A 1 43  ? 65.041  -19.756 -23.263 1.00 0.00 ? 43  LYS A HE2  1  
ATOM 639   H HE3  . LYS A 1 43  ? 65.148  -19.394 -24.985 1.00 0.00 ? 43  LYS A HE3  1  
ATOM 640   H HZ1  . LYS A 1 43  ? 66.954  -20.723 -24.769 1.00 0.00 ? 43  LYS A HZ1  1  
ATOM 641   H HZ2  . LYS A 1 43  ? 67.220  -20.312 -23.143 1.00 0.00 ? 43  LYS A HZ2  1  
ATOM 642   H HZ3  . LYS A 1 43  ? 67.692  -19.247 -24.378 1.00 0.00 ? 43  LYS A HZ3  1  
ATOM 643   N N    . ILE A 1 44  ? 68.127  -14.298 -19.164 1.00 0.00 ? 44  ILE A N    1  
ATOM 644   C CA   . ILE A 1 44  ? 68.273  -12.921 -18.700 1.00 0.00 ? 44  ILE A CA   1  
ATOM 645   C C    . ILE A 1 44  ? 69.130  -12.105 -19.667 1.00 0.00 ? 44  ILE A C    1  
ATOM 646   O O    . ILE A 1 44  ? 69.646  -12.634 -20.650 1.00 0.00 ? 44  ILE A O    1  
ATOM 647   C CB   . ILE A 1 44  ? 68.897  -12.849 -17.283 1.00 0.00 ? 44  ILE A CB   1  
ATOM 648   C CG1  . ILE A 1 44  ? 70.407  -13.198 -17.321 1.00 0.00 ? 44  ILE A CG1  1  
ATOM 649   C CG2  . ILE A 1 44  ? 68.142  -13.797 -16.332 1.00 0.00 ? 44  ILE A CG2  1  
ATOM 650   C CD1  . ILE A 1 44  ? 70.671  -14.480 -18.122 1.00 0.00 ? 44  ILE A CD1  1  
ATOM 651   H H    . ILE A 1 44  ? 68.409  -15.032 -18.582 1.00 0.00 ? 44  ILE A H    1  
ATOM 652   H HA   . ILE A 1 44  ? 67.292  -12.476 -18.660 1.00 0.00 ? 44  ILE A HA   1  
ATOM 653   H HB   . ILE A 1 44  ? 68.784  -11.836 -16.915 1.00 0.00 ? 44  ILE A HB   1  
ATOM 654   H HG12 . ILE A 1 44  ? 70.945  -12.383 -17.780 1.00 0.00 ? 44  ILE A HG12 1  
ATOM 655   H HG13 . ILE A 1 44  ? 70.771  -13.330 -16.312 1.00 0.00 ? 44  ILE A HG13 1  
ATOM 656   H HG21 . ILE A 1 44  ? 68.719  -13.954 -15.433 1.00 0.00 ? 44  ILE A HG21 1  
ATOM 657   H HG22 . ILE A 1 44  ? 67.968  -14.744 -16.816 1.00 0.00 ? 44  ILE A HG22 1  
ATOM 658   H HG23 . ILE A 1 44  ? 67.191  -13.356 -16.070 1.00 0.00 ? 44  ILE A HG23 1  
ATOM 659   H HD11 . ILE A 1 44  ? 70.528  -14.287 -19.173 1.00 0.00 ? 44  ILE A HD11 1  
ATOM 660   H HD12 . ILE A 1 44  ? 70.000  -15.259 -17.801 1.00 0.00 ? 44  ILE A HD12 1  
ATOM 661   H HD13 . ILE A 1 44  ? 71.689  -14.799 -17.955 1.00 0.00 ? 44  ILE A HD13 1  
ATOM 662   N N    . CYS A 1 45  ? 69.263  -10.810 -19.384 1.00 0.00 ? 45  CYS A N    1  
ATOM 663   C CA   . CYS A 1 45  ? 70.047  -9.918  -20.233 1.00 0.00 ? 45  CYS A CA   1  
ATOM 664   C C    . CYS A 1 45  ? 69.547  -9.968  -21.674 1.00 0.00 ? 45  CYS A C    1  
ATOM 665   O O    . CYS A 1 45  ? 70.337  -9.867  -22.612 1.00 0.00 ? 45  CYS A O    1  
ATOM 666   C CB   . CYS A 1 45  ? 71.531  -10.308 -20.212 1.00 0.00 ? 45  CYS A CB   1  
ATOM 667   S SG   . CYS A 1 45  ? 72.247  -10.031 -18.569 1.00 0.00 ? 45  CYS A SG   1  
ATOM 668   H H    . CYS A 1 45  ? 68.816  -10.439 -18.595 1.00 0.00 ? 45  CYS A H    1  
ATOM 669   H HA   . CYS A 1 45  ? 69.946  -8.910  -19.863 1.00 0.00 ? 45  CYS A HA   1  
ATOM 670   H HB2  . CYS A 1 45  ? 71.625  -11.351 -20.467 1.00 0.00 ? 45  CYS A HB2  1  
ATOM 671   H HB3  . CYS A 1 45  ? 72.065  -9.717  -20.941 1.00 0.00 ? 45  CYS A HB3  1  
ATOM 672   N N    . GLN A 1 46  ? 68.240  -10.127 -21.851 1.00 0.00 ? 46  GLN A N    1  
ATOM 673   C CA   . GLN A 1 46  ? 67.679  -10.189 -23.195 1.00 0.00 ? 46  GLN A CA   1  
ATOM 674   C C    . GLN A 1 46  ? 67.989  -8.899  -23.952 1.00 0.00 ? 46  GLN A C    1  
ATOM 675   O O    . GLN A 1 46  ? 68.361  -8.934  -25.124 1.00 0.00 ? 46  GLN A O    1  
ATOM 676   C CB   . GLN A 1 46  ? 66.158  -10.424 -23.132 1.00 0.00 ? 46  GLN A CB   1  
ATOM 677   C CG   . GLN A 1 46  ? 65.508  -10.214 -24.512 1.00 0.00 ? 46  GLN A CG   1  
ATOM 678   C CD   . GLN A 1 46  ? 66.307  -10.947 -25.594 1.00 0.00 ? 46  GLN A CD   1  
ATOM 679   O OE1  . GLN A 1 46  ? 66.428  -12.155 -25.563 1.00 0.00 ? 46  GLN A OE1  1  
ATOM 680   N NE2  . GLN A 1 46  ? 66.861  -10.261 -26.556 1.00 0.00 ? 46  GLN A NE2  1  
ATOM 681   H H    . GLN A 1 46  ? 67.649  -10.204 -21.073 1.00 0.00 ? 46  GLN A H    1  
ATOM 682   H HA   . GLN A 1 46  ? 68.136  -11.013 -23.718 1.00 0.00 ? 46  GLN A HA   1  
ATOM 683   H HB2  . GLN A 1 46  ? 65.970  -11.436 -22.803 1.00 0.00 ? 46  GLN A HB2  1  
ATOM 684   H HB3  . GLN A 1 46  ? 65.720  -9.737  -22.429 1.00 0.00 ? 46  GLN A HB3  1  
ATOM 685   H HG2  . GLN A 1 46  ? 64.499  -10.597 -24.492 1.00 0.00 ? 46  GLN A HG2  1  
ATOM 686   H HG3  . GLN A 1 46  ? 65.484  -9.159  -24.740 1.00 0.00 ? 46  GLN A HG3  1  
ATOM 687   H HE21 . GLN A 1 46  ? 66.765  -9.286  -26.581 1.00 0.00 ? 46  GLN A HE21 1  
ATOM 688   H HE22 . GLN A 1 46  ? 67.375  -10.720 -27.253 1.00 0.00 ? 46  GLN A HE22 1  
ATOM 689   N N    . SER A 1 47  ? 67.837  -7.769  -23.273 1.00 0.00 ? 47  SER A N    1  
ATOM 690   C CA   . SER A 1 47  ? 68.108  -6.478  -23.896 1.00 0.00 ? 47  SER A CA   1  
ATOM 691   C C    . SER A 1 47  ? 67.829  -5.339  -22.922 1.00 0.00 ? 47  SER A C    1  
ATOM 692   O O    . SER A 1 47  ? 67.181  -5.528  -21.893 1.00 0.00 ? 47  SER A O    1  
ATOM 693   C CB   . SER A 1 47  ? 67.235  -6.304  -25.142 1.00 0.00 ? 47  SER A CB   1  
ATOM 694   O OG   . SER A 1 47  ? 67.137  -4.921  -25.456 1.00 0.00 ? 47  SER A OG   1  
ATOM 695   H H    . SER A 1 47  ? 67.542  -7.802  -22.340 1.00 0.00 ? 47  SER A H    1  
ATOM 696   H HA   . SER A 1 47  ? 69.148  -6.441  -24.187 1.00 0.00 ? 47  SER A HA   1  
ATOM 697   H HB2  . SER A 1 47  ? 67.676  -6.825  -25.976 1.00 0.00 ? 47  SER A HB2  1  
ATOM 698   H HB3  . SER A 1 47  ? 66.250  -6.710  -24.948 1.00 0.00 ? 47  SER A HB3  1  
ATOM 699   H HG   . SER A 1 47  ? 66.795  -4.466  -24.683 1.00 0.00 ? 47  SER A HG   1  
ATOM 700   N N    . VAL A 1 48  ? 68.318  -4.151  -23.268 1.00 0.00 ? 48  VAL A N    1  
ATOM 701   C CA   . VAL A 1 48  ? 68.122  -2.962  -22.441 1.00 0.00 ? 48  VAL A CA   1  
ATOM 702   C C    . VAL A 1 48  ? 68.095  -1.723  -23.328 1.00 0.00 ? 48  VAL A C    1  
ATOM 703   O O    . VAL A 1 48  ? 68.920  -1.575  -24.230 1.00 0.00 ? 48  VAL A O    1  
ATOM 704   C CB   . VAL A 1 48  ? 69.252  -2.817  -21.397 1.00 0.00 ? 48  VAL A CB   1  
ATOM 705   C CG1  . VAL A 1 48  ? 70.613  -2.842  -22.097 1.00 0.00 ? 48  VAL A CG1  1  
ATOM 706   C CG2  . VAL A 1 48  ? 69.091  -1.494  -20.633 1.00 0.00 ? 48  VAL A CG2  1  
ATOM 707   H H    . VAL A 1 48  ? 68.820  -4.069  -24.107 1.00 0.00 ? 48  VAL A H    1  
ATOM 708   H HA   . VAL A 1 48  ? 67.175  -3.038  -21.923 1.00 0.00 ? 48  VAL A HA   1  
ATOM 709   H HB   . VAL A 1 48  ? 69.197  -3.641  -20.699 1.00 0.00 ? 48  VAL A HB   1  
ATOM 710   H HG11 . VAL A 1 48  ? 70.713  -1.972  -22.727 1.00 0.00 ? 48  VAL A HG11 1  
ATOM 711   H HG12 . VAL A 1 48  ? 70.691  -3.734  -22.700 1.00 0.00 ? 48  VAL A HG12 1  
ATOM 712   H HG13 . VAL A 1 48  ? 71.397  -2.840  -21.354 1.00 0.00 ? 48  VAL A HG13 1  
ATOM 713   H HG21 . VAL A 1 48  ? 68.060  -1.372  -20.336 1.00 0.00 ? 48  VAL A HG21 1  
ATOM 714   H HG22 . VAL A 1 48  ? 69.377  -0.669  -21.269 1.00 0.00 ? 48  VAL A HG22 1  
ATOM 715   H HG23 . VAL A 1 48  ? 69.719  -1.505  -19.756 1.00 0.00 ? 48  VAL A HG23 1  
ATOM 716   N N    . THR A 1 49  ? 67.128  -0.839  -23.077 1.00 0.00 ? 49  THR A N    1  
ATOM 717   C CA   . THR A 1 49  ? 66.981  0.391   -23.863 1.00 0.00 ? 49  THR A CA   1  
ATOM 718   C C    . THR A 1 49  ? 66.868  1.600   -22.946 1.00 0.00 ? 49  THR A C    1  
ATOM 719   O O    . THR A 1 49  ? 65.873  1.769   -22.240 1.00 0.00 ? 49  THR A O    1  
ATOM 720   C CB   . THR A 1 49  ? 65.719  0.329   -24.744 1.00 0.00 ? 49  THR A CB   1  
ATOM 721   O OG1  . THR A 1 49  ? 65.765  -0.841  -25.551 1.00 0.00 ? 49  THR A OG1  1  
ATOM 722   C CG2  . THR A 1 49  ? 65.657  1.566   -25.641 1.00 0.00 ? 49  THR A CG2  1  
ATOM 723   H H    . THR A 1 49  ? 66.495  -1.019  -22.350 1.00 0.00 ? 49  THR A H    1  
ATOM 724   H HA   . THR A 1 49  ? 67.843  0.525   -24.504 1.00 0.00 ? 49  THR A HA   1  
ATOM 725   H HB   . THR A 1 49  ? 64.842  0.299   -24.116 1.00 0.00 ? 49  THR A HB   1  
ATOM 726   H HG1  . THR A 1 49  ? 65.442  -1.576  -25.027 1.00 0.00 ? 49  THR A HG1  1  
ATOM 727   H HG21 . THR A 1 49  ? 65.475  2.441   -25.034 1.00 0.00 ? 49  THR A HG21 1  
ATOM 728   H HG22 . THR A 1 49  ? 64.858  1.452   -26.357 1.00 0.00 ? 49  THR A HG22 1  
ATOM 729   H HG23 . THR A 1 49  ? 66.595  1.680   -26.163 1.00 0.00 ? 49  THR A HG23 1  
ATOM 730   N N    . GLU A 1 50  ? 67.897  2.443   -22.965 1.00 0.00 ? 50  GLU A N    1  
ATOM 731   C CA   . GLU A 1 50  ? 67.914  3.644   -22.136 1.00 0.00 ? 50  GLU A CA   1  
ATOM 732   C C    . GLU A 1 50  ? 67.147  4.772   -22.812 1.00 0.00 ? 50  GLU A C    1  
ATOM 733   O O    . GLU A 1 50  ? 67.214  4.945   -24.029 1.00 0.00 ? 50  GLU A O    1  
ATOM 734   C CB   . GLU A 1 50  ? 69.363  4.081   -21.879 1.00 0.00 ? 50  GLU A CB   1  
ATOM 735   C CG   . GLU A 1 50  ? 70.081  4.370   -23.212 1.00 0.00 ? 50  GLU A CG   1  
ATOM 736   C CD   . GLU A 1 50  ? 69.713  5.770   -23.719 1.00 0.00 ? 50  GLU A CD   1  
ATOM 737   O OE1  . GLU A 1 50  ? 69.754  6.695   -22.925 1.00 0.00 ? 50  GLU A OE1  1  
ATOM 738   O OE2  . GLU A 1 50  ? 69.396  5.890   -24.891 1.00 0.00 ? 50  GLU A OE2  1  
ATOM 739   H H    . GLU A 1 50  ? 68.659  2.254   -23.551 1.00 0.00 ? 50  GLU A H    1  
ATOM 740   H HA   . GLU A 1 50  ? 67.445  3.428   -21.187 1.00 0.00 ? 50  GLU A HA   1  
ATOM 741   H HB2  . GLU A 1 50  ? 69.366  4.968   -21.263 1.00 0.00 ? 50  GLU A HB2  1  
ATOM 742   H HB3  . GLU A 1 50  ? 69.883  3.287   -21.360 1.00 0.00 ? 50  GLU A HB3  1  
ATOM 743   H HG2  . GLU A 1 50  ? 71.151  4.319   -23.061 1.00 0.00 ? 50  GLU A HG2  1  
ATOM 744   H HG3  . GLU A 1 50  ? 69.791  3.636   -23.950 1.00 0.00 ? 50  GLU A HG3  1  
ATOM 745   N N    . ILE A 1 51  ? 66.420  5.542   -22.007 1.00 0.00 ? 51  ILE A N    1  
ATOM 746   C CA   . ILE A 1 51  ? 65.637  6.670   -22.512 1.00 0.00 ? 51  ILE A CA   1  
ATOM 747   C C    . ILE A 1 51  ? 65.686  7.807   -21.497 1.00 0.00 ? 51  ILE A C    1  
ATOM 748   O O    . ILE A 1 51  ? 65.879  7.576   -20.304 1.00 0.00 ? 51  ILE A O    1  
ATOM 749   C CB   . ILE A 1 51  ? 64.167  6.253   -22.768 1.00 0.00 ? 51  ILE A CB   1  
ATOM 750   C CG1  . ILE A 1 51  ? 64.159  4.863   -23.428 1.00 0.00 ? 51  ILE A CG1  1  
ATOM 751   C CG2  . ILE A 1 51  ? 63.483  7.274   -23.693 1.00 0.00 ? 51  ILE A CG2  1  
ATOM 752   C CD1  . ILE A 1 51  ? 62.747  4.505   -23.920 1.00 0.00 ? 51  ILE A CD1  1  
ATOM 753   H H    . ILE A 1 51  ? 66.414  5.352   -21.046 1.00 0.00 ? 51  ILE A H    1  
ATOM 754   H HA   . ILE A 1 51  ? 66.071  7.020   -23.442 1.00 0.00 ? 51  ILE A HA   1  
ATOM 755   H HB   . ILE A 1 51  ? 63.634  6.208   -21.828 1.00 0.00 ? 51  ILE A HB   1  
ATOM 756   H HG12 . ILE A 1 51  ? 64.840  4.862   -24.267 1.00 0.00 ? 51  ILE A HG12 1  
ATOM 757   H HG13 . ILE A 1 51  ? 64.482  4.126   -22.708 1.00 0.00 ? 51  ILE A HG13 1  
ATOM 758   H HG21 . ILE A 1 51  ? 63.685  8.273   -23.343 1.00 0.00 ? 51  ILE A HG21 1  
ATOM 759   H HG22 . ILE A 1 51  ? 62.417  7.105   -23.691 1.00 0.00 ? 51  ILE A HG22 1  
ATOM 760   H HG23 . ILE A 1 51  ? 63.863  7.161   -24.698 1.00 0.00 ? 51  ILE A HG23 1  
ATOM 761   H HD11 . ILE A 1 51  ? 62.017  4.821   -23.189 1.00 0.00 ? 51  ILE A HD11 1  
ATOM 762   H HD12 . ILE A 1 51  ? 62.672  3.436   -24.061 1.00 0.00 ? 51  ILE A HD12 1  
ATOM 763   H HD13 . ILE A 1 51  ? 62.554  5.005   -24.858 1.00 0.00 ? 51  ILE A HD13 1  
ATOM 764   N N    . THR A 1 52  ? 65.505  9.031   -21.977 1.00 0.00 ? 52  THR A N    1  
ATOM 765   C CA   . THR A 1 52  ? 65.530  10.212  -21.120 1.00 0.00 ? 52  THR A CA   1  
ATOM 766   C C    . THR A 1 52  ? 64.630  11.284  -21.730 1.00 0.00 ? 52  THR A C    1  
ATOM 767   O O    . THR A 1 52  ? 64.926  11.827  -22.794 1.00 0.00 ? 52  THR A O    1  
ATOM 768   C CB   . THR A 1 52  ? 66.969  10.772  -20.968 1.00 0.00 ? 52  THR A CB   1  
ATOM 769   O OG1  . THR A 1 52  ? 67.209  11.747  -21.971 1.00 0.00 ? 52  THR A OG1  1  
ATOM 770   C CG2  . THR A 1 52  ? 67.997  9.645   -21.109 1.00 0.00 ? 52  THR A CG2  1  
ATOM 771   H H    . THR A 1 52  ? 65.333  9.144   -22.933 1.00 0.00 ? 52  THR A H    1  
ATOM 772   H HA   . THR A 1 52  ? 65.143  9.951   -20.141 1.00 0.00 ? 52  THR A HA   1  
ATOM 773   H HB   . THR A 1 52  ? 67.080  11.225  -19.994 1.00 0.00 ? 52  THR A HB   1  
ATOM 774   H HG1  . THR A 1 52  ? 68.072  11.573  -22.354 1.00 0.00 ? 52  THR A HG1  1  
ATOM 775   H HG21 . THR A 1 52  ? 68.992  10.052  -20.996 1.00 0.00 ? 52  THR A HG21 1  
ATOM 776   H HG22 . THR A 1 52  ? 67.907  9.190   -22.085 1.00 0.00 ? 52  THR A HG22 1  
ATOM 777   H HG23 . THR A 1 52  ? 67.827  8.902   -20.346 1.00 0.00 ? 52  THR A HG23 1  
ATOM 778   N N    . GLU A 1 53  ? 63.517  11.549  -21.066 1.00 0.00 ? 53  GLU A N    1  
ATOM 779   C CA   . GLU A 1 53  ? 62.540  12.521  -21.553 1.00 0.00 ? 53  GLU A CA   1  
ATOM 780   C C    . GLU A 1 53  ? 63.104  13.946  -21.586 1.00 0.00 ? 53  GLU A C    1  
ATOM 781   O O    . GLU A 1 53  ? 63.389  14.530  -20.543 1.00 0.00 ? 53  GLU A O    1  
ATOM 782   C CB   . GLU A 1 53  ? 61.281  12.474  -20.655 1.00 0.00 ? 53  GLU A CB   1  
ATOM 783   C CG   . GLU A 1 53  ? 61.688  12.163  -19.202 1.00 0.00 ? 53  GLU A CG   1  
ATOM 784   C CD   . GLU A 1 53  ? 60.549  12.532  -18.247 1.00 0.00 ? 53  GLU A CD   1  
ATOM 785   O OE1  . GLU A 1 53  ? 59.623  11.745  -18.129 1.00 0.00 ? 53  GLU A OE1  1  
ATOM 786   O OE2  . GLU A 1 53  ? 60.623  13.595  -17.652 1.00 0.00 ? 53  GLU A OE2  1  
ATOM 787   H H    . GLU A 1 53  ? 63.329  11.060  -20.238 1.00 0.00 ? 53  GLU A H    1  
ATOM 788   H HA   . GLU A 1 53  ? 62.256  12.245  -22.559 1.00 0.00 ? 53  GLU A HA   1  
ATOM 789   H HB2  . GLU A 1 53  ? 60.765  13.425  -20.692 1.00 0.00 ? 53  GLU A HB2  1  
ATOM 790   H HB3  . GLU A 1 53  ? 60.614  11.701  -21.006 1.00 0.00 ? 53  GLU A HB3  1  
ATOM 791   H HG2  . GLU A 1 53  ? 61.906  11.112  -19.105 1.00 0.00 ? 53  GLU A HG2  1  
ATOM 792   H HG3  . GLU A 1 53  ? 62.565  12.725  -18.946 1.00 0.00 ? 53  GLU A HG3  1  
ATOM 793   N N    . SER A 1 54  ? 63.212  14.505  -22.798 1.00 0.00 ? 54  SER A N    1  
ATOM 794   C CA   . SER A 1 54  ? 63.693  15.872  -22.976 1.00 0.00 ? 54  SER A CA   1  
ATOM 795   C C    . SER A 1 54  ? 65.195  15.956  -22.759 1.00 0.00 ? 54  SER A C    1  
ATOM 796   O O    . SER A 1 54  ? 65.914  16.562  -23.553 1.00 0.00 ? 54  SER A O    1  
ATOM 797   C CB   . SER A 1 54  ? 62.950  16.812  -22.008 1.00 0.00 ? 54  SER A CB   1  
ATOM 798   O OG   . SER A 1 54  ? 61.625  16.334  -21.823 1.00 0.00 ? 54  SER A OG   1  
ATOM 799   H H    . SER A 1 54  ? 62.940  13.995  -23.588 1.00 0.00 ? 54  SER A H    1  
ATOM 800   H HA   . SER A 1 54  ? 63.476  16.179  -23.990 1.00 0.00 ? 54  SER A HA   1  
ATOM 801   H HB2  . SER A 1 54  ? 63.450  16.837  -21.054 1.00 0.00 ? 54  SER A HB2  1  
ATOM 802   H HB3  . SER A 1 54  ? 62.923  17.812  -22.418 1.00 0.00 ? 54  SER A HB3  1  
ATOM 803   H HG   . SER A 1 54  ? 61.082  16.681  -22.535 1.00 0.00 ? 54  SER A HG   1  
ATOM 804   N N    . GLU A 1 55  ? 65.664  15.332  -21.690 1.00 0.00 ? 55  GLU A N    1  
ATOM 805   C CA   . GLU A 1 55  ? 67.098  15.347  -21.412 1.00 0.00 ? 55  GLU A CA   1  
ATOM 806   C C    . GLU A 1 55  ? 67.849  14.764  -22.610 1.00 0.00 ? 55  GLU A C    1  
ATOM 807   O O    . GLU A 1 55  ? 68.963  15.183  -22.928 1.00 0.00 ? 55  GLU A O    1  
ATOM 808   C CB   . GLU A 1 55  ? 67.411  14.537  -20.150 1.00 0.00 ? 55  GLU A CB   1  
ATOM 809   C CG   . GLU A 1 55  ? 68.929  14.482  -19.933 1.00 0.00 ? 55  GLU A CG   1  
ATOM 810   C CD   . GLU A 1 55  ? 69.230  13.949  -18.530 1.00 0.00 ? 55  GLU A CD   1  
ATOM 811   O OE1  . GLU A 1 55  ? 69.187  12.742  -18.354 1.00 0.00 ? 55  GLU A OE1  1  
ATOM 812   O OE2  . GLU A 1 55  ? 69.498  14.756  -17.655 1.00 0.00 ? 55  GLU A OE2  1  
ATOM 813   H H    . GLU A 1 55  ? 65.038  14.843  -21.098 1.00 0.00 ? 55  GLU A H    1  
ATOM 814   H HA   . GLU A 1 55  ? 67.416  16.368  -21.263 1.00 0.00 ? 55  GLU A HA   1  
ATOM 815   H HB2  . GLU A 1 55  ? 66.945  15.007  -19.298 1.00 0.00 ? 55  GLU A HB2  1  
ATOM 816   H HB3  . GLU A 1 55  ? 67.027  13.539  -20.263 1.00 0.00 ? 55  GLU A HB3  1  
ATOM 817   H HG2  . GLU A 1 55  ? 69.375  13.828  -20.668 1.00 0.00 ? 55  GLU A HG2  1  
ATOM 818   H HG3  . GLU A 1 55  ? 69.345  15.474  -20.033 1.00 0.00 ? 55  GLU A HG3  1  
ATOM 819   N N    . SER A 1 56  ? 67.213  13.800  -23.270 1.00 0.00 ? 56  SER A N    1  
ATOM 820   C CA   . SER A 1 56  ? 67.794  13.147  -24.446 1.00 0.00 ? 56  SER A CA   1  
ATOM 821   C C    . SER A 1 56  ? 69.297  12.903  -24.271 1.00 0.00 ? 56  SER A C    1  
ATOM 822   O O    . SER A 1 56  ? 69.704  12.008  -23.529 1.00 0.00 ? 56  SER A O    1  
ATOM 823   C CB   . SER A 1 56  ? 67.544  14.010  -25.687 1.00 0.00 ? 56  SER A CB   1  
ATOM 824   O OG   . SER A 1 56  ? 66.163  13.962  -26.021 1.00 0.00 ? 56  SER A OG   1  
ATOM 825   H H    . SER A 1 56  ? 66.326  13.527  -22.956 1.00 0.00 ? 56  SER A H    1  
ATOM 826   H HA   . SER A 1 56  ? 67.304  12.196  -24.588 1.00 0.00 ? 56  SER A HA   1  
ATOM 827   H HB2  . SER A 1 56  ? 67.820  15.030  -25.479 1.00 0.00 ? 56  SER A HB2  1  
ATOM 828   H HB3  . SER A 1 56  ? 68.137  13.639  -26.513 1.00 0.00 ? 56  SER A HB3  1  
ATOM 829   H HG   . SER A 1 56  ? 65.658  14.006  -25.205 1.00 0.00 ? 56  SER A HG   1  
ATOM 830   N N    . ASP A 1 57  ? 70.114  13.701  -24.959 1.00 0.00 ? 57  ASP A N    1  
ATOM 831   C CA   . ASP A 1 57  ? 71.569  13.560  -24.871 1.00 0.00 ? 57  ASP A CA   1  
ATOM 832   C C    . ASP A 1 57  ? 72.298  14.833  -25.329 1.00 0.00 ? 57  ASP A C    1  
ATOM 833   O O    . ASP A 1 57  ? 73.312  15.200  -24.735 1.00 0.00 ? 57  ASP A O    1  
ATOM 834   C CB   . ASP A 1 57  ? 72.042  12.349  -25.702 1.00 0.00 ? 57  ASP A CB   1  
ATOM 835   C CG   . ASP A 1 57  ? 73.413  11.873  -25.205 1.00 0.00 ? 57  ASP A CG   1  
ATOM 836   O OD1  . ASP A 1 57  ? 74.308  12.697  -25.117 1.00 0.00 ? 57  ASP A OD1  1  
ATOM 837   O OD2  . ASP A 1 57  ? 73.542  10.694  -24.922 1.00 0.00 ? 57  ASP A OD2  1  
ATOM 838   H H    . ASP A 1 57  ? 69.732  14.390  -25.529 1.00 0.00 ? 57  ASP A H    1  
ATOM 839   H HA   . ASP A 1 57  ? 71.827  13.384  -23.834 1.00 0.00 ? 57  ASP A HA   1  
ATOM 840   H HB2  . ASP A 1 57  ? 71.328  11.545  -25.601 1.00 0.00 ? 57  ASP A HB2  1  
ATOM 841   H HB3  . ASP A 1 57  ? 72.122  12.626  -26.741 1.00 0.00 ? 57  ASP A HB3  1  
ATOM 842   N N    . PRO A 1 58  ? 71.813  15.543  -26.378 1.00 0.00 ? 58  PRO A N    1  
ATOM 843   C CA   . PRO A 1 58  ? 72.471  16.767  -26.848 1.00 0.00 ? 58  PRO A CA   1  
ATOM 844   C C    . PRO A 1 58  ? 72.079  17.971  -25.974 1.00 0.00 ? 58  PRO A C    1  
ATOM 845   O O    . PRO A 1 58  ? 72.676  18.182  -24.920 1.00 0.00 ? 58  PRO A O    1  
ATOM 846   C CB   . PRO A 1 58  ? 72.022  16.908  -28.328 1.00 0.00 ? 58  PRO A CB   1  
ATOM 847   C CG   . PRO A 1 58  ? 70.894  15.913  -28.535 1.00 0.00 ? 58  PRO A CG   1  
ATOM 848   C CD   . PRO A 1 58  ? 70.619  15.236  -27.178 1.00 0.00 ? 58  PRO A CD   1  
ATOM 849   H HA   . PRO A 1 58  ? 73.542  16.636  -26.806 1.00 0.00 ? 58  PRO A HA   1  
ATOM 850   H HB2  . PRO A 1 58  ? 71.686  17.917  -28.534 1.00 0.00 ? 58  PRO A HB2  1  
ATOM 851   H HB3  . PRO A 1 58  ? 72.848  16.667  -28.989 1.00 0.00 ? 58  PRO A HB3  1  
ATOM 852   H HG2  . PRO A 1 58  ? 70.001  16.426  -28.883 1.00 0.00 ? 58  PRO A HG2  1  
ATOM 853   H HG3  . PRO A 1 58  ? 71.182  15.163  -29.262 1.00 0.00 ? 58  PRO A HG3  1  
ATOM 854   H HD2  . PRO A 1 58  ? 69.738  15.659  -26.718 1.00 0.00 ? 58  PRO A HD2  1  
ATOM 855   H HD3  . PRO A 1 58  ? 70.506  14.172  -27.296 1.00 0.00 ? 58  PRO A HD3  1  
ATOM 856   N N    . ASP A 1 59  ? 71.065  18.737  -26.389 1.00 0.00 ? 59  ASP A N    1  
ATOM 857   C CA   . ASP A 1 59  ? 70.615  19.883  -25.599 1.00 0.00 ? 59  ASP A CA   1  
ATOM 858   C C    . ASP A 1 59  ? 69.378  20.572  -26.205 1.00 0.00 ? 59  ASP A C    1  
ATOM 859   O O    . ASP A 1 59  ? 69.385  21.792  -26.371 1.00 0.00 ? 59  ASP A O    1  
ATOM 860   C CB   . ASP A 1 59  ? 71.747  20.914  -25.487 1.00 0.00 ? 59  ASP A CB   1  
ATOM 861   C CG   . ASP A 1 59  ? 72.289  21.227  -26.882 1.00 0.00 ? 59  ASP A CG   1  
ATOM 862   O OD1  . ASP A 1 59  ? 71.498  21.262  -27.810 1.00 0.00 ? 59  ASP A OD1  1  
ATOM 863   O OD2  . ASP A 1 59  ? 73.487  21.428  -26.999 1.00 0.00 ? 59  ASP A OD2  1  
ATOM 864   H H    . ASP A 1 59  ? 70.599  18.515  -27.221 1.00 0.00 ? 59  ASP A H    1  
ATOM 865   H HA   . ASP A 1 59  ? 70.368  19.541  -24.606 1.00 0.00 ? 59  ASP A HA   1  
ATOM 866   H HB2  . ASP A 1 59  ? 71.367  21.821  -25.037 1.00 0.00 ? 59  ASP A HB2  1  
ATOM 867   H HB3  . ASP A 1 59  ? 72.540  20.519  -24.875 1.00 0.00 ? 59  ASP A HB3  1  
ATOM 868   N N    . PRO A 1 60  ? 68.284  19.836  -26.526 1.00 0.00 ? 60  PRO A N    1  
ATOM 869   C CA   . PRO A 1 60  ? 67.069  20.437  -27.079 1.00 0.00 ? 60  PRO A CA   1  
ATOM 870   C C    . PRO A 1 60  ? 66.017  20.666  -25.991 1.00 0.00 ? 60  PRO A C    1  
ATOM 871   O O    . PRO A 1 60  ? 65.522  21.776  -25.804 1.00 0.00 ? 60  PRO A O    1  
ATOM 872   C CB   . PRO A 1 60  ? 66.613  19.368  -28.074 1.00 0.00 ? 60  PRO A CB   1  
ATOM 873   C CG   . PRO A 1 60  ? 66.973  18.060  -27.412 1.00 0.00 ? 60  PRO A CG   1  
ATOM 874   C CD   . PRO A 1 60  ? 68.108  18.376  -26.400 1.00 0.00 ? 60  PRO A CD   1  
ATOM 875   H HA   . PRO A 1 60  ? 67.291  21.355  -27.600 1.00 0.00 ? 60  PRO A HA   1  
ATOM 876   H HB2  . PRO A 1 60  ? 65.542  19.438  -28.245 1.00 0.00 ? 60  PRO A HB2  1  
ATOM 877   H HB3  . PRO A 1 60  ? 67.147  19.474  -29.008 1.00 0.00 ? 60  PRO A HB3  1  
ATOM 878   H HG2  . PRO A 1 60  ? 66.109  17.648  -26.899 1.00 0.00 ? 60  PRO A HG2  1  
ATOM 879   H HG3  . PRO A 1 60  ? 67.326  17.349  -28.149 1.00 0.00 ? 60  PRO A HG3  1  
ATOM 880   H HD2  . PRO A 1 60  ? 67.813  18.111  -25.392 1.00 0.00 ? 60  PRO A HD2  1  
ATOM 881   H HD3  . PRO A 1 60  ? 69.004  17.863  -26.675 1.00 0.00 ? 60  PRO A HD3  1  
ATOM 882   N N    . GLU A 1 61  ? 65.685  19.584  -25.294 1.00 0.00 ? 61  GLU A N    1  
ATOM 883   C CA   . GLU A 1 61  ? 64.692  19.629  -24.231 1.00 0.00 ? 61  GLU A CA   1  
ATOM 884   C C    . GLU A 1 61  ? 63.333  20.025  -24.803 1.00 0.00 ? 61  GLU A C    1  
ATOM 885   O O    . GLU A 1 61  ? 62.782  21.064  -24.445 1.00 0.00 ? 61  GLU A O    1  
ATOM 886   C CB   . GLU A 1 61  ? 65.120  20.636  -23.151 1.00 0.00 ? 61  GLU A CB   1  
ATOM 887   C CG   . GLU A 1 61  ? 64.304  20.413  -21.870 1.00 0.00 ? 61  GLU A CG   1  
ATOM 888   C CD   . GLU A 1 61  ? 64.803  19.159  -21.146 1.00 0.00 ? 61  GLU A CD   1  
ATOM 889   O OE1  . GLU A 1 61  ? 65.706  18.520  -21.661 1.00 0.00 ? 61  GLU A OE1  1  
ATOM 890   O OE2  . GLU A 1 61  ? 64.273  18.860  -20.089 1.00 0.00 ? 61  GLU A OE2  1  
ATOM 891   H H    . GLU A 1 61  ? 66.124  18.742  -25.526 1.00 0.00 ? 61  GLU A H    1  
ATOM 892   H HA   . GLU A 1 61  ? 64.618  18.648  -23.788 1.00 0.00 ? 61  GLU A HA   1  
ATOM 893   H HB2  . GLU A 1 61  ? 66.172  20.505  -22.937 1.00 0.00 ? 61  GLU A HB2  1  
ATOM 894   H HB3  . GLU A 1 61  ? 64.952  21.641  -23.508 1.00 0.00 ? 61  GLU A HB3  1  
ATOM 895   H HG2  . GLU A 1 61  ? 64.416  21.270  -21.220 1.00 0.00 ? 61  GLU A HG2  1  
ATOM 896   H HG3  . GLU A 1 61  ? 63.261  20.288  -22.122 1.00 0.00 ? 61  GLU A HG3  1  
ATOM 897   N N    . VAL A 1 62  ? 62.819  19.192  -25.710 1.00 0.00 ? 62  VAL A N    1  
ATOM 898   C CA   . VAL A 1 62  ? 61.533  19.441  -26.369 1.00 0.00 ? 62  VAL A CA   1  
ATOM 899   C C    . VAL A 1 62  ? 61.657  20.581  -27.380 1.00 0.00 ? 62  VAL A C    1  
ATOM 900   O O    . VAL A 1 62  ? 60.887  20.655  -28.337 1.00 0.00 ? 62  VAL A O    1  
ATOM 901   C CB   . VAL A 1 62  ? 60.406  19.787  -25.364 1.00 0.00 ? 62  VAL A CB   1  
ATOM 902   C CG1  . VAL A 1 62  ? 59.049  19.691  -26.071 1.00 0.00 ? 62  VAL A CG1  1  
ATOM 903   C CG2  . VAL A 1 62  ? 60.437  18.801  -24.186 1.00 0.00 ? 62  VAL A CG2  1  
ATOM 904   H H    . VAL A 1 62  ? 63.330  18.393  -25.959 1.00 0.00 ? 62  VAL A H    1  
ATOM 905   H HA   . VAL A 1 62  ? 61.252  18.544  -26.903 1.00 0.00 ? 62  VAL A HA   1  
ATOM 906   H HB   . VAL A 1 62  ? 60.540  20.794  -24.999 1.00 0.00 ? 62  VAL A HB   1  
ATOM 907   H HG11 . VAL A 1 62  ? 58.259  19.905  -25.366 1.00 0.00 ? 62  VAL A HG11 1  
ATOM 908   H HG12 . VAL A 1 62  ? 58.918  18.695  -26.466 1.00 0.00 ? 62  VAL A HG12 1  
ATOM 909   H HG13 . VAL A 1 62  ? 59.013  20.406  -26.880 1.00 0.00 ? 62  VAL A HG13 1  
ATOM 910   H HG21 . VAL A 1 62  ? 61.254  19.053  -23.529 1.00 0.00 ? 62  VAL A HG21 1  
ATOM 911   H HG22 . VAL A 1 62  ? 60.569  17.796  -24.557 1.00 0.00 ? 62  VAL A HG22 1  
ATOM 912   H HG23 . VAL A 1 62  ? 59.508  18.862  -23.635 1.00 0.00 ? 62  VAL A HG23 1  
ATOM 913   N N    . GLU A 1 63  ? 62.626  21.467  -27.157 1.00 0.00 ? 63  GLU A N    1  
ATOM 914   C CA   . GLU A 1 63  ? 62.845  22.601  -28.050 1.00 0.00 ? 63  GLU A CA   1  
ATOM 915   C C    . GLU A 1 63  ? 61.631  23.527  -28.046 1.00 0.00 ? 63  GLU A C    1  
ATOM 916   O O    . GLU A 1 63  ? 60.972  23.710  -29.069 1.00 0.00 ? 63  GLU A O    1  
ATOM 917   C CB   . GLU A 1 63  ? 63.122  22.107  -29.478 1.00 0.00 ? 63  GLU A CB   1  
ATOM 918   C CG   . GLU A 1 63  ? 63.727  23.241  -30.312 1.00 0.00 ? 63  GLU A CG   1  
ATOM 919   C CD   . GLU A 1 63  ? 64.038  22.727  -31.720 1.00 0.00 ? 63  GLU A CD   1  
ATOM 920   O OE1  . GLU A 1 63  ? 64.975  21.957  -31.853 1.00 0.00 ? 63  GLU A OE1  1  
ATOM 921   O OE2  . GLU A 1 63  ? 63.336  23.113  -32.638 1.00 0.00 ? 63  GLU A OE2  1  
ATOM 922   H H    . GLU A 1 63  ? 63.200  21.358  -26.372 1.00 0.00 ? 63  GLU A H    1  
ATOM 923   H HA   . GLU A 1 63  ? 63.704  23.155  -27.698 1.00 0.00 ? 63  GLU A HA   1  
ATOM 924   H HB2  . GLU A 1 63  ? 63.816  21.280  -29.442 1.00 0.00 ? 63  GLU A HB2  1  
ATOM 925   H HB3  . GLU A 1 63  ? 62.200  21.782  -29.935 1.00 0.00 ? 63  GLU A HB3  1  
ATOM 926   H HG2  . GLU A 1 63  ? 63.021  24.058  -30.373 1.00 0.00 ? 63  GLU A HG2  1  
ATOM 927   H HG3  . GLU A 1 63  ? 64.637  23.586  -29.847 1.00 0.00 ? 63  GLU A HG3  1  
ATOM 928   N N    . SER A 1 64  ? 61.344  24.108  -26.880 1.00 0.00 ? 64  SER A N    1  
ATOM 929   C CA   . SER A 1 64  ? 60.208  25.019  -26.735 1.00 0.00 ? 64  SER A CA   1  
ATOM 930   C C    . SER A 1 64  ? 60.621  26.452  -27.063 1.00 0.00 ? 64  SER A C    1  
ATOM 931   O O    . SER A 1 64  ? 60.826  27.269  -26.166 1.00 0.00 ? 64  SER A O    1  
ATOM 932   C CB   . SER A 1 64  ? 59.680  24.959  -25.302 1.00 0.00 ? 64  SER A CB   1  
ATOM 933   O OG   . SER A 1 64  ? 58.635  25.911  -25.146 1.00 0.00 ? 64  SER A OG   1  
ATOM 934   H H    . SER A 1 64  ? 61.911  23.921  -26.104 1.00 0.00 ? 64  SER A H    1  
ATOM 935   H HA   . SER A 1 64  ? 59.416  24.719  -27.408 1.00 0.00 ? 64  SER A HA   1  
ATOM 936   H HB2  . SER A 1 64  ? 59.294  23.975  -25.098 1.00 0.00 ? 64  SER A HB2  1  
ATOM 937   H HB3  . SER A 1 64  ? 60.485  25.178  -24.613 1.00 0.00 ? 64  SER A HB3  1  
ATOM 938   H HG   . SER A 1 64  ? 59.027  26.735  -24.846 1.00 0.00 ? 64  SER A HG   1  
ATOM 939   N N    . GLU A 1 65  ? 60.740  26.748  -28.354 1.00 0.00 ? 65  GLU A N    1  
ATOM 940   C CA   . GLU A 1 65  ? 61.128  28.087  -28.793 1.00 0.00 ? 65  GLU A CA   1  
ATOM 941   C C    . GLU A 1 65  ? 59.940  29.043  -28.699 1.00 0.00 ? 65  GLU A C    1  
ATOM 942   O O    . GLU A 1 65  ? 59.561  29.673  -29.688 1.00 0.00 ? 65  GLU A O    1  
ATOM 943   C CB   . GLU A 1 65  ? 61.635  28.035  -30.241 1.00 0.00 ? 65  GLU A CB   1  
ATOM 944   C CG   . GLU A 1 65  ? 63.008  27.355  -30.285 1.00 0.00 ? 65  GLU A CG   1  
ATOM 945   C CD   . GLU A 1 65  ? 64.066  28.292  -29.697 1.00 0.00 ? 65  GLU A CD   1  
ATOM 946   O OE1  . GLU A 1 65  ? 64.112  29.437  -30.116 1.00 0.00 ? 65  GLU A OE1  1  
ATOM 947   O OE2  . GLU A 1 65  ? 64.809  27.849  -28.838 1.00 0.00 ? 65  GLU A OE2  1  
ATOM 948   H H    . GLU A 1 65  ? 60.562  26.055  -29.024 1.00 0.00 ? 65  GLU A H    1  
ATOM 949   H HA   . GLU A 1 65  ? 61.921  28.454  -28.157 1.00 0.00 ? 65  GLU A HA   1  
ATOM 950   H HB2  . GLU A 1 65  ? 60.937  27.472  -30.844 1.00 0.00 ? 65  GLU A HB2  1  
ATOM 951   H HB3  . GLU A 1 65  ? 61.718  29.039  -30.632 1.00 0.00 ? 65  GLU A HB3  1  
ATOM 952   H HG2  . GLU A 1 65  ? 62.976  26.440  -29.710 1.00 0.00 ? 65  GLU A HG2  1  
ATOM 953   H HG3  . GLU A 1 65  ? 63.263  27.127  -31.309 1.00 0.00 ? 65  GLU A HG3  1  
ATOM 954   N N    . ASP A 1 66  ? 59.356  29.145  -27.510 1.00 0.00 ? 66  ASP A N    1  
ATOM 955   C CA   . ASP A 1 66  ? 58.211  30.029  -27.310 1.00 0.00 ? 66  ASP A CA   1  
ATOM 956   C C    . ASP A 1 66  ? 57.905  30.208  -25.827 1.00 0.00 ? 66  ASP A C    1  
ATOM 957   O O    . ASP A 1 66  ? 57.137  29.443  -25.243 1.00 0.00 ? 66  ASP A O    1  
ATOM 958   C CB   . ASP A 1 66  ? 56.983  29.456  -28.019 1.00 0.00 ? 66  ASP A CB   1  
ATOM 959   C CG   . ASP A 1 66  ? 56.744  28.019  -27.551 1.00 0.00 ? 66  ASP A CG   1  
ATOM 960   O OD1  . ASP A 1 66  ? 57.679  27.417  -27.048 1.00 0.00 ? 66  ASP A OD1  1  
ATOM 961   O OD2  . ASP A 1 66  ? 55.631  27.544  -27.704 1.00 0.00 ? 66  ASP A OD2  1  
ATOM 962   H H    . ASP A 1 66  ? 59.699  28.618  -26.758 1.00 0.00 ? 66  ASP A H    1  
ATOM 963   H HA   . ASP A 1 66  ? 58.438  30.994  -27.738 1.00 0.00 ? 66  ASP A HA   1  
ATOM 964   H HB2  . ASP A 1 66  ? 56.118  30.060  -27.784 1.00 0.00 ? 66  ASP A HB2  1  
ATOM 965   H HB3  . ASP A 1 66  ? 57.147  29.462  -29.086 1.00 0.00 ? 66  ASP A HB3  1  
ATOM 966   N N    . ASP A 1 67  ? 58.507  31.230  -25.223 1.00 0.00 ? 67  ASP A N    1  
ATOM 967   C CA   . ASP A 1 67  ? 58.287  31.514  -23.806 1.00 0.00 ? 67  ASP A CA   1  
ATOM 968   C C    . ASP A 1 67  ? 56.963  32.250  -23.616 1.00 0.00 ? 67  ASP A C    1  
ATOM 969   O O    . ASP A 1 67  ? 56.362  32.716  -24.583 1.00 0.00 ? 67  ASP A O    1  
ATOM 970   C CB   . ASP A 1 67  ? 59.431  32.373  -23.261 1.00 0.00 ? 67  ASP A CB   1  
ATOM 971   C CG   . ASP A 1 67  ? 60.718  31.546  -23.226 1.00 0.00 ? 67  ASP A CG   1  
ATOM 972   O OD1  . ASP A 1 67  ? 61.232  31.241  -24.289 1.00 0.00 ? 67  ASP A OD1  1  
ATOM 973   O OD2  . ASP A 1 67  ? 61.168  31.233  -22.136 1.00 0.00 ? 67  ASP A OD2  1  
ATOM 974   H H    . ASP A 1 67  ? 59.104  31.809  -25.742 1.00 0.00 ? 67  ASP A H    1  
ATOM 975   H HA   . ASP A 1 67  ? 58.254  30.584  -23.256 1.00 0.00 ? 67  ASP A HA   1  
ATOM 976   H HB2  . ASP A 1 67  ? 59.572  33.233  -23.900 1.00 0.00 ? 67  ASP A HB2  1  
ATOM 977   H HB3  . ASP A 1 67  ? 59.190  32.701  -22.261 1.00 0.00 ? 67  ASP A HB3  1  
ATOM 978   N N    . SER A 1 68  ? 56.517  32.353  -22.368 1.00 0.00 ? 68  SER A N    1  
ATOM 979   C CA   . SER A 1 68  ? 55.264  33.037  -22.065 1.00 0.00 ? 68  SER A CA   1  
ATOM 980   C C    . SER A 1 68  ? 55.075  33.146  -20.556 1.00 0.00 ? 68  SER A C    1  
ATOM 981   O O    . SER A 1 68  ? 54.751  34.213  -20.033 1.00 0.00 ? 68  SER A O    1  
ATOM 982   C CB   . SER A 1 68  ? 54.087  32.272  -22.673 1.00 0.00 ? 68  SER A CB   1  
ATOM 983   O OG   . SER A 1 68  ? 54.087  30.940  -22.178 1.00 0.00 ? 68  SER A OG   1  
ATOM 984   H H    . SER A 1 68  ? 57.035  31.968  -21.631 1.00 0.00 ? 68  SER A H    1  
ATOM 985   H HA   . SER A 1 68  ? 55.293  34.030  -22.490 1.00 0.00 ? 68  SER A HA   1  
ATOM 986   H HB2  . SER A 1 68  ? 53.163  32.752  -22.396 1.00 0.00 ? 68  SER A HB2  1  
ATOM 987   H HB3  . SER A 1 68  ? 54.177  32.268  -23.750 1.00 0.00 ? 68  SER A HB3  1  
ATOM 988   H HG   . SER A 1 68  ? 53.259  30.527  -22.436 1.00 0.00 ? 68  SER A HG   1  
ATOM 989   N N    . THR A 1 69  ? 55.287  32.032  -19.863 1.00 0.00 ? 69  THR A N    1  
ATOM 990   C CA   . THR A 1 69  ? 55.144  32.001  -18.412 1.00 0.00 ? 69  THR A CA   1  
ATOM 991   C C    . THR A 1 69  ? 55.618  30.656  -17.866 1.00 0.00 ? 69  THR A C    1  
ATOM 992   O O    . THR A 1 69  ? 56.254  30.589  -16.816 1.00 0.00 ? 69  THR A O    1  
ATOM 993   C CB   . THR A 1 69  ? 53.675  32.215  -17.992 1.00 0.00 ? 69  THR A CB   1  
ATOM 994   O OG1  . THR A 1 69  ? 53.478  31.697  -16.683 1.00 0.00 ? 69  THR A OG1  1  
ATOM 995   C CG2  . THR A 1 69  ? 52.749  31.492  -18.972 1.00 0.00 ? 69  THR A CG2  1  
ATOM 996   H H    . THR A 1 69  ? 55.546  31.214  -20.336 1.00 0.00 ? 69  THR A H    1  
ATOM 997   H HA   . THR A 1 69  ? 55.751  32.785  -17.982 1.00 0.00 ? 69  THR A HA   1  
ATOM 998   H HB   . THR A 1 69  ? 53.446  33.270  -17.999 1.00 0.00 ? 69  THR A HB   1  
ATOM 999   H HG1  . THR A 1 69  ? 53.324  32.437  -16.091 1.00 0.00 ? 69  THR A HG1  1  
ATOM 1000  H HG21 . THR A 1 69  ? 53.071  30.468  -19.084 1.00 0.00 ? 69  THR A HG21 1  
ATOM 1001  H HG22 . THR A 1 69  ? 52.782  31.988  -19.931 1.00 0.00 ? 69  THR A HG22 1  
ATOM 1002  H HG23 . THR A 1 69  ? 51.738  31.512  -18.592 1.00 0.00 ? 69  THR A HG23 1  
ATOM 1003  N N    . SER A 1 70  ? 55.288  29.588  -18.585 1.00 0.00 ? 70  SER A N    1  
ATOM 1004  C CA   . SER A 1 70  ? 55.669  28.241  -18.173 1.00 0.00 ? 70  SER A CA   1  
ATOM 1005  C C    . SER A 1 70  ? 57.140  28.176  -17.763 1.00 0.00 ? 70  SER A C    1  
ATOM 1006  O O    . SER A 1 70  ? 58.011  28.725  -18.437 1.00 0.00 ? 70  SER A O    1  
ATOM 1007  C CB   . SER A 1 70  ? 55.417  27.259  -19.317 1.00 0.00 ? 70  SER A CB   1  
ATOM 1008  O OG   . SER A 1 70  ? 56.269  27.581  -20.408 1.00 0.00 ? 70  SER A OG   1  
ATOM 1009  H H    . SER A 1 70  ? 54.762  29.709  -19.404 1.00 0.00 ? 70  SER A H    1  
ATOM 1010  H HA   . SER A 1 70  ? 55.060  27.951  -17.329 1.00 0.00 ? 70  SER A HA   1  
ATOM 1011  H HB2  . SER A 1 70  ? 55.628  26.256  -18.986 1.00 0.00 ? 70  SER A HB2  1  
ATOM 1012  H HB3  . SER A 1 70  ? 54.381  27.323  -19.623 1.00 0.00 ? 70  SER A HB3  1  
ATOM 1013  H HG   . SER A 1 70  ? 56.450  28.524  -20.374 1.00 0.00 ? 70  SER A HG   1  
ATOM 1014  N N    . VAL A 1 71  ? 57.400  27.478  -16.659 1.00 0.00 ? 71  VAL A N    1  
ATOM 1015  C CA   . VAL A 1 71  ? 58.760  27.306  -16.146 1.00 0.00 ? 71  VAL A CA   1  
ATOM 1016  C C    . VAL A 1 71  ? 58.807  26.074  -15.246 1.00 0.00 ? 71  VAL A C    1  
ATOM 1017  O O    . VAL A 1 71  ? 59.535  26.041  -14.253 1.00 0.00 ? 71  VAL A O    1  
ATOM 1018  C CB   . VAL A 1 71  ? 59.217  28.535  -15.323 1.00 0.00 ? 71  VAL A CB   1  
ATOM 1019  C CG1  . VAL A 1 71  ? 59.494  29.726  -16.249 1.00 0.00 ? 71  VAL A CG1  1  
ATOM 1020  C CG2  . VAL A 1 71  ? 58.119  28.910  -14.323 1.00 0.00 ? 71  VAL A CG2  1  
ATOM 1021  H H    . VAL A 1 71  ? 56.657  27.051  -16.184 1.00 0.00 ? 71  VAL A H    1  
ATOM 1022  H HA   . VAL A 1 71  ? 59.437  27.160  -16.975 1.00 0.00 ? 71  VAL A HA   1  
ATOM 1023  H HB   . VAL A 1 71  ? 60.123  28.290  -14.785 1.00 0.00 ? 71  VAL A HB   1  
ATOM 1024  H HG11 . VAL A 1 71  ? 58.562  30.125  -16.615 1.00 0.00 ? 71  VAL A HG11 1  
ATOM 1025  H HG12 . VAL A 1 71  ? 60.101  29.405  -17.083 1.00 0.00 ? 71  VAL A HG12 1  
ATOM 1026  H HG13 . VAL A 1 71  ? 60.019  30.491  -15.698 1.00 0.00 ? 71  VAL A HG13 1  
ATOM 1027  H HG21 . VAL A 1 71  ? 57.886  28.055  -13.706 1.00 0.00 ? 71  VAL A HG21 1  
ATOM 1028  H HG22 . VAL A 1 71  ? 57.234  29.218  -14.861 1.00 0.00 ? 71  VAL A HG22 1  
ATOM 1029  H HG23 . VAL A 1 71  ? 58.462  29.722  -13.700 1.00 0.00 ? 71  VAL A HG23 1  
ATOM 1030  N N    . GLU A 1 72  ? 58.010  25.072  -15.597 1.00 0.00 ? 72  GLU A N    1  
ATOM 1031  C CA   . GLU A 1 72  ? 57.941  23.840  -14.818 1.00 0.00 ? 72  GLU A CA   1  
ATOM 1032  C C    . GLU A 1 72  ? 59.306  23.153  -14.733 1.00 0.00 ? 72  GLU A C    1  
ATOM 1033  O O    . GLU A 1 72  ? 59.619  22.525  -13.723 1.00 0.00 ? 72  GLU A O    1  
ATOM 1034  C CB   . GLU A 1 72  ? 56.918  22.888  -15.448 1.00 0.00 ? 72  GLU A CB   1  
ATOM 1035  C CG   . GLU A 1 72  ? 57.144  22.821  -16.961 1.00 0.00 ? 72  GLU A CG   1  
ATOM 1036  C CD   . GLU A 1 72  ? 56.288  21.703  -17.557 1.00 0.00 ? 72  GLU A CD   1  
ATOM 1037  O OE1  . GLU A 1 72  ? 55.103  21.672  -17.268 1.00 0.00 ? 72  GLU A OE1  1  
ATOM 1038  O OE2  . GLU A 1 72  ? 56.832  20.897  -18.292 1.00 0.00 ? 72  GLU A OE2  1  
ATOM 1039  H H    . GLU A 1 72  ? 57.447  25.166  -16.393 1.00 0.00 ? 72  GLU A H    1  
ATOM 1040  H HA   . GLU A 1 72  ? 57.615  24.083  -13.818 1.00 0.00 ? 72  GLU A HA   1  
ATOM 1041  H HB2  . GLU A 1 72  ? 57.029  21.901  -15.023 1.00 0.00 ? 72  GLU A HB2  1  
ATOM 1042  H HB3  . GLU A 1 72  ? 55.921  23.252  -15.252 1.00 0.00 ? 72  GLU A HB3  1  
ATOM 1043  H HG2  . GLU A 1 72  ? 56.866  23.764  -17.408 1.00 0.00 ? 72  GLU A HG2  1  
ATOM 1044  H HG3  . GLU A 1 72  ? 58.184  22.620  -17.163 1.00 0.00 ? 72  GLU A HG3  1  
ATOM 1045  N N    . ASP A 1 73  ? 60.098  23.258  -15.804 1.00 0.00 ? 73  ASP A N    1  
ATOM 1046  C CA   . ASP A 1 73  ? 61.424  22.628  -15.862 1.00 0.00 ? 73  ASP A CA   1  
ATOM 1047  C C    . ASP A 1 73  ? 62.123  22.615  -14.499 1.00 0.00 ? 73  ASP A C    1  
ATOM 1048  O O    . ASP A 1 73  ? 61.860  21.747  -13.668 1.00 0.00 ? 73  ASP A O    1  
ATOM 1049  C CB   . ASP A 1 73  ? 62.300  23.369  -16.876 1.00 0.00 ? 73  ASP A CB   1  
ATOM 1050  C CG   . ASP A 1 73  ? 61.689  23.234  -18.273 1.00 0.00 ? 73  ASP A CG   1  
ATOM 1051  O OD1  . ASP A 1 73  ? 61.031  22.236  -18.516 1.00 0.00 ? 73  ASP A OD1  1  
ATOM 1052  O OD2  . ASP A 1 73  ? 61.892  24.131  -19.075 1.00 0.00 ? 73  ASP A OD2  1  
ATOM 1053  H H    . ASP A 1 73  ? 59.781  23.754  -16.588 1.00 0.00 ? 73  ASP A H    1  
ATOM 1054  H HA   . ASP A 1 73  ? 61.305  21.609  -16.197 1.00 0.00 ? 73  ASP A HA   1  
ATOM 1055  H HB2  . ASP A 1 73  ? 62.357  24.413  -16.607 1.00 0.00 ? 73  ASP A HB2  1  
ATOM 1056  H HB3  . ASP A 1 73  ? 63.291  22.941  -16.875 1.00 0.00 ? 73  ASP A HB3  1  
ATOM 1057  N N    . VAL A 1 74  ? 63.020  23.573  -14.283 1.00 0.00 ? 74  VAL A N    1  
ATOM 1058  C CA   . VAL A 1 74  ? 63.754  23.652  -13.025 1.00 0.00 ? 74  VAL A CA   1  
ATOM 1059  C C    . VAL A 1 74  ? 64.516  22.352  -12.759 1.00 0.00 ? 74  VAL A C    1  
ATOM 1060  O O    . VAL A 1 74  ? 65.719  22.269  -13.004 1.00 0.00 ? 74  VAL A O    1  
ATOM 1061  C CB   . VAL A 1 74  ? 62.800  23.922  -11.845 1.00 0.00 ? 74  VAL A CB   1  
ATOM 1062  C CG1  . VAL A 1 74  ? 63.614  24.143  -10.569 1.00 0.00 ? 74  VAL A CG1  1  
ATOM 1063  C CG2  . VAL A 1 74  ? 61.970  25.173  -12.140 1.00 0.00 ? 74  VAL A CG2  1  
ATOM 1064  H H    . VAL A 1 74  ? 63.197  24.233  -14.986 1.00 0.00 ? 74  VAL A H    1  
ATOM 1065  H HA   . VAL A 1 74  ? 64.464  24.464  -13.087 1.00 0.00 ? 74  VAL A HA   1  
ATOM 1066  H HB   . VAL A 1 74  ? 62.143  23.076  -11.709 1.00 0.00 ? 74  VAL A HB   1  
ATOM 1067  H HG11 . VAL A 1 74  ? 64.103  23.222  -10.289 1.00 0.00 ? 74  VAL A HG11 1  
ATOM 1068  H HG12 . VAL A 1 74  ? 62.956  24.457  -9.772  1.00 0.00 ? 74  VAL A HG12 1  
ATOM 1069  H HG13 . VAL A 1 74  ? 64.357  24.907  -10.744 1.00 0.00 ? 74  VAL A HG13 1  
ATOM 1070  H HG21 . VAL A 1 74  ? 61.468  25.055  -13.090 1.00 0.00 ? 74  VAL A HG21 1  
ATOM 1071  H HG22 . VAL A 1 74  ? 62.619  26.035  -12.180 1.00 0.00 ? 74  VAL A HG22 1  
ATOM 1072  H HG23 . VAL A 1 74  ? 61.236  25.310  -11.360 1.00 0.00 ? 74  VAL A HG23 1  
ATOM 1073  N N    . ASP A 1 75  ? 63.809  21.340  -12.258 1.00 0.00 ? 75  ASP A N    1  
ATOM 1074  C CA   . ASP A 1 75  ? 64.429  20.050  -11.964 1.00 0.00 ? 75  ASP A CA   1  
ATOM 1075  C C    . ASP A 1 75  ? 64.674  19.268  -13.261 1.00 0.00 ? 75  ASP A C    1  
ATOM 1076  O O    . ASP A 1 75  ? 63.925  19.421  -14.225 1.00 0.00 ? 75  ASP A O    1  
ATOM 1077  C CB   . ASP A 1 75  ? 63.508  19.244  -11.043 1.00 0.00 ? 75  ASP A CB   1  
ATOM 1078  C CG   . ASP A 1 75  ? 63.478  19.886  -9.654  1.00 0.00 ? 75  ASP A CG   1  
ATOM 1079  O OD1  . ASP A 1 75  ? 64.369  19.602  -8.871  1.00 0.00 ? 75  ASP A OD1  1  
ATOM 1080  O OD2  . ASP A 1 75  ? 62.565  20.654  -9.398  1.00 0.00 ? 75  ASP A OD2  1  
ATOM 1081  H H    . ASP A 1 75  ? 62.854  21.463  -12.083 1.00 0.00 ? 75  ASP A H    1  
ATOM 1082  H HA   . ASP A 1 75  ? 65.368  20.223  -11.461 1.00 0.00 ? 75  ASP A HA   1  
ATOM 1083  H HB2  . ASP A 1 75  ? 62.510  19.234  -11.455 1.00 0.00 ? 75  ASP A HB2  1  
ATOM 1084  H HB3  . ASP A 1 75  ? 63.871  18.231  -10.961 1.00 0.00 ? 75  ASP A HB3  1  
ATOM 1085  N N    . PRO A 1 76  ? 65.722  18.415  -13.312 1.00 0.00 ? 76  PRO A N    1  
ATOM 1086  C CA   . PRO A 1 76  ? 66.027  17.623  -14.520 1.00 0.00 ? 76  PRO A CA   1  
ATOM 1087  C C    . PRO A 1 76  ? 64.949  16.548  -14.778 1.00 0.00 ? 76  PRO A C    1  
ATOM 1088  O O    . PRO A 1 76  ? 64.372  16.026  -13.825 1.00 0.00 ? 76  PRO A O    1  
ATOM 1089  C CB   . PRO A 1 76  ? 67.396  16.987  -14.205 1.00 0.00 ? 76  PRO A CB   1  
ATOM 1090  C CG   . PRO A 1 76  ? 67.431  16.905  -12.714 1.00 0.00 ? 76  PRO A CG   1  
ATOM 1091  C CD   . PRO A 1 76  ? 66.686  18.149  -12.228 1.00 0.00 ? 76  PRO A CD   1  
ATOM 1092  H HA   . PRO A 1 76  ? 66.124  18.285  -15.355 1.00 0.00 ? 76  PRO A HA   1  
ATOM 1093  H HB2  . PRO A 1 76  ? 67.475  16.000  -14.648 1.00 0.00 ? 76  PRO A HB2  1  
ATOM 1094  H HB3  . PRO A 1 76  ? 68.199  17.621  -14.559 1.00 0.00 ? 76  PRO A HB3  1  
ATOM 1095  H HG2  . PRO A 1 76  ? 66.927  16.006  -12.378 1.00 0.00 ? 76  PRO A HG2  1  
ATOM 1096  H HG3  . PRO A 1 76  ? 68.450  16.920  -12.353 1.00 0.00 ? 76  PRO A HG3  1  
ATOM 1097  H HD2  . PRO A 1 76  ? 66.176  17.951  -11.298 1.00 0.00 ? 76  PRO A HD2  1  
ATOM 1098  H HD3  . PRO A 1 76  ? 67.361  18.985  -12.120 1.00 0.00 ? 76  PRO A HD3  1  
ATOM 1099  N N    . PRO A 1 77  ? 64.656  16.189  -16.057 1.00 0.00 ? 77  PRO A N    1  
ATOM 1100  C CA   . PRO A 1 77  ? 63.637  15.159  -16.366 1.00 0.00 ? 77  PRO A CA   1  
ATOM 1101  C C    . PRO A 1 77  ? 63.909  13.812  -15.671 1.00 0.00 ? 77  PRO A C    1  
ATOM 1102  O O    . PRO A 1 77  ? 64.425  13.769  -14.554 1.00 0.00 ? 77  PRO A O    1  
ATOM 1103  C CB   . PRO A 1 77  ? 63.682  15.017  -17.904 1.00 0.00 ? 77  PRO A CB   1  
ATOM 1104  C CG   . PRO A 1 77  ? 64.310  16.279  -18.400 1.00 0.00 ? 77  PRO A CG   1  
ATOM 1105  C CD   . PRO A 1 77  ? 65.258  16.744  -17.294 1.00 0.00 ? 77  PRO A CD   1  
ATOM 1106  H HA   . PRO A 1 77  ? 62.664  15.522  -16.073 1.00 0.00 ? 77  PRO A HA   1  
ATOM 1107  H HB2  . PRO A 1 77  ? 64.281  14.159  -18.189 1.00 0.00 ? 77  PRO A HB2  1  
ATOM 1108  H HB3  . PRO A 1 77  ? 62.680  14.923  -18.302 1.00 0.00 ? 77  PRO A HB3  1  
ATOM 1109  H HG2  . PRO A 1 77  ? 64.858  16.092  -19.317 1.00 0.00 ? 77  PRO A HG2  1  
ATOM 1110  H HG3  . PRO A 1 77  ? 63.553  17.033  -18.572 1.00 0.00 ? 77  PRO A HG3  1  
ATOM 1111  H HD2  . PRO A 1 77  ? 66.254  16.344  -17.449 1.00 0.00 ? 77  PRO A HD2  1  
ATOM 1112  H HD3  . PRO A 1 77  ? 65.278  17.818  -17.262 1.00 0.00 ? 77  PRO A HD3  1  
ATOM 1113  N N    . THR A 1 78  ? 63.527  12.713  -16.338 1.00 0.00 ? 78  THR A N    1  
ATOM 1114  C CA   . THR A 1 78  ? 63.696  11.360  -15.782 1.00 0.00 ? 78  THR A CA   1  
ATOM 1115  C C    . THR A 1 78  ? 64.344  10.412  -16.793 1.00 0.00 ? 78  THR A C    1  
ATOM 1116  O O    . THR A 1 78  ? 64.174  10.565  -18.003 1.00 0.00 ? 78  THR A O    1  
ATOM 1117  C CB   . THR A 1 78  ? 62.328  10.769  -15.391 1.00 0.00 ? 78  THR A CB   1  
ATOM 1118  O OG1  . THR A 1 78  ? 61.619  10.407  -16.568 1.00 0.00 ? 78  THR A OG1  1  
ATOM 1119  C CG2  . THR A 1 78  ? 61.519  11.807  -14.609 1.00 0.00 ? 78  THR A CG2  1  
ATOM 1120  H H    . THR A 1 78  ? 63.101  12.816  -17.214 1.00 0.00 ? 78  THR A H    1  
ATOM 1121  H HA   . THR A 1 78  ? 64.318  11.402  -14.899 1.00 0.00 ? 78  THR A HA   1  
ATOM 1122  H HB   . THR A 1 78  ? 62.475  9.893   -14.778 1.00 0.00 ? 78  THR A HB   1  
ATOM 1123  H HG1  . THR A 1 78  ? 60.864  9.874   -16.308 1.00 0.00 ? 78  THR A HG1  1  
ATOM 1124  H HG21 . THR A 1 78  ? 60.685  11.322  -14.123 1.00 0.00 ? 78  THR A HG21 1  
ATOM 1125  H HG22 . THR A 1 78  ? 61.150  12.562  -15.288 1.00 0.00 ? 78  THR A HG22 1  
ATOM 1126  H HG23 . THR A 1 78  ? 62.148  12.272  -13.863 1.00 0.00 ? 78  THR A HG23 1  
ATOM 1127  N N    . THR A 1 79  ? 65.080  9.418   -16.278 1.00 0.00 ? 79  THR A N    1  
ATOM 1128  C CA   . THR A 1 79  ? 65.749  8.418   -17.119 1.00 0.00 ? 79  THR A CA   1  
ATOM 1129  C C    . THR A 1 79  ? 65.235  7.034   -16.737 1.00 0.00 ? 79  THR A C    1  
ATOM 1130  O O    . THR A 1 79  ? 65.220  6.681   -15.559 1.00 0.00 ? 79  THR A O    1  
ATOM 1131  C CB   . THR A 1 79  ? 67.278  8.471   -16.913 1.00 0.00 ? 79  THR A CB   1  
ATOM 1132  O OG1  . THR A 1 79  ? 67.775  9.704   -17.412 1.00 0.00 ? 79  THR A OG1  1  
ATOM 1133  C CG2  . THR A 1 79  ? 67.955  7.313   -17.655 1.00 0.00 ? 79  THR A CG2  1  
ATOM 1134  H H    . THR A 1 79  ? 65.162  9.343   -15.300 1.00 0.00 ? 79  THR A H    1  
ATOM 1135  H HA   . THR A 1 79  ? 65.527  8.600   -18.163 1.00 0.00 ? 79  THR A HA   1  
ATOM 1136  H HB   . THR A 1 79  ? 67.498  8.397   -15.862 1.00 0.00 ? 79  THR A HB   1  
ATOM 1137  H HG1  . THR A 1 79  ? 68.140  10.197  -16.673 1.00 0.00 ? 79  THR A HG1  1  
ATOM 1138  H HG21 . THR A 1 79  ? 67.768  6.389   -17.127 1.00 0.00 ? 79  THR A HG21 1  
ATOM 1139  H HG22 . THR A 1 79  ? 69.019  7.490   -17.705 1.00 0.00 ? 79  THR A HG22 1  
ATOM 1140  H HG23 . THR A 1 79  ? 67.555  7.243   -18.655 1.00 0.00 ? 79  THR A HG23 1  
ATOM 1141  N N    . TYR A 1 80  ? 64.788  6.262   -17.733 1.00 0.00 ? 80  TYR A N    1  
ATOM 1142  C CA   . TYR A 1 80  ? 64.236  4.918   -17.490 1.00 0.00 ? 80  TYR A CA   1  
ATOM 1143  C C    . TYR A 1 80  ? 64.937  3.882   -18.375 1.00 0.00 ? 80  TYR A C    1  
ATOM 1144  O O    . TYR A 1 80  ? 65.448  4.206   -19.448 1.00 0.00 ? 80  TYR A O    1  
ATOM 1145  C CB   . TYR A 1 80  ? 62.693  4.976   -17.738 1.00 0.00 ? 80  TYR A CB   1  
ATOM 1146  C CG   . TYR A 1 80  ? 62.192  3.880   -18.670 1.00 0.00 ? 80  TYR A CG   1  
ATOM 1147  C CD1  . TYR A 1 80  ? 62.224  2.533   -18.256 1.00 0.00 ? 80  TYR A CD1  1  
ATOM 1148  C CD2  . TYR A 1 80  ? 61.666  4.209   -19.944 1.00 0.00 ? 80  TYR A CD2  1  
ATOM 1149  C CE1  . TYR A 1 80  ? 61.741  1.518   -19.113 1.00 0.00 ? 80  TYR A CE1  1  
ATOM 1150  C CE2  . TYR A 1 80  ? 61.177  3.193   -20.793 1.00 0.00 ? 80  TYR A CE2  1  
ATOM 1151  C CZ   . TYR A 1 80  ? 61.219  1.847   -20.380 1.00 0.00 ? 80  TYR A CZ   1  
ATOM 1152  O OH   . TYR A 1 80  ? 60.516  0.896   -21.093 1.00 0.00 ? 80  TYR A OH   1  
ATOM 1153  H H    . TYR A 1 80  ? 64.814  6.605   -18.652 1.00 0.00 ? 80  TYR A H    1  
ATOM 1154  H HA   . TYR A 1 80  ? 64.412  4.639   -16.456 1.00 0.00 ? 80  TYR A HA   1  
ATOM 1155  H HB2  . TYR A 1 80  ? 62.174  4.884   -16.795 1.00 0.00 ? 80  TYR A HB2  1  
ATOM 1156  H HB3  . TYR A 1 80  ? 62.452  5.939   -18.163 1.00 0.00 ? 80  TYR A HB3  1  
ATOM 1157  H HD1  . TYR A 1 80  ? 62.622  2.275   -17.286 1.00 0.00 ? 80  TYR A HD1  1  
ATOM 1158  H HD2  . TYR A 1 80  ? 61.639  5.239   -20.269 1.00 0.00 ? 80  TYR A HD2  1  
ATOM 1159  H HE1  . TYR A 1 80  ? 61.772  0.491   -18.799 1.00 0.00 ? 80  TYR A HE1  1  
ATOM 1160  H HE2  . TYR A 1 80  ? 60.774  3.445   -21.760 1.00 0.00 ? 80  TYR A HE2  1  
ATOM 1161  H HH   . TYR A 1 80  ? 60.981  0.741   -21.917 1.00 0.00 ? 80  TYR A HH   1  
ATOM 1162  N N    . TYR A 1 81  ? 64.949  2.626   -17.910 1.00 0.00 ? 81  TYR A N    1  
ATOM 1163  C CA   . TYR A 1 81  ? 65.576  1.523   -18.647 1.00 0.00 ? 81  TYR A CA   1  
ATOM 1164  C C    . TYR A 1 81  ? 64.598  0.359   -18.774 1.00 0.00 ? 81  TYR A C    1  
ATOM 1165  O O    . TYR A 1 81  ? 63.909  0.009   -17.816 1.00 0.00 ? 81  TYR A O    1  
ATOM 1166  C CB   . TYR A 1 81  ? 66.827  1.030   -17.909 1.00 0.00 ? 81  TYR A CB   1  
ATOM 1167  C CG   . TYR A 1 81  ? 67.759  2.187   -17.629 1.00 0.00 ? 81  TYR A CG   1  
ATOM 1168  C CD1  . TYR A 1 81  ? 68.640  2.643   -18.633 1.00 0.00 ? 81  TYR A CD1  1  
ATOM 1169  C CD2  . TYR A 1 81  ? 67.754  2.809   -16.360 1.00 0.00 ? 81  TYR A CD2  1  
ATOM 1170  C CE1  . TYR A 1 81  ? 69.514  3.721   -18.369 1.00 0.00 ? 81  TYR A CE1  1  
ATOM 1171  C CE2  . TYR A 1 81  ? 68.628  3.884   -16.097 1.00 0.00 ? 81  TYR A CE2  1  
ATOM 1172  C CZ   . TYR A 1 81  ? 69.507  4.341   -17.102 1.00 0.00 ? 81  TYR A CZ   1  
ATOM 1173  O OH   . TYR A 1 81  ? 70.381  5.376   -16.835 1.00 0.00 ? 81  TYR A OH   1  
ATOM 1174  H H    . TYR A 1 81  ? 64.516  2.428   -17.054 1.00 0.00 ? 81  TYR A H    1  
ATOM 1175  H HA   . TYR A 1 81  ? 65.861  1.853   -19.638 1.00 0.00 ? 81  TYR A HA   1  
ATOM 1176  H HB2  . TYR A 1 81  ? 66.533  0.569   -16.977 1.00 0.00 ? 81  TYR A HB2  1  
ATOM 1177  H HB3  . TYR A 1 81  ? 67.338  0.301   -18.522 1.00 0.00 ? 81  TYR A HB3  1  
ATOM 1178  H HD1  . TYR A 1 81  ? 68.647  2.166   -19.601 1.00 0.00 ? 81  TYR A HD1  1  
ATOM 1179  H HD2  . TYR A 1 81  ? 67.083  2.460   -15.593 1.00 0.00 ? 81  TYR A HD2  1  
ATOM 1180  H HE1  . TYR A 1 81  ? 70.187  4.071   -19.139 1.00 0.00 ? 81  TYR A HE1  1  
ATOM 1181  H HE2  . TYR A 1 81  ? 68.623  4.355   -15.127 1.00 0.00 ? 81  TYR A HE2  1  
ATOM 1182  H HH   . TYR A 1 81  ? 71.220  4.995   -16.566 1.00 0.00 ? 81  TYR A HH   1  
ATOM 1183  N N    . SER A 1 82  ? 64.549  -0.244  -19.961 1.00 0.00 ? 82  SER A N    1  
ATOM 1184  C CA   . SER A 1 82  ? 63.661  -1.384  -20.218 1.00 0.00 ? 82  SER A CA   1  
ATOM 1185  C C    . SER A 1 82  ? 64.467  -2.675  -20.259 1.00 0.00 ? 82  SER A C    1  
ATOM 1186  O O    . SER A 1 82  ? 64.586  -3.312  -21.304 1.00 0.00 ? 82  SER A O    1  
ATOM 1187  C CB   . SER A 1 82  ? 62.947  -1.189  -21.557 1.00 0.00 ? 82  SER A CB   1  
ATOM 1188  O OG   . SER A 1 82  ? 63.860  -1.441  -22.617 1.00 0.00 ? 82  SER A OG   1  
ATOM 1189  H H    . SER A 1 82  ? 65.129  0.077   -20.684 1.00 0.00 ? 82  SER A H    1  
ATOM 1190  H HA   . SER A 1 82  ? 62.919  -1.460  -19.435 1.00 0.00 ? 82  SER A HA   1  
ATOM 1191  H HB2  . SER A 1 82  ? 62.120  -1.875  -21.631 1.00 0.00 ? 82  SER A HB2  1  
ATOM 1192  H HB3  . SER A 1 82  ? 62.577  -0.175  -21.622 1.00 0.00 ? 82  SER A HB3  1  
ATOM 1193  H HG   . SER A 1 82  ? 64.733  -1.561  -22.235 1.00 0.00 ? 82  SER A HG   1  
ATOM 1194  N N    . ILE A 1 83  ? 65.030  -3.046  -19.117 1.00 0.00 ? 83  ILE A N    1  
ATOM 1195  C CA   . ILE A 1 83  ? 65.840  -4.256  -19.031 1.00 0.00 ? 83  ILE A CA   1  
ATOM 1196  C C    . ILE A 1 83  ? 64.962  -5.507  -19.123 1.00 0.00 ? 83  ILE A C    1  
ATOM 1197  O O    . ILE A 1 83  ? 64.368  -5.943  -18.139 1.00 0.00 ? 83  ILE A O    1  
ATOM 1198  C CB   . ILE A 1 83  ? 66.641  -4.282  -17.699 1.00 0.00 ? 83  ILE A CB   1  
ATOM 1199  C CG1  . ILE A 1 83  ? 65.724  -3.853  -16.516 1.00 0.00 ? 83  ILE A CG1  1  
ATOM 1200  C CG2  . ILE A 1 83  ? 67.836  -3.311  -17.805 1.00 0.00 ? 83  ILE A CG2  1  
ATOM 1201  C CD1  . ILE A 1 83  ? 66.207  -4.499  -15.204 1.00 0.00 ? 83  ILE A CD1  1  
ATOM 1202  H H    . ILE A 1 83  ? 64.912  -2.488  -18.320 1.00 0.00 ? 83  ILE A H    1  
ATOM 1203  H HA   . ILE A 1 83  ? 66.537  -4.266  -19.857 1.00 0.00 ? 83  ILE A HA   1  
ATOM 1204  H HB   . ILE A 1 83  ? 67.017  -5.284  -17.529 1.00 0.00 ? 83  ILE A HB   1  
ATOM 1205  H HG12 . ILE A 1 83  ? 65.742  -2.776  -16.410 1.00 0.00 ? 83  ILE A HG12 1  
ATOM 1206  H HG13 . ILE A 1 83  ? 64.711  -4.166  -16.705 1.00 0.00 ? 83  ILE A HG13 1  
ATOM 1207  H HG21 . ILE A 1 83  ? 67.515  -2.393  -18.274 1.00 0.00 ? 83  ILE A HG21 1  
ATOM 1208  H HG22 . ILE A 1 83  ? 68.615  -3.763  -18.399 1.00 0.00 ? 83  ILE A HG22 1  
ATOM 1209  H HG23 . ILE A 1 83  ? 68.217  -3.093  -16.820 1.00 0.00 ? 83  ILE A HG23 1  
ATOM 1210  H HD11 . ILE A 1 83  ? 65.801  -3.955  -14.363 1.00 0.00 ? 83  ILE A HD11 1  
ATOM 1211  H HD12 . ILE A 1 83  ? 67.284  -4.475  -15.159 1.00 0.00 ? 83  ILE A HD12 1  
ATOM 1212  H HD13 . ILE A 1 83  ? 65.871  -5.525  -15.163 1.00 0.00 ? 83  ILE A HD13 1  
ATOM 1213  N N    . ILE A 1 84  ? 64.897  -6.098  -20.316 1.00 0.00 ? 84  ILE A N    1  
ATOM 1214  C CA   . ILE A 1 84  ? 64.105  -7.310  -20.524 1.00 0.00 ? 84  ILE A CA   1  
ATOM 1215  C C    . ILE A 1 84  ? 64.951  -8.537  -20.207 1.00 0.00 ? 84  ILE A C    1  
ATOM 1216  O O    . ILE A 1 84  ? 66.157  -8.543  -20.449 1.00 0.00 ? 84  ILE A O    1  
ATOM 1217  C CB   . ILE A 1 84  ? 63.623  -7.404  -21.990 1.00 0.00 ? 84  ILE A CB   1  
ATOM 1218  C CG1  . ILE A 1 84  ? 63.049  -6.047  -22.419 1.00 0.00 ? 84  ILE A CG1  1  
ATOM 1219  C CG2  . ILE A 1 84  ? 62.544  -8.486  -22.117 1.00 0.00 ? 84  ILE A CG2  1  
ATOM 1220  C CD1  . ILE A 1 84  ? 62.520  -6.129  -23.858 1.00 0.00 ? 84  ILE A CD1  1  
ATOM 1221  H H    . ILE A 1 84  ? 65.399  -5.731  -21.074 1.00 0.00 ? 84  ILE A H    1  
ATOM 1222  H HA   . ILE A 1 84  ? 63.243  -7.295  -19.873 1.00 0.00 ? 84  ILE A HA   1  
ATOM 1223  H HB   . ILE A 1 84  ? 64.459  -7.657  -22.628 1.00 0.00 ? 84  ILE A HB   1  
ATOM 1224  H HG12 . ILE A 1 84  ? 62.243  -5.773  -21.755 1.00 0.00 ? 84  ILE A HG12 1  
ATOM 1225  H HG13 . ILE A 1 84  ? 63.825  -5.299  -22.368 1.00 0.00 ? 84  ILE A HG13 1  
ATOM 1226  H HG21 . ILE A 1 84  ? 62.862  -9.376  -21.594 1.00 0.00 ? 84  ILE A HG21 1  
ATOM 1227  H HG22 . ILE A 1 84  ? 62.391  -8.722  -23.159 1.00 0.00 ? 84  ILE A HG22 1  
ATOM 1228  H HG23 . ILE A 1 84  ? 61.619  -8.128  -21.687 1.00 0.00 ? 84  ILE A HG23 1  
ATOM 1229  H HD11 . ILE A 1 84  ? 61.562  -6.628  -23.862 1.00 0.00 ? 84  ILE A HD11 1  
ATOM 1230  H HD12 . ILE A 1 84  ? 63.217  -6.680  -24.473 1.00 0.00 ? 84  ILE A HD12 1  
ATOM 1231  H HD13 . ILE A 1 84  ? 62.405  -5.131  -24.255 1.00 0.00 ? 84  ILE A HD13 1  
ATOM 1232  N N    . GLY A 1 85  ? 64.321  -9.571  -19.655 1.00 0.00 ? 85  GLY A N    1  
ATOM 1233  C CA   . GLY A 1 85  ? 65.042  -10.787 -19.312 1.00 0.00 ? 85  GLY A CA   1  
ATOM 1234  C C    . GLY A 1 85  ? 64.317  -11.606 -18.266 1.00 0.00 ? 85  GLY A C    1  
ATOM 1235  O O    . GLY A 1 85  ? 63.445  -11.099 -17.560 1.00 0.00 ? 85  GLY A O    1  
ATOM 1236  H H    . GLY A 1 85  ? 63.361  -9.510  -19.469 1.00 0.00 ? 85  GLY A H    1  
ATOM 1237  H HA2  . GLY A 1 85  ? 65.163  -11.385 -20.203 1.00 0.00 ? 85  GLY A HA2  1  
ATOM 1238  H HA3  . GLY A 1 85  ? 66.018  -10.523 -18.930 1.00 0.00 ? 85  GLY A HA3  1  
ATOM 1239  N N    . GLY A 1 86  ? 64.687  -12.876 -18.161 1.00 0.00 ? 86  GLY A N    1  
ATOM 1240  C CA   . GLY A 1 86  ? 64.071  -13.756 -17.188 1.00 0.00 ? 86  GLY A CA   1  
ATOM 1241  C C    . GLY A 1 86  ? 62.584  -13.914 -17.421 1.00 0.00 ? 86  GLY A C    1  
ATOM 1242  O O    . GLY A 1 86  ? 61.831  -14.203 -16.492 1.00 0.00 ? 86  GLY A O    1  
ATOM 1243  H H    . GLY A 1 86  ? 65.394  -13.224 -18.745 1.00 0.00 ? 86  GLY A H    1  
ATOM 1244  H HA2  . GLY A 1 86  ? 64.543  -14.726 -17.242 1.00 0.00 ? 86  GLY A HA2  1  
ATOM 1245  H HA3  . GLY A 1 86  ? 64.226  -13.342 -16.205 1.00 0.00 ? 86  GLY A HA3  1  
ATOM 1246  N N    . GLY A 1 87  ? 62.157  -13.721 -18.663 1.00 0.00 ? 87  GLY A N    1  
ATOM 1247  C CA   . GLY A 1 87  ? 60.752  -13.842 -18.997 1.00 0.00 ? 87  GLY A CA   1  
ATOM 1248  C C    . GLY A 1 87  ? 59.940  -12.704 -18.413 1.00 0.00 ? 87  GLY A C    1  
ATOM 1249  O O    . GLY A 1 87  ? 58.711  -12.728 -18.440 1.00 0.00 ? 87  GLY A O    1  
ATOM 1250  H H    . GLY A 1 87  ? 62.801  -13.492 -19.366 1.00 0.00 ? 87  GLY A H    1  
ATOM 1251  H HA2  . GLY A 1 87  ? 60.644  -13.837 -20.072 1.00 0.00 ? 87  GLY A HA2  1  
ATOM 1252  H HA3  . GLY A 1 87  ? 60.377  -14.778 -18.609 1.00 0.00 ? 87  GLY A HA3  1  
ATOM 1253  N N    . LEU A 1 88  ? 60.642  -11.696 -17.889 1.00 0.00 ? 88  LEU A N    1  
ATOM 1254  C CA   . LEU A 1 88  ? 59.994  -10.522 -17.290 1.00 0.00 ? 88  LEU A CA   1  
ATOM 1255  C C    . LEU A 1 88  ? 60.667  -9.243  -17.783 1.00 0.00 ? 88  LEU A C    1  
ATOM 1256  O O    . LEU A 1 88  ? 61.784  -9.274  -18.297 1.00 0.00 ? 88  LEU A O    1  
ATOM 1257  C CB   . LEU A 1 88  ? 60.094  -10.577 -15.756 1.00 0.00 ? 88  LEU A CB   1  
ATOM 1258  C CG   . LEU A 1 88  ? 59.636  -11.949 -15.221 1.00 0.00 ? 88  LEU A CG   1  
ATOM 1259  C CD1  . LEU A 1 88  ? 60.046  -12.090 -13.753 1.00 0.00 ? 88  LEU A CD1  1  
ATOM 1260  C CD2  . LEU A 1 88  ? 58.111  -12.074 -15.314 1.00 0.00 ? 88  LEU A CD2  1  
ATOM 1261  H H    . LEU A 1 88  ? 61.621  -11.741 -17.915 1.00 0.00 ? 88  LEU A H    1  
ATOM 1262  H HA   . LEU A 1 88  ? 58.952  -10.492 -17.574 1.00 0.00 ? 88  LEU A HA   1  
ATOM 1263  H HB2  . LEU A 1 88  ? 61.120  -10.405 -15.464 1.00 0.00 ? 88  LEU A HB2  1  
ATOM 1264  H HB3  . LEU A 1 88  ? 59.471  -9.804  -15.332 1.00 0.00 ? 88  LEU A HB3  1  
ATOM 1265  H HG   . LEU A 1 88  ? 60.099  -12.736 -15.791 1.00 0.00 ? 88  LEU A HG   1  
ATOM 1266  H HD11 . LEU A 1 88  ? 59.480  -11.391 -13.156 1.00 0.00 ? 88  LEU A HD11 1  
ATOM 1267  H HD12 . LEU A 1 88  ? 61.101  -11.886 -13.646 1.00 0.00 ? 88  LEU A HD12 1  
ATOM 1268  H HD13 . LEU A 1 88  ? 59.839  -13.095 -13.418 1.00 0.00 ? 88  LEU A HD13 1  
ATOM 1269  H HD21 . LEU A 1 88  ? 57.797  -12.974 -14.808 1.00 0.00 ? 88  LEU A HD21 1  
ATOM 1270  H HD22 . LEU A 1 88  ? 57.810  -12.123 -16.347 1.00 0.00 ? 88  LEU A HD22 1  
ATOM 1271  H HD23 . LEU A 1 88  ? 57.647  -11.219 -14.844 1.00 0.00 ? 88  LEU A HD23 1  
ATOM 1272  N N    . ARG A 1 89  ? 59.976  -8.116  -17.607 1.00 0.00 ? 89  ARG A N    1  
ATOM 1273  C CA   . ARG A 1 89  ? 60.499  -6.808  -18.018 1.00 0.00 ? 89  ARG A CA   1  
ATOM 1274  C C    . ARG A 1 89  ? 60.370  -5.825  -16.863 1.00 0.00 ? 89  ARG A C    1  
ATOM 1275  O O    . ARG A 1 89  ? 59.264  -5.465  -16.473 1.00 0.00 ? 89  ARG A O    1  
ATOM 1276  C CB   . ARG A 1 89  ? 59.713  -6.285  -19.225 1.00 0.00 ? 89  ARG A CB   1  
ATOM 1277  C CG   . ARG A 1 89  ? 60.230  -4.899  -19.621 1.00 0.00 ? 89  ARG A CG   1  
ATOM 1278  C CD   . ARG A 1 89  ? 59.618  -4.493  -20.963 1.00 0.00 ? 89  ARG A CD   1  
ATOM 1279  N NE   . ARG A 1 89  ? 58.132  -4.523  -20.859 1.00 0.00 ? 89  ARG A NE   1  
ATOM 1280  C CZ   . ARG A 1 89  ? 57.398  -4.152  -21.872 1.00 0.00 ? 89  ARG A CZ   1  
ATOM 1281  N NH1  . ARG A 1 89  ? 57.912  -3.408  -22.812 1.00 0.00 ? 89  ARG A NH1  1  
ATOM 1282  N NH2  . ARG A 1 89  ? 56.150  -4.527  -21.945 1.00 0.00 ? 89  ARG A NH2  1  
ATOM 1283  H H    . ARG A 1 89  ? 59.094  -8.162  -17.182 1.00 0.00 ? 89  ARG A H    1  
ATOM 1284  H HA   . ARG A 1 89  ? 61.543  -6.893  -18.288 1.00 0.00 ? 89  ARG A HA   1  
ATOM 1285  H HB2  . ARG A 1 89  ? 59.840  -6.965  -20.054 1.00 0.00 ? 89  ARG A HB2  1  
ATOM 1286  H HB3  . ARG A 1 89  ? 58.666  -6.218  -18.971 1.00 0.00 ? 89  ARG A HB3  1  
ATOM 1287  H HG2  . ARG A 1 89  ? 59.949  -4.179  -18.867 1.00 0.00 ? 89  ARG A HG2  1  
ATOM 1288  H HG3  . ARG A 1 89  ? 61.305  -4.927  -19.712 1.00 0.00 ? 89  ARG A HG3  1  
ATOM 1289  H HD2  . ARG A 1 89  ? 59.940  -3.494  -21.218 1.00 0.00 ? 89  ARG A HD2  1  
ATOM 1290  H HD3  . ARG A 1 89  ? 59.940  -5.182  -21.730 1.00 0.00 ? 89  ARG A HD3  1  
ATOM 1291  H HE   . ARG A 1 89  ? 57.706  -4.824  -20.028 1.00 0.00 ? 89  ARG A HE   1  
ATOM 1292  H HH11 . ARG A 1 89  ? 58.868  -3.120  -22.756 1.00 0.00 ? 89  ARG A HH11 1  
ATOM 1293  H HH12 . ARG A 1 89  ? 57.349  -3.123  -23.588 1.00 0.00 ? 89  ARG A HH12 1  
ATOM 1294  H HH21 . ARG A 1 89  ? 55.756  -5.098  -21.224 1.00 0.00 ? 89  ARG A HH21 1  
ATOM 1295  H HH22 . ARG A 1 89  ? 55.587  -4.243  -22.720 1.00 0.00 ? 89  ARG A HH22 1  
ATOM 1296  N N    . MET A 1 90  ? 61.510  -5.402  -16.311 1.00 0.00 ? 90  MET A N    1  
ATOM 1297  C CA   . MET A 1 90  ? 61.521  -4.466  -15.180 1.00 0.00 ? 90  MET A CA   1  
ATOM 1298  C C    . MET A 1 90  ? 61.831  -3.053  -15.655 1.00 0.00 ? 90  MET A C    1  
ATOM 1299  O O    . MET A 1 90  ? 62.965  -2.740  -16.010 1.00 0.00 ? 90  MET A O    1  
ATOM 1300  C CB   . MET A 1 90  ? 62.582  -4.897  -14.159 1.00 0.00 ? 90  MET A CB   1  
ATOM 1301  C CG   . MET A 1 90  ? 62.420  -6.386  -13.826 1.00 0.00 ? 90  MET A CG   1  
ATOM 1302  S SD   . MET A 1 90  ? 63.102  -7.385  -15.174 1.00 0.00 ? 90  MET A SD   1  
ATOM 1303  C CE   . MET A 1 90  ? 63.529  -8.844  -14.190 1.00 0.00 ? 90  MET A CE   1  
ATOM 1304  H H    . MET A 1 90  ? 62.362  -5.733  -16.664 1.00 0.00 ? 90  MET A H    1  
ATOM 1305  H HA   . MET A 1 90  ? 60.556  -4.467  -14.694 1.00 0.00 ? 90  MET A HA   1  
ATOM 1306  H HB2  . MET A 1 90  ? 63.565  -4.728  -14.573 1.00 0.00 ? 90  MET A HB2  1  
ATOM 1307  H HB3  . MET A 1 90  ? 62.467  -4.315  -13.257 1.00 0.00 ? 90  MET A HB3  1  
ATOM 1308  H HG2  . MET A 1 90  ? 62.951  -6.608  -12.912 1.00 0.00 ? 90  MET A HG2  1  
ATOM 1309  H HG3  . MET A 1 90  ? 61.373  -6.620  -13.697 1.00 0.00 ? 90  MET A HG3  1  
ATOM 1310  H HE1  . MET A 1 90  ? 64.411  -8.636  -13.603 1.00 0.00 ? 90  MET A HE1  1  
ATOM 1311  H HE2  . MET A 1 90  ? 63.721  -9.678  -14.847 1.00 0.00 ? 90  MET A HE2  1  
ATOM 1312  H HE3  . MET A 1 90  ? 62.708  -9.086  -13.531 1.00 0.00 ? 90  MET A HE3  1  
ATOM 1313  N N    . ASN A 1 91  ? 60.811  -2.197  -15.661 1.00 0.00 ? 91  ASN A N    1  
ATOM 1314  C CA   . ASN A 1 91  ? 60.981  -0.813  -16.099 1.00 0.00 ? 91  ASN A CA   1  
ATOM 1315  C C    . ASN A 1 91  ? 61.387  0.086   -14.935 1.00 0.00 ? 91  ASN A C    1  
ATOM 1316  O O    . ASN A 1 91  ? 60.745  0.092   -13.885 1.00 0.00 ? 91  ASN A O    1  
ATOM 1317  C CB   . ASN A 1 91  ? 59.678  -0.296  -16.711 1.00 0.00 ? 91  ASN A CB   1  
ATOM 1318  C CG   . ASN A 1 91  ? 59.239  -1.229  -17.840 1.00 0.00 ? 91  ASN A CG   1  
ATOM 1319  O OD1  . ASN A 1 91  ? 58.100  -1.653  -17.886 1.00 0.00 ? 91  ASN A OD1  1  
ATOM 1320  N ND2  . ASN A 1 91  ? 60.099  -1.571  -18.760 1.00 0.00 ? 91  ASN A ND2  1  
ATOM 1321  H H    . ASN A 1 91  ? 59.927  -2.502  -15.368 1.00 0.00 ? 91  ASN A H    1  
ATOM 1322  H HA   . ASN A 1 91  ? 61.754  -0.771  -16.851 1.00 0.00 ? 91  ASN A HA   1  
ATOM 1323  H HB2  . ASN A 1 91  ? 58.913  -0.264  -15.950 1.00 0.00 ? 91  ASN A HB2  1  
ATOM 1324  H HB3  . ASN A 1 91  ? 59.834  0.696   -17.107 1.00 0.00 ? 91  ASN A HB3  1  
ATOM 1325  H HD21 . ASN A 1 91  ? 61.017  -1.230  -18.723 1.00 0.00 ? 91  ASN A HD21 1  
ATOM 1326  H HD22 . ASN A 1 91  ? 59.828  -2.168  -19.488 1.00 0.00 ? 91  ASN A HD22 1  
ATOM 1327  N N    . PHE A 1 92  ? 62.461  0.847   -15.141 1.00 0.00 ? 92  PHE A N    1  
ATOM 1328  C CA   . PHE A 1 92  ? 62.975  1.767   -14.121 1.00 0.00 ? 92  PHE A CA   1  
ATOM 1329  C C    . PHE A 1 92  ? 62.442  3.179   -14.386 1.00 0.00 ? 92  PHE A C    1  
ATOM 1330  O O    . PHE A 1 92  ? 61.477  3.353   -15.131 1.00 0.00 ? 92  PHE A O    1  
ATOM 1331  C CB   . PHE A 1 92  ? 64.526  1.751   -14.162 1.00 0.00 ? 92  PHE A CB   1  
ATOM 1332  C CG   . PHE A 1 92  ? 65.112  1.822   -12.760 1.00 0.00 ? 92  PHE A CG   1  
ATOM 1333  C CD1  . PHE A 1 92  ? 64.830  0.797   -11.830 1.00 0.00 ? 92  PHE A CD1  1  
ATOM 1334  C CD2  . PHE A 1 92  ? 65.947  2.902   -12.385 1.00 0.00 ? 92  PHE A CD2  1  
ATOM 1335  C CE1  . PHE A 1 92  ? 65.375  0.851   -10.529 1.00 0.00 ? 92  PHE A CE1  1  
ATOM 1336  C CE2  . PHE A 1 92  ? 66.494  2.951   -11.084 1.00 0.00 ? 92  PHE A CE2  1  
ATOM 1337  C CZ   . PHE A 1 92  ? 66.207  1.928   -10.156 1.00 0.00 ? 92  PHE A CZ   1  
ATOM 1338  H H    . PHE A 1 92  ? 62.919  0.790   -16.005 1.00 0.00 ? 92  PHE A H    1  
ATOM 1339  H HA   . PHE A 1 92  ? 62.635  1.444   -13.144 1.00 0.00 ? 92  PHE A HA   1  
ATOM 1340  H HB2  . PHE A 1 92  ? 64.851  0.832   -14.627 1.00 0.00 ? 92  PHE A HB2  1  
ATOM 1341  H HB3  . PHE A 1 92  ? 64.889  2.584   -14.750 1.00 0.00 ? 92  PHE A HB3  1  
ATOM 1342  H HD1  . PHE A 1 92  ? 64.193  -0.028  -12.114 1.00 0.00 ? 92  PHE A HD1  1  
ATOM 1343  H HD2  . PHE A 1 92  ? 66.165  3.689   -13.091 1.00 0.00 ? 92  PHE A HD2  1  
ATOM 1344  H HE1  . PHE A 1 92  ? 65.155  0.067   -9.819  1.00 0.00 ? 92  PHE A HE1  1  
ATOM 1345  H HE2  . PHE A 1 92  ? 67.132  3.775   -10.797 1.00 0.00 ? 92  PHE A HE2  1  
ATOM 1346  H HZ   . PHE A 1 92  ? 66.590  1.990   -9.149  1.00 0.00 ? 92  PHE A HZ   1  
ATOM 1347  N N    . GLY A 1 93  ? 63.078  4.181   -13.778 1.00 0.00 ? 93  GLY A N    1  
ATOM 1348  C CA   . GLY A 1 93  ? 62.664  5.567   -13.963 1.00 0.00 ? 93  GLY A CA   1  
ATOM 1349  C C    . GLY A 1 93  ? 63.112  6.451   -12.816 1.00 0.00 ? 93  GLY A C    1  
ATOM 1350  O O    . GLY A 1 93  ? 62.291  6.892   -12.011 1.00 0.00 ? 93  GLY A O    1  
ATOM 1351  H H    . GLY A 1 93  ? 63.843  3.982   -13.199 1.00 0.00 ? 93  GLY A H    1  
ATOM 1352  H HA2  . GLY A 1 93  ? 63.089  5.940   -14.880 1.00 0.00 ? 93  GLY A HA2  1  
ATOM 1353  H HA3  . GLY A 1 93  ? 61.585  5.612   -14.035 1.00 0.00 ? 93  GLY A HA3  1  
ATOM 1354  N N    . PHE A 1 94  ? 64.423  6.705   -12.721 1.00 0.00 ? 94  PHE A N    1  
ATOM 1355  C CA   . PHE A 1 94  ? 64.955  7.534   -11.634 1.00 0.00 ? 94  PHE A CA   1  
ATOM 1356  C C    . PHE A 1 94  ? 64.964  9.007   -12.023 1.00 0.00 ? 94  PHE A C    1  
ATOM 1357  O O    . PHE A 1 94  ? 64.987  9.355   -13.203 1.00 0.00 ? 94  PHE A O    1  
ATOM 1358  C CB   . PHE A 1 94  ? 66.371  7.059   -11.241 1.00 0.00 ? 94  PHE A CB   1  
ATOM 1359  C CG   . PHE A 1 94  ? 67.425  7.580   -12.204 1.00 0.00 ? 94  PHE A CG   1  
ATOM 1360  C CD1  . PHE A 1 94  ? 67.867  8.918   -12.107 1.00 0.00 ? 94  PHE A CD1  1  
ATOM 1361  C CD2  . PHE A 1 94  ? 67.982  6.725   -13.182 1.00 0.00 ? 94  PHE A CD2  1  
ATOM 1362  C CE1  . PHE A 1 94  ? 68.856  9.403   -12.989 1.00 0.00 ? 94  PHE A CE1  1  
ATOM 1363  C CE2  . PHE A 1 94  ? 68.979  7.208   -14.057 1.00 0.00 ? 94  PHE A CE2  1  
ATOM 1364  C CZ   . PHE A 1 94  ? 69.410  8.548   -13.966 1.00 0.00 ? 94  PHE A CZ   1  
ATOM 1365  H H    . PHE A 1 94  ? 65.042  6.319   -13.375 1.00 0.00 ? 94  PHE A H    1  
ATOM 1366  H HA   . PHE A 1 94  ? 64.313  7.423   -10.769 1.00 0.00 ? 94  PHE A HA   1  
ATOM 1367  H HB2  . PHE A 1 94  ? 66.602  7.417   -10.246 1.00 0.00 ? 94  PHE A HB2  1  
ATOM 1368  H HB3  . PHE A 1 94  ? 66.392  5.979   -11.237 1.00 0.00 ? 94  PHE A HB3  1  
ATOM 1369  H HD1  . PHE A 1 94  ? 67.446  9.574   -11.359 1.00 0.00 ? 94  PHE A HD1  1  
ATOM 1370  H HD2  . PHE A 1 94  ? 67.645  5.700   -13.259 1.00 0.00 ? 94  PHE A HD2  1  
ATOM 1371  H HE1  . PHE A 1 94  ? 69.187  10.428  -12.920 1.00 0.00 ? 94  PHE A HE1  1  
ATOM 1372  H HE2  . PHE A 1 94  ? 69.405  6.556   -14.805 1.00 0.00 ? 94  PHE A HE2  1  
ATOM 1373  H HZ   . PHE A 1 94  ? 70.220  8.898   -14.591 1.00 0.00 ? 94  PHE A HZ   1  
ATOM 1374  N N    . THR A 1 95  ? 64.944  9.870   -11.006 1.00 0.00 ? 95  THR A N    1  
ATOM 1375  C CA   . THR A 1 95  ? 64.948  11.320  -11.214 1.00 0.00 ? 95  THR A CA   1  
ATOM 1376  C C    . THR A 1 95  ? 65.821  11.993  -10.160 1.00 0.00 ? 95  THR A C    1  
ATOM 1377  O O    . THR A 1 95  ? 65.629  11.781  -8.965  1.00 0.00 ? 95  THR A O    1  
ATOM 1378  C CB   . THR A 1 95  ? 63.516  11.901  -11.105 1.00 0.00 ? 95  THR A CB   1  
ATOM 1379  O OG1  . THR A 1 95  ? 63.241  12.243  -9.751  1.00 0.00 ? 95  THR A OG1  1  
ATOM 1380  C CG2  . THR A 1 95  ? 62.497  10.861  -11.575 1.00 0.00 ? 95  THR A CG2  1  
ATOM 1381  H H    . THR A 1 95  ? 64.926  9.522   -10.089 1.00 0.00 ? 95  THR A H    1  
ATOM 1382  H HA   . THR A 1 95  ? 65.350  11.546  -12.195 1.00 0.00 ? 95  THR A HA   1  
ATOM 1383  H HB   . THR A 1 95  ? 63.431  12.785  -11.720 1.00 0.00 ? 95  THR A HB   1  
ATOM 1384  H HG1  . THR A 1 95  ? 62.552  11.656  -9.431  1.00 0.00 ? 95  THR A HG1  1  
ATOM 1385  H HG21 . THR A 1 95  ? 62.420  10.074  -10.839 1.00 0.00 ? 95  THR A HG21 1  
ATOM 1386  H HG22 . THR A 1 95  ? 62.817  10.444  -12.516 1.00 0.00 ? 95  THR A HG22 1  
ATOM 1387  H HG23 . THR A 1 95  ? 61.534  11.333  -11.699 1.00 0.00 ? 95  THR A HG23 1  
ATOM 1388  N N    . LYS A 1 96  ? 66.786  12.788  -10.618 1.00 0.00 ? 96  LYS A N    1  
ATOM 1389  C CA   . LYS A 1 96  ? 67.705  13.493  -9.722  1.00 0.00 ? 96  LYS A CA   1  
ATOM 1390  C C    . LYS A 1 96  ? 68.533  12.519  -8.890  1.00 0.00 ? 96  LYS A C    1  
ATOM 1391  O O    . LYS A 1 96  ? 68.859  12.801  -7.736  1.00 0.00 ? 96  LYS A O    1  
ATOM 1392  C CB   . LYS A 1 96  ? 66.943  14.446  -8.791  1.00 0.00 ? 96  LYS A CB   1  
ATOM 1393  C CG   . LYS A 1 96  ? 66.308  15.570  -9.620  1.00 0.00 ? 96  LYS A CG   1  
ATOM 1394  C CD   . LYS A 1 96  ? 65.374  16.433  -8.740  1.00 0.00 ? 96  LYS A CD   1  
ATOM 1395  C CE   . LYS A 1 96  ? 63.978  15.799  -8.643  1.00 0.00 ? 96  LYS A CE   1  
ATOM 1396  N NZ   . LYS A 1 96  ? 63.409  15.631  -10.011 1.00 0.00 ? 96  LYS A NZ   1  
ATOM 1397  H H    . LYS A 1 96  ? 66.895  12.892  -11.586 1.00 0.00 ? 96  LYS A H    1  
ATOM 1398  H HA   . LYS A 1 96  ? 68.380  14.080  -10.326 1.00 0.00 ? 96  LYS A HA   1  
ATOM 1399  H HB2  . LYS A 1 96  ? 66.180  13.908  -8.260  1.00 0.00 ? 96  LYS A HB2  1  
ATOM 1400  H HB3  . LYS A 1 96  ? 67.633  14.878  -8.082  1.00 0.00 ? 96  LYS A HB3  1  
ATOM 1401  H HG2  . LYS A 1 96  ? 67.096  16.191  -10.023 1.00 0.00 ? 96  LYS A HG2  1  
ATOM 1402  H HG3  . LYS A 1 96  ? 65.745  15.139  -10.436 1.00 0.00 ? 96  LYS A HG3  1  
ATOM 1403  H HD2  . LYS A 1 96  ? 65.793  16.528  -7.748  1.00 0.00 ? 96  LYS A HD2  1  
ATOM 1404  H HD3  . LYS A 1 96  ? 65.283  17.417  -9.177  1.00 0.00 ? 96  LYS A HD3  1  
ATOM 1405  H HE2  . LYS A 1 96  ? 64.045  14.838  -8.160  1.00 0.00 ? 96  LYS A HE2  1  
ATOM 1406  H HE3  . LYS A 1 96  ? 63.332  16.445  -8.065  1.00 0.00 ? 96  LYS A HE3  1  
ATOM 1407  H HZ1  . LYS A 1 96  ? 63.210  14.625  -10.181 1.00 0.00 ? 96  LYS A HZ1  1  
ATOM 1408  H HZ2  . LYS A 1 96  ? 64.094  15.973  -10.715 1.00 0.00 ? 96  LYS A HZ2  1  
ATOM 1409  H HZ3  . LYS A 1 96  ? 62.528  16.175  -10.090 1.00 0.00 ? 96  LYS A HZ3  1  
ATOM 1410  N N    . CYS A 1 97  ? 68.889  11.377  -9.487  1.00 0.00 ? 97  CYS A N    1  
ATOM 1411  C CA   . CYS A 1 97  ? 69.708  10.361  -8.806  1.00 0.00 ? 97  CYS A CA   1  
ATOM 1412  C C    . CYS A 1 97  ? 70.986  10.107  -9.614  1.00 0.00 ? 97  CYS A C    1  
ATOM 1413  O O    . CYS A 1 97  ? 70.952  10.168  -10.844 1.00 0.00 ? 97  CYS A O    1  
ATOM 1414  C CB   . CYS A 1 97  ? 68.926  9.050   -8.683  1.00 0.00 ? 97  CYS A CB   1  
ATOM 1415  S SG   . CYS A 1 97  ? 67.298  9.376   -7.964  1.00 0.00 ? 97  CYS A SG   1  
ATOM 1416  H H    . CYS A 1 97  ? 68.608  11.217  -10.412 1.00 0.00 ? 97  CYS A H    1  
ATOM 1417  H HA   . CYS A 1 97  ? 69.964  10.708  -7.817  1.00 0.00 ? 97  CYS A HA   1  
ATOM 1418  H HB2  . CYS A 1 97  ? 68.805  8.609   -9.660  1.00 0.00 ? 97  CYS A HB2  1  
ATOM 1419  H HB3  . CYS A 1 97  ? 69.469  8.367   -8.045  1.00 0.00 ? 97  CYS A HB3  1  
ATOM 1420  N N    . PRO A 1 98  ? 72.135  9.813   -8.959  1.00 0.00 ? 98  PRO A N    1  
ATOM 1421  C CA   . PRO A 1 98  ? 73.394  9.551   -9.675  1.00 0.00 ? 98  PRO A CA   1  
ATOM 1422  C C    . PRO A 1 98  ? 73.173  8.737   -10.953 1.00 0.00 ? 98  PRO A C    1  
ATOM 1423  O O    . PRO A 1 98  ? 72.269  7.905   -11.021 1.00 0.00 ? 98  PRO A O    1  
ATOM 1424  C CB   . PRO A 1 98  ? 74.229  8.769   -8.654  1.00 0.00 ? 98  PRO A CB   1  
ATOM 1425  C CG   . PRO A 1 98  ? 73.794  9.305   -7.326  1.00 0.00 ? 98  PRO A CG   1  
ATOM 1426  C CD   . PRO A 1 98  ? 72.317  9.710   -7.493  1.00 0.00 ? 98  PRO A CD   1  
ATOM 1427  H HA   . PRO A 1 98  ? 73.887  10.481  -9.908  1.00 0.00 ? 98  PRO A HA   1  
ATOM 1428  H HB2  . PRO A 1 98  ? 74.015  7.707   -8.726  1.00 0.00 ? 98  PRO A HB2  1  
ATOM 1429  H HB3  . PRO A 1 98  ? 75.284  8.951   -8.806  1.00 0.00 ? 98  PRO A HB3  1  
ATOM 1430  H HG2  . PRO A 1 98  ? 73.896  8.541   -6.560  1.00 0.00 ? 98  PRO A HG2  1  
ATOM 1431  H HG3  . PRO A 1 98  ? 74.383  10.173  -7.060  1.00 0.00 ? 98  PRO A HG3  1  
ATOM 1432  H HD2  . PRO A 1 98  ? 71.661  8.951   -7.081  1.00 0.00 ? 98  PRO A HD2  1  
ATOM 1433  H HD3  . PRO A 1 98  ? 72.130  10.667  -7.026  1.00 0.00 ? 98  PRO A HD3  1  
ATOM 1434  N N    . GLN A 1 99  ? 74.006  8.983   -11.958 1.00 0.00 ? 99  GLN A N    1  
ATOM 1435  C CA   . GLN A 1 99  ? 73.890  8.264   -13.221 1.00 0.00 ? 99  GLN A CA   1  
ATOM 1436  C C    . GLN A 1 99  ? 74.170  6.778   -13.016 1.00 0.00 ? 99  GLN A C    1  
ATOM 1437  O O    . GLN A 1 99  ? 75.012  6.405   -12.200 1.00 0.00 ? 99  GLN A O    1  
ATOM 1438  C CB   . GLN A 1 99  ? 74.876  8.835   -14.241 1.00 0.00 ? 99  GLN A CB   1  
ATOM 1439  C CG   . GLN A 1 99  ? 74.719  10.356  -14.309 1.00 0.00 ? 99  GLN A CG   1  
ATOM 1440  C CD   . GLN A 1 99  ? 75.640  10.916  -15.394 1.00 0.00 ? 99  GLN A CD   1  
ATOM 1441  O OE1  . GLN A 1 99  ? 76.257  11.947  -15.212 1.00 0.00 ? 99  GLN A OE1  1  
ATOM 1442  N NE2  . GLN A 1 99  ? 75.759  10.278  -16.526 1.00 0.00 ? 99  GLN A NE2  1  
ATOM 1443  H H    . GLN A 1 99  ? 74.709  9.656   -11.849 1.00 0.00 ? 99  GLN A H    1  
ATOM 1444  H HA   . GLN A 1 99  ? 72.886  8.382   -13.602 1.00 0.00 ? 99  GLN A HA   1  
ATOM 1445  H HB2  . GLN A 1 99  ? 75.885  8.589   -13.943 1.00 0.00 ? 99  GLN A HB2  1  
ATOM 1446  H HB3  . GLN A 1 99  ? 74.675  8.411   -15.213 1.00 0.00 ? 99  GLN A HB3  1  
ATOM 1447  H HG2  . GLN A 1 99  ? 73.694  10.601  -14.542 1.00 0.00 ? 99  GLN A HG2  1  
ATOM 1448  H HG3  . GLN A 1 99  ? 74.985  10.788  -13.355 1.00 0.00 ? 99  GLN A HG3  1  
ATOM 1449  H HE21 . GLN A 1 99  ? 75.261  9.447   -16.675 1.00 0.00 ? 99  GLN A HE21 1  
ATOM 1450  H HE22 . GLN A 1 99  ? 76.346  10.630  -17.228 1.00 0.00 ? 99  GLN A HE22 1  
ATOM 1451  N N    . ILE A 1 100 ? 73.463  5.935   -13.769 1.00 0.00 ? 100 ILE A N    1  
ATOM 1452  C CA   . ILE A 1 100 ? 73.638  4.479   -13.681 1.00 0.00 ? 100 ILE A CA   1  
ATOM 1453  C C    . ILE A 1 100 ? 74.340  3.969   -14.934 1.00 0.00 ? 100 ILE A C    1  
ATOM 1454  O O    . ILE A 1 100 ? 73.811  4.085   -16.040 1.00 0.00 ? 100 ILE A O    1  
ATOM 1455  C CB   . ILE A 1 100 ? 72.272  3.771   -13.553 1.00 0.00 ? 100 ILE A CB   1  
ATOM 1456  C CG1  . ILE A 1 100 ? 71.440  4.478   -12.473 1.00 0.00 ? 100 ILE A CG1  1  
ATOM 1457  C CG2  . ILE A 1 100 ? 72.482  2.300   -13.165 1.00 0.00 ? 100 ILE A CG2  1  
ATOM 1458  C CD1  . ILE A 1 100 ? 70.117  3.732   -12.252 1.00 0.00 ? 100 ILE A CD1  1  
ATOM 1459  H H    . ILE A 1 100 ? 72.814  6.296   -14.410 1.00 0.00 ? 100 ILE A H    1  
ATOM 1460  H HA   . ILE A 1 100 ? 74.242  4.233   -12.816 1.00 0.00 ? 100 ILE A HA   1  
ATOM 1461  H HB   . ILE A 1 100 ? 71.751  3.820   -14.499 1.00 0.00 ? 100 ILE A HB   1  
ATOM 1462  H HG12 . ILE A 1 100 ? 71.999  4.500   -11.549 1.00 0.00 ? 100 ILE A HG12 1  
ATOM 1463  H HG13 . ILE A 1 100 ? 71.231  5.489   -12.790 1.00 0.00 ? 100 ILE A HG13 1  
ATOM 1464  H HG21 . ILE A 1 100 ? 73.257  1.870   -13.782 1.00 0.00 ? 100 ILE A HG21 1  
ATOM 1465  H HG22 . ILE A 1 100 ? 71.563  1.754   -13.315 1.00 0.00 ? 100 ILE A HG22 1  
ATOM 1466  H HG23 . ILE A 1 100 ? 72.774  2.236   -12.127 1.00 0.00 ? 100 ILE A HG23 1  
ATOM 1467  H HD11 . ILE A 1 100 ? 70.296  2.850   -11.653 1.00 0.00 ? 100 ILE A HD11 1  
ATOM 1468  H HD12 . ILE A 1 100 ? 69.697  3.441   -13.204 1.00 0.00 ? 100 ILE A HD12 1  
ATOM 1469  H HD13 . ILE A 1 100 ? 69.423  4.379   -11.736 1.00 0.00 ? 100 ILE A HD13 1  
ATOM 1470  N N    . LYS A 1 101 ? 75.542  3.412   -14.757 1.00 0.00 ? 101 LYS A N    1  
ATOM 1471  C CA   . LYS A 1 101 ? 76.330  2.891   -15.882 1.00 0.00 ? 101 LYS A CA   1  
ATOM 1472  C C    . LYS A 1 101 ? 76.593  1.396   -15.720 1.00 0.00 ? 101 LYS A C    1  
ATOM 1473  O O    . LYS A 1 101 ? 77.252  0.785   -16.560 1.00 0.00 ? 101 LYS A O    1  
ATOM 1474  C CB   . LYS A 1 101 ? 77.670  3.639   -15.963 1.00 0.00 ? 101 LYS A CB   1  
ATOM 1475  C CG   . LYS A 1 101 ? 77.431  5.155   -16.183 1.00 0.00 ? 101 LYS A CG   1  
ATOM 1476  C CD   . LYS A 1 101 ? 77.272  5.478   -17.691 1.00 0.00 ? 101 LYS A CD   1  
ATOM 1477  C CE   . LYS A 1 101 ? 78.647  5.695   -18.339 1.00 0.00 ? 101 LYS A CE   1  
ATOM 1478  N NZ   . LYS A 1 101 ? 78.470  5.982   -19.791 1.00 0.00 ? 101 LYS A NZ   1  
ATOM 1479  H H    . LYS A 1 101 ? 75.912  3.358   -13.851 1.00 0.00 ? 101 LYS A H    1  
ATOM 1480  H HA   . LYS A 1 101 ? 75.795  3.043   -16.809 1.00 0.00 ? 101 LYS A HA   1  
ATOM 1481  H HB2  . LYS A 1 101 ? 78.210  3.491   -15.038 1.00 0.00 ? 101 LYS A HB2  1  
ATOM 1482  H HB3  . LYS A 1 101 ? 78.252  3.239   -16.780 1.00 0.00 ? 101 LYS A HB3  1  
ATOM 1483  H HG2  . LYS A 1 101 ? 76.534  5.457   -15.657 1.00 0.00 ? 101 LYS A HG2  1  
ATOM 1484  H HG3  . LYS A 1 101 ? 78.270  5.709   -15.784 1.00 0.00 ? 101 LYS A HG3  1  
ATOM 1485  H HD2  . LYS A 1 101 ? 76.770  4.663   -18.190 1.00 0.00 ? 101 LYS A HD2  1  
ATOM 1486  H HD3  . LYS A 1 101 ? 76.685  6.378   -17.804 1.00 0.00 ? 101 LYS A HD3  1  
ATOM 1487  H HE2  . LYS A 1 101 ? 79.141  6.531   -17.865 1.00 0.00 ? 101 LYS A HE2  1  
ATOM 1488  H HE3  . LYS A 1 101 ? 79.249  4.808   -18.220 1.00 0.00 ? 101 LYS A HE3  1  
ATOM 1489  H HZ1  . LYS A 1 101 ? 78.858  5.196   -20.349 1.00 0.00 ? 101 LYS A HZ1  1  
ATOM 1490  H HZ2  . LYS A 1 101 ? 78.971  6.861   -20.034 1.00 0.00 ? 101 LYS A HZ2  1  
ATOM 1491  H HZ3  . LYS A 1 101 ? 77.459  6.088   -20.003 1.00 0.00 ? 101 LYS A HZ3  1  
ATOM 1492  N N    . SER A 1 102 ? 76.075  0.809   -14.636 1.00 0.00 ? 102 SER A N    1  
ATOM 1493  C CA   . SER A 1 102 ? 76.259  -0.625  -14.367 1.00 0.00 ? 102 SER A CA   1  
ATOM 1494  C C    . SER A 1 102 ? 74.918  -1.354  -14.412 1.00 0.00 ? 102 SER A C    1  
ATOM 1495  O O    . SER A 1 102 ? 74.018  -1.070  -13.623 1.00 0.00 ? 102 SER A O    1  
ATOM 1496  C CB   . SER A 1 102 ? 76.889  -0.814  -12.985 1.00 0.00 ? 102 SER A CB   1  
ATOM 1497  O OG   . SER A 1 102 ? 75.889  -0.651  -11.988 1.00 0.00 ? 102 SER A OG   1  
ATOM 1498  H H    . SER A 1 102 ? 75.560  1.344   -13.997 1.00 0.00 ? 102 SER A H    1  
ATOM 1499  H HA   . SER A 1 102 ? 76.916  -1.060  -15.110 1.00 0.00 ? 102 SER A HA   1  
ATOM 1500  H HB2  . SER A 1 102 ? 77.307  -1.803  -12.906 1.00 0.00 ? 102 SER A HB2  1  
ATOM 1501  H HB3  . SER A 1 102 ? 77.674  -0.082  -12.846 1.00 0.00 ? 102 SER A HB3  1  
ATOM 1502  H HG   . SER A 1 102 ? 75.417  -1.482  -11.901 1.00 0.00 ? 102 SER A HG   1  
ATOM 1503  N N    . ILE A 1 103 ? 74.795  -2.301  -15.345 1.00 0.00 ? 103 ILE A N    1  
ATOM 1504  C CA   . ILE A 1 103 ? 73.565  -3.085  -15.507 1.00 0.00 ? 103 ILE A CA   1  
ATOM 1505  C C    . ILE A 1 103 ? 73.926  -4.566  -15.635 1.00 0.00 ? 103 ILE A C    1  
ATOM 1506  O O    . ILE A 1 103 ? 74.661  -4.958  -16.541 1.00 0.00 ? 103 ILE A O    1  
ATOM 1507  C CB   . ILE A 1 103 ? 72.784  -2.603  -16.768 1.00 0.00 ? 103 ILE A CB   1  
ATOM 1508  C CG1  . ILE A 1 103 ? 71.735  -3.637  -17.235 1.00 0.00 ? 103 ILE A CG1  1  
ATOM 1509  C CG2  . ILE A 1 103 ? 73.765  -2.346  -17.915 1.00 0.00 ? 103 ILE A CG2  1  
ATOM 1510  C CD1  . ILE A 1 103 ? 70.760  -3.961  -16.100 1.00 0.00 ? 103 ILE A CD1  1  
ATOM 1511  H H    . ILE A 1 103 ? 75.550  -2.478  -15.946 1.00 0.00 ? 103 ILE A H    1  
ATOM 1512  H HA   . ILE A 1 103 ? 72.936  -2.955  -14.635 1.00 0.00 ? 103 ILE A HA   1  
ATOM 1513  H HB   . ILE A 1 103 ? 72.283  -1.675  -16.529 1.00 0.00 ? 103 ILE A HB   1  
ATOM 1514  H HG12 . ILE A 1 103 ? 71.182  -3.222  -18.065 1.00 0.00 ? 103 ILE A HG12 1  
ATOM 1515  H HG13 . ILE A 1 103 ? 72.225  -4.541  -17.560 1.00 0.00 ? 103 ILE A HG13 1  
ATOM 1516  H HG21 . ILE A 1 103 ? 74.315  -3.249  -18.132 1.00 0.00 ? 103 ILE A HG21 1  
ATOM 1517  H HG22 . ILE A 1 103 ? 74.453  -1.563  -17.634 1.00 0.00 ? 103 ILE A HG22 1  
ATOM 1518  H HG23 . ILE A 1 103 ? 73.216  -2.041  -18.794 1.00 0.00 ? 103 ILE A HG23 1  
ATOM 1519  H HD11 . ILE A 1 103 ? 71.279  -4.463  -15.304 1.00 0.00 ? 103 ILE A HD11 1  
ATOM 1520  H HD12 . ILE A 1 103 ? 69.978  -4.603  -16.474 1.00 0.00 ? 103 ILE A HD12 1  
ATOM 1521  H HD13 . ILE A 1 103 ? 70.327  -3.045  -15.726 1.00 0.00 ? 103 ILE A HD13 1  
ATOM 1522  N N    . SER A 1 104 ? 73.408  -5.389  -14.721 1.00 0.00 ? 104 SER A N    1  
ATOM 1523  C CA   . SER A 1 104 ? 73.684  -6.829  -14.743 1.00 0.00 ? 104 SER A CA   1  
ATOM 1524  C C    . SER A 1 104 ? 72.464  -7.620  -14.281 1.00 0.00 ? 104 SER A C    1  
ATOM 1525  O O    . SER A 1 104 ? 71.580  -7.084  -13.613 1.00 0.00 ? 104 SER A O    1  
ATOM 1526  C CB   . SER A 1 104 ? 74.873  -7.143  -13.836 1.00 0.00 ? 104 SER A CB   1  
ATOM 1527  O OG   . SER A 1 104 ? 76.013  -6.426  -14.292 1.00 0.00 ? 104 SER A OG   1  
ATOM 1528  H H    . SER A 1 104 ? 72.828  -5.023  -14.021 1.00 0.00 ? 104 SER A H    1  
ATOM 1529  H HA   . SER A 1 104 ? 73.926  -7.130  -15.752 1.00 0.00 ? 104 SER A HA   1  
ATOM 1530  H HB2  . SER A 1 104 ? 74.648  -6.844  -12.826 1.00 0.00 ? 104 SER A HB2  1  
ATOM 1531  H HB3  . SER A 1 104 ? 75.071  -8.207  -13.859 1.00 0.00 ? 104 SER A HB3  1  
ATOM 1532  H HG   . SER A 1 104 ? 76.438  -6.948  -14.977 1.00 0.00 ? 104 SER A HG   1  
ATOM 1533  N N    . GLU A 1 105 ? 72.421  -8.903  -14.651 1.00 0.00 ? 105 GLU A N    1  
ATOM 1534  C CA   . GLU A 1 105 ? 71.301  -9.774  -14.280 1.00 0.00 ? 105 GLU A CA   1  
ATOM 1535  C C    . GLU A 1 105 ? 71.769  -11.216 -14.109 1.00 0.00 ? 105 GLU A C    1  
ATOM 1536  O O    . GLU A 1 105 ? 72.889  -11.567 -14.482 1.00 0.00 ? 105 GLU A O    1  
ATOM 1537  C CB   . GLU A 1 105 ? 70.216  -9.721  -15.359 1.00 0.00 ? 105 GLU A CB   1  
ATOM 1538  C CG   . GLU A 1 105 ? 69.641  -8.304  -15.448 1.00 0.00 ? 105 GLU A CG   1  
ATOM 1539  C CD   . GLU A 1 105 ? 68.382  -8.316  -16.318 1.00 0.00 ? 105 GLU A CD   1  
ATOM 1540  O OE1  . GLU A 1 105 ? 67.484  -9.085  -16.017 1.00 0.00 ? 105 GLU A OE1  1  
ATOM 1541  O OE2  . GLU A 1 105 ? 68.338  -7.555  -17.271 1.00 0.00 ? 105 GLU A OE2  1  
ATOM 1542  H H    . GLU A 1 105 ? 73.153  -9.271  -15.187 1.00 0.00 ? 105 GLU A H    1  
ATOM 1543  H HA   . GLU A 1 105 ? 70.877  -9.437  -13.345 1.00 0.00 ? 105 GLU A HA   1  
ATOM 1544  H HB2  . GLU A 1 105 ? 70.646  -9.993  -16.312 1.00 0.00 ? 105 GLU A HB2  1  
ATOM 1545  H HB3  . GLU A 1 105 ? 69.428  -10.415 -15.110 1.00 0.00 ? 105 GLU A HB3  1  
ATOM 1546  H HG2  . GLU A 1 105 ? 69.389  -7.955  -14.458 1.00 0.00 ? 105 GLU A HG2  1  
ATOM 1547  H HG3  . GLU A 1 105 ? 70.372  -7.644  -15.888 1.00 0.00 ? 105 GLU A HG3  1  
ATOM 1548  N N    . SER A 1 106 ? 70.897  -12.047 -13.542 1.00 0.00 ? 106 SER A N    1  
ATOM 1549  C CA   . SER A 1 106 ? 71.215  -13.455 -13.319 1.00 0.00 ? 106 SER A CA   1  
ATOM 1550  C C    . SER A 1 106 ? 69.942  -14.257 -13.066 1.00 0.00 ? 106 SER A C    1  
ATOM 1551  O O    . SER A 1 106 ? 68.910  -13.697 -12.694 1.00 0.00 ? 106 SER A O    1  
ATOM 1552  C CB   . SER A 1 106 ? 72.152  -13.596 -12.118 1.00 0.00 ? 106 SER A CB   1  
ATOM 1553  O OG   . SER A 1 106 ? 72.711  -14.902 -12.109 1.00 0.00 ? 106 SER A OG   1  
ATOM 1554  H H    . SER A 1 106 ? 70.023  -11.705 -13.267 1.00 0.00 ? 106 SER A H    1  
ATOM 1555  H HA   . SER A 1 106 ? 71.709  -13.849 -14.194 1.00 0.00 ? 106 SER A HA   1  
ATOM 1556  H HB2  . SER A 1 106 ? 72.941  -12.873 -12.195 1.00 0.00 ? 106 SER A HB2  1  
ATOM 1557  H HB3  . SER A 1 106 ? 71.597  -13.422 -11.205 1.00 0.00 ? 106 SER A HB3  1  
ATOM 1558  H HG   . SER A 1 106 ? 72.770  -15.193 -11.196 1.00 0.00 ? 106 SER A HG   1  
ATOM 1559  N N    . ALA A 1 107 ? 70.023  -15.573 -13.269 1.00 0.00 ? 107 ALA A N    1  
ATOM 1560  C CA   . ALA A 1 107 ? 68.872  -16.461 -13.063 1.00 0.00 ? 107 ALA A CA   1  
ATOM 1561  C C    . ALA A 1 107 ? 69.275  -17.676 -12.234 1.00 0.00 ? 107 ALA A C    1  
ATOM 1562  O O    . ALA A 1 107 ? 70.235  -18.375 -12.560 1.00 0.00 ? 107 ALA A O    1  
ATOM 1563  C CB   . ALA A 1 107 ? 68.326  -16.913 -14.411 1.00 0.00 ? 107 ALA A CB   1  
ATOM 1564  H H    . ALA A 1 107 ? 70.872  -15.957 -13.568 1.00 0.00 ? 107 ALA A H    1  
ATOM 1565  H HA   . ALA A 1 107 ? 68.091  -15.931 -12.534 1.00 0.00 ? 107 ALA A HA   1  
ATOM 1566  H HB1  . ALA A 1 107 ? 69.141  -17.248 -15.036 1.00 0.00 ? 107 ALA A HB1  1  
ATOM 1567  H HB2  . ALA A 1 107 ? 67.823  -16.087 -14.888 1.00 0.00 ? 107 ALA A HB2  1  
ATOM 1568  H HB3  . ALA A 1 107 ? 67.626  -17.724 -14.268 1.00 0.00 ? 107 ALA A HB3  1  
ATOM 1569  N N    . ASP A 1 108 ? 68.523  -17.924 -11.164 1.00 0.00 ? 108 ASP A N    1  
ATOM 1570  C CA   . ASP A 1 108 ? 68.782  -19.061 -10.279 1.00 0.00 ? 108 ASP A CA   1  
ATOM 1571  C C    . ASP A 1 108 ? 67.458  -19.655 -9.814  1.00 0.00 ? 108 ASP A C    1  
ATOM 1572  O O    . ASP A 1 108 ? 66.748  -19.056 -9.005  1.00 0.00 ? 108 ASP A O    1  
ATOM 1573  C CB   . ASP A 1 108 ? 69.597  -18.607 -9.066  1.00 0.00 ? 108 ASP A CB   1  
ATOM 1574  C CG   . ASP A 1 108 ? 68.815  -17.544 -8.292  1.00 0.00 ? 108 ASP A CG   1  
ATOM 1575  O OD1  . ASP A 1 108 ? 68.347  -16.607 -8.919  1.00 0.00 ? 108 ASP A OD1  1  
ATOM 1576  O OD2  . ASP A 1 108 ? 68.696  -17.685 -7.086  1.00 0.00 ? 108 ASP A OD2  1  
ATOM 1577  H H    . ASP A 1 108 ? 67.768  -17.331 -10.964 1.00 0.00 ? 108 ASP A H    1  
ATOM 1578  H HA   . ASP A 1 108 ? 69.337  -19.822 -10.812 1.00 0.00 ? 108 ASP A HA   1  
ATOM 1579  H HB2  . ASP A 1 108 ? 69.788  -19.454 -8.423  1.00 0.00 ? 108 ASP A HB2  1  
ATOM 1580  H HB3  . ASP A 1 108 ? 70.535  -18.189 -9.398  1.00 0.00 ? 108 ASP A HB3  1  
ATOM 1581  N N    . GLY A 1 109 ? 67.125  -20.829 -10.339 1.00 0.00 ? 109 GLY A N    1  
ATOM 1582  C CA   . GLY A 1 109 ? 65.880  -21.481 -9.982  1.00 0.00 ? 109 GLY A CA   1  
ATOM 1583  C C    . GLY A 1 109 ? 64.690  -20.787 -10.617 1.00 0.00 ? 109 GLY A C    1  
ATOM 1584  O O    . GLY A 1 109 ? 64.717  -20.454 -11.801 1.00 0.00 ? 109 GLY A O    1  
ATOM 1585  H H    . GLY A 1 109 ? 67.724  -21.255 -10.986 1.00 0.00 ? 109 GLY A H    1  
ATOM 1586  H HA2  . GLY A 1 109 ? 65.911  -22.507 -10.320 1.00 0.00 ? 109 GLY A HA2  1  
ATOM 1587  H HA3  . GLY A 1 109 ? 65.766  -21.466 -8.908  1.00 0.00 ? 109 GLY A HA3  1  
ATOM 1588  N N    . ASN A 1 110 ? 63.644  -20.563 -9.824  1.00 0.00 ? 110 ASN A N    1  
ATOM 1589  C CA   . ASN A 1 110 ? 62.434  -19.894 -10.314 1.00 0.00 ? 110 ASN A CA   1  
ATOM 1590  C C    . ASN A 1 110 ? 62.477  -18.408 -9.980  1.00 0.00 ? 110 ASN A C    1  
ATOM 1591  O O    . ASN A 1 110 ? 61.439  -17.752 -9.891  1.00 0.00 ? 110 ASN A O    1  
ATOM 1592  C CB   . ASN A 1 110 ? 61.199  -20.524 -9.668  1.00 0.00 ? 110 ASN A CB   1  
ATOM 1593  C CG   . ASN A 1 110 ? 61.331  -20.459 -8.145  1.00 0.00 ? 110 ASN A CG   1  
ATOM 1594  O OD1  . ASN A 1 110 ? 60.827  -19.548 -7.518  1.00 0.00 ? 110 ASN A OD1  1  
ATOM 1595  N ND2  . ASN A 1 110 ? 61.991  -21.395 -7.519  1.00 0.00 ? 110 ASN A ND2  1  
ATOM 1596  H H    . ASN A 1 110 ? 63.685  -20.848 -8.887  1.00 0.00 ? 110 ASN A H    1  
ATOM 1597  H HA   . ASN A 1 110 ? 62.361  -20.011 -11.388 1.00 0.00 ? 110 ASN A HA   1  
ATOM 1598  H HB2  . ASN A 1 110 ? 60.317  -19.983 -9.978  1.00 0.00 ? 110 ASN A HB2  1  
ATOM 1599  H HB3  . ASN A 1 110 ? 61.117  -21.555 -9.976  1.00 0.00 ? 110 ASN A HB3  1  
ATOM 1600  H HD21 . ASN A 1 110 ? 62.397  -22.129 -8.024  1.00 0.00 ? 110 ASN A HD21 1  
ATOM 1601  H HD22 . ASN A 1 110 ? 62.081  -21.362 -6.544  1.00 0.00 ? 110 ASN A HD22 1  
ATOM 1602  N N    . THR A 1 111 ? 63.688  -17.883 -9.784  1.00 0.00 ? 111 THR A N    1  
ATOM 1603  C CA   . THR A 1 111 ? 63.875  -16.466 -9.445  1.00 0.00 ? 111 THR A CA   1  
ATOM 1604  C C    . THR A 1 111 ? 64.926  -15.837 -10.350 1.00 0.00 ? 111 THR A C    1  
ATOM 1605  O O    . THR A 1 111 ? 65.754  -16.534 -10.937 1.00 0.00 ? 111 THR A O    1  
ATOM 1606  C CB   . THR A 1 111 ? 64.340  -16.314 -7.977  1.00 0.00 ? 111 THR A CB   1  
ATOM 1607  O OG1  . THR A 1 111 ? 65.755  -16.443 -7.914  1.00 0.00 ? 111 THR A OG1  1  
ATOM 1608  C CG2  . THR A 1 111 ? 63.694  -17.402 -7.116  1.00 0.00 ? 111 THR A CG2  1  
ATOM 1609  H H    . THR A 1 111 ? 64.475  -18.462 -9.859  1.00 0.00 ? 111 THR A H    1  
ATOM 1610  H HA   . THR A 1 111 ? 62.942  -15.932 -9.574  1.00 0.00 ? 111 THR A HA   1  
ATOM 1611  H HB   . THR A 1 111 ? 64.051  -15.343 -7.602  1.00 0.00 ? 111 THR A HB   1  
ATOM 1612  H HG1  . THR A 1 111 ? 65.968  -16.995 -7.160  1.00 0.00 ? 111 THR A HG1  1  
ATOM 1613  H HG21 . THR A 1 111 ? 64.174  -18.349 -7.314  1.00 0.00 ? 111 THR A HG21 1  
ATOM 1614  H HG22 . THR A 1 111 ? 62.643  -17.475 -7.352  1.00 0.00 ? 111 THR A HG22 1  
ATOM 1615  H HG23 . THR A 1 111 ? 63.812  -17.150 -6.073  1.00 0.00 ? 111 THR A HG23 1  
ATOM 1616  N N    . VAL A 1 112 ? 64.890  -14.510 -10.448 1.00 0.00 ? 112 VAL A N    1  
ATOM 1617  C CA   . VAL A 1 112 ? 65.848  -13.774 -11.273 1.00 0.00 ? 112 VAL A CA   1  
ATOM 1618  C C    . VAL A 1 112 ? 66.194  -12.456 -10.595 1.00 0.00 ? 112 VAL A C    1  
ATOM 1619  O O    . VAL A 1 112 ? 65.328  -11.794 -10.024 1.00 0.00 ? 112 VAL A O    1  
ATOM 1620  C CB   . VAL A 1 112 ? 65.275  -13.509 -12.674 1.00 0.00 ? 112 VAL A CB   1  
ATOM 1621  C CG1  . VAL A 1 112 ? 64.990  -14.853 -13.348 1.00 0.00 ? 112 VAL A CG1  1  
ATOM 1622  C CG2  . VAL A 1 112 ? 63.975  -12.712 -12.558 1.00 0.00 ? 112 VAL A CG2  1  
ATOM 1623  H H    . VAL A 1 112 ? 64.210  -14.014 -9.948  1.00 0.00 ? 112 VAL A H    1  
ATOM 1624  H HA   . VAL A 1 112 ? 66.756  -14.353 -11.373 1.00 0.00 ? 112 VAL A HA   1  
ATOM 1625  H HB   . VAL A 1 112 ? 65.994  -12.955 -13.261 1.00 0.00 ? 112 VAL A HB   1  
ATOM 1626  H HG11 . VAL A 1 112 ? 64.724  -14.692 -14.379 1.00 0.00 ? 112 VAL A HG11 1  
ATOM 1627  H HG12 . VAL A 1 112 ? 64.173  -15.344 -12.840 1.00 0.00 ? 112 VAL A HG12 1  
ATOM 1628  H HG13 . VAL A 1 112 ? 65.871  -15.476 -13.296 1.00 0.00 ? 112 VAL A HG13 1  
ATOM 1629  H HG21 . VAL A 1 112 ? 63.293  -13.230 -11.900 1.00 0.00 ? 112 VAL A HG21 1  
ATOM 1630  H HG22 . VAL A 1 112 ? 63.526  -12.613 -13.535 1.00 0.00 ? 112 VAL A HG22 1  
ATOM 1631  H HG23 . VAL A 1 112 ? 64.188  -11.732 -12.159 1.00 0.00 ? 112 VAL A HG23 1  
ATOM 1632  N N    . ASN A 1 113 ? 67.479  -12.095 -10.638 1.00 0.00 ? 113 ASN A N    1  
ATOM 1633  C CA   . ASN A 1 113 ? 67.956  -10.865 -9.998  1.00 0.00 ? 113 ASN A CA   1  
ATOM 1634  C C    . ASN A 1 113 ? 68.324  -9.803  -11.026 1.00 0.00 ? 113 ASN A C    1  
ATOM 1635  O O    . ASN A 1 113 ? 68.369  -10.065 -12.227 1.00 0.00 ? 113 ASN A O    1  
ATOM 1636  C CB   . ASN A 1 113 ? 69.186  -11.180 -9.145  1.00 0.00 ? 113 ASN A CB   1  
ATOM 1637  C CG   . ASN A 1 113 ? 68.876  -12.357 -8.217  1.00 0.00 ? 113 ASN A CG   1  
ATOM 1638  O OD1  . ASN A 1 113 ? 67.820  -12.413 -7.620  1.00 0.00 ? 113 ASN A OD1  1  
ATOM 1639  N ND2  . ASN A 1 113 ? 69.760  -13.307 -8.072  1.00 0.00 ? 113 ASN A ND2  1  
ATOM 1640  H H    . ASN A 1 113 ? 68.122  -12.672 -11.099 1.00 0.00 ? 113 ASN A H    1  
ATOM 1641  H HA   . ASN A 1 113 ? 67.188  -10.470 -9.351  1.00 0.00 ? 113 ASN A HA   1  
ATOM 1642  H HB2  . ASN A 1 113 ? 70.015  -11.436 -9.788  1.00 0.00 ? 113 ASN A HB2  1  
ATOM 1643  H HB3  . ASN A 1 113 ? 69.444  -10.316 -8.552  1.00 0.00 ? 113 ASN A HB3  1  
ATOM 1644  H HD21 . ASN A 1 113 ? 70.612  -13.262 -8.553  1.00 0.00 ? 113 ASN A HD21 1  
ATOM 1645  H HD22 . ASN A 1 113 ? 69.571  -14.064 -7.480  1.00 0.00 ? 113 ASN A HD22 1  
ATOM 1646  N N    . ALA A 1 114 ? 68.594  -8.602  -10.528 1.00 0.00 ? 114 ALA A N    1  
ATOM 1647  C CA   . ALA A 1 114 ? 68.972  -7.481  -11.379 1.00 0.00 ? 114 ALA A CA   1  
ATOM 1648  C C    . ALA A 1 114 ? 69.626  -6.396  -10.535 1.00 0.00 ? 114 ALA A C    1  
ATOM 1649  O O    . ALA A 1 114 ? 69.019  -5.876  -9.599  1.00 0.00 ? 114 ALA A O    1  
ATOM 1650  C CB   . ALA A 1 114 ? 67.746  -6.925  -12.087 1.00 0.00 ? 114 ALA A CB   1  
ATOM 1651  H H    . ALA A 1 114 ? 68.545  -8.466  -9.558  1.00 0.00 ? 114 ALA A H    1  
ATOM 1652  H HA   . ALA A 1 114 ? 69.681  -7.822  -12.117 1.00 0.00 ? 114 ALA A HA   1  
ATOM 1653  H HB1  . ALA A 1 114 ? 68.054  -6.196  -12.821 1.00 0.00 ? 114 ALA A HB1  1  
ATOM 1654  H HB2  . ALA A 1 114 ? 67.095  -6.456  -11.365 1.00 0.00 ? 114 ALA A HB2  1  
ATOM 1655  H HB3  . ALA A 1 114 ? 67.220  -7.730  -12.579 1.00 0.00 ? 114 ALA A HB3  1  
ATOM 1656  N N    . ARG A 1 115 ? 70.878  -6.067  -10.864 1.00 0.00 ? 115 ARG A N    1  
ATOM 1657  C CA   . ARG A 1 115 ? 71.632  -5.048  -10.126 1.00 0.00 ? 115 ARG A CA   1  
ATOM 1658  C C    . ARG A 1 115 ? 71.912  -3.836  -11.008 1.00 0.00 ? 115 ARG A C    1  
ATOM 1659  O O    . ARG A 1 115 ? 72.662  -3.921  -11.981 1.00 0.00 ? 115 ARG A O    1  
ATOM 1660  C CB   . ARG A 1 115 ? 72.965  -5.645  -9.643  1.00 0.00 ? 115 ARG A CB   1  
ATOM 1661  C CG   . ARG A 1 115 ? 73.639  -4.708  -8.608  1.00 0.00 ? 115 ARG A CG   1  
ATOM 1662  C CD   . ARG A 1 115 ? 73.150  -5.032  -7.188  1.00 0.00 ? 115 ARG A CD   1  
ATOM 1663  N NE   . ARG A 1 115 ? 73.781  -6.300  -6.722  1.00 0.00 ? 115 ARG A NE   1  
ATOM 1664  C CZ   . ARG A 1 115 ? 75.069  -6.350  -6.512  1.00 0.00 ? 115 ARG A CZ   1  
ATOM 1665  N NH1  . ARG A 1 115 ? 75.551  -6.057  -5.336  1.00 0.00 ? 115 ARG A NH1  1  
ATOM 1666  N NH2  . ARG A 1 115 ? 75.875  -6.692  -7.480  1.00 0.00 ? 115 ARG A NH2  1  
ATOM 1667  H H    . ARG A 1 115 ? 71.308  -6.526  -11.616 1.00 0.00 ? 115 ARG A H    1  
ATOM 1668  H HA   . ARG A 1 115 ? 71.067  -4.723  -9.264  1.00 0.00 ? 115 ARG A HA   1  
ATOM 1669  H HB2  . ARG A 1 115 ? 72.781  -6.612  -9.197  1.00 0.00 ? 115 ARG A HB2  1  
ATOM 1670  H HB3  . ARG A 1 115 ? 73.623  -5.770  -10.493 1.00 0.00 ? 115 ARG A HB3  1  
ATOM 1671  H HG2  . ARG A 1 115 ? 74.711  -4.842  -8.649  1.00 0.00 ? 115 ARG A HG2  1  
ATOM 1672  H HG3  . ARG A 1 115 ? 73.405  -3.677  -8.837  1.00 0.00 ? 115 ARG A HG3  1  
ATOM 1673  H HD2  . ARG A 1 115 ? 73.424  -4.229  -6.521  1.00 0.00 ? 115 ARG A HD2  1  
ATOM 1674  H HD3  . ARG A 1 115 ? 72.076  -5.146  -7.190  1.00 0.00 ? 115 ARG A HD3  1  
ATOM 1675  H HE   . ARG A 1 115 ? 73.230  -7.096  -6.572  1.00 0.00 ? 115 ARG A HE   1  
ATOM 1676  H HH11 . ARG A 1 115 ? 74.933  -5.794  -4.594  1.00 0.00 ? 115 ARG A HH11 1  
ATOM 1677  H HH12 . ARG A 1 115 ? 76.537  -6.095  -5.174  1.00 0.00 ? 115 ARG A HH12 1  
ATOM 1678  H HH21 . ARG A 1 115 ? 75.506  -6.916  -8.383  1.00 0.00 ? 115 ARG A HH21 1  
ATOM 1679  H HH22 . ARG A 1 115 ? 76.861  -6.731  -7.320  1.00 0.00 ? 115 ARG A HH22 1  
ATOM 1680  N N    . LEU A 1 116 ? 71.328  -2.698  -10.634 1.00 0.00 ? 116 LEU A N    1  
ATOM 1681  C CA   . LEU A 1 116 ? 71.530  -1.437  -11.355 1.00 0.00 ? 116 LEU A CA   1  
ATOM 1682  C C    . LEU A 1 116 ? 72.234  -0.472  -10.406 1.00 0.00 ? 116 LEU A C    1  
ATOM 1683  O O    . LEU A 1 116 ? 71.784  -0.272  -9.278  1.00 0.00 ? 116 LEU A O    1  
ATOM 1684  C CB   . LEU A 1 116 ? 70.170  -0.845  -11.795 1.00 0.00 ? 116 LEU A CB   1  
ATOM 1685  C CG   . LEU A 1 116 ? 69.738  -1.408  -13.161 1.00 0.00 ? 116 LEU A CG   1  
ATOM 1686  C CD1  . LEU A 1 116 ? 69.454  -2.918  -13.057 1.00 0.00 ? 116 LEU A CD1  1  
ATOM 1687  C CD2  . LEU A 1 116 ? 68.471  -0.675  -13.618 1.00 0.00 ? 116 LEU A CD2  1  
ATOM 1688  H H    . LEU A 1 116 ? 70.772  -2.692  -9.827  1.00 0.00 ? 116 LEU A H    1  
ATOM 1689  H HA   . LEU A 1 116 ? 72.158  -1.597  -12.224 1.00 0.00 ? 116 LEU A HA   1  
ATOM 1690  H HB2  . LEU A 1 116 ? 69.422  -1.090  -11.059 1.00 0.00 ? 116 LEU A HB2  1  
ATOM 1691  H HB3  . LEU A 1 116 ? 70.248  0.232   -11.874 1.00 0.00 ? 116 LEU A HB3  1  
ATOM 1692  H HG   . LEU A 1 116 ? 70.525  -1.241  -13.884 1.00 0.00 ? 116 LEU A HG   1  
ATOM 1693  H HD11 . LEU A 1 116 ? 68.938  -3.132  -12.132 1.00 0.00 ? 116 LEU A HD11 1  
ATOM 1694  H HD12 . LEU A 1 116 ? 70.384  -3.461  -13.084 1.00 0.00 ? 116 LEU A HD12 1  
ATOM 1695  H HD13 . LEU A 1 116 ? 68.839  -3.231  -13.889 1.00 0.00 ? 116 LEU A HD13 1  
ATOM 1696  H HD21 . LEU A 1 116 ? 68.672  0.384   -13.685 1.00 0.00 ? 116 LEU A HD21 1  
ATOM 1697  H HD22 . LEU A 1 116 ? 67.679  -0.847  -12.905 1.00 0.00 ? 116 LEU A HD22 1  
ATOM 1698  H HD23 . LEU A 1 116 ? 68.170  -1.045  -14.588 1.00 0.00 ? 116 LEU A HD23 1  
ATOM 1699  N N    . SER A 1 117 ? 73.345  0.109   -10.842 1.00 0.00 ? 117 SER A N    1  
ATOM 1700  C CA   . SER A 1 117 ? 74.079  1.023   -9.974  1.00 0.00 ? 117 SER A CA   1  
ATOM 1701  C C    . SER A 1 117 ? 75.083  1.857   -10.757 1.00 0.00 ? 117 SER A C    1  
ATOM 1702  O O    . SER A 1 117 ? 75.274  1.666   -11.958 1.00 0.00 ? 117 SER A O    1  
ATOM 1703  C CB   . SER A 1 117 ? 74.823  0.219   -8.906  1.00 0.00 ? 117 SER A CB   1  
ATOM 1704  O OG   . SER A 1 117 ? 76.024  -0.298  -9.463  1.00 0.00 ? 117 SER A OG   1  
ATOM 1705  H H    . SER A 1 117 ? 73.681  -0.088  -11.742 1.00 0.00 ? 117 SER A H    1  
ATOM 1706  H HA   . SER A 1 117 ? 73.379  1.685   -9.488  1.00 0.00 ? 117 SER A HA   1  
ATOM 1707  H HB2  . SER A 1 117 ? 75.067  0.852   -8.071  1.00 0.00 ? 117 SER A HB2  1  
ATOM 1708  H HB3  . SER A 1 117 ? 74.195  -0.595  -8.567  1.00 0.00 ? 117 SER A HB3  1  
ATOM 1709  H HG   . SER A 1 117 ? 76.604  0.442   -9.658  1.00 0.00 ? 117 SER A HG   1  
ATOM 1710  N N    . SER A 1 118 ? 75.736  2.778   -10.048 1.00 0.00 ? 118 SER A N    1  
ATOM 1711  C CA   . SER A 1 118 ? 76.745  3.646   -10.649 1.00 0.00 ? 118 SER A CA   1  
ATOM 1712  C C    . SER A 1 118 ? 78.123  3.019   -10.483 1.00 0.00 ? 118 SER A C    1  
ATOM 1713  O O    . SER A 1 118 ? 78.296  2.071   -9.719  1.00 0.00 ? 118 SER A O    1  
ATOM 1714  C CB   . SER A 1 118 ? 76.723  5.016   -9.970  1.00 0.00 ? 118 SER A CB   1  
ATOM 1715  O OG   . SER A 1 118 ? 76.957  4.852   -8.577  1.00 0.00 ? 118 SER A OG   1  
ATOM 1716  H H    . SER A 1 118 ? 75.544  2.867   -9.091  1.00 0.00 ? 118 SER A H    1  
ATOM 1717  H HA   . SER A 1 118 ? 76.537  3.773   -11.703 1.00 0.00 ? 118 SER A HA   1  
ATOM 1718  H HB2  . SER A 1 118 ? 77.496  5.639   -10.388 1.00 0.00 ? 118 SER A HB2  1  
ATOM 1719  H HB3  . SER A 1 118 ? 75.760  5.481   -10.131 1.00 0.00 ? 118 SER A HB3  1  
ATOM 1720  H HG   . SER A 1 118 ? 76.106  4.741   -8.146  1.00 0.00 ? 118 SER A HG   1  
ATOM 1721  N N    . VAL A 1 119 ? 79.102  3.541   -11.213 1.00 0.00 ? 119 VAL A N    1  
ATOM 1722  C CA   . VAL A 1 119 ? 80.468  3.017   -11.154 1.00 0.00 ? 119 VAL A CA   1  
ATOM 1723  C C    . VAL A 1 119 ? 81.297  3.774   -10.119 1.00 0.00 ? 119 VAL A C    1  
ATOM 1724  O O    . VAL A 1 119 ? 81.131  4.979   -9.934  1.00 0.00 ? 119 VAL A O    1  
ATOM 1725  C CB   . VAL A 1 119 ? 81.151  3.166   -12.529 1.00 0.00 ? 119 VAL A CB   1  
ATOM 1726  C CG1  . VAL A 1 119 ? 80.541  2.169   -13.516 1.00 0.00 ? 119 VAL A CG1  1  
ATOM 1727  C CG2  . VAL A 1 119 ? 80.933  4.593   -13.045 1.00 0.00 ? 119 VAL A CG2  1  
ATOM 1728  H H    . VAL A 1 119 ? 78.903  4.286   -11.820 1.00 0.00 ? 119 VAL A H    1  
ATOM 1729  H HA   . VAL A 1 119 ? 80.445  1.968   -10.889 1.00 0.00 ? 119 VAL A HA   1  
ATOM 1730  H HB   . VAL A 1 119 ? 82.212  2.971   -12.434 1.00 0.00 ? 119 VAL A HB   1  
ATOM 1731  H HG11 . VAL A 1 119 ? 80.871  2.402   -14.517 1.00 0.00 ? 119 VAL A HG11 1  
ATOM 1732  H HG12 . VAL A 1 119 ? 79.463  2.230   -13.469 1.00 0.00 ? 119 VAL A HG12 1  
ATOM 1733  H HG13 . VAL A 1 119 ? 80.854  1.169   -13.257 1.00 0.00 ? 119 VAL A HG13 1  
ATOM 1734  H HG21 . VAL A 1 119 ? 81.548  4.759   -13.915 1.00 0.00 ? 119 VAL A HG21 1  
ATOM 1735  H HG22 . VAL A 1 119 ? 81.203  5.301   -12.277 1.00 0.00 ? 119 VAL A HG22 1  
ATOM 1736  H HG23 . VAL A 1 119 ? 79.895  4.725   -13.309 1.00 0.00 ? 119 VAL A HG23 1  
ATOM 1737  N N    . SER A 1 120 ? 82.205  3.057   -9.458  1.00 0.00 ? 120 SER A N    1  
ATOM 1738  C CA   . SER A 1 120 ? 83.079  3.666   -8.455  1.00 0.00 ? 120 SER A CA   1  
ATOM 1739  C C    . SER A 1 120 ? 84.351  4.184   -9.136  1.00 0.00 ? 120 SER A C    1  
ATOM 1740  O O    . SER A 1 120 ? 84.779  3.618   -10.141 1.00 0.00 ? 120 SER A O    1  
ATOM 1741  C CB   . SER A 1 120 ? 83.453  2.627   -7.396  1.00 0.00 ? 120 SER A CB   1  
ATOM 1742  O OG   . SER A 1 120 ? 84.095  1.526   -8.025  1.00 0.00 ? 120 SER A OG   1  
ATOM 1743  H H    . SER A 1 120 ? 82.299  2.102   -9.658  1.00 0.00 ? 120 SER A H    1  
ATOM 1744  H HA   . SER A 1 120 ? 82.557  4.479   -7.977  1.00 0.00 ? 120 SER A HA   1  
ATOM 1745  H HB2  . SER A 1 120 ? 84.126  3.067   -6.680  1.00 0.00 ? 120 SER A HB2  1  
ATOM 1746  H HB3  . SER A 1 120 ? 82.558  2.293   -6.888  1.00 0.00 ? 120 SER A HB3  1  
ATOM 1747  H HG   . SER A 1 120 ? 84.503  0.990   -7.341  1.00 0.00 ? 120 SER A HG   1  
ATOM 1748  N N    . PRO A 1 121 ? 84.985  5.256   -8.614  1.00 0.00 ? 121 PRO A N    1  
ATOM 1749  C CA   . PRO A 1 121 ? 86.213  5.800   -9.217  1.00 0.00 ? 121 PRO A CA   1  
ATOM 1750  C C    . PRO A 1 121 ? 87.161  4.698   -9.692  1.00 0.00 ? 121 PRO A C    1  
ATOM 1751  O O    . PRO A 1 121 ? 87.045  3.545   -9.276  1.00 0.00 ? 121 PRO A O    1  
ATOM 1752  C CB   . PRO A 1 121 ? 86.832  6.618   -8.076  1.00 0.00 ? 121 PRO A CB   1  
ATOM 1753  C CG   . PRO A 1 121 ? 85.655  7.120   -7.303  1.00 0.00 ? 121 PRO A CG   1  
ATOM 1754  C CD   . PRO A 1 121 ? 84.581  6.026   -7.416  1.00 0.00 ? 121 PRO A CD   1  
ATOM 1755  H HA   . PRO A 1 121 ? 85.965  6.456   -10.036 1.00 0.00 ? 121 PRO A HA   1  
ATOM 1756  H HB2  . PRO A 1 121 ? 87.456  5.986   -7.454  1.00 0.00 ? 121 PRO A HB2  1  
ATOM 1757  H HB3  . PRO A 1 121 ? 87.406  7.446   -8.468  1.00 0.00 ? 121 PRO A HB3  1  
ATOM 1758  H HG2  . PRO A 1 121 ? 85.928  7.284   -6.266  1.00 0.00 ? 121 PRO A HG2  1  
ATOM 1759  H HG3  . PRO A 1 121 ? 85.286  8.041   -7.737  1.00 0.00 ? 121 PRO A HG3  1  
ATOM 1760  H HD2  . PRO A 1 121 ? 84.587  5.392   -6.537  1.00 0.00 ? 121 PRO A HD2  1  
ATOM 1761  H HD3  . PRO A 1 121 ? 83.608  6.464   -7.562  1.00 0.00 ? 121 PRO A HD3  1  
ATOM 1762  N N    . GLY A 1 122 ? 88.101  5.062   -10.559 1.00 0.00 ? 122 GLY A N    1  
ATOM 1763  C CA   . GLY A 1 122 ? 89.060  4.104   -11.075 1.00 0.00 ? 122 GLY A CA   1  
ATOM 1764  C C    . GLY A 1 122 ? 88.393  2.832   -11.558 1.00 0.00 ? 122 GLY A C    1  
ATOM 1765  O O    . GLY A 1 122 ? 88.537  1.773   -10.946 1.00 0.00 ? 122 GLY A O    1  
ATOM 1766  H H    . GLY A 1 122 ? 88.148  5.996   -10.853 1.00 0.00 ? 122 GLY A H    1  
ATOM 1767  H HA2  . GLY A 1 122 ? 89.595  4.553   -11.899 1.00 0.00 ? 122 GLY A HA2  1  
ATOM 1768  H HA3  . GLY A 1 122 ? 89.764  3.856   -10.293 1.00 0.00 ? 122 GLY A HA3  1  
ATOM 1769  N N    . GLN A 1 123 ? 87.663  2.937   -12.666 1.00 0.00 ? 123 GLN A N    1  
ATOM 1770  C CA   . GLN A 1 123 ? 86.966  1.785   -13.246 1.00 0.00 ? 123 GLN A CA   1  
ATOM 1771  C C    . GLN A 1 123 ? 87.077  1.825   -14.765 1.00 0.00 ? 123 GLN A C    1  
ATOM 1772  O O    . GLN A 1 123 ? 87.385  0.817   -15.402 1.00 0.00 ? 123 GLN A O    1  
ATOM 1773  C CB   . GLN A 1 123 ? 85.490  1.805   -12.833 1.00 0.00 ? 123 GLN A CB   1  
ATOM 1774  C CG   . GLN A 1 123 ? 84.834  0.465   -13.182 1.00 0.00 ? 123 GLN A CG   1  
ATOM 1775  C CD   . GLN A 1 123 ? 85.345  -0.621  -12.229 1.00 0.00 ? 123 GLN A CD   1  
ATOM 1776  O OE1  . GLN A 1 123 ? 86.216  -1.393  -12.580 1.00 0.00 ? 123 GLN A OE1  1  
ATOM 1777  N NE2  . GLN A 1 123 ? 84.837  -0.713  -11.032 1.00 0.00 ? 123 GLN A NE2  1  
ATOM 1778  H H    . GLN A 1 123 ? 87.591  3.809   -13.108 1.00 0.00 ? 123 GLN A H    1  
ATOM 1779  H HA   . GLN A 1 123 ? 87.420  0.869   -12.889 1.00 0.00 ? 123 GLN A HA   1  
ATOM 1780  H HB2  . GLN A 1 123 ? 85.419  1.977   -11.769 1.00 0.00 ? 123 GLN A HB2  1  
ATOM 1781  H HB3  . GLN A 1 123 ? 84.980  2.599   -13.360 1.00 0.00 ? 123 GLN A HB3  1  
ATOM 1782  H HG2  . GLN A 1 123 ? 83.763  0.554   -13.084 1.00 0.00 ? 123 GLN A HG2  1  
ATOM 1783  H HG3  . GLN A 1 123 ? 85.081  0.194   -14.197 1.00 0.00 ? 123 GLN A HG3  1  
ATOM 1784  H HE21 . GLN A 1 123 ? 84.135  -0.091  -10.748 1.00 0.00 ? 123 GLN A HE21 1  
ATOM 1785  H HE22 . GLN A 1 123 ? 85.157  -1.404  -10.415 1.00 0.00 ? 123 GLN A HE22 1  
ATOM 1786  N N    . GLY A 1 124 ? 86.833  3.002   -15.343 1.00 0.00 ? 124 GLY A N    1  
ATOM 1787  C CA   . GLY A 1 124 ? 86.913  3.180   -16.789 1.00 0.00 ? 124 GLY A CA   1  
ATOM 1788  C C    . GLY A 1 124 ? 85.807  4.071   -17.315 1.00 0.00 ? 124 GLY A C    1  
ATOM 1789  O O    . GLY A 1 124 ? 85.812  4.449   -18.486 1.00 0.00 ? 124 GLY A O    1  
ATOM 1790  H H    . GLY A 1 124 ? 86.598  3.770   -14.781 1.00 0.00 ? 124 GLY A H    1  
ATOM 1791  H HA2  . GLY A 1 124 ? 87.865  3.627   -17.031 1.00 0.00 ? 124 GLY A HA2  1  
ATOM 1792  H HA3  . GLY A 1 124 ? 86.843  2.217   -17.281 1.00 0.00 ? 124 GLY A HA3  1  
ATOM 1793  N N    . LYS A 1 125 ? 84.853  4.413   -16.444 1.00 0.00 ? 125 LYS A N    1  
ATOM 1794  C CA   . LYS A 1 125 ? 83.722  5.274   -16.820 1.00 0.00 ? 125 LYS A CA   1  
ATOM 1795  C C    . LYS A 1 125 ? 83.767  6.564   -15.992 1.00 0.00 ? 125 LYS A C    1  
ATOM 1796  O O    . LYS A 1 125 ? 84.695  6.779   -15.212 1.00 0.00 ? 125 LYS A O    1  
ATOM 1797  C CB   . LYS A 1 125 ? 82.396  4.513   -16.569 1.00 0.00 ? 125 LYS A CB   1  
ATOM 1798  C CG   . LYS A 1 125 ? 81.928  3.785   -17.843 1.00 0.00 ? 125 LYS A CG   1  
ATOM 1799  C CD   . LYS A 1 125 ? 82.970  2.735   -18.267 1.00 0.00 ? 125 LYS A CD   1  
ATOM 1800  C CE   . LYS A 1 125 ? 82.333  1.724   -19.225 1.00 0.00 ? 125 LYS A CE   1  
ATOM 1801  N NZ   . LYS A 1 125 ? 81.868  2.427   -20.455 1.00 0.00 ? 125 LYS A NZ   1  
ATOM 1802  H H    . LYS A 1 125 ? 84.903  4.090   -15.520 1.00 0.00 ? 125 LYS A H    1  
ATOM 1803  H HA   . LYS A 1 125 ? 83.792  5.539   -17.869 1.00 0.00 ? 125 LYS A HA   1  
ATOM 1804  H HB2  . LYS A 1 125 ? 82.554  3.782   -15.791 1.00 0.00 ? 125 LYS A HB2  1  
ATOM 1805  H HB3  . LYS A 1 125 ? 81.624  5.204   -16.256 1.00 0.00 ? 125 LYS A HB3  1  
ATOM 1806  H HG2  . LYS A 1 125 ? 80.984  3.297   -17.642 1.00 0.00 ? 125 LYS A HG2  1  
ATOM 1807  H HG3  . LYS A 1 125 ? 81.798  4.503   -18.639 1.00 0.00 ? 125 LYS A HG3  1  
ATOM 1808  H HD2  . LYS A 1 125 ? 83.790  3.228   -18.767 1.00 0.00 ? 125 LYS A HD2  1  
ATOM 1809  H HD3  . LYS A 1 125 ? 83.341  2.215   -17.396 1.00 0.00 ? 125 LYS A HD3  1  
ATOM 1810  H HE2  . LYS A 1 125 ? 83.061  0.974   -19.494 1.00 0.00 ? 125 LYS A HE2  1  
ATOM 1811  H HE3  . LYS A 1 125 ? 81.490  1.251   -18.742 1.00 0.00 ? 125 LYS A HE3  1  
ATOM 1812  H HZ1  . LYS A 1 125 ? 82.213  3.407   -20.445 1.00 0.00 ? 125 LYS A HZ1  1  
ATOM 1813  H HZ2  . LYS A 1 125 ? 80.828  2.425   -20.483 1.00 0.00 ? 125 LYS A HZ2  1  
ATOM 1814  H HZ3  . LYS A 1 125 ? 82.240  1.940   -21.294 1.00 0.00 ? 125 LYS A HZ3  1  
ATOM 1815  N N    . ASP A 1 126 ? 82.765  7.417   -16.177 1.00 0.00 ? 126 ASP A N    1  
ATOM 1816  C CA   . ASP A 1 126 ? 82.706  8.685   -15.453 1.00 0.00 ? 126 ASP A CA   1  
ATOM 1817  C C    . ASP A 1 126 ? 82.399  8.465   -13.972 1.00 0.00 ? 126 ASP A C    1  
ATOM 1818  O O    . ASP A 1 126 ? 82.058  7.360   -13.552 1.00 0.00 ? 126 ASP A O    1  
ATOM 1819  C CB   . ASP A 1 126 ? 81.633  9.584   -16.068 1.00 0.00 ? 126 ASP A CB   1  
ATOM 1820  C CG   . ASP A 1 126 ? 81.821  9.641   -17.585 1.00 0.00 ? 126 ASP A CG   1  
ATOM 1821  O OD1  . ASP A 1 126 ? 82.608  10.456  -18.034 1.00 0.00 ? 126 ASP A OD1  1  
ATOM 1822  O OD2  . ASP A 1 126 ? 81.175  8.866   -18.271 1.00 0.00 ? 126 ASP A OD2  1  
ATOM 1823  H H    . ASP A 1 126 ? 82.057  7.197   -16.816 1.00 0.00 ? 126 ASP A H    1  
ATOM 1824  H HA   . ASP A 1 126 ? 83.661  9.179   -15.539 1.00 0.00 ? 126 ASP A HA   1  
ATOM 1825  H HB2  . ASP A 1 126 ? 80.655  9.185   -15.839 1.00 0.00 ? 126 ASP A HB2  1  
ATOM 1826  H HB3  . ASP A 1 126 ? 81.719  10.579  -15.659 1.00 0.00 ? 126 ASP A HB3  1  
ATOM 1827  N N    . SER A 1 127 ? 82.526  9.536   -13.192 1.00 0.00 ? 127 SER A N    1  
ATOM 1828  C CA   . SER A 1 127 ? 82.265  9.480   -11.758 1.00 0.00 ? 127 SER A CA   1  
ATOM 1829  C C    . SER A 1 127 ? 82.081  10.898  -11.204 1.00 0.00 ? 127 SER A C    1  
ATOM 1830  O O    . SER A 1 127 ? 82.855  11.350  -10.362 1.00 0.00 ? 127 SER A O    1  
ATOM 1831  C CB   . SER A 1 127 ? 83.440  8.782   -11.058 1.00 0.00 ? 127 SER A CB   1  
ATOM 1832  O OG   . SER A 1 127 ? 83.274  7.374   -11.160 1.00 0.00 ? 127 SER A OG   1  
ATOM 1833  H H    . SER A 1 127 ? 82.801  10.387  -13.593 1.00 0.00 ? 127 SER A H    1  
ATOM 1834  H HA   . SER A 1 127 ? 81.363  8.911   -11.583 1.00 0.00 ? 127 SER A HA   1  
ATOM 1835  H HB2  . SER A 1 127 ? 84.363  9.062   -11.538 1.00 0.00 ? 127 SER A HB2  1  
ATOM 1836  H HB3  . SER A 1 127 ? 83.478  9.075   -10.016 1.00 0.00 ? 127 SER A HB3  1  
ATOM 1837  H HG   . SER A 1 127 ? 83.076  7.034   -10.284 1.00 0.00 ? 127 SER A HG   1  
ATOM 1838  N N    . PRO A 1 128 ? 81.056  11.622  -11.685 1.00 0.00 ? 128 PRO A N    1  
ATOM 1839  C CA   . PRO A 1 128 ? 80.780  13.004  -11.251 1.00 0.00 ? 128 PRO A CA   1  
ATOM 1840  C C    . PRO A 1 128 ? 80.914  13.207  -9.740  1.00 0.00 ? 128 PRO A C    1  
ATOM 1841  O O    . PRO A 1 128 ? 80.263  12.525  -8.950  1.00 0.00 ? 128 PRO A O    1  
ATOM 1842  C CB   . PRO A 1 128 ? 79.334  13.238  -11.713 1.00 0.00 ? 128 PRO A CB   1  
ATOM 1843  C CG   . PRO A 1 128 ? 79.194  12.393  -12.937 1.00 0.00 ? 128 PRO A CG   1  
ATOM 1844  C CD   . PRO A 1 128 ? 80.076  11.159  -12.691 1.00 0.00 ? 128 PRO A CD   1  
ATOM 1845  H HA   . PRO A 1 128 ? 81.432  13.688  -11.770 1.00 0.00 ? 128 PRO A HA   1  
ATOM 1846  H HB2  . PRO A 1 128 ? 78.635  12.916  -10.946 1.00 0.00 ? 128 PRO A HB2  1  
ATOM 1847  H HB3  . PRO A 1 128 ? 79.172  14.280  -11.954 1.00 0.00 ? 128 PRO A HB3  1  
ATOM 1848  H HG2  . PRO A 1 128 ? 78.157  12.101  -13.077 1.00 0.00 ? 128 PRO A HG2  1  
ATOM 1849  H HG3  . PRO A 1 128 ? 79.549  12.929  -13.807 1.00 0.00 ? 128 PRO A HG3  1  
ATOM 1850  H HD2  . PRO A 1 128 ? 79.486  10.341  -12.297 1.00 0.00 ? 128 PRO A HD2  1  
ATOM 1851  H HD3  . PRO A 1 128 ? 80.579  10.864  -13.597 1.00 0.00 ? 128 PRO A HD3  1  
ATOM 1852  N N    . ALA A 1 129 ? 81.745  14.175  -9.352  1.00 0.00 ? 129 ALA A N    1  
ATOM 1853  C CA   . ALA A 1 129 ? 81.950  14.505  -7.940  1.00 0.00 ? 129 ALA A CA   1  
ATOM 1854  C C    . ALA A 1 129 ? 81.069  15.695  -7.567  1.00 0.00 ? 129 ALA A C    1  
ATOM 1855  O O    . ALA A 1 129 ? 80.776  16.540  -8.412  1.00 0.00 ? 129 ALA A O    1  
ATOM 1856  C CB   . ALA A 1 129 ? 83.415  14.846  -7.705  1.00 0.00 ? 129 ALA A CB   1  
ATOM 1857  H H    . ALA A 1 129 ? 82.218  14.696  -10.034 1.00 0.00 ? 129 ALA A H    1  
ATOM 1858  H HA   . ALA A 1 129 ? 81.683  13.660  -7.323  1.00 0.00 ? 129 ALA A HA   1  
ATOM 1859  H HB1  . ALA A 1 129 ? 84.033  14.032  -8.051  1.00 0.00 ? 129 ALA A HB1  1  
ATOM 1860  H HB2  . ALA A 1 129 ? 83.582  15.001  -6.650  1.00 0.00 ? 129 ALA A HB2  1  
ATOM 1861  H HB3  . ALA A 1 129 ? 83.666  15.745  -8.246  1.00 0.00 ? 129 ALA A HB3  1  
ATOM 1862  N N    . ILE A 1 130 ? 80.638  15.763  -6.306  1.00 0.00 ? 130 ILE A N    1  
ATOM 1863  C CA   . ILE A 1 130 ? 79.780  16.867  -5.857  1.00 0.00 ? 130 ILE A CA   1  
ATOM 1864  C C    . ILE A 1 130 ? 80.015  17.177  -4.381  1.00 0.00 ? 130 ILE A C    1  
ATOM 1865  O O    . ILE A 1 130 ? 80.593  16.372  -3.650  1.00 0.00 ? 130 ILE A O    1  
ATOM 1866  C CB   . ILE A 1 130 ? 78.291  16.525  -6.059  1.00 0.00 ? 130 ILE A CB   1  
ATOM 1867  C CG1  . ILE A 1 130 ? 77.974  15.198  -5.354  1.00 0.00 ? 130 ILE A CG1  1  
ATOM 1868  C CG2  . ILE A 1 130 ? 77.987  16.398  -7.557  1.00 0.00 ? 130 ILE A CG2  1  
ATOM 1869  C CD1  . ILE A 1 130 ? 76.502  14.821  -5.579  1.00 0.00 ? 130 ILE A CD1  1  
ATOM 1870  H H    . ILE A 1 130 ? 80.894  15.064  -5.668  1.00 0.00 ? 130 ILE A H    1  
ATOM 1871  H HA   . ILE A 1 130 ? 80.012  17.755  -6.430  1.00 0.00 ? 130 ILE A HA   1  
ATOM 1872  H HB   . ILE A 1 130 ? 77.684  17.312  -5.637  1.00 0.00 ? 130 ILE A HB   1  
ATOM 1873  H HG12 . ILE A 1 130 ? 78.609  14.421  -5.752  1.00 0.00 ? 130 ILE A HG12 1  
ATOM 1874  H HG13 . ILE A 1 130 ? 78.157  15.303  -4.294  1.00 0.00 ? 130 ILE A HG13 1  
ATOM 1875  H HG21 . ILE A 1 130 ? 78.422  17.233  -8.087  1.00 0.00 ? 130 ILE A HG21 1  
ATOM 1876  H HG22 . ILE A 1 130 ? 76.918  16.400  -7.709  1.00 0.00 ? 130 ILE A HG22 1  
ATOM 1877  H HG23 . ILE A 1 130 ? 78.404  15.477  -7.935  1.00 0.00 ? 130 ILE A HG23 1  
ATOM 1878  H HD11 . ILE A 1 130 ? 75.879  15.698  -5.475  1.00 0.00 ? 130 ILE A HD11 1  
ATOM 1879  H HD12 . ILE A 1 130 ? 76.205  14.083  -4.847  1.00 0.00 ? 130 ILE A HD12 1  
ATOM 1880  H HD13 . ILE A 1 130 ? 76.382  14.408  -6.569  1.00 0.00 ? 130 ILE A HD13 1  
ATOM 1881  N N    . THR A 1 131 ? 79.564  18.356  -3.954  1.00 0.00 ? 131 THR A N    1  
ATOM 1882  C CA   . THR A 1 131 ? 79.725  18.790  -2.571  1.00 0.00 ? 131 THR A CA   1  
ATOM 1883  C C    . THR A 1 131 ? 78.678  18.144  -1.673  1.00 0.00 ? 131 THR A C    1  
ATOM 1884  O O    . THR A 1 131 ? 77.811  17.405  -2.140  1.00 0.00 ? 131 THR A O    1  
ATOM 1885  C CB   . THR A 1 131 ? 79.587  20.320  -2.460  1.00 0.00 ? 131 THR A CB   1  
ATOM 1886  O OG1  . THR A 1 131 ? 78.370  20.728  -3.067  1.00 0.00 ? 131 THR A OG1  1  
ATOM 1887  C CG2  . THR A 1 131 ? 80.762  20.992  -3.172  1.00 0.00 ? 131 THR A CG2  1  
ATOM 1888  H H    . THR A 1 131 ? 79.115  18.950  -4.583  1.00 0.00 ? 131 THR A H    1  
ATOM 1889  H HA   . THR A 1 131 ? 80.706  18.507  -2.223  1.00 0.00 ? 131 THR A HA   1  
ATOM 1890  H HB   . THR A 1 131 ? 79.588  20.609  -1.421  1.00 0.00 ? 131 THR A HB   1  
ATOM 1891  H HG1  . THR A 1 131 ? 78.515  20.784  -4.014  1.00 0.00 ? 131 THR A HG1  1  
ATOM 1892  H HG21 . THR A 1 131 ? 80.704  20.793  -4.232  1.00 0.00 ? 131 THR A HG21 1  
ATOM 1893  H HG22 . THR A 1 131 ? 81.691  20.600  -2.783  1.00 0.00 ? 131 THR A HG22 1  
ATOM 1894  H HG23 . THR A 1 131 ? 80.724  22.058  -3.003  1.00 0.00 ? 131 THR A HG23 1  
ATOM 1895  N N    . HIS A 1 132 ? 78.768  18.431  -0.380  1.00 0.00 ? 132 HIS A N    1  
ATOM 1896  C CA   . HIS A 1 132 ? 77.829  17.879  0.585   1.00 0.00 ? 132 HIS A CA   1  
ATOM 1897  C C    . HIS A 1 132 ? 76.452  18.516  0.427   1.00 0.00 ? 132 HIS A C    1  
ATOM 1898  O O    . HIS A 1 132 ? 75.430  17.863  0.634   1.00 0.00 ? 132 HIS A O    1  
ATOM 1899  C CB   . HIS A 1 132 ? 78.340  18.119  2.006   1.00 0.00 ? 132 HIS A CB   1  
ATOM 1900  C CG   . HIS A 1 132 ? 79.645  17.397  2.202   1.00 0.00 ? 132 HIS A CG   1  
ATOM 1901  N ND1  . HIS A 1 132 ? 79.736  16.218  2.925   1.00 0.00 ? 132 HIS A ND1  1  
ATOM 1902  C CD2  . HIS A 1 132 ? 80.920  17.674  1.773   1.00 0.00 ? 132 HIS A CD2  1  
ATOM 1903  C CE1  . HIS A 1 132 ? 81.025  15.833  2.913   1.00 0.00 ? 132 HIS A CE1  1  
ATOM 1904  N NE2  . HIS A 1 132 ? 81.790  16.685  2.225   1.00 0.00 ? 132 HIS A NE2  1  
ATOM 1905  H H    . HIS A 1 132 ? 79.482  19.026  -0.069  1.00 0.00 ? 132 HIS A H    1  
ATOM 1906  H HA   . HIS A 1 132 ? 77.743  16.815  0.422   1.00 0.00 ? 132 HIS A HA   1  
ATOM 1907  H HB2  . HIS A 1 132 ? 78.489  19.178  2.162   1.00 0.00 ? 132 HIS A HB2  1  
ATOM 1908  H HB3  . HIS A 1 132 ? 77.616  17.750  2.717   1.00 0.00 ? 132 HIS A HB3  1  
ATOM 1909  H HD1  . HIS A 1 132 ? 78.996  15.751  3.366   1.00 0.00 ? 132 HIS A HD1  1  
ATOM 1910  H HD2  . HIS A 1 132 ? 81.222  18.581  1.270   1.00 0.00 ? 132 HIS A HD2  1  
ATOM 1911  H HE1  . HIS A 1 132 ? 81.396  14.944  3.400   1.00 0.00 ? 132 HIS A HE1  1  
ATOM 1912  N N    . GLU A 1 133 ? 76.431  19.799  0.077   1.00 0.00 ? 133 GLU A N    1  
ATOM 1913  C CA   . GLU A 1 133 ? 75.165  20.511  -0.083  1.00 0.00 ? 133 GLU A CA   1  
ATOM 1914  C C    . GLU A 1 133 ? 74.387  19.971  -1.282  1.00 0.00 ? 133 GLU A C    1  
ATOM 1915  O O    . GLU A 1 133 ? 73.178  19.755  -1.198  1.00 0.00 ? 133 GLU A O    1  
ATOM 1916  C CB   . GLU A 1 133 ? 75.415  22.022  -0.239  1.00 0.00 ? 133 GLU A CB   1  
ATOM 1917  C CG   . GLU A 1 133 ? 76.591  22.270  -1.189  1.00 0.00 ? 133 GLU A CG   1  
ATOM 1918  C CD   . GLU A 1 133 ? 76.689  23.766  -1.493  1.00 0.00 ? 133 GLU A CD   1  
ATOM 1919  O OE1  . GLU A 1 133 ? 75.655  24.411  -1.540  1.00 0.00 ? 133 GLU A OE1  1  
ATOM 1920  O OE2  . GLU A 1 133 ? 77.799  24.242  -1.674  1.00 0.00 ? 133 GLU A OE2  1  
ATOM 1921  H H    . GLU A 1 133 ? 77.274  20.278  -0.061  1.00 0.00 ? 133 GLU A H    1  
ATOM 1922  H HA   . GLU A 1 133 ? 74.571  20.351  0.806   1.00 0.00 ? 133 GLU A HA   1  
ATOM 1923  H HB2  . GLU A 1 133 ? 74.528  22.499  -0.633  1.00 0.00 ? 133 GLU A HB2  1  
ATOM 1924  H HB3  . GLU A 1 133 ? 75.645  22.448  0.728   1.00 0.00 ? 133 GLU A HB3  1  
ATOM 1925  H HG2  . GLU A 1 133 ? 77.506  21.937  -0.724  1.00 0.00 ? 133 GLU A HG2  1  
ATOM 1926  H HG3  . GLU A 1 133 ? 76.434  21.730  -2.107  1.00 0.00 ? 133 GLU A HG3  1  
ATOM 1927  N N    . GLU A 1 134 ? 75.082  19.749  -2.392  1.00 0.00 ? 134 GLU A N    1  
ATOM 1928  C CA   . GLU A 1 134 ? 74.431  19.228  -3.588  1.00 0.00 ? 134 GLU A CA   1  
ATOM 1929  C C    . GLU A 1 134 ? 74.023  17.777  -3.365  1.00 0.00 ? 134 GLU A C    1  
ATOM 1930  O O    . GLU A 1 134 ? 73.031  17.308  -3.921  1.00 0.00 ? 134 GLU A O    1  
ATOM 1931  C CB   . GLU A 1 134 ? 75.379  19.323  -4.789  1.00 0.00 ? 134 GLU A CB   1  
ATOM 1932  C CG   . GLU A 1 134 ? 75.553  20.790  -5.197  1.00 0.00 ? 134 GLU A CG   1  
ATOM 1933  C CD   . GLU A 1 134 ? 76.376  20.866  -6.484  1.00 0.00 ? 134 GLU A CD   1  
ATOM 1934  O OE1  . GLU A 1 134 ? 76.282  19.946  -7.280  1.00 0.00 ? 134 GLU A OE1  1  
ATOM 1935  O OE2  . GLU A 1 134 ? 77.087  21.843  -6.653  1.00 0.00 ? 134 GLU A OE2  1  
ATOM 1936  H H    . GLU A 1 134 ? 76.044  19.933  -2.406  1.00 0.00 ? 134 GLU A H    1  
ATOM 1937  H HA   . GLU A 1 134 ? 73.546  19.813  -3.789  1.00 0.00 ? 134 GLU A HA   1  
ATOM 1938  H HB2  . GLU A 1 134 ? 76.339  18.910  -4.520  1.00 0.00 ? 134 GLU A HB2  1  
ATOM 1939  H HB3  . GLU A 1 134 ? 74.967  18.767  -5.618  1.00 0.00 ? 134 GLU A HB3  1  
ATOM 1940  H HG2  . GLU A 1 134 ? 74.584  21.237  -5.363  1.00 0.00 ? 134 GLU A HG2  1  
ATOM 1941  H HG3  . GLU A 1 134 ? 76.067  21.324  -4.413  1.00 0.00 ? 134 GLU A HG3  1  
ATOM 1942  N N    . ALA A 1 135 ? 74.793  17.075  -2.542  1.00 0.00 ? 135 ALA A N    1  
ATOM 1943  C CA   . ALA A 1 135 ? 74.503  15.680  -2.245  1.00 0.00 ? 135 ALA A CA   1  
ATOM 1944  C C    . ALA A 1 135 ? 73.262  15.577  -1.363  1.00 0.00 ? 135 ALA A C    1  
ATOM 1945  O O    . ALA A 1 135 ? 72.289  14.911  -1.716  1.00 0.00 ? 135 ALA A O    1  
ATOM 1946  C CB   . ALA A 1 135 ? 75.696  15.050  -1.544  1.00 0.00 ? 135 ALA A CB   1  
ATOM 1947  H H    . ALA A 1 135 ? 75.568  17.504  -2.124  1.00 0.00 ? 135 ALA A H    1  
ATOM 1948  H HA   . ALA A 1 135 ? 74.322  15.152  -3.170  1.00 0.00 ? 135 ALA A HA   1  
ATOM 1949  H HB1  . ALA A 1 135 ? 75.999  15.676  -0.717  1.00 0.00 ? 135 ALA A HB1  1  
ATOM 1950  H HB2  . ALA A 1 135 ? 76.515  14.955  -2.242  1.00 0.00 ? 135 ALA A HB2  1  
ATOM 1951  H HB3  . ALA A 1 135 ? 75.425  14.074  -1.175  1.00 0.00 ? 135 ALA A HB3  1  
ATOM 1952  N N    . LEU A 1 136 ? 73.304  16.247  -0.218  1.00 0.00 ? 136 LEU A N    1  
ATOM 1953  C CA   . LEU A 1 136 ? 72.179  16.234  0.709   1.00 0.00 ? 136 LEU A CA   1  
ATOM 1954  C C    . LEU A 1 136 ? 70.894  16.619  -0.018  1.00 0.00 ? 136 LEU A C    1  
ATOM 1955  O O    . LEU A 1 136 ? 69.812  16.140  0.314   1.00 0.00 ? 136 LEU A O    1  
ATOM 1956  C CB   . LEU A 1 136 ? 72.452  17.215  1.860   1.00 0.00 ? 136 LEU A CB   1  
ATOM 1957  C CG   . LEU A 1 136 ? 71.232  17.333  2.793   1.00 0.00 ? 136 LEU A CG   1  
ATOM 1958  C CD1  . LEU A 1 136 ? 70.810  15.945  3.307   1.00 0.00 ? 136 LEU A CD1  1  
ATOM 1959  C CD2  . LEU A 1 136 ? 71.609  18.226  3.980   1.00 0.00 ? 136 LEU A CD2  1  
ATOM 1960  H H    . LEU A 1 136 ? 74.106  16.761  0.007   1.00 0.00 ? 136 LEU A H    1  
ATOM 1961  H HA   . LEU A 1 136 ? 72.074  15.238  1.111   1.00 0.00 ? 136 LEU A HA   1  
ATOM 1962  H HB2  . LEU A 1 136 ? 73.300  16.864  2.430   1.00 0.00 ? 136 LEU A HB2  1  
ATOM 1963  H HB3  . LEU A 1 136 ? 72.679  18.188  1.449   1.00 0.00 ? 136 LEU A HB3  1  
ATOM 1964  H HG   . LEU A 1 136 ? 70.409  17.784  2.258   1.00 0.00 ? 136 LEU A HG   1  
ATOM 1965  H HD11 . LEU A 1 136 ? 70.200  16.054  4.194   1.00 0.00 ? 136 LEU A HD11 1  
ATOM 1966  H HD12 . LEU A 1 136 ? 71.687  15.362  3.548   1.00 0.00 ? 136 LEU A HD12 1  
ATOM 1967  H HD13 . LEU A 1 136 ? 70.237  15.436  2.546   1.00 0.00 ? 136 LEU A HD13 1  
ATOM 1968  H HD21 . LEU A 1 136 ? 72.013  19.159  3.615   1.00 0.00 ? 136 LEU A HD21 1  
ATOM 1969  H HD22 . LEU A 1 136 ? 72.349  17.726  4.587   1.00 0.00 ? 136 LEU A HD22 1  
ATOM 1970  H HD23 . LEU A 1 136 ? 70.730  18.424  4.576   1.00 0.00 ? 136 LEU A HD23 1  
ATOM 1971  N N    . ALA A 1 137 ? 71.023  17.487  -1.015  1.00 0.00 ? 137 ALA A N    1  
ATOM 1972  C CA   . ALA A 1 137 ? 69.866  17.931  -1.784  1.00 0.00 ? 137 ALA A CA   1  
ATOM 1973  C C    . ALA A 1 137 ? 69.348  16.803  -2.669  1.00 0.00 ? 137 ALA A C    1  
ATOM 1974  O O    . ALA A 1 137 ? 68.141  16.574  -2.757  1.00 0.00 ? 137 ALA A O    1  
ATOM 1975  C CB   . ALA A 1 137 ? 70.245  19.129  -2.641  1.00 0.00 ? 137 ALA A CB   1  
ATOM 1976  H H    . ALA A 1 137 ? 71.911  17.835  -1.240  1.00 0.00 ? 137 ALA A H    1  
ATOM 1977  H HA   . ALA A 1 137 ? 69.084  18.225  -1.100  1.00 0.00 ? 137 ALA A HA   1  
ATOM 1978  H HB1  . ALA A 1 137 ? 70.754  19.861  -2.032  1.00 0.00 ? 137 ALA A HB1  1  
ATOM 1979  H HB2  . ALA A 1 137 ? 69.352  19.567  -3.061  1.00 0.00 ? 137 ALA A HB2  1  
ATOM 1980  H HB3  . ALA A 1 137 ? 70.899  18.807  -3.439  1.00 0.00 ? 137 ALA A HB3  1  
ATOM 1981  N N    . MET A 1 138 ? 70.267  16.102  -3.326  1.00 0.00 ? 138 MET A N    1  
ATOM 1982  C CA   . MET A 1 138 ? 69.888  15.002  -4.202  1.00 0.00 ? 138 MET A CA   1  
ATOM 1983  C C    . MET A 1 138 ? 69.222  13.884  -3.404  1.00 0.00 ? 138 MET A C    1  
ATOM 1984  O O    . MET A 1 138 ? 68.107  13.479  -3.709  1.00 0.00 ? 138 MET A O    1  
ATOM 1985  C CB   . MET A 1 138 ? 71.126  14.458  -4.930  1.00 0.00 ? 138 MET A CB   1  
ATOM 1986  C CG   . MET A 1 138 ? 71.570  15.447  -6.013  1.00 0.00 ? 138 MET A CG   1  
ATOM 1987  S SD   . MET A 1 138 ? 73.225  15.002  -6.596  1.00 0.00 ? 138 MET A SD   1  
ATOM 1988  C CE   . MET A 1 138 ? 73.096  15.758  -8.236  1.00 0.00 ? 138 MET A CE   1  
ATOM 1989  H H    . MET A 1 138 ? 71.213  16.330  -3.218  1.00 0.00 ? 138 MET A H    1  
ATOM 1990  H HA   . MET A 1 138 ? 69.184  15.368  -4.936  1.00 0.00 ? 138 MET A HA   1  
ATOM 1991  H HB2  . MET A 1 138 ? 71.929  14.321  -4.218  1.00 0.00 ? 138 MET A HB2  1  
ATOM 1992  H HB3  . MET A 1 138 ? 70.890  13.510  -5.390  1.00 0.00 ? 138 MET A HB3  1  
ATOM 1993  H HG2  . MET A 1 138 ? 70.876  15.410  -6.839  1.00 0.00 ? 138 MET A HG2  1  
ATOM 1994  H HG3  . MET A 1 138 ? 71.589  16.447  -5.604  1.00 0.00 ? 138 MET A HG3  1  
ATOM 1995  H HE1  . MET A 1 138 ? 72.539  15.106  -8.891  1.00 0.00 ? 138 MET A HE1  1  
ATOM 1996  H HE2  . MET A 1 138 ? 74.087  15.913  -8.640  1.00 0.00 ? 138 MET A HE2  1  
ATOM 1997  H HE3  . MET A 1 138 ? 72.589  16.708  -8.157  1.00 0.00 ? 138 MET A HE3  1  
ATOM 1998  N N    . ILE A 1 139 ? 69.921  13.372  -2.400  1.00 0.00 ? 139 ILE A N    1  
ATOM 1999  C CA   . ILE A 1 139 ? 69.389  12.277  -1.590  1.00 0.00 ? 139 ILE A CA   1  
ATOM 2000  C C    . ILE A 1 139 ? 67.940  12.533  -1.173  1.00 0.00 ? 139 ILE A C    1  
ATOM 2001  O O    . ILE A 1 139 ? 67.209  11.597  -0.846  1.00 0.00 ? 139 ILE A O    1  
ATOM 2002  C CB   . ILE A 1 139 ? 70.213  12.091  -0.297  1.00 0.00 ? 139 ILE A CB   1  
ATOM 2003  C CG1  . ILE A 1 139 ? 71.704  11.872  -0.639  1.00 0.00 ? 139 ILE A CG1  1  
ATOM 2004  C CG2  . ILE A 1 139 ? 69.677  10.877  0.473   1.00 0.00 ? 139 ILE A CG2  1  
ATOM 2005  C CD1  . ILE A 1 139 ? 72.602  12.098  0.618   1.00 0.00 ? 139 ILE A CD1  1  
ATOM 2006  H H    . ILE A 1 139 ? 70.823  13.708  -2.218  1.00 0.00 ? 139 ILE A H    1  
ATOM 2007  H HA   . ILE A 1 139 ? 69.434  11.365  -2.163  1.00 0.00 ? 139 ILE A HA   1  
ATOM 2008  H HB   . ILE A 1 139 ? 70.107  12.976  0.315   1.00 0.00 ? 139 ILE A HB   1  
ATOM 2009  H HG12 . ILE A 1 139 ? 71.837  10.862  -1.006  1.00 0.00 ? 139 ILE A HG12 1  
ATOM 2010  H HG13 . ILE A 1 139 ? 71.995  12.566  -1.416  1.00 0.00 ? 139 ILE A HG13 1  
ATOM 2011  H HG21 . ILE A 1 139 ? 68.730  11.127  0.925   1.00 0.00 ? 139 ILE A HG21 1  
ATOM 2012  H HG22 . ILE A 1 139 ? 70.378  10.594  1.245   1.00 0.00 ? 139 ILE A HG22 1  
ATOM 2013  H HG23 . ILE A 1 139 ? 69.542  10.049  -0.209  1.00 0.00 ? 139 ILE A HG23 1  
ATOM 2014  H HD11 . ILE A 1 139 ? 71.995  12.271  1.498   1.00 0.00 ? 139 ILE A HD11 1  
ATOM 2015  H HD12 . ILE A 1 139 ? 73.239  12.958  0.464   1.00 0.00 ? 139 ILE A HD12 1  
ATOM 2016  H HD13 . ILE A 1 139 ? 73.221  11.226  0.786   1.00 0.00 ? 139 ILE A HD13 1  
ATOM 2017  N N    . LYS A 1 140 ? 67.530  13.798  -1.165  1.00 0.00 ? 140 LYS A N    1  
ATOM 2018  C CA   . LYS A 1 140 ? 66.166  14.152  -0.759  1.00 0.00 ? 140 LYS A CA   1  
ATOM 2019  C C    . LYS A 1 140 ? 65.181  14.067  -1.927  1.00 0.00 ? 140 LYS A C    1  
ATOM 2020  O O    . LYS A 1 140 ? 64.056  13.594  -1.762  1.00 0.00 ? 140 LYS A O    1  
ATOM 2021  C CB   . LYS A 1 140 ? 66.154  15.577  -0.188  1.00 0.00 ? 140 LYS A CB   1  
ATOM 2022  C CG   . LYS A 1 140 ? 67.001  15.647  1.105   1.00 0.00 ? 140 LYS A CG   1  
ATOM 2023  C CD   . LYS A 1 140 ? 66.166  15.227  2.325   1.00 0.00 ? 140 LYS A CD   1  
ATOM 2024  C CE   . LYS A 1 140 ? 66.995  15.422  3.597   1.00 0.00 ? 140 LYS A CE   1  
ATOM 2025  N NZ   . LYS A 1 140 ? 67.302  16.869  3.774   1.00 0.00 ? 140 LYS A NZ   1  
ATOM 2026  H H    . LYS A 1 140 ? 68.158  14.507  -1.425  1.00 0.00 ? 140 LYS A H    1  
ATOM 2027  H HA   . LYS A 1 140 ? 65.838  13.472  0.013   1.00 0.00 ? 140 LYS A HA   1  
ATOM 2028  H HB2  . LYS A 1 140 ? 66.567  16.252  -0.925  1.00 0.00 ? 140 LYS A HB2  1  
ATOM 2029  H HB3  . LYS A 1 140 ? 65.135  15.867  0.026   1.00 0.00 ? 140 LYS A HB3  1  
ATOM 2030  H HG2  . LYS A 1 140 ? 67.855  14.991  1.018   1.00 0.00 ? 140 LYS A HG2  1  
ATOM 2031  H HG3  . LYS A 1 140 ? 67.347  16.660  1.249   1.00 0.00 ? 140 LYS A HG3  1  
ATOM 2032  H HD2  . LYS A 1 140 ? 65.275  15.836  2.382   1.00 0.00 ? 140 LYS A HD2  1  
ATOM 2033  H HD3  . LYS A 1 140 ? 65.889  14.189  2.238   1.00 0.00 ? 140 LYS A HD3  1  
ATOM 2034  H HE2  . LYS A 1 140 ? 66.436  15.065  4.449   1.00 0.00 ? 140 LYS A HE2  1  
ATOM 2035  H HE3  . LYS A 1 140 ? 67.917  14.866  3.513   1.00 0.00 ? 140 LYS A HE3  1  
ATOM 2036  H HZ1  . LYS A 1 140 ? 66.480  17.436  3.486   1.00 0.00 ? 140 LYS A HZ1  1  
ATOM 2037  H HZ2  . LYS A 1 140 ? 68.123  17.123  3.187   1.00 0.00 ? 140 LYS A HZ2  1  
ATOM 2038  H HZ3  . LYS A 1 140 ? 67.518  17.058  4.772   1.00 0.00 ? 140 LYS A HZ3  1  
ATOM 2039  N N    . ASP A 1 141 ? 65.593  14.546  -3.099  1.00 0.00 ? 141 ASP A N    1  
ATOM 2040  C CA   . ASP A 1 141 ? 64.717  14.540  -4.277  1.00 0.00 ? 141 ASP A CA   1  
ATOM 2041  C C    . ASP A 1 141 ? 64.781  13.213  -5.034  1.00 0.00 ? 141 ASP A C    1  
ATOM 2042  O O    . ASP A 1 141 ? 63.827  12.836  -5.713  1.00 0.00 ? 141 ASP A O    1  
ATOM 2043  C CB   . ASP A 1 141 ? 65.122  15.674  -5.219  1.00 0.00 ? 141 ASP A CB   1  
ATOM 2044  C CG   . ASP A 1 141 ? 65.207  16.984  -4.434  1.00 0.00 ? 141 ASP A CG   1  
ATOM 2045  O OD1  . ASP A 1 141 ? 64.662  17.036  -3.345  1.00 0.00 ? 141 ASP A OD1  1  
ATOM 2046  O OD2  . ASP A 1 141 ? 65.816  17.914  -4.937  1.00 0.00 ? 141 ASP A OD2  1  
ATOM 2047  H H    . ASP A 1 141 ? 66.492  14.929  -3.171  1.00 0.00 ? 141 ASP A H    1  
ATOM 2048  H HA   . ASP A 1 141 ? 63.697  14.710  -3.962  1.00 0.00 ? 141 ASP A HA   1  
ATOM 2049  H HB2  . ASP A 1 141 ? 66.084  15.451  -5.657  1.00 0.00 ? 141 ASP A HB2  1  
ATOM 2050  H HB3  . ASP A 1 141 ? 64.383  15.772  -6.000  1.00 0.00 ? 141 ASP A HB3  1  
ATOM 2051  N N    . CYS A 1 142 ? 65.907  12.521  -4.931  1.00 0.00 ? 142 CYS A N    1  
ATOM 2052  C CA   . CYS A 1 142 ? 66.077  11.252  -5.630  1.00 0.00 ? 142 CYS A CA   1  
ATOM 2053  C C    . CYS A 1 142 ? 64.888  10.326  -5.387  1.00 0.00 ? 142 CYS A C    1  
ATOM 2054  O O    . CYS A 1 142 ? 64.600  9.954   -4.249  1.00 0.00 ? 142 CYS A O    1  
ATOM 2055  C CB   . CYS A 1 142 ? 67.365  10.566  -5.172  1.00 0.00 ? 142 CYS A CB   1  
ATOM 2056  S SG   . CYS A 1 142 ? 67.526  8.961   -5.999  1.00 0.00 ? 142 CYS A SG   1  
ATOM 2057  H H    . CYS A 1 142 ? 66.637  12.872  -4.391  1.00 0.00 ? 142 CYS A H    1  
ATOM 2058  H HA   . CYS A 1 142 ? 66.148  11.452  -6.685  1.00 0.00 ? 142 CYS A HA   1  
ATOM 2059  H HB2  . CYS A 1 142 ? 68.213  11.186  -5.425  1.00 0.00 ? 142 CYS A HB2  1  
ATOM 2060  H HB3  . CYS A 1 142 ? 67.334  10.418  -4.103  1.00 0.00 ? 142 CYS A HB3  1  
ATOM 2061  N N    . GLU A 1 143 ? 64.201  9.957   -6.471  1.00 0.00 ? 143 GLU A N    1  
ATOM 2062  C CA   . GLU A 1 143 ? 63.035  9.070   -6.385  1.00 0.00 ? 143 GLU A CA   1  
ATOM 2063  C C    . GLU A 1 143 ? 63.057  8.053   -7.523  1.00 0.00 ? 143 GLU A C    1  
ATOM 2064  O O    . GLU A 1 143 ? 63.132  8.418   -8.697  1.00 0.00 ? 143 GLU A O    1  
ATOM 2065  C CB   . GLU A 1 143 ? 61.743  9.897   -6.457  1.00 0.00 ? 143 GLU A CB   1  
ATOM 2066  C CG   . GLU A 1 143 ? 61.517  10.626  -5.128  1.00 0.00 ? 143 GLU A CG   1  
ATOM 2067  C CD   . GLU A 1 143 ? 61.093  9.621   -4.054  1.00 0.00 ? 143 GLU A CD   1  
ATOM 2068  O OE1  . GLU A 1 143 ? 60.371  8.695   -4.388  1.00 0.00 ? 143 GLU A OE1  1  
ATOM 2069  O OE2  . GLU A 1 143 ? 61.497  9.793   -2.916  1.00 0.00 ? 143 GLU A OE2  1  
ATOM 2070  H H    . GLU A 1 143 ? 64.481  10.293  -7.348  1.00 0.00 ? 143 GLU A H    1  
ATOM 2071  H HA   . GLU A 1 143 ? 63.056  8.531   -5.446  1.00 0.00 ? 143 GLU A HA   1  
ATOM 2072  H HB2  . GLU A 1 143 ? 61.827  10.622  -7.253  1.00 0.00 ? 143 GLU A HB2  1  
ATOM 2073  H HB3  . GLU A 1 143 ? 60.902  9.244   -6.655  1.00 0.00 ? 143 GLU A HB3  1  
ATOM 2074  H HG2  . GLU A 1 143 ? 62.431  11.115  -4.825  1.00 0.00 ? 143 GLU A HG2  1  
ATOM 2075  H HG3  . GLU A 1 143 ? 60.740  11.361  -5.253  1.00 0.00 ? 143 GLU A HG3  1  
ATOM 2076  N N    . VAL A 1 144 ? 62.992  6.773   -7.161  1.00 0.00 ? 144 VAL A N    1  
ATOM 2077  C CA   . VAL A 1 144 ? 63.008  5.687   -8.141  1.00 0.00 ? 144 VAL A CA   1  
ATOM 2078  C C    . VAL A 1 144 ? 61.582  5.265   -8.495  1.00 0.00 ? 144 VAL A C    1  
ATOM 2079  O O    . VAL A 1 144 ? 60.631  5.587   -7.783  1.00 0.00 ? 144 VAL A O    1  
ATOM 2080  C CB   . VAL A 1 144 ? 63.767  4.469   -7.568  1.00 0.00 ? 144 VAL A CB   1  
ATOM 2081  C CG1  . VAL A 1 144 ? 63.699  3.284   -8.543  1.00 0.00 ? 144 VAL A CG1  1  
ATOM 2082  C CG2  . VAL A 1 144 ? 65.231  4.859   -7.337  1.00 0.00 ? 144 VAL A CG2  1  
ATOM 2083  H H    . VAL A 1 144 ? 62.940  6.548   -6.209  1.00 0.00 ? 144 VAL A H    1  
ATOM 2084  H HA   . VAL A 1 144 ? 63.510  6.014   -9.041  1.00 0.00 ? 144 VAL A HA   1  
ATOM 2085  H HB   . VAL A 1 144 ? 63.322  4.182   -6.628  1.00 0.00 ? 144 VAL A HB   1  
ATOM 2086  H HG11 . VAL A 1 144 ? 64.454  2.555   -8.283  1.00 0.00 ? 144 VAL A HG11 1  
ATOM 2087  H HG12 . VAL A 1 144 ? 63.868  3.632   -9.551  1.00 0.00 ? 144 VAL A HG12 1  
ATOM 2088  H HG13 . VAL A 1 144 ? 62.724  2.821   -8.480  1.00 0.00 ? 144 VAL A HG13 1  
ATOM 2089  H HG21 . VAL A 1 144 ? 65.710  5.039   -8.288  1.00 0.00 ? 144 VAL A HG21 1  
ATOM 2090  H HG22 . VAL A 1 144 ? 65.741  4.058   -6.823  1.00 0.00 ? 144 VAL A HG22 1  
ATOM 2091  H HG23 . VAL A 1 144 ? 65.274  5.756   -6.738  1.00 0.00 ? 144 VAL A HG23 1  
ATOM 2092  N N    . SER A 1 145 ? 61.452  4.531   -9.596  1.00 0.00 ? 145 SER A N    1  
ATOM 2093  C CA   . SER A 1 145 ? 60.154  4.038   -10.060 1.00 0.00 ? 145 SER A CA   1  
ATOM 2094  C C    . SER A 1 145 ? 60.311  2.617   -10.584 1.00 0.00 ? 145 SER A C    1  
ATOM 2095  O O    . SER A 1 145 ? 61.339  2.275   -11.168 1.00 0.00 ? 145 SER A O    1  
ATOM 2096  C CB   . SER A 1 145 ? 59.617  4.940   -11.174 1.00 0.00 ? 145 SER A CB   1  
ATOM 2097  O OG   . SER A 1 145 ? 60.205  4.557   -12.410 1.00 0.00 ? 145 SER A OG   1  
ATOM 2098  H H    . SER A 1 145 ? 62.260  4.302   -10.102 1.00 0.00 ? 145 SER A H    1  
ATOM 2099  H HA   . SER A 1 145 ? 59.449  4.032   -9.236  1.00 0.00 ? 145 SER A HA   1  
ATOM 2100  H HB2  . SER A 1 145 ? 58.545  4.836   -11.246 1.00 0.00 ? 145 SER A HB2  1  
ATOM 2101  H HB3  . SER A 1 145 ? 59.862  5.971   -10.952 1.00 0.00 ? 145 SER A HB3  1  
ATOM 2102  H HG   . SER A 1 145 ? 61.026  4.099   -12.217 1.00 0.00 ? 145 SER A HG   1  
ATOM 2103  N N    . ILE A 1 146 ? 59.293  1.785   -10.366 1.00 0.00 ? 146 ILE A N    1  
ATOM 2104  C CA   . ILE A 1 146 ? 59.339  0.391   -10.814 1.00 0.00 ? 146 ILE A CA   1  
ATOM 2105  C C    . ILE A 1 146 ? 57.979  -0.046  -11.348 1.00 0.00 ? 146 ILE A C    1  
ATOM 2106  O O    . ILE A 1 146 ? 56.936  0.347   -10.824 1.00 0.00 ? 146 ILE A O    1  
ATOM 2107  C CB   . ILE A 1 146 ? 59.742  -0.541  -9.650  1.00 0.00 ? 146 ILE A CB   1  
ATOM 2108  C CG1  . ILE A 1 146 ? 60.944  0.071   -8.916  1.00 0.00 ? 146 ILE A CG1  1  
ATOM 2109  C CG2  . ILE A 1 146 ? 60.117  -1.926  -10.195 1.00 0.00 ? 146 ILE A CG2  1  
ATOM 2110  C CD1  . ILE A 1 146 ? 61.430  -0.879  -7.814  1.00 0.00 ? 146 ILE A CD1  1  
ATOM 2111  H H    . ILE A 1 146 ? 58.502  2.110   -9.889  1.00 0.00 ? 146 ILE A H    1  
ATOM 2112  H HA   . ILE A 1 146 ? 60.068  0.288   -11.608 1.00 0.00 ? 146 ILE A HA   1  
ATOM 2113  H HB   . ILE A 1 146 ? 58.913  -0.639  -8.963  1.00 0.00 ? 146 ILE A HB   1  
ATOM 2114  H HG12 . ILE A 1 146 ? 61.744  0.243   -9.620  1.00 0.00 ? 146 ILE A HG12 1  
ATOM 2115  H HG13 . ILE A 1 146 ? 60.650  1.012   -8.472  1.00 0.00 ? 146 ILE A HG13 1  
ATOM 2116  H HG21 . ILE A 1 146 ? 59.374  -2.245  -10.911 1.00 0.00 ? 146 ILE A HG21 1  
ATOM 2117  H HG22 . ILE A 1 146 ? 60.155  -2.634  -9.381  1.00 0.00 ? 146 ILE A HG22 1  
ATOM 2118  H HG23 . ILE A 1 146 ? 61.083  -1.877  -10.677 1.00 0.00 ? 146 ILE A HG23 1  
ATOM 2119  H HD11 . ILE A 1 146 ? 62.001  -1.682  -8.256  1.00 0.00 ? 146 ILE A HD11 1  
ATOM 2120  H HD12 . ILE A 1 146 ? 60.581  -1.288  -7.284  1.00 0.00 ? 146 ILE A HD12 1  
ATOM 2121  H HD13 . ILE A 1 146 ? 62.056  -0.335  -7.121  1.00 0.00 ? 146 ILE A HD13 1  
ATOM 2122  N N    . ASP A 1 147 ? 58.004  -0.864  -12.396 1.00 0.00 ? 147 ASP A N    1  
ATOM 2123  C CA   . ASP A 1 147 ? 56.777  -1.361  -13.010 1.00 0.00 ? 147 ASP A CA   1  
ATOM 2124  C C    . ASP A 1 147 ? 57.064  -2.638  -13.790 1.00 0.00 ? 147 ASP A C    1  
ATOM 2125  O O    . ASP A 1 147 ? 57.156  -2.619  -15.017 1.00 0.00 ? 147 ASP A O    1  
ATOM 2126  C CB   . ASP A 1 147 ? 56.197  -0.298  -13.949 1.00 0.00 ? 147 ASP A CB   1  
ATOM 2127  C CG   . ASP A 1 147 ? 54.835  -0.759  -14.477 1.00 0.00 ? 147 ASP A CG   1  
ATOM 2128  O OD1  . ASP A 1 147 ? 54.644  -1.956  -14.611 1.00 0.00 ? 147 ASP A OD1  1  
ATOM 2129  O OD2  . ASP A 1 147 ? 54.005  0.096   -14.739 1.00 0.00 ? 147 ASP A OD2  1  
ATOM 2130  H H    . ASP A 1 147 ? 58.870  -1.140  -12.766 1.00 0.00 ? 147 ASP A H    1  
ATOM 2131  H HA   . ASP A 1 147 ? 56.056  -1.579  -12.239 1.00 0.00 ? 147 ASP A HA   1  
ATOM 2132  H HB2  . ASP A 1 147 ? 56.078  0.630   -13.410 1.00 0.00 ? 147 ASP A HB2  1  
ATOM 2133  H HB3  . ASP A 1 147 ? 56.867  -0.148  -14.779 1.00 0.00 ? 147 ASP A HB3  1  
ATOM 2134  N N    . ILE A 1 148 ? 57.212  -3.750  -13.069 1.00 0.00 ? 148 ILE A N    1  
ATOM 2135  C CA   . ILE A 1 148 ? 57.498  -5.028  -13.712 1.00 0.00 ? 148 ILE A CA   1  
ATOM 2136  C C    . ILE A 1 148 ? 56.244  -5.587  -14.371 1.00 0.00 ? 148 ILE A C    1  
ATOM 2137  O O    . ILE A 1 148 ? 55.125  -5.312  -13.939 1.00 0.00 ? 148 ILE A O    1  
ATOM 2138  C CB   . ILE A 1 148 ? 58.039  -6.057  -12.700 1.00 0.00 ? 148 ILE A CB   1  
ATOM 2139  C CG1  . ILE A 1 148 ? 58.461  -7.332  -13.448 1.00 0.00 ? 148 ILE A CG1  1  
ATOM 2140  C CG2  . ILE A 1 148 ? 56.956  -6.391  -11.673 1.00 0.00 ? 148 ILE A CG2  1  
ATOM 2141  C CD1  . ILE A 1 148 ? 59.199  -8.286  -12.500 1.00 0.00 ? 148 ILE A CD1  1  
ATOM 2142  H H    . ILE A 1 148 ? 57.133  -3.707  -12.093 1.00 0.00 ? 148 ILE A H    1  
ATOM 2143  H HA   . ILE A 1 148 ? 58.243  -4.870  -14.471 1.00 0.00 ? 148 ILE A HA   1  
ATOM 2144  H HB   . ILE A 1 148 ? 58.895  -5.636  -12.192 1.00 0.00 ? 148 ILE A HB   1  
ATOM 2145  H HG12 . ILE A 1 148 ? 57.584  -7.827  -13.839 1.00 0.00 ? 148 ILE A HG12 1  
ATOM 2146  H HG13 . ILE A 1 148 ? 59.113  -7.068  -14.266 1.00 0.00 ? 148 ILE A HG13 1  
ATOM 2147  H HG21 . ILE A 1 148 ? 56.187  -6.991  -12.136 1.00 0.00 ? 148 ILE A HG21 1  
ATOM 2148  H HG22 . ILE A 1 148 ? 56.525  -5.477  -11.305 1.00 0.00 ? 148 ILE A HG22 1  
ATOM 2149  H HG23 . ILE A 1 148 ? 57.395  -6.937  -10.853 1.00 0.00 ? 148 ILE A HG23 1  
ATOM 2150  H HD11 . ILE A 1 148 ? 58.488  -8.773  -11.851 1.00 0.00 ? 148 ILE A HD11 1  
ATOM 2151  H HD12 . ILE A 1 148 ? 59.911  -7.732  -11.904 1.00 0.00 ? 148 ILE A HD12 1  
ATOM 2152  H HD13 . ILE A 1 148 ? 59.724  -9.031  -13.080 1.00 0.00 ? 148 ILE A HD13 1  
ATOM 2153  N N    . ARG A 1 149 ? 56.443  -6.376  -15.426 1.00 0.00 ? 149 ARG A N    1  
ATOM 2154  C CA   . ARG A 1 149 ? 55.331  -6.982  -16.160 1.00 0.00 ? 149 ARG A CA   1  
ATOM 2155  C C    . ARG A 1 149 ? 55.618  -8.453  -16.437 1.00 0.00 ? 149 ARG A C    1  
ATOM 2156  O O    . ARG A 1 149 ? 56.298  -9.121  -15.658 1.00 0.00 ? 149 ARG A O    1  
ATOM 2157  C CB   . ARG A 1 149 ? 55.121  -6.241  -17.483 1.00 0.00 ? 149 ARG A CB   1  
ATOM 2158  C CG   . ARG A 1 149 ? 55.095  -4.734  -17.223 1.00 0.00 ? 149 ARG A CG   1  
ATOM 2159  C CD   . ARG A 1 149 ? 54.718  -4.000  -18.512 1.00 0.00 ? 149 ARG A CD   1  
ATOM 2160  N NE   . ARG A 1 149 ? 53.307  -4.319  -18.870 1.00 0.00 ? 149 ARG A NE   1  
ATOM 2161  C CZ   . ARG A 1 149 ? 52.842  -3.991  -20.044 1.00 0.00 ? 149 ARG A CZ   1  
ATOM 2162  N NH1  . ARG A 1 149 ? 52.711  -2.732  -20.366 1.00 0.00 ? 149 ARG A NH1  1  
ATOM 2163  N NH2  . ARG A 1 149 ? 52.510  -4.921  -20.898 1.00 0.00 ? 149 ARG A NH2  1  
ATOM 2164  H H    . ARG A 1 149 ? 57.362  -6.554  -15.718 1.00 0.00 ? 149 ARG A H    1  
ATOM 2165  H HA   . ARG A 1 149 ? 54.422  -6.912  -15.576 1.00 0.00 ? 149 ARG A HA   1  
ATOM 2166  H HB2  . ARG A 1 149 ? 55.930  -6.477  -18.160 1.00 0.00 ? 149 ARG A HB2  1  
ATOM 2167  H HB3  . ARG A 1 149 ? 54.183  -6.546  -17.922 1.00 0.00 ? 149 ARG A HB3  1  
ATOM 2168  H HG2  . ARG A 1 149 ? 54.366  -4.514  -16.457 1.00 0.00 ? 149 ARG A HG2  1  
ATOM 2169  H HG3  . ARG A 1 149 ? 56.071  -4.408  -16.898 1.00 0.00 ? 149 ARG A HG3  1  
ATOM 2170  H HD2  . ARG A 1 149 ? 54.820  -2.936  -18.362 1.00 0.00 ? 149 ARG A HD2  1  
ATOM 2171  H HD3  . ARG A 1 149 ? 55.373  -4.316  -19.310 1.00 0.00 ? 149 ARG A HD3  1  
ATOM 2172  H HE   . ARG A 1 149 ? 52.729  -4.776  -18.225 1.00 0.00 ? 149 ARG A HE   1  
ATOM 2173  H HH11 . ARG A 1 149 ? 52.966  -2.020  -19.711 1.00 0.00 ? 149 ARG A HH11 1  
ATOM 2174  H HH12 . ARG A 1 149 ? 52.355  -2.481  -21.265 1.00 0.00 ? 149 ARG A HH12 1  
ATOM 2175  H HH21 . ARG A 1 149 ? 52.611  -5.884  -20.652 1.00 0.00 ? 149 ARG A HH21 1  
ATOM 2176  H HH22 . ARG A 1 149 ? 52.154  -4.668  -21.798 1.00 0.00 ? 149 ARG A HH22 1  
ATOM 2177  N N    . CYS A 1 150 ? 55.093  -8.952  -17.554 1.00 0.00 ? 150 CYS A N    1  
ATOM 2178  C CA   . CYS A 1 150 ? 55.283  -10.352 -17.947 1.00 0.00 ? 150 CYS A CA   1  
ATOM 2179  C C    . CYS A 1 150 ? 55.692  -10.437 -19.417 1.00 0.00 ? 150 CYS A C    1  
ATOM 2180  O O    . CYS A 1 150 ? 54.881  -10.179 -20.307 1.00 0.00 ? 150 CYS A O    1  
ATOM 2181  C CB   . CYS A 1 150 ? 53.972  -11.120 -17.732 1.00 0.00 ? 150 CYS A CB   1  
ATOM 2182  S SG   . CYS A 1 150 ? 54.309  -12.895 -17.669 1.00 0.00 ? 150 CYS A SG   1  
ATOM 2183  H H    . CYS A 1 150 ? 54.560  -8.367  -18.131 1.00 0.00 ? 150 CYS A H    1  
ATOM 2184  H HA   . CYS A 1 150 ? 56.058  -10.806 -17.343 1.00 0.00 ? 150 CYS A HA   1  
ATOM 2185  H HB2  . CYS A 1 150 ? 53.525  -10.807 -16.801 1.00 0.00 ? 150 CYS A HB2  1  
ATOM 2186  H HB3  . CYS A 1 150 ? 53.287  -10.911 -18.544 1.00 0.00 ? 150 CYS A HB3  1  
ATOM 2187  N N    . SER A 1 151 ? 56.953  -10.793 -19.673 1.00 0.00 ? 151 SER A N    1  
ATOM 2188  C CA   . SER A 1 151 ? 57.455  -10.902 -21.045 1.00 0.00 ? 151 SER A CA   1  
ATOM 2189  C C    . SER A 1 151 ? 57.412  -12.349 -21.526 1.00 0.00 ? 151 SER A C    1  
ATOM 2190  O O    . SER A 1 151 ? 57.123  -13.264 -20.755 1.00 0.00 ? 151 SER A O    1  
ATOM 2191  C CB   . SER A 1 151 ? 58.894  -10.393 -21.109 1.00 0.00 ? 151 SER A CB   1  
ATOM 2192  O OG   . SER A 1 151 ? 58.973  -9.136  -20.450 1.00 0.00 ? 151 SER A OG   1  
ATOM 2193  H H    . SER A 1 151 ? 57.565  -10.985 -18.931 1.00 0.00 ? 151 SER A H    1  
ATOM 2194  H HA   . SER A 1 151 ? 56.847  -10.297 -21.706 1.00 0.00 ? 151 SER A HA   1  
ATOM 2195  H HB2  . SER A 1 151 ? 59.549  -11.092 -20.616 1.00 0.00 ? 151 SER A HB2  1  
ATOM 2196  H HB3  . SER A 1 151 ? 59.194  -10.289 -22.143 1.00 0.00 ? 151 SER A HB3  1  
ATOM 2197  H HG   . SER A 1 151 ? 58.123  -8.963  -20.041 1.00 0.00 ? 151 SER A HG   1  
ATOM 2198  N N    . GLU A 1 152 ? 57.711  -12.544 -22.809 1.00 0.00 ? 152 GLU A N    1  
ATOM 2199  C CA   . GLU A 1 152 ? 57.718  -13.879 -23.410 1.00 0.00 ? 152 GLU A CA   1  
ATOM 2200  C C    . GLU A 1 152 ? 58.780  -13.952 -24.501 1.00 0.00 ? 152 GLU A C    1  
ATOM 2201  O O    . GLU A 1 152 ? 58.831  -14.911 -25.272 1.00 0.00 ? 152 GLU A O    1  
ATOM 2202  C CB   . GLU A 1 152 ? 56.346  -14.195 -24.010 1.00 0.00 ? 152 GLU A CB   1  
ATOM 2203  C CG   . GLU A 1 152 ? 55.291  -14.205 -22.900 1.00 0.00 ? 152 GLU A CG   1  
ATOM 2204  C CD   . GLU A 1 152 ? 53.978  -14.769 -23.448 1.00 0.00 ? 152 GLU A CD   1  
ATOM 2205  O OE1  . GLU A 1 152 ? 53.901  -15.974 -23.623 1.00 0.00 ? 152 GLU A OE1  1  
ATOM 2206  O OE2  . GLU A 1 152 ? 53.073  -13.986 -23.684 1.00 0.00 ? 152 GLU A OE2  1  
ATOM 2207  H H    . GLU A 1 152 ? 57.937  -11.770 -23.368 1.00 0.00 ? 152 GLU A H    1  
ATOM 2208  H HA   . GLU A 1 152 ? 57.947  -14.616 -22.651 1.00 0.00 ? 152 GLU A HA   1  
ATOM 2209  H HB2  . GLU A 1 152 ? 56.091  -13.442 -24.741 1.00 0.00 ? 152 GLU A HB2  1  
ATOM 2210  H HB3  . GLU A 1 152 ? 56.377  -15.164 -24.486 1.00 0.00 ? 152 GLU A HB3  1  
ATOM 2211  H HG2  . GLU A 1 152 ? 55.635  -14.822 -22.083 1.00 0.00 ? 152 GLU A HG2  1  
ATOM 2212  H HG3  . GLU A 1 152 ? 55.128  -13.198 -22.549 1.00 0.00 ? 152 GLU A HG3  1  
ATOM 2213  N N    . GLU A 1 153 ? 59.627  -12.928 -24.558 1.00 0.00 ? 153 GLU A N    1  
ATOM 2214  C CA   . GLU A 1 153 ? 60.689  -12.876 -25.558 1.00 0.00 ? 153 GLU A CA   1  
ATOM 2215  C C    . GLU A 1 153 ? 61.685  -14.011 -25.348 1.00 0.00 ? 153 GLU A C    1  
ATOM 2216  O O    . GLU A 1 153 ? 62.507  -13.968 -24.433 1.00 0.00 ? 153 GLU A O    1  
ATOM 2217  C CB   . GLU A 1 153 ? 61.418  -11.534 -25.472 1.00 0.00 ? 153 GLU A CB   1  
ATOM 2218  C CG   . GLU A 1 153 ? 60.449  -10.403 -25.824 1.00 0.00 ? 153 GLU A CG   1  
ATOM 2219  C CD   . GLU A 1 153 ? 61.183  -9.063  -25.757 1.00 0.00 ? 153 GLU A CD   1  
ATOM 2220  O OE1  . GLU A 1 153 ? 62.400  -9.072  -25.835 1.00 0.00 ? 153 GLU A OE1  1  
ATOM 2221  O OE2  . GLU A 1 153 ? 60.515  -8.050  -25.629 1.00 0.00 ? 153 GLU A OE2  1  
ATOM 2222  H H    . GLU A 1 153 ? 59.535  -12.193 -23.917 1.00 0.00 ? 153 GLU A H    1  
ATOM 2223  H HA   . GLU A 1 153 ? 60.250  -12.972 -26.540 1.00 0.00 ? 153 GLU A HA   1  
ATOM 2224  H HB2  . GLU A 1 153 ? 61.790  -11.390 -24.469 1.00 0.00 ? 153 GLU A HB2  1  
ATOM 2225  H HB3  . GLU A 1 153 ? 62.244  -11.529 -26.167 1.00 0.00 ? 153 GLU A HB3  1  
ATOM 2226  H HG2  . GLU A 1 153 ? 60.066  -10.556 -26.824 1.00 0.00 ? 153 GLU A HG2  1  
ATOM 2227  H HG3  . GLU A 1 153 ? 59.629  -10.399 -25.122 1.00 0.00 ? 153 GLU A HG3  1  
ATOM 2228  N N    . GLU A 1 154 ? 61.604  -15.029 -26.203 1.00 0.00 ? 154 GLU A N    1  
ATOM 2229  C CA   . GLU A 1 154 ? 62.501  -16.179 -26.107 1.00 0.00 ? 154 GLU A CA   1  
ATOM 2230  C C    . GLU A 1 154 ? 63.850  -15.874 -26.753 1.00 0.00 ? 154 GLU A C    1  
ATOM 2231  O O    . GLU A 1 154 ? 64.729  -16.734 -26.810 1.00 0.00 ? 154 GLU A O    1  
ATOM 2232  C CB   . GLU A 1 154 ? 61.869  -17.388 -26.799 1.00 0.00 ? 154 GLU A CB   1  
ATOM 2233  C CG   . GLU A 1 154 ? 60.625  -17.826 -26.025 1.00 0.00 ? 154 GLU A CG   1  
ATOM 2234  C CD   . GLU A 1 154 ? 60.043  -19.088 -26.666 1.00 0.00 ? 154 GLU A CD   1  
ATOM 2235  O OE1  . GLU A 1 154 ? 60.814  -19.862 -27.208 1.00 0.00 ? 154 GLU A OE1  1  
ATOM 2236  O OE2  . GLU A 1 154 ? 58.836  -19.259 -26.602 1.00 0.00 ? 154 GLU A OE2  1  
ATOM 2237  H H    . GLU A 1 154 ? 60.926  -15.006 -26.910 1.00 0.00 ? 154 GLU A H    1  
ATOM 2238  H HA   . GLU A 1 154 ? 62.660  -16.422 -25.066 1.00 0.00 ? 154 GLU A HA   1  
ATOM 2239  H HB2  . GLU A 1 154 ? 61.590  -17.120 -27.808 1.00 0.00 ? 154 GLU A HB2  1  
ATOM 2240  H HB3  . GLU A 1 154 ? 62.580  -18.200 -26.827 1.00 0.00 ? 154 GLU A HB3  1  
ATOM 2241  H HG2  . GLU A 1 154 ? 60.893  -18.033 -24.999 1.00 0.00 ? 154 GLU A HG2  1  
ATOM 2242  H HG3  . GLU A 1 154 ? 59.886  -17.039 -26.052 1.00 0.00 ? 154 GLU A HG3  1  
ATOM 2243  N N    . LYS A 1 155 ? 64.006  -14.649 -27.244 1.00 0.00 ? 155 LYS A N    1  
ATOM 2244  C CA   . LYS A 1 155 ? 65.254  -14.250 -27.887 1.00 0.00 ? 155 LYS A CA   1  
ATOM 2245  C C    . LYS A 1 155 ? 66.447  -14.551 -26.978 1.00 0.00 ? 155 LYS A C    1  
ATOM 2246  O O    . LYS A 1 155 ? 66.327  -14.543 -25.754 1.00 0.00 ? 155 LYS A O    1  
ATOM 2247  C CB   . LYS A 1 155 ? 65.207  -12.754 -28.221 1.00 0.00 ? 155 LYS A CB   1  
ATOM 2248  C CG   . LYS A 1 155 ? 64.257  -12.518 -29.400 1.00 0.00 ? 155 LYS A CG   1  
ATOM 2249  C CD   . LYS A 1 155 ? 64.099  -11.014 -29.635 1.00 0.00 ? 155 LYS A CD   1  
ATOM 2250  C CE   . LYS A 1 155 ? 63.066  -10.777 -30.740 1.00 0.00 ? 155 LYS A CE   1  
ATOM 2251  N NZ   . LYS A 1 155 ? 62.791  -9.317  -30.856 1.00 0.00 ? 155 LYS A NZ   1  
ATOM 2252  H H    . LYS A 1 155 ? 63.272  -14.004 -27.174 1.00 0.00 ? 155 LYS A H    1  
ATOM 2253  H HA   . LYS A 1 155 ? 65.368  -14.810 -28.803 1.00 0.00 ? 155 LYS A HA   1  
ATOM 2254  H HB2  . LYS A 1 155 ? 64.850  -12.207 -27.363 1.00 0.00 ? 155 LYS A HB2  1  
ATOM 2255  H HB3  . LYS A 1 155 ? 66.196  -12.407 -28.485 1.00 0.00 ? 155 LYS A HB3  1  
ATOM 2256  H HG2  . LYS A 1 155 ? 64.661  -12.981 -30.287 1.00 0.00 ? 155 LYS A HG2  1  
ATOM 2257  H HG3  . LYS A 1 155 ? 63.293  -12.948 -29.176 1.00 0.00 ? 155 LYS A HG3  1  
ATOM 2258  H HD2  . LYS A 1 155 ? 63.766  -10.540 -28.723 1.00 0.00 ? 155 LYS A HD2  1  
ATOM 2259  H HD3  . LYS A 1 155 ? 65.046  -10.594 -29.936 1.00 0.00 ? 155 LYS A HD3  1  
ATOM 2260  H HE2  . LYS A 1 155 ? 63.451  -11.146 -31.678 1.00 0.00 ? 155 LYS A HE2  1  
ATOM 2261  H HE3  . LYS A 1 155 ? 62.152  -11.297 -30.495 1.00 0.00 ? 155 LYS A HE3  1  
ATOM 2262  H HZ1  . LYS A 1 155 ? 63.082  -8.837  -29.981 1.00 0.00 ? 155 LYS A HZ1  1  
ATOM 2263  H HZ2  . LYS A 1 155 ? 61.772  -9.168  -31.011 1.00 0.00 ? 155 LYS A HZ2  1  
ATOM 2264  H HZ3  . LYS A 1 155 ? 63.325  -8.926  -31.658 1.00 0.00 ? 155 LYS A HZ3  1  
ATOM 2265  N N    . ASP A 1 156 ? 67.595  -14.828 -27.594 1.00 0.00 ? 156 ASP A N    1  
ATOM 2266  C CA   . ASP A 1 156 ? 68.806  -15.147 -26.843 1.00 0.00 ? 156 ASP A CA   1  
ATOM 2267  C C    . ASP A 1 156 ? 69.234  -13.975 -25.964 1.00 0.00 ? 156 ASP A C    1  
ATOM 2268  O O    . ASP A 1 156 ? 68.678  -12.881 -26.055 1.00 0.00 ? 156 ASP A O    1  
ATOM 2269  C CB   . ASP A 1 156 ? 69.940  -15.498 -27.808 1.00 0.00 ? 156 ASP A CB   1  
ATOM 2270  C CG   . ASP A 1 156 ? 69.465  -16.580 -28.780 1.00 0.00 ? 156 ASP A CG   1  
ATOM 2271  O OD1  . ASP A 1 156 ? 68.670  -16.260 -29.648 1.00 0.00 ? 156 ASP A OD1  1  
ATOM 2272  O OD2  . ASP A 1 156 ? 69.904  -17.709 -28.640 1.00 0.00 ? 156 ASP A OD2  1  
ATOM 2273  H H    . ASP A 1 156 ? 67.625  -14.827 -28.574 1.00 0.00 ? 156 ASP A H    1  
ATOM 2274  H HA   . ASP A 1 156 ? 68.612  -16.001 -26.213 1.00 0.00 ? 156 ASP A HA   1  
ATOM 2275  H HB2  . ASP A 1 156 ? 70.227  -14.616 -28.362 1.00 0.00 ? 156 ASP A HB2  1  
ATOM 2276  H HB3  . ASP A 1 156 ? 70.788  -15.866 -27.251 1.00 0.00 ? 156 ASP A HB3  1  
ATOM 2277  N N    . SER A 1 157 ? 70.228  -14.218 -25.104 1.00 0.00 ? 157 SER A N    1  
ATOM 2278  C CA   . SER A 1 157 ? 70.736  -13.188 -24.195 1.00 0.00 ? 157 SER A CA   1  
ATOM 2279  C C    . SER A 1 157 ? 71.994  -12.535 -24.760 1.00 0.00 ? 157 SER A C    1  
ATOM 2280  O O    . SER A 1 157 ? 72.769  -13.170 -25.474 1.00 0.00 ? 157 SER A O    1  
ATOM 2281  C CB   . SER A 1 157 ? 71.061  -13.815 -22.840 1.00 0.00 ? 157 SER A CB   1  
ATOM 2282  O OG   . SER A 1 157 ? 72.051  -14.820 -23.012 1.00 0.00 ? 157 SER A OG   1  
ATOM 2283  H H    . SER A 1 157 ? 70.626  -15.113 -25.078 1.00 0.00 ? 157 SER A H    1  
ATOM 2284  H HA   . SER A 1 157 ? 69.984  -12.427 -24.050 1.00 0.00 ? 157 SER A HA   1  
ATOM 2285  H HB2  . SER A 1 157 ? 71.437  -13.059 -22.172 1.00 0.00 ? 157 SER A HB2  1  
ATOM 2286  H HB3  . SER A 1 157 ? 70.163  -14.248 -22.420 1.00 0.00 ? 157 SER A HB3  1  
ATOM 2287  H HG   . SER A 1 157 ? 71.610  -15.626 -23.292 1.00 0.00 ? 157 SER A HG   1  
ATOM 2288  N N    . ASP A 1 158 ? 72.190  -11.259 -24.421 1.00 0.00 ? 158 ASP A N    1  
ATOM 2289  C CA   . ASP A 1 158 ? 73.360  -10.498 -24.876 1.00 0.00 ? 158 ASP A CA   1  
ATOM 2290  C C    . ASP A 1 158 ? 74.142  -9.988  -23.672 1.00 0.00 ? 158 ASP A C    1  
ATOM 2291  O O    . ASP A 1 158 ? 73.842  -8.923  -23.131 1.00 0.00 ? 158 ASP A O    1  
ATOM 2292  C CB   . ASP A 1 158 ? 72.909  -9.312  -25.731 1.00 0.00 ? 158 ASP A CB   1  
ATOM 2293  C CG   . ASP A 1 158 ? 74.129  -8.651  -26.376 1.00 0.00 ? 158 ASP A CG   1  
ATOM 2294  O OD1  . ASP A 1 158 ? 74.714  -7.789  -25.743 1.00 0.00 ? 158 ASP A OD1  1  
ATOM 2295  O OD2  . ASP A 1 158 ? 74.457  -9.020  -27.492 1.00 0.00 ? 158 ASP A OD2  1  
ATOM 2296  H H    . ASP A 1 158 ? 71.534  -10.817 -23.843 1.00 0.00 ? 158 ASP A H    1  
ATOM 2297  H HA   . ASP A 1 158 ? 74.007  -11.132 -25.471 1.00 0.00 ? 158 ASP A HA   1  
ATOM 2298  H HB2  . ASP A 1 158 ? 72.236  -9.660  -26.503 1.00 0.00 ? 158 ASP A HB2  1  
ATOM 2299  H HB3  . ASP A 1 158 ? 72.399  -8.592  -25.109 1.00 0.00 ? 158 ASP A HB3  1  
ATOM 2300  N N    . ILE A 1 159 ? 75.143  -10.765 -23.250 1.00 0.00 ? 159 ILE A N    1  
ATOM 2301  C CA   . ILE A 1 159 ? 75.975  -10.406 -22.092 1.00 0.00 ? 159 ILE A CA   1  
ATOM 2302  C C    . ILE A 1 159 ? 77.392  -10.040 -22.534 1.00 0.00 ? 159 ILE A C    1  
ATOM 2303  O O    . ILE A 1 159 ? 77.725  -10.102 -23.717 1.00 0.00 ? 159 ILE A O    1  
ATOM 2304  C CB   . ILE A 1 159 ? 76.048  -11.585 -21.080 1.00 0.00 ? 159 ILE A CB   1  
ATOM 2305  C CG1  . ILE A 1 159 ? 76.167  -12.924 -21.827 1.00 0.00 ? 159 ILE A CG1  1  
ATOM 2306  C CG2  . ILE A 1 159 ? 74.773  -11.614 -20.230 1.00 0.00 ? 159 ILE A CG2  1  
ATOM 2307  C CD1  . ILE A 1 159 ? 77.450  -12.962 -22.671 1.00 0.00 ? 159 ILE A CD1  1  
ATOM 2308  H H    . ILE A 1 159 ? 75.324  -11.603 -23.725 1.00 0.00 ? 159 ILE A H    1  
ATOM 2309  H HA   . ILE A 1 159 ? 75.547  -9.546  -21.590 1.00 0.00 ? 159 ILE A HA   1  
ATOM 2310  H HB   . ILE A 1 159 ? 76.902  -11.457 -20.428 1.00 0.00 ? 159 ILE A HB   1  
ATOM 2311  H HG12 . ILE A 1 159 ? 76.190  -13.728 -21.104 1.00 0.00 ? 159 ILE A HG12 1  
ATOM 2312  H HG13 . ILE A 1 159 ? 75.309  -13.052 -22.471 1.00 0.00 ? 159 ILE A HG13 1  
ATOM 2313  H HG21 . ILE A 1 159 ? 74.676  -10.681 -19.694 1.00 0.00 ? 159 ILE A HG21 1  
ATOM 2314  H HG22 . ILE A 1 159 ? 74.830  -12.429 -19.524 1.00 0.00 ? 159 ILE A HG22 1  
ATOM 2315  H HG23 . ILE A 1 159 ? 73.918  -11.751 -20.872 1.00 0.00 ? 159 ILE A HG23 1  
ATOM 2316  H HD11 . ILE A 1 159 ? 78.260  -12.496 -22.128 1.00 0.00 ? 159 ILE A HD11 1  
ATOM 2317  H HD12 . ILE A 1 159 ? 77.289  -12.436 -23.600 1.00 0.00 ? 159 ILE A HD12 1  
ATOM 2318  H HD13 . ILE A 1 159 ? 77.709  -13.989 -22.886 1.00 0.00 ? 159 ILE A HD13 1  
ATOM 2319  N N    . LYS A 1 160 ? 78.224  -9.658  -21.560 1.00 0.00 ? 160 LYS A N    1  
ATOM 2320  C CA   . LYS A 1 160 ? 79.617  -9.282  -21.824 1.00 0.00 ? 160 LYS A CA   1  
ATOM 2321  C C    . LYS A 1 160 ? 80.533  -9.923  -20.783 1.00 0.00 ? 160 LYS A C    1  
ATOM 2322  O O    . LYS A 1 160 ? 80.323  -9.774  -19.580 1.00 0.00 ? 160 LYS A O    1  
ATOM 2323  C CB   . LYS A 1 160 ? 79.760  -7.756  -21.773 1.00 0.00 ? 160 LYS A CB   1  
ATOM 2324  C CG   . LYS A 1 160 ? 81.108  -7.339  -22.373 1.00 0.00 ? 160 LYS A CG   1  
ATOM 2325  C CD   . LYS A 1 160 ? 81.219  -5.811  -22.372 1.00 0.00 ? 160 LYS A CD   1  
ATOM 2326  C CE   . LYS A 1 160 ? 82.425  -5.380  -23.211 1.00 0.00 ? 160 LYS A CE   1  
ATOM 2327  N NZ   . LYS A 1 160 ? 82.121  -5.577  -24.657 1.00 0.00 ? 160 LYS A NZ   1  
ATOM 2328  H H    . LYS A 1 160 ? 77.893  -9.635  -20.638 1.00 0.00 ? 160 LYS A H    1  
ATOM 2329  H HA   . LYS A 1 160 ? 79.909  -9.632  -22.807 1.00 0.00 ? 160 LYS A HA   1  
ATOM 2330  H HB2  . LYS A 1 160 ? 78.961  -7.303  -22.341 1.00 0.00 ? 160 LYS A HB2  1  
ATOM 2331  H HB3  . LYS A 1 160 ? 79.707  -7.421  -20.748 1.00 0.00 ? 160 LYS A HB3  1  
ATOM 2332  H HG2  . LYS A 1 160 ? 81.910  -7.760  -21.783 1.00 0.00 ? 160 LYS A HG2  1  
ATOM 2333  H HG3  . LYS A 1 160 ? 81.178  -7.703  -23.387 1.00 0.00 ? 160 LYS A HG3  1  
ATOM 2334  H HD2  . LYS A 1 160 ? 80.319  -5.385  -22.790 1.00 0.00 ? 160 LYS A HD2  1  
ATOM 2335  H HD3  . LYS A 1 160 ? 81.345  -5.460  -21.359 1.00 0.00 ? 160 LYS A HD3  1  
ATOM 2336  H HE2  . LYS A 1 160 ? 82.636  -4.336  -23.028 1.00 0.00 ? 160 LYS A HE2  1  
ATOM 2337  H HE3  . LYS A 1 160 ? 83.287  -5.973  -22.940 1.00 0.00 ? 160 LYS A HE3  1  
ATOM 2338  H HZ1  . LYS A 1 160 ? 81.228  -5.100  -24.891 1.00 0.00 ? 160 LYS A HZ1  1  
ATOM 2339  H HZ2  . LYS A 1 160 ? 82.034  -6.596  -24.856 1.00 0.00 ? 160 LYS A HZ2  1  
ATOM 2340  H HZ3  . LYS A 1 160 ? 82.887  -5.175  -25.232 1.00 0.00 ? 160 LYS A HZ3  1  
ATOM 2341  N N    . THR A 1 161 ? 81.541  -10.648 -21.257 1.00 0.00 ? 161 THR A N    1  
ATOM 2342  C CA   . THR A 1 161 ? 82.480  -11.324 -20.365 1.00 0.00 ? 161 THR A CA   1  
ATOM 2343  C C    . THR A 1 161 ? 83.166  -10.331 -19.428 1.00 0.00 ? 161 THR A C    1  
ATOM 2344  O O    . THR A 1 161 ? 83.954  -10.720 -18.567 1.00 0.00 ? 161 THR A O    1  
ATOM 2345  C CB   . THR A 1 161 ? 83.559  -12.073 -21.178 1.00 0.00 ? 161 THR A CB   1  
ATOM 2346  O OG1  . THR A 1 161 ? 82.925  -12.935 -22.112 1.00 0.00 ? 161 THR A OG1  1  
ATOM 2347  C CG2  . THR A 1 161 ? 84.459  -12.906 -20.250 1.00 0.00 ? 161 THR A CG2  1  
ATOM 2348  H H    . THR A 1 161 ? 81.653  -10.739 -22.227 1.00 0.00 ? 161 THR A H    1  
ATOM 2349  H HA   . THR A 1 161 ? 81.934  -12.042 -19.771 1.00 0.00 ? 161 THR A HA   1  
ATOM 2350  H HB   . THR A 1 161 ? 84.165  -11.355 -21.713 1.00 0.00 ? 161 THR A HB   1  
ATOM 2351  H HG1  . THR A 1 161 ? 81.980  -12.769 -22.075 1.00 0.00 ? 161 THR A HG1  1  
ATOM 2352  H HG21 . THR A 1 161 ? 83.866  -13.350 -19.463 1.00 0.00 ? 161 THR A HG21 1  
ATOM 2353  H HG22 . THR A 1 161 ? 85.218  -12.273 -19.815 1.00 0.00 ? 161 THR A HG22 1  
ATOM 2354  H HG23 . THR A 1 161 ? 84.934  -13.689 -20.823 1.00 0.00 ? 161 THR A HG23 1  
ATOM 2355  N N    . HIS A 1 162 ? 82.857  -9.047  -19.590 1.00 0.00 ? 162 HIS A N    1  
ATOM 2356  C CA   . HIS A 1 162 ? 83.451  -8.018  -18.742 1.00 0.00 ? 162 HIS A CA   1  
ATOM 2357  C C    . HIS A 1 162 ? 82.810  -8.040  -17.345 1.00 0.00 ? 162 HIS A C    1  
ATOM 2358  O O    . HIS A 1 162 ? 81.612  -7.781  -17.222 1.00 0.00 ? 162 HIS A O    1  
ATOM 2359  C CB   . HIS A 1 162 ? 83.226  -6.642  -19.374 1.00 0.00 ? 162 HIS A CB   1  
ATOM 2360  C CG   . HIS A 1 162 ? 84.003  -5.604  -18.612 1.00 0.00 ? 162 HIS A CG   1  
ATOM 2361  N ND1  . HIS A 1 162 ? 84.372  -5.781  -17.287 1.00 0.00 ? 162 HIS A ND1  1  
ATOM 2362  C CD2  . HIS A 1 162 ? 84.488  -4.371  -18.974 1.00 0.00 ? 162 HIS A CD2  1  
ATOM 2363  C CE1  . HIS A 1 162 ? 85.047  -4.682  -16.904 1.00 0.00 ? 162 HIS A CE1  1  
ATOM 2364  N NE2  . HIS A 1 162 ? 85.147  -3.792  -17.894 1.00 0.00 ? 162 HIS A NE2  1  
ATOM 2365  H H    . HIS A 1 162 ? 82.215  -8.789  -20.281 1.00 0.00 ? 162 HIS A H    1  
ATOM 2366  H HA   . HIS A 1 162 ? 84.511  -8.195  -18.673 1.00 0.00 ? 162 HIS A HA   1  
ATOM 2367  H HB2  . HIS A 1 162 ? 83.559  -6.659  -20.401 1.00 0.00 ? 162 HIS A HB2  1  
ATOM 2368  H HB3  . HIS A 1 162 ? 82.175  -6.399  -19.341 1.00 0.00 ? 162 HIS A HB3  1  
ATOM 2369  H HD1  . HIS A 1 162 ? 84.175  -6.564  -16.731 1.00 0.00 ? 162 HIS A HD1  1  
ATOM 2370  H HD2  . HIS A 1 162 ? 84.303  -3.886  -19.921 1.00 0.00 ? 162 HIS A HD2  1  
ATOM 2371  H HE1  . HIS A 1 162 ? 85.459  -4.538  -15.915 1.00 0.00 ? 162 HIS A HE1  1  
ATOM 2372  N N    . PRO A 1 163 ? 83.570  -8.343  -16.263 1.00 0.00 ? 163 PRO A N    1  
ATOM 2373  C CA   . PRO A 1 163 ? 83.006  -8.375  -14.902 1.00 0.00 ? 163 PRO A CA   1  
ATOM 2374  C C    . PRO A 1 163 ? 82.024  -7.226  -14.662 1.00 0.00 ? 163 PRO A C    1  
ATOM 2375  O O    . PRO A 1 163 ? 82.038  -6.227  -15.380 1.00 0.00 ? 163 PRO A O    1  
ATOM 2376  C CB   . PRO A 1 163 ? 84.243  -8.258  -14.004 1.00 0.00 ? 163 PRO A CB   1  
ATOM 2377  C CG   . PRO A 1 163 ? 85.316  -8.958  -14.773 1.00 0.00 ? 163 PRO A CG   1  
ATOM 2378  C CD   . PRO A 1 163 ? 85.014  -8.674  -16.253 1.00 0.00 ? 163 PRO A CD   1  
ATOM 2379  H HA   . PRO A 1 163 ? 82.521  -9.320  -14.726 1.00 0.00 ? 163 PRO A HA   1  
ATOM 2380  H HB2  . PRO A 1 163 ? 84.501  -7.217  -13.848 1.00 0.00 ? 163 PRO A HB2  1  
ATOM 2381  H HB3  . PRO A 1 163 ? 84.076  -8.752  -13.056 1.00 0.00 ? 163 PRO A HB3  1  
ATOM 2382  H HG2  . PRO A 1 163 ? 86.291  -8.568  -14.498 1.00 0.00 ? 163 PRO A HG2  1  
ATOM 2383  H HG3  . PRO A 1 163 ? 85.277  -10.023 -14.590 1.00 0.00 ? 163 PRO A HG3  1  
ATOM 2384  H HD2  . PRO A 1 163 ? 85.599  -7.833  -16.606 1.00 0.00 ? 163 PRO A HD2  1  
ATOM 2385  H HD3  . PRO A 1 163 ? 85.199  -9.548  -16.861 1.00 0.00 ? 163 PRO A HD3  1  
ATOM 2386  N N    . VAL A 1 164 ? 81.172  -7.379  -13.650 1.00 0.00 ? 164 VAL A N    1  
ATOM 2387  C CA   . VAL A 1 164 ? 80.184  -6.351  -13.326 1.00 0.00 ? 164 VAL A CA   1  
ATOM 2388  C C    . VAL A 1 164 ? 80.820  -5.236  -12.497 1.00 0.00 ? 164 VAL A C    1  
ATOM 2389  O O    . VAL A 1 164 ? 81.482  -5.493  -11.492 1.00 0.00 ? 164 VAL A O    1  
ATOM 2390  C CB   . VAL A 1 164 ? 79.005  -6.957  -12.534 1.00 0.00 ? 164 VAL A CB   1  
ATOM 2391  C CG1  . VAL A 1 164 ? 79.518  -7.610  -11.245 1.00 0.00 ? 164 VAL A CG1  1  
ATOM 2392  C CG2  . VAL A 1 164 ? 77.991  -5.857  -12.192 1.00 0.00 ? 164 VAL A CG2  1  
ATOM 2393  H H    . VAL A 1 164 ? 81.206  -8.197  -13.111 1.00 0.00 ? 164 VAL A H    1  
ATOM 2394  H HA   . VAL A 1 164 ? 79.800  -5.927  -14.242 1.00 0.00 ? 164 VAL A HA   1  
ATOM 2395  H HB   . VAL A 1 164 ? 78.523  -7.710  -13.142 1.00 0.00 ? 164 VAL A HB   1  
ATOM 2396  H HG11 . VAL A 1 164 ? 79.794  -6.847  -10.532 1.00 0.00 ? 164 VAL A HG11 1  
ATOM 2397  H HG12 . VAL A 1 164 ? 80.382  -8.219  -11.469 1.00 0.00 ? 164 VAL A HG12 1  
ATOM 2398  H HG13 . VAL A 1 164 ? 78.742  -8.231  -10.824 1.00 0.00 ? 164 VAL A HG13 1  
ATOM 2399  H HG21 . VAL A 1 164 ? 77.754  -5.297  -13.085 1.00 0.00 ? 164 VAL A HG21 1  
ATOM 2400  H HG22 . VAL A 1 164 ? 78.408  -5.191  -11.452 1.00 0.00 ? 164 VAL A HG22 1  
ATOM 2401  H HG23 . VAL A 1 164 ? 77.091  -6.308  -11.803 1.00 0.00 ? 164 VAL A HG23 1  
ATOM 2402  N N    . LEU A 1 165 ? 80.615  -3.995  -12.933 1.00 0.00 ? 165 LEU A N    1  
ATOM 2403  C CA   . LEU A 1 165 ? 81.169  -2.841  -12.228 1.00 0.00 ? 165 LEU A CA   1  
ATOM 2404  C C    . LEU A 1 165 ? 80.318  -2.504  -11.005 1.00 0.00 ? 165 LEU A C    1  
ATOM 2405  O O    . LEU A 1 165 ? 79.123  -2.237  -11.124 1.00 0.00 ? 165 LEU A O    1  
ATOM 2406  C CB   . LEU A 1 165 ? 81.224  -1.631  -13.175 1.00 0.00 ? 165 LEU A CB   1  
ATOM 2407  C CG   . LEU A 1 165 ? 81.696  -2.077  -14.564 1.00 0.00 ? 165 LEU A CG   1  
ATOM 2408  C CD1  . LEU A 1 165 ? 81.849  -0.846  -15.462 1.00 0.00 ? 165 LEU A CD1  1  
ATOM 2409  C CD2  . LEU A 1 165 ? 83.045  -2.800  -14.450 1.00 0.00 ? 165 LEU A CD2  1  
ATOM 2410  H H    . LEU A 1 165 ? 80.082  -3.852  -13.742 1.00 0.00 ? 165 LEU A H    1  
ATOM 2411  H HA   . LEU A 1 165 ? 82.173  -3.074  -11.900 1.00 0.00 ? 165 LEU A HA   1  
ATOM 2412  H HB2  . LEU A 1 165 ? 80.240  -1.191  -13.258 1.00 0.00 ? 165 LEU A HB2  1  
ATOM 2413  H HB3  . LEU A 1 165 ? 81.913  -0.898  -12.782 1.00 0.00 ? 165 LEU A HB3  1  
ATOM 2414  H HG   . LEU A 1 165 ? 80.963  -2.744  -14.994 1.00 0.00 ? 165 LEU A HG   1  
ATOM 2415  H HD11 . LEU A 1 165 ? 80.919  -0.297  -15.482 1.00 0.00 ? 165 LEU A HD11 1  
ATOM 2416  H HD12 . LEU A 1 165 ? 82.102  -1.162  -16.463 1.00 0.00 ? 165 LEU A HD12 1  
ATOM 2417  H HD13 . LEU A 1 165 ? 82.634  -0.213  -15.074 1.00 0.00 ? 165 LEU A HD13 1  
ATOM 2418  H HD21 . LEU A 1 165 ? 83.488  -2.897  -15.432 1.00 0.00 ? 165 LEU A HD21 1  
ATOM 2419  H HD22 . LEU A 1 165 ? 82.893  -3.784  -14.031 1.00 0.00 ? 165 LEU A HD22 1  
ATOM 2420  H HD23 . LEU A 1 165 ? 83.708  -2.234  -13.812 1.00 0.00 ? 165 LEU A HD23 1  
ATOM 2421  N N    . GLY A 1 166 ? 80.942  -2.526  -9.827  1.00 0.00 ? 166 GLY A N    1  
ATOM 2422  C CA   . GLY A 1 166 ? 80.242  -2.231  -8.580  1.00 0.00 ? 166 GLY A CA   1  
ATOM 2423  C C    . GLY A 1 166 ? 80.398  -0.780  -8.161  1.00 0.00 ? 166 GLY A C    1  
ATOM 2424  O O    . GLY A 1 166 ? 81.314  -0.089  -8.608  1.00 0.00 ? 166 GLY A O    1  
ATOM 2425  H H    . GLY A 1 166 ? 81.896  -2.752  -9.797  1.00 0.00 ? 166 GLY A H    1  
ATOM 2426  H HA2  . GLY A 1 166 ? 79.188  -2.450  -8.694  1.00 0.00 ? 166 GLY A HA2  1  
ATOM 2427  H HA3  . GLY A 1 166 ? 80.644  -2.860  -7.800  1.00 0.00 ? 166 GLY A HA3  1  
ATOM 2428  N N    . SER A 1 167 ? 79.498  -0.322  -7.288  1.00 0.00 ? 167 SER A N    1  
ATOM 2429  C CA   . SER A 1 167 ? 79.535  1.054   -6.789  1.00 0.00 ? 167 SER A CA   1  
ATOM 2430  C C    . SER A 1 167 ? 80.351  1.107   -5.496  1.00 0.00 ? 167 SER A C    1  
ATOM 2431  O O    . SER A 1 167 ? 80.393  2.134   -4.818  1.00 0.00 ? 167 SER A O    1  
ATOM 2432  C CB   . SER A 1 167 ? 78.091  1.546   -6.542  1.00 0.00 ? 167 SER A CB   1  
ATOM 2433  O OG   . SER A 1 167 ? 77.255  0.424   -6.297  1.00 0.00 ? 167 SER A OG   1  
ATOM 2434  H H    . SER A 1 167 ? 78.799  -0.927  -6.963  1.00 0.00 ? 167 SER A H    1  
ATOM 2435  H HA   . SER A 1 167 ? 80.008  1.693   -7.524  1.00 0.00 ? 167 SER A HA   1  
ATOM 2436  H HB2  . SER A 1 167 ? 78.056  2.206   -5.689  1.00 0.00 ? 167 SER A HB2  1  
ATOM 2437  H HB3  . SER A 1 167 ? 77.735  2.082   -7.414  1.00 0.00 ? 167 SER A HB3  1  
ATOM 2438  H HG   . SER A 1 167 ? 76.906  0.125   -7.141  1.00 0.00 ? 167 SER A HG   1  
ATOM 2439  N N    . ASN A 1 168 ? 80.992  -0.013  -5.170  1.00 0.00 ? 168 ASN A N    1  
ATOM 2440  C CA   . ASN A 1 168 ? 81.813  -0.110  -3.966  1.00 0.00 ? 168 ASN A CA   1  
ATOM 2441  C C    . ASN A 1 168 ? 80.998  0.182   -2.708  1.00 0.00 ? 168 ASN A C    1  
ATOM 2442  O O    . ASN A 1 168 ? 81.523  0.122   -1.596  1.00 0.00 ? 168 ASN A O    1  
ATOM 2443  C CB   . ASN A 1 168 ? 82.994  0.860   -4.050  1.00 0.00 ? 168 ASN A CB   1  
ATOM 2444  C CG   . ASN A 1 168 ? 83.869  0.709   -2.804  1.00 0.00 ? 168 ASN A CG   1  
ATOM 2445  O OD1  . ASN A 1 168 ? 84.026  1.641   -2.042  1.00 0.00 ? 168 ASN A OD1  1  
ATOM 2446  N ND2  . ASN A 1 168 ? 84.448  -0.435  -2.565  1.00 0.00 ? 168 ASN A ND2  1  
ATOM 2447  H H    . ASN A 1 168 ? 80.912  -0.794  -5.757  1.00 0.00 ? 168 ASN A H    1  
ATOM 2448  H HA   . ASN A 1 168 ? 82.202  -1.114  -3.897  1.00 0.00 ? 168 ASN A HA   1  
ATOM 2449  H HB2  . ASN A 1 168 ? 83.579  0.639   -4.931  1.00 0.00 ? 168 ASN A HB2  1  
ATOM 2450  H HB3  . ASN A 1 168 ? 82.627  1.872   -4.107  1.00 0.00 ? 168 ASN A HB3  1  
ATOM 2451  H HD21 . ASN A 1 168 ? 84.322  -1.188  -3.181  1.00 0.00 ? 168 ASN A HD21 1  
ATOM 2452  H HD22 . ASN A 1 168 ? 85.011  -0.543  -1.769  1.00 0.00 ? 168 ASN A HD22 1  
ATOM 2453  N N    . ILE A 1 169 ? 79.710  0.485   -2.880  1.00 0.00 ? 169 ILE A N    1  
ATOM 2454  C CA   . ILE A 1 169 ? 78.837  0.769   -1.739  1.00 0.00 ? 169 ILE A CA   1  
ATOM 2455  C C    . ILE A 1 169 ? 78.182  -0.526  -1.270  1.00 0.00 ? 169 ILE A C    1  
ATOM 2456  O O    . ILE A 1 169 ? 77.812  -1.368  -2.088  1.00 0.00 ? 169 ILE A O    1  
ATOM 2457  C CB   . ILE A 1 169 ? 77.741  1.787   -2.129  1.00 0.00 ? 169 ILE A CB   1  
ATOM 2458  C CG1  . ILE A 1 169 ? 76.902  2.183   -0.897  1.00 0.00 ? 169 ILE A CG1  1  
ATOM 2459  C CG2  . ILE A 1 169 ? 76.819  1.170   -3.185  1.00 0.00 ? 169 ILE A CG2  1  
ATOM 2460  C CD1  . ILE A 1 169 ? 77.768  2.926   0.144   1.00 0.00 ? 169 ILE A CD1  1  
ATOM 2461  H H    . ILE A 1 169 ? 79.339  0.508   -3.787  1.00 0.00 ? 169 ILE A H    1  
ATOM 2462  H HA   . ILE A 1 169 ? 79.426  1.178   -0.929  1.00 0.00 ? 169 ILE A HA   1  
ATOM 2463  H HB   . ILE A 1 169 ? 78.209  2.669   -2.543  1.00 0.00 ? 169 ILE A HB   1  
ATOM 2464  H HG12 . ILE A 1 169 ? 76.097  2.830   -1.218  1.00 0.00 ? 169 ILE A HG12 1  
ATOM 2465  H HG13 . ILE A 1 169 ? 76.483  1.296   -0.447  1.00 0.00 ? 169 ILE A HG13 1  
ATOM 2466  H HG21 . ILE A 1 169 ? 77.416  0.709   -3.956  1.00 0.00 ? 169 ILE A HG21 1  
ATOM 2467  H HG22 . ILE A 1 169 ? 76.204  1.943   -3.622  1.00 0.00 ? 169 ILE A HG22 1  
ATOM 2468  H HG23 . ILE A 1 169 ? 76.189  0.425   -2.725  1.00 0.00 ? 169 ILE A HG23 1  
ATOM 2469  H HD11 . ILE A 1 169 ? 77.140  3.580   0.733   1.00 0.00 ? 169 ILE A HD11 1  
ATOM 2470  H HD12 . ILE A 1 169 ? 78.524  3.516   -0.356  1.00 0.00 ? 169 ILE A HD12 1  
ATOM 2471  H HD13 . ILE A 1 169 ? 78.246  2.212   0.798   1.00 0.00 ? 169 ILE A HD13 1  
ATOM 2472  N N    . SER A 1 170 ? 78.034  -0.688  0.043   1.00 0.00 ? 170 SER A N    1  
ATOM 2473  C CA   . SER A 1 170 ? 77.417  -1.892  0.596   1.00 0.00 ? 170 SER A CA   1  
ATOM 2474  C C    . SER A 1 170 ? 75.908  -1.709  0.694   1.00 0.00 ? 170 SER A C    1  
ATOM 2475  O O    . SER A 1 170 ? 75.372  -0.685  0.274   1.00 0.00 ? 170 SER A O    1  
ATOM 2476  C CB   . SER A 1 170 ? 77.986  -2.175  1.985   1.00 0.00 ? 170 SER A CB   1  
ATOM 2477  O OG   . SER A 1 170 ? 79.406  -2.135  1.927   1.00 0.00 ? 170 SER A OG   1  
ATOM 2478  H H    . SER A 1 170 ? 78.333  0.009   0.665   1.00 0.00 ? 170 SER A H    1  
ATOM 2479  H HA   . SER A 1 170 ? 77.629  -2.737  -0.046  1.00 0.00 ? 170 SER A HA   1  
ATOM 2480  H HB2  . SER A 1 170 ? 77.639  -1.428  2.679   1.00 0.00 ? 170 SER A HB2  1  
ATOM 2481  H HB3  . SER A 1 170 ? 77.657  -3.151  2.317   1.00 0.00 ? 170 SER A HB3  1  
ATOM 2482  H HG   . SER A 1 170 ? 79.722  -3.029  1.778   1.00 0.00 ? 170 SER A HG   1  
ATOM 2483  N N    . HIS A 1 171 ? 75.228  -2.710  1.251   1.00 0.00 ? 171 HIS A N    1  
ATOM 2484  C CA   . HIS A 1 171 ? 73.769  -2.667  1.411   1.00 0.00 ? 171 HIS A CA   1  
ATOM 2485  C C    . HIS A 1 171 ? 73.398  -2.866  2.878   1.00 0.00 ? 171 HIS A C    1  
ATOM 2486  O O    . HIS A 1 171 ? 72.292  -3.302  3.198   1.00 0.00 ? 171 HIS A O    1  
ATOM 2487  C CB   . HIS A 1 171 ? 73.125  -3.761  0.548   1.00 0.00 ? 171 HIS A CB   1  
ATOM 2488  C CG   . HIS A 1 171 ? 73.838  -3.838  -0.774  1.00 0.00 ? 171 HIS A CG   1  
ATOM 2489  N ND1  . HIS A 1 171 ? 74.325  -2.713  -1.418  1.00 0.00 ? 171 HIS A ND1  1  
ATOM 2490  C CD2  . HIS A 1 171 ? 74.155  -4.901  -1.584  1.00 0.00 ? 171 HIS A CD2  1  
ATOM 2491  C CE1  . HIS A 1 171 ? 74.905  -3.119  -2.563  1.00 0.00 ? 171 HIS A CE1  1  
ATOM 2492  N NE2  . HIS A 1 171 ? 74.829  -4.444  -2.713  1.00 0.00 ? 171 HIS A NE2  1  
ATOM 2493  H H    . HIS A 1 171 ? 75.716  -3.500  1.565   1.00 0.00 ? 171 HIS A H    1  
ATOM 2494  H HA   . HIS A 1 171 ? 73.392  -1.704  1.089   1.00 0.00 ? 171 HIS A HA   1  
ATOM 2495  H HB2  . HIS A 1 171 ? 73.202  -4.712  1.050   1.00 0.00 ? 171 HIS A HB2  1  
ATOM 2496  H HB3  . HIS A 1 171 ? 72.084  -3.527  0.381   1.00 0.00 ? 171 HIS A HB3  1  
ATOM 2497  H HD1  . HIS A 1 171 ? 74.261  -1.788  -1.099  1.00 0.00 ? 171 HIS A HD1  1  
ATOM 2498  H HD2  . HIS A 1 171 ? 73.861  -5.926  -1.408  1.00 0.00 ? 171 HIS A HD2  1  
ATOM 2499  H HE1  . HIS A 1 171 ? 75.374  -2.455  -3.274  1.00 0.00 ? 171 HIS A HE1  1  
ATOM 2500  N N    . LYS A 1 172 ? 74.336  -2.543  3.764   1.00 0.00 ? 172 LYS A N    1  
ATOM 2501  C CA   . LYS A 1 172 ? 74.107  -2.686  5.198   1.00 0.00 ? 172 LYS A CA   1  
ATOM 2502  C C    . LYS A 1 172 ? 72.899  -1.863  5.632   1.00 0.00 ? 172 LYS A C    1  
ATOM 2503  O O    . LYS A 1 172 ? 72.125  -1.394  4.798   1.00 0.00 ? 172 LYS A O    1  
ATOM 2504  C CB   . LYS A 1 172 ? 75.345  -2.225  5.970   1.00 0.00 ? 172 LYS A CB   1  
ATOM 2505  C CG   . LYS A 1 172 ? 76.566  -3.024  5.504   1.00 0.00 ? 172 LYS A CG   1  
ATOM 2506  C CD   . LYS A 1 172 ? 77.746  -2.772  6.451   1.00 0.00 ? 172 LYS A CD   1  
ATOM 2507  C CE   . LYS A 1 172 ? 78.154  -1.289  6.417   1.00 0.00 ? 172 LYS A CE   1  
ATOM 2508  N NZ   . LYS A 1 172 ? 77.263  -0.507  7.321   1.00 0.00 ? 172 LYS A NZ   1  
ATOM 2509  H H    . LYS A 1 172 ? 75.197  -2.200  3.448   1.00 0.00 ? 172 LYS A H    1  
ATOM 2510  H HA   . LYS A 1 172 ? 73.923  -3.726  5.422   1.00 0.00 ? 172 LYS A HA   1  
ATOM 2511  H HB2  . LYS A 1 172 ? 75.509  -1.174  5.786   1.00 0.00 ? 172 LYS A HB2  1  
ATOM 2512  H HB3  . LYS A 1 172 ? 75.192  -2.388  7.027   1.00 0.00 ? 172 LYS A HB3  1  
ATOM 2513  H HG2  . LYS A 1 172 ? 76.327  -4.078  5.503   1.00 0.00 ? 172 LYS A HG2  1  
ATOM 2514  H HG3  . LYS A 1 172 ? 76.836  -2.717  4.506   1.00 0.00 ? 172 LYS A HG3  1  
ATOM 2515  H HD2  . LYS A 1 172 ? 77.459  -3.039  7.458   1.00 0.00 ? 172 LYS A HD2  1  
ATOM 2516  H HD3  . LYS A 1 172 ? 78.584  -3.381  6.145   1.00 0.00 ? 172 LYS A HD3  1  
ATOM 2517  H HE2  . LYS A 1 172 ? 79.177  -1.189  6.755   1.00 0.00 ? 172 LYS A HE2  1  
ATOM 2518  H HE3  . LYS A 1 172 ? 78.073  -0.906  5.410   1.00 0.00 ? 172 LYS A HE3  1  
ATOM 2519  H HZ1  . LYS A 1 172 ? 76.530  -1.132  7.710   1.00 0.00 ? 172 LYS A HZ1  1  
ATOM 2520  H HZ2  . LYS A 1 172 ? 76.814  0.262   6.782   1.00 0.00 ? 172 LYS A HZ2  1  
ATOM 2521  H HZ3  . LYS A 1 172 ? 77.823  -0.106  8.098   1.00 0.00 ? 172 LYS A HZ3  1  
ATOM 2522  N N    . LYS A 1 173 ? 72.743  -1.689  6.945   1.00 0.00 ? 173 LYS A N    1  
ATOM 2523  C CA   . LYS A 1 173 ? 71.625  -0.920  7.498   1.00 0.00 ? 173 LYS A CA   1  
ATOM 2524  C C    . LYS A 1 173 ? 72.081  0.477   7.909   1.00 0.00 ? 173 LYS A C    1  
ATOM 2525  O O    . LYS A 1 173 ? 72.998  0.628   8.717   1.00 0.00 ? 173 LYS A O    1  
ATOM 2526  C CB   . LYS A 1 173 ? 71.052  -1.652  8.716   1.00 0.00 ? 173 LYS A CB   1  
ATOM 2527  C CG   . LYS A 1 173 ? 70.849  -3.133  8.376   1.00 0.00 ? 173 LYS A CG   1  
ATOM 2528  C CD   . LYS A 1 173 ? 69.990  -3.804  9.455   1.00 0.00 ? 173 LYS A CD   1  
ATOM 2529  C CE   . LYS A 1 173 ? 70.664  -3.672  10.827  1.00 0.00 ? 173 LYS A CE   1  
ATOM 2530  N NZ   . LYS A 1 173 ? 70.079  -4.673  11.762  1.00 0.00 ? 173 LYS A NZ   1  
ATOM 2531  H H    . LYS A 1 173 ? 73.394  -2.088  7.561   1.00 0.00 ? 173 LYS A H    1  
ATOM 2532  H HA   . LYS A 1 173 ? 70.845  -0.827  6.756   1.00 0.00 ? 173 LYS A HA   1  
ATOM 2533  H HB2  . LYS A 1 173 ? 71.742  -1.563  9.544   1.00 0.00 ? 173 LYS A HB2  1  
ATOM 2534  H HB3  . LYS A 1 173 ? 70.104  -1.211  8.988   1.00 0.00 ? 173 LYS A HB3  1  
ATOM 2535  H HG2  . LYS A 1 173 ? 70.352  -3.218  7.419   1.00 0.00 ? 173 LYS A HG2  1  
ATOM 2536  H HG3  . LYS A 1 173 ? 71.809  -3.624  8.327   1.00 0.00 ? 173 LYS A HG3  1  
ATOM 2537  H HD2  . LYS A 1 173 ? 69.018  -3.331  9.485   1.00 0.00 ? 173 LYS A HD2  1  
ATOM 2538  H HD3  . LYS A 1 173 ? 69.871  -4.850  9.216   1.00 0.00 ? 173 LYS A HD3  1  
ATOM 2539  H HE2  . LYS A 1 173 ? 71.727  -3.850  10.731  1.00 0.00 ? 173 LYS A HE2  1  
ATOM 2540  H HE3  . LYS A 1 173 ? 70.499  -2.678  11.216  1.00 0.00 ? 173 LYS A HE3  1  
ATOM 2541  H HZ1  . LYS A 1 173 ? 69.042  -4.599  11.744  1.00 0.00 ? 173 LYS A HZ1  1  
ATOM 2542  H HZ2  . LYS A 1 173 ? 70.425  -4.489  12.726  1.00 0.00 ? 173 LYS A HZ2  1  
ATOM 2543  H HZ3  . LYS A 1 173 ? 70.363  -5.629  11.469  1.00 0.00 ? 173 LYS A HZ3  1  
ATOM 2544  N N    . VAL A 1 174 ? 71.434  1.499   7.346   1.00 0.00 ? 174 VAL A N    1  
ATOM 2545  C CA   . VAL A 1 174 ? 71.772  2.893   7.652   1.00 0.00 ? 174 VAL A CA   1  
ATOM 2546  C C    . VAL A 1 174 ? 70.501  3.733   7.764   1.00 0.00 ? 174 VAL A C    1  
ATOM 2547  O O    . VAL A 1 174 ? 69.395  3.196   7.805   1.00 0.00 ? 174 VAL A O    1  
ATOM 2548  C CB   . VAL A 1 174 ? 72.671  3.492   6.554   1.00 0.00 ? 174 VAL A CB   1  
ATOM 2549  C CG1  . VAL A 1 174 ? 74.045  2.822   6.599   1.00 0.00 ? 174 VAL A CG1  1  
ATOM 2550  C CG2  . VAL A 1 174 ? 72.034  3.250   5.183   1.00 0.00 ? 174 VAL A CG2  1  
ATOM 2551  H H    . VAL A 1 174 ? 70.714  1.313   6.707   1.00 0.00 ? 174 VAL A H    1  
ATOM 2552  H HA   . VAL A 1 174 ? 72.299  2.939   8.597   1.00 0.00 ? 174 VAL A HA   1  
ATOM 2553  H HB   . VAL A 1 174 ? 72.786  4.554   6.719   1.00 0.00 ? 174 VAL A HB   1  
ATOM 2554  H HG11 . VAL A 1 174 ? 74.697  3.288   5.875   1.00 0.00 ? 174 VAL A HG11 1  
ATOM 2555  H HG12 . VAL A 1 174 ? 73.942  1.772   6.368   1.00 0.00 ? 174 VAL A HG12 1  
ATOM 2556  H HG13 . VAL A 1 174 ? 74.468  2.933   7.587   1.00 0.00 ? 174 VAL A HG13 1  
ATOM 2557  H HG21 . VAL A 1 174 ? 72.624  3.736   4.422   1.00 0.00 ? 174 VAL A HG21 1  
ATOM 2558  H HG22 . VAL A 1 174 ? 71.033  3.653   5.175   1.00 0.00 ? 174 VAL A HG22 1  
ATOM 2559  H HG23 . VAL A 1 174 ? 71.997  2.188   4.987   1.00 0.00 ? 174 VAL A HG23 1  
ATOM 2560  N N    . SER A 1 175 ? 70.668  5.052   7.812   1.00 0.00 ? 175 SER A N    1  
ATOM 2561  C CA   . SER A 1 175 ? 69.525  5.954   7.920   1.00 0.00 ? 175 SER A CA   1  
ATOM 2562  C C    . SER A 1 175 ? 68.468  5.606   6.871   1.00 0.00 ? 175 SER A C    1  
ATOM 2563  O O    . SER A 1 175 ? 68.792  5.126   5.785   1.00 0.00 ? 175 SER A O    1  
ATOM 2564  C CB   . SER A 1 175 ? 69.991  7.401   7.742   1.00 0.00 ? 175 SER A CB   1  
ATOM 2565  O OG   . SER A 1 175 ? 70.649  7.829   8.928   1.00 0.00 ? 175 SER A OG   1  
ATOM 2566  H H    . SER A 1 175 ? 71.573  5.423   7.774   1.00 0.00 ? 175 SER A H    1  
ATOM 2567  H HA   . SER A 1 175 ? 69.089  5.848   8.902   1.00 0.00 ? 175 SER A HA   1  
ATOM 2568  H HB2  . SER A 1 175 ? 70.680  7.459   6.918   1.00 0.00 ? 175 SER A HB2  1  
ATOM 2569  H HB3  . SER A 1 175 ? 69.139  8.040   7.543   1.00 0.00 ? 175 SER A HB3  1  
ATOM 2570  H HG   . SER A 1 175 ? 70.031  7.743   9.657   1.00 0.00 ? 175 SER A HG   1  
ATOM 2571  N N    . TYR A 1 176 ? 67.199  5.840   7.213   1.00 0.00 ? 176 TYR A N    1  
ATOM 2572  C CA   . TYR A 1 176 ? 66.085  5.540   6.306   1.00 0.00 ? 176 TYR A CA   1  
ATOM 2573  C C    . TYR A 1 176 ? 65.623  6.792   5.562   1.00 0.00 ? 176 TYR A C    1  
ATOM 2574  O O    . TYR A 1 176 ? 65.428  7.848   6.165   1.00 0.00 ? 176 TYR A O    1  
ATOM 2575  C CB   . TYR A 1 176 ? 64.913  4.968   7.108   1.00 0.00 ? 176 TYR A CB   1  
ATOM 2576  C CG   . TYR A 1 176 ? 64.407  6.011   8.080   1.00 0.00 ? 176 TYR A CG   1  
ATOM 2577  C CD1  . TYR A 1 176 ? 64.959  6.094   9.377   1.00 0.00 ? 176 TYR A CD1  1  
ATOM 2578  C CD2  . TYR A 1 176 ? 63.383  6.900   7.688   1.00 0.00 ? 176 TYR A CD2  1  
ATOM 2579  C CE1  . TYR A 1 176 ? 64.486  7.070   10.282  1.00 0.00 ? 176 TYR A CE1  1  
ATOM 2580  C CE2  . TYR A 1 176 ? 62.911  7.875   8.594   1.00 0.00 ? 176 TYR A CE2  1  
ATOM 2581  C CZ   . TYR A 1 176 ? 63.462  7.960   9.892   1.00 0.00 ? 176 TYR A CZ   1  
ATOM 2582  O OH   . TYR A 1 176 ? 63.113  9.009   10.718  1.00 0.00 ? 176 TYR A OH   1  
ATOM 2583  H H    . TYR A 1 176 ? 67.006  6.218   8.097   1.00 0.00 ? 176 TYR A H    1  
ATOM 2584  H HA   . TYR A 1 176 ? 66.397  4.800   5.581   1.00 0.00 ? 176 TYR A HA   1  
ATOM 2585  H HB2  . TYR A 1 176 ? 64.118  4.688   6.434   1.00 0.00 ? 176 TYR A HB2  1  
ATOM 2586  H HB3  . TYR A 1 176 ? 65.243  4.098   7.657   1.00 0.00 ? 176 TYR A HB3  1  
ATOM 2587  H HD1  . TYR A 1 176 ? 65.742  5.414   9.676   1.00 0.00 ? 176 TYR A HD1  1  
ATOM 2588  H HD2  . TYR A 1 176 ? 62.962  6.834   6.697   1.00 0.00 ? 176 TYR A HD2  1  
ATOM 2589  H HE1  . TYR A 1 176 ? 64.908  7.135   11.274  1.00 0.00 ? 176 TYR A HE1  1  
ATOM 2590  H HE2  . TYR A 1 176 ? 62.128  8.555   8.295   1.00 0.00 ? 176 TYR A HE2  1  
ATOM 2591  H HH   . TYR A 1 176 ? 63.354  9.828   10.276  1.00 0.00 ? 176 TYR A HH   1  
ATOM 2592  N N    . GLU A 1 177 ? 65.438  6.660   4.247   1.00 0.00 ? 177 GLU A N    1  
ATOM 2593  C CA   . GLU A 1 177 ? 64.985  7.775   3.409   1.00 0.00 ? 177 GLU A CA   1  
ATOM 2594  C C    . GLU A 1 177 ? 64.041  7.247   2.333   1.00 0.00 ? 177 GLU A C    1  
ATOM 2595  O O    . GLU A 1 177 ? 64.334  6.251   1.681   1.00 0.00 ? 177 GLU A O    1  
ATOM 2596  C CB   . GLU A 1 177 ? 66.188  8.461   2.755   1.00 0.00 ? 177 GLU A CB   1  
ATOM 2597  C CG   . GLU A 1 177 ? 65.746  9.762   2.075   1.00 0.00 ? 177 GLU A CG   1  
ATOM 2598  C CD   . GLU A 1 177 ? 65.372  10.798  3.137   1.00 0.00 ? 177 GLU A CD   1  
ATOM 2599  O OE1  . GLU A 1 177 ? 66.270  11.296  3.794   1.00 0.00 ? 177 GLU A OE1  1  
ATOM 2600  O OE2  . GLU A 1 177 ? 64.192  11.076  3.276   1.00 0.00 ? 177 GLU A OE2  1  
ATOM 2601  H H    . GLU A 1 177 ? 65.607  5.791   3.825   1.00 0.00 ? 177 GLU A H    1  
ATOM 2602  H HA   . GLU A 1 177 ? 64.453  8.494   4.017   1.00 0.00 ? 177 GLU A HA   1  
ATOM 2603  H HB2  . GLU A 1 177 ? 66.927  8.685   3.510   1.00 0.00 ? 177 GLU A HB2  1  
ATOM 2604  H HB3  . GLU A 1 177 ? 66.620  7.801   2.017   1.00 0.00 ? 177 GLU A HB3  1  
ATOM 2605  H HG2  . GLU A 1 177 ? 66.556  10.144  1.472   1.00 0.00 ? 177 GLU A HG2  1  
ATOM 2606  H HG3  . GLU A 1 177 ? 64.890  9.570   1.445   1.00 0.00 ? 177 GLU A HG3  1  
ATOM 2607  N N    . ASP A 1 178 ? 62.902  7.909   2.164   1.00 0.00 ? 178 ASP A N    1  
ATOM 2608  C CA   . ASP A 1 178 ? 61.917  7.475   1.174   1.00 0.00 ? 178 ASP A CA   1  
ATOM 2609  C C    . ASP A 1 178 ? 62.377  7.786   -0.250  1.00 0.00 ? 178 ASP A C    1  
ATOM 2610  O O    . ASP A 1 178 ? 62.206  8.905   -0.735  1.00 0.00 ? 178 ASP A O    1  
ATOM 2611  C CB   . ASP A 1 178 ? 60.580  8.169   1.437   1.00 0.00 ? 178 ASP A CB   1  
ATOM 2612  C CG   . ASP A 1 178 ? 60.164  7.941   2.892   1.00 0.00 ? 178 ASP A CG   1  
ATOM 2613  O OD1  . ASP A 1 178 ? 60.825  8.476   3.767   1.00 0.00 ? 178 ASP A OD1  1  
ATOM 2614  O OD2  . ASP A 1 178 ? 59.193  7.235   3.107   1.00 0.00 ? 178 ASP A OD2  1  
ATOM 2615  H H    . ASP A 1 178 ? 62.712  8.692   2.721   1.00 0.00 ? 178 ASP A H    1  
ATOM 2616  H HA   . ASP A 1 178 ? 61.775  6.410   1.268   1.00 0.00 ? 178 ASP A HA   1  
ATOM 2617  H HB2  . ASP A 1 178 ? 60.682  9.229   1.253   1.00 0.00 ? 178 ASP A HB2  1  
ATOM 2618  H HB3  . ASP A 1 178 ? 59.826  7.760   0.782   1.00 0.00 ? 178 ASP A HB3  1  
ATOM 2619  N N    . ILE A 1 179 ? 62.947  6.780   -0.924  1.00 0.00 ? 179 ILE A N    1  
ATOM 2620  C CA   . ILE A 1 179 ? 63.415  6.940   -2.310  1.00 0.00 ? 179 ILE A CA   1  
ATOM 2621  C C    . ILE A 1 179 ? 62.489  6.190   -3.268  1.00 0.00 ? 179 ILE A C    1  
ATOM 2622  O O    . ILE A 1 179 ? 62.006  6.756   -4.249  1.00 0.00 ? 179 ILE A O    1  
ATOM 2623  C CB   . ILE A 1 179 ? 64.850  6.389   -2.481  1.00 0.00 ? 179 ILE A CB   1  
ATOM 2624  C CG1  . ILE A 1 179 ? 65.738  6.927   -1.350  1.00 0.00 ? 179 ILE A CG1  1  
ATOM 2625  C CG2  . ILE A 1 179 ? 65.421  6.830   -3.837  1.00 0.00 ? 179 ILE A CG2  1  
ATOM 2626  C CD1  . ILE A 1 179 ? 67.191  6.482   -1.558  1.00 0.00 ? 179 ILE A CD1  1  
ATOM 2627  H H    . ILE A 1 179 ? 63.045  5.908   -0.485  1.00 0.00 ? 179 ILE A H    1  
ATOM 2628  H HA   . ILE A 1 179 ? 63.415  7.990   -2.577  1.00 0.00 ? 179 ILE A HA   1  
ATOM 2629  H HB   . ILE A 1 179 ? 64.827  5.310   -2.438  1.00 0.00 ? 179 ILE A HB   1  
ATOM 2630  H HG12 . ILE A 1 179 ? 65.690  8.006   -1.340  1.00 0.00 ? 179 ILE A HG12 1  
ATOM 2631  H HG13 . ILE A 1 179 ? 65.380  6.546   -0.407  1.00 0.00 ? 179 ILE A HG13 1  
ATOM 2632  H HG21 . ILE A 1 179 ? 65.682  7.877   -3.798  1.00 0.00 ? 179 ILE A HG21 1  
ATOM 2633  H HG22 . ILE A 1 179 ? 64.685  6.672   -4.611  1.00 0.00 ? 179 ILE A HG22 1  
ATOM 2634  H HG23 . ILE A 1 179 ? 66.304  6.249   -4.061  1.00 0.00 ? 179 ILE A HG23 1  
ATOM 2635  H HD11 . ILE A 1 179 ? 67.652  7.096   -2.318  1.00 0.00 ? 179 ILE A HD11 1  
ATOM 2636  H HD12 . ILE A 1 179 ? 67.216  5.447   -1.867  1.00 0.00 ? 179 ILE A HD12 1  
ATOM 2637  H HD13 . ILE A 1 179 ? 67.737  6.591   -0.632  1.00 0.00 ? 179 ILE A HD13 1  
ATOM 2638  N N    . ILE A 1 180 ? 62.248  4.913   -2.979  1.00 0.00 ? 180 ILE A N    1  
ATOM 2639  C CA   . ILE A 1 180 ? 61.381  4.094   -3.824  1.00 0.00 ? 180 ILE A CA   1  
ATOM 2640  C C    . ILE A 1 180 ? 60.003  4.737   -3.967  1.00 0.00 ? 180 ILE A C    1  
ATOM 2641  O O    . ILE A 1 180 ? 59.258  4.860   -2.995  1.00 0.00 ? 180 ILE A O    1  
ATOM 2642  C CB   . ILE A 1 180 ? 61.225  2.665   -3.236  1.00 0.00 ? 180 ILE A CB   1  
ATOM 2643  C CG1  . ILE A 1 180 ? 62.580  1.912   -3.335  1.00 0.00 ? 180 ILE A CG1  1  
ATOM 2644  C CG2  . ILE A 1 180 ? 60.138  1.893   -4.012  1.00 0.00 ? 180 ILE A CG2  1  
ATOM 2645  C CD1  . ILE A 1 180 ? 62.693  0.858   -2.221  1.00 0.00 ? 180 ILE A CD1  1  
ATOM 2646  H H    . ILE A 1 180 ? 62.662  4.514   -2.185  1.00 0.00 ? 180 ILE A H    1  
ATOM 2647  H HA   . ILE A 1 180 ? 61.829  4.016   -4.803  1.00 0.00 ? 180 ILE A HA   1  
ATOM 2648  H HB   . ILE A 1 180 ? 60.927  2.747   -2.198  1.00 0.00 ? 180 ILE A HB   1  
ATOM 2649  H HG12 . ILE A 1 180 ? 62.657  1.422   -4.297  1.00 0.00 ? 180 ILE A HG12 1  
ATOM 2650  H HG13 . ILE A 1 180 ? 63.395  2.614   -3.234  1.00 0.00 ? 180 ILE A HG13 1  
ATOM 2651  H HG21 . ILE A 1 180 ? 60.267  2.058   -5.072  1.00 0.00 ? 180 ILE A HG21 1  
ATOM 2652  H HG22 . ILE A 1 180 ? 59.162  2.246   -3.710  1.00 0.00 ? 180 ILE A HG22 1  
ATOM 2653  H HG23 . ILE A 1 180 ? 60.216  0.839   -3.801  1.00 0.00 ? 180 ILE A HG23 1  
ATOM 2654  H HD11 . ILE A 1 180 ? 62.929  1.346   -1.286  1.00 0.00 ? 180 ILE A HD11 1  
ATOM 2655  H HD12 . ILE A 1 180 ? 63.478  0.158   -2.466  1.00 0.00 ? 180 ILE A HD12 1  
ATOM 2656  H HD13 . ILE A 1 180 ? 61.758  0.328   -2.122  1.00 0.00 ? 180 ILE A HD13 1  
ATOM 2657  N N    . GLY A 1 181 ? 59.670  5.131   -5.194  1.00 0.00 ? 181 GLY A N    1  
ATOM 2658  C CA   . GLY A 1 181 ? 58.381  5.744   -5.472  1.00 0.00 ? 181 GLY A CA   1  
ATOM 2659  C C    . GLY A 1 181 ? 57.297  4.697   -5.640  1.00 0.00 ? 181 GLY A C    1  
ATOM 2660  O O    . GLY A 1 181 ? 57.075  3.874   -4.752  1.00 0.00 ? 181 GLY A O    1  
ATOM 2661  H H    . GLY A 1 181 ? 60.305  4.996   -5.929  1.00 0.00 ? 181 GLY A H    1  
ATOM 2662  H HA2  . GLY A 1 181 ? 58.114  6.404   -4.658  1.00 0.00 ? 181 GLY A HA2  1  
ATOM 2663  H HA3  . GLY A 1 181 ? 58.456  6.321   -6.382  1.00 0.00 ? 181 GLY A HA3  1  
ATOM 2664  N N    . SER A 1 182 ? 56.618  4.728   -6.784  1.00 0.00 ? 182 SER A N    1  
ATOM 2665  C CA   . SER A 1 182 ? 55.552  3.768   -7.054  1.00 0.00 ? 182 SER A CA   1  
ATOM 2666  C C    . SER A 1 182 ? 56.130  2.402   -7.396  1.00 0.00 ? 182 SER A C    1  
ATOM 2667  O O    . SER A 1 182 ? 57.214  2.303   -7.970  1.00 0.00 ? 182 SER A O    1  
ATOM 2668  C CB   . SER A 1 182 ? 54.688  4.259   -8.213  1.00 0.00 ? 182 SER A CB   1  
ATOM 2669  O OG   . SER A 1 182 ? 53.748  3.249   -8.560  1.00 0.00 ? 182 SER A OG   1  
ATOM 2670  H H    . SER A 1 182 ? 56.837  5.409   -7.454  1.00 0.00 ? 182 SER A H    1  
ATOM 2671  H HA   . SER A 1 182 ? 54.936  3.672   -6.179  1.00 0.00 ? 182 SER A HA   1  
ATOM 2672  H HB2  . SER A 1 182 ? 54.159  5.148   -7.917  1.00 0.00 ? 182 SER A HB2  1  
ATOM 2673  H HB3  . SER A 1 182 ? 55.321  4.484   -9.062  1.00 0.00 ? 182 SER A HB3  1  
ATOM 2674  H HG   . SER A 1 182 ? 53.706  3.201   -9.517  1.00 0.00 ? 182 SER A HG   1  
ATOM 2675  N N    . THR A 1 183 ? 55.396  1.341   -7.042  1.00 0.00 ? 183 THR A N    1  
ATOM 2676  C CA   . THR A 1 183 ? 55.847  -0.026  -7.324  1.00 0.00 ? 183 THR A CA   1  
ATOM 2677  C C    . THR A 1 183 ? 54.670  -0.905  -7.728  1.00 0.00 ? 183 THR A C    1  
ATOM 2678  O O    . THR A 1 183 ? 54.073  -1.576  -6.891  1.00 0.00 ? 183 THR A O    1  
ATOM 2679  C CB   . THR A 1 183 ? 56.517  -0.647  -6.083  1.00 0.00 ? 183 THR A CB   1  
ATOM 2680  O OG1  . THR A 1 183 ? 55.532  -0.899  -5.092  1.00 0.00 ? 183 THR A OG1  1  
ATOM 2681  C CG2  . THR A 1 183 ? 57.565  0.320   -5.529  1.00 0.00 ? 183 THR A CG2  1  
ATOM 2682  H H    . THR A 1 183 ? 54.530  1.479   -6.587  1.00 0.00 ? 183 THR A H    1  
ATOM 2683  H HA   . THR A 1 183 ? 56.564  -0.014  -8.135  1.00 0.00 ? 183 THR A HA   1  
ATOM 2684  H HB   . THR A 1 183 ? 56.998  -1.573  -6.359  1.00 0.00 ? 183 THR A HB   1  
ATOM 2685  H HG1  . THR A 1 183 ? 55.362  -0.078  -4.626  1.00 0.00 ? 183 THR A HG1  1  
ATOM 2686  H HG21 . THR A 1 183 ? 57.082  1.233   -5.215  1.00 0.00 ? 183 THR A HG21 1  
ATOM 2687  H HG22 . THR A 1 183 ? 58.291  0.543   -6.297  1.00 0.00 ? 183 THR A HG22 1  
ATOM 2688  H HG23 . THR A 1 183 ? 58.062  -0.133  -4.684  1.00 0.00 ? 183 THR A HG23 1  
ATOM 2689  N N    . ILE A 1 184 ? 54.346  -0.912  -9.023  1.00 0.00 ? 184 ILE A N    1  
ATOM 2690  C CA   . ILE A 1 184 ? 53.237  -1.726  -9.533  1.00 0.00 ? 184 ILE A CA   1  
ATOM 2691  C C    . ILE A 1 184 ? 53.789  -3.015  -10.132 1.00 0.00 ? 184 ILE A C    1  
ATOM 2692  O O    . ILE A 1 184 ? 54.790  -2.995  -10.843 1.00 0.00 ? 184 ILE A O    1  
ATOM 2693  C CB   . ILE A 1 184 ? 52.448  -0.950  -10.614 1.00 0.00 ? 184 ILE A CB   1  
ATOM 2694  C CG1  . ILE A 1 184 ? 51.223  -1.758  -11.085 1.00 0.00 ? 184 ILE A CG1  1  
ATOM 2695  C CG2  . ILE A 1 184 ? 53.354  -0.672  -11.813 1.00 0.00 ? 184 ILE A CG2  1  
ATOM 2696  C CD1  . ILE A 1 184 ? 50.202  -1.922  -9.938  1.00 0.00 ? 184 ILE A CD1  1  
ATOM 2697  H H    . ILE A 1 184 ? 54.866  -0.370  -9.651  1.00 0.00 ? 184 ILE A H    1  
ATOM 2698  H HA   . ILE A 1 184 ? 52.566  -1.975  -8.723  1.00 0.00 ? 184 ILE A HA   1  
ATOM 2699  H HB   . ILE A 1 184 ? 52.118  -0.006  -10.200 1.00 0.00 ? 184 ILE A HB   1  
ATOM 2700  H HG12 . ILE A 1 184 ? 50.755  -1.234  -11.907 1.00 0.00 ? 184 ILE A HG12 1  
ATOM 2701  H HG13 . ILE A 1 184 ? 51.542  -2.733  -11.424 1.00 0.00 ? 184 ILE A HG13 1  
ATOM 2702  H HG21 . ILE A 1 184 ? 53.560  -1.596  -12.331 1.00 0.00 ? 184 ILE A HG21 1  
ATOM 2703  H HG22 . ILE A 1 184 ? 54.279  -0.235  -11.470 1.00 0.00 ? 184 ILE A HG22 1  
ATOM 2704  H HG23 . ILE A 1 184 ? 52.860  0.014   -12.485 1.00 0.00 ? 184 ILE A HG23 1  
ATOM 2705  H HD11 . ILE A 1 184 ? 50.199  -1.039  -9.315  1.00 0.00 ? 184 ILE A HD11 1  
ATOM 2706  H HD12 . ILE A 1 184 ? 50.461  -2.783  -9.339  1.00 0.00 ? 184 ILE A HD12 1  
ATOM 2707  H HD13 . ILE A 1 184 ? 49.216  -2.065  -10.355 1.00 0.00 ? 184 ILE A HD13 1  
ATOM 2708  N N    . VAL A 1 185 ? 53.147  -4.144  -9.820  1.00 0.00 ? 185 VAL A N    1  
ATOM 2709  C CA   . VAL A 1 185 ? 53.613  -5.442  -10.318 1.00 0.00 ? 185 VAL A CA   1  
ATOM 2710  C C    . VAL A 1 185 ? 52.440  -6.375  -10.640 1.00 0.00 ? 185 VAL A C    1  
ATOM 2711  O O    . VAL A 1 185 ? 51.558  -6.586  -9.808  1.00 0.00 ? 185 VAL A O    1  
ATOM 2712  C CB   . VAL A 1 185 ? 54.538  -6.109  -9.256  1.00 0.00 ? 185 VAL A CB   1  
ATOM 2713  C CG1  . VAL A 1 185 ? 55.388  -5.029  -8.572  1.00 0.00 ? 185 VAL A CG1  1  
ATOM 2714  C CG2  . VAL A 1 185 ? 53.706  -6.832  -8.176  1.00 0.00 ? 185 VAL A CG2  1  
ATOM 2715  H H    . VAL A 1 185 ? 52.364  -4.105  -9.232  1.00 0.00 ? 185 VAL A H    1  
ATOM 2716  H HA   . VAL A 1 185 ? 54.183  -5.292  -11.225 1.00 0.00 ? 185 VAL A HA   1  
ATOM 2717  H HB   . VAL A 1 185 ? 55.192  -6.818  -9.743  1.00 0.00 ? 185 VAL A HB   1  
ATOM 2718  H HG11 . VAL A 1 185 ? 54.749  -4.399  -7.971  1.00 0.00 ? 185 VAL A HG11 1  
ATOM 2719  H HG12 . VAL A 1 185 ? 55.884  -4.429  -9.317  1.00 0.00 ? 185 VAL A HG12 1  
ATOM 2720  H HG13 . VAL A 1 185 ? 56.126  -5.500  -7.940  1.00 0.00 ? 185 VAL A HG13 1  
ATOM 2721  H HG21 . VAL A 1 185 ? 54.331  -7.058  -7.322  1.00 0.00 ? 185 VAL A HG21 1  
ATOM 2722  H HG22 . VAL A 1 185 ? 53.311  -7.752  -8.580  1.00 0.00 ? 185 VAL A HG22 1  
ATOM 2723  H HG23 . VAL A 1 185 ? 52.890  -6.196  -7.865  1.00 0.00 ? 185 VAL A HG23 1  
ATOM 2724  N N    . ASP A 1 186 ? 52.459  -6.961  -11.839 1.00 0.00 ? 186 ASP A N    1  
ATOM 2725  C CA   . ASP A 1 186 ? 51.421  -7.899  -12.240 1.00 0.00 ? 186 ASP A CA   1  
ATOM 2726  C C    . ASP A 1 186 ? 51.753  -9.258  -11.651 1.00 0.00 ? 186 ASP A C    1  
ATOM 2727  O O    . ASP A 1 186 ? 52.466  -10.051 -12.262 1.00 0.00 ? 186 ASP A O    1  
ATOM 2728  C CB   . ASP A 1 186 ? 51.358  -7.996  -13.766 1.00 0.00 ? 186 ASP A CB   1  
ATOM 2729  C CG   . ASP A 1 186 ? 51.128  -6.603  -14.357 1.00 0.00 ? 186 ASP A CG   1  
ATOM 2730  O OD1  . ASP A 1 186 ? 50.001  -6.140  -14.310 1.00 0.00 ? 186 ASP A OD1  1  
ATOM 2731  O OD2  . ASP A 1 186 ? 52.084  -6.024  -14.847 1.00 0.00 ? 186 ASP A OD2  1  
ATOM 2732  H H    . ASP A 1 186 ? 53.194  -6.783  -12.449 1.00 0.00 ? 186 ASP A H    1  
ATOM 2733  H HA   . ASP A 1 186 ? 50.464  -7.567  -11.864 1.00 0.00 ? 186 ASP A HA   1  
ATOM 2734  H HB2  . ASP A 1 186 ? 52.289  -8.398  -14.139 1.00 0.00 ? 186 ASP A HB2  1  
ATOM 2735  H HB3  . ASP A 1 186 ? 50.545  -8.645  -14.053 1.00 0.00 ? 186 ASP A HB3  1  
ATOM 2736  N N    . THR A 1 187 ? 51.255  -9.509  -10.443 1.00 0.00 ? 187 THR A N    1  
ATOM 2737  C CA   . THR A 1 187 ? 51.537  -10.765 -9.753  1.00 0.00 ? 187 THR A CA   1  
ATOM 2738  C C    . THR A 1 187 ? 51.352  -11.944 -10.704 1.00 0.00 ? 187 THR A C    1  
ATOM 2739  O O    . THR A 1 187 ? 51.988  -12.985 -10.547 1.00 0.00 ? 187 THR A O    1  
ATOM 2740  C CB   . THR A 1 187 ? 50.619  -10.922 -8.502  1.00 0.00 ? 187 THR A CB   1  
ATOM 2741  O OG1  . THR A 1 187 ? 49.628  -9.907  -8.539  1.00 0.00 ? 187 THR A OG1  1  
ATOM 2742  C CG2  . THR A 1 187 ? 51.427  -10.769 -7.204  1.00 0.00 ? 187 THR A CG2  1  
ATOM 2743  H H    . THR A 1 187 ? 50.712  -8.827  -9.996  1.00 0.00 ? 187 THR A H    1  
ATOM 2744  H HA   . THR A 1 187 ? 52.568  -10.751 -9.438  1.00 0.00 ? 187 THR A HA   1  
ATOM 2745  H HB   . THR A 1 187 ? 50.143  -11.892 -8.505  1.00 0.00 ? 187 THR A HB   1  
ATOM 2746  H HG1  . THR A 1 187 ? 49.389  -9.692  -7.635  1.00 0.00 ? 187 THR A HG1  1  
ATOM 2747  H HG21 . THR A 1 187 ? 51.983  -9.843  -7.234  1.00 0.00 ? 187 THR A HG21 1  
ATOM 2748  H HG22 . THR A 1 187 ? 52.112  -11.597 -7.106  1.00 0.00 ? 187 THR A HG22 1  
ATOM 2749  H HG23 . THR A 1 187 ? 50.753  -10.756 -6.360  1.00 0.00 ? 187 THR A HG23 1  
ATOM 2750  N N    . LYS A 1 188 ? 50.496  -11.767 -11.696 1.00 0.00 ? 188 LYS A N    1  
ATOM 2751  C CA   . LYS A 1 188 ? 50.263  -12.823 -12.677 1.00 0.00 ? 188 LYS A CA   1  
ATOM 2752  C C    . LYS A 1 188 ? 51.592  -13.440 -13.139 1.00 0.00 ? 188 LYS A C    1  
ATOM 2753  O O    . LYS A 1 188 ? 51.606  -14.527 -13.716 1.00 0.00 ? 188 LYS A O    1  
ATOM 2754  C CB   . LYS A 1 188 ? 49.509  -12.262 -13.884 1.00 0.00 ? 188 LYS A CB   1  
ATOM 2755  C CG   . LYS A 1 188 ? 48.213  -11.596 -13.411 1.00 0.00 ? 188 LYS A CG   1  
ATOM 2756  C CD   . LYS A 1 188 ? 47.470  -10.981 -14.611 1.00 0.00 ? 188 LYS A CD   1  
ATOM 2757  C CE   . LYS A 1 188 ? 46.839  -12.078 -15.483 1.00 0.00 ? 188 LYS A CE   1  
ATOM 2758  N NZ   . LYS A 1 188 ? 45.782  -11.473 -16.342 1.00 0.00 ? 188 LYS A NZ   1  
ATOM 2759  H H    . LYS A 1 188 ? 50.019  -10.909 -11.772 1.00 0.00 ? 188 LYS A H    1  
ATOM 2760  H HA   . LYS A 1 188 ? 49.662  -13.595 -12.219 1.00 0.00 ? 188 LYS A HA   1  
ATOM 2761  H HB2  . LYS A 1 188 ? 50.127  -11.534 -14.389 1.00 0.00 ? 188 LYS A HB2  1  
ATOM 2762  H HB3  . LYS A 1 188 ? 49.273  -13.067 -14.561 1.00 0.00 ? 188 LYS A HB3  1  
ATOM 2763  H HG2  . LYS A 1 188 ? 47.586  -12.330 -12.929 1.00 0.00 ? 188 LYS A HG2  1  
ATOM 2764  H HG3  . LYS A 1 188 ? 48.452  -10.815 -12.706 1.00 0.00 ? 188 LYS A HG3  1  
ATOM 2765  H HD2  . LYS A 1 188 ? 46.693  -10.325 -14.247 1.00 0.00 ? 188 LYS A HD2  1  
ATOM 2766  H HD3  . LYS A 1 188 ? 48.167  -10.409 -15.206 1.00 0.00 ? 188 LYS A HD3  1  
ATOM 2767  H HE2  . LYS A 1 188 ? 47.596  -12.524 -16.111 1.00 0.00 ? 188 LYS A HE2  1  
ATOM 2768  H HE3  . LYS A 1 188 ? 46.396  -12.839 -14.857 1.00 0.00 ? 188 LYS A HE3  1  
ATOM 2769  H HZ1  . LYS A 1 188 ? 45.523  -12.141 -17.096 1.00 0.00 ? 188 LYS A HZ1  1  
ATOM 2770  H HZ2  . LYS A 1 188 ? 46.142  -10.594 -16.766 1.00 0.00 ? 188 LYS A HZ2  1  
ATOM 2771  H HZ3  . LYS A 1 188 ? 44.944  -11.263 -15.766 1.00 0.00 ? 188 LYS A HZ3  1  
ATOM 2772  N N    . CYS A 1 189 ? 52.711  -12.738 -12.888 1.00 0.00 ? 189 CYS A N    1  
ATOM 2773  C CA   . CYS A 1 189 ? 54.032  -13.241 -13.295 1.00 0.00 ? 189 CYS A CA   1  
ATOM 2774  C C    . CYS A 1 189 ? 55.120  -12.892 -12.270 1.00 0.00 ? 189 CYS A C    1  
ATOM 2775  O O    . CYS A 1 189 ? 56.302  -12.836 -12.612 1.00 0.00 ? 189 CYS A O    1  
ATOM 2776  C CB   . CYS A 1 189 ? 54.399  -12.656 -14.661 1.00 0.00 ? 189 CYS A CB   1  
ATOM 2777  S SG   . CYS A 1 189 ? 53.439  -13.490 -15.948 1.00 0.00 ? 189 CYS A SG   1  
ATOM 2778  H H    . CYS A 1 189 ? 52.647  -11.866 -12.429 1.00 0.00 ? 189 CYS A H    1  
ATOM 2779  H HA   . CYS A 1 189 ? 53.990  -14.319 -13.388 1.00 0.00 ? 189 CYS A HA   1  
ATOM 2780  H HB2  . CYS A 1 189 ? 54.176  -11.600 -14.670 1.00 0.00 ? 189 CYS A HB2  1  
ATOM 2781  H HB3  . CYS A 1 189 ? 55.451  -12.801 -14.852 1.00 0.00 ? 189 CYS A HB3  1  
ATOM 2782  N N    . VAL A 1 190 ? 54.728  -12.680 -11.015 1.00 0.00 ? 190 VAL A N    1  
ATOM 2783  C CA   . VAL A 1 190 ? 55.700  -12.366 -9.963  1.00 0.00 ? 190 VAL A CA   1  
ATOM 2784  C C    . VAL A 1 190 ? 55.069  -12.560 -8.581  1.00 0.00 ? 190 VAL A C    1  
ATOM 2785  O O    . VAL A 1 190 ? 54.263  -11.753 -8.124  1.00 0.00 ? 190 VAL A O    1  
ATOM 2786  C CB   . VAL A 1 190 ? 56.260  -10.927 -10.109 1.00 0.00 ? 190 VAL A CB   1  
ATOM 2787  C CG1  . VAL A 1 190 ? 55.120  -9.907  -10.223 1.00 0.00 ? 190 VAL A CG1  1  
ATOM 2788  C CG2  . VAL A 1 190 ? 57.150  -10.583 -8.903  1.00 0.00 ? 190 VAL A CG2  1  
ATOM 2789  H H    . VAL A 1 190 ? 53.779  -12.752 -10.788 1.00 0.00 ? 190 VAL A H    1  
ATOM 2790  H HA   . VAL A 1 190 ? 56.524  -13.059 -10.051 1.00 0.00 ? 190 VAL A HA   1  
ATOM 2791  H HB   . VAL A 1 190 ? 56.858  -10.881 -11.009 1.00 0.00 ? 190 VAL A HB   1  
ATOM 2792  H HG11 . VAL A 1 190 ? 54.686  -9.726  -9.252  1.00 0.00 ? 190 VAL A HG11 1  
ATOM 2793  H HG12 . VAL A 1 190 ? 54.365  -10.287 -10.889 1.00 0.00 ? 190 VAL A HG12 1  
ATOM 2794  H HG13 . VAL A 1 190 ? 55.509  -8.982  -10.619 1.00 0.00 ? 190 VAL A HG13 1  
ATOM 2795  H HG21 . VAL A 1 190 ? 57.861  -11.380 -8.743  1.00 0.00 ? 190 VAL A HG21 1  
ATOM 2796  H HG22 . VAL A 1 190 ? 56.541  -10.463 -8.019  1.00 0.00 ? 190 VAL A HG22 1  
ATOM 2797  H HG23 . VAL A 1 190 ? 57.680  -9.663  -9.100  1.00 0.00 ? 190 VAL A HG23 1  
ATOM 2798  N N    . LYS A 1 191 ? 55.442  -13.660 -7.935  1.00 0.00 ? 191 LYS A N    1  
ATOM 2799  C CA   . LYS A 1 191 ? 54.913  -13.996 -6.613  1.00 0.00 ? 191 LYS A CA   1  
ATOM 2800  C C    . LYS A 1 191 ? 55.484  -13.078 -5.531  1.00 0.00 ? 191 LYS A C    1  
ATOM 2801  O O    . LYS A 1 191 ? 54.735  -12.423 -4.806  1.00 0.00 ? 191 LYS A O    1  
ATOM 2802  C CB   . LYS A 1 191 ? 55.251  -15.454 -6.280  1.00 0.00 ? 191 LYS A CB   1  
ATOM 2803  C CG   . LYS A 1 191 ? 54.415  -15.922 -5.080  1.00 0.00 ? 191 LYS A CG   1  
ATOM 2804  C CD   . LYS A 1 191 ? 54.955  -17.256 -4.555  1.00 0.00 ? 191 LYS A CD   1  
ATOM 2805  C CE   . LYS A 1 191 ? 54.274  -17.595 -3.227  1.00 0.00 ? 191 LYS A CE   1  
ATOM 2806  N NZ   . LYS A 1 191 ? 54.754  -16.661 -2.171  1.00 0.00 ? 191 LYS A NZ   1  
ATOM 2807  H H    . LYS A 1 191 ? 56.081  -14.265 -8.368  1.00 0.00 ? 191 LYS A H    1  
ATOM 2808  H HA   . LYS A 1 191 ? 53.840  -13.884 -6.634  1.00 0.00 ? 191 LYS A HA   1  
ATOM 2809  H HB2  . LYS A 1 191 ? 55.030  -16.076 -7.135  1.00 0.00 ? 191 LYS A HB2  1  
ATOM 2810  H HB3  . LYS A 1 191 ? 56.301  -15.532 -6.041  1.00 0.00 ? 191 LYS A HB3  1  
ATOM 2811  H HG2  . LYS A 1 191 ? 54.462  -15.181 -4.297  1.00 0.00 ? 191 LYS A HG2  1  
ATOM 2812  H HG3  . LYS A 1 191 ? 53.388  -16.051 -5.388  1.00 0.00 ? 191 LYS A HG3  1  
ATOM 2813  H HD2  . LYS A 1 191 ? 54.753  -18.036 -5.274  1.00 0.00 ? 191 LYS A HD2  1  
ATOM 2814  H HD3  . LYS A 1 191 ? 56.021  -17.180 -4.397  1.00 0.00 ? 191 LYS A HD3  1  
ATOM 2815  H HE2  . LYS A 1 191 ? 53.204  -17.497 -3.336  1.00 0.00 ? 191 LYS A HE2  1  
ATOM 2816  H HE3  . LYS A 1 191 ? 54.515  -18.610 -2.948  1.00 0.00 ? 191 LYS A HE3  1  
ATOM 2817  H HZ1  . LYS A 1 191 ? 54.653  -15.681 -2.501  1.00 0.00 ? 191 LYS A HZ1  1  
ATOM 2818  H HZ2  . LYS A 1 191 ? 55.756  -16.858 -1.964  1.00 0.00 ? 191 LYS A HZ2  1  
ATOM 2819  H HZ3  . LYS A 1 191 ? 54.191  -16.794 -1.308  1.00 0.00 ? 191 LYS A HZ3  1  
ATOM 2820  N N    . ASN A 1 192 ? 56.816  -13.037 -5.425  1.00 0.00 ? 192 ASN A N    1  
ATOM 2821  C CA   . ASN A 1 192 ? 57.495  -12.198 -4.424  1.00 0.00 ? 192 ASN A CA   1  
ATOM 2822  C C    . ASN A 1 192 ? 58.512  -11.287 -5.102  1.00 0.00 ? 192 ASN A C    1  
ATOM 2823  O O    . ASN A 1 192 ? 59.188  -11.695 -6.047  1.00 0.00 ? 192 ASN A O    1  
ATOM 2824  C CB   . ASN A 1 192 ? 58.208  -13.082 -3.389  1.00 0.00 ? 192 ASN A CB   1  
ATOM 2825  C CG   . ASN A 1 192 ? 57.282  -14.220 -2.960  1.00 0.00 ? 192 ASN A CG   1  
ATOM 2826  O OD1  . ASN A 1 192 ? 56.077  -14.073 -2.966  1.00 0.00 ? 192 ASN A OD1  1  
ATOM 2827  N ND2  . ASN A 1 192 ? 57.799  -15.358 -2.585  1.00 0.00 ? 192 ASN A ND2  1  
ATOM 2828  H H    . ASN A 1 192 ? 57.355  -13.580 -6.035  1.00 0.00 ? 192 ASN A H    1  
ATOM 2829  H HA   . ASN A 1 192 ? 56.769  -11.583 -3.909  1.00 0.00 ? 192 ASN A HA   1  
ATOM 2830  H HB2  . ASN A 1 192 ? 59.108  -13.495 -3.822  1.00 0.00 ? 192 ASN A HB2  1  
ATOM 2831  H HB3  . ASN A 1 192 ? 58.466  -12.487 -2.526  1.00 0.00 ? 192 ASN A HB3  1  
ATOM 2832  H HD21 . ASN A 1 192 ? 58.771  -15.477 -2.580  1.00 0.00 ? 192 ASN A HD21 1  
ATOM 2833  H HD22 . ASN A 1 192 ? 57.213  -16.094 -2.307  1.00 0.00 ? 192 ASN A HD22 1  
ATOM 2834  N N    . LEU A 1 193 ? 58.611  -10.044 -4.625  1.00 0.00 ? 193 LEU A N    1  
ATOM 2835  C CA   . LEU A 1 193 ? 59.546  -9.077  -5.209  1.00 0.00 ? 193 LEU A CA   1  
ATOM 2836  C C    . LEU A 1 193 ? 60.116  -8.153  -4.129  1.00 0.00 ? 193 LEU A C    1  
ATOM 2837  O O    . LEU A 1 193 ? 59.428  -7.260  -3.636  1.00 0.00 ? 193 LEU A O    1  
ATOM 2838  C CB   . LEU A 1 193 ? 58.804  -8.251  -6.280  1.00 0.00 ? 193 LEU A CB   1  
ATOM 2839  C CG   . LEU A 1 193 ? 59.775  -7.752  -7.359  1.00 0.00 ? 193 LEU A CG   1  
ATOM 2840  C CD1  . LEU A 1 193 ? 59.027  -6.824  -8.320  1.00 0.00 ? 193 LEU A CD1  1  
ATOM 2841  C CD2  . LEU A 1 193 ? 60.938  -6.990  -6.708  1.00 0.00 ? 193 LEU A CD2  1  
ATOM 2842  H H    . LEU A 1 193 ? 58.038  -9.767  -3.882  1.00 0.00 ? 193 LEU A H    1  
ATOM 2843  H HA   . LEU A 1 193 ? 60.366  -9.610  -5.675  1.00 0.00 ? 193 LEU A HA   1  
ATOM 2844  H HB2  . LEU A 1 193 ? 58.054  -8.874  -6.745  1.00 0.00 ? 193 LEU A HB2  1  
ATOM 2845  H HB3  . LEU A 1 193 ? 58.316  -7.402  -5.818  1.00 0.00 ? 193 LEU A HB3  1  
ATOM 2846  H HG   . LEU A 1 193 ? 60.159  -8.599  -7.907  1.00 0.00 ? 193 LEU A HG   1  
ATOM 2847  H HD11 . LEU A 1 193 ? 58.808  -5.890  -7.823  1.00 0.00 ? 193 LEU A HD11 1  
ATOM 2848  H HD12 . LEU A 1 193 ? 58.104  -7.292  -8.629  1.00 0.00 ? 193 LEU A HD12 1  
ATOM 2849  H HD13 . LEU A 1 193 ? 59.642  -6.634  -9.188  1.00 0.00 ? 193 LEU A HD13 1  
ATOM 2850  H HD21 . LEU A 1 193 ? 61.467  -6.429  -7.463  1.00 0.00 ? 193 LEU A HD21 1  
ATOM 2851  H HD22 . LEU A 1 193 ? 61.616  -7.691  -6.246  1.00 0.00 ? 193 LEU A HD22 1  
ATOM 2852  H HD23 . LEU A 1 193 ? 60.555  -6.312  -5.961  1.00 0.00 ? 193 LEU A HD23 1  
ATOM 2853  N N    . GLU A 1 194 ? 61.384  -8.363  -3.780  1.00 0.00 ? 194 GLU A N    1  
ATOM 2854  C CA   . GLU A 1 194 ? 62.049  -7.535  -2.768  1.00 0.00 ? 194 GLU A CA   1  
ATOM 2855  C C    . GLU A 1 194 ? 62.794  -6.385  -3.440  1.00 0.00 ? 194 GLU A C    1  
ATOM 2856  O O    . GLU A 1 194 ? 63.223  -6.501  -4.586  1.00 0.00 ? 194 GLU A O    1  
ATOM 2857  C CB   . GLU A 1 194 ? 63.038  -8.386  -1.967  1.00 0.00 ? 194 GLU A CB   1  
ATOM 2858  C CG   . GLU A 1 194 ? 62.351  -9.676  -1.513  1.00 0.00 ? 194 GLU A CG   1  
ATOM 2859  C CD   . GLU A 1 194 ? 63.292  -10.460 -0.597  1.00 0.00 ? 194 GLU A CD   1  
ATOM 2860  O OE1  . GLU A 1 194 ? 63.944  -9.836  0.225   1.00 0.00 ? 194 GLU A OE1  1  
ATOM 2861  O OE2  . GLU A 1 194 ? 63.346  -11.672 -0.732  1.00 0.00 ? 194 GLU A OE2  1  
ATOM 2862  H H    . GLU A 1 194 ? 61.888  -9.082  -4.216  1.00 0.00 ? 194 GLU A H    1  
ATOM 2863  H HA   . GLU A 1 194 ? 61.311  -7.128  -2.089  1.00 0.00 ? 194 GLU A HA   1  
ATOM 2864  H HB2  . GLU A 1 194 ? 63.888  -8.630  -2.587  1.00 0.00 ? 194 GLU A HB2  1  
ATOM 2865  H HB3  . GLU A 1 194 ? 63.371  -7.832  -1.102  1.00 0.00 ? 194 GLU A HB3  1  
ATOM 2866  H HG2  . GLU A 1 194 ? 61.446  -9.431  -0.977  1.00 0.00 ? 194 GLU A HG2  1  
ATOM 2867  H HG3  . GLU A 1 194 ? 62.107  -10.278 -2.376  1.00 0.00 ? 194 GLU A HG3  1  
ATOM 2868  N N    . PHE A 1 195 ? 62.944  -5.272  -2.719  1.00 0.00 ? 195 PHE A N    1  
ATOM 2869  C CA   . PHE A 1 195 ? 63.643  -4.097  -3.257  1.00 0.00 ? 195 PHE A CA   1  
ATOM 2870  C C    . PHE A 1 195 ? 64.503  -3.448  -2.169  1.00 0.00 ? 195 PHE A C    1  
ATOM 2871  O O    . PHE A 1 195 ? 64.072  -3.298  -1.026  1.00 0.00 ? 195 PHE A O    1  
ATOM 2872  C CB   . PHE A 1 195 ? 62.634  -3.048  -3.829  1.00 0.00 ? 195 PHE A CB   1  
ATOM 2873  C CG   . PHE A 1 195 ? 61.220  -3.604  -3.864  1.00 0.00 ? 195 PHE A CG   1  
ATOM 2874  C CD1  . PHE A 1 195 ? 60.583  -3.986  -2.662  1.00 0.00 ? 195 PHE A CD1  1  
ATOM 2875  C CD2  . PHE A 1 195 ? 60.527  -3.720  -5.092  1.00 0.00 ? 195 PHE A CD2  1  
ATOM 2876  C CE1  . PHE A 1 195 ? 59.263  -4.484  -2.688  1.00 0.00 ? 195 PHE A CE1  1  
ATOM 2877  C CE2  . PHE A 1 195 ? 59.208  -4.221  -5.115  1.00 0.00 ? 195 PHE A CE2  1  
ATOM 2878  C CZ   . PHE A 1 195 ? 58.573  -4.603  -3.915  1.00 0.00 ? 195 PHE A CZ   1  
ATOM 2879  H H    . PHE A 1 195 ? 62.580  -5.239  -1.810  1.00 0.00 ? 195 PHE A H    1  
ATOM 2880  H HA   . PHE A 1 195 ? 64.304  -4.417  -4.055  1.00 0.00 ? 195 PHE A HA   1  
ATOM 2881  H HB2  . PHE A 1 195 ? 62.633  -2.158  -3.211  1.00 0.00 ? 195 PHE A HB2  1  
ATOM 2882  H HB3  . PHE A 1 195 ? 62.934  -2.768  -4.831  1.00 0.00 ? 195 PHE A HB3  1  
ATOM 2883  H HD1  . PHE A 1 195 ? 61.109  -3.898  -1.722  1.00 0.00 ? 195 PHE A HD1  1  
ATOM 2884  H HD2  . PHE A 1 195 ? 61.007  -3.430  -6.015  1.00 0.00 ? 195 PHE A HD2  1  
ATOM 2885  H HE1  . PHE A 1 195 ? 58.779  -4.776  -1.767  1.00 0.00 ? 195 PHE A HE1  1  
ATOM 2886  H HE2  . PHE A 1 195 ? 58.681  -4.309  -6.054  1.00 0.00 ? 195 PHE A HE2  1  
ATOM 2887  H HZ   . PHE A 1 195 ? 57.509  -4.779  -3.911  1.00 0.00 ? 195 PHE A HZ   1  
ATOM 2888  N N    . SER A 1 196 ? 65.713  -3.047  -2.550  1.00 0.00 ? 196 SER A N    1  
ATOM 2889  C CA   . SER A 1 196 ? 66.638  -2.386  -1.627  1.00 0.00 ? 196 SER A CA   1  
ATOM 2890  C C    . SER A 1 196 ? 67.425  -1.318  -2.379  1.00 0.00 ? 196 SER A C    1  
ATOM 2891  O O    . SER A 1 196 ? 67.896  -1.555  -3.490  1.00 0.00 ? 196 SER A O    1  
ATOM 2892  C CB   . SER A 1 196 ? 67.595  -3.413  -1.006  1.00 0.00 ? 196 SER A CB   1  
ATOM 2893  O OG   . SER A 1 196 ? 66.878  -4.604  -0.713  1.00 0.00 ? 196 SER A OG   1  
ATOM 2894  H H    . SER A 1 196 ? 65.987  -3.181  -3.481  1.00 0.00 ? 196 SER A H    1  
ATOM 2895  H HA   . SER A 1 196 ? 66.075  -1.906  -0.835  1.00 0.00 ? 196 SER A HA   1  
ATOM 2896  H HB2  . SER A 1 196 ? 68.389  -3.641  -1.697  1.00 0.00 ? 196 SER A HB2  1  
ATOM 2897  H HB3  . SER A 1 196 ? 68.021  -3.006  -0.098  1.00 0.00 ? 196 SER A HB3  1  
ATOM 2898  H HG   . SER A 1 196 ? 65.959  -4.465  -0.955  1.00 0.00 ? 196 SER A HG   1  
ATOM 2899  N N    . VAL A 1 197 ? 67.567  -0.143  -1.769  1.00 0.00 ? 197 VAL A N    1  
ATOM 2900  C CA   . VAL A 1 197 ? 68.303  0.966   -2.387  1.00 0.00 ? 197 VAL A CA   1  
ATOM 2901  C C    . VAL A 1 197 ? 69.241  1.589   -1.366  1.00 0.00 ? 197 VAL A C    1  
ATOM 2902  O O    . VAL A 1 197 ? 69.055  1.422   -0.160  1.00 0.00 ? 197 VAL A O    1  
ATOM 2903  C CB   . VAL A 1 197 ? 67.333  2.052   -2.895  1.00 0.00 ? 197 VAL A CB   1  
ATOM 2904  C CG1  . VAL A 1 197 ? 68.093  3.099   -3.718  1.00 0.00 ? 197 VAL A CG1  1  
ATOM 2905  C CG2  . VAL A 1 197 ? 66.257  1.401   -3.768  1.00 0.00 ? 197 VAL A CG2  1  
ATOM 2906  H H    . VAL A 1 197 ? 67.173  -0.015  -0.881  1.00 0.00 ? 197 VAL A H    1  
ATOM 2907  H HA   . VAL A 1 197 ? 68.889  0.599   -3.220  1.00 0.00 ? 197 VAL A HA   1  
ATOM 2908  H HB   . VAL A 1 197 ? 66.867  2.534   -2.050  1.00 0.00 ? 197 VAL A HB   1  
ATOM 2909  H HG11 . VAL A 1 197 ? 67.387  3.727   -4.242  1.00 0.00 ? 197 VAL A HG11 1  
ATOM 2910  H HG12 . VAL A 1 197 ? 68.732  2.604   -4.435  1.00 0.00 ? 197 VAL A HG12 1  
ATOM 2911  H HG13 . VAL A 1 197 ? 68.692  3.709   -3.061  1.00 0.00 ? 197 VAL A HG13 1  
ATOM 2912  H HG21 . VAL A 1 197 ? 65.554  2.154   -4.093  1.00 0.00 ? 197 VAL A HG21 1  
ATOM 2913  H HG22 . VAL A 1 197 ? 65.738  0.646   -3.197  1.00 0.00 ? 197 VAL A HG22 1  
ATOM 2914  H HG23 . VAL A 1 197 ? 66.721  0.947   -4.630  1.00 0.00 ? 197 VAL A HG23 1  
ATOM 2915  N N    . ARG A 1 198 ? 70.247  2.307   -1.845  1.00 0.00 ? 198 ARG A N    1  
ATOM 2916  C CA   . ARG A 1 198 ? 71.197  2.946   -0.947  1.00 0.00 ? 198 ARG A CA   1  
ATOM 2917  C C    . ARG A 1 198 ? 72.132  3.871   -1.716  1.00 0.00 ? 198 ARG A C    1  
ATOM 2918  O O    . ARG A 1 198 ? 72.947  3.421   -2.523  1.00 0.00 ? 198 ARG A O    1  
ATOM 2919  C CB   . ARG A 1 198 ? 72.005  1.871   -0.197  1.00 0.00 ? 198 ARG A CB   1  
ATOM 2920  C CG   . ARG A 1 198 ? 73.182  2.513   0.577   1.00 0.00 ? 198 ARG A CG   1  
ATOM 2921  C CD   . ARG A 1 198 ? 73.585  1.623   1.758   1.00 0.00 ? 198 ARG A CD   1  
ATOM 2922  N NE   . ARG A 1 198 ? 74.846  2.141   2.363   1.00 0.00 ? 198 ARG A NE   1  
ATOM 2923  C CZ   . ARG A 1 198 ? 75.229  1.717   3.537   1.00 0.00 ? 198 ARG A CZ   1  
ATOM 2924  N NH1  . ARG A 1 198 ? 74.516  0.829   4.176   1.00 0.00 ? 198 ARG A NH1  1  
ATOM 2925  N NH2  . ARG A 1 198 ? 76.325  2.181   4.073   1.00 0.00 ? 198 ARG A NH2  1  
ATOM 2926  H H    . ARG A 1 198 ? 70.347  2.414   -2.814  1.00 0.00 ? 198 ARG A H    1  
ATOM 2927  H HA   . ARG A 1 198 ? 70.650  3.531   -0.223  1.00 0.00 ? 198 ARG A HA   1  
ATOM 2928  H HB2  . ARG A 1 198 ? 71.348  1.361   0.496   1.00 0.00 ? 198 ARG A HB2  1  
ATOM 2929  H HB3  . ARG A 1 198 ? 72.392  1.156   -0.909  1.00 0.00 ? 198 ARG A HB3  1  
ATOM 2930  H HG2  . ARG A 1 198 ? 74.027  2.628   -0.086  1.00 0.00 ? 198 ARG A HG2  1  
ATOM 2931  H HG3  . ARG A 1 198 ? 72.891  3.483   0.948   1.00 0.00 ? 198 ARG A HG3  1  
ATOM 2932  H HD2  . ARG A 1 198 ? 72.800  1.633   2.500   1.00 0.00 ? 198 ARG A HD2  1  
ATOM 2933  H HD3  . ARG A 1 198 ? 73.740  0.615   1.412   1.00 0.00 ? 198 ARG A HD3  1  
ATOM 2934  H HE   . ARG A 1 198 ? 75.387  2.800   1.879   1.00 0.00 ? 198 ARG A HE   1  
ATOM 2935  H HH11 . ARG A 1 198 ? 73.676  0.473   3.766   1.00 0.00 ? 198 ARG A HH11 1  
ATOM 2936  H HH12 . ARG A 1 198 ? 74.810  0.505   5.074   1.00 0.00 ? 198 ARG A HH12 1  
ATOM 2937  H HH21 . ARG A 1 198 ? 76.871  2.862   3.583   1.00 0.00 ? 198 ARG A HH21 1  
ATOM 2938  H HH22 . ARG A 1 198 ? 76.619  1.857   4.971   1.00 0.00 ? 198 ARG A HH22 1  
ATOM 2939  N N    . ILE A 1 199 ? 72.014  5.172   -1.446  1.00 0.00 ? 199 ILE A N    1  
ATOM 2940  C CA   . ILE A 1 199 ? 72.855  6.179   -2.096  1.00 0.00 ? 199 ILE A CA   1  
ATOM 2941  C C    . ILE A 1 199 ? 73.896  6.700   -1.107  1.00 0.00 ? 199 ILE A C    1  
ATOM 2942  O O    . ILE A 1 199 ? 73.562  7.092   0.012   1.00 0.00 ? 199 ILE A O    1  
ATOM 2943  C CB   . ILE A 1 199 ? 72.000  7.359   -2.620  1.00 0.00 ? 199 ILE A CB   1  
ATOM 2944  C CG1  . ILE A 1 199 ? 72.920  8.453   -3.193  1.00 0.00 ? 199 ILE A CG1  1  
ATOM 2945  C CG2  . ILE A 1 199 ? 71.151  7.933   -1.482  1.00 0.00 ? 199 ILE A CG2  1  
ATOM 2946  C CD1  . ILE A 1 199 ? 72.098  9.491   -3.967  1.00 0.00 ? 199 ILE A CD1  1  
ATOM 2947  H H    . ILE A 1 199 ? 71.350  5.462   -0.786  1.00 0.00 ? 199 ILE A H    1  
ATOM 2948  H HA   . ILE A 1 199 ? 73.371  5.732   -2.932  1.00 0.00 ? 199 ILE A HA   1  
ATOM 2949  H HB   . ILE A 1 199 ? 71.346  6.994   -3.397  1.00 0.00 ? 199 ILE A HB   1  
ATOM 2950  H HG12 . ILE A 1 199 ? 73.442  8.944   -2.387  1.00 0.00 ? 199 ILE A HG12 1  
ATOM 2951  H HG13 . ILE A 1 199 ? 73.639  8.000   -3.860  1.00 0.00 ? 199 ILE A HG13 1  
ATOM 2952  H HG21 . ILE A 1 199 ? 70.639  7.128   -0.977  1.00 0.00 ? 199 ILE A HG21 1  
ATOM 2953  H HG22 . ILE A 1 199 ? 70.423  8.619   -1.887  1.00 0.00 ? 199 ILE A HG22 1  
ATOM 2954  H HG23 . ILE A 1 199 ? 71.784  8.453   -0.779  1.00 0.00 ? 199 ILE A HG23 1  
ATOM 2955  H HD11 . ILE A 1 199 ? 72.759  10.089  -4.576  1.00 0.00 ? 199 ILE A HD11 1  
ATOM 2956  H HD12 . ILE A 1 199 ? 71.577  10.132  -3.272  1.00 0.00 ? 199 ILE A HD12 1  
ATOM 2957  H HD13 . ILE A 1 199 ? 71.381  8.992   -4.603  1.00 0.00 ? 199 ILE A HD13 1  
ATOM 2958  N N    . GLY A 1 200 ? 75.158  6.692   -1.523  1.00 0.00 ? 200 GLY A N    1  
ATOM 2959  C CA   . GLY A 1 200 ? 76.236  7.156   -0.667  1.00 0.00 ? 200 GLY A CA   1  
ATOM 2960  C C    . GLY A 1 200 ? 77.562  7.198   -1.399  1.00 0.00 ? 200 GLY A C    1  
ATOM 2961  O O    . GLY A 1 200 ? 77.691  6.662   -2.500  1.00 0.00 ? 200 GLY A O    1  
ATOM 2962  H H    . GLY A 1 200 ? 75.367  6.364   -2.422  1.00 0.00 ? 200 GLY A H    1  
ATOM 2963  H HA2  . GLY A 1 200 ? 75.999  8.148   -0.311  1.00 0.00 ? 200 GLY A HA2  1  
ATOM 2964  H HA3  . GLY A 1 200 ? 76.322  6.491   0.179   1.00 0.00 ? 200 GLY A HA3  1  
ATOM 2965  N N    . ASP A 1 201 ? 78.551  7.841   -0.788  1.00 0.00 ? 201 ASP A N    1  
ATOM 2966  C CA   . ASP A 1 201 ? 79.872  7.951   -1.398  1.00 0.00 ? 201 ASP A CA   1  
ATOM 2967  C C    . ASP A 1 201 ? 80.406  6.575   -1.784  1.00 0.00 ? 201 ASP A C    1  
ATOM 2968  O O    . ASP A 1 201 ? 80.516  5.682   -0.944  1.00 0.00 ? 201 ASP A O    1  
ATOM 2969  C CB   . ASP A 1 201 ? 80.842  8.619   -0.420  1.00 0.00 ? 201 ASP A CB   1  
ATOM 2970  C CG   . ASP A 1 201 ? 82.212  8.771   -1.083  1.00 0.00 ? 201 ASP A CG   1  
ATOM 2971  O OD1  . ASP A 1 201 ? 82.263  8.757   -2.302  1.00 0.00 ? 201 ASP A OD1  1  
ATOM 2972  O OD2  . ASP A 1 201 ? 83.187  8.901   -0.361  1.00 0.00 ? 201 ASP A OD2  1  
ATOM 2973  H H    . ASP A 1 201 ? 78.393  8.255   0.087   1.00 0.00 ? 201 ASP A H    1  
ATOM 2974  H HA   . ASP A 1 201 ? 79.799  8.560   -2.286  1.00 0.00 ? 201 ASP A HA   1  
ATOM 2975  H HB2  . ASP A 1 201 ? 80.462  9.593   -0.147  1.00 0.00 ? 201 ASP A HB2  1  
ATOM 2976  H HB3  . ASP A 1 201 ? 80.938  8.009   0.465   1.00 0.00 ? 201 ASP A HB3  1  
ATOM 2977  N N    . MET A 1 202 ? 80.737  6.413   -3.064  1.00 0.00 ? 202 MET A N    1  
ATOM 2978  C CA   . MET A 1 202 ? 81.262  5.141   -3.561  1.00 0.00 ? 202 MET A CA   1  
ATOM 2979  C C    . MET A 1 202 ? 82.760  5.037   -3.291  1.00 0.00 ? 202 MET A C    1  
ATOM 2980  O O    . MET A 1 202 ? 83.408  4.075   -3.704  1.00 0.00 ? 202 MET A O    1  
ATOM 2981  C CB   . MET A 1 202 ? 81.007  5.024   -5.066  1.00 0.00 ? 202 MET A CB   1  
ATOM 2982  C CG   . MET A 1 202 ? 79.503  4.896   -5.330  1.00 0.00 ? 202 MET A CG   1  
ATOM 2983  S SD   . MET A 1 202 ? 79.226  4.442   -7.062  1.00 0.00 ? 202 MET A SD   1  
ATOM 2984  C CE   . MET A 1 202 ? 79.722  6.015   -7.811  1.00 0.00 ? 202 MET A CE   1  
ATOM 2985  H H    . MET A 1 202 ? 80.628  7.162   -3.686  1.00 0.00 ? 202 MET A H    1  
ATOM 2986  H HA   . MET A 1 202 ? 80.761  4.327   -3.057  1.00 0.00 ? 202 MET A HA   1  
ATOM 2987  H HB2  . MET A 1 202 ? 81.386  5.905   -5.562  1.00 0.00 ? 202 MET A HB2  1  
ATOM 2988  H HB3  . MET A 1 202 ? 81.513  4.151   -5.450  1.00 0.00 ? 202 MET A HB3  1  
ATOM 2989  H HG2  . MET A 1 202 ? 79.088  4.129   -4.691  1.00 0.00 ? 202 MET A HG2  1  
ATOM 2990  H HG3  . MET A 1 202 ? 79.019  5.838   -5.120  1.00 0.00 ? 202 MET A HG3  1  
ATOM 2991  H HE1  . MET A 1 202 ? 80.798  6.074   -7.844  1.00 0.00 ? 202 MET A HE1  1  
ATOM 2992  H HE2  . MET A 1 202 ? 79.333  6.835   -7.227  1.00 0.00 ? 202 MET A HE2  1  
ATOM 2993  H HE3  . MET A 1 202 ? 79.328  6.074   -8.815  1.00 0.00 ? 202 MET A HE3  1  
ATOM 2994  N N    . CYS A 1 203 ? 83.307  6.030   -2.589  1.00 0.00 ? 203 CYS A N    1  
ATOM 2995  C CA   . CYS A 1 203 ? 84.736  6.045   -2.254  1.00 0.00 ? 203 CYS A CA   1  
ATOM 2996  C C    . CYS A 1 203 ? 84.930  5.737   -0.775  1.00 0.00 ? 203 CYS A C    1  
ATOM 2997  O O    . CYS A 1 203 ? 85.771  4.919   -0.404  1.00 0.00 ? 203 CYS A O    1  
ATOM 2998  C CB   . CYS A 1 203 ? 85.331  7.419   -2.568  1.00 0.00 ? 203 CYS A CB   1  
ATOM 2999  S SG   . CYS A 1 203 ? 87.131  7.344   -2.403  1.00 0.00 ? 203 CYS A SG   1  
ATOM 3000  H H    . CYS A 1 203 ? 82.737  6.766   -2.282  1.00 0.00 ? 203 CYS A H    1  
ATOM 3001  H HA   . CYS A 1 203 ? 85.260  5.300   -2.838  1.00 0.00 ? 203 CYS A HA   1  
ATOM 3002  H HB2  . CYS A 1 203 ? 85.072  7.701   -3.578  1.00 0.00 ? 203 CYS A HB2  1  
ATOM 3003  H HB3  . CYS A 1 203 ? 84.935  8.150   -1.878  1.00 0.00 ? 203 CYS A HB3  1  
ATOM 3004  N N    . LYS A 1 204 ? 84.141  6.400   0.065   1.00 0.00 ? 204 LYS A N    1  
ATOM 3005  C CA   . LYS A 1 204 ? 84.222  6.195   1.509   1.00 0.00 ? 204 LYS A CA   1  
ATOM 3006  C C    . LYS A 1 204 ? 82.954  6.704   2.186   1.00 0.00 ? 204 LYS A C    1  
ATOM 3007  O O    . LYS A 1 204 ? 82.644  7.894   2.128   1.00 0.00 ? 204 LYS A O    1  
ATOM 3008  C CB   . LYS A 1 204 ? 85.438  6.933   2.073   1.00 0.00 ? 204 LYS A CB   1  
ATOM 3009  C CG   . LYS A 1 204 ? 85.553  6.660   3.574   1.00 0.00 ? 204 LYS A CG   1  
ATOM 3010  C CD   . LYS A 1 204 ? 86.893  7.190   4.088   1.00 0.00 ? 204 LYS A CD   1  
ATOM 3011  C CE   . LYS A 1 204 ? 86.984  6.972   5.600   1.00 0.00 ? 204 LYS A CE   1  
ATOM 3012  N NZ   . LYS A 1 204 ? 86.041  7.895   6.293   1.00 0.00 ? 204 LYS A NZ   1  
ATOM 3013  H H    . LYS A 1 204 ? 83.489  7.040   -0.292  1.00 0.00 ? 204 LYS A H    1  
ATOM 3014  H HA   . LYS A 1 204 ? 84.329  5.139   1.713   1.00 0.00 ? 204 LYS A HA   1  
ATOM 3015  H HB2  . LYS A 1 204 ? 86.332  6.589   1.573   1.00 0.00 ? 204 LYS A HB2  1  
ATOM 3016  H HB3  . LYS A 1 204 ? 85.322  7.995   1.911   1.00 0.00 ? 204 LYS A HB3  1  
ATOM 3017  H HG2  . LYS A 1 204 ? 84.745  7.155   4.093   1.00 0.00 ? 204 LYS A HG2  1  
ATOM 3018  H HG3  . LYS A 1 204 ? 85.497  5.596   3.751   1.00 0.00 ? 204 LYS A HG3  1  
ATOM 3019  H HD2  . LYS A 1 204 ? 87.700  6.663   3.599   1.00 0.00 ? 204 LYS A HD2  1  
ATOM 3020  H HD3  . LYS A 1 204 ? 86.969  8.245   3.874   1.00 0.00 ? 204 LYS A HD3  1  
ATOM 3021  H HE2  . LYS A 1 204 ? 86.725  5.950   5.834   1.00 0.00 ? 204 LYS A HE2  1  
ATOM 3022  H HE3  . LYS A 1 204 ? 87.992  7.172   5.932   1.00 0.00 ? 204 LYS A HE3  1  
ATOM 3023  H HZ1  . LYS A 1 204 ? 85.649  8.571   5.606   1.00 0.00 ? 204 LYS A HZ1  1  
ATOM 3024  H HZ2  . LYS A 1 204 ? 86.549  8.413   7.039   1.00 0.00 ? 204 LYS A HZ2  1  
ATOM 3025  H HZ3  . LYS A 1 204 ? 85.267  7.347   6.717   1.00 0.00 ? 204 LYS A HZ3  1  
ATOM 3026  N N    . GLU A 1 205 ? 82.224  5.795   2.828   1.00 0.00 ? 205 GLU A N    1  
ATOM 3027  C CA   . GLU A 1 205 ? 80.985  6.160   3.515   1.00 0.00 ? 205 GLU A CA   1  
ATOM 3028  C C    . GLU A 1 205 ? 81.170  7.450   4.314   1.00 0.00 ? 205 GLU A C    1  
ATOM 3029  O O    . GLU A 1 205 ? 82.290  7.806   4.682   1.00 0.00 ? 205 GLU A O    1  
ATOM 3030  C CB   . GLU A 1 205 ? 80.553  5.029   4.458   1.00 0.00 ? 205 GLU A CB   1  
ATOM 3031  C CG   . GLU A 1 205 ? 80.052  3.832   3.643   1.00 0.00 ? 205 GLU A CG   1  
ATOM 3032  C CD   . GLU A 1 205 ? 81.208  3.240   2.834   1.00 0.00 ? 205 GLU A CD   1  
ATOM 3033  O OE1  . GLU A 1 205 ? 82.128  2.722   3.446   1.00 0.00 ? 205 GLU A OE1  1  
ATOM 3034  O OE2  . GLU A 1 205 ? 81.154  3.315   1.618   1.00 0.00 ? 205 GLU A OE2  1  
ATOM 3035  H H    . GLU A 1 205 ? 82.520  4.863   2.839   1.00 0.00 ? 205 GLU A H    1  
ATOM 3036  H HA   . GLU A 1 205 ? 80.210  6.317   2.780   1.00 0.00 ? 205 GLU A HA   1  
ATOM 3037  H HB2  . GLU A 1 205 ? 81.397  4.724   5.061   1.00 0.00 ? 205 GLU A HB2  1  
ATOM 3038  H HB3  . GLU A 1 205 ? 79.759  5.378   5.103   1.00 0.00 ? 205 GLU A HB3  1  
ATOM 3039  H HG2  . GLU A 1 205 ? 79.661  3.081   4.314   1.00 0.00 ? 205 GLU A HG2  1  
ATOM 3040  H HG3  . GLU A 1 205 ? 79.273  4.153   2.970   1.00 0.00 ? 205 GLU A HG3  1  
ATOM 3041  N N    . SER A 1 206 ? 80.064  8.148   4.576   1.00 0.00 ? 206 SER A N    1  
ATOM 3042  C CA   . SER A 1 206 ? 80.108  9.405   5.330   1.00 0.00 ? 206 SER A CA   1  
ATOM 3043  C C    . SER A 1 206 ? 78.915  9.507   6.276   1.00 0.00 ? 206 SER A C    1  
ATOM 3044  O O    . SER A 1 206 ? 78.593  10.589  6.762   1.00 0.00 ? 206 SER A O    1  
ATOM 3045  C CB   . SER A 1 206 ? 80.098  10.589  4.364   1.00 0.00 ? 206 SER A CB   1  
ATOM 3046  O OG   . SER A 1 206 ? 79.892  11.791  5.097   1.00 0.00 ? 206 SER A OG   1  
ATOM 3047  H H    . SER A 1 206 ? 79.201  7.814   4.253   1.00 0.00 ? 206 SER A H    1  
ATOM 3048  H HA   . SER A 1 206 ? 81.016  9.445   5.917   1.00 0.00 ? 206 SER A HA   1  
ATOM 3049  H HB2  . SER A 1 206 ? 81.042  10.646  3.850   1.00 0.00 ? 206 SER A HB2  1  
ATOM 3050  H HB3  . SER A 1 206 ? 79.305  10.456  3.641   1.00 0.00 ? 206 SER A HB3  1  
ATOM 3051  H HG   . SER A 1 206 ? 80.693  11.977  5.591   1.00 0.00 ? 206 SER A HG   1  
ATOM 3052  N N    . SER A 1 207 ? 78.281  8.369   6.541   1.00 0.00 ? 207 SER A N    1  
ATOM 3053  C CA   . SER A 1 207 ? 77.130  8.311   7.445   1.00 0.00 ? 207 SER A CA   1  
ATOM 3054  C C    . SER A 1 207 ? 76.007  9.256   7.010   1.00 0.00 ? 207 SER A C    1  
ATOM 3055  O O    . SER A 1 207 ? 74.975  8.811   6.510   1.00 0.00 ? 207 SER A O    1  
ATOM 3056  C CB   . SER A 1 207 ? 77.568  8.642   8.876   1.00 0.00 ? 207 SER A CB   1  
ATOM 3057  O OG   . SER A 1 207 ? 77.893  10.022  8.971   1.00 0.00 ? 207 SER A OG   1  
ATOM 3058  H H    . SER A 1 207 ? 78.601  7.540   6.128   1.00 0.00 ? 207 SER A H    1  
ATOM 3059  H HA   . SER A 1 207 ? 76.745  7.303   7.436   1.00 0.00 ? 207 SER A HA   1  
ATOM 3060  H HB2  . SER A 1 207 ? 76.764  8.420   9.558   1.00 0.00 ? 207 SER A HB2  1  
ATOM 3061  H HB3  . SER A 1 207 ? 78.430  8.041   9.132   1.00 0.00 ? 207 SER A HB3  1  
ATOM 3062  H HG   . SER A 1 207 ? 77.142  10.477  9.359   1.00 0.00 ? 207 SER A HG   1  
ATOM 3063  N N    . GLU A 1 208 ? 76.198  10.555  7.220   1.00 0.00 ? 208 GLU A N    1  
ATOM 3064  C CA   . GLU A 1 208 ? 75.180  11.538  6.861   1.00 0.00 ? 208 GLU A CA   1  
ATOM 3065  C C    . GLU A 1 208 ? 74.676  11.330  5.434   1.00 0.00 ? 208 GLU A C    1  
ATOM 3066  O O    . GLU A 1 208 ? 73.471  11.212  5.206   1.00 0.00 ? 208 GLU A O    1  
ATOM 3067  C CB   . GLU A 1 208 ? 75.748  12.951  7.004   1.00 0.00 ? 208 GLU A CB   1  
ATOM 3068  C CG   . GLU A 1 208 ? 76.266  13.155  8.431   1.00 0.00 ? 208 GLU A CG   1  
ATOM 3069  C CD   . GLU A 1 208 ? 75.091  13.140  9.411   1.00 0.00 ? 208 GLU A CD   1  
ATOM 3070  O OE1  . GLU A 1 208 ? 73.983  13.411  8.980   1.00 0.00 ? 208 GLU A OE1  1  
ATOM 3071  O OE2  . GLU A 1 208 ? 75.320  12.857  10.575  1.00 0.00 ? 208 GLU A OE2  1  
ATOM 3072  H H    . GLU A 1 208 ? 77.029  10.857  7.636   1.00 0.00 ? 208 GLU A H    1  
ATOM 3073  H HA   . GLU A 1 208 ? 74.346  11.433  7.540   1.00 0.00 ? 208 GLU A HA   1  
ATOM 3074  H HB2  . GLU A 1 208 ? 76.560  13.084  6.306   1.00 0.00 ? 208 GLU A HB2  1  
ATOM 3075  H HB3  . GLU A 1 208 ? 74.972  13.673  6.797   1.00 0.00 ? 208 GLU A HB3  1  
ATOM 3076  H HG2  . GLU A 1 208 ? 76.954  12.361  8.681   1.00 0.00 ? 208 GLU A HG2  1  
ATOM 3077  H HG3  . GLU A 1 208 ? 76.774  14.106  8.496   1.00 0.00 ? 208 GLU A HG3  1  
ATOM 3078  N N    . LEU A 1 209 ? 75.595  11.303  4.473   1.00 0.00 ? 209 LEU A N    1  
ATOM 3079  C CA   . LEU A 1 209 ? 75.218  11.128  3.070   1.00 0.00 ? 209 LEU A CA   1  
ATOM 3080  C C    . LEU A 1 209 ? 74.818  9.678   2.785   1.00 0.00 ? 209 LEU A C    1  
ATOM 3081  O O    . LEU A 1 209 ? 74.549  9.318   1.639   1.00 0.00 ? 209 LEU A O    1  
ATOM 3082  C CB   . LEU A 1 209 ? 76.394  11.535  2.163   1.00 0.00 ? 209 LEU A CB   1  
ATOM 3083  C CG   . LEU A 1 209 ? 76.474  13.065  2.046   1.00 0.00 ? 209 LEU A CG   1  
ATOM 3084  C CD1  . LEU A 1 209 ? 76.555  13.695  3.443   1.00 0.00 ? 209 LEU A CD1  1  
ATOM 3085  C CD2  . LEU A 1 209 ? 77.720  13.443  1.240   1.00 0.00 ? 209 LEU A CD2  1  
ATOM 3086  H H    . LEU A 1 209 ? 76.539  11.414  4.708   1.00 0.00 ? 209 LEU A H    1  
ATOM 3087  H HA   . LEU A 1 209 ? 74.372  11.766  2.854   1.00 0.00 ? 209 LEU A HA   1  
ATOM 3088  H HB2  . LEU A 1 209 ? 77.314  11.162  2.585   1.00 0.00 ? 209 LEU A HB2  1  
ATOM 3089  H HB3  . LEU A 1 209 ? 76.259  11.113  1.177   1.00 0.00 ? 209 LEU A HB3  1  
ATOM 3090  H HG   . LEU A 1 209 ? 75.592  13.431  1.539   1.00 0.00 ? 209 LEU A HG   1  
ATOM 3091  H HD11 . LEU A 1 209 ? 77.269  13.152  4.044   1.00 0.00 ? 209 LEU A HD11 1  
ATOM 3092  H HD12 . LEU A 1 209 ? 75.583  13.656  3.911   1.00 0.00 ? 209 LEU A HD12 1  
ATOM 3093  H HD13 . LEU A 1 209 ? 76.868  14.727  3.358   1.00 0.00 ? 209 LEU A HD13 1  
ATOM 3094  H HD21 . LEU A 1 209 ? 78.605  13.150  1.785   1.00 0.00 ? 209 LEU A HD21 1  
ATOM 3095  H HD22 . LEU A 1 209 ? 77.734  14.511  1.078   1.00 0.00 ? 209 LEU A HD22 1  
ATOM 3096  H HD23 . LEU A 1 209 ? 77.700  12.935  0.287   1.00 0.00 ? 209 LEU A HD23 1  
ATOM 3097  N N    . GLU A 1 210 ? 74.783  8.848   3.828   1.00 0.00 ? 210 GLU A N    1  
ATOM 3098  C CA   . GLU A 1 210 ? 74.417  7.432   3.676   1.00 0.00 ? 210 GLU A CA   1  
ATOM 3099  C C    . GLU A 1 210 ? 72.992  7.178   4.170   1.00 0.00 ? 210 GLU A C    1  
ATOM 3100  O O    . GLU A 1 210 ? 72.662  7.469   5.319   1.00 0.00 ? 210 GLU A O    1  
ATOM 3101  C CB   . GLU A 1 210 ? 75.392  6.557   4.471   1.00 0.00 ? 210 GLU A CB   1  
ATOM 3102  C CG   . GLU A 1 210 ? 76.830  6.999   4.186   1.00 0.00 ? 210 GLU A CG   1  
ATOM 3103  C CD   . GLU A 1 210 ? 77.108  6.907   2.684   1.00 0.00 ? 210 GLU A CD   1  
ATOM 3104  O OE1  . GLU A 1 210 ? 77.496  5.839   2.239   1.00 0.00 ? 210 GLU A OE1  1  
ATOM 3105  O OE2  . GLU A 1 210 ? 76.927  7.904   2.006   1.00 0.00 ? 210 GLU A OE2  1  
ATOM 3106  H H    . GLU A 1 210 ? 75.011  9.190   4.717   1.00 0.00 ? 210 GLU A H    1  
ATOM 3107  H HA   . GLU A 1 210 ? 74.476  7.150   2.632   1.00 0.00 ? 210 GLU A HA   1  
ATOM 3108  H HB2  . GLU A 1 210 ? 75.188  6.655   5.526   1.00 0.00 ? 210 GLU A HB2  1  
ATOM 3109  H HB3  . GLU A 1 210 ? 75.268  5.525   4.176   1.00 0.00 ? 210 GLU A HB3  1  
ATOM 3110  H HG2  . GLU A 1 210 ? 76.966  8.018   4.516   1.00 0.00 ? 210 GLU A HG2  1  
ATOM 3111  H HG3  . GLU A 1 210 ? 77.516  6.355   4.717   1.00 0.00 ? 210 GLU A HG3  1  
ATOM 3112  N N    . VAL A 1 211 ? 72.158  6.616   3.293   1.00 0.00 ? 211 VAL A N    1  
ATOM 3113  C CA   . VAL A 1 211 ? 70.767  6.300   3.637   1.00 0.00 ? 211 VAL A CA   1  
ATOM 3114  C C    . VAL A 1 211 ? 70.334  5.035   2.897   1.00 0.00 ? 211 VAL A C    1  
ATOM 3115  O O    . VAL A 1 211 ? 71.120  4.455   2.152   1.00 0.00 ? 211 VAL A O    1  
ATOM 3116  C CB   . VAL A 1 211 ? 69.813  7.462   3.267   1.00 0.00 ? 211 VAL A CB   1  
ATOM 3117  C CG1  . VAL A 1 211 ? 70.356  8.770   3.846   1.00 0.00 ? 211 VAL A CG1  1  
ATOM 3118  C CG2  . VAL A 1 211 ? 69.705  7.603   1.745   1.00 0.00 ? 211 VAL A CG2  1  
ATOM 3119  H H    . VAL A 1 211 ? 72.487  6.398   2.395   1.00 0.00 ? 211 VAL A H    1  
ATOM 3120  H HA   . VAL A 1 211 ? 70.695  6.115   4.700   1.00 0.00 ? 211 VAL A HA   1  
ATOM 3121  H HB   . VAL A 1 211 ? 68.835  7.266   3.683   1.00 0.00 ? 211 VAL A HB   1  
ATOM 3122  H HG11 . VAL A 1 211 ? 69.637  9.559   3.686   1.00 0.00 ? 211 VAL A HG11 1  
ATOM 3123  H HG12 . VAL A 1 211 ? 71.283  9.024   3.353   1.00 0.00 ? 211 VAL A HG12 1  
ATOM 3124  H HG13 . VAL A 1 211 ? 70.532  8.653   4.903   1.00 0.00 ? 211 VAL A HG13 1  
ATOM 3125  H HG21 . VAL A 1 211 ? 69.173  6.757   1.335   1.00 0.00 ? 211 VAL A HG21 1  
ATOM 3126  H HG22 . VAL A 1 211 ? 70.695  7.652   1.318   1.00 0.00 ? 211 VAL A HG22 1  
ATOM 3127  H HG23 . VAL A 1 211 ? 69.165  8.505   1.511   1.00 0.00 ? 211 VAL A HG23 1  
ATOM 3128  N N    . LYS A 1 212 ? 69.091  4.609   3.095   1.00 0.00 ? 212 LYS A N    1  
ATOM 3129  C CA   . LYS A 1 212 ? 68.609  3.408   2.419   1.00 0.00 ? 212 LYS A CA   1  
ATOM 3130  C C    . LYS A 1 212 ? 67.101  3.240   2.568   1.00 0.00 ? 212 LYS A C    1  
ATOM 3131  O O    . LYS A 1 212 ? 66.458  3.903   3.380   1.00 0.00 ? 212 LYS A O    1  
ATOM 3132  C CB   . LYS A 1 212 ? 69.323  2.164   2.979   1.00 0.00 ? 212 LYS A CB   1  
ATOM 3133  C CG   . LYS A 1 212 ? 68.855  1.856   4.434   1.00 0.00 ? 212 LYS A CG   1  
ATOM 3134  C CD   . LYS A 1 212 ? 67.796  0.727   4.454   1.00 0.00 ? 212 LYS A CD   1  
ATOM 3135  C CE   . LYS A 1 212 ? 68.462  -0.651  4.314   1.00 0.00 ? 212 LYS A CE   1  
ATOM 3136  N NZ   . LYS A 1 212 ? 67.465  -1.712  4.633   1.00 0.00 ? 212 LYS A NZ   1  
ATOM 3137  H H    . LYS A 1 212 ? 68.495  5.103   3.696   1.00 0.00 ? 212 LYS A H    1  
ATOM 3138  H HA   . LYS A 1 212 ? 68.841  3.489   1.368   1.00 0.00 ? 212 LYS A HA   1  
ATOM 3139  H HB2  . LYS A 1 212 ? 69.112  1.322   2.335   1.00 0.00 ? 212 LYS A HB2  1  
ATOM 3140  H HB3  . LYS A 1 212 ? 70.389  2.346   2.976   1.00 0.00 ? 212 LYS A HB3  1  
ATOM 3141  H HG2  . LYS A 1 212 ? 69.707  1.555   5.029   1.00 0.00 ? 212 LYS A HG2  1  
ATOM 3142  H HG3  . LYS A 1 212 ? 68.425  2.747   4.876   1.00 0.00 ? 212 LYS A HG3  1  
ATOM 3143  H HD2  . LYS A 1 212 ? 67.255  0.763   5.389   1.00 0.00 ? 212 LYS A HD2  1  
ATOM 3144  H HD3  . LYS A 1 212 ? 67.104  0.866   3.641   1.00 0.00 ? 212 LYS A HD3  1  
ATOM 3145  H HE2  . LYS A 1 212 ? 68.813  -0.786  3.303   1.00 0.00 ? 212 LYS A HE2  1  
ATOM 3146  H HE3  . LYS A 1 212 ? 69.293  -0.728  4.995   1.00 0.00 ? 212 LYS A HE3  1  
ATOM 3147  H HZ1  . LYS A 1 212 ? 66.591  -1.538  4.100   1.00 0.00 ? 212 LYS A HZ1  1  
ATOM 3148  H HZ2  . LYS A 1 212 ? 67.258  -1.697  5.653   1.00 0.00 ? 212 LYS A HZ2  1  
ATOM 3149  H HZ3  . LYS A 1 212 ? 67.850  -2.641  4.370   1.00 0.00 ? 212 LYS A HZ3  1  
ATOM 3150  N N    . ASP A 1 213 ? 66.560  2.325   1.772   1.00 0.00 ? 213 ASP A N    1  
ATOM 3151  C CA   . ASP A 1 213 ? 65.134  2.017   1.787   1.00 0.00 ? 213 ASP A CA   1  
ATOM 3152  C C    . ASP A 1 213 ? 64.924  0.614   1.225   1.00 0.00 ? 213 ASP A C    1  
ATOM 3153  O O    . ASP A 1 213 ? 65.863  -0.005  0.723   1.00 0.00 ? 213 ASP A O    1  
ATOM 3154  C CB   . ASP A 1 213 ? 64.349  3.051   0.966   1.00 0.00 ? 213 ASP A CB   1  
ATOM 3155  C CG   . ASP A 1 213 ? 65.163  3.452   -0.261  1.00 0.00 ? 213 ASP A CG   1  
ATOM 3156  O OD1  . ASP A 1 213 ? 66.234  4.007   -0.083  1.00 0.00 ? 213 ASP A OD1  1  
ATOM 3157  O OD2  . ASP A 1 213 ? 64.699  3.199   -1.358  1.00 0.00 ? 213 ASP A OD2  1  
ATOM 3158  H H    . ASP A 1 213 ? 67.141  1.832   1.158   1.00 0.00 ? 213 ASP A H    1  
ATOM 3159  H HA   . ASP A 1 213 ? 64.781  2.034   2.810   1.00 0.00 ? 213 ASP A HA   1  
ATOM 3160  H HB2  . ASP A 1 213 ? 63.403  2.631   0.652   1.00 0.00 ? 213 ASP A HB2  1  
ATOM 3161  H HB3  . ASP A 1 213 ? 64.166  3.923   1.572   1.00 0.00 ? 213 ASP A HB3  1  
ATOM 3162  N N    . GLY A 1 214 ? 63.695  0.117   1.301   1.00 0.00 ? 214 GLY A N    1  
ATOM 3163  C CA   . GLY A 1 214 ? 63.393  -1.210  0.787   1.00 0.00 ? 214 GLY A CA   1  
ATOM 3164  C C    . GLY A 1 214 ? 62.158  -1.810  1.423   1.00 0.00 ? 214 GLY A C    1  
ATOM 3165  O O    . GLY A 1 214 ? 61.907  -1.629  2.615   1.00 0.00 ? 214 GLY A O    1  
ATOM 3166  H H    . GLY A 1 214 ? 62.978  0.661   1.687   1.00 0.00 ? 214 GLY A H    1  
ATOM 3167  H HA2  . GLY A 1 214 ? 63.237  -1.143  -0.279  1.00 0.00 ? 214 GLY A HA2  1  
ATOM 3168  H HA3  . GLY A 1 214 ? 64.232  -1.868  0.976   1.00 0.00 ? 214 GLY A HA3  1  
ATOM 3169  N N    . PHE A 1 215 ? 61.391  -2.541  0.616   1.00 0.00 ? 215 PHE A N    1  
ATOM 3170  C CA   . PHE A 1 215 ? 60.169  -3.201  1.083   1.00 0.00 ? 215 PHE A CA   1  
ATOM 3171  C C    . PHE A 1 215 ? 60.282  -4.703  0.851   1.00 0.00 ? 215 PHE A C    1  
ATOM 3172  O O    . PHE A 1 215 ? 61.287  -5.183  0.329   1.00 0.00 ? 215 PHE A O    1  
ATOM 3173  C CB   . PHE A 1 215 ? 58.959  -2.653  0.318   1.00 0.00 ? 215 PHE A CB   1  
ATOM 3174  C CG   . PHE A 1 215 ? 58.684  -1.228  0.751   1.00 0.00 ? 215 PHE A CG   1  
ATOM 3175  C CD1  . PHE A 1 215 ? 59.559  -0.192  0.355   1.00 0.00 ? 215 PHE A CD1  1  
ATOM 3176  C CD2  . PHE A 1 215 ? 57.556  -0.929  1.550   1.00 0.00 ? 215 PHE A CD2  1  
ATOM 3177  C CE1  . PHE A 1 215 ? 59.308  1.138   0.756   1.00 0.00 ? 215 PHE A CE1  1  
ATOM 3178  C CE2  . PHE A 1 215 ? 57.305  0.402   1.948   1.00 0.00 ? 215 PHE A CE2  1  
ATOM 3179  C CZ   . PHE A 1 215 ? 58.181  1.435   1.551   1.00 0.00 ? 215 PHE A CZ   1  
ATOM 3180  H H    . PHE A 1 215 ? 61.659  -2.650  -0.321  1.00 0.00 ? 215 PHE A H    1  
ATOM 3181  H HA   . PHE A 1 215 ? 60.028  -3.020  2.141   1.00 0.00 ? 215 PHE A HA   1  
ATOM 3182  H HB2  . PHE A 1 215 ? 59.168  -2.671  -0.742  1.00 0.00 ? 215 PHE A HB2  1  
ATOM 3183  H HB3  . PHE A 1 215 ? 58.094  -3.268  0.523   1.00 0.00 ? 215 PHE A HB3  1  
ATOM 3184  H HD1  . PHE A 1 215 ? 60.422  -0.419  -0.254  1.00 0.00 ? 215 PHE A HD1  1  
ATOM 3185  H HD2  . PHE A 1 215 ? 56.884  -1.718  1.854   1.00 0.00 ? 215 PHE A HD2  1  
ATOM 3186  H HE1  . PHE A 1 215 ? 59.979  1.929   0.452   1.00 0.00 ? 215 PHE A HE1  1  
ATOM 3187  H HE2  . PHE A 1 215 ? 56.442  0.629   2.558   1.00 0.00 ? 215 PHE A HE2  1  
ATOM 3188  H HZ   . PHE A 1 215 ? 57.951  2.461   1.800   1.00 0.00 ? 215 PHE A HZ   1  
ATOM 3189  N N    . LYS A 1 216 ? 59.247  -5.445  1.241   1.00 0.00 ? 216 LYS A N    1  
ATOM 3190  C CA   . LYS A 1 216 ? 59.241  -6.901  1.071   1.00 0.00 ? 216 LYS A CA   1  
ATOM 3191  C C    . LYS A 1 216 ? 57.875  -7.374  0.586   1.00 0.00 ? 216 LYS A C    1  
ATOM 3192  O O    . LYS A 1 216 ? 56.921  -7.446  1.358   1.00 0.00 ? 216 LYS A O    1  
ATOM 3193  C CB   . LYS A 1 216 ? 59.570  -7.580  2.404   1.00 0.00 ? 216 LYS A CB   1  
ATOM 3194  C CG   . LYS A 1 216 ? 60.929  -7.085  2.911   1.00 0.00 ? 216 LYS A CG   1  
ATOM 3195  C CD   . LYS A 1 216 ? 61.412  -7.976  4.064   1.00 0.00 ? 216 LYS A CD   1  
ATOM 3196  C CE   . LYS A 1 216 ? 60.463  -7.851  5.263   1.00 0.00 ? 216 LYS A CE   1  
ATOM 3197  N NZ   . LYS A 1 216 ? 61.139  -8.377  6.482   1.00 0.00 ? 216 LYS A NZ   1  
ATOM 3198  H H    . LYS A 1 216 ? 58.473  -5.008  1.654   1.00 0.00 ? 216 LYS A H    1  
ATOM 3199  H HA   . LYS A 1 216 ? 59.985  -7.189  0.341   1.00 0.00 ? 216 LYS A HA   1  
ATOM 3200  H HB2  . LYS A 1 216 ? 58.804  -7.337  3.126   1.00 0.00 ? 216 LYS A HB2  1  
ATOM 3201  H HB3  . LYS A 1 216 ? 59.606  -8.650  2.263   1.00 0.00 ? 216 LYS A HB3  1  
ATOM 3202  H HG2  . LYS A 1 216 ? 61.649  -7.121  2.106   1.00 0.00 ? 216 LYS A HG2  1  
ATOM 3203  H HG3  . LYS A 1 216 ? 60.834  -6.067  3.261   1.00 0.00 ? 216 LYS A HG3  1  
ATOM 3204  H HD2  . LYS A 1 216 ? 61.439  -9.004  3.733   1.00 0.00 ? 216 LYS A HD2  1  
ATOM 3205  H HD3  . LYS A 1 216 ? 62.404  -7.668  4.361   1.00 0.00 ? 216 LYS A HD3  1  
ATOM 3206  H HE2  . LYS A 1 216 ? 60.202  -6.814  5.417   1.00 0.00 ? 216 LYS A HE2  1  
ATOM 3207  H HE3  . LYS A 1 216 ? 59.567  -8.424  5.076   1.00 0.00 ? 216 LYS A HE3  1  
ATOM 3208  H HZ1  . LYS A 1 216 ? 61.107  -9.416  6.477   1.00 0.00 ? 216 LYS A HZ1  1  
ATOM 3209  H HZ2  . LYS A 1 216 ? 60.651  -8.019  7.329   1.00 0.00 ? 216 LYS A HZ2  1  
ATOM 3210  H HZ3  . LYS A 1 216 ? 62.129  -8.062  6.493   1.00 0.00 ? 216 LYS A HZ3  1  
ATOM 3211  N N    . TYR A 1 217 ? 57.798  -7.704  -0.702  1.00 0.00 ? 217 TYR A N    1  
ATOM 3212  C CA   . TYR A 1 217 ? 56.554  -8.182  -1.308  1.00 0.00 ? 217 TYR A CA   1  
ATOM 3213  C C    . TYR A 1 217 ? 56.560  -9.703  -1.371  1.00 0.00 ? 217 TYR A C    1  
ATOM 3214  O O    . TYR A 1 217 ? 57.425  -10.300 -2.011  1.00 0.00 ? 217 TYR A O    1  
ATOM 3215  C CB   . TYR A 1 217 ? 56.428  -7.609  -2.722  1.00 0.00 ? 217 TYR A CB   1  
ATOM 3216  C CG   . TYR A 1 217 ? 55.080  -7.966  -3.307  1.00 0.00 ? 217 TYR A CG   1  
ATOM 3217  C CD1  . TYR A 1 217 ? 53.927  -7.266  -2.892  1.00 0.00 ? 217 TYR A CD1  1  
ATOM 3218  C CD2  . TYR A 1 217 ? 54.973  -8.991  -4.274  1.00 0.00 ? 217 TYR A CD2  1  
ATOM 3219  C CE1  . TYR A 1 217 ? 52.670  -7.590  -3.444  1.00 0.00 ? 217 TYR A CE1  1  
ATOM 3220  C CE2  . TYR A 1 217 ? 53.715  -9.317  -4.821  1.00 0.00 ? 217 TYR A CE2  1  
ATOM 3221  C CZ   . TYR A 1 217 ? 52.562  -8.618  -4.405  1.00 0.00 ? 217 TYR A CZ   1  
ATOM 3222  O OH   . TYR A 1 217 ? 51.339  -8.901  -4.978  1.00 0.00 ? 217 TYR A OH   1  
ATOM 3223  H H    . TYR A 1 217 ? 58.600  -7.629  -1.260  1.00 0.00 ? 217 TYR A H    1  
ATOM 3224  H HA   . TYR A 1 217 ? 55.707  -7.853  -0.720  1.00 0.00 ? 217 TYR A HA   1  
ATOM 3225  H HB2  . TYR A 1 217 ? 56.526  -6.536  -2.680  1.00 0.00 ? 217 TYR A HB2  1  
ATOM 3226  H HB3  . TYR A 1 217 ? 57.210  -8.018  -3.343  1.00 0.00 ? 217 TYR A HB3  1  
ATOM 3227  H HD1  . TYR A 1 217 ? 54.007  -6.483  -2.154  1.00 0.00 ? 217 TYR A HD1  1  
ATOM 3228  H HD2  . TYR A 1 217 ? 55.855  -9.524  -4.594  1.00 0.00 ? 217 TYR A HD2  1  
ATOM 3229  H HE1  . TYR A 1 217 ? 51.789  -7.055  -3.127  1.00 0.00 ? 217 TYR A HE1  1  
ATOM 3230  H HE2  . TYR A 1 217 ? 53.635  -10.104 -5.557  1.00 0.00 ? 217 TYR A HE2  1  
ATOM 3231  H HH   . TYR A 1 217 ? 50.718  -8.223  -4.701  1.00 0.00 ? 217 TYR A HH   1  
ATOM 3232  N N    . VAL A 1 218 ? 55.598  -10.333 -0.693  1.00 0.00 ? 218 VAL A N    1  
ATOM 3233  C CA   . VAL A 1 218 ? 55.510  -11.796 -0.671  1.00 0.00 ? 218 VAL A CA   1  
ATOM 3234  C C    . VAL A 1 218 ? 54.062  -12.251 -0.806  1.00 0.00 ? 218 VAL A C    1  
ATOM 3235  O O    . VAL A 1 218 ? 53.300  -12.233 0.160   1.00 0.00 ? 218 VAL A O    1  
ATOM 3236  C CB   . VAL A 1 218 ? 56.077  -12.357 0.646   1.00 0.00 ? 218 VAL A CB   1  
ATOM 3237  C CG1  . VAL A 1 218 ? 56.123  -13.884 0.574   1.00 0.00 ? 218 VAL A CG1  1  
ATOM 3238  C CG2  . VAL A 1 218 ? 57.492  -11.815 0.861   1.00 0.00 ? 218 VAL A CG2  1  
ATOM 3239  H H    . VAL A 1 218 ? 54.939  -9.807  -0.192  1.00 0.00 ? 218 VAL A H    1  
ATOM 3240  H HA   . VAL A 1 218 ? 56.079  -12.208 -1.494  1.00 0.00 ? 218 VAL A HA   1  
ATOM 3241  H HB   . VAL A 1 218 ? 55.443  -12.054 1.467   1.00 0.00 ? 218 VAL A HB   1  
ATOM 3242  H HG11 . VAL A 1 218 ? 56.660  -14.186 -0.313  1.00 0.00 ? 218 VAL A HG11 1  
ATOM 3243  H HG12 . VAL A 1 218 ? 55.116  -14.274 0.537   1.00 0.00 ? 218 VAL A HG12 1  
ATOM 3244  H HG13 . VAL A 1 218 ? 56.627  -14.270 1.448   1.00 0.00 ? 218 VAL A HG13 1  
ATOM 3245  H HG21 . VAL A 1 218 ? 57.893  -12.211 1.781   1.00 0.00 ? 218 VAL A HG21 1  
ATOM 3246  H HG22 . VAL A 1 218 ? 57.460  -10.737 0.917   1.00 0.00 ? 218 VAL A HG22 1  
ATOM 3247  H HG23 . VAL A 1 218 ? 58.121  -12.114 0.035   1.00 0.00 ? 218 VAL A HG23 1  
ATOM 3248  N N    . ASP A 1 219 ? 53.694  -12.665 -2.014  1.00 0.00 ? 219 ASP A N    1  
ATOM 3249  C CA   . ASP A 1 219 ? 52.339  -13.132 -2.272  1.00 0.00 ? 219 ASP A CA   1  
ATOM 3250  C C    . ASP A 1 219 ? 51.311  -12.096 -1.825  1.00 0.00 ? 219 ASP A C    1  
ATOM 3251  O O    . ASP A 1 219 ? 50.383  -12.412 -1.079  1.00 0.00 ? 219 ASP A O    1  
ATOM 3252  C CB   . ASP A 1 219 ? 52.091  -14.448 -1.533  1.00 0.00 ? 219 ASP A CB   1  
ATOM 3253  C CG   . ASP A 1 219 ? 50.755  -15.043 -1.980  1.00 0.00 ? 219 ASP A CG   1  
ATOM 3254  O OD1  . ASP A 1 219 ? 50.728  -15.667 -3.028  1.00 0.00 ? 219 ASP A OD1  1  
ATOM 3255  O OD2  . ASP A 1 219 ? 49.781  -14.864 -1.267  1.00 0.00 ? 219 ASP A OD2  1  
ATOM 3256  H H    . ASP A 1 219 ? 54.350  -12.659 -2.742  1.00 0.00 ? 219 ASP A H    1  
ATOM 3257  H HA   . ASP A 1 219 ? 52.224  -13.303 -3.332  1.00 0.00 ? 219 ASP A HA   1  
ATOM 3258  H HB2  . ASP A 1 219 ? 52.888  -15.141 -1.757  1.00 0.00 ? 219 ASP A HB2  1  
ATOM 3259  H HB3  . ASP A 1 219 ? 52.063  -14.263 -0.470  1.00 0.00 ? 219 ASP A HB3  1  
ATOM 3260  N N    . GLY A 1 220 ? 51.475  -10.858 -2.290  1.00 0.00 ? 220 GLY A N    1  
ATOM 3261  C CA   . GLY A 1 220 ? 50.552  -9.787  -1.942  1.00 0.00 ? 220 GLY A CA   1  
ATOM 3262  C C    . GLY A 1 220 ? 50.892  -9.130  -0.616  1.00 0.00 ? 220 GLY A C    1  
ATOM 3263  O O    . GLY A 1 220 ? 50.369  -8.064  -0.292  1.00 0.00 ? 220 GLY A O    1  
ATOM 3264  H H    . GLY A 1 220 ? 52.229  -10.666 -2.886  1.00 0.00 ? 220 GLY A H    1  
ATOM 3265  H HA2  . GLY A 1 220 ? 50.581  -9.038  -2.717  1.00 0.00 ? 220 GLY A HA2  1  
ATOM 3266  H HA3  . GLY A 1 220 ? 49.548  -10.185 -1.884  1.00 0.00 ? 220 GLY A HA3  1  
ATOM 3267  N N    . SER A 1 221 ? 51.760  -9.774  0.165   1.00 0.00 ? 221 SER A N    1  
ATOM 3268  C CA   . SER A 1 221 ? 52.148  -9.242  1.474   1.00 0.00 ? 221 SER A CA   1  
ATOM 3269  C C    . SER A 1 221 ? 53.299  -8.247  1.354   1.00 0.00 ? 221 SER A C    1  
ATOM 3270  O O    . SER A 1 221 ? 54.448  -8.633  1.146   1.00 0.00 ? 221 SER A O    1  
ATOM 3271  C CB   . SER A 1 221 ? 52.571  -10.391 2.389   1.00 0.00 ? 221 SER A CB   1  
ATOM 3272  O OG   . SER A 1 221 ? 52.695  -9.909  3.721   1.00 0.00 ? 221 SER A OG   1  
ATOM 3273  H H    . SER A 1 221 ? 52.138  -10.627 -0.136  1.00 0.00 ? 221 SER A H    1  
ATOM 3274  H HA   . SER A 1 221 ? 51.301  -8.742  1.922   1.00 0.00 ? 221 SER A HA   1  
ATOM 3275  H HB2  . SER A 1 221 ? 51.826  -11.169 2.363   1.00 0.00 ? 221 SER A HB2  1  
ATOM 3276  H HB3  . SER A 1 221 ? 53.518  -10.790 2.051   1.00 0.00 ? 221 SER A HB3  1  
ATOM 3277  H HG   . SER A 1 221 ? 52.432  -8.985  3.728   1.00 0.00 ? 221 SER A HG   1  
ATOM 3278  N N    . ALA A 1 222 ? 52.980  -6.959  1.511   1.00 0.00 ? 222 ALA A N    1  
ATOM 3279  C CA   . ALA A 1 222 ? 53.987  -5.894  1.447   1.00 0.00 ? 222 ALA A CA   1  
ATOM 3280  C C    . ALA A 1 222 ? 54.307  -5.412  2.858   1.00 0.00 ? 222 ALA A C    1  
ATOM 3281  O O    . ALA A 1 222 ? 53.423  -5.359  3.712   1.00 0.00 ? 222 ALA A O    1  
ATOM 3282  C CB   . ALA A 1 222 ? 53.454  -4.736  0.617   1.00 0.00 ? 222 ALA A CB   1  
ATOM 3283  H H    . ALA A 1 222 ? 52.047  -6.720  1.691   1.00 0.00 ? 222 ALA A H    1  
ATOM 3284  H HA   . ALA A 1 222 ? 54.891  -6.268  0.987   1.00 0.00 ? 222 ALA A HA   1  
ATOM 3285  H HB1  . ALA A 1 222 ? 52.538  -4.370  1.056   1.00 0.00 ? 222 ALA A HB1  1  
ATOM 3286  H HB2  . ALA A 1 222 ? 53.260  -5.074  -0.390  1.00 0.00 ? 222 ALA A HB2  1  
ATOM 3287  H HB3  . ALA A 1 222 ? 54.186  -3.942  0.595   1.00 0.00 ? 222 ALA A HB3  1  
ATOM 3288  N N    . SER A 1 223 ? 55.568  -5.066  3.109   1.00 0.00 ? 223 SER A N    1  
ATOM 3289  C CA   . SER A 1 223 ? 55.956  -4.600  4.439   1.00 0.00 ? 223 SER A CA   1  
ATOM 3290  C C    . SER A 1 223 ? 57.314  -3.912  4.419   1.00 0.00 ? 223 SER A C    1  
ATOM 3291  O O    . SER A 1 223 ? 58.289  -4.446  3.891   1.00 0.00 ? 223 SER A O    1  
ATOM 3292  C CB   . SER A 1 223 ? 56.000  -5.782  5.407   1.00 0.00 ? 223 SER A CB   1  
ATOM 3293  O OG   . SER A 1 223 ? 54.747  -6.451  5.391   1.00 0.00 ? 223 SER A OG   1  
ATOM 3294  H H    . SER A 1 223 ? 56.241  -5.127  2.399   1.00 0.00 ? 223 SER A H    1  
ATOM 3295  H HA   . SER A 1 223 ? 55.218  -3.895  4.792   1.00 0.00 ? 223 SER A HA   1  
ATOM 3296  H HB2  . SER A 1 223 ? 56.773  -6.468  5.106   1.00 0.00 ? 223 SER A HB2  1  
ATOM 3297  H HB3  . SER A 1 223 ? 56.214  -5.419  6.405   1.00 0.00 ? 223 SER A HB3  1  
ATOM 3298  H HG   . SER A 1 223 ? 54.294  -6.253  6.213   1.00 0.00 ? 223 SER A HG   1  
ATOM 3299  N N    . LYS A 1 224 ? 57.370  -2.727  5.023   1.00 0.00 ? 224 LYS A N    1  
ATOM 3300  C CA   . LYS A 1 224 ? 58.612  -1.967  5.104   1.00 0.00 ? 224 LYS A CA   1  
ATOM 3301  C C    . LYS A 1 224 ? 59.447  -2.487  6.267   1.00 0.00 ? 224 LYS A C    1  
ATOM 3302  O O    . LYS A 1 224 ? 58.908  -2.815  7.325   1.00 0.00 ? 224 LYS A O    1  
ATOM 3303  C CB   . LYS A 1 224 ? 58.303  -0.482  5.318   1.00 0.00 ? 224 LYS A CB   1  
ATOM 3304  C CG   . LYS A 1 224 ? 57.566  -0.296  6.651   1.00 0.00 ? 224 LYS A CG   1  
ATOM 3305  C CD   . LYS A 1 224 ? 56.975  1.118   6.729   1.00 0.00 ? 224 LYS A CD   1  
ATOM 3306  C CE   . LYS A 1 224 ? 58.098  2.162   6.745   1.00 0.00 ? 224 LYS A CE   1  
ATOM 3307  N NZ   . LYS A 1 224 ? 57.554  3.464   7.224   1.00 0.00 ? 224 LYS A NZ   1  
ATOM 3308  H H    . LYS A 1 224 ? 56.560  -2.365  5.441   1.00 0.00 ? 224 LYS A H    1  
ATOM 3309  H HA   . LYS A 1 224 ? 59.169  -2.083  4.185   1.00 0.00 ? 224 LYS A HA   1  
ATOM 3310  H HB2  . LYS A 1 224 ? 59.228  0.077   5.336   1.00 0.00 ? 224 LYS A HB2  1  
ATOM 3311  H HB3  . LYS A 1 224 ? 57.681  -0.124  4.511   1.00 0.00 ? 224 LYS A HB3  1  
ATOM 3312  H HG2  . LYS A 1 224 ? 56.767  -1.022  6.725   1.00 0.00 ? 224 LYS A HG2  1  
ATOM 3313  H HG3  . LYS A 1 224 ? 58.258  -0.441  7.467   1.00 0.00 ? 224 LYS A HG3  1  
ATOM 3314  H HD2  . LYS A 1 224 ? 56.339  1.287   5.873   1.00 0.00 ? 224 LYS A HD2  1  
ATOM 3315  H HD3  . LYS A 1 224 ? 56.390  1.211   7.633   1.00 0.00 ? 224 LYS A HD3  1  
ATOM 3316  H HE2  . LYS A 1 224 ? 58.889  1.840   7.407   1.00 0.00 ? 224 LYS A HE2  1  
ATOM 3317  H HE3  . LYS A 1 224 ? 58.491  2.284   5.747   1.00 0.00 ? 224 LYS A HE3  1  
ATOM 3318  H HZ1  . LYS A 1 224 ? 58.127  4.242   6.839   1.00 0.00 ? 224 LYS A HZ1  1  
ATOM 3319  H HZ2  . LYS A 1 224 ? 57.587  3.491   8.264   1.00 0.00 ? 224 LYS A HZ2  1  
ATOM 3320  H HZ3  . LYS A 1 224 ? 56.570  3.569   6.904   1.00 0.00 ? 224 LYS A HZ3  1  
ATOM 3321  N N    . GLY A 1 225 ? 60.756  -2.564  6.076   1.00 0.00 ? 225 GLY A N    1  
ATOM 3322  C CA   . GLY A 1 225 ? 61.624  -3.051  7.130   1.00 0.00 ? 225 GLY A CA   1  
ATOM 3323  C C    . GLY A 1 225 ? 63.085  -3.011  6.738   1.00 0.00 ? 225 GLY A C    1  
ATOM 3324  O O    . GLY A 1 225 ? 63.532  -3.777  5.885   1.00 0.00 ? 225 GLY A O    1  
ATOM 3325  H H    . GLY A 1 225 ? 61.140  -2.289  5.217   1.00 0.00 ? 225 GLY A H    1  
ATOM 3326  H HA2  . GLY A 1 225 ? 61.481  -2.441  8.009   1.00 0.00 ? 225 GLY A HA2  1  
ATOM 3327  H HA3  . GLY A 1 225 ? 61.352  -4.069  7.363   1.00 0.00 ? 225 GLY A HA3  1  
ATOM 3328  N N    . ALA A 1 226 ? 63.835  -2.120  7.376   1.00 0.00 ? 226 ALA A N    1  
ATOM 3329  C CA   . ALA A 1 226 ? 65.257  -1.998  7.092   1.00 0.00 ? 226 ALA A CA   1  
ATOM 3330  C C    . ALA A 1 226 ? 65.991  -3.239  7.584   1.00 0.00 ? 226 ALA A C    1  
ATOM 3331  O O    . ALA A 1 226 ? 65.852  -3.635  8.742   1.00 0.00 ? 226 ALA A O    1  
ATOM 3332  C CB   . ALA A 1 226 ? 65.817  -0.759  7.772   1.00 0.00 ? 226 ALA A CB   1  
ATOM 3333  H H    . ALA A 1 226 ? 63.426  -1.540  8.052   1.00 0.00 ? 226 ALA A H    1  
ATOM 3334  H HA   . ALA A 1 226 ? 65.396  -1.907  6.026   1.00 0.00 ? 226 ALA A HA   1  
ATOM 3335  H HB1  . ALA A 1 226 ? 65.738  -0.867  8.843   1.00 0.00 ? 226 ALA A HB1  1  
ATOM 3336  H HB2  . ALA A 1 226 ? 65.257  0.109   7.455   1.00 0.00 ? 226 ALA A HB2  1  
ATOM 3337  H HB3  . ALA A 1 226 ? 66.855  -0.636  7.498   1.00 0.00 ? 226 ALA A HB3  1  
ATOM 3338  N N    . THR A 1 227 ? 66.769  -3.855  6.697   1.00 0.00 ? 227 THR A N    1  
ATOM 3339  C CA   . THR A 1 227 ? 67.521  -5.061  7.048   1.00 0.00 ? 227 THR A CA   1  
ATOM 3340  C C    . THR A 1 227 ? 68.804  -5.149  6.230   1.00 0.00 ? 227 THR A C    1  
ATOM 3341  O O    . THR A 1 227 ? 68.936  -4.501  5.192   1.00 0.00 ? 227 THR A O    1  
ATOM 3342  C CB   . THR A 1 227 ? 66.685  -6.328  6.782   1.00 0.00 ? 227 THR A CB   1  
ATOM 3343  O OG1  . THR A 1 227 ? 66.254  -6.332  5.428   1.00 0.00 ? 227 THR A OG1  1  
ATOM 3344  C CG2  . THR A 1 227 ? 65.467  -6.343  7.708   1.00 0.00 ? 227 THR A CG2  1  
ATOM 3345  H H    . THR A 1 227 ? 66.836  -3.493  5.789   1.00 0.00 ? 227 THR A H    1  
ATOM 3346  H HA   . THR A 1 227 ? 67.782  -5.031  8.097   1.00 0.00 ? 227 THR A HA   1  
ATOM 3347  H HB   . THR A 1 227 ? 67.287  -7.203  6.972   1.00 0.00 ? 227 THR A HB   1  
ATOM 3348  H HG1  . THR A 1 227 ? 66.999  -6.587  4.880   1.00 0.00 ? 227 THR A HG1  1  
ATOM 3349  H HG21 . THR A 1 227 ? 64.769  -5.579  7.398   1.00 0.00 ? 227 THR A HG21 1  
ATOM 3350  H HG22 . THR A 1 227 ? 65.784  -6.151  8.723   1.00 0.00 ? 227 THR A HG22 1  
ATOM 3351  H HG23 . THR A 1 227 ? 64.988  -7.310  7.657   1.00 0.00 ? 227 THR A HG23 1  
ATOM 3352  N N    . ASP A 1 228 ? 69.746  -5.954  6.708   1.00 0.00 ? 228 ASP A N    1  
ATOM 3353  C CA   . ASP A 1 228 ? 71.019  -6.121  6.016   1.00 0.00 ? 228 ASP A CA   1  
ATOM 3354  C C    . ASP A 1 228 ? 70.815  -6.827  4.680   1.00 0.00 ? 228 ASP A C    1  
ATOM 3355  O O    . ASP A 1 228 ? 70.766  -8.057  4.616   1.00 0.00 ? 228 ASP A O    1  
ATOM 3356  C CB   . ASP A 1 228 ? 71.981  -6.933  6.883   1.00 0.00 ? 228 ASP A CB   1  
ATOM 3357  C CG   . ASP A 1 228 ? 71.341  -8.277  7.237   1.00 0.00 ? 228 ASP A CG   1  
ATOM 3358  O OD1  . ASP A 1 228 ? 70.508  -8.299  8.128   1.00 0.00 ? 228 ASP A OD1  1  
ATOM 3359  O OD2  . ASP A 1 228 ? 71.694  -9.262  6.610   1.00 0.00 ? 228 ASP A OD2  1  
ATOM 3360  H H    . ASP A 1 228 ? 69.583  -6.444  7.541   1.00 0.00 ? 228 ASP A H    1  
ATOM 3361  H HA   . ASP A 1 228 ? 71.449  -5.148  5.836   1.00 0.00 ? 228 ASP A HA   1  
ATOM 3362  H HB2  . ASP A 1 228 ? 72.899  -7.104  6.340   1.00 0.00 ? 228 ASP A HB2  1  
ATOM 3363  H HB3  . ASP A 1 228 ? 72.195  -6.390  7.792   1.00 0.00 ? 228 ASP A HB3  1  
ATOM 3364  N N    . ASP A 1 229 ? 70.698  -6.040  3.614   1.00 0.00 ? 229 ASP A N    1  
ATOM 3365  C CA   . ASP A 1 229 ? 70.502  -6.587  2.271   1.00 0.00 ? 229 ASP A CA   1  
ATOM 3366  C C    . ASP A 1 229 ? 71.849  -6.894  1.623   1.00 0.00 ? 229 ASP A C    1  
ATOM 3367  O O    . ASP A 1 229 ? 71.976  -6.885  0.399   1.00 0.00 ? 229 ASP A O    1  
ATOM 3368  C CB   . ASP A 1 229 ? 69.745  -5.575  1.413   1.00 0.00 ? 229 ASP A CB   1  
ATOM 3369  C CG   . ASP A 1 229 ? 68.332  -5.386  1.972   1.00 0.00 ? 229 ASP A CG   1  
ATOM 3370  O OD1  . ASP A 1 229 ? 67.714  -6.382  2.311   1.00 0.00 ? 229 ASP A OD1  1  
ATOM 3371  O OD2  . ASP A 1 229 ? 67.896  -4.251  2.052   1.00 0.00 ? 229 ASP A OD2  1  
ATOM 3372  H H    . ASP A 1 229 ? 70.748  -5.069  3.730   1.00 0.00 ? 229 ASP A H    1  
ATOM 3373  H HA   . ASP A 1 229 ? 69.923  -7.497  2.332   1.00 0.00 ? 229 ASP A HA   1  
ATOM 3374  H HB2  . ASP A 1 229 ? 70.266  -4.630  1.428   1.00 0.00 ? 229 ASP A HB2  1  
ATOM 3375  H HB3  . ASP A 1 229 ? 69.683  -5.937  0.398   1.00 0.00 ? 229 ASP A HB3  1  
ATOM 3376  N N    . THR A 1 230 ? 72.851  -7.155  2.455   1.00 0.00 ? 230 THR A N    1  
ATOM 3377  C CA   . THR A 1 230 ? 74.191  -7.451  1.962   1.00 0.00 ? 230 THR A CA   1  
ATOM 3378  C C    . THR A 1 230 ? 74.226  -8.779  1.213   1.00 0.00 ? 230 THR A C    1  
ATOM 3379  O O    . THR A 1 230 ? 75.043  -8.965  0.311   1.00 0.00 ? 230 THR A O    1  
ATOM 3380  C CB   . THR A 1 230 ? 75.197  -7.523  3.127   1.00 0.00 ? 230 THR A CB   1  
ATOM 3381  O OG1  . THR A 1 230 ? 75.090  -6.347  3.915   1.00 0.00 ? 230 THR A OG1  1  
ATOM 3382  C CG2  . THR A 1 230 ? 76.617  -7.641  2.571   1.00 0.00 ? 230 THR A CG2  1  
ATOM 3383  H H    . THR A 1 230 ? 72.689  -7.140  3.422   1.00 0.00 ? 230 THR A H    1  
ATOM 3384  H HA   . THR A 1 230 ? 74.499  -6.666  1.291   1.00 0.00 ? 230 THR A HA   1  
ATOM 3385  H HB   . THR A 1 230 ? 74.981  -8.387  3.736   1.00 0.00 ? 230 THR A HB   1  
ATOM 3386  H HG1  . THR A 1 230 ? 75.961  -6.145  4.267   1.00 0.00 ? 230 THR A HG1  1  
ATOM 3387  H HG21 . THR A 1 230 ? 77.327  -7.582  3.383   1.00 0.00 ? 230 THR A HG21 1  
ATOM 3388  H HG22 . THR A 1 230 ? 76.799  -6.834  1.875   1.00 0.00 ? 230 THR A HG22 1  
ATOM 3389  H HG23 . THR A 1 230 ? 76.728  -8.586  2.063   1.00 0.00 ? 230 THR A HG23 1  
ATOM 3390  N N    . SER A 1 231 ? 73.347  -9.709  1.600   1.00 0.00 ? 231 SER A N    1  
ATOM 3391  C CA   . SER A 1 231 ? 73.295  -11.036 0.970   1.00 0.00 ? 231 SER A CA   1  
ATOM 3392  C C    . SER A 1 231 ? 71.961  -11.273 0.263   1.00 0.00 ? 231 SER A C    1  
ATOM 3393  O O    . SER A 1 231 ? 71.703  -12.379 -0.214  1.00 0.00 ? 231 SER A O    1  
ATOM 3394  C CB   . SER A 1 231 ? 73.492  -12.113 2.036   1.00 0.00 ? 231 SER A CB   1  
ATOM 3395  O OG   . SER A 1 231 ? 73.577  -13.386 1.409   1.00 0.00 ? 231 SER A OG   1  
ATOM 3396  H H    . SER A 1 231 ? 72.729  -9.505  2.334   1.00 0.00 ? 231 SER A H    1  
ATOM 3397  H HA   . SER A 1 231 ? 74.089  -11.130 0.242   1.00 0.00 ? 231 SER A HA   1  
ATOM 3398  H HB2  . SER A 1 231 ? 74.403  -11.924 2.578   1.00 0.00 ? 231 SER A HB2  1  
ATOM 3399  H HB3  . SER A 1 231 ? 72.657  -12.094 2.724   1.00 0.00 ? 231 SER A HB3  1  
ATOM 3400  H HG   . SER A 1 231 ? 73.454  -14.058 2.083   1.00 0.00 ? 231 SER A HG   1  
ATOM 3401  N N    . LEU A 1 232 ? 71.109  -10.247 0.205   1.00 0.00 ? 232 LEU A N    1  
ATOM 3402  C CA   . LEU A 1 232 ? 69.800  -10.386 -0.443  1.00 0.00 ? 232 LEU A CA   1  
ATOM 3403  C C    . LEU A 1 232 ? 69.928  -11.179 -1.755  1.00 0.00 ? 232 LEU A C    1  
ATOM 3404  O O    . LEU A 1 232 ? 68.998  -11.869 -2.170  1.00 0.00 ? 232 LEU A O    1  
ATOM 3405  C CB   . LEU A 1 232 ? 69.189  -8.983  -0.704  1.00 0.00 ? 232 LEU A CB   1  
ATOM 3406  C CG   . LEU A 1 232 ? 67.668  -8.984  -0.450  1.00 0.00 ? 232 LEU A CG   1  
ATOM 3407  C CD1  . LEU A 1 232 ? 67.108  -7.587  -0.735  1.00 0.00 ? 232 LEU A CD1  1  
ATOM 3408  C CD2  . LEU A 1 232 ? 66.978  -10.010 -1.363  1.00 0.00 ? 232 LEU A CD2  1  
ATOM 3409  H H    . LEU A 1 232 ? 71.356  -9.391  0.616   1.00 0.00 ? 232 LEU A H    1  
ATOM 3410  H HA   . LEU A 1 232 ? 69.156  -10.937 0.228   1.00 0.00 ? 232 LEU A HA   1  
ATOM 3411  H HB2  . LEU A 1 232 ? 69.654  -8.272  -0.036  1.00 0.00 ? 232 LEU A HB2  1  
ATOM 3412  H HB3  . LEU A 1 232 ? 69.379  -8.680  -1.724  1.00 0.00 ? 232 LEU A HB3  1  
ATOM 3413  H HG   . LEU A 1 232 ? 67.481  -9.237  0.585   1.00 0.00 ? 232 LEU A HG   1  
ATOM 3414  H HD11 . LEU A 1 232 ? 67.562  -6.874  -0.067  1.00 0.00 ? 232 LEU A HD11 1  
ATOM 3415  H HD12 . LEU A 1 232 ? 66.039  -7.590  -0.586  1.00 0.00 ? 232 LEU A HD12 1  
ATOM 3416  H HD13 . LEU A 1 232 ? 67.328  -7.314  -1.758  1.00 0.00 ? 232 LEU A HD13 1  
ATOM 3417  H HD21 . LEU A 1 232 ? 65.915  -9.815  -1.392  1.00 0.00 ? 232 LEU A HD21 1  
ATOM 3418  H HD22 . LEU A 1 232 ? 67.143  -11.004 -0.979  1.00 0.00 ? 232 LEU A HD22 1  
ATOM 3419  H HD23 . LEU A 1 232 ? 67.383  -9.937  -2.360  1.00 0.00 ? 232 LEU A HD23 1  
ATOM 3420  N N    . ILE A 1 233 ? 71.103  -11.093 -2.381  1.00 0.00 ? 233 ILE A N    1  
ATOM 3421  C CA   . ILE A 1 233 ? 71.366  -11.824 -3.624  1.00 0.00 ? 233 ILE A CA   1  
ATOM 3422  C C    . ILE A 1 233 ? 72.867  -12.033 -3.809  1.00 0.00 ? 233 ILE A C    1  
ATOM 3423  O O    . ILE A 1 233 ? 73.676  -11.237 -3.334  1.00 0.00 ? 233 ILE A O    1  
ATOM 3424  C CB   . ILE A 1 233 ? 70.819  -11.080 -4.865  1.00 0.00 ? 233 ILE A CB   1  
ATOM 3425  C CG1  . ILE A 1 233 ? 71.388  -9.648  -4.921  1.00 0.00 ? 233 ILE A CG1  1  
ATOM 3426  C CG2  . ILE A 1 233 ? 69.287  -11.025 -4.806  1.00 0.00 ? 233 ILE A CG2  1  
ATOM 3427  C CD1  . ILE A 1 233 ? 71.027  -8.992  -6.263  1.00 0.00 ? 233 ILE A CD1  1  
ATOM 3428  H H    . ILE A 1 233 ? 71.815  -10.545 -1.989  1.00 0.00 ? 233 ILE A H    1  
ATOM 3429  H HA   . ILE A 1 233 ? 70.893  -12.794 -3.566  1.00 0.00 ? 233 ILE A HA   1  
ATOM 3430  H HB   . ILE A 1 233 ? 71.116  -11.621 -5.752  1.00 0.00 ? 233 ILE A HB   1  
ATOM 3431  H HG12 . ILE A 1 233 ? 70.974  -9.063  -4.113  1.00 0.00 ? 233 ILE A HG12 1  
ATOM 3432  H HG13 . ILE A 1 233 ? 72.462  -9.680  -4.823  1.00 0.00 ? 233 ILE A HG13 1  
ATOM 3433  H HG21 . ILE A 1 233 ? 68.900  -12.000 -4.550  1.00 0.00 ? 233 ILE A HG21 1  
ATOM 3434  H HG22 . ILE A 1 233 ? 68.901  -10.729 -5.769  1.00 0.00 ? 233 ILE A HG22 1  
ATOM 3435  H HG23 . ILE A 1 233 ? 68.979  -10.309 -4.060  1.00 0.00 ? 233 ILE A HG23 1  
ATOM 3436  H HD11 . ILE A 1 233 ? 71.651  -8.123  -6.416  1.00 0.00 ? 233 ILE A HD11 1  
ATOM 3437  H HD12 . ILE A 1 233 ? 69.992  -8.692  -6.251  1.00 0.00 ? 233 ILE A HD12 1  
ATOM 3438  H HD13 . ILE A 1 233 ? 71.191  -9.693  -7.069  1.00 0.00 ? 233 ILE A HD13 1  
ATOM 3439  N N    . ASP A 1 234 ? 73.230  -13.106 -4.508  1.00 0.00 ? 234 ASP A N    1  
ATOM 3440  C CA   . ASP A 1 234 ? 74.637  -13.405 -4.755  1.00 0.00 ? 234 ASP A CA   1  
ATOM 3441  C C    . ASP A 1 234 ? 75.191  -12.485 -5.840  1.00 0.00 ? 234 ASP A C    1  
ATOM 3442  O O    . ASP A 1 234 ? 74.988  -12.724 -7.029  1.00 0.00 ? 234 ASP A O    1  
ATOM 3443  C CB   . ASP A 1 234 ? 74.791  -14.863 -5.195  1.00 0.00 ? 234 ASP A CB   1  
ATOM 3444  C CG   . ASP A 1 234 ? 74.457  -15.787 -4.022  1.00 0.00 ? 234 ASP A CG   1  
ATOM 3445  O OD1  . ASP A 1 234 ? 73.289  -16.096 -3.850  1.00 0.00 ? 234 ASP A OD1  1  
ATOM 3446  O OD2  . ASP A 1 234 ? 75.376  -16.171 -3.315  1.00 0.00 ? 234 ASP A OD2  1  
ATOM 3447  H H    . ASP A 1 234 ? 72.540  -13.702 -4.866  1.00 0.00 ? 234 ASP A H    1  
ATOM 3448  H HA   . ASP A 1 234 ? 75.198  -13.254 -3.845  1.00 0.00 ? 234 ASP A HA   1  
ATOM 3449  H HB2  . ASP A 1 234 ? 74.117  -15.065 -6.015  1.00 0.00 ? 234 ASP A HB2  1  
ATOM 3450  H HB3  . ASP A 1 234 ? 75.807  -15.039 -5.511  1.00 0.00 ? 234 ASP A HB3  1  
ATOM 3451  N N    . SER A 1 235 ? 75.880  -11.430 -5.417  1.00 0.00 ? 235 SER A N    1  
ATOM 3452  C CA   . SER A 1 235 ? 76.452  -10.468 -6.356  1.00 0.00 ? 235 SER A CA   1  
ATOM 3453  C C    . SER A 1 235 ? 77.520  -11.118 -7.235  1.00 0.00 ? 235 SER A C    1  
ATOM 3454  O O    . SER A 1 235 ? 78.001  -10.510 -8.190  1.00 0.00 ? 235 SER A O    1  
ATOM 3455  C CB   . SER A 1 235 ? 77.073  -9.304  -5.585  1.00 0.00 ? 235 SER A CB   1  
ATOM 3456  O OG   . SER A 1 235 ? 77.473  -8.294  -6.502  1.00 0.00 ? 235 SER A OG   1  
ATOM 3457  H H    . SER A 1 235 ? 76.001  -11.291 -4.454  1.00 0.00 ? 235 SER A H    1  
ATOM 3458  H HA   . SER A 1 235 ? 75.665  -10.082 -6.984  1.00 0.00 ? 235 SER A HA   1  
ATOM 3459  H HB2  . SER A 1 235 ? 76.349  -8.894  -4.901  1.00 0.00 ? 235 SER A HB2  1  
ATOM 3460  H HB3  . SER A 1 235 ? 77.931  -9.659  -5.027  1.00 0.00 ? 235 SER A HB3  1  
ATOM 3461  H HG   . SER A 1 235 ? 76.926  -8.371  -7.286  1.00 0.00 ? 235 SER A HG   1  
ATOM 3462  N N    . THR A 1 236 ? 77.900  -12.348 -6.896  1.00 0.00 ? 236 THR A N    1  
ATOM 3463  C CA   . THR A 1 236 ? 78.933  -13.065 -7.651  1.00 0.00 ? 236 THR A CA   1  
ATOM 3464  C C    . THR A 1 236 ? 78.364  -13.743 -8.897  1.00 0.00 ? 236 THR A C    1  
ATOM 3465  O O    . THR A 1 236 ? 79.118  -14.203 -9.754  1.00 0.00 ? 236 THR A O    1  
ATOM 3466  C CB   . THR A 1 236 ? 79.590  -14.147 -6.773  1.00 0.00 ? 236 THR A CB   1  
ATOM 3467  O OG1  . THR A 1 236 ? 78.611  -15.102 -6.390  1.00 0.00 ? 236 THR A OG1  1  
ATOM 3468  C CG2  . THR A 1 236 ? 80.191  -13.499 -5.525  1.00 0.00 ? 236 THR A CG2  1  
ATOM 3469  H H    . THR A 1 236 ? 77.493  -12.775 -6.114  1.00 0.00 ? 236 THR A H    1  
ATOM 3470  H HA   . THR A 1 236 ? 79.697  -12.364 -7.955  1.00 0.00 ? 236 THR A HA   1  
ATOM 3471  H HB   . THR A 1 236 ? 80.372  -14.637 -7.331  1.00 0.00 ? 236 THR A HB   1  
ATOM 3472  H HG1  . THR A 1 236 ? 78.889  -15.495 -5.559  1.00 0.00 ? 236 THR A HG1  1  
ATOM 3473  H HG21 . THR A 1 236 ? 80.621  -14.264 -4.895  1.00 0.00 ? 236 THR A HG21 1  
ATOM 3474  H HG22 . THR A 1 236 ? 79.417  -12.978 -4.982  1.00 0.00 ? 236 THR A HG22 1  
ATOM 3475  H HG23 . THR A 1 236 ? 80.959  -12.799 -5.817  1.00 0.00 ? 236 THR A HG23 1  
ATOM 3476  N N    . LYS A 1 237 ? 77.035  -13.819 -8.995  1.00 0.00 ? 237 LYS A N    1  
ATOM 3477  C CA   . LYS A 1 237 ? 76.383  -14.463 -10.147 1.00 0.00 ? 237 LYS A CA   1  
ATOM 3478  C C    . LYS A 1 237 ? 75.835  -13.428 -11.127 1.00 0.00 ? 237 LYS A C    1  
ATOM 3479  O O    . LYS A 1 237 ? 75.135  -13.775 -12.077 1.00 0.00 ? 237 LYS A O    1  
ATOM 3480  C CB   . LYS A 1 237 ? 75.229  -15.350 -9.655  1.00 0.00 ? 237 LYS A CB   1  
ATOM 3481  C CG   . LYS A 1 237 ? 75.759  -16.455 -8.707  1.00 0.00 ? 237 LYS A CG   1  
ATOM 3482  C CD   . LYS A 1 237 ? 76.225  -17.695 -9.511  1.00 0.00 ? 237 LYS A CD   1  
ATOM 3483  C CE   . LYS A 1 237 ? 75.037  -18.628 -9.797  1.00 0.00 ? 237 LYS A CE   1  
ATOM 3484  N NZ   . LYS A 1 237 ? 74.713  -19.408 -8.569  1.00 0.00 ? 237 LYS A NZ   1  
ATOM 3485  H H    . LYS A 1 237 ? 76.479  -13.444 -8.280  1.00 0.00 ? 237 LYS A H    1  
ATOM 3486  H HA   . LYS A 1 237 ? 77.098  -15.087 -10.668 1.00 0.00 ? 237 LYS A HA   1  
ATOM 3487  H HB2  . LYS A 1 237 ? 74.516  -14.732 -9.125  1.00 0.00 ? 237 LYS A HB2  1  
ATOM 3488  H HB3  . LYS A 1 237 ? 74.741  -15.801 -10.506 1.00 0.00 ? 237 LYS A HB3  1  
ATOM 3489  H HG2  . LYS A 1 237 ? 76.593  -16.068 -8.133  1.00 0.00 ? 237 LYS A HG2  1  
ATOM 3490  H HG3  . LYS A 1 237 ? 74.973  -16.746 -8.023  1.00 0.00 ? 237 LYS A HG3  1  
ATOM 3491  H HD2  . LYS A 1 237 ? 76.664  -17.382 -10.447 1.00 0.00 ? 237 LYS A HD2  1  
ATOM 3492  H HD3  . LYS A 1 237 ? 76.965  -18.236 -8.938  1.00 0.00 ? 237 LYS A HD3  1  
ATOM 3493  H HE2  . LYS A 1 237 ? 74.176  -18.045 -10.088 1.00 0.00 ? 237 LYS A HE2  1  
ATOM 3494  H HE3  . LYS A 1 237 ? 75.296  -19.308 -10.595 1.00 0.00 ? 237 LYS A HE3  1  
ATOM 3495  H HZ1  . LYS A 1 237 ? 74.211  -20.279 -8.833  1.00 0.00 ? 237 LYS A HZ1  1  
ATOM 3496  H HZ2  . LYS A 1 237 ? 74.110  -18.835 -7.943  1.00 0.00 ? 237 LYS A HZ2  1  
ATOM 3497  H HZ3  . LYS A 1 237 ? 75.592  -19.655 -8.072  1.00 0.00 ? 237 LYS A HZ3  1  
ATOM 3498  N N    . LEU A 1 238 ? 76.150  -12.157 -10.891 1.00 0.00 ? 238 LEU A N    1  
ATOM 3499  C CA   . LEU A 1 238 ? 75.671  -11.078 -11.759 1.00 0.00 ? 238 LEU A CA   1  
ATOM 3500  C C    . LEU A 1 238 ? 76.544  -10.959 -13.009 1.00 0.00 ? 238 LEU A C    1  
ATOM 3501  O O    . LEU A 1 238 ? 77.772  -10.923 -12.926 1.00 0.00 ? 238 LEU A O    1  
ATOM 3502  C CB   . LEU A 1 238 ? 75.675  -9.743  -10.981 1.00 0.00 ? 238 LEU A CB   1  
ATOM 3503  C CG   . LEU A 1 238 ? 74.430  -9.609  -10.067 1.00 0.00 ? 238 LEU A CG   1  
ATOM 3504  C CD1  . LEU A 1 238 ? 73.178  -9.236  -10.885 1.00 0.00 ? 238 LEU A CD1  1  
ATOM 3505  C CD2  . LEU A 1 238 ? 74.180  -10.919 -9.300  1.00 0.00 ? 238 LEU A CD2  1  
ATOM 3506  H H    . LEU A 1 238 ? 76.708  -11.936 -10.117 1.00 0.00 ? 238 LEU A H    1  
ATOM 3507  H HA   . LEU A 1 238 ? 74.668  -11.295 -12.075 1.00 0.00 ? 238 LEU A HA   1  
ATOM 3508  H HB2  . LEU A 1 238 ? 76.564  -9.701  -10.369 1.00 0.00 ? 238 LEU A HB2  1  
ATOM 3509  H HB3  . LEU A 1 238 ? 75.693  -8.917  -11.678 1.00 0.00 ? 238 LEU A HB3  1  
ATOM 3510  H HG   . LEU A 1 238 ? 74.616  -8.819  -9.352  1.00 0.00 ? 238 LEU A HG   1  
ATOM 3511  H HD11 . LEU A 1 238 ? 73.419  -8.451  -11.584 1.00 0.00 ? 238 LEU A HD11 1  
ATOM 3512  H HD12 . LEU A 1 238 ? 72.407  -8.888  -10.213 1.00 0.00 ? 238 LEU A HD12 1  
ATOM 3513  H HD13 . LEU A 1 238 ? 72.814  -10.097 -11.422 1.00 0.00 ? 238 LEU A HD13 1  
ATOM 3514  H HD21 . LEU A 1 238 ? 73.500  -10.730 -8.483  1.00 0.00 ? 238 LEU A HD21 1  
ATOM 3515  H HD22 . LEU A 1 238 ? 75.112  -11.289 -8.910  1.00 0.00 ? 238 LEU A HD22 1  
ATOM 3516  H HD23 . LEU A 1 238 ? 73.750  -11.657 -9.959  1.00 0.00 ? 238 LEU A HD23 1  
ATOM 3517  N N    . LYS A 1 239 ? 75.884  -10.882 -14.167 1.00 0.00 ? 239 LYS A N    1  
ATOM 3518  C CA   . LYS A 1 239 ? 76.572  -10.749 -15.457 1.00 0.00 ? 239 LYS A CA   1  
ATOM 3519  C C    . LYS A 1 239 ? 76.075  -9.495  -16.169 1.00 0.00 ? 239 LYS A C    1  
ATOM 3520  O O    . LYS A 1 239 ? 74.875  -9.231  -16.202 1.00 0.00 ? 239 LYS A O    1  
ATOM 3521  C CB   . LYS A 1 239 ? 76.296  -11.979 -16.325 1.00 0.00 ? 239 LYS A CB   1  
ATOM 3522  C CG   . LYS A 1 239 ? 76.815  -13.237 -15.614 1.00 0.00 ? 239 LYS A CG   1  
ATOM 3523  C CD   . LYS A 1 239 ? 76.247  -14.493 -16.288 1.00 0.00 ? 239 LYS A CD   1  
ATOM 3524  C CE   . LYS A 1 239 ? 76.784  -14.613 -17.719 1.00 0.00 ? 239 LYS A CE   1  
ATOM 3525  N NZ   . LYS A 1 239 ? 76.532  -15.992 -18.225 1.00 0.00 ? 239 LYS A NZ   1  
ATOM 3526  H H    . LYS A 1 239 ? 74.903  -10.906 -14.154 1.00 0.00 ? 239 LYS A H    1  
ATOM 3527  H HA   . LYS A 1 239 ? 77.640  -10.661 -15.300 1.00 0.00 ? 239 LYS A HA   1  
ATOM 3528  H HB2  . LYS A 1 239 ? 75.232  -12.069 -16.491 1.00 0.00 ? 239 LYS A HB2  1  
ATOM 3529  H HB3  . LYS A 1 239 ? 76.801  -11.869 -17.272 1.00 0.00 ? 239 LYS A HB3  1  
ATOM 3530  H HG2  . LYS A 1 239 ? 77.894  -13.257 -15.665 1.00 0.00 ? 239 LYS A HG2  1  
ATOM 3531  H HG3  . LYS A 1 239 ? 76.507  -13.219 -14.579 1.00 0.00 ? 239 LYS A HG3  1  
ATOM 3532  H HD2  . LYS A 1 239 ? 76.541  -15.366 -15.721 1.00 0.00 ? 239 LYS A HD2  1  
ATOM 3533  H HD3  . LYS A 1 239 ? 75.170  -14.431 -16.314 1.00 0.00 ? 239 LYS A HD3  1  
ATOM 3534  H HE2  . LYS A 1 239 ? 76.279  -13.902 -18.354 1.00 0.00 ? 239 LYS A HE2  1  
ATOM 3535  H HE3  . LYS A 1 239 ? 77.846  -14.416 -17.728 1.00 0.00 ? 239 LYS A HE3  1  
ATOM 3536  H HZ1  . LYS A 1 239 ? 77.118  -16.669 -17.697 1.00 0.00 ? 239 LYS A HZ1  1  
ATOM 3537  H HZ2  . LYS A 1 239 ? 76.774  -16.038 -19.236 1.00 0.00 ? 239 LYS A HZ2  1  
ATOM 3538  H HZ3  . LYS A 1 239 ? 75.529  -16.232 -18.097 1.00 0.00 ? 239 LYS A HZ3  1  
ATOM 3539  N N    . ALA A 1 240 ? 77.001  -8.722  -16.733 1.00 0.00 ? 240 ALA A N    1  
ATOM 3540  C CA   . ALA A 1 240 ? 76.636  -7.493  -17.432 1.00 0.00 ? 240 ALA A CA   1  
ATOM 3541  C C    . ALA A 1 240 ? 75.816  -7.795  -18.682 1.00 0.00 ? 240 ALA A C    1  
ATOM 3542  O O    . ALA A 1 240 ? 76.231  -8.592  -19.524 1.00 0.00 ? 240 ALA A O    1  
ATOM 3543  C CB   . ALA A 1 240 ? 77.894  -6.728  -17.813 1.00 0.00 ? 240 ALA A CB   1  
ATOM 3544  H H    . ALA A 1 240 ? 77.944  -8.983  -16.680 1.00 0.00 ? 240 ALA A H    1  
ATOM 3545  H HA   . ALA A 1 240 ? 76.046  -6.879  -16.770 1.00 0.00 ? 240 ALA A HA   1  
ATOM 3546  H HB1  . ALA A 1 240 ? 78.405  -7.251  -18.607 1.00 0.00 ? 240 ALA A HB1  1  
ATOM 3547  H HB2  . ALA A 1 240 ? 78.544  -6.653  -16.954 1.00 0.00 ? 240 ALA A HB2  1  
ATOM 3548  H HB3  . ALA A 1 240 ? 77.626  -5.738  -18.149 1.00 0.00 ? 240 ALA A HB3  1  
ATOM 3549  N N    . CYS A 1 241 ? 74.651  -7.151  -18.803 1.00 0.00 ? 241 CYS A N    1  
ATOM 3550  C CA   . CYS A 1 241 ? 73.782  -7.359  -19.966 1.00 0.00 ? 241 CYS A CA   1  
ATOM 3551  C C    . CYS A 1 241 ? 74.146  -6.392  -21.092 1.00 0.00 ? 241 CYS A C    1  
ATOM 3552  O O    . CYS A 1 241 ? 73.573  -6.458  -22.178 1.00 0.00 ? 241 CYS A O    1  
ATOM 3553  C CB   . CYS A 1 241 ? 72.313  -7.137  -19.592 1.00 0.00 ? 241 CYS A CB   1  
ATOM 3554  S SG   . CYS A 1 241 ? 71.872  -8.094  -18.116 1.00 0.00 ? 241 CYS A SG   1  
ATOM 3555  H H    . CYS A 1 241 ? 74.374  -6.526  -18.102 1.00 0.00 ? 241 CYS A H    1  
ATOM 3556  H HA   . CYS A 1 241 ? 73.899  -8.372  -20.325 1.00 0.00 ? 241 CYS A HA   1  
ATOM 3557  H HB2  . CYS A 1 241 ? 72.152  -6.088  -19.392 1.00 0.00 ? 241 CYS A HB2  1  
ATOM 3558  H HB3  . CYS A 1 241 ? 71.687  -7.439  -20.417 1.00 0.00 ? 241 CYS A HB3  1  
ATOM 3559  N N    . VAL A 1 242 ? 75.100  -5.498  -20.823 1.00 0.00 ? 242 VAL A N    1  
ATOM 3560  C CA   . VAL A 1 242 ? 75.544  -4.510  -21.812 1.00 0.00 ? 242 VAL A CA   1  
ATOM 3561  C C    . VAL A 1 242 ? 74.357  -3.895  -22.561 1.00 0.00 ? 242 VAL A C    1  
ATOM 3562  O O    . VAL A 1 242 ? 74.593  -2.956  -23.302 1.00 0.00 ? 242 VAL A O    1  
ATOM 3563  C CB   . VAL A 1 242 ? 76.553  -5.126  -22.825 1.00 0.00 ? 242 VAL A CB   1  
ATOM 3564  C CG1  . VAL A 1 242 ? 75.910  -6.269  -23.629 1.00 0.00 ? 242 VAL A CG1  1  
ATOM 3565  C CG2  . VAL A 1 242 ? 77.059  -4.039  -23.794 1.00 0.00 ? 242 VAL A CG2  1  
ATOM 3566  O OXT  . VAL A 1 242 ? 73.242  -4.126  -22.125 1.00 0.00 ? 242 VAL A OXT  1  
ATOM 3567  H H    . VAL A 1 242 ? 75.522  -5.503  -19.938 1.00 0.00 ? 242 VAL A H    1  
ATOM 3568  H HA   . VAL A 1 242 ? 76.048  -3.715  -21.281 1.00 0.00 ? 242 VAL A HA   1  
ATOM 3569  H HB   . VAL A 1 242 ? 77.393  -5.523  -22.272 1.00 0.00 ? 242 VAL A HB   1  
ATOM 3570  H HG11 . VAL A 1 242 ? 74.960  -5.951  -24.029 1.00 0.00 ? 242 VAL A HG11 1  
ATOM 3571  H HG12 . VAL A 1 242 ? 75.766  -7.127  -22.991 1.00 0.00 ? 242 VAL A HG12 1  
ATOM 3572  H HG13 . VAL A 1 242 ? 76.565  -6.543  -24.444 1.00 0.00 ? 242 VAL A HG13 1  
ATOM 3573  H HG21 . VAL A 1 242 ? 77.992  -4.359  -24.234 1.00 0.00 ? 242 VAL A HG21 1  
ATOM 3574  H HG22 . VAL A 1 242 ? 77.219  -3.115  -23.255 1.00 0.00 ? 242 VAL A HG22 1  
ATOM 3575  H HG23 . VAL A 1 242 ? 76.334  -3.876  -24.577 1.00 0.00 ? 242 VAL A HG23 1  
ATOM 3576  N N    . ALA B 2 1   ? 32.355  -17.694 -20.693 1.00 0.00 ? 1   ALA B N    1  
ATOM 3577  C CA   . ALA B 2 1   ? 33.678  -17.187 -20.345 1.00 0.00 ? 1   ALA B CA   1  
ATOM 3578  C C    . ALA B 2 1   ? 33.872  -17.189 -18.830 1.00 0.00 ? 1   ALA B C    1  
ATOM 3579  O O    . ALA B 2 1   ? 34.000  -16.133 -18.210 1.00 0.00 ? 1   ALA B O    1  
ATOM 3580  C CB   . ALA B 2 1   ? 33.849  -15.776 -20.886 1.00 0.00 ? 1   ALA B CB   1  
ATOM 3581  H H1   . ALA B 2 1   ? 32.443  -18.399 -21.452 1.00 0.00 ? 1   ALA B H1   1  
ATOM 3582  H H2   . ALA B 2 1   ? 31.758  -16.906 -21.018 1.00 0.00 ? 1   ALA B H2   1  
ATOM 3583  H H3   . ALA B 2 1   ? 31.923  -18.139 -19.860 1.00 0.00 ? 1   ALA B H3   1  
ATOM 3584  H HA   . ALA B 2 1   ? 34.426  -17.825 -20.792 1.00 0.00 ? 1   ALA B HA   1  
ATOM 3585  H HB1  . ALA B 2 1   ? 33.234  -15.095 -20.316 1.00 0.00 ? 1   ALA B HB1  1  
ATOM 3586  H HB2  . ALA B 2 1   ? 33.550  -15.750 -21.923 1.00 0.00 ? 1   ALA B HB2  1  
ATOM 3587  H HB3  . ALA B 2 1   ? 34.884  -15.481 -20.801 1.00 0.00 ? 1   ALA B HB3  1  
ATOM 3588  N N    . PRO B 2 2   ? 33.899  -18.383 -18.214 1.00 0.00 ? 2   PRO B N    1  
ATOM 3589  C CA   . PRO B 2 2   ? 34.082  -18.524 -16.760 1.00 0.00 ? 2   PRO B CA   1  
ATOM 3590  C C    . PRO B 2 2   ? 35.187  -17.611 -16.223 1.00 0.00 ? 2   PRO B C    1  
ATOM 3591  O O    . PRO B 2 2   ? 36.340  -17.704 -16.643 1.00 0.00 ? 2   PRO B O    1  
ATOM 3592  C CB   . PRO B 2 2   ? 34.444  -20.007 -16.590 1.00 0.00 ? 2   PRO B CB   1  
ATOM 3593  C CG   . PRO B 2 2   ? 33.734  -20.691 -17.714 1.00 0.00 ? 2   PRO B CG   1  
ATOM 3594  C CD   . PRO B 2 2   ? 33.752  -19.692 -18.880 1.00 0.00 ? 2   PRO B CD   1  
ATOM 3595  H HA   . PRO B 2 2   ? 33.153  -18.320 -16.250 1.00 0.00 ? 2   PRO B HA   1  
ATOM 3596  H HB2  . PRO B 2 2   ? 35.517  -20.147 -16.676 1.00 0.00 ? 2   PRO B HB2  1  
ATOM 3597  H HB3  . PRO B 2 2   ? 34.091  -20.382 -15.639 1.00 0.00 ? 2   PRO B HB3  1  
ATOM 3598  H HG2  . PRO B 2 2   ? 34.250  -21.606 -17.985 1.00 0.00 ? 2   PRO B HG2  1  
ATOM 3599  H HG3  . PRO B 2 2   ? 32.712  -20.909 -17.437 1.00 0.00 ? 2   PRO B HG3  1  
ATOM 3600  H HD2  . PRO B 2 2   ? 34.596  -19.882 -19.532 1.00 0.00 ? 2   PRO B HD2  1  
ATOM 3601  H HD3  . PRO B 2 2   ? 32.827  -19.726 -19.435 1.00 0.00 ? 2   PRO B HD3  1  
ATOM 3602  N N    . MET B 2 3   ? 34.823  -16.734 -15.293 1.00 0.00 ? 3   MET B N    1  
ATOM 3603  C CA   . MET B 2 3   ? 35.789  -15.813 -14.705 1.00 0.00 ? 3   MET B CA   1  
ATOM 3604  C C    . MET B 2 3   ? 36.875  -16.582 -13.958 1.00 0.00 ? 3   MET B C    1  
ATOM 3605  O O    . MET B 2 3   ? 36.658  -17.711 -13.519 1.00 0.00 ? 3   MET B O    1  
ATOM 3606  C CB   . MET B 2 3   ? 35.079  -14.859 -13.741 1.00 0.00 ? 3   MET B CB   1  
ATOM 3607  C CG   . MET B 2 3   ? 36.070  -13.807 -13.234 1.00 0.00 ? 3   MET B CG   1  
ATOM 3608  S SD   . MET B 2 3   ? 35.169  -12.516 -12.341 1.00 0.00 ? 3   MET B SD   1  
ATOM 3609  C CE   . MET B 2 3   ? 36.606  -11.728 -11.572 1.00 0.00 ? 3   MET B CE   1  
ATOM 3610  H H    . MET B 2 3   ? 33.889  -16.707 -14.997 1.00 0.00 ? 3   MET B H    1  
ATOM 3611  H HA   . MET B 2 3   ? 36.248  -15.235 -15.494 1.00 0.00 ? 3   MET B HA   1  
ATOM 3612  H HB2  . MET B 2 3   ? 34.265  -14.369 -14.255 1.00 0.00 ? 3   MET B HB2  1  
ATOM 3613  H HB3  . MET B 2 3   ? 34.691  -15.418 -12.903 1.00 0.00 ? 3   MET B HB3  1  
ATOM 3614  H HG2  . MET B 2 3   ? 36.783  -14.274 -12.571 1.00 0.00 ? 3   MET B HG2  1  
ATOM 3615  H HG3  . MET B 2 3   ? 36.591  -13.369 -14.073 1.00 0.00 ? 3   MET B HG3  1  
ATOM 3616  H HE1  . MET B 2 3   ? 37.064  -12.415 -10.876 1.00 0.00 ? 3   MET B HE1  1  
ATOM 3617  H HE2  . MET B 2 3   ? 36.291  -10.839 -11.046 1.00 0.00 ? 3   MET B HE2  1  
ATOM 3618  H HE3  . MET B 2 3   ? 37.321  -11.459 -12.336 1.00 0.00 ? 3   MET B HE3  1  
ATOM 3619  N N    . GLY B 2 4   ? 38.044  -15.965 -13.821 1.00 0.00 ? 4   GLY B N    1  
ATOM 3620  C CA   . GLY B 2 4   ? 39.152  -16.600 -13.130 1.00 0.00 ? 4   GLY B CA   1  
ATOM 3621  C C    . GLY B 2 4   ? 38.862  -16.804 -11.655 1.00 0.00 ? 4   GLY B C    1  
ATOM 3622  O O    . GLY B 2 4   ? 37.976  -16.161 -11.091 1.00 0.00 ? 4   GLY B O    1  
ATOM 3623  H H    . GLY B 2 4   ? 38.160  -15.066 -14.191 1.00 0.00 ? 4   GLY B H    1  
ATOM 3624  H HA2  . GLY B 2 4   ? 39.344  -17.559 -13.585 1.00 0.00 ? 4   GLY B HA2  1  
ATOM 3625  H HA3  . GLY B 2 4   ? 40.030  -15.980 -13.231 1.00 0.00 ? 4   GLY B HA3  1  
ATOM 3626  N N    . SER B 2 5   ? 39.614  -17.704 -11.028 1.00 0.00 ? 5   SER B N    1  
ATOM 3627  C CA   . SER B 2 5   ? 39.429  -17.986 -9.610  1.00 0.00 ? 5   SER B CA   1  
ATOM 3628  C C    . SER B 2 5   ? 39.526  -16.702 -8.791  1.00 0.00 ? 5   SER B C    1  
ATOM 3629  O O    . SER B 2 5   ? 38.529  -16.010 -8.586  1.00 0.00 ? 5   SER B O    1  
ATOM 3630  C CB   . SER B 2 5   ? 40.490  -18.980 -9.133  1.00 0.00 ? 5   SER B CB   1  
ATOM 3631  O OG   . SER B 2 5   ? 41.777  -18.511 -9.513  1.00 0.00 ? 5   SER B OG   1  
ATOM 3632  H H    . SER B 2 5   ? 40.306  -18.185 -11.529 1.00 0.00 ? 5   SER B H    1  
ATOM 3633  H HA   . SER B 2 5   ? 38.453  -18.422 -9.464  1.00 0.00 ? 5   SER B HA   1  
ATOM 3634  H HB2  . SER B 2 5   ? 40.448  -19.070 -8.060  1.00 0.00 ? 5   SER B HB2  1  
ATOM 3635  H HB3  . SER B 2 5   ? 40.301  -19.948 -9.580  1.00 0.00 ? 5   SER B HB3  1  
ATOM 3636  H HG   . SER B 2 5   ? 42.433  -19.059 -9.075  1.00 0.00 ? 5   SER B HG   1  
ATOM 3637  N N    . ASP B 2 6   ? 40.736  -16.390 -8.321  1.00 0.00 ? 6   ASP B N    1  
ATOM 3638  C CA   . ASP B 2 6   ? 40.969  -15.185 -7.517  1.00 0.00 ? 6   ASP B CA   1  
ATOM 3639  C C    . ASP B 2 6   ? 42.199  -14.435 -8.023  1.00 0.00 ? 6   ASP B C    1  
ATOM 3640  O O    . ASP B 2 6   ? 43.222  -14.368 -7.340  1.00 0.00 ? 6   ASP B O    1  
ATOM 3641  C CB   . ASP B 2 6   ? 41.180  -15.574 -6.052  1.00 0.00 ? 6   ASP B CB   1  
ATOM 3642  C CG   . ASP B 2 6   ? 41.243  -14.311 -5.188  1.00 0.00 ? 6   ASP B CG   1  
ATOM 3643  O OD1  . ASP B 2 6   ? 41.278  -13.231 -5.754  1.00 0.00 ? 6   ASP B OD1  1  
ATOM 3644  O OD2  . ASP B 2 6   ? 41.255  -14.448 -3.976  1.00 0.00 ? 6   ASP B OD2  1  
ATOM 3645  H H    . ASP B 2 6   ? 41.489  -16.986 -8.516  1.00 0.00 ? 6   ASP B H    1  
ATOM 3646  H HA   . ASP B 2 6   ? 40.112  -14.529 -7.581  1.00 0.00 ? 6   ASP B HA   1  
ATOM 3647  H HB2  . ASP B 2 6   ? 40.358  -16.195 -5.723  1.00 0.00 ? 6   ASP B HB2  1  
ATOM 3648  H HB3  . ASP B 2 6   ? 42.106  -16.121 -5.953  1.00 0.00 ? 6   ASP B HB3  1  
ATOM 3649  N N    . PRO B 2 7   ? 42.112  -13.854 -9.232  1.00 0.00 ? 7   PRO B N    1  
ATOM 3650  C CA   . PRO B 2 7   ? 43.222  -13.100 -9.835  1.00 0.00 ? 7   PRO B CA   1  
ATOM 3651  C C    . PRO B 2 7   ? 43.930  -12.201 -8.802  1.00 0.00 ? 7   PRO B C    1  
ATOM 3652  O O    . PRO B 2 7   ? 43.278  -11.386 -8.149  1.00 0.00 ? 7   PRO B O    1  
ATOM 3653  C CB   . PRO B 2 7   ? 42.523  -12.263 -10.915 1.00 0.00 ? 7   PRO B CB   1  
ATOM 3654  C CG   . PRO B 2 7   ? 41.390  -13.128 -11.368 1.00 0.00 ? 7   PRO B CG   1  
ATOM 3655  C CD   . PRO B 2 7   ? 40.928  -13.885 -10.115 1.00 0.00 ? 7   PRO B CD   1  
ATOM 3656  H HA   . PRO B 2 7   ? 43.906  -13.780 -10.303 1.00 0.00 ? 7   PRO B HA   1  
ATOM 3657  H HB2  . PRO B 2 7   ? 42.150  -11.335 -10.493 1.00 0.00 ? 7   PRO B HB2  1  
ATOM 3658  H HB3  . PRO B 2 7   ? 43.194  -12.061 -11.738 1.00 0.00 ? 7   PRO B HB3  1  
ATOM 3659  H HG2  . PRO B 2 7   ? 40.586  -12.516 -11.766 1.00 0.00 ? 7   PRO B HG2  1  
ATOM 3660  H HG3  . PRO B 2 7   ? 41.729  -13.830 -12.117 1.00 0.00 ? 7   PRO B HG3  1  
ATOM 3661  H HD2  . PRO B 2 7   ? 40.092  -13.379 -9.649  1.00 0.00 ? 7   PRO B HD2  1  
ATOM 3662  H HD3  . PRO B 2 7   ? 40.669  -14.907 -10.353 1.00 0.00 ? 7   PRO B HD3  1  
ATOM 3663  N N    . PRO B 2 8   ? 45.263  -12.332 -8.626  1.00 0.00 ? 8   PRO B N    1  
ATOM 3664  C CA   . PRO B 2 8   ? 46.013  -11.522 -7.657  1.00 0.00 ? 8   PRO B CA   1  
ATOM 3665  C C    . PRO B 2 8   ? 45.493  -10.085 -7.482  1.00 0.00 ? 8   PRO B C    1  
ATOM 3666  O O    . PRO B 2 8   ? 44.538  -9.869  -6.740  1.00 0.00 ? 8   PRO B O    1  
ATOM 3667  C CB   . PRO B 2 8   ? 47.430  -11.569 -8.217  1.00 0.00 ? 8   PRO B CB   1  
ATOM 3668  C CG   . PRO B 2 8   ? 47.548  -12.957 -8.744  1.00 0.00 ? 8   PRO B CG   1  
ATOM 3669  C CD   . PRO B 2 8   ? 46.165  -13.272 -9.335  1.00 0.00 ? 8   PRO B CD   1  
ATOM 3670  H HA   . PRO B 2 8   ? 46.007  -12.018 -6.700  1.00 0.00 ? 8   PRO B HA   1  
ATOM 3671  H HB2  . PRO B 2 8   ? 47.543  -10.855 -9.020  1.00 0.00 ? 8   PRO B HB2  1  
ATOM 3672  H HB3  . PRO B 2 8   ? 48.153  -11.396 -7.436  1.00 0.00 ? 8   PRO B HB3  1  
ATOM 3673  H HG2  . PRO B 2 8   ? 48.316  -13.009 -9.510  1.00 0.00 ? 8   PRO B HG2  1  
ATOM 3674  H HG3  . PRO B 2 8   ? 47.771  -13.647 -7.943  1.00 0.00 ? 8   PRO B HG3  1  
ATOM 3675  H HD2  . PRO B 2 8   ? 46.155  -13.080 -10.402 1.00 0.00 ? 8   PRO B HD2  1  
ATOM 3676  H HD3  . PRO B 2 8   ? 45.880  -14.293 -9.128  1.00 0.00 ? 8   PRO B HD3  1  
ATOM 3677  N N    . THR B 2 9   ? 46.136  -9.112  -8.137  1.00 0.00 ? 9   THR B N    1  
ATOM 3678  C CA   . THR B 2 9   ? 45.747  -7.707  -8.009  1.00 0.00 ? 9   THR B CA   1  
ATOM 3679  C C    . THR B 2 9   ? 46.878  -6.819  -8.520  1.00 0.00 ? 9   THR B C    1  
ATOM 3680  O O    . THR B 2 9   ? 48.011  -7.276  -8.679  1.00 0.00 ? 9   THR B O    1  
ATOM 3681  C CB   . THR B 2 9   ? 45.520  -7.337  -6.524  1.00 0.00 ? 9   THR B CB   1  
ATOM 3682  O OG1  . THR B 2 9   ? 45.675  -5.931  -6.362  1.00 0.00 ? 9   THR B OG1  1  
ATOM 3683  C CG2  . THR B 2 9   ? 46.556  -8.068  -5.635  1.00 0.00 ? 9   THR B CG2  1  
ATOM 3684  H H    . THR B 2 9   ? 46.894  -9.337  -8.708  1.00 0.00 ? 9   THR B H    1  
ATOM 3685  H HA   . THR B 2 9   ? 44.847  -7.519  -8.573  1.00 0.00 ? 9   THR B HA   1  
ATOM 3686  H HB   . THR B 2 9   ? 44.521  -7.614  -6.225  1.00 0.00 ? 9   THR B HB   1  
ATOM 3687  H HG1  . THR B 2 9   ? 46.553  -5.768  -6.009  1.00 0.00 ? 9   THR B HG1  1  
ATOM 3688  H HG21 . THR B 2 9   ? 46.881  -7.401  -4.850  1.00 0.00 ? 9   THR B HG21 1  
ATOM 3689  H HG22 . THR B 2 9   ? 47.420  -8.370  -6.229  1.00 0.00 ? 9   THR B HG22 1  
ATOM 3690  H HG23 . THR B 2 9   ? 46.106  -8.946  -5.193  1.00 0.00 ? 9   THR B HG23 1  
ATOM 3691  N N    . ALA B 2 10  ? 46.576  -5.547  -8.756  1.00 0.00 ? 10  ALA B N    1  
ATOM 3692  C CA   . ALA B 2 10  ? 47.584  -4.593  -9.228  1.00 0.00 ? 10  ALA B CA   1  
ATOM 3693  C C    . ALA B 2 10  ? 47.327  -3.232  -8.574  1.00 0.00 ? 10  ALA B C    1  
ATOM 3694  O O    . ALA B 2 10  ? 47.111  -2.234  -9.261  1.00 0.00 ? 10  ALA B O    1  
ATOM 3695  C CB   . ALA B 2 10  ? 47.519  -4.490  -10.755 1.00 0.00 ? 10  ALA B CB   1  
ATOM 3696  H H    . ALA B 2 10  ? 45.659  -5.237  -8.606  1.00 0.00 ? 10  ALA B H    1  
ATOM 3697  H HA   . ALA B 2 10  ? 48.576  -4.938  -8.941  1.00 0.00 ? 10  ALA B HA   1  
ATOM 3698  H HB1  . ALA B 2 10  ? 48.481  -4.175  -11.142 1.00 0.00 ? 10  ALA B HB1  1  
ATOM 3699  H HB2  . ALA B 2 10  ? 46.761  -3.776  -11.046 1.00 0.00 ? 10  ALA B HB2  1  
ATOM 3700  H HB3  . ALA B 2 10  ? 47.271  -5.457  -11.165 1.00 0.00 ? 10  ALA B HB3  1  
ATOM 3701  N N    . CYS B 2 11  ? 47.334  -3.207  -7.235  1.00 0.00 ? 11  CYS B N    1  
ATOM 3702  C CA   . CYS B 2 11  ? 47.085  -1.974  -6.476  1.00 0.00 ? 11  CYS B CA   1  
ATOM 3703  C C    . CYS B 2 11  ? 48.406  -1.320  -6.057  1.00 0.00 ? 11  CYS B C    1  
ATOM 3704  O O    . CYS B 2 11  ? 49.425  -1.991  -5.928  1.00 0.00 ? 11  CYS B O    1  
ATOM 3705  C CB   . CYS B 2 11  ? 46.236  -2.319  -5.234  1.00 0.00 ? 11  CYS B CB   1  
ATOM 3706  S SG   . CYS B 2 11  ? 45.202  -0.906  -4.765  1.00 0.00 ? 11  CYS B SG   1  
ATOM 3707  H H    . CYS B 2 11  ? 47.500  -4.029  -6.730  1.00 0.00 ? 11  CYS B H    1  
ATOM 3708  H HA   . CYS B 2 11  ? 46.531  -1.278  -7.093  1.00 0.00 ? 11  CYS B HA   1  
ATOM 3709  H HB2  . CYS B 2 11  ? 45.599  -3.160  -5.464  1.00 0.00 ? 11  CYS B HB2  1  
ATOM 3710  H HB3  . CYS B 2 11  ? 46.881  -2.582  -4.406  1.00 0.00 ? 11  CYS B HB3  1  
ATOM 3711  N N    . CYS B 2 12  ? 48.373  -0.007  -5.859  1.00 0.00 ? 12  CYS B N    1  
ATOM 3712  C CA   . CYS B 2 12  ? 49.564  0.748   -5.464  1.00 0.00 ? 12  CYS B CA   1  
ATOM 3713  C C    . CYS B 2 12  ? 49.962  0.462   -4.025  1.00 0.00 ? 12  CYS B C    1  
ATOM 3714  O O    . CYS B 2 12  ? 49.112  0.251   -3.160  1.00 0.00 ? 12  CYS B O    1  
ATOM 3715  C CB   . CYS B 2 12  ? 49.285  2.240   -5.622  1.00 0.00 ? 12  CYS B CB   1  
ATOM 3716  S SG   . CYS B 2 12  ? 48.980  2.601   -7.366  1.00 0.00 ? 12  CYS B SG   1  
ATOM 3717  H H    . CYS B 2 12  ? 47.528  0.472   -5.990  1.00 0.00 ? 12  CYS B H    1  
ATOM 3718  H HA   . CYS B 2 12  ? 50.394  0.486   -6.104  1.00 0.00 ? 12  CYS B HA   1  
ATOM 3719  H HB2  . CYS B 2 12  ? 48.416  2.508   -5.038  1.00 0.00 ? 12  CYS B HB2  1  
ATOM 3720  H HB3  . CYS B 2 12  ? 50.139  2.805   -5.280  1.00 0.00 ? 12  CYS B HB3  1  
ATOM 3721  N N    . PHE B 2 13  ? 51.273  0.489   -3.778  1.00 0.00 ? 13  PHE B N    1  
ATOM 3722  C CA   . PHE B 2 13  ? 51.820  0.267   -2.439  1.00 0.00 ? 13  PHE B CA   1  
ATOM 3723  C C    . PHE B 2 13  ? 52.535  1.520   -1.975  1.00 0.00 ? 13  PHE B C    1  
ATOM 3724  O O    . PHE B 2 13  ? 52.712  1.745   -0.778  1.00 0.00 ? 13  PHE B O    1  
ATOM 3725  C CB   . PHE B 2 13  ? 52.808  -0.901  -2.443  1.00 0.00 ? 13  PHE B CB   1  
ATOM 3726  C CG   . PHE B 2 13  ? 52.195  -2.076  -3.158  1.00 0.00 ? 13  PHE B CG   1  
ATOM 3727  C CD1  . PHE B 2 13  ? 52.181  -2.096  -4.563  1.00 0.00 ? 13  PHE B CD1  1  
ATOM 3728  C CD2  . PHE B 2 13  ? 51.653  -3.157  -2.427  1.00 0.00 ? 13  PHE B CD2  1  
ATOM 3729  C CE1  . PHE B 2 13  ? 51.636  -3.203  -5.249  1.00 0.00 ? 13  PHE B CE1  1  
ATOM 3730  C CE2  . PHE B 2 13  ? 51.089  -4.255  -3.109  1.00 0.00 ? 13  PHE B CE2  1  
ATOM 3731  C CZ   . PHE B 2 13  ? 51.076  -4.278  -4.521  1.00 0.00 ? 13  PHE B CZ   1  
ATOM 3732  H H    . PHE B 2 13  ? 51.890  0.689   -4.512  1.00 0.00 ? 13  PHE B H    1  
ATOM 3733  H HA   . PHE B 2 13  ? 51.026  0.047   -1.753  1.00 0.00 ? 13  PHE B HA   1  
ATOM 3734  H HB2  . PHE B 2 13  ? 53.715  -0.606  -2.954  1.00 0.00 ? 13  PHE B HB2  1  
ATOM 3735  H HB3  . PHE B 2 13  ? 53.044  -1.177  -1.425  1.00 0.00 ? 13  PHE B HB3  1  
ATOM 3736  H HD1  . PHE B 2 13  ? 52.591  -1.261  -5.113  1.00 0.00 ? 13  PHE B HD1  1  
ATOM 3737  H HD2  . PHE B 2 13  ? 51.662  -3.137  -1.347  1.00 0.00 ? 13  PHE B HD2  1  
ATOM 3738  H HE1  . PHE B 2 13  ? 51.625  -3.219  -6.328  1.00 0.00 ? 13  PHE B HE1  1  
ATOM 3739  H HE2  . PHE B 2 13  ? 50.660  -5.073  -2.550  1.00 0.00 ? 13  PHE B HE2  1  
ATOM 3740  H HZ   . PHE B 2 13  ? 50.568  -5.075  -5.042  1.00 0.00 ? 13  PHE B HZ   1  
ATOM 3741  N N    . SER B 2 14  ? 52.959  2.331   -2.941  1.00 0.00 ? 14  SER B N    1  
ATOM 3742  C CA   . SER B 2 14  ? 53.679  3.570   -2.626  1.00 0.00 ? 14  SER B CA   1  
ATOM 3743  C C    . SER B 2 14  ? 53.456  4.625   -3.706  1.00 0.00 ? 14  SER B C    1  
ATOM 3744  O O    . SER B 2 14  ? 53.135  4.304   -4.848  1.00 0.00 ? 14  SER B O    1  
ATOM 3745  C CB   . SER B 2 14  ? 55.177  3.266   -2.500  1.00 0.00 ? 14  SER B CB   1  
ATOM 3746  O OG   . SER B 2 14  ? 55.576  2.427   -3.574  1.00 0.00 ? 14  SER B OG   1  
ATOM 3747  H H    . SER B 2 14  ? 52.799  2.085   -3.888  1.00 0.00 ? 14  SER B H    1  
ATOM 3748  H HA   . SER B 2 14  ? 53.325  3.963   -1.682  1.00 0.00 ? 14  SER B HA   1  
ATOM 3749  H HB2  . SER B 2 14  ? 55.744  4.182   -2.537  1.00 0.00 ? 14  SER B HB2  1  
ATOM 3750  H HB3  . SER B 2 14  ? 55.365  2.770   -1.556  1.00 0.00 ? 14  SER B HB3  1  
ATOM 3751  H HG   . SER B 2 14  ? 55.362  2.874   -4.396  1.00 0.00 ? 14  SER B HG   1  
ATOM 3752  N N    . TYR B 2 15  ? 53.597  5.896   -3.318  1.00 0.00 ? 15  TYR B N    1  
ATOM 3753  C CA   . TYR B 2 15  ? 53.390  7.025   -4.236  1.00 0.00 ? 15  TYR B CA   1  
ATOM 3754  C C    . TYR B 2 15  ? 54.697  7.793   -4.462  1.00 0.00 ? 15  TYR B C    1  
ATOM 3755  O O    . TYR B 2 15  ? 55.588  7.784   -3.612  1.00 0.00 ? 15  TYR B O    1  
ATOM 3756  C CB   . TYR B 2 15  ? 52.326  7.968   -3.643  1.00 0.00 ? 15  TYR B CB   1  
ATOM 3757  C CG   . TYR B 2 15  ? 51.262  7.142   -2.949  1.00 0.00 ? 15  TYR B CG   1  
ATOM 3758  C CD1  . TYR B 2 15  ? 50.363  6.371   -3.717  1.00 0.00 ? 15  TYR B CD1  1  
ATOM 3759  C CD2  . TYR B 2 15  ? 51.176  7.128   -1.538  1.00 0.00 ? 15  TYR B CD2  1  
ATOM 3760  C CE1  . TYR B 2 15  ? 49.380  5.587   -3.076  1.00 0.00 ? 15  TYR B CE1  1  
ATOM 3761  C CE2  . TYR B 2 15  ? 50.188  6.348   -0.897  1.00 0.00 ? 15  TYR B CE2  1  
ATOM 3762  C CZ   . TYR B 2 15  ? 49.289  5.578   -1.667  1.00 0.00 ? 15  TYR B CZ   1  
ATOM 3763  O OH   . TYR B 2 15  ? 48.294  4.854   -1.044  1.00 0.00 ? 15  TYR B OH   1  
ATOM 3764  H H    . TYR B 2 15  ? 53.812  6.081   -2.378  1.00 0.00 ? 15  TYR B H    1  
ATOM 3765  H HA   . TYR B 2 15  ? 53.036  6.659   -5.192  1.00 0.00 ? 15  TYR B HA   1  
ATOM 3766  H HB2  . TYR B 2 15  ? 52.787  8.640   -2.929  1.00 0.00 ? 15  TYR B HB2  1  
ATOM 3767  H HB3  . TYR B 2 15  ? 51.871  8.547   -4.433  1.00 0.00 ? 15  TYR B HB3  1  
ATOM 3768  H HD1  . TYR B 2 15  ? 50.426  6.382   -4.794  1.00 0.00 ? 15  TYR B HD1  1  
ATOM 3769  H HD2  . TYR B 2 15  ? 51.865  7.715   -0.949  1.00 0.00 ? 15  TYR B HD2  1  
ATOM 3770  H HE1  . TYR B 2 15  ? 48.695  4.996   -3.664  1.00 0.00 ? 15  TYR B HE1  1  
ATOM 3771  H HE2  . TYR B 2 15  ? 50.119  6.342   0.180   1.00 0.00 ? 15  TYR B HE2  1  
ATOM 3772  H HH   . TYR B 2 15  ? 47.556  5.445   -0.879  1.00 0.00 ? 15  TYR B HH   1  
ATOM 3773  N N    . THR B 2 16  ? 54.793  8.470   -5.607  1.00 0.00 ? 16  THR B N    1  
ATOM 3774  C CA   . THR B 2 16  ? 55.984  9.255   -5.928  1.00 0.00 ? 16  THR B CA   1  
ATOM 3775  C C    . THR B 2 16  ? 55.973  10.559  -5.134  1.00 0.00 ? 16  THR B C    1  
ATOM 3776  O O    . THR B 2 16  ? 54.923  11.175  -4.961  1.00 0.00 ? 16  THR B O    1  
ATOM 3777  C CB   . THR B 2 16  ? 56.035  9.594   -7.431  1.00 0.00 ? 16  THR B CB   1  
ATOM 3778  O OG1  . THR B 2 16  ? 57.219  10.328  -7.709  1.00 0.00 ? 16  THR B OG1  1  
ATOM 3779  C CG2  . THR B 2 16  ? 54.812  10.431  -7.811  1.00 0.00 ? 16  THR B CG2  1  
ATOM 3780  H H    . THR B 2 16  ? 54.046  8.449   -6.240  1.00 0.00 ? 16  THR B H    1  
ATOM 3781  H HA   . THR B 2 16  ? 56.866  8.688   -5.666  1.00 0.00 ? 16  THR B HA   1  
ATOM 3782  H HB   . THR B 2 16  ? 56.034  8.680   -8.006  1.00 0.00 ? 16  THR B HB   1  
ATOM 3783  H HG1  . THR B 2 16  ? 57.168  11.163  -7.239  1.00 0.00 ? 16  THR B HG1  1  
ATOM 3784  H HG21 . THR B 2 16  ? 53.920  9.965   -7.418  1.00 0.00 ? 16  THR B HG21 1  
ATOM 3785  H HG22 . THR B 2 16  ? 54.741  10.495  -8.887  1.00 0.00 ? 16  THR B HG22 1  
ATOM 3786  H HG23 . THR B 2 16  ? 54.913  11.423  -7.398  1.00 0.00 ? 16  THR B HG23 1  
ATOM 3787  N N    . ALA B 2 17  ? 57.139  10.966  -4.632  1.00 0.00 ? 17  ALA B N    1  
ATOM 3788  C CA   . ALA B 2 17  ? 57.234  12.185  -3.835  1.00 0.00 ? 17  ALA B CA   1  
ATOM 3789  C C    . ALA B 2 17  ? 57.295  13.419  -4.724  1.00 0.00 ? 17  ALA B C    1  
ATOM 3790  O O    . ALA B 2 17  ? 57.001  14.526  -4.275  1.00 0.00 ? 17  ALA B O    1  
ATOM 3791  C CB   . ALA B 2 17  ? 58.472  12.125  -2.952  1.00 0.00 ? 17  ALA B CB   1  
ATOM 3792  H H    . ALA B 2 17  ? 57.942  10.433  -4.781  1.00 0.00 ? 17  ALA B H    1  
ATOM 3793  H HA   . ALA B 2 17  ? 56.364  12.260  -3.198  1.00 0.00 ? 17  ALA B HA   1  
ATOM 3794  H HB1  . ALA B 2 17  ? 59.356  12.257  -3.557  1.00 0.00 ? 17  ALA B HB1  1  
ATOM 3795  H HB2  . ALA B 2 17  ? 58.516  11.165  -2.458  1.00 0.00 ? 17  ALA B HB2  1  
ATOM 3796  H HB3  . ALA B 2 17  ? 58.424  12.909  -2.211  1.00 0.00 ? 17  ALA B HB3  1  
ATOM 3797  N N    . ARG B 2 18  ? 57.684  13.227  -5.986  1.00 0.00 ? 18  ARG B N    1  
ATOM 3798  C CA   . ARG B 2 18  ? 57.789  14.343  -6.932  1.00 0.00 ? 18  ARG B CA   1  
ATOM 3799  C C    . ARG B 2 18  ? 56.638  14.330  -7.934  1.00 0.00 ? 18  ARG B C    1  
ATOM 3800  O O    . ARG B 2 18  ? 56.383  13.320  -8.590  1.00 0.00 ? 18  ARG B O    1  
ATOM 3801  C CB   . ARG B 2 18  ? 59.117  14.258  -7.690  1.00 0.00 ? 18  ARG B CB   1  
ATOM 3802  C CG   . ARG B 2 18  ? 60.291  14.294  -6.698  1.00 0.00 ? 18  ARG B CG   1  
ATOM 3803  C CD   . ARG B 2 18  ? 60.397  15.674  -6.022  1.00 0.00 ? 18  ARG B CD   1  
ATOM 3804  N NE   . ARG B 2 18  ? 61.790  15.872  -5.529  1.00 0.00 ? 18  ARG B NE   1  
ATOM 3805  C CZ   . ARG B 2 18  ? 62.056  16.838  -4.693  1.00 0.00 ? 18  ARG B CZ   1  
ATOM 3806  N NH1  . ARG B 2 18  ? 62.251  18.050  -5.134  1.00 0.00 ? 18  ARG B NH1  1  
ATOM 3807  N NH2  . ARG B 2 18  ? 62.128  16.591  -3.413  1.00 0.00 ? 18  ARG B NH2  1  
ATOM 3808  H H    . ARG B 2 18  ? 57.911  12.323  -6.285  1.00 0.00 ? 18  ARG B H    1  
ATOM 3809  H HA   . ARG B 2 18  ? 57.763  15.273  -6.392  1.00 0.00 ? 18  ARG B HA   1  
ATOM 3810  H HB2  . ARG B 2 18  ? 59.149  13.332  -8.247  1.00 0.00 ? 18  ARG B HB2  1  
ATOM 3811  H HB3  . ARG B 2 18  ? 59.196  15.089  -8.373  1.00 0.00 ? 18  ARG B HB3  1  
ATOM 3812  H HG2  . ARG B 2 18  ? 60.141  13.538  -5.943  1.00 0.00 ? 18  ARG B HG2  1  
ATOM 3813  H HG3  . ARG B 2 18  ? 61.210  14.089  -7.228  1.00 0.00 ? 18  ARG B HG3  1  
ATOM 3814  H HD2  . ARG B 2 18  ? 60.156  16.454  -6.730  1.00 0.00 ? 18  ARG B HD2  1  
ATOM 3815  H HD3  . ARG B 2 18  ? 59.715  15.723  -5.185  1.00 0.00 ? 18  ARG B HD3  1  
ATOM 3816  H HE   . ARG B 2 18  ? 62.507  15.278  -5.835  1.00 0.00 ? 18  ARG B HE   1  
ATOM 3817  H HH11 . ARG B 2 18  ? 62.196  18.241  -6.114  1.00 0.00 ? 18  ARG B HH11 1  
ATOM 3818  H HH12 . ARG B 2 18  ? 62.454  18.790  -4.493  1.00 0.00 ? 18  ARG B HH12 1  
ATOM 3819  H HH21 . ARG B 2 18  ? 61.978  15.662  -3.074  1.00 0.00 ? 18  ARG B HH21 1  
ATOM 3820  H HH22 . ARG B 2 18  ? 62.331  17.330  -2.771  1.00 0.00 ? 18  ARG B HH22 1  
ATOM 3821  N N    . LYS B 2 19  ? 55.956  15.470  -8.058  1.00 0.00 ? 19  LYS B N    1  
ATOM 3822  C CA   . LYS B 2 19  ? 54.842  15.599  -8.998  1.00 0.00 ? 19  LYS B CA   1  
ATOM 3823  C C    . LYS B 2 19  ? 55.388  15.947  -10.383 1.00 0.00 ? 19  LYS B C    1  
ATOM 3824  O O    . LYS B 2 19  ? 55.969  17.012  -10.580 1.00 0.00 ? 19  LYS B O    1  
ATOM 3825  C CB   . LYS B 2 19  ? 53.868  16.690  -8.515  1.00 0.00 ? 19  LYS B CB   1  
ATOM 3826  C CG   . LYS B 2 19  ? 54.657  17.852  -7.897  1.00 0.00 ? 19  LYS B CG   1  
ATOM 3827  C CD   . LYS B 2 19  ? 53.726  19.050  -7.687  1.00 0.00 ? 19  LYS B CD   1  
ATOM 3828  C CE   . LYS B 2 19  ? 54.445  20.115  -6.858  1.00 0.00 ? 19  LYS B CE   1  
ATOM 3829  N NZ   . LYS B 2 19  ? 53.560  21.304  -6.702  1.00 0.00 ? 19  LYS B NZ   1  
ATOM 3830  H H    . LYS B 2 19  ? 56.218  16.244  -7.518  1.00 0.00 ? 19  LYS B H    1  
ATOM 3831  H HA   . LYS B 2 19  ? 54.312  14.657  -9.058  1.00 0.00 ? 19  LYS B HA   1  
ATOM 3832  H HB2  . LYS B 2 19  ? 53.280  17.054  -9.346  1.00 0.00 ? 19  LYS B HB2  1  
ATOM 3833  H HB3  . LYS B 2 19  ? 53.207  16.276  -7.766  1.00 0.00 ? 19  LYS B HB3  1  
ATOM 3834  H HG2  . LYS B 2 19  ? 55.066  17.543  -6.946  1.00 0.00 ? 19  LYS B HG2  1  
ATOM 3835  H HG3  . LYS B 2 19  ? 55.461  18.135  -8.558  1.00 0.00 ? 19  LYS B HG3  1  
ATOM 3836  H HD2  . LYS B 2 19  ? 53.451  19.463  -8.646  1.00 0.00 ? 19  LYS B HD2  1  
ATOM 3837  H HD3  . LYS B 2 19  ? 52.839  18.728  -7.165  1.00 0.00 ? 19  LYS B HD3  1  
ATOM 3838  H HE2  . LYS B 2 19  ? 54.685  19.714  -5.885  1.00 0.00 ? 19  LYS B HE2  1  
ATOM 3839  H HE3  . LYS B 2 19  ? 55.356  20.409  -7.360  1.00 0.00 ? 19  LYS B HE3  1  
ATOM 3840  H HZ1  . LYS B 2 19  ? 52.950  21.175  -5.870  1.00 0.00 ? 19  LYS B HZ1  1  
ATOM 3841  H HZ2  . LYS B 2 19  ? 52.970  21.411  -7.553  1.00 0.00 ? 19  LYS B HZ2  1  
ATOM 3842  H HZ3  . LYS B 2 19  ? 54.141  22.156  -6.573  1.00 0.00 ? 19  LYS B HZ3  1  
ATOM 3843  N N    . LEU B 2 20  ? 55.218  15.031  -11.333 1.00 0.00 ? 20  LEU B N    1  
ATOM 3844  C CA   . LEU B 2 20  ? 55.723  15.244  -12.689 1.00 0.00 ? 20  LEU B CA   1  
ATOM 3845  C C    . LEU B 2 20  ? 54.832  16.243  -13.458 1.00 0.00 ? 20  LEU B C    1  
ATOM 3846  O O    . LEU B 2 20  ? 53.667  15.946  -13.722 1.00 0.00 ? 20  LEU B O    1  
ATOM 3847  C CB   . LEU B 2 20  ? 55.772  13.894  -13.436 1.00 0.00 ? 20  LEU B CB   1  
ATOM 3848  C CG   . LEU B 2 20  ? 57.058  13.131  -13.066 1.00 0.00 ? 20  LEU B CG   1  
ATOM 3849  C CD1  . LEU B 2 20  ? 57.094  12.880  -11.554 1.00 0.00 ? 20  LEU B CD1  1  
ATOM 3850  C CD2  . LEU B 2 20  ? 57.100  11.792  -13.813 1.00 0.00 ? 20  LEU B CD2  1  
ATOM 3851  H H    . LEU B 2 20  ? 54.763  14.190  -11.116 1.00 0.00 ? 20  LEU B H    1  
ATOM 3852  H HA   . LEU B 2 20  ? 56.724  15.632  -12.620 1.00 0.00 ? 20  LEU B HA   1  
ATOM 3853  H HB2  . LEU B 2 20  ? 54.913  13.301  -13.158 1.00 0.00 ? 20  LEU B HB2  1  
ATOM 3854  H HB3  . LEU B 2 20  ? 55.758  14.064  -14.504 1.00 0.00 ? 20  LEU B HB3  1  
ATOM 3855  H HG   . LEU B 2 20  ? 57.917  13.725  -13.348 1.00 0.00 ? 20  LEU B HG   1  
ATOM 3856  H HD11 . LEU B 2 20  ? 57.870  12.163  -11.324 1.00 0.00 ? 20  LEU B HD11 1  
ATOM 3857  H HD12 . LEU B 2 20  ? 56.139  12.493  -11.229 1.00 0.00 ? 20  LEU B HD12 1  
ATOM 3858  H HD13 . LEU B 2 20  ? 57.300  13.808  -11.040 1.00 0.00 ? 20  LEU B HD13 1  
ATOM 3859  H HD21 . LEU B 2 20  ? 58.100  11.385  -13.765 1.00 0.00 ? 20  LEU B HD21 1  
ATOM 3860  H HD22 . LEU B 2 20  ? 56.826  11.943  -14.847 1.00 0.00 ? 20  LEU B HD22 1  
ATOM 3861  H HD23 . LEU B 2 20  ? 56.410  11.099  -13.356 1.00 0.00 ? 20  LEU B HD23 1  
ATOM 3862  N N    . PRO B 2 21  ? 55.355  17.442  -13.840 1.00 0.00 ? 21  PRO B N    1  
ATOM 3863  C CA   . PRO B 2 21  ? 54.564  18.439  -14.583 1.00 0.00 ? 21  PRO B CA   1  
ATOM 3864  C C    . PRO B 2 21  ? 53.717  17.811  -15.689 1.00 0.00 ? 21  PRO B C    1  
ATOM 3865  O O    . PRO B 2 21  ? 54.050  16.751  -16.219 1.00 0.00 ? 21  PRO B O    1  
ATOM 3866  C CB   . PRO B 2 21  ? 55.622  19.388  -15.162 1.00 0.00 ? 21  PRO B CB   1  
ATOM 3867  C CG   . PRO B 2 21  ? 56.726  19.362  -14.158 1.00 0.00 ? 21  PRO B CG   1  
ATOM 3868  C CD   . PRO B 2 21  ? 56.732  17.936  -13.588 1.00 0.00 ? 21  PRO B CD   1  
ATOM 3869  H HA   . PRO B 2 21  ? 53.930  18.985  -13.901 1.00 0.00 ? 21  PRO B HA   1  
ATOM 3870  H HB2  . PRO B 2 21  ? 55.969  19.026  -16.123 1.00 0.00 ? 21  PRO B HB2  1  
ATOM 3871  H HB3  . PRO B 2 21  ? 55.224  20.389  -15.259 1.00 0.00 ? 21  PRO B HB3  1  
ATOM 3872  H HG2  . PRO B 2 21  ? 57.675  19.589  -14.636 1.00 0.00 ? 21  PRO B HG2  1  
ATOM 3873  H HG3  . PRO B 2 21  ? 56.532  20.072  -13.365 1.00 0.00 ? 21  PRO B HG3  1  
ATOM 3874  H HD2  . PRO B 2 21  ? 57.458  17.322  -14.107 1.00 0.00 ? 21  PRO B HD2  1  
ATOM 3875  H HD3  . PRO B 2 21  ? 56.936  17.952  -12.528 1.00 0.00 ? 21  PRO B HD3  1  
ATOM 3876  N N    . ARG B 2 22  ? 52.620  18.478  -16.022 1.00 0.00 ? 22  ARG B N    1  
ATOM 3877  C CA   . ARG B 2 22  ? 51.714  17.995  -17.058 1.00 0.00 ? 22  ARG B CA   1  
ATOM 3878  C C    . ARG B 2 22  ? 52.474  17.534  -18.303 1.00 0.00 ? 22  ARG B C    1  
ATOM 3879  O O    . ARG B 2 22  ? 52.223  16.447  -18.820 1.00 0.00 ? 22  ARG B O    1  
ATOM 3880  C CB   . ARG B 2 22  ? 50.733  19.103  -17.443 1.00 0.00 ? 22  ARG B CB   1  
ATOM 3881  C CG   . ARG B 2 22  ? 49.841  19.435  -16.245 1.00 0.00 ? 22  ARG B CG   1  
ATOM 3882  C CD   . ARG B 2 22  ? 48.900  20.583  -16.611 1.00 0.00 ? 22  ARG B CD   1  
ATOM 3883  N NE   . ARG B 2 22  ? 48.015  20.162  -17.734 1.00 0.00 ? 22  ARG B NE   1  
ATOM 3884  C CZ   . ARG B 2 22  ? 47.330  21.054  -18.396 1.00 0.00 ? 22  ARG B CZ   1  
ATOM 3885  N NH1  . ARG B 2 22  ? 46.813  22.076  -17.772 1.00 0.00 ? 22  ARG B NH1  1  
ATOM 3886  N NH2  . ARG B 2 22  ? 47.163  20.924  -19.684 1.00 0.00 ? 22  ARG B NH2  1  
ATOM 3887  H H    . ARG B 2 22  ? 52.411  19.316  -15.557 1.00 0.00 ? 22  ARG B H    1  
ATOM 3888  H HA   . ARG B 2 22  ? 51.153  17.163  -16.664 1.00 0.00 ? 22  ARG B HA   1  
ATOM 3889  H HB2  . ARG B 2 22  ? 51.284  19.985  -17.737 1.00 0.00 ? 22  ARG B HB2  1  
ATOM 3890  H HB3  . ARG B 2 22  ? 50.118  18.771  -18.266 1.00 0.00 ? 22  ARG B HB3  1  
ATOM 3891  H HG2  . ARG B 2 22  ? 49.259  18.563  -15.978 1.00 0.00 ? 22  ARG B HG2  1  
ATOM 3892  H HG3  . ARG B 2 22  ? 50.456  19.729  -15.408 1.00 0.00 ? 22  ARG B HG3  1  
ATOM 3893  H HD2  . ARG B 2 22  ? 48.296  20.842  -15.754 1.00 0.00 ? 22  ARG B HD2  1  
ATOM 3894  H HD3  . ARG B 2 22  ? 49.482  21.443  -16.912 1.00 0.00 ? 22  ARG B HD3  1  
ATOM 3895  H HE   . ARG B 2 22  ? 47.948  19.214  -17.975 1.00 0.00 ? 22  ARG B HE   1  
ATOM 3896  H HH11 . ARG B 2 22  ? 46.941  22.176  -16.784 1.00 0.00 ? 22  ARG B HH11 1  
ATOM 3897  H HH12 . ARG B 2 22  ? 46.288  22.759  -18.279 1.00 0.00 ? 22  ARG B HH12 1  
ATOM 3898  H HH21 . ARG B 2 22  ? 47.560  20.140  -20.162 1.00 0.00 ? 22  ARG B HH21 1  
ATOM 3899  H HH22 . ARG B 2 22  ? 46.638  21.607  -20.192 1.00 0.00 ? 22  ARG B HH22 1  
ATOM 3900  N N    . ASN B 2 23  ? 53.380  18.375  -18.796 1.00 0.00 ? 23  ASN B N    1  
ATOM 3901  C CA   . ASN B 2 23  ? 54.149  18.062  -20.003 1.00 0.00 ? 23  ASN B CA   1  
ATOM 3902  C C    . ASN B 2 23  ? 54.569  16.592  -20.087 1.00 0.00 ? 23  ASN B C    1  
ATOM 3903  O O    . ASN B 2 23  ? 54.623  16.030  -21.180 1.00 0.00 ? 23  ASN B O    1  
ATOM 3904  C CB   . ASN B 2 23  ? 55.397  18.948  -20.059 1.00 0.00 ? 23  ASN B CB   1  
ATOM 3905  C CG   . ASN B 2 23  ? 54.982  20.409  -20.251 1.00 0.00 ? 23  ASN B CG   1  
ATOM 3906  O OD1  . ASN B 2 23  ? 55.818  21.271  -20.435 1.00 0.00 ? 23  ASN B OD1  1  
ATOM 3907  N ND2  . ASN B 2 23  ? 53.716  20.726  -20.220 1.00 0.00 ? 23  ASN B ND2  1  
ATOM 3908  H H    . ASN B 2 23  ? 53.529  19.243  -18.367 1.00 0.00 ? 23  ASN B H    1  
ATOM 3909  H HA   . ASN B 2 23  ? 53.540  18.286  -20.860 1.00 0.00 ? 23  ASN B HA   1  
ATOM 3910  H HB2  . ASN B 2 23  ? 55.947  18.849  -19.135 1.00 0.00 ? 23  ASN B HB2  1  
ATOM 3911  H HB3  . ASN B 2 23  ? 56.021  18.642  -20.884 1.00 0.00 ? 23  ASN B HB3  1  
ATOM 3912  H HD21 . ASN B 2 23  ? 53.041  20.031  -20.073 1.00 0.00 ? 23  ASN B HD21 1  
ATOM 3913  H HD22 . ASN B 2 23  ? 53.441  21.658  -20.343 1.00 0.00 ? 23  ASN B HD22 1  
ATOM 3914  N N    . PHE B 2 24  ? 54.868  15.970  -18.944 1.00 0.00 ? 24  PHE B N    1  
ATOM 3915  C CA   . PHE B 2 24  ? 55.287  14.556  -18.926 1.00 0.00 ? 24  PHE B CA   1  
ATOM 3916  C C    . PHE B 2 24  ? 54.148  13.678  -18.388 1.00 0.00 ? 24  PHE B C    1  
ATOM 3917  O O    . PHE B 2 24  ? 54.382  12.716  -17.657 1.00 0.00 ? 24  PHE B O    1  
ATOM 3918  C CB   . PHE B 2 24  ? 56.564  14.375  -18.065 1.00 0.00 ? 24  PHE B CB   1  
ATOM 3919  C CG   . PHE B 2 24  ? 57.534  15.535  -18.279 1.00 0.00 ? 24  PHE B CG   1  
ATOM 3920  C CD1  . PHE B 2 24  ? 57.210  16.811  -17.766 1.00 0.00 ? 24  PHE B CD1  1  
ATOM 3921  C CD2  . PHE B 2 24  ? 58.769  15.353  -18.980 1.00 0.00 ? 24  PHE B CD2  1  
ATOM 3922  C CE1  . PHE B 2 24  ? 58.098  17.895  -17.945 1.00 0.00 ? 24  PHE B CE1  1  
ATOM 3923  C CE2  . PHE B 2 24  ? 59.644  16.445  -19.154 1.00 0.00 ? 24  PHE B CE2  1  
ATOM 3924  C CZ   . PHE B 2 24  ? 59.310  17.712  -18.639 1.00 0.00 ? 24  PHE B CZ   1  
ATOM 3925  H H    . PHE B 2 24  ? 54.804  16.462  -18.103 1.00 0.00 ? 24  PHE B H    1  
ATOM 3926  H HA   . PHE B 2 24  ? 55.512  14.233  -19.936 1.00 0.00 ? 24  PHE B HA   1  
ATOM 3927  H HB2  . PHE B 2 24  ? 56.289  14.337  -17.020 1.00 0.00 ? 24  PHE B HB2  1  
ATOM 3928  H HB3  . PHE B 2 24  ? 57.052  13.449  -18.335 1.00 0.00 ? 24  PHE B HB3  1  
ATOM 3929  H HD1  . PHE B 2 24  ? 56.285  16.958  -17.233 1.00 0.00 ? 24  PHE B HD1  1  
ATOM 3930  H HD2  . PHE B 2 24  ? 59.049  14.385  -19.380 1.00 0.00 ? 24  PHE B HD2  1  
ATOM 3931  H HE1  . PHE B 2 24  ? 57.846  18.868  -17.550 1.00 0.00 ? 24  PHE B HE1  1  
ATOM 3932  H HE2  . PHE B 2 24  ? 60.575  16.310  -19.685 1.00 0.00 ? 24  PHE B HE2  1  
ATOM 3933  H HZ   . PHE B 2 24  ? 59.961  18.556  -18.817 1.00 0.00 ? 24  PHE B HZ   1  
ATOM 3934  N N    . VAL B 2 25  ? 52.912  14.028  -18.768 1.00 0.00 ? 25  VAL B N    1  
ATOM 3935  C CA   . VAL B 2 25  ? 51.714  13.292  -18.343 1.00 0.00 ? 25  VAL B CA   1  
ATOM 3936  C C    . VAL B 2 25  ? 50.611  13.458  -19.392 1.00 0.00 ? 25  VAL B C    1  
ATOM 3937  O O    . VAL B 2 25  ? 49.924  14.479  -19.417 1.00 0.00 ? 25  VAL B O    1  
ATOM 3938  C CB   . VAL B 2 25  ? 51.188  13.833  -16.998 1.00 0.00 ? 25  VAL B CB   1  
ATOM 3939  C CG1  . VAL B 2 25  ? 49.980  13.007  -16.547 1.00 0.00 ? 25  VAL B CG1  1  
ATOM 3940  C CG2  . VAL B 2 25  ? 52.291  13.746  -15.936 1.00 0.00 ? 25  VAL B CG2  1  
ATOM 3941  H H    . VAL B 2 25  ? 52.801  14.805  -19.352 1.00 0.00 ? 25  VAL B H    1  
ATOM 3942  H HA   . VAL B 2 25  ? 51.950  12.245  -18.236 1.00 0.00 ? 25  VAL B HA   1  
ATOM 3943  H HB   . VAL B 2 25  ? 50.890  14.862  -17.126 1.00 0.00 ? 25  VAL B HB   1  
ATOM 3944  H HG11 . VAL B 2 25  ? 49.155  13.170  -17.225 1.00 0.00 ? 25  VAL B HG11 1  
ATOM 3945  H HG12 . VAL B 2 25  ? 49.688  13.310  -15.553 1.00 0.00 ? 25  VAL B HG12 1  
ATOM 3946  H HG13 . VAL B 2 25  ? 50.240  11.959  -16.542 1.00 0.00 ? 25  VAL B HG13 1  
ATOM 3947  H HG21 . VAL B 2 25  ? 51.872  13.938  -14.960 1.00 0.00 ? 25  VAL B HG21 1  
ATOM 3948  H HG22 . VAL B 2 25  ? 53.053  14.482  -16.146 1.00 0.00 ? 25  VAL B HG22 1  
ATOM 3949  H HG23 . VAL B 2 25  ? 52.729  12.759  -15.950 1.00 0.00 ? 25  VAL B HG23 1  
ATOM 3950  N N    . VAL B 2 26  ? 50.466  12.468  -20.282 1.00 0.00 ? 26  VAL B N    1  
ATOM 3951  C CA   . VAL B 2 26  ? 49.463  12.541  -21.360 1.00 0.00 ? 26  VAL B CA   1  
ATOM 3952  C C    . VAL B 2 26  ? 48.218  11.688  -21.078 1.00 0.00 ? 26  VAL B C    1  
ATOM 3953  O O    . VAL B 2 26  ? 47.204  11.838  -21.758 1.00 0.00 ? 26  VAL B O    1  
ATOM 3954  C CB   . VAL B 2 26  ? 50.081  12.067  -22.690 1.00 0.00 ? 26  VAL B CB   1  
ATOM 3955  C CG1  . VAL B 2 26  ? 51.145  13.068  -23.143 1.00 0.00 ? 26  VAL B CG1  1  
ATOM 3956  C CG2  . VAL B 2 26  ? 50.730  10.695  -22.488 1.00 0.00 ? 26  VAL B CG2  1  
ATOM 3957  H H    . VAL B 2 26  ? 51.061  11.691  -20.235 1.00 0.00 ? 26  VAL B H    1  
ATOM 3958  H HA   . VAL B 2 26  ? 49.148  13.568  -21.486 1.00 0.00 ? 26  VAL B HA   1  
ATOM 3959  H HB   . VAL B 2 26  ? 49.310  11.997  -23.445 1.00 0.00 ? 26  VAL B HB   1  
ATOM 3960  H HG11 . VAL B 2 26  ? 51.842  13.243  -22.337 1.00 0.00 ? 26  VAL B HG11 1  
ATOM 3961  H HG12 . VAL B 2 26  ? 50.670  13.999  -23.416 1.00 0.00 ? 26  VAL B HG12 1  
ATOM 3962  H HG13 . VAL B 2 26  ? 51.675  12.670  -23.996 1.00 0.00 ? 26  VAL B HG13 1  
ATOM 3963  H HG21 . VAL B 2 26  ? 49.992  9.999   -22.118 1.00 0.00 ? 26  VAL B HG21 1  
ATOM 3964  H HG22 . VAL B 2 26  ? 51.535  10.779  -21.774 1.00 0.00 ? 26  VAL B HG22 1  
ATOM 3965  H HG23 . VAL B 2 26  ? 51.119  10.339  -23.431 1.00 0.00 ? 26  VAL B HG23 1  
ATOM 3966  N N    . ASP B 2 27  ? 48.285  10.791  -20.095 1.00 0.00 ? 27  ASP B N    1  
ATOM 3967  C CA   . ASP B 2 27  ? 47.129  9.936   -19.782 1.00 0.00 ? 27  ASP B CA   1  
ATOM 3968  C C    . ASP B 2 27  ? 47.194  9.425   -18.347 1.00 0.00 ? 27  ASP B C    1  
ATOM 3969  O O    . ASP B 2 27  ? 48.133  9.734   -17.614 1.00 0.00 ? 27  ASP B O    1  
ATOM 3970  C CB   . ASP B 2 27  ? 47.090  8.747   -20.744 1.00 0.00 ? 27  ASP B CB   1  
ATOM 3971  C CG   . ASP B 2 27  ? 46.792  9.244   -22.159 1.00 0.00 ? 27  ASP B CG   1  
ATOM 3972  O OD1  . ASP B 2 27  ? 45.655  9.609   -22.411 1.00 0.00 ? 27  ASP B OD1  1  
ATOM 3973  O OD2  . ASP B 2 27  ? 47.706  9.252   -22.968 1.00 0.00 ? 27  ASP B OD2  1  
ATOM 3974  H H    . ASP B 2 27  ? 49.112  10.695  -19.579 1.00 0.00 ? 27  ASP B H    1  
ATOM 3975  H HA   . ASP B 2 27  ? 46.219  10.508  -19.903 1.00 0.00 ? 27  ASP B HA   1  
ATOM 3976  H HB2  . ASP B 2 27  ? 48.047  8.244   -20.732 1.00 0.00 ? 27  ASP B HB2  1  
ATOM 3977  H HB3  . ASP B 2 27  ? 46.317  8.059   -20.436 1.00 0.00 ? 27  ASP B HB3  1  
ATOM 3978  N N    . TYR B 2 28  ? 46.186  8.643   -17.944 1.00 0.00 ? 28  TYR B N    1  
ATOM 3979  C CA   . TYR B 2 28  ? 46.154  8.107   -16.586 1.00 0.00 ? 28  TYR B CA   1  
ATOM 3980  C C    . TYR B 2 28  ? 45.131  6.976   -16.445 1.00 0.00 ? 28  TYR B C    1  
ATOM 3981  O O    . TYR B 2 28  ? 44.320  6.735   -17.339 1.00 0.00 ? 28  TYR B O    1  
ATOM 3982  C CB   . TYR B 2 28  ? 45.828  9.235   -15.594 1.00 0.00 ? 28  TYR B CB   1  
ATOM 3983  C CG   . TYR B 2 28  ? 44.376  9.654   -15.742 1.00 0.00 ? 28  TYR B CG   1  
ATOM 3984  C CD1  . TYR B 2 28  ? 43.964  10.372  -16.886 1.00 0.00 ? 28  TYR B CD1  1  
ATOM 3985  C CD2  . TYR B 2 28  ? 43.435  9.325   -14.739 1.00 0.00 ? 28  TYR B CD2  1  
ATOM 3986  C CE1  . TYR B 2 28  ? 42.613  10.762  -17.026 1.00 0.00 ? 28  TYR B CE1  1  
ATOM 3987  C CE2  . TYR B 2 28  ? 42.086  9.716   -14.880 1.00 0.00 ? 28  TYR B CE2  1  
ATOM 3988  C CZ   . TYR B 2 28  ? 41.675  10.434  -16.023 1.00 0.00 ? 28  TYR B CZ   1  
ATOM 3989  O OH   . TYR B 2 28  ? 40.343  10.748  -16.196 1.00 0.00 ? 28  TYR B OH   1  
ATOM 3990  H H    . TYR B 2 28  ? 45.456  8.429   -18.562 1.00 0.00 ? 28  TYR B H    1  
ATOM 3991  H HA   . TYR B 2 28  ? 47.129  7.713   -16.350 1.00 0.00 ? 28  TYR B HA   1  
ATOM 3992  H HB2  . TYR B 2 28  ? 46.005  8.890   -14.587 1.00 0.00 ? 28  TYR B HB2  1  
ATOM 3993  H HB3  . TYR B 2 28  ? 46.466  10.082  -15.797 1.00 0.00 ? 28  TYR B HB3  1  
ATOM 3994  H HD1  . TYR B 2 28  ? 44.680  10.624  -17.653 1.00 0.00 ? 28  TYR B HD1  1  
ATOM 3995  H HD2  . TYR B 2 28  ? 43.749  8.776   -13.863 1.00 0.00 ? 28  TYR B HD2  1  
ATOM 3996  H HE1  . TYR B 2 28  ? 42.297  11.310  -17.901 1.00 0.00 ? 28  TYR B HE1  1  
ATOM 3997  H HE2  . TYR B 2 28  ? 41.368  9.464   -14.113 1.00 0.00 ? 28  TYR B HE2  1  
ATOM 3998  H HH   . TYR B 2 28  ? 40.240  11.134  -17.069 1.00 0.00 ? 28  TYR B HH   1  
ATOM 3999  N N    . TYR B 2 29  ? 45.185  6.294   -15.301 1.00 0.00 ? 29  TYR B N    1  
ATOM 4000  C CA   . TYR B 2 29  ? 44.275  5.190   -15.006 1.00 0.00 ? 29  TYR B CA   1  
ATOM 4001  C C    . TYR B 2 29  ? 44.217  4.963   -13.496 1.00 0.00 ? 29  TYR B C    1  
ATOM 4002  O O    . TYR B 2 29  ? 45.164  5.288   -12.781 1.00 0.00 ? 29  TYR B O    1  
ATOM 4003  C CB   . TYR B 2 29  ? 44.754  3.912   -15.699 1.00 0.00 ? 29  TYR B CB   1  
ATOM 4004  C CG   . TYR B 2 29  ? 44.608  4.064   -17.194 1.00 0.00 ? 29  TYR B CG   1  
ATOM 4005  C CD1  . TYR B 2 29  ? 43.391  3.723   -17.823 1.00 0.00 ? 29  TYR B CD1  1  
ATOM 4006  C CD2  . TYR B 2 29  ? 45.689  4.547   -17.964 1.00 0.00 ? 29  TYR B CD2  1  
ATOM 4007  C CE1  . TYR B 2 29  ? 43.255  3.864   -19.221 1.00 0.00 ? 29  TYR B CE1  1  
ATOM 4008  C CE2  . TYR B 2 29  ? 45.553  4.689   -19.363 1.00 0.00 ? 29  TYR B CE2  1  
ATOM 4009  C CZ   . TYR B 2 29  ? 44.335  4.348   -19.991 1.00 0.00 ? 29  TYR B CZ   1  
ATOM 4010  O OH   . TYR B 2 29  ? 44.227  4.409   -21.365 1.00 0.00 ? 29  TYR B OH   1  
ATOM 4011  H H    . TYR B 2 29  ? 45.852  6.545   -14.634 1.00 0.00 ? 29  TYR B H    1  
ATOM 4012  H HA   . TYR B 2 29  ? 43.286  5.437   -15.364 1.00 0.00 ? 29  TYR B HA   1  
ATOM 4013  H HB2  . TYR B 2 29  ? 45.791  3.736   -15.452 1.00 0.00 ? 29  TYR B HB2  1  
ATOM 4014  H HB3  . TYR B 2 29  ? 44.158  3.076   -15.364 1.00 0.00 ? 29  TYR B HB3  1  
ATOM 4015  H HD1  . TYR B 2 29  ? 42.565  3.354   -17.234 1.00 0.00 ? 29  TYR B HD1  1  
ATOM 4016  H HD2  . TYR B 2 29  ? 46.621  4.808   -17.484 1.00 0.00 ? 29  TYR B HD2  1  
ATOM 4017  H HE1  . TYR B 2 29  ? 42.323  3.604   -19.701 1.00 0.00 ? 29  TYR B HE1  1  
ATOM 4018  H HE2  . TYR B 2 29  ? 46.379  5.057   -19.951 1.00 0.00 ? 29  TYR B HE2  1  
ATOM 4019  H HH   . TYR B 2 29  ? 45.057  4.745   -21.713 1.00 0.00 ? 29  TYR B HH   1  
ATOM 4020  N N    . GLU B 2 30  ? 43.101  4.415   -13.006 1.00 0.00 ? 30  GLU B N    1  
ATOM 4021  C CA   . GLU B 2 30  ? 42.935  4.164   -11.568 1.00 0.00 ? 30  GLU B CA   1  
ATOM 4022  C C    . GLU B 2 30  ? 43.260  2.713   -11.222 1.00 0.00 ? 30  GLU B C    1  
ATOM 4023  O O    . GLU B 2 30  ? 43.036  1.807   -12.025 1.00 0.00 ? 30  GLU B O    1  
ATOM 4024  C CB   . GLU B 2 30  ? 41.492  4.466   -11.159 1.00 0.00 ? 30  GLU B CB   1  
ATOM 4025  C CG   . GLU B 2 30  ? 41.234  5.970   -11.276 1.00 0.00 ? 30  GLU B CG   1  
ATOM 4026  C CD   . GLU B 2 30  ? 39.756  6.259   -10.999 1.00 0.00 ? 30  GLU B CD   1  
ATOM 4027  O OE1  . GLU B 2 30  ? 39.387  6.288   -9.837  1.00 0.00 ? 30  GLU B OE1  1  
ATOM 4028  O OE2  . GLU B 2 30  ? 39.020  6.445   -11.954 1.00 0.00 ? 30  GLU B OE2  1  
ATOM 4029  H H    . GLU B 2 30  ? 42.367  4.179   -13.611 1.00 0.00 ? 30  GLU B H    1  
ATOM 4030  H HA   . GLU B 2 30  ? 43.594  4.812   -11.007 1.00 0.00 ? 30  GLU B HA   1  
ATOM 4031  H HB2  . GLU B 2 30  ? 40.813  3.933   -11.809 1.00 0.00 ? 30  GLU B HB2  1  
ATOM 4032  H HB3  . GLU B 2 30  ? 41.333  4.154   -10.138 1.00 0.00 ? 30  GLU B HB3  1  
ATOM 4033  H HG2  . GLU B 2 30  ? 41.845  6.494   -10.557 1.00 0.00 ? 30  GLU B HG2  1  
ATOM 4034  H HG3  . GLU B 2 30  ? 41.483  6.302   -12.272 1.00 0.00 ? 30  GLU B HG3  1  
ATOM 4035  N N    . THR B 2 31  ? 43.797  2.509   -10.021 1.00 0.00 ? 31  THR B N    1  
ATOM 4036  C CA   . THR B 2 31  ? 44.163  1.171   -9.562  1.00 0.00 ? 31  THR B CA   1  
ATOM 4037  C C    . THR B 2 31  ? 42.982  0.201   -9.687  1.00 0.00 ? 31  THR B C    1  
ATOM 4038  O O    . THR B 2 31  ? 42.587  -0.171  -10.791 1.00 0.00 ? 31  THR B O    1  
ATOM 4039  C CB   . THR B 2 31  ? 44.626  1.208   -8.092  1.00 0.00 ? 31  THR B CB   1  
ATOM 4040  O OG1  . THR B 2 31  ? 43.620  1.819   -7.297  1.00 0.00 ? 31  THR B OG1  1  
ATOM 4041  C CG2  . THR B 2 31  ? 45.923  2.008   -7.980  1.00 0.00 ? 31  THR B CG2  1  
ATOM 4042  H H    . THR B 2 31  ? 43.962  3.280   -9.437  1.00 0.00 ? 31  THR B H    1  
ATOM 4043  H HA   . THR B 2 31  ? 44.977  0.806   -10.170 1.00 0.00 ? 31  THR B HA   1  
ATOM 4044  H HB   . THR B 2 31  ? 44.797  0.201   -7.743  1.00 0.00 ? 31  THR B HB   1  
ATOM 4045  H HG1  . THR B 2 31  ? 43.933  2.689   -7.040  1.00 0.00 ? 31  THR B HG1  1  
ATOM 4046  H HG21 . THR B 2 31  ? 45.724  3.048   -8.196  1.00 0.00 ? 31  THR B HG21 1  
ATOM 4047  H HG22 . THR B 2 31  ? 46.645  1.625   -8.685  1.00 0.00 ? 31  THR B HG22 1  
ATOM 4048  H HG23 . THR B 2 31  ? 46.314  1.917   -6.978  1.00 0.00 ? 31  THR B HG23 1  
ATOM 4049  N N    . SER B 2 32  ? 42.430  -0.217  -8.545  1.00 0.00 ? 32  SER B N    1  
ATOM 4050  C CA   . SER B 2 32  ? 41.301  -1.152  -8.534  1.00 0.00 ? 32  SER B CA   1  
ATOM 4051  C C    . SER B 2 32  ? 40.428  -0.928  -7.302  1.00 0.00 ? 32  SER B C    1  
ATOM 4052  O O    . SER B 2 32  ? 40.267  0.202   -6.842  1.00 0.00 ? 32  SER B O    1  
ATOM 4053  C CB   . SER B 2 32  ? 41.823  -2.591  -8.539  1.00 0.00 ? 32  SER B CB   1  
ATOM 4054  O OG   . SER B 2 32  ? 42.793  -2.735  -9.568  1.00 0.00 ? 32  SER B OG   1  
ATOM 4055  H H    . SER B 2 32  ? 42.797  0.108   -7.695  1.00 0.00 ? 32  SER B H    1  
ATOM 4056  H HA   . SER B 2 32  ? 40.699  -0.998  -9.419  1.00 0.00 ? 32  SER B HA   1  
ATOM 4057  H HB2  . SER B 2 32  ? 42.277  -2.814  -7.589  1.00 0.00 ? 32  SER B HB2  1  
ATOM 4058  H HB3  . SER B 2 32  ? 40.997  -3.270  -8.710  1.00 0.00 ? 32  SER B HB3  1  
ATOM 4059  H HG   . SER B 2 32  ? 42.594  -2.095  -10.255 1.00 0.00 ? 32  SER B HG   1  
ATOM 4060  N N    . SER B 2 33  ? 39.861  -2.016  -6.774  1.00 0.00 ? 33  SER B N    1  
ATOM 4061  C CA   . SER B 2 33  ? 38.996  -1.940  -5.592  1.00 0.00 ? 33  SER B CA   1  
ATOM 4062  C C    . SER B 2 33  ? 39.243  -3.133  -4.674  1.00 0.00 ? 33  SER B C    1  
ATOM 4063  O O    . SER B 2 33  ? 38.968  -3.072  -3.476  1.00 0.00 ? 33  SER B O    1  
ATOM 4064  C CB   . SER B 2 33  ? 37.529  -1.925  -6.023  1.00 0.00 ? 33  SER B CB   1  
ATOM 4065  O OG   . SER B 2 33  ? 37.256  -3.082  -6.803  1.00 0.00 ? 33  SER B OG   1  
ATOM 4066  H H    . SER B 2 33  ? 40.026  -2.889  -7.189  1.00 0.00 ? 33  SER B H    1  
ATOM 4067  H HA   . SER B 2 33  ? 39.207  -1.032  -5.043  1.00 0.00 ? 33  SER B HA   1  
ATOM 4068  H HB2  . SER B 2 33  ? 36.896  -1.927  -5.152  1.00 0.00 ? 33  SER B HB2  1  
ATOM 4069  H HB3  . SER B 2 33  ? 37.334  -1.033  -6.604  1.00 0.00 ? 33  SER B HB3  1  
ATOM 4070  H HG   . SER B 2 33  ? 37.044  -3.801  -6.202  1.00 0.00 ? 33  SER B HG   1  
ATOM 4071  N N    . LEU B 2 34  ? 39.768  -4.214  -5.242  1.00 0.00 ? 34  LEU B N    1  
ATOM 4072  C CA   . LEU B 2 34  ? 40.052  -5.410  -4.456  1.00 0.00 ? 34  LEU B CA   1  
ATOM 4073  C C    . LEU B 2 34  ? 41.033  -5.080  -3.335  1.00 0.00 ? 34  LEU B C    1  
ATOM 4074  O O    . LEU B 2 34  ? 41.324  -5.919  -2.484  1.00 0.00 ? 34  LEU B O    1  
ATOM 4075  C CB   . LEU B 2 34  ? 40.643  -6.506  -5.351  1.00 0.00 ? 34  LEU B CB   1  
ATOM 4076  C CG   . LEU B 2 34  ? 39.808  -6.655  -6.630  1.00 0.00 ? 34  LEU B CG   1  
ATOM 4077  C CD1  . LEU B 2 34  ? 40.419  -7.759  -7.499  1.00 0.00 ? 34  LEU B CD1  1  
ATOM 4078  C CD2  . LEU B 2 34  ? 38.358  -7.024  -6.273  1.00 0.00 ? 34  LEU B CD2  1  
ATOM 4079  H H    . LEU B 2 34  ? 39.972  -4.205  -6.200  1.00 0.00 ? 34  LEU B H    1  
ATOM 4080  H HA   . LEU B 2 34  ? 39.135  -5.771  -4.018  1.00 0.00 ? 34  LEU B HA   1  
ATOM 4081  H HB2  . LEU B 2 34  ? 41.658  -6.245  -5.615  1.00 0.00 ? 34  LEU B HB2  1  
ATOM 4082  H HB3  . LEU B 2 34  ? 40.643  -7.444  -4.814  1.00 0.00 ? 34  LEU B HB3  1  
ATOM 4083  H HG   . LEU B 2 34  ? 39.821  -5.725  -7.176  1.00 0.00 ? 34  LEU B HG   1  
ATOM 4084  H HD11 . LEU B 2 34  ? 40.431  -8.687  -6.948  1.00 0.00 ? 34  LEU B HD11 1  
ATOM 4085  H HD12 . LEU B 2 34  ? 41.429  -7.488  -7.769  1.00 0.00 ? 34  LEU B HD12 1  
ATOM 4086  H HD13 . LEU B 2 34  ? 39.827  -7.880  -8.396  1.00 0.00 ? 34  LEU B HD13 1  
ATOM 4087  H HD21 . LEU B 2 34  ? 37.836  -6.141  -5.934  1.00 0.00 ? 34  LEU B HD21 1  
ATOM 4088  H HD22 . LEU B 2 34  ? 38.352  -7.769  -5.490  1.00 0.00 ? 34  LEU B HD22 1  
ATOM 4089  H HD23 . LEU B 2 34  ? 37.857  -7.419  -7.147  1.00 0.00 ? 34  LEU B HD23 1  
ATOM 4090  N N    . CYS B 2 35  ? 41.528  -3.838  -3.338  1.00 0.00 ? 35  CYS B N    1  
ATOM 4091  C CA   . CYS B 2 35  ? 42.470  -3.369  -2.314  1.00 0.00 ? 35  CYS B CA   1  
ATOM 4092  C C    . CYS B 2 35  ? 41.839  -2.221  -1.535  1.00 0.00 ? 35  CYS B C    1  
ATOM 4093  O O    . CYS B 2 35  ? 41.464  -1.200  -2.110  1.00 0.00 ? 35  CYS B O    1  
ATOM 4094  C CB   . CYS B 2 35  ? 43.774  -2.895  -2.969  1.00 0.00 ? 35  CYS B CB   1  
ATOM 4095  S SG   . CYS B 2 35  ? 43.409  -1.726  -4.305  1.00 0.00 ? 35  CYS B SG   1  
ATOM 4096  H H    . CYS B 2 35  ? 41.242  -3.215  -4.037  1.00 0.00 ? 35  CYS B H    1  
ATOM 4097  H HA   . CYS B 2 35  ? 42.697  -4.173  -1.625  1.00 0.00 ? 35  CYS B HA   1  
ATOM 4098  H HB2  . CYS B 2 35  ? 44.391  -2.409  -2.227  1.00 0.00 ? 35  CYS B HB2  1  
ATOM 4099  H HB3  . CYS B 2 35  ? 44.303  -3.747  -3.372  1.00 0.00 ? 35  CYS B HB3  1  
ATOM 4100  N N    . SER B 2 36  ? 41.708  -2.404  -0.225  1.00 0.00 ? 36  SER B N    1  
ATOM 4101  C CA   . SER B 2 36  ? 41.103  -1.384  0.624   1.00 0.00 ? 36  SER B CA   1  
ATOM 4102  C C    . SER B 2 36  ? 42.037  -0.192  0.807   1.00 0.00 ? 36  SER B C    1  
ATOM 4103  O O    . SER B 2 36  ? 42.092  0.399   1.886   1.00 0.00 ? 36  SER B O    1  
ATOM 4104  C CB   . SER B 2 36  ? 40.764  -1.980  1.990   1.00 0.00 ? 36  SER B CB   1  
ATOM 4105  O OG   . SER B 2 36  ? 40.110  -0.998  2.783   1.00 0.00 ? 36  SER B OG   1  
ATOM 4106  H H    . SER B 2 36  ? 42.013  -3.245  0.176   1.00 0.00 ? 36  SER B H    1  
ATOM 4107  H HA   . SER B 2 36  ? 40.189  -1.042  0.161   1.00 0.00 ? 36  SER B HA   1  
ATOM 4108  H HB2  . SER B 2 36  ? 40.110  -2.827  1.864   1.00 0.00 ? 36  SER B HB2  1  
ATOM 4109  H HB3  . SER B 2 36  ? 41.676  -2.302  2.476   1.00 0.00 ? 36  SER B HB3  1  
ATOM 4110  H HG   . SER B 2 36  ? 40.784  -0.476  3.224   1.00 0.00 ? 36  SER B HG   1  
ATOM 4111  N N    . GLN B 2 37  ? 42.768  0.163   -0.246  1.00 0.00 ? 37  GLN B N    1  
ATOM 4112  C CA   . GLN B 2 37  ? 43.693  1.288   -0.190  1.00 0.00 ? 37  GLN B CA   1  
ATOM 4113  C C    . GLN B 2 37  ? 44.138  1.633   -1.612  1.00 0.00 ? 37  GLN B C    1  
ATOM 4114  O O    . GLN B 2 37  ? 45.320  1.538   -1.942  1.00 0.00 ? 37  GLN B O    1  
ATOM 4115  C CB   . GLN B 2 37  ? 44.910  0.921   0.667   1.00 0.00 ? 37  GLN B CB   1  
ATOM 4116  C CG   . GLN B 2 37  ? 45.398  -0.480  0.289   1.00 0.00 ? 37  GLN B CG   1  
ATOM 4117  C CD   . GLN B 2 37  ? 46.705  -0.781  1.023   1.00 0.00 ? 37  GLN B CD   1  
ATOM 4118  O OE1  . GLN B 2 37  ? 47.710  -0.141  0.786   1.00 0.00 ? 37  GLN B OE1  1  
ATOM 4119  N NE2  . GLN B 2 37  ? 46.735  -1.735  1.913   1.00 0.00 ? 37  GLN B NE2  1  
ATOM 4120  H H    . GLN B 2 37  ? 42.702  -0.327  -1.090  1.00 0.00 ? 37  GLN B H    1  
ATOM 4121  H HA   . GLN B 2 37  ? 43.197  2.139   0.250   1.00 0.00 ? 37  GLN B HA   1  
ATOM 4122  H HB2  . GLN B 2 37  ? 45.703  1.637   0.497   1.00 0.00 ? 37  GLN B HB2  1  
ATOM 4123  H HB3  . GLN B 2 37  ? 44.632  0.932   1.710   1.00 0.00 ? 37  GLN B HB3  1  
ATOM 4124  H HG2  . GLN B 2 37  ? 44.650  -1.208  0.570   1.00 0.00 ? 37  GLN B HG2  1  
ATOM 4125  H HG3  . GLN B 2 37  ? 45.566  -0.529  -0.776  1.00 0.00 ? 37  GLN B HG3  1  
ATOM 4126  H HE21 . GLN B 2 37  ? 45.925  -2.252  2.106   1.00 0.00 ? 37  GLN B HE21 1  
ATOM 4127  H HE22 . GLN B 2 37  ? 47.568  -1.935  2.390   1.00 0.00 ? 37  GLN B HE22 1  
ATOM 4128  N N    . PRO B 2 38  ? 43.180  2.006   -2.484  1.00 0.00 ? 38  PRO B N    1  
ATOM 4129  C CA   . PRO B 2 38  ? 43.469  2.328   -3.896  1.00 0.00 ? 38  PRO B CA   1  
ATOM 4130  C C    . PRO B 2 38  ? 44.245  3.639   -4.060  1.00 0.00 ? 38  PRO B C    1  
ATOM 4131  O O    . PRO B 2 38  ? 44.859  4.130   -3.114  1.00 0.00 ? 38  PRO B O    1  
ATOM 4132  C CB   . PRO B 2 38  ? 42.069  2.397   -4.542  1.00 0.00 ? 38  PRO B CB   1  
ATOM 4133  C CG   . PRO B 2 38  ? 41.163  2.805   -3.426  1.00 0.00 ? 38  PRO B CG   1  
ATOM 4134  C CD   . PRO B 2 38  ? 41.743  2.148   -2.171  1.00 0.00 ? 38  PRO B CD   1  
ATOM 4135  H HA   . PRO B 2 38  ? 44.028  1.522   -4.346  1.00 0.00 ? 38  PRO B HA   1  
ATOM 4136  H HB2  . PRO B 2 38  ? 42.045  3.126   -5.345  1.00 0.00 ? 38  PRO B HB2  1  
ATOM 4137  H HB3  . PRO B 2 38  ? 41.778  1.424   -4.915  1.00 0.00 ? 38  PRO B HB3  1  
ATOM 4138  H HG2  . PRO B 2 38  ? 41.164  3.886   -3.323  1.00 0.00 ? 38  PRO B HG2  1  
ATOM 4139  H HG3  . PRO B 2 38  ? 40.158  2.448   -3.599  1.00 0.00 ? 38  PRO B HG3  1  
ATOM 4140  H HD2  . PRO B 2 38  ? 41.597  2.786   -1.309  1.00 0.00 ? 38  PRO B HD2  1  
ATOM 4141  H HD3  . PRO B 2 38  ? 41.301  1.177   -2.005  1.00 0.00 ? 38  PRO B HD3  1  
ATOM 4142  N N    . ALA B 2 39  ? 44.198  4.187   -5.274  1.00 0.00 ? 39  ALA B N    1  
ATOM 4143  C CA   . ALA B 2 39  ? 44.889  5.437   -5.589  1.00 0.00 ? 39  ALA B CA   1  
ATOM 4144  C C    . ALA B 2 39  ? 44.788  5.729   -7.085  1.00 0.00 ? 39  ALA B C    1  
ATOM 4145  O O    . ALA B 2 39  ? 44.246  4.930   -7.848  1.00 0.00 ? 39  ALA B O    1  
ATOM 4146  C CB   . ALA B 2 39  ? 46.358  5.345   -5.170  1.00 0.00 ? 39  ALA B CB   1  
ATOM 4147  H H    . ALA B 2 39  ? 43.672  3.734   -5.966  1.00 0.00 ? 39  ALA B H    1  
ATOM 4148  H HA   . ALA B 2 39  ? 44.417  6.244   -5.045  1.00 0.00 ? 39  ALA B HA   1  
ATOM 4149  H HB1  . ALA B 2 39  ? 46.941  6.082   -5.705  1.00 0.00 ? 39  ALA B HB1  1  
ATOM 4150  H HB2  . ALA B 2 39  ? 46.732  4.359   -5.398  1.00 0.00 ? 39  ALA B HB2  1  
ATOM 4151  H HB3  . ALA B 2 39  ? 46.444  5.525   -4.110  1.00 0.00 ? 39  ALA B HB3  1  
ATOM 4152  N N    . VAL B 2 40  ? 45.325  6.879   -7.498  1.00 0.00 ? 40  VAL B N    1  
ATOM 4153  C CA   . VAL B 2 40  ? 45.308  7.280   -8.908  1.00 0.00 ? 40  VAL B CA   1  
ATOM 4154  C C    . VAL B 2 40  ? 46.690  7.084   -9.519  1.00 0.00 ? 40  VAL B C    1  
ATOM 4155  O O    . VAL B 2 40  ? 47.704  7.448   -8.924  1.00 0.00 ? 40  VAL B O    1  
ATOM 4156  C CB   . VAL B 2 40  ? 44.895  8.765   -9.047  1.00 0.00 ? 40  VAL B CB   1  
ATOM 4157  C CG1  . VAL B 2 40  ? 45.100  9.245   -10.494 1.00 0.00 ? 40  VAL B CG1  1  
ATOM 4158  C CG2  . VAL B 2 40  ? 43.419  8.898   -8.677  1.00 0.00 ? 40  VAL B CG2  1  
ATOM 4159  H H    . VAL B 2 40  ? 45.754  7.472   -6.845  1.00 0.00 ? 40  VAL B H    1  
ATOM 4160  H HA   . VAL B 2 40  ? 44.598  6.670   -9.453  1.00 0.00 ? 40  VAL B HA   1  
ATOM 4161  H HB   . VAL B 2 40  ? 45.492  9.369   -8.379  1.00 0.00 ? 40  VAL B HB   1  
ATOM 4162  H HG11 . VAL B 2 40  ? 46.154  9.381   -10.683 1.00 0.00 ? 40  VAL B HG11 1  
ATOM 4163  H HG12 . VAL B 2 40  ? 44.588  10.185  -10.640 1.00 0.00 ? 40  VAL B HG12 1  
ATOM 4164  H HG13 . VAL B 2 40  ? 44.704  8.509   -11.176 1.00 0.00 ? 40  VAL B HG13 1  
ATOM 4165  H HG21 . VAL B 2 40  ? 43.276  8.606   -7.647  1.00 0.00 ? 40  VAL B HG21 1  
ATOM 4166  H HG22 . VAL B 2 40  ? 42.835  8.253   -9.318  1.00 0.00 ? 40  VAL B HG22 1  
ATOM 4167  H HG23 . VAL B 2 40  ? 43.102  9.922   -8.809  1.00 0.00 ? 40  VAL B HG23 1  
ATOM 4168  N N    . VAL B 2 41  ? 46.714  6.504   -10.718 1.00 0.00 ? 41  VAL B N    1  
ATOM 4169  C CA   . VAL B 2 41  ? 47.969  6.248   -11.436 1.00 0.00 ? 41  VAL B CA   1  
ATOM 4170  C C    . VAL B 2 41  ? 48.021  7.081   -12.706 1.00 0.00 ? 41  VAL B C    1  
ATOM 4171  O O    . VAL B 2 41  ? 47.071  7.090   -13.481 1.00 0.00 ? 41  VAL B O    1  
ATOM 4172  C CB   . VAL B 2 41  ? 48.086  4.754   -11.812 1.00 0.00 ? 41  VAL B CB   1  
ATOM 4173  C CG1  . VAL B 2 41  ? 49.523  4.434   -12.229 1.00 0.00 ? 41  VAL B CG1  1  
ATOM 4174  C CG2  . VAL B 2 41  ? 47.706  3.895   -10.603 1.00 0.00 ? 41  VAL B CG2  1  
ATOM 4175  H H    . VAL B 2 41  ? 45.863  6.240   -11.130 1.00 0.00 ? 41  VAL B H    1  
ATOM 4176  H HA   . VAL B 2 41  ? 48.808  6.520   -10.816 1.00 0.00 ? 41  VAL B HA   1  
ATOM 4177  H HB   . VAL B 2 41  ? 47.418  4.533   -12.634 1.00 0.00 ? 41  VAL B HB   1  
ATOM 4178  H HG11 . VAL B 2 41  ? 49.801  5.054   -13.068 1.00 0.00 ? 41  VAL B HG11 1  
ATOM 4179  H HG12 . VAL B 2 41  ? 49.592  3.394   -12.511 1.00 0.00 ? 41  VAL B HG12 1  
ATOM 4180  H HG13 . VAL B 2 41  ? 50.190  4.627   -11.402 1.00 0.00 ? 41  VAL B HG13 1  
ATOM 4181  H HG21 . VAL B 2 41  ? 46.679  4.090   -10.331 1.00 0.00 ? 41  VAL B HG21 1  
ATOM 4182  H HG22 . VAL B 2 41  ? 48.352  4.137   -9.772  1.00 0.00 ? 41  VAL B HG22 1  
ATOM 4183  H HG23 . VAL B 2 41  ? 47.818  2.850   -10.854 1.00 0.00 ? 41  VAL B HG23 1  
ATOM 4184  N N    . PHE B 2 42  ? 49.136  7.788   -12.914 1.00 0.00 ? 42  PHE B N    1  
ATOM 4185  C CA   . PHE B 2 42  ? 49.298  8.636   -14.103 1.00 0.00 ? 42  PHE B CA   1  
ATOM 4186  C C    . PHE B 2 42  ? 50.355  8.068   -15.045 1.00 0.00 ? 42  PHE B C    1  
ATOM 4187  O O    . PHE B 2 42  ? 51.342  7.475   -14.609 1.00 0.00 ? 42  PHE B O    1  
ATOM 4188  C CB   . PHE B 2 42  ? 49.678  10.063  -13.689 1.00 0.00 ? 42  PHE B CB   1  
ATOM 4189  C CG   . PHE B 2 42  ? 51.039  10.079  -13.032 1.00 0.00 ? 42  PHE B CG   1  
ATOM 4190  C CD1  . PHE B 2 42  ? 52.203  10.055  -13.829 1.00 0.00 ? 42  PHE B CD1  1  
ATOM 4191  C CD2  . PHE B 2 42  ? 51.149  10.134  -11.624 1.00 0.00 ? 42  PHE B CD2  1  
ATOM 4192  C CE1  . PHE B 2 42  ? 53.475  10.085  -13.222 1.00 0.00 ? 42  PHE B CE1  1  
ATOM 4193  C CE2  . PHE B 2 42  ? 52.424  10.164  -11.017 1.00 0.00 ? 42  PHE B CE2  1  
ATOM 4194  C CZ   . PHE B 2 42  ? 53.586  10.141  -11.814 1.00 0.00 ? 42  PHE B CZ   1  
ATOM 4195  H H    . PHE B 2 42  ? 49.862  7.743   -12.254 1.00 0.00 ? 42  PHE B H    1  
ATOM 4196  H HA   . PHE B 2 42  ? 48.363  8.687   -14.639 1.00 0.00 ? 42  PHE B HA   1  
ATOM 4197  H HB2  . PHE B 2 42  ? 49.698  10.693  -14.566 1.00 0.00 ? 42  PHE B HB2  1  
ATOM 4198  H HB3  . PHE B 2 42  ? 48.939  10.441  -12.997 1.00 0.00 ? 42  PHE B HB3  1  
ATOM 4199  H HD1  . PHE B 2 42  ? 52.121  10.015  -14.904 1.00 0.00 ? 42  PHE B HD1  1  
ATOM 4200  H HD2  . PHE B 2 42  ? 50.259  10.152  -11.015 1.00 0.00 ? 42  PHE B HD2  1  
ATOM 4201  H HE1  . PHE B 2 42  ? 54.362  10.064  -13.832 1.00 0.00 ? 42  PHE B HE1  1  
ATOM 4202  H HE2  . PHE B 2 42  ? 52.509  10.206  -9.942  1.00 0.00 ? 42  PHE B HE2  1  
ATOM 4203  H HZ   . PHE B 2 42  ? 54.558  10.240  -11.355 1.00 0.00 ? 42  PHE B HZ   1  
ATOM 4204  N N    . GLN B 2 43  ? 50.136  8.268   -16.345 1.00 0.00 ? 43  GLN B N    1  
ATOM 4205  C CA   . GLN B 2 43  ? 51.053  7.800   -17.376 1.00 0.00 ? 43  GLN B CA   1  
ATOM 4206  C C    . GLN B 2 43  ? 52.018  8.937   -17.700 1.00 0.00 ? 43  GLN B C    1  
ATOM 4207  O O    . GLN B 2 43  ? 51.808  10.067  -17.260 1.00 0.00 ? 43  GLN B O    1  
ATOM 4208  C CB   . GLN B 2 43  ? 50.230  7.383   -18.611 1.00 0.00 ? 43  GLN B CB   1  
ATOM 4209  C CG   . GLN B 2 43  ? 51.106  7.322   -19.865 1.00 0.00 ? 43  GLN B CG   1  
ATOM 4210  C CD   . GLN B 2 43  ? 50.336  6.647   -21.000 1.00 0.00 ? 43  GLN B CD   1  
ATOM 4211  O OE1  . GLN B 2 43  ? 49.351  5.973   -20.767 1.00 0.00 ? 43  GLN B OE1  1  
ATOM 4212  N NE2  . GLN B 2 43  ? 50.743  6.799   -22.230 1.00 0.00 ? 43  GLN B NE2  1  
ATOM 4213  H H    . GLN B 2 43  ? 49.335  8.755   -16.623 1.00 0.00 ? 43  GLN B H    1  
ATOM 4214  H HA   . GLN B 2 43  ? 51.613  6.947   -17.014 1.00 0.00 ? 43  GLN B HA   1  
ATOM 4215  H HB2  . GLN B 2 43  ? 49.794  6.409   -18.434 1.00 0.00 ? 43  GLN B HB2  1  
ATOM 4216  H HB3  . GLN B 2 43  ? 49.438  8.100   -18.767 1.00 0.00 ? 43  GLN B HB3  1  
ATOM 4217  H HG2  . GLN B 2 43  ? 51.367  8.326   -20.156 1.00 0.00 ? 43  GLN B HG2  1  
ATOM 4218  H HG3  . GLN B 2 43  ? 52.001  6.758   -19.654 1.00 0.00 ? 43  GLN B HG3  1  
ATOM 4219  H HE21 . GLN B 2 43  ? 51.537  7.342   -22.419 1.00 0.00 ? 43  GLN B HE21 1  
ATOM 4220  H HE22 . GLN B 2 43  ? 50.257  6.371   -22.966 1.00 0.00 ? 43  GLN B HE22 1  
ATOM 4221  N N    . THR B 2 44  ? 53.081  8.653   -18.457 1.00 0.00 ? 44  THR B N    1  
ATOM 4222  C CA   . THR B 2 44  ? 54.064  9.685   -18.804 1.00 0.00 ? 44  THR B CA   1  
ATOM 4223  C C    . THR B 2 44  ? 54.453  9.600   -20.279 1.00 0.00 ? 44  THR B C    1  
ATOM 4224  O O    . THR B 2 44  ? 53.621  9.328   -21.144 1.00 0.00 ? 44  THR B O    1  
ATOM 4225  C CB   . THR B 2 44  ? 55.340  9.527   -17.947 1.00 0.00 ? 44  THR B CB   1  
ATOM 4226  O OG1  . THR B 2 44  ? 56.182  8.546   -18.538 1.00 0.00 ? 44  THR B OG1  1  
ATOM 4227  C CG2  . THR B 2 44  ? 54.961  9.090   -16.533 1.00 0.00 ? 44  THR B CG2  1  
ATOM 4228  H H    . THR B 2 44  ? 53.221  7.746   -18.796 1.00 0.00 ? 44  THR B H    1  
ATOM 4229  H HA   . THR B 2 44  ? 53.651  10.664  -18.624 1.00 0.00 ? 44  THR B HA   1  
ATOM 4230  H HB   . THR B 2 44  ? 55.868  10.468  -17.899 1.00 0.00 ? 44  THR B HB   1  
ATOM 4231  H HG1  . THR B 2 44  ? 55.635  7.794   -18.779 1.00 0.00 ? 44  THR B HG1  1  
ATOM 4232  H HG21 . THR B 2 44  ? 54.643  8.058   -16.548 1.00 0.00 ? 44  THR B HG21 1  
ATOM 4233  H HG22 . THR B 2 44  ? 54.156  9.711   -16.168 1.00 0.00 ? 44  THR B HG22 1  
ATOM 4234  H HG23 . THR B 2 44  ? 55.818  9.194   -15.886 1.00 0.00 ? 44  THR B HG23 1  
ATOM 4235  N N    . ALA B 2 45  ? 55.732  9.857   -20.544 1.00 0.00 ? 45  ALA B N    1  
ATOM 4236  C CA   . ALA B 2 45  ? 56.269  9.838   -21.911 1.00 0.00 ? 45  ALA B CA   1  
ATOM 4237  C C    . ALA B 2 45  ? 57.455  8.887   -22.042 1.00 0.00 ? 45  ALA B C    1  
ATOM 4238  O O    . ALA B 2 45  ? 57.574  8.176   -23.040 1.00 0.00 ? 45  ALA B O    1  
ATOM 4239  C CB   . ALA B 2 45  ? 56.702  11.243  -22.301 1.00 0.00 ? 45  ALA B CB   1  
ATOM 4240  H H    . ALA B 2 45  ? 56.312  10.075  -19.784 1.00 0.00 ? 45  ALA B H    1  
ATOM 4241  H HA   . ALA B 2 45  ? 55.501  9.517   -22.598 1.00 0.00 ? 45  ALA B HA   1  
ATOM 4242  H HB1  . ALA B 2 45  ? 56.979  11.258  -23.344 1.00 0.00 ? 45  ALA B HB1  1  
ATOM 4243  H HB2  . ALA B 2 45  ? 57.548  11.540  -21.699 1.00 0.00 ? 45  ALA B HB2  1  
ATOM 4244  H HB3  . ALA B 2 45  ? 55.884  11.930  -22.136 1.00 0.00 ? 45  ALA B HB3  1  
ATOM 4245  N N    . ALA B 2 46  ? 58.328  8.876   -21.035 1.00 0.00 ? 46  ALA B N    1  
ATOM 4246  C CA   . ALA B 2 46  ? 59.514  8.000   -21.041 1.00 0.00 ? 46  ALA B CA   1  
ATOM 4247  C C    . ALA B 2 46  ? 59.586  7.151   -19.773 1.00 0.00 ? 46  ALA B C    1  
ATOM 4248  O O    . ALA B 2 46  ? 60.636  7.073   -19.142 1.00 0.00 ? 46  ALA B O    1  
ATOM 4249  C CB   . ALA B 2 46  ? 60.778  8.839   -21.186 1.00 0.00 ? 46  ALA B CB   1  
ATOM 4250  H H    . ALA B 2 46  ? 58.163  9.449   -20.259 1.00 0.00 ? 46  ALA B H    1  
ATOM 4251  H HA   . ALA B 2 46  ? 59.458  7.327   -21.888 1.00 0.00 ? 46  ALA B HA   1  
ATOM 4252  H HB1  . ALA B 2 46  ? 61.621  8.203   -21.440 1.00 0.00 ? 46  ALA B HB1  1  
ATOM 4253  H HB2  . ALA B 2 46  ? 60.978  9.342   -20.258 1.00 0.00 ? 46  ALA B HB2  1  
ATOM 4254  H HB3  . ALA B 2 46  ? 60.634  9.568   -21.969 1.00 0.00 ? 46  ALA B HB3  1  
ATOM 4255  N N    . SER B 2 47  ? 58.475  6.512   -19.395 1.00 0.00 ? 47  SER B N    1  
ATOM 4256  C CA   . SER B 2 47  ? 58.464  5.667   -18.191 1.00 0.00 ? 47  SER B CA   1  
ATOM 4257  C C    . SER B 2 47  ? 57.435  4.541   -18.308 1.00 0.00 ? 47  SER B C    1  
ATOM 4258  O O    . SER B 2 47  ? 57.797  3.408   -18.616 1.00 0.00 ? 47  SER B O    1  
ATOM 4259  C CB   . SER B 2 47  ? 58.194  6.515   -16.942 1.00 0.00 ? 47  SER B CB   1  
ATOM 4260  O OG   . SER B 2 47  ? 56.842  6.943   -16.926 1.00 0.00 ? 47  SER B OG   1  
ATOM 4261  H H    . SER B 2 47  ? 57.661  6.602   -19.933 1.00 0.00 ? 47  SER B H    1  
ATOM 4262  H HA   . SER B 2 47  ? 59.436  5.210   -18.082 1.00 0.00 ? 47  SER B HA   1  
ATOM 4263  H HB2  . SER B 2 47  ? 58.387  5.928   -16.060 1.00 0.00 ? 47  SER B HB2  1  
ATOM 4264  H HB3  . SER B 2 47  ? 58.852  7.375   -16.946 1.00 0.00 ? 47  SER B HB3  1  
ATOM 4265  H HG   . SER B 2 47  ? 56.773  7.688   -16.326 1.00 0.00 ? 47  SER B HG   1  
ATOM 4266  N N    . ALA B 2 48  ? 56.160  4.866   -18.069 1.00 0.00 ? 48  ALA B N    1  
ATOM 4267  C CA   . ALA B 2 48  ? 55.061  3.888   -18.149 1.00 0.00 ? 48  ALA B CA   1  
ATOM 4268  C C    . ALA B 2 48  ? 53.892  4.351   -17.277 1.00 0.00 ? 48  ALA B C    1  
ATOM 4269  O O    . ALA B 2 48  ? 53.002  5.067   -17.736 1.00 0.00 ? 48  ALA B O    1  
ATOM 4270  C CB   . ALA B 2 48  ? 55.525  2.491   -17.698 1.00 0.00 ? 48  ALA B CB   1  
ATOM 4271  H H    . ALA B 2 48  ? 55.951  5.792   -17.847 1.00 0.00 ? 48  ALA B H    1  
ATOM 4272  H HA   . ALA B 2 48  ? 54.722  3.833   -19.175 1.00 0.00 ? 48  ALA B HA   1  
ATOM 4273  H HB1  . ALA B 2 48  ? 54.686  1.922   -17.317 1.00 0.00 ? 48  ALA B HB1  1  
ATOM 4274  H HB2  . ALA B 2 48  ? 56.267  2.594   -16.922 1.00 0.00 ? 48  ALA B HB2  1  
ATOM 4275  H HB3  . ALA B 2 48  ? 55.958  1.961   -18.537 1.00 0.00 ? 48  ALA B HB3  1  
ATOM 4276  N N    . GLN B 2 49  ? 53.910  3.926   -16.012 1.00 0.00 ? 49  GLN B N    1  
ATOM 4277  C CA   . GLN B 2 49  ? 52.859  4.283   -15.056 1.00 0.00 ? 49  GLN B CA   1  
ATOM 4278  C C    . GLN B 2 49  ? 53.467  4.512   -13.675 1.00 0.00 ? 49  GLN B C    1  
ATOM 4279  O O    . GLN B 2 49  ? 54.460  3.880   -13.315 1.00 0.00 ? 49  GLN B O    1  
ATOM 4280  C CB   . GLN B 2 49  ? 51.822  3.159   -14.982 1.00 0.00 ? 49  GLN B CB   1  
ATOM 4281  C CG   . GLN B 2 49  ? 51.416  2.746   -16.398 1.00 0.00 ? 49  GLN B CG   1  
ATOM 4282  C CD   . GLN B 2 49  ? 50.269  1.737   -16.328 1.00 0.00 ? 49  GLN B CD   1  
ATOM 4283  O OE1  . GLN B 2 49  ? 49.113  2.109   -16.363 1.00 0.00 ? 49  GLN B OE1  1  
ATOM 4284  N NE2  . GLN B 2 49  ? 50.541  0.464   -16.228 1.00 0.00 ? 49  GLN B NE2  1  
ATOM 4285  H H    . GLN B 2 49  ? 54.649  3.355   -15.714 1.00 0.00 ? 49  GLN B H    1  
ATOM 4286  H HA   . GLN B 2 49  ? 52.368  5.193   -15.375 1.00 0.00 ? 49  GLN B HA   1  
ATOM 4287  H HB2  . GLN B 2 49  ? 52.246  2.310   -14.467 1.00 0.00 ? 49  GLN B HB2  1  
ATOM 4288  H HB3  . GLN B 2 49  ? 50.952  3.507   -14.449 1.00 0.00 ? 49  GLN B HB3  1  
ATOM 4289  H HG2  . GLN B 2 49  ? 51.095  3.619   -16.950 1.00 0.00 ? 49  GLN B HG2  1  
ATOM 4290  H HG3  . GLN B 2 49  ? 52.260  2.295   -16.899 1.00 0.00 ? 49  GLN B HG3  1  
ATOM 4291  H HE21 . GLN B 2 49  ? 51.473  0.163   -16.199 1.00 0.00 ? 49  GLN B HE21 1  
ATOM 4292  H HE22 . GLN B 2 49  ? 49.814  -0.190  -16.183 1.00 0.00 ? 49  GLN B HE22 1  
ATOM 4293  N N    . VAL B 2 50  ? 52.871  5.425   -12.908 1.00 0.00 ? 50  VAL B N    1  
ATOM 4294  C CA   . VAL B 2 50  ? 53.367  5.743   -11.565 1.00 0.00 ? 50  VAL B CA   1  
ATOM 4295  C C    . VAL B 2 50  ? 52.206  6.174   -10.663 1.00 0.00 ? 50  VAL B C    1  
ATOM 4296  O O    . VAL B 2 50  ? 51.473  7.112   -10.977 1.00 0.00 ? 50  VAL B O    1  
ATOM 4297  C CB   . VAL B 2 50  ? 54.435  6.875   -11.643 1.00 0.00 ? 50  VAL B CB   1  
ATOM 4298  C CG1  . VAL B 2 50  ? 54.666  7.520   -10.265 1.00 0.00 ? 50  VAL B CG1  1  
ATOM 4299  C CG2  . VAL B 2 50  ? 55.761  6.291   -12.154 1.00 0.00 ? 50  VAL B CG2  1  
ATOM 4300  H H    . VAL B 2 50  ? 52.083  5.897   -13.250 1.00 0.00 ? 50  VAL B H    1  
ATOM 4301  H HA   . VAL B 2 50  ? 53.821  4.861   -11.133 1.00 0.00 ? 50  VAL B HA   1  
ATOM 4302  H HB   . VAL B 2 50  ? 54.093  7.629   -12.335 1.00 0.00 ? 50  VAL B HB   1  
ATOM 4303  H HG11 . VAL B 2 50  ? 55.551  8.140   -10.295 1.00 0.00 ? 50  VAL B HG11 1  
ATOM 4304  H HG12 . VAL B 2 50  ? 54.795  6.749   -9.523  1.00 0.00 ? 50  VAL B HG12 1  
ATOM 4305  H HG13 . VAL B 2 50  ? 53.814  8.131   -10.003 1.00 0.00 ? 50  VAL B HG13 1  
ATOM 4306  H HG21 . VAL B 2 50  ? 56.523  7.057   -12.142 1.00 0.00 ? 50  VAL B HG21 1  
ATOM 4307  H HG22 . VAL B 2 50  ? 55.633  5.933   -13.163 1.00 0.00 ? 50  VAL B HG22 1  
ATOM 4308  H HG23 . VAL B 2 50  ? 56.065  5.472   -11.515 1.00 0.00 ? 50  VAL B HG23 1  
ATOM 4309  N N    . CYS B 2 51  ? 52.054  5.472   -9.545  1.00 0.00 ? 51  CYS B N    1  
ATOM 4310  C CA   . CYS B 2 51  ? 50.990  5.763   -8.591  1.00 0.00 ? 51  CYS B CA   1  
ATOM 4311  C C    . CYS B 2 51  ? 51.101  7.187   -8.057  1.00 0.00 ? 51  CYS B C    1  
ATOM 4312  O O    . CYS B 2 51  ? 52.153  7.818   -8.158  1.00 0.00 ? 51  CYS B O    1  
ATOM 4313  C CB   . CYS B 2 51  ? 51.057  4.774   -7.432  1.00 0.00 ? 51  CYS B CB   1  
ATOM 4314  S SG   . CYS B 2 51  ? 50.801  3.102   -8.070  1.00 0.00 ? 51  CYS B SG   1  
ATOM 4315  H H    . CYS B 2 51  ? 52.667  4.733   -9.356  1.00 0.00 ? 51  CYS B H    1  
ATOM 4316  H HA   . CYS B 2 51  ? 50.041  5.648   -9.081  1.00 0.00 ? 51  CYS B HA   1  
ATOM 4317  H HB2  . CYS B 2 51  ? 52.024  4.836   -6.957  1.00 0.00 ? 51  CYS B HB2  1  
ATOM 4318  H HB3  . CYS B 2 51  ? 50.286  5.006   -6.715  1.00 0.00 ? 51  CYS B HB3  1  
ATOM 4319  N N    . ALA B 2 52  ? 50.007  7.683   -7.479  1.00 0.00 ? 52  ALA B N    1  
ATOM 4320  C CA   . ALA B 2 52  ? 49.977  9.031   -6.914  1.00 0.00 ? 52  ALA B CA   1  
ATOM 4321  C C    . ALA B 2 52  ? 48.917  9.108   -5.819  1.00 0.00 ? 52  ALA B C    1  
ATOM 4322  O O    . ALA B 2 52  ? 47.753  8.781   -6.053  1.00 0.00 ? 52  ALA B O    1  
ATOM 4323  C CB   . ALA B 2 52  ? 49.670  10.042  -8.007  1.00 0.00 ? 52  ALA B CB   1  
ATOM 4324  H H    . ALA B 2 52  ? 49.199  7.132   -7.412  1.00 0.00 ? 52  ALA B H    1  
ATOM 4325  H HA   . ALA B 2 52  ? 50.942  9.261   -6.484  1.00 0.00 ? 52  ALA B HA   1  
ATOM 4326  H HB1  . ALA B 2 52  ? 48.812  9.710   -8.574  1.00 0.00 ? 52  ALA B HB1  1  
ATOM 4327  H HB2  . ALA B 2 52  ? 50.522  10.130  -8.663  1.00 0.00 ? 52  ALA B HB2  1  
ATOM 4328  H HB3  . ALA B 2 52  ? 49.457  11.003  -7.563  1.00 0.00 ? 52  ALA B HB3  1  
ATOM 4329  N N    . ASP B 2 53  ? 49.314  9.544   -4.629  1.00 0.00 ? 53  ASP B N    1  
ATOM 4330  C CA   . ASP B 2 53  ? 48.371  9.655   -3.527  1.00 0.00 ? 53  ASP B CA   1  
ATOM 4331  C C    . ASP B 2 53  ? 47.320  10.723  -3.863  1.00 0.00 ? 53  ASP B C    1  
ATOM 4332  O O    . ASP B 2 53  ? 47.684  11.864  -4.143  1.00 0.00 ? 53  ASP B O    1  
ATOM 4333  C CB   . ASP B 2 53  ? 49.119  10.046  -2.245  1.00 0.00 ? 53  ASP B CB   1  
ATOM 4334  C CG   . ASP B 2 53  ? 48.221  9.815   -1.026  1.00 0.00 ? 53  ASP B CG   1  
ATOM 4335  O OD1  . ASP B 2 53  ? 47.044  10.114  -1.116  1.00 0.00 ? 53  ASP B OD1  1  
ATOM 4336  O OD2  . ASP B 2 53  ? 48.730  9.342   -0.023  1.00 0.00 ? 53  ASP B OD2  1  
ATOM 4337  H H    . ASP B 2 53  ? 50.249  9.797   -4.491  1.00 0.00 ? 53  ASP B H    1  
ATOM 4338  H HA   . ASP B 2 53  ? 47.903  8.697   -3.383  1.00 0.00 ? 53  ASP B HA   1  
ATOM 4339  H HB2  . ASP B 2 53  ? 50.010  9.442   -2.154  1.00 0.00 ? 53  ASP B HB2  1  
ATOM 4340  H HB3  . ASP B 2 53  ? 49.397  11.089  -2.292  1.00 0.00 ? 53  ASP B HB3  1  
ATOM 4341  N N    . PRO B 2 54  ? 46.005  10.399  -3.863  1.00 0.00 ? 54  PRO B N    1  
ATOM 4342  C CA   . PRO B 2 54  ? 44.974  11.394  -4.198  1.00 0.00 ? 54  PRO B CA   1  
ATOM 4343  C C    . PRO B 2 54  ? 44.788  12.403  -3.069  1.00 0.00 ? 54  PRO B C    1  
ATOM 4344  O O    . PRO B 2 54  ? 43.956  13.306  -3.156  1.00 0.00 ? 54  PRO B O    1  
ATOM 4345  C CB   . PRO B 2 54  ? 43.708  10.549  -4.422  1.00 0.00 ? 54  PRO B CB   1  
ATOM 4346  C CG   . PRO B 2 54  ? 43.899  9.349   -3.550  1.00 0.00 ? 54  PRO B CG   1  
ATOM 4347  C CD   . PRO B 2 54  ? 45.410  9.081   -3.539  1.00 0.00 ? 54  PRO B CD   1  
ATOM 4348  H HA   . PRO B 2 54  ? 45.235  11.906  -5.111  1.00 0.00 ? 54  PRO B HA   1  
ATOM 4349  H HB2  . PRO B 2 54  ? 42.821  11.101  -4.132  1.00 0.00 ? 54  PRO B HB2  1  
ATOM 4350  H HB3  . PRO B 2 54  ? 43.636  10.246  -5.459  1.00 0.00 ? 54  PRO B HB3  1  
ATOM 4351  H HG2  . PRO B 2 54  ? 43.544  9.560   -2.546  1.00 0.00 ? 54  PRO B HG2  1  
ATOM 4352  H HG3  . PRO B 2 54  ? 43.376  8.495   -3.956  1.00 0.00 ? 54  PRO B HG3  1  
ATOM 4353  H HD2  . PRO B 2 54  ? 45.727  8.747   -2.559  1.00 0.00 ? 54  PRO B HD2  1  
ATOM 4354  H HD3  . PRO B 2 54  ? 45.680  8.357   -4.294  1.00 0.00 ? 54  PRO B HD3  1  
ATOM 4355  N N    . SER B 2 55  ? 45.565  12.231  -2.007  1.00 0.00 ? 55  SER B N    1  
ATOM 4356  C CA   . SER B 2 55  ? 45.478  13.119  -0.854  1.00 0.00 ? 55  SER B CA   1  
ATOM 4357  C C    . SER B 2 55  ? 45.975  14.523  -1.191  1.00 0.00 ? 55  SER B C    1  
ATOM 4358  O O    . SER B 2 55  ? 45.732  15.466  -0.438  1.00 0.00 ? 55  SER B O    1  
ATOM 4359  C CB   . SER B 2 55  ? 46.304  12.551  0.300   1.00 0.00 ? 55  SER B CB   1  
ATOM 4360  O OG   . SER B 2 55  ? 47.645  12.360  -0.133  1.00 0.00 ? 55  SER B OG   1  
ATOM 4361  H H    . SER B 2 55  ? 46.199  11.484  -1.990  1.00 0.00 ? 55  SER B H    1  
ATOM 4362  H HA   . SER B 2 55  ? 44.447  13.181  -0.541  1.00 0.00 ? 55  SER B HA   1  
ATOM 4363  H HB2  . SER B 2 55  ? 46.295  13.241  1.127   1.00 0.00 ? 55  SER B HB2  1  
ATOM 4364  H HB3  . SER B 2 55  ? 45.878  11.607  0.616   1.00 0.00 ? 55  SER B HB3  1  
ATOM 4365  H HG   . SER B 2 55  ? 48.219  12.860  0.451   1.00 0.00 ? 55  SER B HG   1  
ATOM 4366  N N    . GLU B 2 56  ? 46.674  14.668  -2.321  1.00 0.00 ? 56  GLU B N    1  
ATOM 4367  C CA   . GLU B 2 56  ? 47.199  15.975  -2.735  1.00 0.00 ? 56  GLU B CA   1  
ATOM 4368  C C    . GLU B 2 56  ? 46.294  16.600  -3.796  1.00 0.00 ? 56  GLU B C    1  
ATOM 4369  O O    . GLU B 2 56  ? 46.020  15.994  -4.833  1.00 0.00 ? 56  GLU B O    1  
ATOM 4370  C CB   . GLU B 2 56  ? 48.621  15.805  -3.288  1.00 0.00 ? 56  GLU B CB   1  
ATOM 4371  C CG   . GLU B 2 56  ? 49.599  15.564  -2.133  1.00 0.00 ? 56  GLU B CG   1  
ATOM 4372  C CD   . GLU B 2 56  ? 50.983  15.233  -2.695  1.00 0.00 ? 56  GLU B CD   1  
ATOM 4373  O OE1  . GLU B 2 56  ? 51.699  16.160  -3.034  1.00 0.00 ? 56  GLU B OE1  1  
ATOM 4374  O OE2  . GLU B 2 56  ? 51.303  14.059  -2.776  1.00 0.00 ? 56  GLU B OE2  1  
ATOM 4375  H H    . GLU B 2 56  ? 46.843  13.888  -2.892  1.00 0.00 ? 56  GLU B H    1  
ATOM 4376  H HA   . GLU B 2 56  ? 47.235  16.641  -1.880  1.00 0.00 ? 56  GLU B HA   1  
ATOM 4377  H HB2  . GLU B 2 56  ? 48.645  14.959  -3.955  1.00 0.00 ? 56  GLU B HB2  1  
ATOM 4378  H HB3  . GLU B 2 56  ? 48.913  16.698  -3.824  1.00 0.00 ? 56  GLU B HB3  1  
ATOM 4379  H HG2  . GLU B 2 56  ? 49.661  16.453  -1.521  1.00 0.00 ? 56  GLU B HG2  1  
ATOM 4380  H HG3  . GLU B 2 56  ? 49.250  14.737  -1.532  1.00 0.00 ? 56  GLU B HG3  1  
ATOM 4381  N N    . SER B 2 57  ? 45.822  17.810  -3.514  1.00 0.00 ? 57  SER B N    1  
ATOM 4382  C CA   . SER B 2 57  ? 44.931  18.521  -4.427  1.00 0.00 ? 57  SER B CA   1  
ATOM 4383  C C    . SER B 2 57  ? 45.487  18.566  -5.850  1.00 0.00 ? 57  SER B C    1  
ATOM 4384  O O    . SER B 2 57  ? 44.734  18.458  -6.817  1.00 0.00 ? 57  SER B O    1  
ATOM 4385  C CB   . SER B 2 57  ? 44.710  19.948  -3.925  1.00 0.00 ? 57  SER B CB   1  
ATOM 4386  O OG   . SER B 2 57  ? 43.749  20.593  -4.751  1.00 0.00 ? 57  SER B OG   1  
ATOM 4387  H H    . SER B 2 57  ? 46.068  18.230  -2.663  1.00 0.00 ? 57  SER B H    1  
ATOM 4388  H HA   . SER B 2 57  ? 43.978  18.014  -4.444  1.00 0.00 ? 57  SER B HA   1  
ATOM 4389  H HB2  . SER B 2 57  ? 44.346  19.924  -2.911  1.00 0.00 ? 57  SER B HB2  1  
ATOM 4390  H HB3  . SER B 2 57  ? 45.647  20.488  -3.956  1.00 0.00 ? 57  SER B HB3  1  
ATOM 4391  H HG   . SER B 2 57  ? 43.507  19.985  -5.453  1.00 0.00 ? 57  SER B HG   1  
ATOM 4392  N N    . TRP B 2 58  ? 46.798  18.738  -5.978  1.00 0.00 ? 58  TRP B N    1  
ATOM 4393  C CA   . TRP B 2 58  ? 47.416  18.811  -7.299  1.00 0.00 ? 58  TRP B CA   1  
ATOM 4394  C C    . TRP B 2 58  ? 47.092  17.564  -8.117  1.00 0.00 ? 58  TRP B C    1  
ATOM 4395  O O    . TRP B 2 58  ? 46.941  17.634  -9.337  1.00 0.00 ? 58  TRP B O    1  
ATOM 4396  C CB   . TRP B 2 58  ? 48.935  18.959  -7.157  1.00 0.00 ? 58  TRP B CB   1  
ATOM 4397  C CG   . TRP B 2 58  ? 49.254  20.320  -6.625  1.00 0.00 ? 58  TRP B CG   1  
ATOM 4398  C CD1  . TRP B 2 58  ? 49.784  20.578  -5.406  1.00 0.00 ? 58  TRP B CD1  1  
ATOM 4399  C CD2  . TRP B 2 58  ? 49.065  21.610  -7.272  1.00 0.00 ? 58  TRP B CD2  1  
ATOM 4400  N NE1  . TRP B 2 58  ? 49.939  21.946  -5.263  1.00 0.00 ? 58  TRP B NE1  1  
ATOM 4401  C CE2  . TRP B 2 58  ? 49.511  22.630  -6.384  1.00 0.00 ? 58  TRP B CE2  1  
ATOM 4402  C CE3  . TRP B 2 58  ? 48.555  21.997  -8.539  1.00 0.00 ? 58  TRP B CE3  1  
ATOM 4403  C CZ2  . TRP B 2 58  ? 49.455  23.989  -6.737  1.00 0.00 ? 58  TRP B CZ2  1  
ATOM 4404  C CZ3  . TRP B 2 58  ? 48.495  23.365  -8.898  1.00 0.00 ? 58  TRP B CZ3  1  
ATOM 4405  C CH2  . TRP B 2 58  ? 48.944  24.358  -7.998  1.00 0.00 ? 58  TRP B CH2  1  
ATOM 4406  H H    . TRP B 2 58  ? 47.356  18.830  -5.177  1.00 0.00 ? 58  TRP B H    1  
ATOM 4407  H HA   . TRP B 2 58  ? 47.028  19.674  -7.819  1.00 0.00 ? 58  TRP B HA   1  
ATOM 4408  H HB2  . TRP B 2 58  ? 49.308  18.208  -6.475  1.00 0.00 ? 58  TRP B HB2  1  
ATOM 4409  H HB3  . TRP B 2 58  ? 49.403  18.832  -8.122  1.00 0.00 ? 58  TRP B HB3  1  
ATOM 4410  H HD1  . TRP B 2 58  ? 50.045  19.835  -4.667  1.00 0.00 ? 58  TRP B HD1  1  
ATOM 4411  H HE1  . TRP B 2 58  ? 50.305  22.394  -4.472  1.00 0.00 ? 58  TRP B HE1  1  
ATOM 4412  H HE3  . TRP B 2 58  ? 48.209  21.243  -9.232  1.00 0.00 ? 58  TRP B HE3  1  
ATOM 4413  H HZ2  . TRP B 2 58  ? 49.798  24.746  -6.047  1.00 0.00 ? 58  TRP B HZ2  1  
ATOM 4414  H HZ3  . TRP B 2 58  ? 48.104  23.650  -9.864  1.00 0.00 ? 58  TRP B HZ3  1  
ATOM 4415  H HH2  . TRP B 2 58  ? 48.896  25.401  -8.277  1.00 0.00 ? 58  TRP B HH2  1  
ATOM 4416  N N    . VAL B 2 59  ? 46.980  16.430  -7.441  1.00 0.00 ? 59  VAL B N    1  
ATOM 4417  C CA   . VAL B 2 59  ? 46.664  15.179  -8.118  1.00 0.00 ? 59  VAL B CA   1  
ATOM 4418  C C    . VAL B 2 59  ? 45.212  15.187  -8.568  1.00 0.00 ? 59  VAL B C    1  
ATOM 4419  O O    . VAL B 2 59  ? 44.874  14.673  -9.631  1.00 0.00 ? 59  VAL B O    1  
ATOM 4420  C CB   . VAL B 2 59  ? 46.890  13.979  -7.183  1.00 0.00 ? 59  VAL B CB   1  
ATOM 4421  C CG1  . VAL B 2 59  ? 46.661  12.676  -7.951  1.00 0.00 ? 59  VAL B CG1  1  
ATOM 4422  C CG2  . VAL B 2 59  ? 48.328  14.019  -6.659  1.00 0.00 ? 59  VAL B CG2  1  
ATOM 4423  H H    . VAL B 2 59  ? 47.106  16.434  -6.469  1.00 0.00 ? 59  VAL B H    1  
ATOM 4424  H HA   . VAL B 2 59  ? 47.300  15.075  -8.984  1.00 0.00 ? 59  VAL B HA   1  
ATOM 4425  H HB   . VAL B 2 59  ? 46.201  14.034  -6.351  1.00 0.00 ? 59  VAL B HB   1  
ATOM 4426  H HG11 . VAL B 2 59  ? 45.618  12.596  -8.219  1.00 0.00 ? 59  VAL B HG11 1  
ATOM 4427  H HG12 . VAL B 2 59  ? 46.937  11.838  -7.329  1.00 0.00 ? 59  VAL B HG12 1  
ATOM 4428  H HG13 . VAL B 2 59  ? 47.264  12.675  -8.847  1.00 0.00 ? 59  VAL B HG13 1  
ATOM 4429  H HG21 . VAL B 2 59  ? 49.011  13.767  -7.457  1.00 0.00 ? 59  VAL B HG21 1  
ATOM 4430  H HG22 . VAL B 2 59  ? 48.439  13.310  -5.854  1.00 0.00 ? 59  VAL B HG22 1  
ATOM 4431  H HG23 . VAL B 2 59  ? 48.548  15.012  -6.297  1.00 0.00 ? 59  VAL B HG23 1  
ATOM 4432  N N    . GLN B 2 60  ? 44.361  15.785  -7.746  1.00 0.00 ? 60  GLN B N    1  
ATOM 4433  C CA   . GLN B 2 60  ? 42.939  15.869  -8.062  1.00 0.00 ? 60  GLN B CA   1  
ATOM 4434  C C    . GLN B 2 60  ? 42.705  16.839  -9.216  1.00 0.00 ? 60  GLN B C    1  
ATOM 4435  O O    . GLN B 2 60  ? 41.859  16.603  -10.077 1.00 0.00 ? 60  GLN B O    1  
ATOM 4436  C CB   . GLN B 2 60  ? 42.154  16.336  -6.833  1.00 0.00 ? 60  GLN B CB   1  
ATOM 4437  C CG   . GLN B 2 60  ? 42.404  15.376  -5.668  1.00 0.00 ? 60  GLN B CG   1  
ATOM 4438  C CD   . GLN B 2 60  ? 41.733  14.032  -5.960  1.00 0.00 ? 60  GLN B CD   1  
ATOM 4439  O OE1  . GLN B 2 60  ? 40.537  13.969  -6.164  1.00 0.00 ? 60  GLN B OE1  1  
ATOM 4440  N NE2  . GLN B 2 60  ? 42.458  12.947  -5.987  1.00 0.00 ? 60  GLN B NE2  1  
ATOM 4441  H H    . GLN B 2 60  ? 44.699  16.179  -6.912  1.00 0.00 ? 60  GLN B H    1  
ATOM 4442  H HA   . GLN B 2 60  ? 42.587  14.892  -8.351  1.00 0.00 ? 60  GLN B HA   1  
ATOM 4443  H HB2  . GLN B 2 60  ? 42.477  17.330  -6.556  1.00 0.00 ? 60  GLN B HB2  1  
ATOM 4444  H HB3  . GLN B 2 60  ? 41.101  16.351  -7.064  1.00 0.00 ? 60  GLN B HB3  1  
ATOM 4445  H HG2  . GLN B 2 60  ? 43.467  15.228  -5.544  1.00 0.00 ? 60  GLN B HG2  1  
ATOM 4446  H HG3  . GLN B 2 60  ? 41.990  15.793  -4.762  1.00 0.00 ? 60  GLN B HG3  1  
ATOM 4447  H HE21 . GLN B 2 60  ? 43.422  12.997  -5.823  1.00 0.00 ? 60  GLN B HE21 1  
ATOM 4448  H HE22 . GLN B 2 60  ? 42.038  12.081  -6.173  1.00 0.00 ? 60  GLN B HE22 1  
ATOM 4449  N N    . GLU B 2 61  ? 43.467  17.927  -9.227  1.00 0.00 ? 61  GLU B N    1  
ATOM 4450  C CA   . GLU B 2 61  ? 43.343  18.929  -10.282 1.00 0.00 ? 61  GLU B CA   1  
ATOM 4451  C C    . GLU B 2 61  ? 43.890  18.380  -11.596 1.00 0.00 ? 61  GLU B C    1  
ATOM 4452  O O    . GLU B 2 61  ? 43.369  18.674  -12.672 1.00 0.00 ? 61  GLU B O    1  
ATOM 4453  C CB   . GLU B 2 61  ? 44.110  20.196  -9.888  1.00 0.00 ? 61  GLU B CB   1  
ATOM 4454  C CG   . GLU B 2 61  ? 43.787  21.334  -10.864 1.00 0.00 ? 61  GLU B CG   1  
ATOM 4455  C CD   . GLU B 2 61  ? 42.342  21.794  -10.662 1.00 0.00 ? 61  GLU B CD   1  
ATOM 4456  O OE1  . GLU B 2 61  ? 41.980  22.064  -9.530  1.00 0.00 ? 61  GLU B OE1  1  
ATOM 4457  O OE2  . GLU B 2 61  ? 41.623  21.868  -11.645 1.00 0.00 ? 61  GLU B OE2  1  
ATOM 4458  H H    . GLU B 2 61  ? 44.126  18.057  -8.515  1.00 0.00 ? 61  GLU B H    1  
ATOM 4459  H HA   . GLU B 2 61  ? 42.300  19.173  -10.411 1.00 0.00 ? 61  GLU B HA   1  
ATOM 4460  H HB2  . GLU B 2 61  ? 43.823  20.491  -8.889  1.00 0.00 ? 61  GLU B HB2  1  
ATOM 4461  H HB3  . GLU B 2 61  ? 45.170  19.995  -9.911  1.00 0.00 ? 61  GLU B HB3  1  
ATOM 4462  H HG2  . GLU B 2 61  ? 44.456  22.163  -10.681 1.00 0.00 ? 61  GLU B HG2  1  
ATOM 4463  H HG3  . GLU B 2 61  ? 43.915  20.989  -11.879 1.00 0.00 ? 61  GLU B HG3  1  
ATOM 4464  N N    . TYR B 2 62  ? 44.945  17.581  -11.494 1.00 0.00 ? 62  TYR B N    1  
ATOM 4465  C CA   . TYR B 2 62  ? 45.560  16.991  -12.679 1.00 0.00 ? 62  TYR B CA   1  
ATOM 4466  C C    . TYR B 2 62  ? 44.576  16.029  -13.346 1.00 0.00 ? 62  TYR B C    1  
ATOM 4467  O O    . TYR B 2 62  ? 44.501  15.955  -14.573 1.00 0.00 ? 62  TYR B O    1  
ATOM 4468  C CB   . TYR B 2 62  ? 46.862  16.251  -12.288 1.00 0.00 ? 62  TYR B CB   1  
ATOM 4469  C CG   . TYR B 2 62  ? 48.049  17.204  -12.308 1.00 0.00 ? 62  TYR B CG   1  
ATOM 4470  C CD1  . TYR B 2 62  ? 47.919  18.520  -11.807 1.00 0.00 ? 62  TYR B CD1  1  
ATOM 4471  C CD2  . TYR B 2 62  ? 49.291  16.772  -12.831 1.00 0.00 ? 62  TYR B CD2  1  
ATOM 4472  C CE1  . TYR B 2 62  ? 49.025  19.398  -11.829 1.00 0.00 ? 62  TYR B CE1  1  
ATOM 4473  C CE2  . TYR B 2 62  ? 50.395  17.651  -12.853 1.00 0.00 ? 62  TYR B CE2  1  
ATOM 4474  C CZ   . TYR B 2 62  ? 50.261  18.964  -12.352 1.00 0.00 ? 62  TYR B CZ   1  
ATOM 4475  O OH   . TYR B 2 62  ? 51.356  19.804  -12.322 1.00 0.00 ? 62  TYR B OH   1  
ATOM 4476  H H    . TYR B 2 62  ? 45.306  17.387  -10.604 1.00 0.00 ? 62  TYR B H    1  
ATOM 4477  H HA   . TYR B 2 62  ? 45.788  17.780  -13.380 1.00 0.00 ? 62  TYR B HA   1  
ATOM 4478  H HB2  . TYR B 2 62  ? 46.752  15.846  -11.293 1.00 0.00 ? 62  TYR B HB2  1  
ATOM 4479  H HB3  . TYR B 2 62  ? 47.045  15.440  -12.982 1.00 0.00 ? 62  TYR B HB3  1  
ATOM 4480  H HD1  . TYR B 2 62  ? 46.977  18.857  -11.407 1.00 0.00 ? 62  TYR B HD1  1  
ATOM 4481  H HD2  . TYR B 2 62  ? 49.393  15.768  -13.214 1.00 0.00 ? 62  TYR B HD2  1  
ATOM 4482  H HE1  . TYR B 2 62  ? 48.925  20.403  -11.447 1.00 0.00 ? 62  TYR B HE1  1  
ATOM 4483  H HE2  . TYR B 2 62  ? 51.341  17.319  -13.252 1.00 0.00 ? 62  TYR B HE2  1  
ATOM 4484  H HH   . TYR B 2 62  ? 51.571  19.978  -11.403 1.00 0.00 ? 62  TYR B HH   1  
ATOM 4485  N N    . VAL B 2 63  ? 43.817  15.306  -12.531 1.00 0.00 ? 63  VAL B N    1  
ATOM 4486  C CA   . VAL B 2 63  ? 42.835  14.365  -13.056 1.00 0.00 ? 63  VAL B CA   1  
ATOM 4487  C C    . VAL B 2 63  ? 41.675  15.130  -13.689 1.00 0.00 ? 63  VAL B C    1  
ATOM 4488  O O    . VAL B 2 63  ? 41.221  14.799  -14.783 1.00 0.00 ? 63  VAL B O    1  
ATOM 4489  C CB   . VAL B 2 63  ? 42.293  13.455  -11.928 1.00 0.00 ? 63  VAL B CB   1  
ATOM 4490  C CG1  . VAL B 2 63  ? 41.107  12.623  -12.438 1.00 0.00 ? 63  VAL B CG1  1  
ATOM 4491  C CG2  . VAL B 2 63  ? 43.410  12.513  -11.459 1.00 0.00 ? 63  VAL B CG2  1  
ATOM 4492  H H    . VAL B 2 63  ? 43.914  15.414  -11.561 1.00 0.00 ? 63  VAL B H    1  
ATOM 4493  H HA   . VAL B 2 63  ? 43.303  13.750  -13.808 1.00 0.00 ? 63  VAL B HA   1  
ATOM 4494  H HB   . VAL B 2 63  ? 41.969  14.068  -11.099 1.00 0.00 ? 63  VAL B HB   1  
ATOM 4495  H HG11 . VAL B 2 63  ? 40.895  11.825  -11.739 1.00 0.00 ? 63  VAL B HG11 1  
ATOM 4496  H HG12 . VAL B 2 63  ? 41.349  12.202  -13.401 1.00 0.00 ? 63  VAL B HG12 1  
ATOM 4497  H HG13 . VAL B 2 63  ? 40.238  13.258  -12.529 1.00 0.00 ? 63  VAL B HG13 1  
ATOM 4498  H HG21 . VAL B 2 63  ? 44.316  13.078  -11.300 1.00 0.00 ? 63  VAL B HG21 1  
ATOM 4499  H HG22 . VAL B 2 63  ? 43.585  11.758  -12.211 1.00 0.00 ? 63  VAL B HG22 1  
ATOM 4500  H HG23 . VAL B 2 63  ? 43.115  12.040  -10.535 1.00 0.00 ? 63  VAL B HG23 1  
ATOM 4501  N N    . TYR B 2 64  ? 41.205  16.155  -12.989 1.00 0.00 ? 64  TYR B N    1  
ATOM 4502  C CA   . TYR B 2 64  ? 40.103  16.965  -13.480 1.00 0.00 ? 64  TYR B CA   1  
ATOM 4503  C C    . TYR B 2 64  ? 40.472  17.588  -14.830 1.00 0.00 ? 64  TYR B C    1  
ATOM 4504  O O    . TYR B 2 64  ? 39.634  17.681  -15.724 1.00 0.00 ? 64  TYR B O    1  
ATOM 4505  C CB   . TYR B 2 64  ? 39.776  18.071  -12.452 1.00 0.00 ? 64  TYR B CB   1  
ATOM 4506  C CG   . TYR B 2 64  ? 38.797  17.562  -11.402 1.00 0.00 ? 64  TYR B CG   1  
ATOM 4507  C CD1  . TYR B 2 64  ? 38.948  16.270  -10.843 1.00 0.00 ? 64  TYR B CD1  1  
ATOM 4508  C CD2  . TYR B 2 64  ? 37.730  18.386  -10.981 1.00 0.00 ? 64  TYR B CD2  1  
ATOM 4509  C CE1  . TYR B 2 64  ? 38.035  15.810  -9.870  1.00 0.00 ? 64  TYR B CE1  1  
ATOM 4510  C CE2  . TYR B 2 64  ? 36.816  17.923  -10.010 1.00 0.00 ? 64  TYR B CE2  1  
ATOM 4511  C CZ   . TYR B 2 64  ? 36.969  16.636  -9.454  1.00 0.00 ? 64  TYR B CZ   1  
ATOM 4512  O OH   . TYR B 2 64  ? 36.048  16.166  -8.540  1.00 0.00 ? 64  TYR B OH   1  
ATOM 4513  H H    . TYR B 2 64  ? 41.609  16.371  -12.124 1.00 0.00 ? 64  TYR B H    1  
ATOM 4514  H HA   . TYR B 2 64  ? 39.236  16.334  -13.618 1.00 0.00 ? 64  TYR B HA   1  
ATOM 4515  H HB2  . TYR B 2 64  ? 40.688  18.378  -11.964 1.00 0.00 ? 64  TYR B HB2  1  
ATOM 4516  H HB3  . TYR B 2 64  ? 39.343  18.925  -12.958 1.00 0.00 ? 64  TYR B HB3  1  
ATOM 4517  H HD1  . TYR B 2 64  ? 39.761  15.636  -11.156 1.00 0.00 ? 64  TYR B HD1  1  
ATOM 4518  H HD2  . TYR B 2 64  ? 37.613  19.370  -11.405 1.00 0.00 ? 64  TYR B HD2  1  
ATOM 4519  H HE1  . TYR B 2 64  ? 38.150  14.824  -9.444  1.00 0.00 ? 64  TYR B HE1  1  
ATOM 4520  H HE2  . TYR B 2 64  ? 36.001  18.556  -9.690  1.00 0.00 ? 64  TYR B HE2  1  
ATOM 4521  H HH   . TYR B 2 64  ? 35.877  16.865  -7.905  1.00 0.00 ? 64  TYR B HH   1  
ATOM 4522  N N    . ASP B 2 65  ? 41.724  18.015  -14.966 1.00 0.00 ? 65  ASP B N    1  
ATOM 4523  C CA   . ASP B 2 65  ? 42.175  18.630  -16.211 1.00 0.00 ? 65  ASP B CA   1  
ATOM 4524  C C    . ASP B 2 65  ? 42.167  17.619  -17.352 1.00 0.00 ? 65  ASP B C    1  
ATOM 4525  O O    . ASP B 2 65  ? 41.764  17.934  -18.471 1.00 0.00 ? 65  ASP B O    1  
ATOM 4526  C CB   . ASP B 2 65  ? 43.585  19.197  -16.035 1.00 0.00 ? 65  ASP B CB   1  
ATOM 4527  C CG   . ASP B 2 65  ? 43.545  20.372  -15.056 1.00 0.00 ? 65  ASP B CG   1  
ATOM 4528  O OD1  . ASP B 2 65  ? 42.617  21.160  -15.146 1.00 0.00 ? 65  ASP B OD1  1  
ATOM 4529  O OD2  . ASP B 2 65  ? 44.441  20.464  -14.233 1.00 0.00 ? 65  ASP B OD2  1  
ATOM 4530  H H    . ASP B 2 65  ? 42.355  17.919  -14.219 1.00 0.00 ? 65  ASP B H    1  
ATOM 4531  H HA   . ASP B 2 65  ? 41.506  19.436  -16.461 1.00 0.00 ? 65  ASP B HA   1  
ATOM 4532  H HB2  . ASP B 2 65  ? 44.236  18.427  -15.647 1.00 0.00 ? 65  ASP B HB2  1  
ATOM 4533  H HB3  . ASP B 2 65  ? 43.958  19.537  -16.989 1.00 0.00 ? 65  ASP B HB3  1  
ATOM 4534  N N    . LEU B 2 66  ? 42.615  16.407  -17.060 1.00 0.00 ? 66  LEU B N    1  
ATOM 4535  C CA   . LEU B 2 66  ? 42.655  15.357  -18.070 1.00 0.00 ? 66  LEU B CA   1  
ATOM 4536  C C    . LEU B 2 66  ? 41.243  14.901  -18.423 1.00 0.00 ? 66  LEU B C    1  
ATOM 4537  O O    . LEU B 2 66  ? 41.019  14.308  -19.478 1.00 0.00 ? 66  LEU B O    1  
ATOM 4538  C CB   . LEU B 2 66  ? 43.472  14.167  -17.549 1.00 0.00 ? 66  LEU B CB   1  
ATOM 4539  C CG   . LEU B 2 66  ? 44.945  14.586  -17.312 1.00 0.00 ? 66  LEU B CG   1  
ATOM 4540  C CD1  . LEU B 2 66  ? 45.600  13.633  -16.307 1.00 0.00 ? 66  LEU B CD1  1  
ATOM 4541  C CD2  . LEU B 2 66  ? 45.740  14.536  -18.628 1.00 0.00 ? 66  LEU B CD2  1  
ATOM 4542  H H    . LEU B 2 66  ? 42.923  16.215  -16.150 1.00 0.00 ? 66  LEU B H    1  
ATOM 4543  H HA   . LEU B 2 66  ? 43.127  15.745  -18.958 1.00 0.00 ? 66  LEU B HA   1  
ATOM 4544  H HB2  . LEU B 2 66  ? 43.036  13.829  -16.618 1.00 0.00 ? 66  LEU B HB2  1  
ATOM 4545  H HB3  . LEU B 2 66  ? 43.432  13.363  -18.269 1.00 0.00 ? 66  LEU B HB3  1  
ATOM 4546  H HG   . LEU B 2 66  ? 44.975  15.590  -16.913 1.00 0.00 ? 66  LEU B HG   1  
ATOM 4547  H HD11 . LEU B 2 66  ? 45.516  12.617  -16.666 1.00 0.00 ? 66  LEU B HD11 1  
ATOM 4548  H HD12 . LEU B 2 66  ? 45.103  13.721  -15.353 1.00 0.00 ? 66  LEU B HD12 1  
ATOM 4549  H HD13 . LEU B 2 66  ? 46.643  13.889  -16.193 1.00 0.00 ? 66  LEU B HD13 1  
ATOM 4550  H HD21 . LEU B 2 66  ? 45.614  13.569  -19.094 1.00 0.00 ? 66  LEU B HD21 1  
ATOM 4551  H HD22 . LEU B 2 66  ? 46.787  14.696  -18.420 1.00 0.00 ? 66  LEU B HD22 1  
ATOM 4552  H HD23 . LEU B 2 66  ? 45.389  15.307  -19.296 1.00 0.00 ? 66  LEU B HD23 1  
ATOM 4553  N N    . GLU B 2 67  ? 40.292  15.183  -17.534 1.00 0.00 ? 67  GLU B N    1  
ATOM 4554  C CA   . GLU B 2 67  ? 38.902  14.797  -17.763 1.00 0.00 ? 67  GLU B CA   1  
ATOM 4555  C C    . GLU B 2 67  ? 38.280  15.698  -18.841 1.00 0.00 ? 67  GLU B C    1  
ATOM 4556  O O    . GLU B 2 67  ? 37.464  15.243  -19.642 1.00 0.00 ? 67  GLU B O    1  
ATOM 4557  C CB   . GLU B 2 67  ? 38.120  14.844  -16.409 1.00 0.00 ? 67  GLU B CB   1  
ATOM 4558  C CG   . GLU B 2 67  ? 36.950  15.842  -16.437 1.00 0.00 ? 67  GLU B CG   1  
ATOM 4559  C CD   . GLU B 2 67  ? 36.264  15.857  -15.068 1.00 0.00 ? 67  GLU B CD   1  
ATOM 4560  O OE1  . GLU B 2 67  ? 35.797  14.810  -14.651 1.00 0.00 ? 67  GLU B OE1  1  
ATOM 4561  O OE2  . GLU B 2 67  ? 36.218  16.915  -14.463 1.00 0.00 ? 67  GLU B OE2  1  
ATOM 4562  H H    . GLU B 2 67  ? 40.529  15.659  -16.711 1.00 0.00 ? 67  GLU B H    1  
ATOM 4563  H HA   . GLU B 2 67  ? 38.893  13.780  -18.136 1.00 0.00 ? 67  GLU B HA   1  
ATOM 4564  H HB2  . GLU B 2 67  ? 37.730  13.860  -16.182 1.00 0.00 ? 67  GLU B HB2  1  
ATOM 4565  H HB3  . GLU B 2 67  ? 38.803  15.135  -15.624 1.00 0.00 ? 67  GLU B HB3  1  
ATOM 4566  H HG2  . GLU B 2 67  ? 37.323  16.828  -16.662 1.00 0.00 ? 67  GLU B HG2  1  
ATOM 4567  H HG3  . GLU B 2 67  ? 36.236  15.543  -17.190 1.00 0.00 ? 67  GLU B HG3  1  
ATOM 4568  N N    . LEU B 2 68  ? 38.676  16.973  -18.859 1.00 0.00 ? 68  LEU B N    1  
ATOM 4569  C CA   . LEU B 2 68  ? 38.149  17.910  -19.850 1.00 0.00 ? 68  LEU B CA   1  
ATOM 4570  C C    . LEU B 2 68  ? 38.804  17.671  -21.207 1.00 0.00 ? 68  LEU B C    1  
ATOM 4571  O O    . LEU B 2 68  ? 38.207  17.069  -22.100 1.00 0.00 ? 68  LEU B O    1  
ATOM 4572  C CB   . LEU B 2 68  ? 38.402  19.359  -19.412 1.00 0.00 ? 68  LEU B CB   1  
ATOM 4573  C CG   . LEU B 2 68  ? 37.900  19.583  -17.980 1.00 0.00 ? 68  LEU B CG   1  
ATOM 4574  C CD1  . LEU B 2 68  ? 38.325  20.979  -17.516 1.00 0.00 ? 68  LEU B CD1  1  
ATOM 4575  C CD2  . LEU B 2 68  ? 36.366  19.466  -17.926 1.00 0.00 ? 68  LEU B CD2  1  
ATOM 4576  H H    . LEU B 2 68  ? 39.335  17.284  -18.202 1.00 0.00 ? 68  LEU B H    1  
ATOM 4577  H HA   . LEU B 2 68  ? 37.088  17.758  -19.953 1.00 0.00 ? 68  LEU B HA   1  
ATOM 4578  H HB2  . LEU B 2 68  ? 39.461  19.563  -19.451 1.00 0.00 ? 68  LEU B HB2  1  
ATOM 4579  H HB3  . LEU B 2 68  ? 37.887  20.030  -20.082 1.00 0.00 ? 68  LEU B HB3  1  
ATOM 4580  H HG   . LEU B 2 68  ? 38.342  18.846  -17.330 1.00 0.00 ? 68  LEU B HG   1  
ATOM 4581  H HD11 . LEU B 2 68  ? 37.821  21.726  -18.112 1.00 0.00 ? 68  LEU B HD11 1  
ATOM 4582  H HD12 . LEU B 2 68  ? 39.393  21.087  -17.632 1.00 0.00 ? 68  LEU B HD12 1  
ATOM 4583  H HD13 . LEU B 2 68  ? 38.060  21.109  -16.477 1.00 0.00 ? 68  LEU B HD13 1  
ATOM 4584  H HD21 . LEU B 2 68  ? 35.928  19.979  -18.770 1.00 0.00 ? 68  LEU B HD21 1  
ATOM 4585  H HD22 . LEU B 2 68  ? 36.000  19.910  -17.010 1.00 0.00 ? 68  LEU B HD22 1  
ATOM 4586  H HD23 . LEU B 2 68  ? 36.082  18.425  -17.951 1.00 0.00 ? 68  LEU B HD23 1  
ATOM 4587  N N    . ASN B 2 69  ? 40.036  18.148  -21.353 1.00 0.00 ? 69  ASN B N    1  
ATOM 4588  C CA   . ASN B 2 69  ? 40.772  17.987  -22.603 1.00 0.00 ? 69  ASN B CA   1  
ATOM 4589  C C    . ASN B 2 69  ? 41.341  16.575  -22.711 1.00 0.00 ? 69  ASN B C    1  
ATOM 4590  O O    . ASN B 2 69  ? 41.565  16.132  -23.825 1.00 0.00 ? 69  ASN B O    1  
ATOM 4591  C CB   . ASN B 2 69  ? 41.913  19.003  -22.669 1.00 0.00 ? 69  ASN B CB   1  
ATOM 4592  C CG   . ASN B 2 69  ? 42.537  18.983  -24.066 1.00 0.00 ? 69  ASN B CG   1  
ATOM 4593  O OD1  . ASN B 2 69  ? 41.873  19.262  -25.045 1.00 0.00 ? 69  ASN B OD1  1  
ATOM 4594  N ND2  . ASN B 2 69  ? 43.795  18.662  -24.201 1.00 0.00 ? 69  ASN B ND2  1  
ATOM 4595  O OXT  . ASN B 2 69  ? 41.595  15.980  -21.677 1.00 0.00 ? 69  ASN B OXT  1  
ATOM 4596  H H    . ASN B 2 69  ? 40.457  18.618  -20.606 1.00 0.00 ? 69  ASN B H    1  
ATOM 4597  H HA   . ASN B 2 69  ? 40.103  18.160  -23.435 1.00 0.00 ? 69  ASN B HA   1  
ATOM 4598  H HB2  . ASN B 2 69  ? 41.527  19.991  -22.461 1.00 0.00 ? 69  ASN B HB2  1  
ATOM 4599  H HB3  . ASN B 2 69  ? 42.665  18.749  -21.937 1.00 0.00 ? 69  ASN B HB3  1  
ATOM 4600  H HD21 . ASN B 2 69  ? 44.330  18.436  -23.412 1.00 0.00 ? 69  ASN B HD21 1  
ATOM 4601  H HD22 . ASN B 2 69  ? 44.203  18.646  -25.091 1.00 0.00 ? 69  ASN B HD22 1  
ATOM 4602  N N    . MET A 1 1   ? 104.145 -2.324  -25.523 1.00 0.00 ? 1   MET A N    2  
ATOM 4603  C CA   . MET A 1 1   ? 104.151 -0.869  -25.422 1.00 0.00 ? 1   MET A CA   2  
ATOM 4604  C C    . MET A 1 1   ? 102.756 -0.347  -25.092 1.00 0.00 ? 1   MET A C    2  
ATOM 4605  O O    . MET A 1 1   ? 102.135 0.344   -25.899 1.00 0.00 ? 1   MET A O    2  
ATOM 4606  C CB   . MET A 1 1   ? 104.629 -0.256  -26.740 1.00 0.00 ? 1   MET A CB   2  
ATOM 4607  C CG   . MET A 1 1   ? 106.067 -0.697  -27.017 1.00 0.00 ? 1   MET A CG   2  
ATOM 4608  S SD   . MET A 1 1   ? 106.710 0.207   -28.447 1.00 0.00 ? 1   MET A SD   2  
ATOM 4609  C CE   . MET A 1 1   ? 108.225 -0.759  -28.664 1.00 0.00 ? 1   MET A CE   2  
ATOM 4610  H H1   . MET A 1 1   ? 103.202 -2.685  -25.273 1.00 0.00 ? 1   MET A H1   2  
ATOM 4611  H H2   . MET A 1 1   ? 104.853 -2.720  -24.871 1.00 0.00 ? 1   MET A H2   2  
ATOM 4612  H H3   . MET A 1 1   ? 104.372 -2.606  -26.497 1.00 0.00 ? 1   MET A H3   2  
ATOM 4613  H HA   . MET A 1 1   ? 104.831 -0.576  -24.635 1.00 0.00 ? 1   MET A HA   2  
ATOM 4614  H HB2  . MET A 1 1   ? 103.988 -0.589  -27.544 1.00 0.00 ? 1   MET A HB2  2  
ATOM 4615  H HB3  . MET A 1 1   ? 104.591 0.821   -26.672 1.00 0.00 ? 1   MET A HB3  2  
ATOM 4616  H HG2  . MET A 1 1   ? 106.681 -0.486  -26.153 1.00 0.00 ? 1   MET A HG2  2  
ATOM 4617  H HG3  . MET A 1 1   ? 106.086 -1.756  -27.223 1.00 0.00 ? 1   MET A HG3  2  
ATOM 4618  H HE1  . MET A 1 1   ? 108.804 -0.345  -29.477 1.00 0.00 ? 1   MET A HE1  2  
ATOM 4619  H HE2  . MET A 1 1   ? 107.971 -1.783  -28.889 1.00 0.00 ? 1   MET A HE2  2  
ATOM 4620  H HE3  . MET A 1 1   ? 108.807 -0.724  -27.755 1.00 0.00 ? 1   MET A HE3  2  
ATOM 4621  N N    . PRO A 1 2   ? 102.244 -0.674  -23.894 1.00 0.00 ? 2   PRO A N    2  
ATOM 4622  C CA   . PRO A 1 2   ? 100.911 -0.236  -23.453 1.00 0.00 ? 2   PRO A CA   2  
ATOM 4623  C C    . PRO A 1 2   ? 100.644 1.230   -23.794 1.00 0.00 ? 2   PRO A C    2  
ATOM 4624  O O    . PRO A 1 2   ? 101.569 1.986   -24.092 1.00 0.00 ? 2   PRO A O    2  
ATOM 4625  C CB   . PRO A 1 2   ? 100.948 -0.466  -21.935 1.00 0.00 ? 2   PRO A CB   2  
ATOM 4626  C CG   . PRO A 1 2   ? 101.868 -1.633  -21.762 1.00 0.00 ? 2   PRO A CG   2  
ATOM 4627  C CD   . PRO A 1 2   ? 102.921 -1.497  -22.871 1.00 0.00 ? 2   PRO A CD   2  
ATOM 4628  H HA   . PRO A 1 2   ? 100.152 -0.863  -23.892 1.00 0.00 ? 2   PRO A HA   2  
ATOM 4629  H HB2  . PRO A 1 2   ? 101.345 0.409   -21.430 1.00 0.00 ? 2   PRO A HB2  2  
ATOM 4630  H HB3  . PRO A 1 2   ? 99.963  -0.702  -21.558 1.00 0.00 ? 2   PRO A HB3  2  
ATOM 4631  H HG2  . PRO A 1 2   ? 102.335 -1.604  -20.783 1.00 0.00 ? 2   PRO A HG2  2  
ATOM 4632  H HG3  . PRO A 1 2   ? 101.324 -2.561  -21.886 1.00 0.00 ? 2   PRO A HG3  2  
ATOM 4633  H HD2  . PRO A 1 2   ? 103.803 -0.991  -22.500 1.00 0.00 ? 2   PRO A HD2  2  
ATOM 4634  H HD3  . PRO A 1 2   ? 103.180 -2.462  -23.282 1.00 0.00 ? 2   PRO A HD3  2  
ATOM 4635  N N    . ALA A 1 3   ? 99.376  1.622   -23.749 1.00 0.00 ? 3   ALA A N    2  
ATOM 4636  C CA   . ALA A 1 3   ? 99.000  2.997   -24.056 1.00 0.00 ? 3   ALA A CA   2  
ATOM 4637  C C    . ALA A 1 3   ? 99.715  3.967   -23.120 1.00 0.00 ? 3   ALA A C    2  
ATOM 4638  O O    . ALA A 1 3   ? 100.555 3.563   -22.317 1.00 0.00 ? 3   ALA A O    2  
ATOM 4639  C CB   . ALA A 1 3   ? 97.495  3.163   -23.922 1.00 0.00 ? 3   ALA A CB   2  
ATOM 4640  H H    . ALA A 1 3   ? 98.680  0.976   -23.506 1.00 0.00 ? 3   ALA A H    2  
ATOM 4641  H HA   . ALA A 1 3   ? 99.286  3.220   -25.073 1.00 0.00 ? 3   ALA A HA   2  
ATOM 4642  H HB1  . ALA A 1 3   ? 97.210  4.151   -24.251 1.00 0.00 ? 3   ALA A HB1  2  
ATOM 4643  H HB2  . ALA A 1 3   ? 97.208  3.031   -22.888 1.00 0.00 ? 3   ALA A HB2  2  
ATOM 4644  H HB3  . ALA A 1 3   ? 96.995  2.424   -24.531 1.00 0.00 ? 3   ALA A HB3  2  
ATOM 4645  N N    . SER A 1 4   ? 99.373  5.247   -23.228 1.00 0.00 ? 4   SER A N    2  
ATOM 4646  C CA   . SER A 1 4   ? 99.989  6.267   -22.385 1.00 0.00 ? 4   SER A CA   2  
ATOM 4647  C C    . SER A 1 4   ? 99.195  7.567   -22.453 1.00 0.00 ? 4   SER A C    2  
ATOM 4648  O O    . SER A 1 4   ? 98.055  7.587   -22.920 1.00 0.00 ? 4   SER A O    2  
ATOM 4649  C CB   . SER A 1 4   ? 101.426 6.521   -22.838 1.00 0.00 ? 4   SER A CB   2  
ATOM 4650  O OG   . SER A 1 4   ? 102.116 5.281   -22.929 1.00 0.00 ? 4   SER A OG   2  
ATOM 4651  H H    . SER A 1 4   ? 98.696  5.510   -23.885 1.00 0.00 ? 4   SER A H    2  
ATOM 4652  H HA   . SER A 1 4   ? 100.002 5.918   -21.363 1.00 0.00 ? 4   SER A HA   2  
ATOM 4653  H HB2  . SER A 1 4   ? 101.422 6.996   -23.805 1.00 0.00 ? 4   SER A HB2  2  
ATOM 4654  H HB3  . SER A 1 4   ? 101.919 7.167   -22.124 1.00 0.00 ? 4   SER A HB3  2  
ATOM 4655  H HG   . SER A 1 4   ? 102.619 5.161   -22.120 1.00 0.00 ? 4   SER A HG   2  
ATOM 4656  N N    . LEU A 1 5   ? 99.802  8.651   -21.983 1.00 0.00 ? 5   LEU A N    2  
ATOM 4657  C CA   . LEU A 1 5   ? 99.141  9.951   -21.995 1.00 0.00 ? 5   LEU A CA   2  
ATOM 4658  C C    . LEU A 1 5   ? 97.783  9.864   -21.303 1.00 0.00 ? 5   LEU A C    2  
ATOM 4659  O O    . LEU A 1 5   ? 96.795  9.446   -21.907 1.00 0.00 ? 5   LEU A O    2  
ATOM 4660  C CB   . LEU A 1 5   ? 98.963  10.435  -23.443 1.00 0.00 ? 5   LEU A CB   2  
ATOM 4661  C CG   . LEU A 1 5   ? 100.226 10.125  -24.256 1.00 0.00 ? 5   LEU A CG   2  
ATOM 4662  C CD1  . LEU A 1 5   ? 100.074 10.708  -25.663 1.00 0.00 ? 5   LEU A CD1  2  
ATOM 4663  C CD2  . LEU A 1 5   ? 101.452 10.747  -23.573 1.00 0.00 ? 5   LEU A CD2  2  
ATOM 4664  H H    . LEU A 1 5   ? 100.711 8.576   -21.623 1.00 0.00 ? 5   LEU A H    2  
ATOM 4665  H HA   . LEU A 1 5   ? 99.757  10.662  -21.463 1.00 0.00 ? 5   LEU A HA   2  
ATOM 4666  H HB2  . LEU A 1 5   ? 98.118  9.929   -23.892 1.00 0.00 ? 5   LEU A HB2  2  
ATOM 4667  H HB3  . LEU A 1 5   ? 98.787  11.500  -23.448 1.00 0.00 ? 5   LEU A HB3  2  
ATOM 4668  H HG   . LEU A 1 5   ? 100.354 9.054   -24.325 1.00 0.00 ? 5   LEU A HG   2  
ATOM 4669  H HD11 . LEU A 1 5   ? 99.218  10.262  -26.147 1.00 0.00 ? 5   LEU A HD11 2  
ATOM 4670  H HD12 . LEU A 1 5   ? 100.964 10.496  -26.237 1.00 0.00 ? 5   LEU A HD12 2  
ATOM 4671  H HD13 . LEU A 1 5   ? 99.934  11.777  -25.597 1.00 0.00 ? 5   LEU A HD13 2  
ATOM 4672  H HD21 . LEU A 1 5   ? 102.290 10.742  -24.257 1.00 0.00 ? 5   LEU A HD21 2  
ATOM 4673  H HD22 . LEU A 1 5   ? 101.706 10.171  -22.695 1.00 0.00 ? 5   LEU A HD22 2  
ATOM 4674  H HD23 . LEU A 1 5   ? 101.230 11.764  -23.285 1.00 0.00 ? 5   LEU A HD23 2  
ATOM 4675  N N    . GLN A 1 6   ? 97.743  10.261  -20.036 1.00 0.00 ? 6   GLN A N    2  
ATOM 4676  C CA   . GLN A 1 6   ? 96.500  10.222  -19.272 1.00 0.00 ? 6   GLN A CA   2  
ATOM 4677  C C    . GLN A 1 6   ? 96.635  11.020  -17.977 1.00 0.00 ? 6   GLN A C    2  
ATOM 4678  O O    . GLN A 1 6   ? 97.622  10.885  -17.254 1.00 0.00 ? 6   GLN A O    2  
ATOM 4679  C CB   . GLN A 1 6   ? 96.111  8.765   -18.963 1.00 0.00 ? 6   GLN A CB   2  
ATOM 4680  C CG   . GLN A 1 6   ? 97.049  8.154   -17.908 1.00 0.00 ? 6   GLN A CG   2  
ATOM 4681  C CD   . GLN A 1 6   ? 98.509  8.343   -18.327 1.00 0.00 ? 6   GLN A CD   2  
ATOM 4682  O OE1  . GLN A 1 6   ? 98.936  7.819   -19.337 1.00 0.00 ? 6   GLN A OE1  2  
ATOM 4683  N NE2  . GLN A 1 6   ? 99.298  9.078   -17.591 1.00 0.00 ? 6   GLN A NE2  2  
ATOM 4684  H H    . GLN A 1 6   ? 98.562  10.585  -19.606 1.00 0.00 ? 6   GLN A H    2  
ATOM 4685  H HA   . GLN A 1 6   ? 95.716  10.667  -19.868 1.00 0.00 ? 6   GLN A HA   2  
ATOM 4686  H HB2  . GLN A 1 6   ? 95.097  8.740   -18.591 1.00 0.00 ? 6   GLN A HB2  2  
ATOM 4687  H HB3  . GLN A 1 6   ? 96.170  8.183   -19.870 1.00 0.00 ? 6   GLN A HB3  2  
ATOM 4688  H HG2  . GLN A 1 6   ? 96.884  8.630   -16.953 1.00 0.00 ? 6   GLN A HG2  2  
ATOM 4689  H HG3  . GLN A 1 6   ? 96.842  7.098   -17.818 1.00 0.00 ? 6   GLN A HG3  2  
ATOM 4690  H HE21 . GLN A 1 6   ? 98.953  9.500   -16.777 1.00 0.00 ? 6   GLN A HE21 2  
ATOM 4691  H HE22 . GLN A 1 6   ? 100.233 9.205   -17.852 1.00 0.00 ? 6   GLN A HE22 2  
ATOM 4692  N N    . GLN A 1 7   ? 95.637  11.851  -17.694 1.00 0.00 ? 7   GLN A N    2  
ATOM 4693  C CA   . GLN A 1 7   ? 95.653  12.665  -16.485 1.00 0.00 ? 7   GLN A CA   2  
ATOM 4694  C C    . GLN A 1 7   ? 95.484  11.785  -15.248 1.00 0.00 ? 7   GLN A C    2  
ATOM 4695  O O    . GLN A 1 7   ? 95.995  10.666  -15.199 1.00 0.00 ? 7   GLN A O    2  
ATOM 4696  C CB   . GLN A 1 7   ? 94.529  13.703  -16.539 1.00 0.00 ? 7   GLN A CB   2  
ATOM 4697  C CG   . GLN A 1 7   ? 94.577  14.449  -17.876 1.00 0.00 ? 7   GLN A CG   2  
ATOM 4698  C CD   . GLN A 1 7   ? 95.916  15.176  -18.009 1.00 0.00 ? 7   GLN A CD   2  
ATOM 4699  O OE1  . GLN A 1 7   ? 96.166  16.144  -17.320 1.00 0.00 ? 7   GLN A OE1  2  
ATOM 4700  N NE2  . GLN A 1 7   ? 96.793  14.748  -18.876 1.00 0.00 ? 7   GLN A NE2  2  
ATOM 4701  H H    . GLN A 1 7   ? 94.877  11.916  -18.308 1.00 0.00 ? 7   GLN A H    2  
ATOM 4702  H HA   . GLN A 1 7   ? 96.601  13.179  -16.421 1.00 0.00 ? 7   GLN A HA   2  
ATOM 4703  H HB2  . GLN A 1 7   ? 93.576  13.206  -16.437 1.00 0.00 ? 7   GLN A HB2  2  
ATOM 4704  H HB3  . GLN A 1 7   ? 94.653  14.410  -15.731 1.00 0.00 ? 7   GLN A HB3  2  
ATOM 4705  H HG2  . GLN A 1 7   ? 94.466  13.743  -18.686 1.00 0.00 ? 7   GLN A HG2  2  
ATOM 4706  H HG3  . GLN A 1 7   ? 93.773  15.169  -17.914 1.00 0.00 ? 7   GLN A HG3  2  
ATOM 4707  H HE21 . GLN A 1 7   ? 96.591  13.967  -19.431 1.00 0.00 ? 7   GLN A HE21 2  
ATOM 4708  H HE22 . GLN A 1 7   ? 97.653  15.208  -18.969 1.00 0.00 ? 7   GLN A HE22 2  
ATOM 4709  N N    . SER A 1 8   ? 94.767  12.295  -14.253 1.00 0.00 ? 8   SER A N    2  
ATOM 4710  C CA   . SER A 1 8   ? 94.538  11.545  -13.024 1.00 0.00 ? 8   SER A CA   2  
ATOM 4711  C C    . SER A 1 8   ? 93.465  12.219  -12.177 1.00 0.00 ? 8   SER A C    2  
ATOM 4712  O O    . SER A 1 8   ? 92.879  11.598  -11.290 1.00 0.00 ? 8   SER A O    2  
ATOM 4713  C CB   . SER A 1 8   ? 95.837  11.446  -12.223 1.00 0.00 ? 8   SER A CB   2  
ATOM 4714  O OG   . SER A 1 8   ? 95.572  10.823  -10.974 1.00 0.00 ? 8   SER A OG   2  
ATOM 4715  H H    . SER A 1 8   ? 94.382  13.193  -14.347 1.00 0.00 ? 8   SER A H    2  
ATOM 4716  H HA   . SER A 1 8   ? 94.210  10.548  -13.278 1.00 0.00 ? 8   SER A HA   2  
ATOM 4717  H HB2  . SER A 1 8   ? 96.554  10.857  -12.768 1.00 0.00 ? 8   SER A HB2  2  
ATOM 4718  H HB3  . SER A 1 8   ? 96.236  12.439  -12.065 1.00 0.00 ? 8   SER A HB3  2  
ATOM 4719  H HG   . SER A 1 8   ? 95.764  9.887   -11.062 1.00 0.00 ? 8   SER A HG   2  
ATOM 4720  N N    . SER A 1 9   ? 93.212  13.495  -12.456 1.00 0.00 ? 9   SER A N    2  
ATOM 4721  C CA   . SER A 1 9   ? 92.207  14.250  -11.714 1.00 0.00 ? 9   SER A CA   2  
ATOM 4722  C C    . SER A 1 9   ? 90.801  13.869  -12.170 1.00 0.00 ? 9   SER A C    2  
ATOM 4723  O O    . SER A 1 9   ? 89.834  14.030  -11.427 1.00 0.00 ? 9   SER A O    2  
ATOM 4724  C CB   . SER A 1 9   ? 92.423  15.748  -11.922 1.00 0.00 ? 9   SER A CB   2  
ATOM 4725  O OG   . SER A 1 9   ? 93.728  16.100  -11.483 1.00 0.00 ? 9   SER A OG   2  
ATOM 4726  H H    . SER A 1 9   ? 93.712  13.937  -13.173 1.00 0.00 ? 9   SER A H    2  
ATOM 4727  H HA   . SER A 1 9   ? 92.305  14.029  -10.661 1.00 0.00 ? 9   SER A HA   2  
ATOM 4728  H HB2  . SER A 1 9   ? 92.326  15.986  -12.969 1.00 0.00 ? 9   SER A HB2  2  
ATOM 4729  H HB3  . SER A 1 9   ? 91.681  16.301  -11.360 1.00 0.00 ? 9   SER A HB3  2  
ATOM 4730  H HG   . SER A 1 9   ? 94.274  16.248  -12.258 1.00 0.00 ? 9   SER A HG   2  
ATOM 4731  N N    . SER A 1 10  ? 90.697  13.365  -13.396 1.00 0.00 ? 10  SER A N    2  
ATOM 4732  C CA   . SER A 1 10  ? 89.403  12.967  -13.939 1.00 0.00 ? 10  SER A CA   2  
ATOM 4733  C C    . SER A 1 10  ? 88.672  12.046  -12.965 1.00 0.00 ? 10  SER A C    2  
ATOM 4734  O O    . SER A 1 10  ? 89.282  11.175  -12.343 1.00 0.00 ? 10  SER A O    2  
ATOM 4735  C CB   . SER A 1 10  ? 89.593  12.251  -15.276 1.00 0.00 ? 10  SER A CB   2  
ATOM 4736  O OG   . SER A 1 10  ? 90.376  11.082  -15.075 1.00 0.00 ? 10  SER A OG   2  
ATOM 4737  H H    . SER A 1 10  ? 91.502  13.259  -13.944 1.00 0.00 ? 10  SER A H    2  
ATOM 4738  H HA   . SER A 1 10  ? 88.804  13.851  -14.100 1.00 0.00 ? 10  SER A HA   2  
ATOM 4739  H HB2  . SER A 1 10  ? 88.634  11.971  -15.677 1.00 0.00 ? 10  SER A HB2  2  
ATOM 4740  H HB3  . SER A 1 10  ? 90.091  12.916  -15.970 1.00 0.00 ? 10  SER A HB3  2  
ATOM 4741  H HG   . SER A 1 10  ? 90.789  10.854  -15.911 1.00 0.00 ? 10  SER A HG   2  
ATOM 4742  N N    . SER A 1 11  ? 87.366  12.248  -12.836 1.00 0.00 ? 11  SER A N    2  
ATOM 4743  C CA   . SER A 1 11  ? 86.562  11.432  -11.933 1.00 0.00 ? 11  SER A CA   2  
ATOM 4744  C C    . SER A 1 11  ? 86.566  9.973   -12.377 1.00 0.00 ? 11  SER A C    2  
ATOM 4745  O O    . SER A 1 11  ? 86.303  9.071   -11.583 1.00 0.00 ? 11  SER A O    2  
ATOM 4746  C CB   . SER A 1 11  ? 85.126  11.953  -11.898 1.00 0.00 ? 11  SER A CB   2  
ATOM 4747  O OG   . SER A 1 11  ? 84.619  12.020  -13.225 1.00 0.00 ? 11  SER A OG   2  
ATOM 4748  H H    . SER A 1 11  ? 86.934  12.958  -13.355 1.00 0.00 ? 11  SER A H    2  
ATOM 4749  H HA   . SER A 1 11  ? 86.979  11.495  -10.939 1.00 0.00 ? 11  SER A HA   2  
ATOM 4750  H HB2  . SER A 1 11  ? 84.511  11.284  -11.319 1.00 0.00 ? 11  SER A HB2  2  
ATOM 4751  H HB3  . SER A 1 11  ? 85.110  12.935  -11.446 1.00 0.00 ? 11  SER A HB3  2  
ATOM 4752  H HG   . SER A 1 11  ? 85.365  11.995  -13.829 1.00 0.00 ? 11  SER A HG   2  
ATOM 4753  N N    . SER A 1 12  ? 86.864  9.747   -13.654 1.00 0.00 ? 12  SER A N    2  
ATOM 4754  C CA   . SER A 1 12  ? 86.898  8.392   -14.198 1.00 0.00 ? 12  SER A CA   2  
ATOM 4755  C C    . SER A 1 12  ? 88.185  7.679   -13.791 1.00 0.00 ? 12  SER A C    2  
ATOM 4756  O O    . SER A 1 12  ? 88.217  6.454   -13.674 1.00 0.00 ? 12  SER A O    2  
ATOM 4757  C CB   . SER A 1 12  ? 86.806  8.443   -15.723 1.00 0.00 ? 12  SER A CB   2  
ATOM 4758  O OG   . SER A 1 12  ? 87.190  7.183   -16.259 1.00 0.00 ? 12  SER A OG   2  
ATOM 4759  H H    . SER A 1 12  ? 87.064  10.505  -14.241 1.00 0.00 ? 12  SER A H    2  
ATOM 4760  H HA   . SER A 1 12  ? 86.054  7.835   -13.816 1.00 0.00 ? 12  SER A HA   2  
ATOM 4761  H HB2  . SER A 1 12  ? 85.792  8.660   -16.019 1.00 0.00 ? 12  SER A HB2  2  
ATOM 4762  H HB3  . SER A 1 12  ? 87.461  9.219   -16.096 1.00 0.00 ? 12  SER A HB3  2  
ATOM 4763  H HG   . SER A 1 12  ? 86.727  7.061   -17.091 1.00 0.00 ? 12  SER A HG   2  
ATOM 4764  N N    . SER A 1 13  ? 89.248  8.454   -13.584 1.00 0.00 ? 13  SER A N    2  
ATOM 4765  C CA   . SER A 1 13  ? 90.540  7.886   -13.198 1.00 0.00 ? 13  SER A CA   2  
ATOM 4766  C C    . SER A 1 13  ? 90.561  7.534   -11.713 1.00 0.00 ? 13  SER A C    2  
ATOM 4767  O O    . SER A 1 13  ? 90.928  6.421   -11.337 1.00 0.00 ? 13  SER A O    2  
ATOM 4768  C CB   . SER A 1 13  ? 91.657  8.884   -13.499 1.00 0.00 ? 13  SER A CB   2  
ATOM 4769  O OG   . SER A 1 13  ? 91.461  10.058  -12.721 1.00 0.00 ? 13  SER A OG   2  
ATOM 4770  H H    . SER A 1 13  ? 89.165  9.424   -13.697 1.00 0.00 ? 13  SER A H    2  
ATOM 4771  H HA   . SER A 1 13  ? 90.716  6.988   -13.773 1.00 0.00 ? 13  SER A HA   2  
ATOM 4772  H HB2  . SER A 1 13  ? 92.610  8.449   -13.248 1.00 0.00 ? 13  SER A HB2  2  
ATOM 4773  H HB3  . SER A 1 13  ? 91.644  9.132   -14.552 1.00 0.00 ? 13  SER A HB3  2  
ATOM 4774  H HG   . SER A 1 13  ? 91.945  9.953   -11.899 1.00 0.00 ? 13  SER A HG   2  
ATOM 4775  N N    . SER A 1 14  ? 90.174  8.490   -10.872 1.00 0.00 ? 14  SER A N    2  
ATOM 4776  C CA   . SER A 1 14  ? 90.161  8.266   -9.429  1.00 0.00 ? 14  SER A CA   2  
ATOM 4777  C C    . SER A 1 14  ? 89.285  9.302   -8.730  1.00 0.00 ? 14  SER A C    2  
ATOM 4778  O O    . SER A 1 14  ? 88.816  10.254  -9.353  1.00 0.00 ? 14  SER A O    2  
ATOM 4779  C CB   . SER A 1 14  ? 91.584  8.348   -8.877  1.00 0.00 ? 14  SER A CB   2  
ATOM 4780  O OG   . SER A 1 14  ? 91.587  7.921   -7.521  1.00 0.00 ? 14  SER A OG   2  
ATOM 4781  H H    . SER A 1 14  ? 89.897  9.360   -11.227 1.00 0.00 ? 14  SER A H    2  
ATOM 4782  H HA   . SER A 1 14  ? 89.765  7.282   -9.226  1.00 0.00 ? 14  SER A HA   2  
ATOM 4783  H HB2  . SER A 1 14  ? 92.232  7.708   -9.452  1.00 0.00 ? 14  SER A HB2  2  
ATOM 4784  H HB3  . SER A 1 14  ? 91.937  9.369   -8.945  1.00 0.00 ? 14  SER A HB3  2  
ATOM 4785  H HG   . SER A 1 14  ? 92.112  8.545   -7.014  1.00 0.00 ? 14  SER A HG   2  
ATOM 4786  N N    . CYS A 1 15  ? 89.073  9.109   -7.433  1.00 0.00 ? 15  CYS A N    2  
ATOM 4787  C CA   . CYS A 1 15  ? 88.253  10.033  -6.657  1.00 0.00 ? 15  CYS A CA   2  
ATOM 4788  C C    . CYS A 1 15  ? 88.967  11.374  -6.501  1.00 0.00 ? 15  CYS A C    2  
ATOM 4789  O O    . CYS A 1 15  ? 90.197  11.435  -6.491  1.00 0.00 ? 15  CYS A O    2  
ATOM 4790  C CB   . CYS A 1 15  ? 87.952  9.431   -5.279  1.00 0.00 ? 15  CYS A CB   2  
ATOM 4791  S SG   . CYS A 1 15  ? 86.493  10.238  -4.574  1.00 0.00 ? 15  CYS A SG   2  
ATOM 4792  H H    . CYS A 1 15  ? 89.474  8.333   -6.989  1.00 0.00 ? 15  CYS A H    2  
ATOM 4793  H HA   . CYS A 1 15  ? 87.321  10.193  -7.177  1.00 0.00 ? 15  CYS A HA   2  
ATOM 4794  H HB2  . CYS A 1 15  ? 87.759  8.373   -5.386  1.00 0.00 ? 15  CYS A HB2  2  
ATOM 4795  H HB3  . CYS A 1 15  ? 88.799  9.575   -4.622  1.00 0.00 ? 15  CYS A HB3  2  
ATOM 4796  N N    . THR A 1 16  ? 88.190  12.446  -6.384  1.00 0.00 ? 16  THR A N    2  
ATOM 4797  C CA   . THR A 1 16  ? 88.765  13.778  -6.235  1.00 0.00 ? 16  THR A CA   2  
ATOM 4798  C C    . THR A 1 16  ? 89.560  13.881  -4.938  1.00 0.00 ? 16  THR A C    2  
ATOM 4799  O O    . THR A 1 16  ? 89.506  12.991  -4.090  1.00 0.00 ? 16  THR A O    2  
ATOM 4800  C CB   . THR A 1 16  ? 87.666  14.861  -6.225  1.00 0.00 ? 16  THR A CB   2  
ATOM 4801  O OG1  . THR A 1 16  ? 88.273  16.145  -6.208  1.00 0.00 ? 16  THR A OG1  2  
ATOM 4802  C CG2  . THR A 1 16  ? 86.780  14.700  -4.984  1.00 0.00 ? 16  THR A CG2  2  
ATOM 4803  H H    . THR A 1 16  ? 87.216  12.339  -6.402  1.00 0.00 ? 16  THR A H    2  
ATOM 4804  H HA   . THR A 1 16  ? 89.428  13.965  -7.067  1.00 0.00 ? 16  THR A HA   2  
ATOM 4805  H HB   . THR A 1 16  ? 87.058  14.765  -7.112  1.00 0.00 ? 16  THR A HB   2  
ATOM 4806  H HG1  . THR A 1 16  ? 88.741  16.241  -5.376  1.00 0.00 ? 16  THR A HG1  2  
ATOM 4807  H HG21 . THR A 1 16  ? 85.869  15.265  -5.117  1.00 0.00 ? 16  THR A HG21 2  
ATOM 4808  H HG22 . THR A 1 16  ? 87.307  15.069  -4.117  1.00 0.00 ? 16  THR A HG22 2  
ATOM 4809  H HG23 . THR A 1 16  ? 86.540  13.656  -4.841  1.00 0.00 ? 16  THR A HG23 2  
ATOM 4810  N N    . GLU A 1 17  ? 90.293  14.986  -4.790  1.00 0.00 ? 17  GLU A N    2  
ATOM 4811  C CA   . GLU A 1 17  ? 91.102  15.234  -3.593  1.00 0.00 ? 17  GLU A CA   2  
ATOM 4812  C C    . GLU A 1 17  ? 90.527  16.415  -2.824  1.00 0.00 ? 17  GLU A C    2  
ATOM 4813  O O    . GLU A 1 17  ? 91.092  16.859  -1.826  1.00 0.00 ? 17  GLU A O    2  
ATOM 4814  C CB   . GLU A 1 17  ? 92.546  15.544  -3.994  1.00 0.00 ? 17  GLU A CB   2  
ATOM 4815  C CG   . GLU A 1 17  ? 93.196  14.292  -4.589  1.00 0.00 ? 17  GLU A CG   2  
ATOM 4816  C CD   . GLU A 1 17  ? 92.529  13.956  -5.925  1.00 0.00 ? 17  GLU A CD   2  
ATOM 4817  O OE1  . GLU A 1 17  ? 92.252  14.878  -6.674  1.00 0.00 ? 17  GLU A OE1  2  
ATOM 4818  O OE2  . GLU A 1 17  ? 92.308  12.783  -6.175  1.00 0.00 ? 17  GLU A OE2  2  
ATOM 4819  H H    . GLU A 1 17  ? 90.283  15.661  -5.501  1.00 0.00 ? 17  GLU A H    2  
ATOM 4820  H HA   . GLU A 1 17  ? 91.095  14.360  -2.952  1.00 0.00 ? 17  GLU A HA   2  
ATOM 4821  H HB2  . GLU A 1 17  ? 92.554  16.336  -4.729  1.00 0.00 ? 17  GLU A HB2  2  
ATOM 4822  H HB3  . GLU A 1 17  ? 93.101  15.858  -3.122  1.00 0.00 ? 17  GLU A HB3  2  
ATOM 4823  H HG2  . GLU A 1 17  ? 94.249  14.474  -4.747  1.00 0.00 ? 17  GLU A HG2  2  
ATOM 4824  H HG3  . GLU A 1 17  ? 93.071  13.463  -3.908  1.00 0.00 ? 17  GLU A HG3  2  
ATOM 4825  N N    . GLU A 1 18  ? 89.391  16.912  -3.301  1.00 0.00 ? 18  GLU A N    2  
ATOM 4826  C CA   . GLU A 1 18  ? 88.729  18.039  -2.662  1.00 0.00 ? 18  GLU A CA   2  
ATOM 4827  C C    . GLU A 1 18  ? 88.323  17.666  -1.237  1.00 0.00 ? 18  GLU A C    2  
ATOM 4828  O O    . GLU A 1 18  ? 88.809  16.675  -0.689  1.00 0.00 ? 18  GLU A O    2  
ATOM 4829  C CB   . GLU A 1 18  ? 87.495  18.436  -3.482  1.00 0.00 ? 18  GLU A CB   2  
ATOM 4830  C CG   . GLU A 1 18  ? 87.935  19.130  -4.777  1.00 0.00 ? 18  GLU A CG   2  
ATOM 4831  C CD   . GLU A 1 18  ? 88.467  20.529  -4.456  1.00 0.00 ? 18  GLU A CD   2  
ATOM 4832  O OE1  . GLU A 1 18  ? 87.783  21.254  -3.754  1.00 0.00 ? 18  GLU A OE1  2  
ATOM 4833  O OE2  . GLU A 1 18  ? 89.550  20.849  -4.917  1.00 0.00 ? 18  GLU A OE2  2  
ATOM 4834  H H    . GLU A 1 18  ? 88.988  16.508  -4.097  1.00 0.00 ? 18  GLU A H    2  
ATOM 4835  H HA   . GLU A 1 18  ? 89.411  18.874  -2.623  1.00 0.00 ? 18  GLU A HA   2  
ATOM 4836  H HB2  . GLU A 1 18  ? 86.936  17.547  -3.728  1.00 0.00 ? 18  GLU A HB2  2  
ATOM 4837  H HB3  . GLU A 1 18  ? 86.873  19.106  -2.909  1.00 0.00 ? 18  GLU A HB3  2  
ATOM 4838  H HG2  . GLU A 1 18  ? 88.714  18.548  -5.251  1.00 0.00 ? 18  GLU A HG2  2  
ATOM 4839  H HG3  . GLU A 1 18  ? 87.091  19.213  -5.445  1.00 0.00 ? 18  GLU A HG3  2  
ATOM 4840  N N    . GLU A 1 19  ? 87.436  18.463  -0.638  1.00 0.00 ? 19  GLU A N    2  
ATOM 4841  C CA   . GLU A 1 19  ? 86.972  18.213  0.732   1.00 0.00 ? 19  GLU A CA   2  
ATOM 4842  C C    . GLU A 1 19  ? 85.448  18.174  0.787   1.00 0.00 ? 19  GLU A C    2  
ATOM 4843  O O    . GLU A 1 19  ? 84.857  17.152  1.136   1.00 0.00 ? 19  GLU A O    2  
ATOM 4844  C CB   . GLU A 1 19  ? 87.479  19.322  1.659   1.00 0.00 ? 19  GLU A CB   2  
ATOM 4845  C CG   . GLU A 1 19  ? 89.002  19.426  1.549   1.00 0.00 ? 19  GLU A CG   2  
ATOM 4846  C CD   . GLU A 1 19  ? 89.643  18.144  2.081   1.00 0.00 ? 19  GLU A CD   2  
ATOM 4847  O OE1  . GLU A 1 19  ? 89.228  17.691  3.135   1.00 0.00 ? 19  GLU A OE1  2  
ATOM 4848  O OE2  . GLU A 1 19  ? 90.538  17.636  1.426   1.00 0.00 ? 19  GLU A OE2  2  
ATOM 4849  H H    . GLU A 1 19  ? 87.088  19.236  -1.126  1.00 0.00 ? 19  GLU A H    2  
ATOM 4850  H HA   . GLU A 1 19  ? 87.353  17.265  1.087   1.00 0.00 ? 19  GLU A HA   2  
ATOM 4851  H HB2  . GLU A 1 19  ? 87.032  20.263  1.372   1.00 0.00 ? 19  GLU A HB2  2  
ATOM 4852  H HB3  . GLU A 1 19  ? 87.207  19.092  2.678   1.00 0.00 ? 19  GLU A HB3  2  
ATOM 4853  H HG2  . GLU A 1 19  ? 89.280  19.567  0.515   1.00 0.00 ? 19  GLU A HG2  2  
ATOM 4854  H HG3  . GLU A 1 19  ? 89.347  20.267  2.132   1.00 0.00 ? 19  GLU A HG3  2  
ATOM 4855  N N    . ASN A 1 20  ? 84.820  19.299  0.456   1.00 0.00 ? 20  ASN A N    2  
ATOM 4856  C CA   . ASN A 1 20  ? 83.361  19.394  0.484   1.00 0.00 ? 20  ASN A CA   2  
ATOM 4857  C C    . ASN A 1 20  ? 82.738  18.822  -0.786  1.00 0.00 ? 20  ASN A C    2  
ATOM 4858  O O    . ASN A 1 20  ? 81.714  19.316  -1.253  1.00 0.00 ? 20  ASN A O    2  
ATOM 4859  C CB   . ASN A 1 20  ? 82.945  20.859  0.634   1.00 0.00 ? 20  ASN A CB   2  
ATOM 4860  C CG   . ASN A 1 20  ? 83.714  21.494  1.794   1.00 0.00 ? 20  ASN A CG   2  
ATOM 4861  O OD1  . ASN A 1 20  ? 84.505  22.393  1.594   1.00 0.00 ? 20  ASN A OD1  2  
ATOM 4862  N ND2  . ASN A 1 20  ? 83.512  21.060  3.009   1.00 0.00 ? 20  ASN A ND2  2  
ATOM 4863  H H    . ASN A 1 20  ? 85.347  20.084  0.197   1.00 0.00 ? 20  ASN A H    2  
ATOM 4864  H HA   . ASN A 1 20  ? 82.986  18.844  1.335   1.00 0.00 ? 20  ASN A HA   2  
ATOM 4865  H HB2  . ASN A 1 20  ? 83.166  21.391  -0.281  1.00 0.00 ? 20  ASN A HB2  2  
ATOM 4866  H HB3  . ASN A 1 20  ? 81.885  20.913  0.834   1.00 0.00 ? 20  ASN A HB3  2  
ATOM 4867  H HD21 . ASN A 1 20  ? 82.872  20.335  3.170   1.00 0.00 ? 20  ASN A HD21 2  
ATOM 4868  H HD22 . ASN A 1 20  ? 83.999  21.461  3.759   1.00 0.00 ? 20  ASN A HD22 2  
ATOM 4869  N N    . LYS A 1 21  ? 83.345  17.773  -1.340  1.00 0.00 ? 21  LYS A N    2  
ATOM 4870  C CA   . LYS A 1 21  ? 82.818  17.141  -2.557  1.00 0.00 ? 21  LYS A CA   2  
ATOM 4871  C C    . LYS A 1 21  ? 82.989  15.627  -2.475  1.00 0.00 ? 21  LYS A C    2  
ATOM 4872  O O    . LYS A 1 21  ? 83.989  15.133  -1.955  1.00 0.00 ? 21  LYS A O    2  
ATOM 4873  C CB   . LYS A 1 21  ? 83.546  17.684  -3.798  1.00 0.00 ? 21  LYS A CB   2  
ATOM 4874  C CG   . LYS A 1 21  ? 83.029  19.088  -4.140  1.00 0.00 ? 21  LYS A CG   2  
ATOM 4875  C CD   . LYS A 1 21  ? 83.953  19.749  -5.172  1.00 0.00 ? 21  LYS A CD   2  
ATOM 4876  C CE   . LYS A 1 21  ? 84.079  18.856  -6.412  1.00 0.00 ? 21  LYS A CE   2  
ATOM 4877  N NZ   . LYS A 1 21  ? 82.749  18.272  -6.747  1.00 0.00 ? 21  LYS A NZ   2  
ATOM 4878  H H    . LYS A 1 21  ? 84.155  17.411  -0.923  1.00 0.00 ? 21  LYS A H    2  
ATOM 4879  H HA   . LYS A 1 21  ? 81.763  17.359  -2.645  1.00 0.00 ? 21  LYS A HA   2  
ATOM 4880  H HB2  . LYS A 1 21  ? 84.604  17.731  -3.598  1.00 0.00 ? 21  LYS A HB2  2  
ATOM 4881  H HB3  . LYS A 1 21  ? 83.369  17.027  -4.638  1.00 0.00 ? 21  LYS A HB3  2  
ATOM 4882  H HG2  . LYS A 1 21  ? 82.031  19.016  -4.545  1.00 0.00 ? 21  LYS A HG2  2  
ATOM 4883  H HG3  . LYS A 1 21  ? 83.009  19.691  -3.246  1.00 0.00 ? 21  LYS A HG3  2  
ATOM 4884  H HD2  . LYS A 1 21  ? 83.541  20.706  -5.457  1.00 0.00 ? 21  LYS A HD2  2  
ATOM 4885  H HD3  . LYS A 1 21  ? 84.930  19.895  -4.734  1.00 0.00 ? 21  LYS A HD3  2  
ATOM 4886  H HE2  . LYS A 1 21  ? 84.430  19.445  -7.247  1.00 0.00 ? 21  LYS A HE2  2  
ATOM 4887  H HE3  . LYS A 1 21  ? 84.783  18.060  -6.217  1.00 0.00 ? 21  LYS A HE3  2  
ATOM 4888  H HZ1  . LYS A 1 21  ? 82.655  17.340  -6.295  1.00 0.00 ? 21  LYS A HZ1  2  
ATOM 4889  H HZ2  . LYS A 1 21  ? 82.666  18.167  -7.779  1.00 0.00 ? 21  LYS A HZ2  2  
ATOM 4890  H HZ3  . LYS A 1 21  ? 81.997  18.899  -6.400  1.00 0.00 ? 21  LYS A HZ3  2  
ATOM 4891  N N    . HIS A 1 22  ? 81.998  14.894  -2.986  1.00 0.00 ? 22  HIS A N    2  
ATOM 4892  C CA   . HIS A 1 22  ? 82.042  13.427  -2.957  1.00 0.00 ? 22  HIS A CA   2  
ATOM 4893  C C    . HIS A 1 22  ? 81.413  12.834  -4.213  1.00 0.00 ? 22  HIS A C    2  
ATOM 4894  O O    . HIS A 1 22  ? 80.629  13.488  -4.901  1.00 0.00 ? 22  HIS A O    2  
ATOM 4895  C CB   . HIS A 1 22  ? 81.297  12.914  -1.723  1.00 0.00 ? 22  HIS A CB   2  
ATOM 4896  C CG   . HIS A 1 22  ? 82.029  13.344  -0.482  1.00 0.00 ? 22  HIS A CG   2  
ATOM 4897  N ND1  . HIS A 1 22  ? 81.486  14.244  0.422   1.00 0.00 ? 22  HIS A ND1  2  
ATOM 4898  C CD2  . HIS A 1 22  ? 83.262  13.006  0.020   1.00 0.00 ? 22  HIS A CD2  2  
ATOM 4899  C CE1  . HIS A 1 22  ? 82.382  14.417  1.411   1.00 0.00 ? 22  HIS A CE1  2  
ATOM 4900  N NE2  . HIS A 1 22  ? 83.483  13.685  1.215   1.00 0.00 ? 22  HIS A NE2  2  
ATOM 4901  H H    . HIS A 1 22  ? 81.219  15.348  -3.381  1.00 0.00 ? 22  HIS A H    2  
ATOM 4902  H HA   . HIS A 1 22  ? 83.071  13.097  -2.900  1.00 0.00 ? 22  HIS A HA   2  
ATOM 4903  H HB2  . HIS A 1 22  ? 80.296  13.321  -1.712  1.00 0.00 ? 22  HIS A HB2  2  
ATOM 4904  H HB3  . HIS A 1 22  ? 81.247  11.836  -1.756  1.00 0.00 ? 22  HIS A HB3  2  
ATOM 4905  H HD1  . HIS A 1 22  ? 80.609  14.677  0.353   1.00 0.00 ? 22  HIS A HD1  2  
ATOM 4906  H HD2  . HIS A 1 22  ? 83.933  12.282  -0.417  1.00 0.00 ? 22  HIS A HD2  2  
ATOM 4907  H HE1  . HIS A 1 22  ? 82.231  15.068  2.259   1.00 0.00 ? 22  HIS A HE1  2  
ATOM 4908  N N    . HIS A 1 23  ? 81.761  11.579  -4.495  1.00 0.00 ? 23  HIS A N    2  
ATOM 4909  C CA   . HIS A 1 23  ? 81.226  10.876  -5.662  1.00 0.00 ? 23  HIS A CA   2  
ATOM 4910  C C    . HIS A 1 23  ? 79.918  10.187  -5.296  1.00 0.00 ? 23  HIS A C    2  
ATOM 4911  O O    . HIS A 1 23  ? 79.894  8.990   -5.009  1.00 0.00 ? 23  HIS A O    2  
ATOM 4912  C CB   . HIS A 1 23  ? 82.229  9.830   -6.157  1.00 0.00 ? 23  HIS A CB   2  
ATOM 4913  C CG   . HIS A 1 23  ? 83.425  10.516  -6.756  1.00 0.00 ? 23  HIS A CG   2  
ATOM 4914  N ND1  . HIS A 1 23  ? 83.910  11.718  -6.269  1.00 0.00 ? 23  HIS A ND1  2  
ATOM 4915  C CD2  . HIS A 1 23  ? 84.241  10.178  -7.807  1.00 0.00 ? 23  HIS A CD2  2  
ATOM 4916  C CE1  . HIS A 1 23  ? 84.973  12.058  -7.020  1.00 0.00 ? 23  HIS A CE1  2  
ATOM 4917  N NE2  . HIS A 1 23  ? 85.218  11.154  -7.971  1.00 0.00 ? 23  HIS A NE2  2  
ATOM 4918  H H    . HIS A 1 23  ? 82.380  11.112  -3.896  1.00 0.00 ? 23  HIS A H    2  
ATOM 4919  H HA   . HIS A 1 23  ? 81.037  11.586  -6.457  1.00 0.00 ? 23  HIS A HA   2  
ATOM 4920  H HB2  . HIS A 1 23  ? 82.545  9.214   -5.329  1.00 0.00 ? 23  HIS A HB2  2  
ATOM 4921  H HB3  . HIS A 1 23  ? 81.760  9.212   -6.909  1.00 0.00 ? 23  HIS A HB3  2  
ATOM 4922  H HD1  . HIS A 1 23  ? 83.547  12.227  -5.514  1.00 0.00 ? 23  HIS A HD1  2  
ATOM 4923  H HD2  . HIS A 1 23  ? 84.053  9.369   -8.498  1.00 0.00 ? 23  HIS A HD2  2  
ATOM 4924  H HE1  . HIS A 1 23  ? 85.554  12.955  -6.874  1.00 0.00 ? 23  HIS A HE1  2  
ATOM 4925  N N    . MET A 1 24  ? 78.835  10.951  -5.302  1.00 0.00 ? 24  MET A N    2  
ATOM 4926  C CA   . MET A 1 24  ? 77.527  10.407  -4.964  1.00 0.00 ? 24  MET A CA   2  
ATOM 4927  C C    . MET A 1 24  ? 77.042  9.448   -6.051  1.00 0.00 ? 24  MET A C    2  
ATOM 4928  O O    . MET A 1 24  ? 76.955  9.808   -7.224  1.00 0.00 ? 24  MET A O    2  
ATOM 4929  C CB   . MET A 1 24  ? 76.517  11.550  -4.750  1.00 0.00 ? 24  MET A CB   2  
ATOM 4930  C CG   . MET A 1 24  ? 76.085  12.177  -6.087  1.00 0.00 ? 24  MET A CG   2  
ATOM 4931  S SD   . MET A 1 24  ? 77.533  12.553  -7.107  1.00 0.00 ? 24  MET A SD   2  
ATOM 4932  C CE   . MET A 1 24  ? 76.646  12.885  -8.650  1.00 0.00 ? 24  MET A CE   2  
ATOM 4933  H H    . MET A 1 24  ? 78.916  11.900  -5.534  1.00 0.00 ? 24  MET A H    2  
ATOM 4934  H HA   . MET A 1 24  ? 77.617  9.855   -4.040  1.00 0.00 ? 24  MET A HA   2  
ATOM 4935  H HB2  . MET A 1 24  ? 75.645  11.161  -4.246  1.00 0.00 ? 24  MET A HB2  2  
ATOM 4936  H HB3  . MET A 1 24  ? 76.971  12.312  -4.134  1.00 0.00 ? 24  MET A HB3  2  
ATOM 4937  H HG2  . MET A 1 24  ? 75.442  11.494  -6.613  1.00 0.00 ? 24  MET A HG2  2  
ATOM 4938  H HG3  . MET A 1 24  ? 75.541  13.090  -5.889  1.00 0.00 ? 24  MET A HG3  2  
ATOM 4939  H HE1  . MET A 1 24  ? 75.881  13.627  -8.472  1.00 0.00 ? 24  MET A HE1  2  
ATOM 4940  H HE2  . MET A 1 24  ? 76.190  11.974  -9.006  1.00 0.00 ? 24  MET A HE2  2  
ATOM 4941  H HE3  . MET A 1 24  ? 77.340  13.255  -9.391  1.00 0.00 ? 24  MET A HE3  2  
ATOM 4942  N N    . GLY A 1 25  ? 76.737  8.212   -5.644  1.00 0.00 ? 25  GLY A N    2  
ATOM 4943  C CA   . GLY A 1 25  ? 76.265  7.182   -6.567  1.00 0.00 ? 25  GLY A CA   2  
ATOM 4944  C C    . GLY A 1 25  ? 75.017  6.505   -6.044  1.00 0.00 ? 25  GLY A C    2  
ATOM 4945  O O    . GLY A 1 25  ? 74.532  6.832   -4.961  1.00 0.00 ? 25  GLY A O    2  
ATOM 4946  H H    . GLY A 1 25  ? 76.842  7.986   -4.697  1.00 0.00 ? 25  GLY A H    2  
ATOM 4947  H HA2  . GLY A 1 25  ? 76.046  7.622   -7.531  1.00 0.00 ? 25  GLY A HA2  2  
ATOM 4948  H HA3  . GLY A 1 25  ? 77.040  6.440   -6.689  1.00 0.00 ? 25  GLY A HA3  2  
ATOM 4949  N N    . ILE A 1 26  ? 74.490  5.554   -6.817  1.00 0.00 ? 26  ILE A N    2  
ATOM 4950  C CA   . ILE A 1 26  ? 73.280  4.827   -6.423  1.00 0.00 ? 26  ILE A CA   2  
ATOM 4951  C C    . ILE A 1 26  ? 73.436  3.338   -6.688  1.00 0.00 ? 26  ILE A C    2  
ATOM 4952  O O    . ILE A 1 26  ? 74.203  2.926   -7.556  1.00 0.00 ? 26  ILE A O    2  
ATOM 4953  C CB   . ILE A 1 26  ? 72.053  5.331   -7.215  1.00 0.00 ? 26  ILE A CB   2  
ATOM 4954  C CG1  . ILE A 1 26  ? 70.781  4.623   -6.700  1.00 0.00 ? 26  ILE A CG1  2  
ATOM 4955  C CG2  . ILE A 1 26  ? 72.253  5.042   -8.717  1.00 0.00 ? 26  ILE A CG2  2  
ATOM 4956  C CD1  . ILE A 1 26  ? 69.536  5.375   -7.179  1.00 0.00 ? 26  ILE A CD1  2  
ATOM 4957  H H    . ILE A 1 26  ? 74.920  5.339   -7.671  1.00 0.00 ? 26  ILE A H    2  
ATOM 4958  H HA   . ILE A 1 26  ? 73.095  4.972   -5.366  1.00 0.00 ? 26  ILE A HA   2  
ATOM 4959  H HB   . ILE A 1 26  ? 71.956  6.398   -7.071  1.00 0.00 ? 26  ILE A HB   2  
ATOM 4960  H HG12 . ILE A 1 26  ? 70.750  3.608   -7.064  1.00 0.00 ? 26  ILE A HG12 2  
ATOM 4961  H HG13 . ILE A 1 26  ? 70.787  4.609   -5.620  1.00 0.00 ? 26  ILE A HG13 2  
ATOM 4962  H HG21 . ILE A 1 26  ? 71.589  5.666   -9.297  1.00 0.00 ? 26  ILE A HG21 2  
ATOM 4963  H HG22 . ILE A 1 26  ? 72.044  4.004   -8.927  1.00 0.00 ? 26  ILE A HG22 2  
ATOM 4964  H HG23 . ILE A 1 26  ? 73.274  5.257   -8.996  1.00 0.00 ? 26  ILE A HG23 2  
ATOM 4965  H HD11 . ILE A 1 26  ? 69.502  5.369   -8.257  1.00 0.00 ? 26  ILE A HD11 2  
ATOM 4966  H HD12 . ILE A 1 26  ? 69.573  6.394   -6.825  1.00 0.00 ? 26  ILE A HD12 2  
ATOM 4967  H HD13 . ILE A 1 26  ? 68.652  4.891   -6.788  1.00 0.00 ? 26  ILE A HD13 2  
ATOM 4968  N N    . ASP A 1 27  ? 72.684  2.542   -5.937  1.00 0.00 ? 27  ASP A N    2  
ATOM 4969  C CA   . ASP A 1 27  ? 72.704  1.088   -6.077  1.00 0.00 ? 27  ASP A CA   2  
ATOM 4970  C C    . ASP A 1 27  ? 71.311  0.554   -5.806  1.00 0.00 ? 27  ASP A C    2  
ATOM 4971  O O    . ASP A 1 27  ? 70.641  1.018   -4.891  1.00 0.00 ? 27  ASP A O    2  
ATOM 4972  C CB   . ASP A 1 27  ? 73.698  0.475   -5.089  1.00 0.00 ? 27  ASP A CB   2  
ATOM 4973  C CG   . ASP A 1 27  ? 73.881  -1.011  -5.401  1.00 0.00 ? 27  ASP A CG   2  
ATOM 4974  O OD1  . ASP A 1 27  ? 73.022  -1.566  -6.067  1.00 0.00 ? 27  ASP A OD1  2  
ATOM 4975  O OD2  . ASP A 1 27  ? 74.876  -1.569  -4.968  1.00 0.00 ? 27  ASP A OD2  2  
ATOM 4976  H H    . ASP A 1 27  ? 72.087  2.945   -5.272  1.00 0.00 ? 27  ASP A H    2  
ATOM 4977  H HA   . ASP A 1 27  ? 72.989  0.822   -7.083  1.00 0.00 ? 27  ASP A HA   2  
ATOM 4978  H HB2  . ASP A 1 27  ? 74.649  0.981   -5.175  1.00 0.00 ? 27  ASP A HB2  2  
ATOM 4979  H HB3  . ASP A 1 27  ? 73.322  0.587   -4.083  1.00 0.00 ? 27  ASP A HB3  2  
ATOM 4980  N N    . VAL A 1 28  ? 70.862  -0.406  -6.618  1.00 0.00 ? 28  VAL A N    2  
ATOM 4981  C CA   . VAL A 1 28  ? 69.518  -0.972  -6.453  1.00 0.00 ? 28  VAL A CA   2  
ATOM 4982  C C    . VAL A 1 28  ? 69.524  -2.488  -6.623  1.00 0.00 ? 28  VAL A C    2  
ATOM 4983  O O    . VAL A 1 28  ? 69.646  -3.003  -7.734  1.00 0.00 ? 28  VAL A O    2  
ATOM 4984  C CB   . VAL A 1 28  ? 68.544  -0.364  -7.483  1.00 0.00 ? 28  VAL A CB   2  
ATOM 4985  C CG1  . VAL A 1 28  ? 67.157  -1.001  -7.331  1.00 0.00 ? 28  VAL A CG1  2  
ATOM 4986  C CG2  . VAL A 1 28  ? 68.444  1.146   -7.247  1.00 0.00 ? 28  VAL A CG2  2  
ATOM 4987  H H    . VAL A 1 28  ? 71.434  -0.727  -7.346  1.00 0.00 ? 28  VAL A H    2  
ATOM 4988  H HA   . VAL A 1 28  ? 69.148  -0.745  -5.462  1.00 0.00 ? 28  VAL A HA   2  
ATOM 4989  H HB   . VAL A 1 28  ? 68.916  -0.549  -8.479  1.00 0.00 ? 28  VAL A HB   2  
ATOM 4990  H HG11 . VAL A 1 28  ? 66.891  -1.037  -6.285  1.00 0.00 ? 28  VAL A HG11 2  
ATOM 4991  H HG12 . VAL A 1 28  ? 67.176  -2.004  -7.731  1.00 0.00 ? 28  VAL A HG12 2  
ATOM 4992  H HG13 . VAL A 1 28  ? 66.424  -0.416  -7.869  1.00 0.00 ? 28  VAL A HG13 2  
ATOM 4993  H HG21 . VAL A 1 28  ? 68.138  1.330   -6.227  1.00 0.00 ? 28  VAL A HG21 2  
ATOM 4994  H HG22 . VAL A 1 28  ? 67.716  1.568   -7.923  1.00 0.00 ? 28  VAL A HG22 2  
ATOM 4995  H HG23 . VAL A 1 28  ? 69.407  1.603   -7.422  1.00 0.00 ? 28  VAL A HG23 2  
ATOM 4996  N N    . ILE A 1 29  ? 69.353  -3.190  -5.506  1.00 0.00 ? 29  ILE A N    2  
ATOM 4997  C CA   . ILE A 1 29  ? 69.298  -4.651  -5.505  1.00 0.00 ? 29  ILE A CA   2  
ATOM 4998  C C    . ILE A 1 29  ? 67.830  -5.071  -5.583  1.00 0.00 ? 29  ILE A C    2  
ATOM 4999  O O    . ILE A 1 29  ? 66.969  -4.429  -4.981  1.00 0.00 ? 29  ILE A O    2  
ATOM 5000  C CB   . ILE A 1 29  ? 69.933  -5.217  -4.201  1.00 0.00 ? 29  ILE A CB   2  
ATOM 5001  C CG1  . ILE A 1 29  ? 71.467  -5.143  -4.286  1.00 0.00 ? 29  ILE A CG1  2  
ATOM 5002  C CG2  . ILE A 1 29  ? 69.521  -6.685  -3.985  1.00 0.00 ? 29  ILE A CG2  2  
ATOM 5003  C CD1  . ILE A 1 29  ? 71.919  -3.739  -4.702  1.00 0.00 ? 29  ILE A CD1  2  
ATOM 5004  H H    . ILE A 1 29  ? 69.238  -2.711  -4.659  1.00 0.00 ? 29  ILE A H    2  
ATOM 5005  H HA   . ILE A 1 29  ? 69.830  -5.042  -6.361  1.00 0.00 ? 29  ILE A HA   2  
ATOM 5006  H HB   . ILE A 1 29  ? 69.595  -4.630  -3.362  1.00 0.00 ? 29  ILE A HB   2  
ATOM 5007  H HG12 . ILE A 1 29  ? 71.888  -5.381  -3.320  1.00 0.00 ? 29  ILE A HG12 2  
ATOM 5008  H HG13 . ILE A 1 29  ? 71.817  -5.860  -5.011  1.00 0.00 ? 29  ILE A HG13 2  
ATOM 5009  H HG21 . ILE A 1 29  ? 70.145  -7.129  -3.225  1.00 0.00 ? 29  ILE A HG21 2  
ATOM 5010  H HG22 . ILE A 1 29  ? 69.635  -7.231  -4.909  1.00 0.00 ? 29  ILE A HG22 2  
ATOM 5011  H HG23 . ILE A 1 29  ? 68.489  -6.728  -3.668  1.00 0.00 ? 29  ILE A HG23 2  
ATOM 5012  H HD11 . ILE A 1 29  ? 71.747  -3.604  -5.760  1.00 0.00 ? 29  ILE A HD11 2  
ATOM 5013  H HD12 . ILE A 1 29  ? 72.973  -3.625  -4.494  1.00 0.00 ? 29  ILE A HD12 2  
ATOM 5014  H HD13 . ILE A 1 29  ? 71.363  -3.000  -4.148  1.00 0.00 ? 29  ILE A HD13 2  
ATOM 5015  N N    . ILE A 1 30  ? 67.538  -6.145  -6.315  1.00 0.00 ? 30  ILE A N    2  
ATOM 5016  C CA   . ILE A 1 30  ? 66.154  -6.608  -6.429  1.00 0.00 ? 30  ILE A CA   2  
ATOM 5017  C C    . ILE A 1 30  ? 66.088  -8.097  -6.767  1.00 0.00 ? 30  ILE A C    2  
ATOM 5018  O O    . ILE A 1 30  ? 66.532  -8.537  -7.828  1.00 0.00 ? 30  ILE A O    2  
ATOM 5019  C CB   . ILE A 1 30  ? 65.378  -5.796  -7.496  1.00 0.00 ? 30  ILE A CB   2  
ATOM 5020  C CG1  . ILE A 1 30  ? 63.877  -6.095  -7.372  1.00 0.00 ? 30  ILE A CG1  2  
ATOM 5021  C CG2  . ILE A 1 30  ? 65.865  -6.153  -8.910  1.00 0.00 ? 30  ILE A CG2  2  
ATOM 5022  C CD1  . ILE A 1 30  ? 63.108  -5.334  -8.457  1.00 0.00 ? 30  ILE A CD1  2  
ATOM 5023  H H    . ILE A 1 30  ? 68.254  -6.630  -6.776  1.00 0.00 ? 30  ILE A H    2  
ATOM 5024  H HA   . ILE A 1 30  ? 65.665  -6.462  -5.475  1.00 0.00 ? 30  ILE A HA   2  
ATOM 5025  H HB   . ILE A 1 30  ? 65.545  -4.742  -7.320  1.00 0.00 ? 30  ILE A HB   2  
ATOM 5026  H HG12 . ILE A 1 30  ? 63.710  -7.155  -7.489  1.00 0.00 ? 30  ILE A HG12 2  
ATOM 5027  H HG13 . ILE A 1 30  ? 63.526  -5.781  -6.399  1.00 0.00 ? 30  ILE A HG13 2  
ATOM 5028  H HG21 . ILE A 1 30  ? 65.626  -5.347  -9.589  1.00 0.00 ? 30  ILE A HG21 2  
ATOM 5029  H HG22 . ILE A 1 30  ? 65.383  -7.060  -9.250  1.00 0.00 ? 30  ILE A HG22 2  
ATOM 5030  H HG23 . ILE A 1 30  ? 66.932  -6.300  -8.894  1.00 0.00 ? 30  ILE A HG23 2  
ATOM 5031  H HD11 . ILE A 1 30  ? 63.446  -4.308  -8.489  1.00 0.00 ? 30  ILE A HD11 2  
ATOM 5032  H HD12 . ILE A 1 30  ? 62.053  -5.357  -8.234  1.00 0.00 ? 30  ILE A HD12 2  
ATOM 5033  H HD13 . ILE A 1 30  ? 63.284  -5.800  -9.416  1.00 0.00 ? 30  ILE A HD13 2  
ATOM 5034  N N    . LYS A 1 31  ? 65.506  -8.859  -5.842  1.00 0.00 ? 31  LYS A N    2  
ATOM 5035  C CA   . LYS A 1 31  ? 65.332  -10.304 -6.007  1.00 0.00 ? 31  LYS A CA   2  
ATOM 5036  C C    . LYS A 1 31  ? 63.874  -10.584 -6.339  1.00 0.00 ? 31  LYS A C    2  
ATOM 5037  O O    . LYS A 1 31  ? 62.976  -10.115 -5.638  1.00 0.00 ? 31  LYS A O    2  
ATOM 5038  C CB   . LYS A 1 31  ? 65.720  -11.033 -4.715  1.00 0.00 ? 31  LYS A CB   2  
ATOM 5039  C CG   . LYS A 1 31  ? 65.782  -12.540 -4.974  1.00 0.00 ? 31  LYS A CG   2  
ATOM 5040  C CD   . LYS A 1 31  ? 66.197  -13.262 -3.691  1.00 0.00 ? 31  LYS A CD   2  
ATOM 5041  C CE   . LYS A 1 31  ? 66.300  -14.764 -3.959  1.00 0.00 ? 31  LYS A CE   2  
ATOM 5042  N NZ   . LYS A 1 31  ? 66.461  -15.490 -2.666  1.00 0.00 ? 31  LYS A NZ   2  
ATOM 5043  H H    . LYS A 1 31  ? 65.167  -8.422  -5.033  1.00 0.00 ? 31  LYS A H    2  
ATOM 5044  H HA   . LYS A 1 31  ? 65.956  -10.662 -6.817  1.00 0.00 ? 31  LYS A HA   2  
ATOM 5045  H HB2  . LYS A 1 31  ? 66.686  -10.684 -4.381  1.00 0.00 ? 31  LYS A HB2  2  
ATOM 5046  H HB3  . LYS A 1 31  ? 64.983  -10.833 -3.954  1.00 0.00 ? 31  LYS A HB3  2  
ATOM 5047  H HG2  . LYS A 1 31  ? 64.810  -12.892 -5.288  1.00 0.00 ? 31  LYS A HG2  2  
ATOM 5048  H HG3  . LYS A 1 31  ? 66.506  -12.742 -5.749  1.00 0.00 ? 31  LYS A HG3  2  
ATOM 5049  H HD2  . LYS A 1 31  ? 67.156  -12.887 -3.361  1.00 0.00 ? 31  LYS A HD2  2  
ATOM 5050  H HD3  . LYS A 1 31  ? 65.458  -13.085 -2.923  1.00 0.00 ? 31  LYS A HD3  2  
ATOM 5051  H HE2  . LYS A 1 31  ? 65.401  -15.104 -4.452  1.00 0.00 ? 31  LYS A HE2  2  
ATOM 5052  H HE3  . LYS A 1 31  ? 67.153  -14.960 -4.591  1.00 0.00 ? 31  LYS A HE3  2  
ATOM 5053  H HZ1  . LYS A 1 31  ? 66.476  -14.806 -1.884  1.00 0.00 ? 31  LYS A HZ1  2  
ATOM 5054  H HZ2  . LYS A 1 31  ? 67.354  -16.024 -2.678  1.00 0.00 ? 31  LYS A HZ2  2  
ATOM 5055  H HZ3  . LYS A 1 31  ? 65.666  -16.146 -2.536  1.00 0.00 ? 31  LYS A HZ3  2  
ATOM 5056  N N    . VAL A 1 32  ? 63.637  -11.325 -7.422  1.00 0.00 ? 32  VAL A N    2  
ATOM 5057  C CA   . VAL A 1 32  ? 62.268  -11.634 -7.857  1.00 0.00 ? 32  VAL A CA   2  
ATOM 5058  C C    . VAL A 1 32  ? 62.044  -13.133 -8.005  1.00 0.00 ? 32  VAL A C    2  
ATOM 5059  O O    . VAL A 1 32  ? 62.649  -13.784 -8.856  1.00 0.00 ? 32  VAL A O    2  
ATOM 5060  C CB   . VAL A 1 32  ? 61.973  -10.975 -9.217  1.00 0.00 ? 32  VAL A CB   2  
ATOM 5061  C CG1  . VAL A 1 32  ? 60.482  -11.095 -9.536  1.00 0.00 ? 32  VAL A CG1  2  
ATOM 5062  C CG2  . VAL A 1 32  ? 62.368  -9.497  -9.164  1.00 0.00 ? 32  VAL A CG2  2  
ATOM 5063  H H    . VAL A 1 32  ? 64.394  -11.656 -7.948  1.00 0.00 ? 32  VAL A H    2  
ATOM 5064  H HA   . VAL A 1 32  ? 61.557  -11.254 -7.135  1.00 0.00 ? 32  VAL A HA   2  
ATOM 5065  H HB   . VAL A 1 32  ? 62.543  -11.470 -9.987  1.00 0.00 ? 32  VAL A HB   2  
ATOM 5066  H HG11 . VAL A 1 32  ? 60.277  -10.606 -10.474 1.00 0.00 ? 32  VAL A HG11 2  
ATOM 5067  H HG12 . VAL A 1 32  ? 59.907  -10.626 -8.752  1.00 0.00 ? 32  VAL A HG12 2  
ATOM 5068  H HG13 . VAL A 1 32  ? 60.209  -12.137 -9.606  1.00 0.00 ? 32  VAL A HG13 2  
ATOM 5069  H HG21 . VAL A 1 32  ? 63.444  -9.413  -9.123  1.00 0.00 ? 32  VAL A HG21 2  
ATOM 5070  H HG22 . VAL A 1 32  ? 61.940  -9.043  -8.285  1.00 0.00 ? 32  VAL A HG22 2  
ATOM 5071  H HG23 . VAL A 1 32  ? 62.000  -8.993  -10.045 1.00 0.00 ? 32  VAL A HG23 2  
ATOM 5072  N N    . THR A 1 33  ? 61.130  -13.662 -7.193  1.00 0.00 ? 33  THR A N    2  
ATOM 5073  C CA   . THR A 1 33  ? 60.772  -15.077 -7.253  1.00 0.00 ? 33  THR A CA   2  
ATOM 5074  C C    . THR A 1 33  ? 59.517  -15.221 -8.104  1.00 0.00 ? 33  THR A C    2  
ATOM 5075  O O    . THR A 1 33  ? 58.551  -14.479 -7.922  1.00 0.00 ? 33  THR A O    2  
ATOM 5076  C CB   . THR A 1 33  ? 60.484  -15.642 -5.847  1.00 0.00 ? 33  THR A CB   2  
ATOM 5077  O OG1  . THR A 1 33  ? 61.537  -15.277 -4.966  1.00 0.00 ? 33  THR A OG1  2  
ATOM 5078  C CG2  . THR A 1 33  ? 60.381  -17.168 -5.916  1.00 0.00 ? 33  THR A CG2  2  
ATOM 5079  H H    . THR A 1 33  ? 60.663  -13.081 -6.561  1.00 0.00 ? 33  THR A H    2  
ATOM 5080  H HA   . THR A 1 33  ? 61.575  -15.644 -7.705  1.00 0.00 ? 33  THR A HA   2  
ATOM 5081  H HB   . THR A 1 33  ? 59.552  -15.240 -5.481  1.00 0.00 ? 33  THR A HB   2  
ATOM 5082  H HG1  . THR A 1 33  ? 62.315  -15.087 -5.496  1.00 0.00 ? 33  THR A HG1  2  
ATOM 5083  H HG21 . THR A 1 33  ? 59.576  -17.444 -6.582  1.00 0.00 ? 33  THR A HG21 2  
ATOM 5084  H HG22 . THR A 1 33  ? 60.183  -17.561 -4.930  1.00 0.00 ? 33  THR A HG22 2  
ATOM 5085  H HG23 . THR A 1 33  ? 61.310  -17.576 -6.286  1.00 0.00 ? 33  THR A HG23 2  
ATOM 5086  N N    . LYS A 1 34  ? 59.526  -16.171 -9.032  1.00 0.00 ? 34  LYS A N    2  
ATOM 5087  C CA   . LYS A 1 34  ? 58.367  -16.389 -9.903  1.00 0.00 ? 34  LYS A CA   2  
ATOM 5088  C C    . LYS A 1 34  ? 57.474  -17.480 -9.319  1.00 0.00 ? 34  LYS A C    2  
ATOM 5089  O O    . LYS A 1 34  ? 57.892  -18.239 -8.444  1.00 0.00 ? 34  LYS A O    2  
ATOM 5090  C CB   . LYS A 1 34  ? 58.837  -16.775 -11.320 1.00 0.00 ? 34  LYS A CB   2  
ATOM 5091  C CG   . LYS A 1 34  ? 60.086  -17.668 -11.232 1.00 0.00 ? 34  LYS A CG   2  
ATOM 5092  C CD   . LYS A 1 34  ? 60.322  -18.402 -12.562 1.00 0.00 ? 34  LYS A CD   2  
ATOM 5093  C CE   . LYS A 1 34  ? 60.769  -17.411 -13.645 1.00 0.00 ? 34  LYS A CE   2  
ATOM 5094  N NZ   . LYS A 1 34  ? 61.951  -16.640 -13.164 1.00 0.00 ? 34  LYS A NZ   2  
ATOM 5095  H H    . LYS A 1 34  ? 60.317  -16.741 -9.128  1.00 0.00 ? 34  LYS A H    2  
ATOM 5096  H HA   . LYS A 1 34  ? 57.788  -15.474 -9.969  1.00 0.00 ? 34  LYS A HA   2  
ATOM 5097  H HB2  . LYS A 1 34  ? 58.045  -17.300 -11.836 1.00 0.00 ? 34  LYS A HB2  2  
ATOM 5098  H HB3  . LYS A 1 34  ? 59.082  -15.877 -11.870 1.00 0.00 ? 34  LYS A HB3  2  
ATOM 5099  H HG2  . LYS A 1 34  ? 60.944  -17.053 -11.007 1.00 0.00 ? 34  LYS A HG2  2  
ATOM 5100  H HG3  . LYS A 1 34  ? 59.954  -18.397 -10.444 1.00 0.00 ? 34  LYS A HG3  2  
ATOM 5101  H HD2  . LYS A 1 34  ? 61.092  -19.147 -12.424 1.00 0.00 ? 34  LYS A HD2  2  
ATOM 5102  H HD3  . LYS A 1 34  ? 59.411  -18.887 -12.876 1.00 0.00 ? 34  LYS A HD3  2  
ATOM 5103  H HE2  . LYS A 1 34  ? 61.038  -17.956 -14.538 1.00 0.00 ? 34  LYS A HE2  2  
ATOM 5104  H HE3  . LYS A 1 34  ? 59.962  -16.732 -13.870 1.00 0.00 ? 34  LYS A HE3  2  
ATOM 5105  H HZ1  . LYS A 1 34  ? 62.493  -16.292 -13.981 1.00 0.00 ? 34  LYS A HZ1  2  
ATOM 5106  H HZ2  . LYS A 1 34  ? 62.556  -17.258 -12.585 1.00 0.00 ? 34  LYS A HZ2  2  
ATOM 5107  H HZ3  . LYS A 1 34  ? 61.632  -15.832 -12.594 1.00 0.00 ? 34  LYS A HZ3  2  
ATOM 5108  N N    . GLN A 1 35  ? 56.245  -17.552 -9.813  1.00 0.00 ? 35  GLN A N    2  
ATOM 5109  C CA   . GLN A 1 35  ? 55.298  -18.554 -9.342  1.00 0.00 ? 35  GLN A CA   2  
ATOM 5110  C C    . GLN A 1 35  ? 55.741  -19.946 -9.784  1.00 0.00 ? 35  GLN A C    2  
ATOM 5111  O O    . GLN A 1 35  ? 56.492  -20.091 -10.749 1.00 0.00 ? 35  GLN A O    2  
ATOM 5112  C CB   . GLN A 1 35  ? 53.900  -18.254 -9.896  1.00 0.00 ? 35  GLN A CB   2  
ATOM 5113  C CG   . GLN A 1 35  ? 52.857  -19.115 -9.174  1.00 0.00 ? 35  GLN A CG   2  
ATOM 5114  C CD   . GLN A 1 35  ? 51.454  -18.688 -9.611  1.00 0.00 ? 35  GLN A CD   2  
ATOM 5115  O OE1  . GLN A 1 35  ? 51.303  -17.893 -10.517 1.00 0.00 ? 35  GLN A OE1  2  
ATOM 5116  N NE2  . GLN A 1 35  ? 50.415  -19.187 -9.000  1.00 0.00 ? 35  GLN A NE2  2  
ATOM 5117  H H    . GLN A 1 35  ? 55.975  -16.926 -10.516 1.00 0.00 ? 35  GLN A H    2  
ATOM 5118  H HA   . GLN A 1 35  ? 55.264  -18.523 -8.264  1.00 0.00 ? 35  GLN A HA   2  
ATOM 5119  H HB2  . GLN A 1 35  ? 53.671  -17.209 -9.742  1.00 0.00 ? 35  GLN A HB2  2  
ATOM 5120  H HB3  . GLN A 1 35  ? 53.877  -18.476 -10.951 1.00 0.00 ? 35  GLN A HB3  2  
ATOM 5121  H HG2  . GLN A 1 35  ? 53.011  -20.154 -9.425  1.00 0.00 ? 35  GLN A HG2  2  
ATOM 5122  H HG3  . GLN A 1 35  ? 52.954  -18.982 -8.107  1.00 0.00 ? 35  GLN A HG3  2  
ATOM 5123  H HE21 . GLN A 1 35  ? 50.537  -19.829 -8.269  1.00 0.00 ? 35  GLN A HE21 2  
ATOM 5124  H HE22 . GLN A 1 35  ? 49.512  -18.921 -9.272  1.00 0.00 ? 35  GLN A HE22 2  
ATOM 5125  N N    . ASP A 1 36  ? 55.280  -20.966 -9.070  1.00 0.00 ? 36  ASP A N    2  
ATOM 5126  C CA   . ASP A 1 36  ? 55.643  -22.341 -9.394  1.00 0.00 ? 36  ASP A CA   2  
ATOM 5127  C C    . ASP A 1 36  ? 55.094  -22.745 -10.761 1.00 0.00 ? 36  ASP A C    2  
ATOM 5128  O O    . ASP A 1 36  ? 55.606  -23.669 -11.394 1.00 0.00 ? 36  ASP A O    2  
ATOM 5129  C CB   . ASP A 1 36  ? 55.099  -23.289 -8.323  1.00 0.00 ? 36  ASP A CB   2  
ATOM 5130  C CG   . ASP A 1 36  ? 53.571  -23.225 -8.312  1.00 0.00 ? 36  ASP A CG   2  
ATOM 5131  O OD1  . ASP A 1 36  ? 53.041  -22.244 -7.816  1.00 0.00 ? 36  ASP A OD1  2  
ATOM 5132  O OD2  . ASP A 1 36  ? 52.954  -24.158 -8.800  1.00 0.00 ? 36  ASP A OD2  2  
ATOM 5133  H H    . ASP A 1 36  ? 54.688  -20.791 -8.307  1.00 0.00 ? 36  ASP A H    2  
ATOM 5134  H HA   . ASP A 1 36  ? 56.719  -22.421 -9.413  1.00 0.00 ? 36  ASP A HA   2  
ATOM 5135  H HB2  . ASP A 1 36  ? 55.417  -24.298 -8.542  1.00 0.00 ? 36  ASP A HB2  2  
ATOM 5136  H HB3  . ASP A 1 36  ? 55.476  -22.994 -7.356  1.00 0.00 ? 36  ASP A HB3  2  
ATOM 5137  N N    . GLN A 1 37  ? 54.048  -22.055 -11.210 1.00 0.00 ? 37  GLN A N    2  
ATOM 5138  C CA   . GLN A 1 37  ? 53.433  -22.355 -12.504 1.00 0.00 ? 37  GLN A CA   2  
ATOM 5139  C C    . GLN A 1 37  ? 54.193  -21.677 -13.641 1.00 0.00 ? 37  GLN A C    2  
ATOM 5140  O O    . GLN A 1 37  ? 54.297  -22.219 -14.741 1.00 0.00 ? 37  GLN A O    2  
ATOM 5141  C CB   . GLN A 1 37  ? 51.979  -21.876 -12.509 1.00 0.00 ? 37  GLN A CB   2  
ATOM 5142  C CG   . GLN A 1 37  ? 51.224  -22.513 -11.339 1.00 0.00 ? 37  GLN A CG   2  
ATOM 5143  C CD   . GLN A 1 37  ? 51.115  -24.022 -11.564 1.00 0.00 ? 37  GLN A CD   2  
ATOM 5144  O OE1  . GLN A 1 37  ? 51.792  -24.795 -10.915 1.00 0.00 ? 37  GLN A OE1  2  
ATOM 5145  N NE2  . GLN A 1 37  ? 50.285  -24.478 -12.461 1.00 0.00 ? 37  GLN A NE2  2  
ATOM 5146  H H    . GLN A 1 37  ? 53.680  -21.331 -10.659 1.00 0.00 ? 37  GLN A H    2  
ATOM 5147  H HA   . GLN A 1 37  ? 53.444  -23.424 -12.664 1.00 0.00 ? 37  GLN A HA   2  
ATOM 5148  H HB2  . GLN A 1 37  ? 51.955  -20.799 -12.409 1.00 0.00 ? 37  GLN A HB2  2  
ATOM 5149  H HB3  . GLN A 1 37  ? 51.509  -22.162 -13.437 1.00 0.00 ? 37  GLN A HB3  2  
ATOM 5150  H HG2  . GLN A 1 37  ? 51.756  -22.322 -10.420 1.00 0.00 ? 37  GLN A HG2  2  
ATOM 5151  H HG3  . GLN A 1 37  ? 50.233  -22.088 -11.278 1.00 0.00 ? 37  GLN A HG3  2  
ATOM 5152  H HE21 . GLN A 1 37  ? 49.738  -23.855 -12.984 1.00 0.00 ? 37  GLN A HE21 2  
ATOM 5153  H HE22 . GLN A 1 37  ? 50.207  -25.443 -12.611 1.00 0.00 ? 37  GLN A HE22 2  
ATOM 5154  N N    . THR A 1 38  ? 54.718  -20.486 -13.368 1.00 0.00 ? 38  THR A N    2  
ATOM 5155  C CA   . THR A 1 38  ? 55.465  -19.730 -14.371 1.00 0.00 ? 38  THR A CA   2  
ATOM 5156  C C    . THR A 1 38  ? 56.458  -20.635 -15.123 1.00 0.00 ? 38  THR A C    2  
ATOM 5157  O O    . THR A 1 38  ? 57.447  -21.075 -14.535 1.00 0.00 ? 38  THR A O    2  
ATOM 5158  C CB   . THR A 1 38  ? 56.269  -18.603 -13.702 1.00 0.00 ? 38  THR A CB   2  
ATOM 5159  O OG1  . THR A 1 38  ? 55.391  -17.776 -12.951 1.00 0.00 ? 38  THR A OG1  2  
ATOM 5160  C CG2  . THR A 1 38  ? 56.973  -17.767 -14.773 1.00 0.00 ? 38  THR A CG2  2  
ATOM 5161  H H    . THR A 1 38  ? 54.598  -20.104 -12.473 1.00 0.00 ? 38  THR A H    2  
ATOM 5162  H HA   . THR A 1 38  ? 54.768  -19.287 -15.060 1.00 0.00 ? 38  THR A HA   2  
ATOM 5163  H HB   . THR A 1 38  ? 57.008  -19.034 -13.045 1.00 0.00 ? 38  THR A HB   2  
ATOM 5164  H HG1  . THR A 1 38  ? 55.347  -18.122 -12.058 1.00 0.00 ? 38  THR A HG1  2  
ATOM 5165  H HG21 . THR A 1 38  ? 56.264  -17.499 -15.544 1.00 0.00 ? 38  THR A HG21 2  
ATOM 5166  H HG22 . THR A 1 38  ? 57.776  -18.342 -15.208 1.00 0.00 ? 38  THR A HG22 2  
ATOM 5167  H HG23 . THR A 1 38  ? 57.373  -16.870 -14.325 1.00 0.00 ? 38  THR A HG23 2  
ATOM 5168  N N    . PRO A 1 39  ? 56.235  -20.927 -16.428 1.00 0.00 ? 39  PRO A N    2  
ATOM 5169  C CA   . PRO A 1 39  ? 57.157  -21.779 -17.200 1.00 0.00 ? 39  PRO A CA   2  
ATOM 5170  C C    . PRO A 1 39  ? 58.622  -21.435 -16.924 1.00 0.00 ? 39  PRO A C    2  
ATOM 5171  O O    . PRO A 1 39  ? 58.935  -20.341 -16.452 1.00 0.00 ? 39  PRO A O    2  
ATOM 5172  C CB   . PRO A 1 39  ? 56.773  -21.492 -18.658 1.00 0.00 ? 39  PRO A CB   2  
ATOM 5173  C CG   . PRO A 1 39  ? 55.310  -21.193 -18.597 1.00 0.00 ? 39  PRO A CG   2  
ATOM 5174  C CD   . PRO A 1 39  ? 55.096  -20.474 -17.257 1.00 0.00 ? 39  PRO A CD   2  
ATOM 5175  H HA   . PRO A 1 39  ? 56.973  -22.818 -16.977 1.00 0.00 ? 39  PRO A HA   2  
ATOM 5176  H HB2  . PRO A 1 39  ? 57.323  -20.634 -19.031 1.00 0.00 ? 39  PRO A HB2  2  
ATOM 5177  H HB3  . PRO A 1 39  ? 56.955  -22.357 -19.280 1.00 0.00 ? 39  PRO A HB3  2  
ATOM 5178  H HG2  . PRO A 1 39  ? 55.021  -20.556 -19.426 1.00 0.00 ? 39  PRO A HG2  2  
ATOM 5179  H HG3  . PRO A 1 39  ? 54.738  -22.111 -18.615 1.00 0.00 ? 39  PRO A HG3  2  
ATOM 5180  H HD2  . PRO A 1 39  ? 55.129  -19.399 -17.394 1.00 0.00 ? 39  PRO A HD2  2  
ATOM 5181  H HD3  . PRO A 1 39  ? 54.162  -20.771 -16.803 1.00 0.00 ? 39  PRO A HD3  2  
ATOM 5182  N N    . THR A 1 40  ? 59.513  -22.377 -17.217 1.00 0.00 ? 40  THR A N    2  
ATOM 5183  C CA   . THR A 1 40  ? 60.939  -22.164 -16.991 1.00 0.00 ? 40  THR A CA   2  
ATOM 5184  C C    . THR A 1 40  ? 61.496  -21.139 -17.974 1.00 0.00 ? 40  THR A C    2  
ATOM 5185  O O    . THR A 1 40  ? 61.168  -21.158 -19.161 1.00 0.00 ? 40  THR A O    2  
ATOM 5186  C CB   . THR A 1 40  ? 61.724  -23.478 -17.154 1.00 0.00 ? 40  THR A CB   2  
ATOM 5187  O OG1  . THR A 1 40  ? 61.522  -23.989 -18.463 1.00 0.00 ? 40  THR A OG1  2  
ATOM 5188  C CG2  . THR A 1 40  ? 61.235  -24.498 -16.124 1.00 0.00 ? 40  THR A CG2  2  
ATOM 5189  H H    . THR A 1 40  ? 59.206  -23.231 -17.587 1.00 0.00 ? 40  THR A H    2  
ATOM 5190  H HA   . THR A 1 40  ? 61.081  -21.797 -15.986 1.00 0.00 ? 40  THR A HA   2  
ATOM 5191  H HB   . THR A 1 40  ? 62.775  -23.291 -16.998 1.00 0.00 ? 40  THR A HB   2  
ATOM 5192  H HG1  . THR A 1 40  ? 61.049  -23.326 -18.971 1.00 0.00 ? 40  THR A HG1  2  
ATOM 5193  H HG21 . THR A 1 40  ? 61.653  -25.468 -16.351 1.00 0.00 ? 40  THR A HG21 2  
ATOM 5194  H HG22 . THR A 1 40  ? 60.157  -24.555 -16.158 1.00 0.00 ? 40  THR A HG22 2  
ATOM 5195  H HG23 . THR A 1 40  ? 61.548  -24.192 -15.138 1.00 0.00 ? 40  THR A HG23 2  
ATOM 5196  N N    . ASN A 1 41  ? 62.345  -20.245 -17.469 1.00 0.00 ? 41  ASN A N    2  
ATOM 5197  C CA   . ASN A 1 41  ? 62.957  -19.209 -18.301 1.00 0.00 ? 41  ASN A CA   2  
ATOM 5198  C C    . ASN A 1 41  ? 64.242  -18.705 -17.653 1.00 0.00 ? 41  ASN A C    2  
ATOM 5199  O O    . ASN A 1 41  ? 64.204  -17.926 -16.701 1.00 0.00 ? 41  ASN A O    2  
ATOM 5200  C CB   . ASN A 1 41  ? 61.985  -18.040 -18.481 1.00 0.00 ? 41  ASN A CB   2  
ATOM 5201  C CG   . ASN A 1 41  ? 60.654  -18.558 -19.031 1.00 0.00 ? 41  ASN A CG   2  
ATOM 5202  O OD1  . ASN A 1 41  ? 60.590  -19.044 -20.142 1.00 0.00 ? 41  ASN A OD1  2  
ATOM 5203  N ND2  . ASN A 1 41  ? 59.581  -18.475 -18.292 1.00 0.00 ? 41  ASN A ND2  2  
ATOM 5204  H H    . ASN A 1 41  ? 62.568  -20.285 -16.515 1.00 0.00 ? 41  ASN A H    2  
ATOM 5205  H HA   . ASN A 1 41  ? 63.192  -19.623 -19.271 1.00 0.00 ? 41  ASN A HA   2  
ATOM 5206  H HB2  . ASN A 1 41  ? 61.818  -17.561 -17.527 1.00 0.00 ? 41  ASN A HB2  2  
ATOM 5207  H HB3  . ASN A 1 41  ? 62.403  -17.327 -19.174 1.00 0.00 ? 41  ASN A HB3  2  
ATOM 5208  H HD21 . ASN A 1 41  ? 59.632  -18.083 -17.395 1.00 0.00 ? 41  ASN A HD21 2  
ATOM 5209  H HD22 . ASN A 1 41  ? 58.723  -18.803 -18.635 1.00 0.00 ? 41  ASN A HD22 2  
ATOM 5210  N N    . ASP A 1 42  ? 65.384  -19.157 -18.174 1.00 0.00 ? 42  ASP A N    2  
ATOM 5211  C CA   . ASP A 1 42  ? 66.691  -18.754 -17.643 1.00 0.00 ? 42  ASP A CA   2  
ATOM 5212  C C    . ASP A 1 42  ? 67.328  -17.687 -18.527 1.00 0.00 ? 42  ASP A C    2  
ATOM 5213  O O    . ASP A 1 42  ? 68.307  -17.052 -18.137 1.00 0.00 ? 42  ASP A O    2  
ATOM 5214  C CB   . ASP A 1 42  ? 67.616  -19.972 -17.575 1.00 0.00 ? 42  ASP A CB   2  
ATOM 5215  C CG   . ASP A 1 42  ? 68.896  -19.602 -16.824 1.00 0.00 ? 42  ASP A CG   2  
ATOM 5216  O OD1  . ASP A 1 42  ? 69.783  -19.042 -17.446 1.00 0.00 ? 42  ASP A OD1  2  
ATOM 5217  O OD2  . ASP A 1 42  ? 68.967  -19.886 -15.640 1.00 0.00 ? 42  ASP A OD2  2  
ATOM 5218  H H    . ASP A 1 42  ? 65.349  -19.778 -18.933 1.00 0.00 ? 42  ASP A H    2  
ATOM 5219  H HA   . ASP A 1 42  ? 66.572  -18.356 -16.643 1.00 0.00 ? 42  ASP A HA   2  
ATOM 5220  H HB2  . ASP A 1 42  ? 67.113  -20.777 -17.058 1.00 0.00 ? 42  ASP A HB2  2  
ATOM 5221  H HB3  . ASP A 1 42  ? 67.867  -20.289 -18.576 1.00 0.00 ? 42  ASP A HB3  2  
ATOM 5222  N N    . LYS A 1 43  ? 66.770  -17.497 -19.719 1.00 0.00 ? 43  LYS A N    2  
ATOM 5223  C CA   . LYS A 1 43  ? 67.298  -16.504 -20.647 1.00 0.00 ? 43  LYS A CA   2  
ATOM 5224  C C    . LYS A 1 43  ? 67.284  -15.119 -20.013 1.00 0.00 ? 43  LYS A C    2  
ATOM 5225  O O    . LYS A 1 43  ? 66.377  -14.322 -20.252 1.00 0.00 ? 43  LYS A O    2  
ATOM 5226  C CB   . LYS A 1 43  ? 66.468  -16.494 -21.933 1.00 0.00 ? 43  LYS A CB   2  
ATOM 5227  C CG   . LYS A 1 43  ? 66.277  -17.930 -22.433 1.00 0.00 ? 43  LYS A CG   2  
ATOM 5228  C CD   . LYS A 1 43  ? 65.729  -17.910 -23.862 1.00 0.00 ? 43  LYS A CD   2  
ATOM 5229  C CE   . LYS A 1 43  ? 65.525  -19.346 -24.351 1.00 0.00 ? 43  LYS A CE   2  
ATOM 5230  N NZ   . LYS A 1 43  ? 66.845  -20.031 -24.443 1.00 0.00 ? 43  LYS A NZ   2  
ATOM 5231  H H    . LYS A 1 43  ? 65.992  -18.034 -19.978 1.00 0.00 ? 43  LYS A H    2  
ATOM 5232  H HA   . LYS A 1 43  ? 68.316  -16.765 -20.894 1.00 0.00 ? 43  LYS A HA   2  
ATOM 5233  H HB2  . LYS A 1 43  ? 65.503  -16.050 -21.733 1.00 0.00 ? 43  LYS A HB2  2  
ATOM 5234  H HB3  . LYS A 1 43  ? 66.981  -15.915 -22.686 1.00 0.00 ? 43  LYS A HB3  2  
ATOM 5235  H HG2  . LYS A 1 43  ? 67.227  -18.446 -22.421 1.00 0.00 ? 43  LYS A HG2  2  
ATOM 5236  H HG3  . LYS A 1 43  ? 65.580  -18.445 -21.790 1.00 0.00 ? 43  LYS A HG3  2  
ATOM 5237  H HD2  . LYS A 1 43  ? 64.785  -17.386 -23.876 1.00 0.00 ? 43  LYS A HD2  2  
ATOM 5238  H HD3  . LYS A 1 43  ? 66.431  -17.408 -24.510 1.00 0.00 ? 43  LYS A HD3  2  
ATOM 5239  H HE2  . LYS A 1 43  ? 64.892  -19.876 -23.655 1.00 0.00 ? 43  LYS A HE2  2  
ATOM 5240  H HE3  . LYS A 1 43  ? 65.057  -19.331 -25.324 1.00 0.00 ? 43  LYS A HE3  2  
ATOM 5241  H HZ1  . LYS A 1 43  ? 67.418  -19.581 -25.184 1.00 0.00 ? 43  LYS A HZ1  2  
ATOM 5242  H HZ2  . LYS A 1 43  ? 66.699  -21.034 -24.679 1.00 0.00 ? 43  LYS A HZ2  2  
ATOM 5243  H HZ3  . LYS A 1 43  ? 67.339  -19.956 -23.532 1.00 0.00 ? 43  LYS A HZ3  2  
ATOM 5244  N N    . ILE A 1 44  ? 68.300  -14.842 -19.198 1.00 0.00 ? 44  ILE A N    2  
ATOM 5245  C CA   . ILE A 1 44  ? 68.413  -13.552 -18.519 1.00 0.00 ? 44  ILE A CA   2  
ATOM 5246  C C    . ILE A 1 44  ? 69.130  -12.545 -19.425 1.00 0.00 ? 44  ILE A C    2  
ATOM 5247  O O    . ILE A 1 44  ? 69.869  -12.937 -20.328 1.00 0.00 ? 44  ILE A O    2  
ATOM 5248  C CB   . ILE A 1 44  ? 69.187  -13.726 -17.180 1.00 0.00 ? 44  ILE A CB   2  
ATOM 5249  C CG1  . ILE A 1 44  ? 68.898  -12.537 -16.227 1.00 0.00 ? 44  ILE A CG1  2  
ATOM 5250  C CG2  . ILE A 1 44  ? 70.700  -13.826 -17.451 1.00 0.00 ? 44  ILE A CG2  2  
ATOM 5251  C CD1  . ILE A 1 44  ? 67.607  -12.782 -15.428 1.00 0.00 ? 44  ILE A CD1  2  
ATOM 5252  H H    . ILE A 1 44  ? 68.991  -15.520 -19.049 1.00 0.00 ? 44  ILE A H    2  
ATOM 5253  H HA   . ILE A 1 44  ? 67.423  -13.178 -18.304 1.00 0.00 ? 44  ILE A HA   2  
ATOM 5254  H HB   . ILE A 1 44  ? 68.865  -14.650 -16.715 1.00 0.00 ? 44  ILE A HB   2  
ATOM 5255  H HG12 . ILE A 1 44  ? 69.718  -12.422 -15.531 1.00 0.00 ? 44  ILE A HG12 2  
ATOM 5256  H HG13 . ILE A 1 44  ? 68.789  -11.630 -16.801 1.00 0.00 ? 44  ILE A HG13 2  
ATOM 5257  H HG21 . ILE A 1 44  ? 71.091  -12.844 -17.676 1.00 0.00 ? 44  ILE A HG21 2  
ATOM 5258  H HG22 . ILE A 1 44  ? 70.874  -14.483 -18.291 1.00 0.00 ? 44  ILE A HG22 2  
ATOM 5259  H HG23 . ILE A 1 44  ? 71.197  -14.221 -16.578 1.00 0.00 ? 44  ILE A HG23 2  
ATOM 5260  H HD11 . ILE A 1 44  ? 67.475  -11.985 -14.710 1.00 0.00 ? 44  ILE A HD11 2  
ATOM 5261  H HD12 . ILE A 1 44  ? 67.676  -13.724 -14.907 1.00 0.00 ? 44  ILE A HD12 2  
ATOM 5262  H HD13 . ILE A 1 44  ? 66.762  -12.803 -16.098 1.00 0.00 ? 44  ILE A HD13 2  
ATOM 5263  N N    . CYS A 1 45  ? 68.892  -11.258 -19.190 1.00 0.00 ? 45  CYS A N    2  
ATOM 5264  C CA   . CYS A 1 45  ? 69.508  -10.213 -19.999 1.00 0.00 ? 45  CYS A CA   2  
ATOM 5265  C C    . CYS A 1 45  ? 69.157  -10.416 -21.473 1.00 0.00 ? 45  CYS A C    2  
ATOM 5266  O O    . CYS A 1 45  ? 70.025  -10.635 -22.317 1.00 0.00 ? 45  CYS A O    2  
ATOM 5267  C CB   . CYS A 1 45  ? 71.028  -10.214 -19.802 1.00 0.00 ? 45  CYS A CB   2  
ATOM 5268  S SG   . CYS A 1 45  ? 71.806  -9.148  -21.038 1.00 0.00 ? 45  CYS A SG   2  
ATOM 5269  H H    . CYS A 1 45  ? 68.278  -11.005 -18.471 1.00 0.00 ? 45  CYS A H    2  
ATOM 5270  H HA   . CYS A 1 45  ? 69.118  -9.256  -19.682 1.00 0.00 ? 45  CYS A HA   2  
ATOM 5271  H HB2  . CYS A 1 45  ? 71.260  -9.845  -18.814 1.00 0.00 ? 45  CYS A HB2  2  
ATOM 5272  H HB3  . CYS A 1 45  ? 71.407  -11.217 -19.905 1.00 0.00 ? 45  CYS A HB3  2  
ATOM 5273  N N    . GLN A 1 46  ? 67.868  -10.352 -21.776 1.00 0.00 ? 46  GLN A N    2  
ATOM 5274  C CA   . GLN A 1 46  ? 67.405  -10.526 -23.149 1.00 0.00 ? 46  GLN A CA   2  
ATOM 5275  C C    . GLN A 1 46  ? 67.587  -9.228  -23.936 1.00 0.00 ? 46  GLN A C    2  
ATOM 5276  O O    . GLN A 1 46  ? 67.799  -9.254  -25.147 1.00 0.00 ? 46  GLN A O    2  
ATOM 5277  C CB   . GLN A 1 46  ? 65.930  -10.947 -23.147 1.00 0.00 ? 46  GLN A CB   2  
ATOM 5278  C CG   . GLN A 1 46  ? 65.525  -11.481 -24.528 1.00 0.00 ? 46  GLN A CG   2  
ATOM 5279  C CD   . GLN A 1 46  ? 64.169  -12.183 -24.424 1.00 0.00 ? 46  GLN A CD   2  
ATOM 5280  O OE1  . GLN A 1 46  ? 63.803  -12.954 -25.287 1.00 0.00 ? 46  GLN A OE1  2  
ATOM 5281  N NE2  . GLN A 1 46  ? 63.409  -11.953 -23.389 1.00 0.00 ? 46  GLN A NE2  2  
ATOM 5282  H H    . GLN A 1 46  ? 67.216  -10.184 -21.065 1.00 0.00 ? 46  GLN A H    2  
ATOM 5283  H HA   . GLN A 1 46  ? 67.991  -11.302 -23.619 1.00 0.00 ? 46  GLN A HA   2  
ATOM 5284  H HB2  . GLN A 1 46  ? 65.783  -11.719 -22.405 1.00 0.00 ? 46  GLN A HB2  2  
ATOM 5285  H HB3  . GLN A 1 46  ? 65.316  -10.095 -22.901 1.00 0.00 ? 46  GLN A HB3  2  
ATOM 5286  H HG2  . GLN A 1 46  ? 65.452  -10.660 -25.225 1.00 0.00 ? 46  GLN A HG2  2  
ATOM 5287  H HG3  . GLN A 1 46  ? 66.262  -12.187 -24.879 1.00 0.00 ? 46  GLN A HG3  2  
ATOM 5288  H HE21 . GLN A 1 46  ? 63.710  -11.337 -22.689 1.00 0.00 ? 46  GLN A HE21 2  
ATOM 5289  H HE22 . GLN A 1 46  ? 62.537  -12.394 -23.312 1.00 0.00 ? 46  GLN A HE22 2  
ATOM 5290  N N    . SER A 1 47  ? 67.503  -8.096  -23.234 1.00 0.00 ? 47  SER A N    2  
ATOM 5291  C CA   . SER A 1 47  ? 67.660  -6.790  -23.875 1.00 0.00 ? 47  SER A CA   2  
ATOM 5292  C C    . SER A 1 47  ? 67.729  -5.674  -22.829 1.00 0.00 ? 47  SER A C    2  
ATOM 5293  O O    . SER A 1 47  ? 67.410  -5.883  -21.659 1.00 0.00 ? 47  SER A O    2  
ATOM 5294  C CB   . SER A 1 47  ? 66.486  -6.529  -24.825 1.00 0.00 ? 47  SER A CB   2  
ATOM 5295  O OG   . SER A 1 47  ? 66.612  -7.362  -25.971 1.00 0.00 ? 47  SER A OG   2  
ATOM 5296  H H    . SER A 1 47  ? 67.337  -8.142  -22.270 1.00 0.00 ? 47  SER A H    2  
ATOM 5297  H HA   . SER A 1 47  ? 68.575  -6.789  -24.447 1.00 0.00 ? 47  SER A HA   2  
ATOM 5298  H HB2  . SER A 1 47  ? 65.560  -6.754  -24.325 1.00 0.00 ? 47  SER A HB2  2  
ATOM 5299  H HB3  . SER A 1 47  ? 66.487  -5.488  -25.126 1.00 0.00 ? 47  SER A HB3  2  
ATOM 5300  H HG   . SER A 1 47  ? 65.862  -7.960  -25.986 1.00 0.00 ? 47  SER A HG   2  
ATOM 5301  N N    . VAL A 1 48  ? 68.143  -4.483  -23.271 1.00 0.00 ? 48  VAL A N    2  
ATOM 5302  C CA   . VAL A 1 48  ? 68.254  -3.316  -22.389 1.00 0.00 ? 48  VAL A CA   2  
ATOM 5303  C C    . VAL A 1 48  ? 67.979  -2.038  -23.182 1.00 0.00 ? 48  VAL A C    2  
ATOM 5304  O O    . VAL A 1 48  ? 68.814  -1.606  -23.977 1.00 0.00 ? 48  VAL A O    2  
ATOM 5305  C CB   . VAL A 1 48  ? 69.671  -3.216  -21.780 1.00 0.00 ? 48  VAL A CB   2  
ATOM 5306  C CG1  . VAL A 1 48  ? 69.668  -2.213  -20.625 1.00 0.00 ? 48  VAL A CG1  2  
ATOM 5307  C CG2  . VAL A 1 48  ? 70.098  -4.588  -21.258 1.00 0.00 ? 48  VAL A CG2  2  
ATOM 5308  H H    . VAL A 1 48  ? 68.377  -4.385  -24.218 1.00 0.00 ? 48  VAL A H    2  
ATOM 5309  H HA   . VAL A 1 48  ? 67.529  -3.397  -21.590 1.00 0.00 ? 48  VAL A HA   2  
ATOM 5310  H HB   . VAL A 1 48  ? 70.369  -2.887  -22.538 1.00 0.00 ? 48  VAL A HB   2  
ATOM 5311  H HG11 . VAL A 1 48  ? 70.651  -2.174  -20.179 1.00 0.00 ? 48  VAL A HG11 2  
ATOM 5312  H HG12 . VAL A 1 48  ? 68.948  -2.520  -19.882 1.00 0.00 ? 48  VAL A HG12 2  
ATOM 5313  H HG13 . VAL A 1 48  ? 69.404  -1.234  -20.999 1.00 0.00 ? 48  VAL A HG13 2  
ATOM 5314  H HG21 . VAL A 1 48  ? 70.233  -5.263  -22.090 1.00 0.00 ? 48  VAL A HG21 2  
ATOM 5315  H HG22 . VAL A 1 48  ? 69.337  -4.975  -20.600 1.00 0.00 ? 48  VAL A HG22 2  
ATOM 5316  H HG23 . VAL A 1 48  ? 71.028  -4.494  -20.717 1.00 0.00 ? 48  VAL A HG23 2  
ATOM 5317  N N    . THR A 1 49  ? 66.802  -1.443  -22.972 1.00 0.00 ? 49  THR A N    2  
ATOM 5318  C CA   . THR A 1 49  ? 66.418  -0.217  -23.689 1.00 0.00 ? 49  THR A CA   2  
ATOM 5319  C C    . THR A 1 49  ? 66.473  1.002   -22.771 1.00 0.00 ? 49  THR A C    2  
ATOM 5320  O O    . THR A 1 49  ? 65.670  1.134   -21.848 1.00 0.00 ? 49  THR A O    2  
ATOM 5321  C CB   . THR A 1 49  ? 64.985  -0.339  -24.245 1.00 0.00 ? 49  THR A CB   2  
ATOM 5322  O OG1  . THR A 1 49  ? 64.850  -1.578  -24.928 1.00 0.00 ? 49  THR A OG1  2  
ATOM 5323  C CG2  . THR A 1 49  ? 64.707  0.811   -25.216 1.00 0.00 ? 49  THR A CG2  2  
ATOM 5324  H H    . THR A 1 49  ? 66.173  -1.839  -22.333 1.00 0.00 ? 49  THR A H    2  
ATOM 5325  H HA   . THR A 1 49  ? 67.094  -0.053  -24.520 1.00 0.00 ? 49  THR A HA   2  
ATOM 5326  H HB   . THR A 1 49  ? 64.277  -0.297  -23.432 1.00 0.00 ? 49  THR A HB   2  
ATOM 5327  H HG1  . THR A 1 49  ? 64.588  -1.392  -25.832 1.00 0.00 ? 49  THR A HG1  2  
ATOM 5328  H HG21 . THR A 1 49  ? 64.834  1.754   -24.704 1.00 0.00 ? 49  THR A HG21 2  
ATOM 5329  H HG22 . THR A 1 49  ? 63.694  0.735   -25.583 1.00 0.00 ? 49  THR A HG22 2  
ATOM 5330  H HG23 . THR A 1 49  ? 65.396  0.756   -26.046 1.00 0.00 ? 49  THR A HG23 2  
ATOM 5331  N N    . GLU A 1 50  ? 67.421  1.899   -23.045 1.00 0.00 ? 50  GLU A N    2  
ATOM 5332  C CA   . GLU A 1 50  ? 67.578  3.121   -22.255 1.00 0.00 ? 50  GLU A CA   2  
ATOM 5333  C C    . GLU A 1 50  ? 66.716  4.241   -22.835 1.00 0.00 ? 50  GLU A C    2  
ATOM 5334  O O    . GLU A 1 50  ? 66.635  4.409   -24.051 1.00 0.00 ? 50  GLU A O    2  
ATOM 5335  C CB   . GLU A 1 50  ? 69.060  3.546   -22.224 1.00 0.00 ? 50  GLU A CB   2  
ATOM 5336  C CG   . GLU A 1 50  ? 69.496  4.155   -23.569 1.00 0.00 ? 50  GLU A CG   2  
ATOM 5337  C CD   . GLU A 1 50  ? 69.100  3.231   -24.721 1.00 0.00 ? 50  GLU A CD   2  
ATOM 5338  O OE1  . GLU A 1 50  ? 69.568  2.104   -24.739 1.00 0.00 ? 50  GLU A OE1  2  
ATOM 5339  O OE2  . GLU A 1 50  ? 68.337  3.665   -25.569 1.00 0.00 ? 50  GLU A OE2  2  
ATOM 5340  H H    . GLU A 1 50  ? 68.022  1.737   -23.800 1.00 0.00 ? 50  GLU A H    2  
ATOM 5341  H HA   . GLU A 1 50  ? 67.255  2.931   -21.239 1.00 0.00 ? 50  GLU A HA   2  
ATOM 5342  H HB2  . GLU A 1 50  ? 69.202  4.277   -21.442 1.00 0.00 ? 50  GLU A HB2  2  
ATOM 5343  H HB3  . GLU A 1 50  ? 69.671  2.680   -22.014 1.00 0.00 ? 50  GLU A HB3  2  
ATOM 5344  H HG2  . GLU A 1 50  ? 69.026  5.118   -23.701 1.00 0.00 ? 50  GLU A HG2  2  
ATOM 5345  H HG3  . GLU A 1 50  ? 70.569  4.282   -23.569 1.00 0.00 ? 50  GLU A HG3  2  
ATOM 5346  N N    . ILE A 1 51  ? 66.074  5.004   -21.953 1.00 0.00 ? 51  ILE A N    2  
ATOM 5347  C CA   . ILE A 1 51  ? 65.214  6.115   -22.370 1.00 0.00 ? 51  ILE A CA   2  
ATOM 5348  C C    . ILE A 1 51  ? 65.414  7.290   -21.419 1.00 0.00 ? 51  ILE A C    2  
ATOM 5349  O O    . ILE A 1 51  ? 65.749  7.098   -20.251 1.00 0.00 ? 51  ILE A O    2  
ATOM 5350  C CB   . ILE A 1 51  ? 63.730  5.685   -22.353 1.00 0.00 ? 51  ILE A CB   2  
ATOM 5351  C CG1  . ILE A 1 51  ? 63.610  4.302   -23.012 1.00 0.00 ? 51  ILE A CG1  2  
ATOM 5352  C CG2  . ILE A 1 51  ? 62.878  6.700   -23.125 1.00 0.00 ? 51  ILE A CG2  2  
ATOM 5353  C CD1  . ILE A 1 51  ? 62.134  3.889   -23.122 1.00 0.00 ? 51  ILE A CD1  2  
ATOM 5354  H H    . ILE A 1 51  ? 66.181  4.818   -20.997 1.00 0.00 ? 51  ILE A H    2  
ATOM 5355  H HA   . ILE A 1 51  ? 65.482  6.428   -23.371 1.00 0.00 ? 51  ILE A HA   2  
ATOM 5356  H HB   . ILE A 1 51  ? 63.381  5.627   -21.332 1.00 0.00 ? 51  ILE A HB   2  
ATOM 5357  H HG12 . ILE A 1 51  ? 64.046  4.339   -24.000 1.00 0.00 ? 51  ILE A HG12 2  
ATOM 5358  H HG13 . ILE A 1 51  ? 64.140  3.576   -22.414 1.00 0.00 ? 51  ILE A HG13 2  
ATOM 5359  H HG21 . ILE A 1 51  ? 63.071  6.604   -24.183 1.00 0.00 ? 51  ILE A HG21 2  
ATOM 5360  H HG22 . ILE A 1 51  ? 63.126  7.699   -22.804 1.00 0.00 ? 51  ILE A HG22 2  
ATOM 5361  H HG23 . ILE A 1 51  ? 61.832  6.513   -22.932 1.00 0.00 ? 51  ILE A HG23 2  
ATOM 5362  H HD11 . ILE A 1 51  ? 62.071  2.822   -23.277 1.00 0.00 ? 51  ILE A HD11 2  
ATOM 5363  H HD12 . ILE A 1 51  ? 61.678  4.397   -23.959 1.00 0.00 ? 51  ILE A HD12 2  
ATOM 5364  H HD13 . ILE A 1 51  ? 61.613  4.151   -22.213 1.00 0.00 ? 51  ILE A HD13 2  
ATOM 5365  N N    . THR A 1 52  ? 65.216  8.504   -21.922 1.00 0.00 ? 52  THR A N    2  
ATOM 5366  C CA   . THR A 1 52  ? 65.385  9.707   -21.109 1.00 0.00 ? 52  THR A CA   2  
ATOM 5367  C C    . THR A 1 52  ? 64.448  10.803  -21.591 1.00 0.00 ? 52  THR A C    2  
ATOM 5368  O O    . THR A 1 52  ? 64.280  11.008  -22.793 1.00 0.00 ? 52  THR A O    2  
ATOM 5369  C CB   . THR A 1 52  ? 66.830  10.237  -21.197 1.00 0.00 ? 52  THR A CB   2  
ATOM 5370  O OG1  . THR A 1 52  ? 67.070  10.731  -22.507 1.00 0.00 ? 52  THR A OG1  2  
ATOM 5371  C CG2  . THR A 1 52  ? 67.818  9.111   -20.886 1.00 0.00 ? 52  THR A CG2  2  
ATOM 5372  H H    . THR A 1 52  ? 64.948  8.596   -22.860 1.00 0.00 ? 52  THR A H    2  
ATOM 5373  H HA   . THR A 1 52  ? 65.157  9.482   -20.076 1.00 0.00 ? 52  THR A HA   2  
ATOM 5374  H HB   . THR A 1 52  ? 66.963  11.034  -20.482 1.00 0.00 ? 52  THR A HB   2  
ATOM 5375  H HG1  . THR A 1 52  ? 67.950  11.118  -22.521 1.00 0.00 ? 52  THR A HG1  2  
ATOM 5376  H HG21 . THR A 1 52  ? 68.813  9.522   -20.796 1.00 0.00 ? 52  THR A HG21 2  
ATOM 5377  H HG22 . THR A 1 52  ? 67.801  8.386   -21.686 1.00 0.00 ? 52  THR A HG22 2  
ATOM 5378  H HG23 . THR A 1 52  ? 67.541  8.634   -19.959 1.00 0.00 ? 52  THR A HG23 2  
ATOM 5379  N N    . GLU A 1 53  ? 63.847  11.513  -20.644 1.00 0.00 ? 53  GLU A N    2  
ATOM 5380  C CA   . GLU A 1 53  ? 62.934  12.603  -20.970 1.00 0.00 ? 53  GLU A CA   2  
ATOM 5381  C C    . GLU A 1 53  ? 63.536  13.482  -22.070 1.00 0.00 ? 53  GLU A C    2  
ATOM 5382  O O    . GLU A 1 53  ? 64.711  13.342  -22.409 1.00 0.00 ? 53  GLU A O    2  
ATOM 5383  C CB   . GLU A 1 53  ? 62.671  13.429  -19.691 1.00 0.00 ? 53  GLU A CB   2  
ATOM 5384  C CG   . GLU A 1 53  ? 61.292  14.098  -19.737 1.00 0.00 ? 53  GLU A CG   2  
ATOM 5385  C CD   . GLU A 1 53  ? 60.198  13.033  -19.634 1.00 0.00 ? 53  GLU A CD   2  
ATOM 5386  O OE1  . GLU A 1 53  ? 59.887  12.637  -18.522 1.00 0.00 ? 53  GLU A OE1  2  
ATOM 5387  O OE2  . GLU A 1 53  ? 59.689  12.632  -20.667 1.00 0.00 ? 53  GLU A OE2  2  
ATOM 5388  H H    . GLU A 1 53  ? 64.029  11.307  -19.704 1.00 0.00 ? 53  GLU A H    2  
ATOM 5389  H HA   . GLU A 1 53  ? 62.007  12.186  -21.326 1.00 0.00 ? 53  GLU A HA   2  
ATOM 5390  H HB2  . GLU A 1 53  ? 62.713  12.770  -18.836 1.00 0.00 ? 53  GLU A HB2  2  
ATOM 5391  H HB3  . GLU A 1 53  ? 63.432  14.189  -19.583 1.00 0.00 ? 53  GLU A HB3  2  
ATOM 5392  H HG2  . GLU A 1 53  ? 61.205  14.782  -18.907 1.00 0.00 ? 53  GLU A HG2  2  
ATOM 5393  H HG3  . GLU A 1 53  ? 61.181  14.639  -20.662 1.00 0.00 ? 53  GLU A HG3  2  
ATOM 5394  N N    . SER A 1 54  ? 62.733  14.383  -22.623 1.00 0.00 ? 54  SER A N    2  
ATOM 5395  C CA   . SER A 1 54  ? 63.209  15.272  -23.679 1.00 0.00 ? 54  SER A CA   2  
ATOM 5396  C C    . SER A 1 54  ? 64.517  15.947  -23.276 1.00 0.00 ? 54  SER A C    2  
ATOM 5397  O O    . SER A 1 54  ? 65.169  16.584  -24.102 1.00 0.00 ? 54  SER A O    2  
ATOM 5398  C CB   . SER A 1 54  ? 62.156  16.339  -23.975 1.00 0.00 ? 54  SER A CB   2  
ATOM 5399  O OG   . SER A 1 54  ? 60.886  15.716  -24.128 1.00 0.00 ? 54  SER A OG   2  
ATOM 5400  H H    . SER A 1 54  ? 61.807  14.455  -22.316 1.00 0.00 ? 54  SER A H    2  
ATOM 5401  H HA   . SER A 1 54  ? 63.377  14.692  -24.574 1.00 0.00 ? 54  SER A HA   2  
ATOM 5402  H HB2  . SER A 1 54  ? 62.110  17.039  -23.157 1.00 0.00 ? 54  SER A HB2  2  
ATOM 5403  H HB3  . SER A 1 54  ? 62.422  16.865  -24.882 1.00 0.00 ? 54  SER A HB3  2  
ATOM 5404  H HG   . SER A 1 54  ? 60.217  16.324  -23.807 1.00 0.00 ? 54  SER A HG   2  
ATOM 5405  N N    . GLU A 1 55  ? 64.884  15.798  -21.995 1.00 0.00 ? 55  GLU A N    2  
ATOM 5406  C CA   . GLU A 1 55  ? 66.119  16.387  -21.453 1.00 0.00 ? 55  GLU A CA   2  
ATOM 5407  C C    . GLU A 1 55  ? 67.218  16.480  -22.517 1.00 0.00 ? 55  GLU A C    2  
ATOM 5408  O O    . GLU A 1 55  ? 68.023  15.563  -22.679 1.00 0.00 ? 55  GLU A O    2  
ATOM 5409  C CB   . GLU A 1 55  ? 66.622  15.537  -20.284 1.00 0.00 ? 55  GLU A CB   2  
ATOM 5410  C CG   . GLU A 1 55  ? 67.878  16.175  -19.685 1.00 0.00 ? 55  GLU A CG   2  
ATOM 5411  C CD   . GLU A 1 55  ? 68.224  15.484  -18.364 1.00 0.00 ? 55  GLU A CD   2  
ATOM 5412  O OE1  . GLU A 1 55  ? 68.346  14.270  -18.368 1.00 0.00 ? 55  GLU A OE1  2  
ATOM 5413  O OE2  . GLU A 1 55  ? 68.360  16.180  -17.372 1.00 0.00 ? 55  GLU A OE2  2  
ATOM 5414  H H    . GLU A 1 55  ? 64.301  15.272  -21.400 1.00 0.00 ? 55  GLU A H    2  
ATOM 5415  H HA   . GLU A 1 55  ? 65.902  17.379  -21.089 1.00 0.00 ? 55  GLU A HA   2  
ATOM 5416  H HB2  . GLU A 1 55  ? 65.853  15.477  -19.529 1.00 0.00 ? 55  GLU A HB2  2  
ATOM 5417  H HB3  . GLU A 1 55  ? 66.857  14.543  -20.637 1.00 0.00 ? 55  GLU A HB3  2  
ATOM 5418  H HG2  . GLU A 1 55  ? 68.703  16.064  -20.375 1.00 0.00 ? 55  GLU A HG2  2  
ATOM 5419  H HG3  . GLU A 1 55  ? 67.699  17.224  -19.504 1.00 0.00 ? 55  GLU A HG3  2  
ATOM 5420  N N    . SER A 1 56  ? 67.228  17.598  -23.240 1.00 0.00 ? 56  SER A N    2  
ATOM 5421  C CA   . SER A 1 56  ? 68.217  17.816  -24.298 1.00 0.00 ? 56  SER A CA   2  
ATOM 5422  C C    . SER A 1 56  ? 68.378  16.555  -25.146 1.00 0.00 ? 56  SER A C    2  
ATOM 5423  O O    . SER A 1 56  ? 69.460  15.973  -25.217 1.00 0.00 ? 56  SER A O    2  
ATOM 5424  C CB   . SER A 1 56  ? 69.565  18.195  -23.682 1.00 0.00 ? 56  SER A CB   2  
ATOM 5425  O OG   . SER A 1 56  ? 69.441  19.443  -23.013 1.00 0.00 ? 56  SER A OG   2  
ATOM 5426  H H    . SER A 1 56  ? 66.552  18.282  -23.054 1.00 0.00 ? 56  SER A H    2  
ATOM 5427  H HA   . SER A 1 56  ? 67.882  18.624  -24.930 1.00 0.00 ? 56  SER A HA   2  
ATOM 5428  H HB2  . SER A 1 56  ? 69.864  17.441  -22.974 1.00 0.00 ? 56  SER A HB2  2  
ATOM 5429  H HB3  . SER A 1 56  ? 70.309  18.266  -24.465 1.00 0.00 ? 56  SER A HB3  2  
ATOM 5430  H HG   . SER A 1 56  ? 69.500  19.281  -22.069 1.00 0.00 ? 56  SER A HG   2  
ATOM 5431  N N    . ASP A 1 57  ? 67.285  16.132  -25.774 1.00 0.00 ? 57  ASP A N    2  
ATOM 5432  C CA   . ASP A 1 57  ? 67.298  14.931  -26.601 1.00 0.00 ? 57  ASP A CA   2  
ATOM 5433  C C    . ASP A 1 57  ? 65.995  14.865  -27.406 1.00 0.00 ? 57  ASP A C    2  
ATOM 5434  O O    . ASP A 1 57  ? 65.052  15.602  -27.120 1.00 0.00 ? 57  ASP A O    2  
ATOM 5435  C CB   . ASP A 1 57  ? 67.458  13.682  -25.682 1.00 0.00 ? 57  ASP A CB   2  
ATOM 5436  C CG   . ASP A 1 57  ? 68.803  12.981  -25.935 1.00 0.00 ? 57  ASP A CG   2  
ATOM 5437  O OD1  . ASP A 1 57  ? 69.779  13.678  -26.157 1.00 0.00 ? 57  ASP A OD1  2  
ATOM 5438  O OD2  . ASP A 1 57  ? 68.828  11.762  -25.902 1.00 0.00 ? 57  ASP A OD2  2  
ATOM 5439  H H    . ASP A 1 57  ? 66.448  16.633  -25.670 1.00 0.00 ? 57  ASP A H    2  
ATOM 5440  H HA   . ASP A 1 57  ? 68.129  14.991  -27.291 1.00 0.00 ? 57  ASP A HA   2  
ATOM 5441  H HB2  . ASP A 1 57  ? 67.422  13.999  -24.650 1.00 0.00 ? 57  ASP A HB2  2  
ATOM 5442  H HB3  . ASP A 1 57  ? 66.654  12.978  -25.855 1.00 0.00 ? 57  ASP A HB3  2  
ATOM 5443  N N    . PRO A 1 58  ? 65.923  13.983  -28.423 1.00 0.00 ? 58  PRO A N    2  
ATOM 5444  C CA   . PRO A 1 58  ? 64.724  13.831  -29.262 1.00 0.00 ? 58  PRO A CA   2  
ATOM 5445  C C    . PRO A 1 58  ? 63.430  14.035  -28.469 1.00 0.00 ? 58  PRO A C    2  
ATOM 5446  O O    . PRO A 1 58  ? 63.041  13.191  -27.663 1.00 0.00 ? 58  PRO A O    2  
ATOM 5447  C CB   . PRO A 1 58  ? 64.856  12.400  -29.782 1.00 0.00 ? 58  PRO A CB   2  
ATOM 5448  C CG   . PRO A 1 58  ? 66.333  12.215  -29.957 1.00 0.00 ? 58  PRO A CG   2  
ATOM 5449  C CD   . PRO A 1 58  ? 66.996  13.059  -28.849 1.00 0.00 ? 58  PRO A CD   2  
ATOM 5450  H HA   . PRO A 1 58  ? 64.763  14.518  -30.090 1.00 0.00 ? 58  PRO A HA   2  
ATOM 5451  H HB2  . PRO A 1 58  ? 64.464  11.697  -29.055 1.00 0.00 ? 58  PRO A HB2  2  
ATOM 5452  H HB3  . PRO A 1 58  ? 64.346  12.288  -30.729 1.00 0.00 ? 58  PRO A HB3  2  
ATOM 5453  H HG2  . PRO A 1 58  ? 66.595  11.167  -29.851 1.00 0.00 ? 58  PRO A HG2  2  
ATOM 5454  H HG3  . PRO A 1 58  ? 66.643  12.578  -30.928 1.00 0.00 ? 58  PRO A HG3  2  
ATOM 5455  H HD2  . PRO A 1 58  ? 67.306  12.428  -28.029 1.00 0.00 ? 58  PRO A HD2  2  
ATOM 5456  H HD3  . PRO A 1 58  ? 67.836  13.617  -29.236 1.00 0.00 ? 58  PRO A HD3  2  
ATOM 5457  N N    . ASP A 1 59  ? 62.782  15.171  -28.708 1.00 0.00 ? 59  ASP A N    2  
ATOM 5458  C CA   . ASP A 1 59  ? 61.538  15.503  -28.019 1.00 0.00 ? 59  ASP A CA   2  
ATOM 5459  C C    . ASP A 1 59  ? 60.358  14.726  -28.622 1.00 0.00 ? 59  ASP A C    2  
ATOM 5460  O O    . ASP A 1 59  ? 60.011  14.948  -29.783 1.00 0.00 ? 59  ASP A O    2  
ATOM 5461  C CB   . ASP A 1 59  ? 61.267  17.003  -28.155 1.00 0.00 ? 59  ASP A CB   2  
ATOM 5462  C CG   . ASP A 1 59  ? 62.519  17.788  -27.759 1.00 0.00 ? 59  ASP A CG   2  
ATOM 5463  O OD1  . ASP A 1 59  ? 63.587  17.440  -28.235 1.00 0.00 ? 59  ASP A OD1  2  
ATOM 5464  O OD2  . ASP A 1 59  ? 62.387  18.725  -26.989 1.00 0.00 ? 59  ASP A OD2  2  
ATOM 5465  H H    . ASP A 1 59  ? 63.150  15.800  -29.364 1.00 0.00 ? 59  ASP A H    2  
ATOM 5466  H HA   . ASP A 1 59  ? 61.648  15.271  -26.975 1.00 0.00 ? 59  ASP A HA   2  
ATOM 5467  H HB2  . ASP A 1 59  ? 61.007  17.230  -29.179 1.00 0.00 ? 59  ASP A HB2  2  
ATOM 5468  H HB3  . ASP A 1 59  ? 60.450  17.282  -27.506 1.00 0.00 ? 59  ASP A HB3  2  
ATOM 5469  N N    . PRO A 1 60  ? 59.710  13.803  -27.867 1.00 0.00 ? 60  PRO A N    2  
ATOM 5470  C CA   . PRO A 1 60  ? 58.573  13.035  -28.395 1.00 0.00 ? 60  PRO A CA   2  
ATOM 5471  C C    . PRO A 1 60  ? 57.271  13.845  -28.363 1.00 0.00 ? 60  PRO A C    2  
ATOM 5472  O O    . PRO A 1 60  ? 56.509  13.843  -29.330 1.00 0.00 ? 60  PRO A O    2  
ATOM 5473  C CB   . PRO A 1 60  ? 58.509  11.809  -27.474 1.00 0.00 ? 60  PRO A CB   2  
ATOM 5474  C CG   . PRO A 1 60  ? 59.002  12.310  -26.151 1.00 0.00 ? 60  PRO A CG   2  
ATOM 5475  C CD   . PRO A 1 60  ? 60.013  13.427  -26.467 1.00 0.00 ? 60  PRO A CD   2  
ATOM 5476  H HA   . PRO A 1 60  ? 58.780  12.717  -29.406 1.00 0.00 ? 60  PRO A HA   2  
ATOM 5477  H HB2  . PRO A 1 60  ? 57.492  11.440  -27.396 1.00 0.00 ? 60  PRO A HB2  2  
ATOM 5478  H HB3  . PRO A 1 60  ? 59.162  11.028  -27.841 1.00 0.00 ? 60  PRO A HB3  2  
ATOM 5479  H HG2  . PRO A 1 60  ? 58.174  12.702  -25.572 1.00 0.00 ? 60  PRO A HG2  2  
ATOM 5480  H HG3  . PRO A 1 60  ? 59.490  11.515  -25.601 1.00 0.00 ? 60  PRO A HG3  2  
ATOM 5481  H HD2  . PRO A 1 60  ? 59.867  14.272  -25.805 1.00 0.00 ? 60  PRO A HD2  2  
ATOM 5482  H HD3  . PRO A 1 60  ? 61.027  13.060  -26.395 1.00 0.00 ? 60  PRO A HD3  2  
ATOM 5483  N N    . GLU A 1 61  ? 57.026  14.540  -27.254 1.00 0.00 ? 61  GLU A N    2  
ATOM 5484  C CA   . GLU A 1 61  ? 55.816  15.351  -27.129 1.00 0.00 ? 61  GLU A CA   2  
ATOM 5485  C C    . GLU A 1 61  ? 55.713  16.315  -28.314 1.00 0.00 ? 61  GLU A C    2  
ATOM 5486  O O    . GLU A 1 61  ? 56.721  16.844  -28.784 1.00 0.00 ? 61  GLU A O    2  
ATOM 5487  C CB   . GLU A 1 61  ? 55.839  16.141  -25.801 1.00 0.00 ? 61  GLU A CB   2  
ATOM 5488  C CG   . GLU A 1 61  ? 55.309  15.272  -24.652 1.00 0.00 ? 61  GLU A CG   2  
ATOM 5489  C CD   . GLU A 1 61  ? 56.200  14.042  -24.483 1.00 0.00 ? 61  GLU A CD   2  
ATOM 5490  O OE1  . GLU A 1 61  ? 57.253  14.175  -23.883 1.00 0.00 ? 61  GLU A OE1  2  
ATOM 5491  O OE2  . GLU A 1 61  ? 55.813  12.986  -24.956 1.00 0.00 ? 61  GLU A OE2  2  
ATOM 5492  H H    . GLU A 1 61  ? 57.668  14.513  -26.514 1.00 0.00 ? 61  GLU A H    2  
ATOM 5493  H HA   . GLU A 1 61  ? 54.955  14.697  -27.143 1.00 0.00 ? 61  GLU A HA   2  
ATOM 5494  H HB2  . GLU A 1 61  ? 56.854  16.439  -25.584 1.00 0.00 ? 61  GLU A HB2  2  
ATOM 5495  H HB3  . GLU A 1 61  ? 55.219  17.023  -25.887 1.00 0.00 ? 61  GLU A HB3  2  
ATOM 5496  H HG2  . GLU A 1 61  ? 55.312  15.847  -23.738 1.00 0.00 ? 61  GLU A HG2  2  
ATOM 5497  H HG3  . GLU A 1 61  ? 54.301  14.957  -24.875 1.00 0.00 ? 61  GLU A HG3  2  
ATOM 5498  N N    . VAL A 1 62  ? 54.492  16.531  -28.791 1.00 0.00 ? 62  VAL A N    2  
ATOM 5499  C CA   . VAL A 1 62  ? 54.271  17.425  -29.923 1.00 0.00 ? 62  VAL A CA   2  
ATOM 5500  C C    . VAL A 1 62  ? 54.639  18.864  -29.563 1.00 0.00 ? 62  VAL A C    2  
ATOM 5501  O O    . VAL A 1 62  ? 55.318  19.548  -30.329 1.00 0.00 ? 62  VAL A O    2  
ATOM 5502  C CB   . VAL A 1 62  ? 52.798  17.377  -30.384 1.00 0.00 ? 62  VAL A CB   2  
ATOM 5503  C CG1  . VAL A 1 62  ? 52.389  15.918  -30.610 1.00 0.00 ? 62  VAL A CG1  2  
ATOM 5504  C CG2  . VAL A 1 62  ? 51.887  18.004  -29.314 1.00 0.00 ? 62  VAL A CG2  2  
ATOM 5505  H H    . VAL A 1 62  ? 53.727  16.076  -28.381 1.00 0.00 ? 62  VAL A H    2  
ATOM 5506  H HA   . VAL A 1 62  ? 54.897  17.104  -30.742 1.00 0.00 ? 62  VAL A HA   2  
ATOM 5507  H HB   . VAL A 1 62  ? 52.696  17.924  -31.311 1.00 0.00 ? 62  VAL A HB   2  
ATOM 5508  H HG11 . VAL A 1 62  ? 53.095  15.447  -31.278 1.00 0.00 ? 62  VAL A HG11 2  
ATOM 5509  H HG12 . VAL A 1 62  ? 51.402  15.885  -31.046 1.00 0.00 ? 62  VAL A HG12 2  
ATOM 5510  H HG13 . VAL A 1 62  ? 52.384  15.395  -29.665 1.00 0.00 ? 62  VAL A HG13 2  
ATOM 5511  H HG21 . VAL A 1 62  ? 52.184  17.655  -28.336 1.00 0.00 ? 62  VAL A HG21 2  
ATOM 5512  H HG22 . VAL A 1 62  ? 50.860  17.722  -29.499 1.00 0.00 ? 62  VAL A HG22 2  
ATOM 5513  H HG23 . VAL A 1 62  ? 51.974  19.079  -29.355 1.00 0.00 ? 62  VAL A HG23 2  
ATOM 5514  N N    . GLU A 1 63  ? 54.186  19.321  -28.397 1.00 0.00 ? 63  GLU A N    2  
ATOM 5515  C CA   . GLU A 1 63  ? 54.473  20.684  -27.947 1.00 0.00 ? 63  GLU A CA   2  
ATOM 5516  C C    . GLU A 1 63  ? 55.845  20.749  -27.281 1.00 0.00 ? 63  GLU A C    2  
ATOM 5517  O O    . GLU A 1 63  ? 56.719  19.928  -27.561 1.00 0.00 ? 63  GLU A O    2  
ATOM 5518  C CB   . GLU A 1 63  ? 53.393  21.142  -26.961 1.00 0.00 ? 63  GLU A CB   2  
ATOM 5519  C CG   . GLU A 1 63  ? 53.445  20.276  -25.699 1.00 0.00 ? 63  GLU A CG   2  
ATOM 5520  C CD   . GLU A 1 63  ? 52.208  20.549  -24.841 1.00 0.00 ? 63  GLU A CD   2  
ATOM 5521  O OE1  . GLU A 1 63  ? 51.114  20.267  -25.305 1.00 0.00 ? 63  GLU A OE1  2  
ATOM 5522  O OE2  . GLU A 1 63  ? 52.374  21.037  -23.735 1.00 0.00 ? 63  GLU A OE2  2  
ATOM 5523  H H    . GLU A 1 63  ? 53.648  18.734  -27.824 1.00 0.00 ? 63  GLU A H    2  
ATOM 5524  H HA   . GLU A 1 63  ? 54.467  21.349  -28.800 1.00 0.00 ? 63  GLU A HA   2  
ATOM 5525  H HB2  . GLU A 1 63  ? 53.562  22.175  -26.696 1.00 0.00 ? 63  GLU A HB2  2  
ATOM 5526  H HB3  . GLU A 1 63  ? 52.423  21.046  -27.424 1.00 0.00 ? 63  GLU A HB3  2  
ATOM 5527  H HG2  . GLU A 1 63  ? 53.467  19.233  -25.979 1.00 0.00 ? 63  GLU A HG2  2  
ATOM 5528  H HG3  . GLU A 1 63  ? 54.332  20.515  -25.133 1.00 0.00 ? 63  GLU A HG3  2  
ATOM 5529  N N    . SER A 1 64  ? 56.031  21.730  -26.401 1.00 0.00 ? 64  SER A N    2  
ATOM 5530  C CA   . SER A 1 64  ? 57.304  21.893  -25.701 1.00 0.00 ? 64  SER A CA   2  
ATOM 5531  C C    . SER A 1 64  ? 57.112  22.687  -24.412 1.00 0.00 ? 64  SER A C    2  
ATOM 5532  O O    . SER A 1 64  ? 56.122  23.399  -24.249 1.00 0.00 ? 64  SER A O    2  
ATOM 5533  C CB   . SER A 1 64  ? 58.303  22.618  -26.602 1.00 0.00 ? 64  SER A CB   2  
ATOM 5534  O OG   . SER A 1 64  ? 57.772  23.884  -26.971 1.00 0.00 ? 64  SER A OG   2  
ATOM 5535  H H    . SER A 1 64  ? 55.300  22.357  -26.218 1.00 0.00 ? 64  SER A H    2  
ATOM 5536  H HA   . SER A 1 64  ? 57.702  20.920  -25.453 1.00 0.00 ? 64  SER A HA   2  
ATOM 5537  H HB2  . SER A 1 64  ? 59.230  22.764  -26.073 1.00 0.00 ? 64  SER A HB2  2  
ATOM 5538  H HB3  . SER A 1 64  ? 58.487  22.022  -27.487 1.00 0.00 ? 64  SER A HB3  2  
ATOM 5539  H HG   . SER A 1 64  ? 57.717  23.915  -27.929 1.00 0.00 ? 64  SER A HG   2  
ATOM 5540  N N    . GLU A 1 65  ? 58.070  22.553  -23.496 1.00 0.00 ? 65  GLU A N    2  
ATOM 5541  C CA   . GLU A 1 65  ? 58.010  23.252  -22.211 1.00 0.00 ? 65  GLU A CA   2  
ATOM 5542  C C    . GLU A 1 65  ? 57.508  24.692  -22.388 1.00 0.00 ? 65  GLU A C    2  
ATOM 5543  O O    . GLU A 1 65  ? 56.307  24.951  -22.314 1.00 0.00 ? 65  GLU A O    2  
ATOM 5544  C CB   . GLU A 1 65  ? 59.409  23.249  -21.546 1.00 0.00 ? 65  GLU A CB   2  
ATOM 5545  C CG   . GLU A 1 65  ? 60.516  23.328  -22.623 1.00 0.00 ? 65  GLU A CG   2  
ATOM 5546  C CD   . GLU A 1 65  ? 60.828  21.928  -23.167 1.00 0.00 ? 65  GLU A CD   2  
ATOM 5547  O OE1  . GLU A 1 65  ? 61.286  21.102  -22.394 1.00 0.00 ? 65  GLU A OE1  2  
ATOM 5548  O OE2  . GLU A 1 65  ? 60.605  21.708  -24.346 1.00 0.00 ? 65  GLU A OE2  2  
ATOM 5549  H H    . GLU A 1 65  ? 58.828  21.966  -23.683 1.00 0.00 ? 65  GLU A H    2  
ATOM 5550  H HA   . GLU A 1 65  ? 57.318  22.728  -21.566 1.00 0.00 ? 65  GLU A HA   2  
ATOM 5551  H HB2  . GLU A 1 65  ? 59.498  24.097  -20.878 1.00 0.00 ? 65  GLU A HB2  2  
ATOM 5552  H HB3  . GLU A 1 65  ? 59.531  22.339  -20.970 1.00 0.00 ? 65  GLU A HB3  2  
ATOM 5553  H HG2  . GLU A 1 65  ? 60.191  23.960  -23.437 1.00 0.00 ? 65  GLU A HG2  2  
ATOM 5554  H HG3  . GLU A 1 65  ? 61.413  23.744  -22.186 1.00 0.00 ? 65  GLU A HG3  2  
ATOM 5555  N N    . ASP A 1 66  ? 58.436  25.619  -22.611 1.00 0.00 ? 66  ASP A N    2  
ATOM 5556  C CA   . ASP A 1 66  ? 58.077  27.023  -22.786 1.00 0.00 ? 66  ASP A CA   2  
ATOM 5557  C C    . ASP A 1 66  ? 57.346  27.546  -21.553 1.00 0.00 ? 66  ASP A C    2  
ATOM 5558  O O    . ASP A 1 66  ? 56.151  27.840  -21.603 1.00 0.00 ? 66  ASP A O    2  
ATOM 5559  C CB   . ASP A 1 66  ? 57.190  27.194  -24.024 1.00 0.00 ? 66  ASP A CB   2  
ATOM 5560  C CG   . ASP A 1 66  ? 57.037  28.684  -24.340 1.00 0.00 ? 66  ASP A CG   2  
ATOM 5561  O OD1  . ASP A 1 66  ? 56.770  29.440  -23.420 1.00 0.00 ? 66  ASP A OD1  2  
ATOM 5562  O OD2  . ASP A 1 66  ? 57.187  29.043  -25.496 1.00 0.00 ? 66  ASP A OD2  2  
ATOM 5563  H H    . ASP A 1 66  ? 59.377  25.357  -22.652 1.00 0.00 ? 66  ASP A H    2  
ATOM 5564  H HA   . ASP A 1 66  ? 58.982  27.598  -22.924 1.00 0.00 ? 66  ASP A HA   2  
ATOM 5565  H HB2  . ASP A 1 66  ? 57.647  26.693  -24.864 1.00 0.00 ? 66  ASP A HB2  2  
ATOM 5566  H HB3  . ASP A 1 66  ? 56.218  26.767  -23.834 1.00 0.00 ? 66  ASP A HB3  2  
ATOM 5567  N N    . ASP A 1 67  ? 58.076  27.657  -20.448 1.00 0.00 ? 67  ASP A N    2  
ATOM 5568  C CA   . ASP A 1 67  ? 57.492  28.145  -19.203 1.00 0.00 ? 67  ASP A CA   2  
ATOM 5569  C C    . ASP A 1 67  ? 56.996  29.577  -19.373 1.00 0.00 ? 67  ASP A C    2  
ATOM 5570  O O    . ASP A 1 67  ? 55.810  29.856  -19.200 1.00 0.00 ? 67  ASP A O    2  
ATOM 5571  C CB   . ASP A 1 67  ? 58.532  28.090  -18.082 1.00 0.00 ? 67  ASP A CB   2  
ATOM 5572  C CG   . ASP A 1 67  ? 57.852  28.372  -16.740 1.00 0.00 ? 67  ASP A CG   2  
ATOM 5573  O OD1  . ASP A 1 67  ? 56.779  28.952  -16.753 1.00 0.00 ? 67  ASP A OD1  2  
ATOM 5574  O OD2  . ASP A 1 67  ? 58.417  28.004  -15.724 1.00 0.00 ? 67  ASP A OD2  2  
ATOM 5575  H H    . ASP A 1 67  ? 59.022  27.406  -20.475 1.00 0.00 ? 67  ASP A H    2  
ATOM 5576  H HA   . ASP A 1 67  ? 56.658  27.513  -18.936 1.00 0.00 ? 67  ASP A HA   2  
ATOM 5577  H HB2  . ASP A 1 67  ? 58.985  27.110  -18.058 1.00 0.00 ? 67  ASP A HB2  2  
ATOM 5578  H HB3  . ASP A 1 67  ? 59.293  28.835  -18.260 1.00 0.00 ? 67  ASP A HB3  2  
ATOM 5579  N N    . SER A 1 68  ? 57.918  30.479  -19.708 1.00 0.00 ? 68  SER A N    2  
ATOM 5580  C CA   . SER A 1 68  ? 57.586  31.892  -19.901 1.00 0.00 ? 68  SER A CA   2  
ATOM 5581  C C    . SER A 1 68  ? 57.494  32.612  -18.556 1.00 0.00 ? 68  SER A C    2  
ATOM 5582  O O    . SER A 1 68  ? 56.571  33.391  -18.318 1.00 0.00 ? 68  SER A O    2  
ATOM 5583  C CB   . SER A 1 68  ? 56.267  32.040  -20.681 1.00 0.00 ? 68  SER A CB   2  
ATOM 5584  O OG   . SER A 1 68  ? 56.297  33.254  -21.420 1.00 0.00 ? 68  SER A OG   2  
ATOM 5585  H H    . SER A 1 68  ? 58.847  30.188  -19.822 1.00 0.00 ? 68  SER A H    2  
ATOM 5586  H HA   . SER A 1 68  ? 58.376  32.351  -20.478 1.00 0.00 ? 68  SER A HA   2  
ATOM 5587  H HB2  . SER A 1 68  ? 56.159  31.216  -21.364 1.00 0.00 ? 68  SER A HB2  2  
ATOM 5588  H HB3  . SER A 1 68  ? 55.427  32.046  -19.996 1.00 0.00 ? 68  SER A HB3  2  
ATOM 5589  H HG   . SER A 1 68  ? 56.818  33.891  -20.924 1.00 0.00 ? 68  SER A HG   2  
ATOM 5590  N N    . THR A 1 69  ? 58.461  32.344  -17.680 1.00 0.00 ? 69  THR A N    2  
ATOM 5591  C CA   . THR A 1 69  ? 58.497  32.965  -16.355 1.00 0.00 ? 69  THR A CA   2  
ATOM 5592  C C    . THR A 1 69  ? 59.941  33.112  -15.883 1.00 0.00 ? 69  THR A C    2  
ATOM 5593  O O    . THR A 1 69  ? 60.225  33.833  -14.928 1.00 0.00 ? 69  THR A O    2  
ATOM 5594  C CB   . THR A 1 69  ? 57.731  32.114  -15.326 1.00 0.00 ? 69  THR A CB   2  
ATOM 5595  O OG1  . THR A 1 69  ? 58.301  30.814  -15.270 1.00 0.00 ? 69  THR A OG1  2  
ATOM 5596  C CG2  . THR A 1 69  ? 56.261  32.010  -15.738 1.00 0.00 ? 69  THR A CG2  2  
ATOM 5597  H H    . THR A 1 69  ? 59.170  31.713  -17.928 1.00 0.00 ? 69  THR A H    2  
ATOM 5598  H HA   . THR A 1 69  ? 58.045  33.947  -16.403 1.00 0.00 ? 69  THR A HA   2  
ATOM 5599  H HB   . THR A 1 69  ? 57.795  32.578  -14.354 1.00 0.00 ? 69  THR A HB   2  
ATOM 5600  H HG1  . THR A 1 69  ? 59.078  30.855  -14.706 1.00 0.00 ? 69  THR A HG1  2  
ATOM 5601  H HG21 . THR A 1 69  ? 55.880  32.995  -15.963 1.00 0.00 ? 69  THR A HG21 2  
ATOM 5602  H HG22 . THR A 1 69  ? 55.690  31.576  -14.932 1.00 0.00 ? 69  THR A HG22 2  
ATOM 5603  H HG23 . THR A 1 69  ? 56.178  31.384  -16.615 1.00 0.00 ? 69  THR A HG23 2  
ATOM 5604  N N    . SER A 1 70  ? 60.848  32.421  -16.567 1.00 0.00 ? 70  SER A N    2  
ATOM 5605  C CA   . SER A 1 70  ? 62.263  32.475  -16.220 1.00 0.00 ? 70  SER A CA   2  
ATOM 5606  C C    . SER A 1 70  ? 63.101  31.822  -17.315 1.00 0.00 ? 70  SER A C    2  
ATOM 5607  O O    . SER A 1 70  ? 64.032  32.428  -17.844 1.00 0.00 ? 70  SER A O    2  
ATOM 5608  C CB   . SER A 1 70  ? 62.505  31.756  -14.892 1.00 0.00 ? 70  SER A CB   2  
ATOM 5609  O OG   . SER A 1 70  ? 62.128  30.391  -15.021 1.00 0.00 ? 70  SER A OG   2  
ATOM 5610  H H    . SER A 1 70  ? 60.559  31.864  -17.319 1.00 0.00 ? 70  SER A H    2  
ATOM 5611  H HA   . SER A 1 70  ? 62.562  33.507  -16.118 1.00 0.00 ? 70  SER A HA   2  
ATOM 5612  H HB2  . SER A 1 70  ? 63.549  31.813  -14.635 1.00 0.00 ? 70  SER A HB2  2  
ATOM 5613  H HB3  . SER A 1 70  ? 61.919  32.230  -14.116 1.00 0.00 ? 70  SER A HB3  2  
ATOM 5614  H HG   . SER A 1 70  ? 61.442  30.335  -15.691 1.00 0.00 ? 70  SER A HG   2  
ATOM 5615  N N    . VAL A 1 71  ? 62.757  30.583  -17.653 1.00 0.00 ? 71  VAL A N    2  
ATOM 5616  C CA   . VAL A 1 71  ? 63.475  29.853  -18.690 1.00 0.00 ? 71  VAL A CA   2  
ATOM 5617  C C    . VAL A 1 71  ? 64.977  29.866  -18.421 1.00 0.00 ? 71  VAL A C    2  
ATOM 5618  O O    . VAL A 1 71  ? 65.734  30.552  -19.107 1.00 0.00 ? 71  VAL A O    2  
ATOM 5619  C CB   . VAL A 1 71  ? 63.222  30.474  -20.076 1.00 0.00 ? 71  VAL A CB   2  
ATOM 5620  C CG1  . VAL A 1 71  ? 63.782  29.554  -21.161 1.00 0.00 ? 71  VAL A CG1  2  
ATOM 5621  C CG2  . VAL A 1 71  ? 61.716  30.649  -20.286 1.00 0.00 ? 71  VAL A CG2  2  
ATOM 5622  H H    . VAL A 1 71  ? 62.002  30.155  -17.197 1.00 0.00 ? 71  VAL A H    2  
ATOM 5623  H HA   . VAL A 1 71  ? 63.131  28.830  -18.701 1.00 0.00 ? 71  VAL A HA   2  
ATOM 5624  H HB   . VAL A 1 71  ? 63.709  31.437  -20.133 1.00 0.00 ? 71  VAL A HB   2  
ATOM 5625  H HG11 . VAL A 1 71  ? 64.855  29.487  -21.056 1.00 0.00 ? 71  VAL A HG11 2  
ATOM 5626  H HG12 . VAL A 1 71  ? 63.539  29.953  -22.134 1.00 0.00 ? 71  VAL A HG12 2  
ATOM 5627  H HG13 . VAL A 1 71  ? 63.349  28.570  -21.057 1.00 0.00 ? 71  VAL A HG13 2  
ATOM 5628  H HG21 . VAL A 1 71  ? 61.537  31.104  -21.248 1.00 0.00 ? 71  VAL A HG21 2  
ATOM 5629  H HG22 . VAL A 1 71  ? 61.315  31.282  -19.507 1.00 0.00 ? 71  VAL A HG22 2  
ATOM 5630  H HG23 . VAL A 1 71  ? 61.233  29.684  -20.248 1.00 0.00 ? 71  VAL A HG23 2  
ATOM 5631  N N    . GLU A 1 72  ? 65.401  29.102  -17.417 1.00 0.00 ? 72  GLU A N    2  
ATOM 5632  C CA   . GLU A 1 72  ? 66.818  29.027  -17.058 1.00 0.00 ? 72  GLU A CA   2  
ATOM 5633  C C    . GLU A 1 72  ? 67.116  27.703  -16.362 1.00 0.00 ? 72  GLU A C    2  
ATOM 5634  O O    . GLU A 1 72  ? 68.055  26.996  -16.726 1.00 0.00 ? 72  GLU A O    2  
ATOM 5635  C CB   . GLU A 1 72  ? 67.184  30.192  -16.133 1.00 0.00 ? 72  GLU A CB   2  
ATOM 5636  C CG   . GLU A 1 72  ? 68.708  30.290  -15.992 1.00 0.00 ? 72  GLU A CG   2  
ATOM 5637  C CD   . GLU A 1 72  ? 69.316  30.798  -17.302 1.00 0.00 ? 72  GLU A CD   2  
ATOM 5638  O OE1  . GLU A 1 72  ? 68.651  31.559  -17.986 1.00 0.00 ? 72  GLU A OE1  2  
ATOM 5639  O OE2  . GLU A 1 72  ? 70.438  30.418  -17.598 1.00 0.00 ? 72  GLU A OE2  2  
ATOM 5640  H H    . GLU A 1 72  ? 64.750  28.580  -16.904 1.00 0.00 ? 72  GLU A H    2  
ATOM 5641  H HA   . GLU A 1 72  ? 67.417  29.089  -17.957 1.00 0.00 ? 72  GLU A HA   2  
ATOM 5642  H HB2  . GLU A 1 72  ? 66.801  31.113  -16.548 1.00 0.00 ? 72  GLU A HB2  2  
ATOM 5643  H HB3  . GLU A 1 72  ? 66.745  30.029  -15.160 1.00 0.00 ? 72  GLU A HB3  2  
ATOM 5644  H HG2  . GLU A 1 72  ? 68.951  30.975  -15.194 1.00 0.00 ? 72  GLU A HG2  2  
ATOM 5645  H HG3  . GLU A 1 72  ? 69.114  29.315  -15.765 1.00 0.00 ? 72  GLU A HG3  2  
ATOM 5646  N N    . ASP A 1 73  ? 66.309  27.373  -15.358 1.00 0.00 ? 73  ASP A N    2  
ATOM 5647  C CA   . ASP A 1 73  ? 66.494  26.129  -14.618 1.00 0.00 ? 73  ASP A CA   2  
ATOM 5648  C C    . ASP A 1 73  ? 66.035  24.936  -15.451 1.00 0.00 ? 73  ASP A C    2  
ATOM 5649  O O    . ASP A 1 73  ? 65.233  25.082  -16.373 1.00 0.00 ? 73  ASP A O    2  
ATOM 5650  C CB   . ASP A 1 73  ? 65.697  26.177  -13.312 1.00 0.00 ? 73  ASP A CB   2  
ATOM 5651  C CG   . ASP A 1 73  ? 64.242  26.542  -13.614 1.00 0.00 ? 73  ASP A CG   2  
ATOM 5652  O OD1  . ASP A 1 73  ? 63.989  27.703  -13.888 1.00 0.00 ? 73  ASP A OD1  2  
ATOM 5653  O OD2  . ASP A 1 73  ? 63.408  25.654  -13.565 1.00 0.00 ? 73  ASP A OD2  2  
ATOM 5654  H H    . ASP A 1 73  ? 65.575  27.974  -15.112 1.00 0.00 ? 73  ASP A H    2  
ATOM 5655  H HA   . ASP A 1 73  ? 67.541  26.012  -14.382 1.00 0.00 ? 73  ASP A HA   2  
ATOM 5656  H HB2  . ASP A 1 73  ? 65.735  25.209  -12.833 1.00 0.00 ? 73  ASP A HB2  2  
ATOM 5657  H HB3  . ASP A 1 73  ? 66.124  26.921  -12.656 1.00 0.00 ? 73  ASP A HB3  2  
ATOM 5658  N N    . VAL A 1 74  ? 66.549  23.756  -15.119 1.00 0.00 ? 74  VAL A N    2  
ATOM 5659  C CA   . VAL A 1 74  ? 66.184  22.543  -15.841 1.00 0.00 ? 74  VAL A CA   2  
ATOM 5660  C C    . VAL A 1 74  ? 64.729  22.174  -15.554 1.00 0.00 ? 74  VAL A C    2  
ATOM 5661  O O    . VAL A 1 74  ? 63.919  23.040  -15.225 1.00 0.00 ? 74  VAL A O    2  
ATOM 5662  C CB   . VAL A 1 74  ? 67.096  21.370  -15.428 1.00 0.00 ? 74  VAL A CB   2  
ATOM 5663  C CG1  . VAL A 1 74  ? 68.556  21.755  -15.670 1.00 0.00 ? 74  VAL A CG1  2  
ATOM 5664  C CG2  . VAL A 1 74  ? 66.891  21.061  -13.941 1.00 0.00 ? 74  VAL A CG2  2  
ATOM 5665  H H    . VAL A 1 74  ? 67.182  23.701  -14.373 1.00 0.00 ? 74  VAL A H    2  
ATOM 5666  H HA   . VAL A 1 74  ? 66.299  22.717  -16.900 1.00 0.00 ? 74  VAL A HA   2  
ATOM 5667  H HB   . VAL A 1 74  ? 66.854  20.499  -16.018 1.00 0.00 ? 74  VAL A HB   2  
ATOM 5668  H HG11 . VAL A 1 74  ? 68.782  22.664  -15.132 1.00 0.00 ? 74  VAL A HG11 2  
ATOM 5669  H HG12 . VAL A 1 74  ? 68.718  21.911  -16.726 1.00 0.00 ? 74  VAL A HG12 2  
ATOM 5670  H HG13 . VAL A 1 74  ? 69.200  20.961  -15.321 1.00 0.00 ? 74  VAL A HG13 2  
ATOM 5671  H HG21 . VAL A 1 74  ? 65.923  20.605  -13.796 1.00 0.00 ? 74  VAL A HG21 2  
ATOM 5672  H HG22 . VAL A 1 74  ? 66.945  21.977  -13.371 1.00 0.00 ? 74  VAL A HG22 2  
ATOM 5673  H HG23 . VAL A 1 74  ? 67.661  20.382  -13.603 1.00 0.00 ? 74  VAL A HG23 2  
ATOM 5674  N N    . ASP A 1 75  ? 64.400  20.886  -15.674 1.00 0.00 ? 75  ASP A N    2  
ATOM 5675  C CA   . ASP A 1 75  ? 63.036  20.421  -15.417 1.00 0.00 ? 75  ASP A CA   2  
ATOM 5676  C C    . ASP A 1 75  ? 63.047  18.925  -15.056 1.00 0.00 ? 75  ASP A C    2  
ATOM 5677  O O    . ASP A 1 75  ? 63.662  18.133  -15.767 1.00 0.00 ? 75  ASP A O    2  
ATOM 5678  C CB   . ASP A 1 75  ? 62.173  20.643  -16.661 1.00 0.00 ? 75  ASP A CB   2  
ATOM 5679  C CG   . ASP A 1 75  ? 62.794  19.914  -17.854 1.00 0.00 ? 75  ASP A CG   2  
ATOM 5680  O OD1  . ASP A 1 75  ? 62.707  18.697  -17.891 1.00 0.00 ? 75  ASP A OD1  2  
ATOM 5681  O OD2  . ASP A 1 75  ? 63.347  20.584  -18.710 1.00 0.00 ? 75  ASP A OD2  2  
ATOM 5682  H H    . ASP A 1 75  ? 65.085  20.237  -15.935 1.00 0.00 ? 75  ASP A H    2  
ATOM 5683  H HA   . ASP A 1 75  ? 62.625  20.996  -14.606 1.00 0.00 ? 75  ASP A HA   2  
ATOM 5684  H HB2  . ASP A 1 75  ? 61.179  20.262  -16.479 1.00 0.00 ? 75  ASP A HB2  2  
ATOM 5685  H HB3  . ASP A 1 75  ? 62.118  21.700  -16.876 1.00 0.00 ? 75  ASP A HB3  2  
ATOM 5686  N N    . PRO A 1 76  ? 62.380  18.506  -13.947 1.00 0.00 ? 76  PRO A N    2  
ATOM 5687  C CA   . PRO A 1 76  ? 62.352  17.096  -13.511 1.00 0.00 ? 76  PRO A CA   2  
ATOM 5688  C C    . PRO A 1 76  ? 62.381  16.080  -14.664 1.00 0.00 ? 76  PRO A C    2  
ATOM 5689  O O    . PRO A 1 76  ? 61.335  15.739  -15.215 1.00 0.00 ? 76  PRO A O    2  
ATOM 5690  C CB   . PRO A 1 76  ? 61.029  17.016  -12.748 1.00 0.00 ? 76  PRO A CB   2  
ATOM 5691  C CG   . PRO A 1 76  ? 60.934  18.340  -12.062 1.00 0.00 ? 76  PRO A CG   2  
ATOM 5692  C CD   . PRO A 1 76  ? 61.587  19.352  -13.022 1.00 0.00 ? 76  PRO A CD   2  
ATOM 5693  H HA   . PRO A 1 76  ? 63.156  16.906  -12.821 1.00 0.00 ? 76  PRO A HA   2  
ATOM 5694  H HB2  . PRO A 1 76  ? 60.203  16.882  -13.439 1.00 0.00 ? 76  PRO A HB2  2  
ATOM 5695  H HB3  . PRO A 1 76  ? 61.051  16.215  -12.023 1.00 0.00 ? 76  PRO A HB3  2  
ATOM 5696  H HG2  . PRO A 1 76  ? 59.895  18.595  -11.880 1.00 0.00 ? 76  PRO A HG2  2  
ATOM 5697  H HG3  . PRO A 1 76  ? 61.479  18.319  -11.127 1.00 0.00 ? 76  PRO A HG3  2  
ATOM 5698  H HD2  . PRO A 1 76  ? 60.828  19.901  -13.566 1.00 0.00 ? 76  PRO A HD2  2  
ATOM 5699  H HD3  . PRO A 1 76  ? 62.237  20.030  -12.487 1.00 0.00 ? 76  PRO A HD3  2  
ATOM 5700  N N    . PRO A 1 77  ? 63.575  15.558  -15.029 1.00 0.00 ? 77  PRO A N    2  
ATOM 5701  C CA   . PRO A 1 77  ? 63.721  14.561  -16.089 1.00 0.00 ? 77  PRO A CA   2  
ATOM 5702  C C    . PRO A 1 77  ? 63.837  13.154  -15.499 1.00 0.00 ? 77  PRO A C    2  
ATOM 5703  O O    . PRO A 1 77  ? 64.414  12.980  -14.424 1.00 0.00 ? 77  PRO A O    2  
ATOM 5704  C CB   . PRO A 1 77  ? 65.033  14.996  -16.736 1.00 0.00 ? 77  PRO A CB   2  
ATOM 5705  C CG   . PRO A 1 77  ? 65.882  15.438  -15.571 1.00 0.00 ? 77  PRO A CG   2  
ATOM 5706  C CD   . PRO A 1 77  ? 64.898  15.883  -14.460 1.00 0.00 ? 77  PRO A CD   2  
ATOM 5707  H HA   . PRO A 1 77  ? 62.915  14.623  -16.801 1.00 0.00 ? 77  PRO A HA   2  
ATOM 5708  H HB2  . PRO A 1 77  ? 65.491  14.166  -17.265 1.00 0.00 ? 77  PRO A HB2  2  
ATOM 5709  H HB3  . PRO A 1 77  ? 64.860  15.823  -17.408 1.00 0.00 ? 77  PRO A HB3  2  
ATOM 5710  H HG2  . PRO A 1 77  ? 66.496  14.611  -15.224 1.00 0.00 ? 77  PRO A HG2  2  
ATOM 5711  H HG3  . PRO A 1 77  ? 66.516  16.268  -15.858 1.00 0.00 ? 77  PRO A HG3  2  
ATOM 5712  H HD2  . PRO A 1 77  ? 65.069  15.323  -13.547 1.00 0.00 ? 77  PRO A HD2  2  
ATOM 5713  H HD3  . PRO A 1 77  ? 64.980  16.942  -14.273 1.00 0.00 ? 77  PRO A HD3  2  
ATOM 5714  N N    . THR A 1 78  ? 63.284  12.151  -16.189 1.00 0.00 ? 78  THR A N    2  
ATOM 5715  C CA   . THR A 1 78  ? 63.333  10.763  -15.698 1.00 0.00 ? 78  THR A CA   2  
ATOM 5716  C C    . THR A 1 78  ? 63.810  9.808   -16.787 1.00 0.00 ? 78  THR A C    2  
ATOM 5717  O O    . THR A 1 78  ? 63.506  9.990   -17.966 1.00 0.00 ? 78  THR A O    2  
ATOM 5718  C CB   . THR A 1 78  ? 61.940  10.303  -15.229 1.00 0.00 ? 78  THR A CB   2  
ATOM 5719  O OG1  . THR A 1 78  ? 61.974  8.912   -14.946 1.00 0.00 ? 78  THR A OG1  2  
ATOM 5720  C CG2  . THR A 1 78  ? 60.912  10.578  -16.328 1.00 0.00 ? 78  THR A CG2  2  
ATOM 5721  H H    . THR A 1 78  ? 62.827  12.346  -17.033 1.00 0.00 ? 78  THR A H    2  
ATOM 5722  H HA   . THR A 1 78  ? 64.015  10.693  -14.861 1.00 0.00 ? 78  THR A HA   2  
ATOM 5723  H HB   . THR A 1 78  ? 61.663  10.846  -14.338 1.00 0.00 ? 78  THR A HB   2  
ATOM 5724  H HG1  . THR A 1 78  ? 62.874  8.679   -14.711 1.00 0.00 ? 78  THR A HG1  2  
ATOM 5725  H HG21 . THR A 1 78  ? 60.845  11.642  -16.500 1.00 0.00 ? 78  THR A HG21 2  
ATOM 5726  H HG22 . THR A 1 78  ? 59.948  10.202  -16.021 1.00 0.00 ? 78  THR A HG22 2  
ATOM 5727  H HG23 . THR A 1 78  ? 61.218  10.085  -17.239 1.00 0.00 ? 78  THR A HG23 2  
ATOM 5728  N N    . THR A 1 79  ? 64.549  8.773   -16.370 1.00 0.00 ? 79  THR A N    2  
ATOM 5729  C CA   . THR A 1 79  ? 65.065  7.756   -17.294 1.00 0.00 ? 79  THR A CA   2  
ATOM 5730  C C    . THR A 1 79  ? 64.550  6.388   -16.863 1.00 0.00 ? 79  THR A C    2  
ATOM 5731  O O    . THR A 1 79  ? 64.606  6.041   -15.683 1.00 0.00 ? 79  THR A O    2  
ATOM 5732  C CB   . THR A 1 79  ? 66.606  7.738   -17.299 1.00 0.00 ? 79  THR A CB   2  
ATOM 5733  O OG1  . THR A 1 79  ? 67.063  6.701   -18.156 1.00 0.00 ? 79  THR A OG1  2  
ATOM 5734  C CG2  . THR A 1 79  ? 67.126  7.496   -15.883 1.00 0.00 ? 79  THR A CG2  2  
ATOM 5735  H H    . THR A 1 79  ? 64.740  8.681   -15.412 1.00 0.00 ? 79  THR A H    2  
ATOM 5736  H HA   . THR A 1 79  ? 64.713  7.959   -18.297 1.00 0.00 ? 79  THR A HA   2  
ATOM 5737  H HB   . THR A 1 79  ? 66.975  8.688   -17.655 1.00 0.00 ? 79  THR A HB   2  
ATOM 5738  H HG1  . THR A 1 79  ? 66.484  5.944   -18.040 1.00 0.00 ? 79  THR A HG1  2  
ATOM 5739  H HG21 . THR A 1 79  ? 66.611  8.149   -15.193 1.00 0.00 ? 79  THR A HG21 2  
ATOM 5740  H HG22 . THR A 1 79  ? 68.186  7.699   -15.848 1.00 0.00 ? 79  THR A HG22 2  
ATOM 5741  H HG23 . THR A 1 79  ? 66.948  6.468   -15.609 1.00 0.00 ? 79  THR A HG23 2  
ATOM 5742  N N    . TYR A 1 80  ? 64.005  5.631   -17.818 1.00 0.00 ? 80  TYR A N    2  
ATOM 5743  C CA   . TYR A 1 80  ? 63.424  4.308   -17.529 1.00 0.00 ? 80  TYR A CA   2  
ATOM 5744  C C    . TYR A 1 80  ? 64.054  3.220   -18.408 1.00 0.00 ? 80  TYR A C    2  
ATOM 5745  O O    . TYR A 1 80  ? 63.890  3.218   -19.628 1.00 0.00 ? 80  TYR A O    2  
ATOM 5746  C CB   . TYR A 1 80  ? 61.879  4.410   -17.738 1.00 0.00 ? 80  TYR A CB   2  
ATOM 5747  C CG   . TYR A 1 80  ? 61.317  3.252   -18.556 1.00 0.00 ? 80  TYR A CG   2  
ATOM 5748  C CD1  . TYR A 1 80  ? 61.462  1.927   -18.094 1.00 0.00 ? 80  TYR A CD1  2  
ATOM 5749  C CD2  . TYR A 1 80  ? 60.644  3.502   -19.777 1.00 0.00 ? 80  TYR A CD2  2  
ATOM 5750  C CE1  . TYR A 1 80  ? 60.937  0.854   -18.848 1.00 0.00 ? 80  TYR A CE1  2  
ATOM 5751  C CE2  . TYR A 1 80  ? 60.121  2.428   -20.529 1.00 0.00 ? 80  TYR A CE2  2  
ATOM 5752  C CZ   . TYR A 1 80  ? 60.267  1.105   -20.065 1.00 0.00 ? 80  TYR A CZ   2  
ATOM 5753  O OH   . TYR A 1 80  ? 59.669  0.066   -20.747 1.00 0.00 ? 80  TYR A OH   2  
ATOM 5754  H H    . TYR A 1 80  ? 63.958  5.983   -18.731 1.00 0.00 ? 80  TYR A H    2  
ATOM 5755  H HA   . TYR A 1 80  ? 63.617  4.048   -16.493 1.00 0.00 ? 80  TYR A HA   2  
ATOM 5756  H HB2  . TYR A 1 80  ? 61.384  4.423   -16.777 1.00 0.00 ? 80  TYR A HB2  2  
ATOM 5757  H HB3  . TYR A 1 80  ? 61.664  5.339   -18.247 1.00 0.00 ? 80  TYR A HB3  2  
ATOM 5758  H HD1  . TYR A 1 80  ? 61.975  1.732   -17.164 1.00 0.00 ? 80  TYR A HD1  2  
ATOM 5759  H HD2  . TYR A 1 80  ? 60.529  4.514   -20.135 1.00 0.00 ? 80  TYR A HD2  2  
ATOM 5760  H HE1  . TYR A 1 80  ? 61.048  -0.159  -18.495 1.00 0.00 ? 80  TYR A HE1  2  
ATOM 5761  H HE2  . TYR A 1 80  ? 59.609  2.620   -21.460 1.00 0.00 ? 80  TYR A HE2  2  
ATOM 5762  H HH   . TYR A 1 80  ? 60.237  -0.705  -20.674 1.00 0.00 ? 80  TYR A HH   2  
ATOM 5763  N N    . TYR A 1 81  ? 64.762  2.287   -17.765 1.00 0.00 ? 81  TYR A N    2  
ATOM 5764  C CA   . TYR A 1 81  ? 65.406  1.177   -18.473 1.00 0.00 ? 81  TYR A CA   2  
ATOM 5765  C C    . TYR A 1 81  ? 64.489  -0.047  -18.486 1.00 0.00 ? 81  TYR A C    2  
ATOM 5766  O O    . TYR A 1 81  ? 64.052  -0.518  -17.436 1.00 0.00 ? 81  TYR A O    2  
ATOM 5767  C CB   . TYR A 1 81  ? 66.724  0.810   -17.783 1.00 0.00 ? 81  TYR A CB   2  
ATOM 5768  C CG   . TYR A 1 81  ? 67.528  2.062   -17.524 1.00 0.00 ? 81  TYR A CG   2  
ATOM 5769  C CD1  . TYR A 1 81  ? 68.414  2.548   -18.510 1.00 0.00 ? 81  TYR A CD1  2  
ATOM 5770  C CD2  . TYR A 1 81  ? 67.395  2.746   -16.296 1.00 0.00 ? 81  TYR A CD2  2  
ATOM 5771  C CE1  . TYR A 1 81  ? 69.167  3.718   -18.268 1.00 0.00 ? 81  TYR A CE1  2  
ATOM 5772  C CE2  . TYR A 1 81  ? 68.148  3.914   -16.053 1.00 0.00 ? 81  TYR A CE2  2  
ATOM 5773  C CZ   . TYR A 1 81  ? 69.034  4.401   -17.039 1.00 0.00 ? 81  TYR A CZ   2  
ATOM 5774  O OH   . TYR A 1 81  ? 69.743  5.563   -16.816 1.00 0.00 ? 81  TYR A OH   2  
ATOM 5775  H H    . TYR A 1 81  ? 64.854  2.342   -16.790 1.00 0.00 ? 81  TYR A H    2  
ATOM 5776  H HA   . TYR A 1 81  ? 65.618  1.470   -19.491 1.00 0.00 ? 81  TYR A HA   2  
ATOM 5777  H HB2  . TYR A 1 81  ? 66.515  0.317   -16.844 1.00 0.00 ? 81  TYR A HB2  2  
ATOM 5778  H HB3  . TYR A 1 81  ? 67.290  0.147   -18.419 1.00 0.00 ? 81  TYR A HB3  2  
ATOM 5779  H HD1  . TYR A 1 81  ? 68.517  2.025   -19.449 1.00 0.00 ? 81  TYR A HD1  2  
ATOM 5780  H HD2  . TYR A 1 81  ? 66.717  2.374   -15.542 1.00 0.00 ? 81  TYR A HD2  2  
ATOM 5781  H HE1  . TYR A 1 81  ? 69.844  4.090   -19.021 1.00 0.00 ? 81  TYR A HE1  2  
ATOM 5782  H HE2  . TYR A 1 81  ? 68.048  4.434   -15.113 1.00 0.00 ? 81  TYR A HE2  2  
ATOM 5783  H HH   . TYR A 1 81  ? 70.670  5.332   -16.717 1.00 0.00 ? 81  TYR A HH   2  
ATOM 5784  N N    . SER A 1 82  ? 64.196  -0.555  -19.686 1.00 0.00 ? 82  SER A N    2  
ATOM 5785  C CA   . SER A 1 82  ? 63.322  -1.725  -19.839 1.00 0.00 ? 82  SER A CA   2  
ATOM 5786  C C    . SER A 1 82  ? 64.141  -3.009  -19.967 1.00 0.00 ? 82  SER A C    2  
ATOM 5787  O O    . SER A 1 82  ? 64.216  -3.603  -21.042 1.00 0.00 ? 82  SER A O    2  
ATOM 5788  C CB   . SER A 1 82  ? 62.449  -1.556  -21.085 1.00 0.00 ? 82  SER A CB   2  
ATOM 5789  O OG   . SER A 1 82  ? 61.391  -2.506  -21.049 1.00 0.00 ? 82  SER A OG   2  
ATOM 5790  H H    . SER A 1 82  ? 64.572  -0.131  -20.486 1.00 0.00 ? 82  SER A H    2  
ATOM 5791  H HA   . SER A 1 82  ? 62.676  -1.811  -18.976 1.00 0.00 ? 82  SER A HA   2  
ATOM 5792  H HB2  . SER A 1 82  ? 62.033  -0.564  -21.102 1.00 0.00 ? 82  SER A HB2  2  
ATOM 5793  H HB3  . SER A 1 82  ? 63.051  -1.704  -21.971 1.00 0.00 ? 82  SER A HB3  2  
ATOM 5794  H HG   . SER A 1 82  ? 61.545  -3.146  -21.747 1.00 0.00 ? 82  SER A HG   2  
ATOM 5795  N N    . ILE A 1 83  ? 64.749  -3.432  -18.864 1.00 0.00 ? 83  ILE A N    2  
ATOM 5796  C CA   . ILE A 1 83  ? 65.557  -4.649  -18.864 1.00 0.00 ? 83  ILE A CA   2  
ATOM 5797  C C    . ILE A 1 83  ? 64.650  -5.880  -18.957 1.00 0.00 ? 83  ILE A C    2  
ATOM 5798  O O    . ILE A 1 83  ? 63.914  -6.196  -18.022 1.00 0.00 ? 83  ILE A O    2  
ATOM 5799  C CB   . ILE A 1 83  ? 66.440  -4.713  -17.579 1.00 0.00 ? 83  ILE A CB   2  
ATOM 5800  C CG1  . ILE A 1 83  ? 66.933  -6.149  -17.272 1.00 0.00 ? 83  ILE A CG1  2  
ATOM 5801  C CG2  . ILE A 1 83  ? 65.634  -4.194  -16.384 1.00 0.00 ? 83  ILE A CG2  2  
ATOM 5802  C CD1  . ILE A 1 83  ? 67.710  -6.720  -18.462 1.00 0.00 ? 83  ILE A CD1  2  
ATOM 5803  H H    . ILE A 1 83  ? 64.654  -2.917  -18.037 1.00 0.00 ? 83  ILE A H    2  
ATOM 5804  H HA   . ILE A 1 83  ? 66.204  -4.631  -19.730 1.00 0.00 ? 83  ILE A HA   2  
ATOM 5805  H HB   . ILE A 1 83  ? 67.297  -4.068  -17.720 1.00 0.00 ? 83  ILE A HB   2  
ATOM 5806  H HG12 . ILE A 1 83  ? 67.587  -6.115  -16.412 1.00 0.00 ? 83  ILE A HG12 2  
ATOM 5807  H HG13 . ILE A 1 83  ? 66.094  -6.788  -17.046 1.00 0.00 ? 83  ILE A HG13 2  
ATOM 5808  H HG21 . ILE A 1 83  ? 66.148  -4.433  -15.464 1.00 0.00 ? 83  ILE A HG21 2  
ATOM 5809  H HG22 . ILE A 1 83  ? 64.661  -4.656  -16.382 1.00 0.00 ? 83  ILE A HG22 2  
ATOM 5810  H HG23 . ILE A 1 83  ? 65.521  -3.123  -16.463 1.00 0.00 ? 83  ILE A HG23 2  
ATOM 5811  H HD11 . ILE A 1 83  ? 67.072  -6.770  -19.329 1.00 0.00 ? 83  ILE A HD11 2  
ATOM 5812  H HD12 . ILE A 1 83  ? 68.057  -7.712  -18.218 1.00 0.00 ? 83  ILE A HD12 2  
ATOM 5813  H HD13 . ILE A 1 83  ? 68.557  -6.086  -18.674 1.00 0.00 ? 83  ILE A HD13 2  
ATOM 5814  N N    . ILE A 1 84  ? 64.724  -6.577  -20.092 1.00 0.00 ? 84  ILE A N    2  
ATOM 5815  C CA   . ILE A 1 84  ? 63.927  -7.787  -20.317 1.00 0.00 ? 84  ILE A CA   2  
ATOM 5816  C C    . ILE A 1 84  ? 64.796  -9.022  -20.074 1.00 0.00 ? 84  ILE A C    2  
ATOM 5817  O O    . ILE A 1 84  ? 65.991  -9.007  -20.370 1.00 0.00 ? 84  ILE A O    2  
ATOM 5818  C CB   . ILE A 1 84  ? 63.405  -7.831  -21.775 1.00 0.00 ? 84  ILE A CB   2  
ATOM 5819  C CG1  . ILE A 1 84  ? 62.820  -6.456  -22.170 1.00 0.00 ? 84  ILE A CG1  2  
ATOM 5820  C CG2  . ILE A 1 84  ? 62.348  -8.944  -21.933 1.00 0.00 ? 84  ILE A CG2  2  
ATOM 5821  C CD1  . ILE A 1 84  ? 61.824  -5.952  -21.119 1.00 0.00 ? 84  ILE A CD1  2  
ATOM 5822  H H    . ILE A 1 84  ? 65.338  -6.278  -20.795 1.00 0.00 ? 84  ILE A H    2  
ATOM 5823  H HA   . ILE A 1 84  ? 63.087  -7.806  -19.636 1.00 0.00 ? 84  ILE A HA   2  
ATOM 5824  H HB   . ILE A 1 84  ? 64.237  -8.050  -22.433 1.00 0.00 ? 84  ILE A HB   2  
ATOM 5825  H HG12 . ILE A 1 84  ? 63.627  -5.744  -22.256 1.00 0.00 ? 84  ILE A HG12 2  
ATOM 5826  H HG13 . ILE A 1 84  ? 62.320  -6.536  -23.124 1.00 0.00 ? 84  ILE A HG13 2  
ATOM 5827  H HG21 . ILE A 1 84  ? 61.772  -8.781  -22.832 1.00 0.00 ? 84  ILE A HG21 2  
ATOM 5828  H HG22 . ILE A 1 84  ? 61.685  -8.955  -21.082 1.00 0.00 ? 84  ILE A HG22 2  
ATOM 5829  H HG23 . ILE A 1 84  ? 62.845  -9.900  -22.002 1.00 0.00 ? 84  ILE A HG23 2  
ATOM 5830  H HD11 . ILE A 1 84  ? 62.357  -5.649  -20.232 1.00 0.00 ? 84  ILE A HD11 2  
ATOM 5831  H HD12 . ILE A 1 84  ? 61.126  -6.733  -20.871 1.00 0.00 ? 84  ILE A HD12 2  
ATOM 5832  H HD13 . ILE A 1 84  ? 61.285  -5.105  -21.517 1.00 0.00 ? 84  ILE A HD13 2  
ATOM 5833  N N    . GLY A 1 85  ? 64.202  -10.090 -19.540 1.00 0.00 ? 85  GLY A N    2  
ATOM 5834  C CA   . GLY A 1 85  ? 64.951  -11.315 -19.277 1.00 0.00 ? 85  GLY A CA   2  
ATOM 5835  C C    . GLY A 1 85  ? 64.357  -12.120 -18.140 1.00 0.00 ? 85  GLY A C    2  
ATOM 5836  O O    . GLY A 1 85  ? 63.479  -11.644 -17.421 1.00 0.00 ? 85  GLY A O    2  
ATOM 5837  H H    . GLY A 1 85  ? 63.244  -10.054 -19.326 1.00 0.00 ? 85  GLY A H    2  
ATOM 5838  H HA2  . GLY A 1 85  ? 64.951  -11.921 -20.171 1.00 0.00 ? 85  GLY A HA2  2  
ATOM 5839  H HA3  . GLY A 1 85  ? 65.974  -11.065 -19.024 1.00 0.00 ? 85  GLY A HA3  2  
ATOM 5840  N N    . GLY A 1 86  ? 64.843  -13.347 -17.977 1.00 0.00 ? 86  GLY A N    2  
ATOM 5841  C CA   . GLY A 1 86  ? 64.355  -14.212 -16.921 1.00 0.00 ? 86  GLY A CA   2  
ATOM 5842  C C    . GLY A 1 86  ? 62.863  -14.448 -17.030 1.00 0.00 ? 86  GLY A C    2  
ATOM 5843  O O    . GLY A 1 86  ? 62.209  -14.818 -16.055 1.00 0.00 ? 86  GLY A O    2  
ATOM 5844  H H    . GLY A 1 86  ? 65.546  -13.672 -18.577 1.00 0.00 ? 86  GLY A H    2  
ATOM 5845  H HA2  . GLY A 1 86  ? 64.867  -15.162 -16.978 1.00 0.00 ? 86  GLY A HA2  2  
ATOM 5846  H HA3  . GLY A 1 86  ? 64.571  -13.754 -15.967 1.00 0.00 ? 86  GLY A HA3  2  
ATOM 5847  N N    . GLY A 1 87  ? 62.323  -14.221 -18.223 1.00 0.00 ? 87  GLY A N    2  
ATOM 5848  C CA   . GLY A 1 87  ? 60.902  -14.402 -18.449 1.00 0.00 ? 87  GLY A CA   2  
ATOM 5849  C C    . GLY A 1 87  ? 60.093  -13.302 -17.797 1.00 0.00 ? 87  GLY A C    2  
ATOM 5850  O O    . GLY A 1 87  ? 58.868  -13.381 -17.714 1.00 0.00 ? 87  GLY A O    2  
ATOM 5851  H H    . GLY A 1 87  ? 62.893  -13.919 -18.960 1.00 0.00 ? 87  GLY A H    2  
ATOM 5852  H HA2  . GLY A 1 87  ? 60.711  -14.398 -19.513 1.00 0.00 ? 87  GLY A HA2  2  
ATOM 5853  H HA3  . GLY A 1 87  ? 60.597  -15.355 -18.041 1.00 0.00 ? 87  GLY A HA3  2  
ATOM 5854  N N    . LEU A 1 88  ? 60.792  -12.270 -17.323 1.00 0.00 ? 88  LEU A N    2  
ATOM 5855  C CA   . LEU A 1 88  ? 60.149  -11.133 -16.658 1.00 0.00 ? 88  LEU A CA   2  
ATOM 5856  C C    . LEU A 1 88  ? 60.652  -9.816  -17.243 1.00 0.00 ? 88  LEU A C    2  
ATOM 5857  O O    . LEU A 1 88  ? 61.753  -9.743  -17.789 1.00 0.00 ? 88  LEU A O    2  
ATOM 5858  C CB   . LEU A 1 88  ? 60.470  -11.177 -15.155 1.00 0.00 ? 88  LEU A CB   2  
ATOM 5859  C CG   . LEU A 1 88  ? 59.771  -12.393 -14.486 1.00 0.00 ? 88  LEU A CG   2  
ATOM 5860  C CD1  . LEU A 1 88  ? 60.575  -12.857 -13.262 1.00 0.00 ? 88  LEU A CD1  2  
ATOM 5861  C CD2  . LEU A 1 88  ? 58.352  -12.009 -14.036 1.00 0.00 ? 88  LEU A CD2  2  
ATOM 5862  H H    . LEU A 1 88  ? 61.767  -12.275 -17.416 1.00 0.00 ? 88  LEU A H    2  
ATOM 5863  H HA   . LEU A 1 88  ? 59.079  -11.185 -16.791 1.00 0.00 ? 88  LEU A HA   2  
ATOM 5864  H HB2  . LEU A 1 88  ? 61.542  -11.258 -15.032 1.00 0.00 ? 88  LEU A HB2  2  
ATOM 5865  H HB3  . LEU A 1 88  ? 60.130  -10.260 -14.690 1.00 0.00 ? 88  LEU A HB3  2  
ATOM 5866  H HG   . LEU A 1 88  ? 59.712  -13.212 -15.191 1.00 0.00 ? 88  LEU A HG   2  
ATOM 5867  H HD11 . LEU A 1 88  ? 60.858  -11.999 -12.671 1.00 0.00 ? 88  LEU A HD11 2  
ATOM 5868  H HD12 . LEU A 1 88  ? 61.464  -13.373 -13.594 1.00 0.00 ? 88  LEU A HD12 2  
ATOM 5869  H HD13 . LEU A 1 88  ? 59.976  -13.527 -12.662 1.00 0.00 ? 88  LEU A HD13 2  
ATOM 5870  H HD21 . LEU A 1 88  ? 57.811  -12.903 -13.771 1.00 0.00 ? 88  LEU A HD21 2  
ATOM 5871  H HD22 . LEU A 1 88  ? 57.838  -11.504 -14.838 1.00 0.00 ? 88  LEU A HD22 2  
ATOM 5872  H HD23 . LEU A 1 88  ? 58.409  -11.355 -13.178 1.00 0.00 ? 88  LEU A HD23 2  
ATOM 5873  N N    . ARG A 1 89  ? 59.830  -8.775  -17.115 1.00 0.00 ? 89  ARG A N    2  
ATOM 5874  C CA   . ARG A 1 89  ? 60.168  -7.437  -17.616 1.00 0.00 ? 89  ARG A CA   2  
ATOM 5875  C C    . ARG A 1 89  ? 60.141  -6.447  -16.457 1.00 0.00 ? 89  ARG A C    2  
ATOM 5876  O O    . ARG A 1 89  ? 59.072  -6.098  -15.970 1.00 0.00 ? 89  ARG A O    2  
ATOM 5877  C CB   . ARG A 1 89  ? 59.144  -7.024  -18.690 1.00 0.00 ? 89  ARG A CB   2  
ATOM 5878  C CG   . ARG A 1 89  ? 59.264  -5.522  -19.002 1.00 0.00 ? 89  ARG A CG   2  
ATOM 5879  C CD   . ARG A 1 89  ? 58.535  -5.202  -20.309 1.00 0.00 ? 89  ARG A CD   2  
ATOM 5880  N NE   . ARG A 1 89  ? 58.679  -3.751  -20.614 1.00 0.00 ? 89  ARG A NE   2  
ATOM 5881  C CZ   . ARG A 1 89  ? 58.105  -3.246  -21.672 1.00 0.00 ? 89  ARG A CZ   2  
ATOM 5882  N NH1  . ARG A 1 89  ? 57.141  -3.896  -22.265 1.00 0.00 ? 89  ARG A NH1  2  
ATOM 5883  N NH2  . ARG A 1 89  ? 58.496  -2.092  -22.138 1.00 0.00 ? 89  ARG A NH2  2  
ATOM 5884  H H    . ARG A 1 89  ? 58.971  -8.904  -16.662 1.00 0.00 ? 89  ARG A H    2  
ATOM 5885  H HA   . ARG A 1 89  ? 61.158  -7.442  -18.055 1.00 0.00 ? 89  ARG A HA   2  
ATOM 5886  H HB2  . ARG A 1 89  ? 59.327  -7.595  -19.590 1.00 0.00 ? 89  ARG A HB2  2  
ATOM 5887  H HB3  . ARG A 1 89  ? 58.148  -7.234  -18.332 1.00 0.00 ? 89  ARG A HB3  2  
ATOM 5888  H HG2  . ARG A 1 89  ? 58.820  -4.955  -18.197 1.00 0.00 ? 89  ARG A HG2  2  
ATOM 5889  H HG3  . ARG A 1 89  ? 60.304  -5.254  -19.095 1.00 0.00 ? 89  ARG A HG3  2  
ATOM 5890  H HD2  . ARG A 1 89  ? 58.964  -5.782  -21.113 1.00 0.00 ? 89  ARG A HD2  2  
ATOM 5891  H HD3  . ARG A 1 89  ? 57.488  -5.446  -20.208 1.00 0.00 ? 89  ARG A HD3  2  
ATOM 5892  H HE   . ARG A 1 89  ? 59.203  -3.174  -20.020 1.00 0.00 ? 89  ARG A HE   2  
ATOM 5893  H HH11 . ARG A 1 89  ? 56.841  -4.781  -21.907 1.00 0.00 ? 89  ARG A HH11 2  
ATOM 5894  H HH12 . ARG A 1 89  ? 56.702  -3.510  -23.076 1.00 0.00 ? 89  ARG A HH12 2  
ATOM 5895  H HH21 . ARG A 1 89  ? 59.235  -1.593  -21.684 1.00 0.00 ? 89  ARG A HH21 2  
ATOM 5896  H HH22 . ARG A 1 89  ? 58.057  -1.705  -22.950 1.00 0.00 ? 89  ARG A HH22 2  
ATOM 5897  N N    . MET A 1 90  ? 61.320  -6.004  -16.016 1.00 0.00 ? 90  MET A N    2  
ATOM 5898  C CA   . MET A 1 90  ? 61.419  -5.058  -14.895 1.00 0.00 ? 90  MET A CA   2  
ATOM 5899  C C    . MET A 1 90  ? 61.674  -3.642  -15.398 1.00 0.00 ? 90  MET A C    2  
ATOM 5900  O O    . MET A 1 90  ? 62.773  -3.316  -15.842 1.00 0.00 ? 90  MET A O    2  
ATOM 5901  C CB   . MET A 1 90  ? 62.556  -5.475  -13.958 1.00 0.00 ? 90  MET A CB   2  
ATOM 5902  C CG   . MET A 1 90  ? 62.381  -6.940  -13.550 1.00 0.00 ? 90  MET A CG   2  
ATOM 5903  S SD   . MET A 1 90  ? 63.800  -7.457  -12.547 1.00 0.00 ? 90  MET A SD   2  
ATOM 5904  C CE   . MET A 1 90  ? 63.898  -9.171  -13.124 1.00 0.00 ? 90  MET A CE   2  
ATOM 5905  H H    . MET A 1 90  ? 62.142  -6.324  -16.443 1.00 0.00 ? 90  MET A H    2  
ATOM 5906  H HA   . MET A 1 90  ? 60.496  -5.063  -14.333 1.00 0.00 ? 90  MET A HA   2  
ATOM 5907  H HB2  . MET A 1 90  ? 63.501  -5.354  -14.463 1.00 0.00 ? 90  MET A HB2  2  
ATOM 5908  H HB3  . MET A 1 90  ? 62.539  -4.854  -13.075 1.00 0.00 ? 90  MET A HB3  2  
ATOM 5909  H HG2  . MET A 1 90  ? 61.474  -7.046  -12.973 1.00 0.00 ? 90  MET A HG2  2  
ATOM 5910  H HG3  . MET A 1 90  ? 62.318  -7.555  -14.435 1.00 0.00 ? 90  MET A HG3  2  
ATOM 5911  H HE1  . MET A 1 90  ? 64.099  -9.182  -14.185 1.00 0.00 ? 90  MET A HE1  2  
ATOM 5912  H HE2  . MET A 1 90  ? 62.961  -9.671  -12.930 1.00 0.00 ? 90  MET A HE2  2  
ATOM 5913  H HE3  . MET A 1 90  ? 64.694  -9.681  -12.602 1.00 0.00 ? 90  MET A HE3  2  
ATOM 5914  N N    . ASN A 1 91  ? 60.640  -2.802  -15.321 1.00 0.00 ? 91  ASN A N    2  
ATOM 5915  C CA   . ASN A 1 91  ? 60.741  -1.409  -15.764 1.00 0.00 ? 91  ASN A CA   2  
ATOM 5916  C C    . ASN A 1 91  ? 61.055  -0.494  -14.585 1.00 0.00 ? 91  ASN A C    2  
ATOM 5917  O O    . ASN A 1 91  ? 60.366  -0.518  -13.566 1.00 0.00 ? 91  ASN A O    2  
ATOM 5918  C CB   . ASN A 1 91  ? 59.423  -0.974  -16.407 1.00 0.00 ? 91  ASN A CB   2  
ATOM 5919  C CG   . ASN A 1 91  ? 59.163  -1.816  -17.659 1.00 0.00 ? 91  ASN A CG   2  
ATOM 5920  O OD1  . ASN A 1 91  ? 60.056  -2.464  -18.165 1.00 0.00 ? 91  ASN A OD1  2  
ATOM 5921  N ND2  . ASN A 1 91  ? 57.968  -1.831  -18.182 1.00 0.00 ? 91  ASN A ND2  2  
ATOM 5922  H H    . ASN A 1 91  ? 59.791  -3.123  -14.954 1.00 0.00 ? 91  ASN A H    2  
ATOM 5923  H HA   . ASN A 1 91  ? 61.531  -1.319  -16.497 1.00 0.00 ? 91  ASN A HA   2  
ATOM 5924  H HB2  . ASN A 1 91  ? 58.616  -1.117  -15.703 1.00 0.00 ? 91  ASN A HB2  2  
ATOM 5925  H HB3  . ASN A 1 91  ? 59.482  0.067   -16.682 1.00 0.00 ? 91  ASN A HB3  2  
ATOM 5926  H HD21 . ASN A 1 91  ? 57.247  -1.308  -17.774 1.00 0.00 ? 91  ASN A HD21 2  
ATOM 5927  H HD22 . ASN A 1 91  ? 57.791  -2.367  -18.984 1.00 0.00 ? 91  ASN A HD22 2  
ATOM 5928  N N    . PHE A 1 92  ? 62.101  0.319   -14.737 1.00 0.00 ? 92  PHE A N    2  
ATOM 5929  C CA   . PHE A 1 92  ? 62.514  1.256   -13.686 1.00 0.00 ? 92  PHE A CA   2  
ATOM 5930  C C    . PHE A 1 92  ? 62.062  2.672   -14.031 1.00 0.00 ? 92  PHE A C    2  
ATOM 5931  O O    . PHE A 1 92  ? 61.288  2.876   -14.966 1.00 0.00 ? 92  PHE A O    2  
ATOM 5932  C CB   . PHE A 1 92  ? 64.040  1.228   -13.536 1.00 0.00 ? 92  PHE A CB   2  
ATOM 5933  C CG   . PHE A 1 92  ? 64.465  -0.091  -12.925 1.00 0.00 ? 92  PHE A CG   2  
ATOM 5934  C CD1  . PHE A 1 92  ? 64.411  -1.273  -13.696 1.00 0.00 ? 92  PHE A CD1  2  
ATOM 5935  C CD2  . PHE A 1 92  ? 64.915  -0.145  -11.584 1.00 0.00 ? 92  PHE A CD2  2  
ATOM 5936  C CE1  . PHE A 1 92  ? 64.804  -2.505  -13.130 1.00 0.00 ? 92  PHE A CE1  2  
ATOM 5937  C CE2  . PHE A 1 92  ? 65.308  -1.378  -11.020 1.00 0.00 ? 92  PHE A CE2  2  
ATOM 5938  C CZ   . PHE A 1 92  ? 65.254  -2.558  -11.792 1.00 0.00 ? 92  PHE A CZ   2  
ATOM 5939  H H    . PHE A 1 92  ? 62.604  0.291   -15.577 1.00 0.00 ? 92  PHE A H    2  
ATOM 5940  H HA   . PHE A 1 92  ? 62.067  0.969   -12.742 1.00 0.00 ? 92  PHE A HA   2  
ATOM 5941  H HB2  . PHE A 1 92  ? 64.496  1.336   -14.510 1.00 0.00 ? 92  PHE A HB2  2  
ATOM 5942  H HB3  . PHE A 1 92  ? 64.355  2.042   -12.899 1.00 0.00 ? 92  PHE A HB3  2  
ATOM 5943  H HD1  . PHE A 1 92  ? 64.067  -1.234  -14.719 1.00 0.00 ? 92  PHE A HD1  2  
ATOM 5944  H HD2  . PHE A 1 92  ? 64.957  0.757   -10.992 1.00 0.00 ? 92  PHE A HD2  2  
ATOM 5945  H HE1  . PHE A 1 92  ? 64.762  -3.409  -13.721 1.00 0.00 ? 92  PHE A HE1  2  
ATOM 5946  H HE2  . PHE A 1 92  ? 65.652  -1.418  -9.997  1.00 0.00 ? 92  PHE A HE2  2  
ATOM 5947  H HZ   . PHE A 1 92  ? 65.612  -3.489  -11.381 1.00 0.00 ? 92  PHE A HZ   2  
ATOM 5948  N N    . GLY A 1 93  ? 62.549  3.645   -13.269 1.00 0.00 ? 93  GLY A N    2  
ATOM 5949  C CA   . GLY A 1 93  ? 62.190  5.033   -13.499 1.00 0.00 ? 93  GLY A CA   2  
ATOM 5950  C C    . GLY A 1 93  ? 62.936  5.966   -12.566 1.00 0.00 ? 93  GLY A C    2  
ATOM 5951  O O    . GLY A 1 93  ? 62.361  6.505   -11.620 1.00 0.00 ? 93  GLY A O    2  
ATOM 5952  H H    . GLY A 1 93  ? 63.161  3.421   -12.537 1.00 0.00 ? 93  GLY A H    2  
ATOM 5953  H HA2  . GLY A 1 93  ? 62.428  5.293   -14.519 1.00 0.00 ? 93  GLY A HA2  2  
ATOM 5954  H HA3  . GLY A 1 93  ? 61.129  5.153   -13.342 1.00 0.00 ? 93  GLY A HA3  2  
ATOM 5955  N N    . PHE A 1 94  ? 64.230  6.138   -12.822 1.00 0.00 ? 94  PHE A N    2  
ATOM 5956  C CA   . PHE A 1 94  ? 65.059  6.995   -11.981 1.00 0.00 ? 94  PHE A CA   2  
ATOM 5957  C C    . PHE A 1 94  ? 64.797  8.466   -12.276 1.00 0.00 ? 94  PHE A C    2  
ATOM 5958  O O    . PHE A 1 94  ? 64.705  8.875   -13.434 1.00 0.00 ? 94  PHE A O    2  
ATOM 5959  C CB   . PHE A 1 94  ? 66.537  6.687   -12.226 1.00 0.00 ? 94  PHE A CB   2  
ATOM 5960  C CG   . PHE A 1 94  ? 66.854  5.288   -11.748 1.00 0.00 ? 94  PHE A CG   2  
ATOM 5961  C CD1  . PHE A 1 94  ? 66.614  4.184   -12.595 1.00 0.00 ? 94  PHE A CD1  2  
ATOM 5962  C CD2  . PHE A 1 94  ? 67.393  5.084   -10.459 1.00 0.00 ? 94  PHE A CD2  2  
ATOM 5963  C CE1  . PHE A 1 94  ? 66.911  2.876   -12.152 1.00 0.00 ? 94  PHE A CE1  2  
ATOM 5964  C CE2  . PHE A 1 94  ? 67.691  3.777   -10.017 1.00 0.00 ? 94  PHE A CE2  2  
ATOM 5965  C CZ   . PHE A 1 94  ? 67.450  2.673   -10.863 1.00 0.00 ? 94  PHE A CZ   2  
ATOM 5966  H H    . PHE A 1 94  ? 64.636  5.661   -13.576 1.00 0.00 ? 94  PHE A H    2  
ATOM 5967  H HA   . PHE A 1 94  ? 64.832  6.800   -10.945 1.00 0.00 ? 94  PHE A HA   2  
ATOM 5968  H HB2  . PHE A 1 94  ? 66.748  6.761   -13.280 1.00 0.00 ? 94  PHE A HB2  2  
ATOM 5969  H HB3  . PHE A 1 94  ? 67.146  7.397   -11.688 1.00 0.00 ? 94  PHE A HB3  2  
ATOM 5970  H HD1  . PHE A 1 94  ? 66.202  4.339   -13.581 1.00 0.00 ? 94  PHE A HD1  2  
ATOM 5971  H HD2  . PHE A 1 94  ? 67.576  5.928   -9.810  1.00 0.00 ? 94  PHE A HD2  2  
ATOM 5972  H HE1  . PHE A 1 94  ? 66.727  2.033   -12.800 1.00 0.00 ? 94  PHE A HE1  2  
ATOM 5973  H HE2  . PHE A 1 94  ? 68.102  3.622   -9.032  1.00 0.00 ? 94  PHE A HE2  2  
ATOM 5974  H HZ   . PHE A 1 94  ? 67.765  1.684   -10.561 1.00 0.00 ? 94  PHE A HZ   2  
ATOM 5975  N N    . THR A 1 95  ? 64.676  9.260   -11.211 1.00 0.00 ? 95  THR A N    2  
ATOM 5976  C CA   . THR A 1 95  ? 64.421  10.697  -11.336 1.00 0.00 ? 95  THR A CA   2  
ATOM 5977  C C    . THR A 1 95  ? 65.239  11.464  -10.302 1.00 0.00 ? 95  THR A C    2  
ATOM 5978  O O    . THR A 1 95  ? 65.134  11.207  -9.103  1.00 0.00 ? 95  THR A O    2  
ATOM 5979  C CB   . THR A 1 95  ? 62.928  11.008  -11.108 1.00 0.00 ? 95  THR A CB   2  
ATOM 5980  O OG1  . THR A 1 95  ? 62.148  10.276  -12.041 1.00 0.00 ? 95  THR A OG1  2  
ATOM 5981  C CG2  . THR A 1 95  ? 62.680  12.505  -11.295 1.00 0.00 ? 95  THR A CG2  2  
ATOM 5982  H H    . THR A 1 95  ? 64.758  8.871   -10.315 1.00 0.00 ? 95  THR A H    2  
ATOM 5983  H HA   . THR A 1 95  ? 64.702  11.035  -12.324 1.00 0.00 ? 95  THR A HA   2  
ATOM 5984  H HB   . THR A 1 95  ? 62.652  10.724  -10.105 1.00 0.00 ? 95  THR A HB   2  
ATOM 5985  H HG1  . THR A 1 95  ? 61.379  10.807  -12.266 1.00 0.00 ? 95  THR A HG1  2  
ATOM 5986  H HG21 . THR A 1 95  ? 63.144  12.837  -12.212 1.00 0.00 ? 95  THR A HG21 2  
ATOM 5987  H HG22 . THR A 1 95  ? 63.101  13.047  -10.461 1.00 0.00 ? 95  THR A HG22 2  
ATOM 5988  H HG23 . THR A 1 95  ? 61.616  12.690  -11.343 1.00 0.00 ? 95  THR A HG23 2  
ATOM 5989  N N    . LYS A 1 96  ? 66.066  12.390  -10.781 1.00 0.00 ? 96  LYS A N    2  
ATOM 5990  C CA   . LYS A 1 96  ? 66.920  13.184  -9.900  1.00 0.00 ? 96  LYS A CA   2  
ATOM 5991  C C    . LYS A 1 96  ? 67.827  12.278  -9.075  1.00 0.00 ? 96  LYS A C    2  
ATOM 5992  O O    . LYS A 1 96  ? 68.169  12.597  -7.936  1.00 0.00 ? 96  LYS A O    2  
ATOM 5993  C CB   . LYS A 1 96  ? 66.073  14.059  -8.968  1.00 0.00 ? 96  LYS A CB   2  
ATOM 5994  C CG   . LYS A 1 96  ? 65.363  15.141  -9.785  1.00 0.00 ? 96  LYS A CG   2  
ATOM 5995  C CD   . LYS A 1 96  ? 64.391  15.906  -8.884  1.00 0.00 ? 96  LYS A CD   2  
ATOM 5996  C CE   . LYS A 1 96  ? 63.545  16.854  -9.735  1.00 0.00 ? 96  LYS A CE   2  
ATOM 5997  N NZ   . LYS A 1 96  ? 64.436  17.828  -10.427 1.00 0.00 ? 96  LYS A NZ   2  
ATOM 5998  H H    . LYS A 1 96  ? 66.119  12.530  -11.749 1.00 0.00 ? 96  LYS A H    2  
ATOM 5999  H HA   . LYS A 1 96  ? 67.539  13.827  -10.509 1.00 0.00 ? 96  LYS A HA   2  
ATOM 6000  H HB2  . LYS A 1 96  ? 65.341  13.450  -8.463  1.00 0.00 ? 96  LYS A HB2  2  
ATOM 6001  H HB3  . LYS A 1 96  ? 66.715  14.528  -8.238  1.00 0.00 ? 96  LYS A HB3  2  
ATOM 6002  H HG2  . LYS A 1 96  ? 66.096  15.826  -10.189 1.00 0.00 ? 96  LYS A HG2  2  
ATOM 6003  H HG3  . LYS A 1 96  ? 64.816  14.682  -10.594 1.00 0.00 ? 96  LYS A HG3  2  
ATOM 6004  H HD2  . LYS A 1 96  ? 63.746  15.205  -8.375  1.00 0.00 ? 96  LYS A HD2  2  
ATOM 6005  H HD3  . LYS A 1 96  ? 64.948  16.478  -8.157  1.00 0.00 ? 96  LYS A HD3  2  
ATOM 6006  H HE2  . LYS A 1 96  ? 62.995  16.285  -10.469 1.00 0.00 ? 96  LYS A HE2  2  
ATOM 6007  H HE3  . LYS A 1 96  ? 62.853  17.388  -9.100  1.00 0.00 ? 96  LYS A HE3  2  
ATOM 6008  H HZ1  . LYS A 1 96  ? 64.747  17.429  -11.336 1.00 0.00 ? 96  LYS A HZ1  2  
ATOM 6009  H HZ2  . LYS A 1 96  ? 65.266  18.023  -9.832  1.00 0.00 ? 96  LYS A HZ2  2  
ATOM 6010  H HZ3  . LYS A 1 96  ? 63.917  18.711  -10.600 1.00 0.00 ? 96  LYS A HZ3  2  
ATOM 6011  N N    . CYS A 1 97  ? 68.221  11.148  -9.668  1.00 0.00 ? 97  CYS A N    2  
ATOM 6012  C CA   . CYS A 1 97  ? 69.105  10.181  -9.003  1.00 0.00 ? 97  CYS A CA   2  
ATOM 6013  C C    . CYS A 1 97  ? 70.375  9.985   -9.838  1.00 0.00 ? 97  CYS A C    2  
ATOM 6014  O O    . CYS A 1 97  ? 70.325  10.097  -11.062 1.00 0.00 ? 97  CYS A O    2  
ATOM 6015  C CB   . CYS A 1 97  ? 68.389  8.835   -8.865  1.00 0.00 ? 97  CYS A CB   2  
ATOM 6016  S SG   . CYS A 1 97  ? 66.830  9.059   -7.976  1.00 0.00 ? 97  CYS A SG   2  
ATOM 6017  H H    . CYS A 1 97  ? 67.917  10.961  -10.581 1.00 0.00 ? 97  CYS A H    2  
ATOM 6018  H HA   . CYS A 1 97  ? 69.365  10.542  -8.020  1.00 0.00 ? 97  CYS A HA   2  
ATOM 6019  H HB2  . CYS A 1 97  ? 68.188  8.435   -9.846  1.00 0.00 ? 97  CYS A HB2  2  
ATOM 6020  H HB3  . CYS A 1 97  ? 69.017  8.147   -8.321  1.00 0.00 ? 97  CYS A HB3  2  
ATOM 6021  N N    . PRO A 1 98  ? 71.534  9.682   -9.207  1.00 0.00 ? 98  PRO A N    2  
ATOM 6022  C CA   . PRO A 1 98  ? 72.790  9.468   -9.944  1.00 0.00 ? 98  PRO A CA   2  
ATOM 6023  C C    . PRO A 1 98  ? 72.566  8.712   -11.256 1.00 0.00 ? 98  PRO A C    2  
ATOM 6024  O O    . PRO A 1 98  ? 71.616  7.940   -11.383 1.00 0.00 ? 98  PRO A O    2  
ATOM 6025  C CB   . PRO A 1 98  ? 73.638  8.649   -8.963  1.00 0.00 ? 98  PRO A CB   2  
ATOM 6026  C CG   . PRO A 1 98  ? 73.207  9.125   -7.610  1.00 0.00 ? 98  PRO A CG   2  
ATOM 6027  C CD   . PRO A 1 98  ? 71.728  9.526   -7.749  1.00 0.00 ? 98  PRO A CD   2  
ATOM 6028  H HA   . PRO A 1 98  ? 73.273  10.413  -10.137 1.00 0.00 ? 98  PRO A HA   2  
ATOM 6029  H HB2  . PRO A 1 98  ? 73.430  7.594   -9.079  1.00 0.00 ? 98  PRO A HB2  2  
ATOM 6030  H HB3  . PRO A 1 98  ? 74.691  8.843   -9.113  1.00 0.00 ? 98  PRO A HB3  2  
ATOM 6031  H HG2  . PRO A 1 98  ? 73.321  8.334   -6.878  1.00 0.00 ? 98  PRO A HG2  2  
ATOM 6032  H HG3  . PRO A 1 98  ? 73.791  9.984   -7.313  1.00 0.00 ? 98  PRO A HG3  2  
ATOM 6033  H HD2  . PRO A 1 98  ? 71.084  8.749   -7.359  1.00 0.00 ? 98  PRO A HD2  2  
ATOM 6034  H HD3  . PRO A 1 98  ? 71.539  10.463  -7.245  1.00 0.00 ? 98  PRO A HD3  2  
ATOM 6035  N N    . GLN A 1 99  ? 73.442  8.945   -12.230 1.00 0.00 ? 99  GLN A N    2  
ATOM 6036  C CA   . GLN A 1 99  ? 73.325  8.288   -13.531 1.00 0.00 ? 99  GLN A CA   2  
ATOM 6037  C C    . GLN A 1 99  ? 73.865  6.861   -13.475 1.00 0.00 ? 99  GLN A C    2  
ATOM 6038  O O    . GLN A 1 99  ? 75.073  6.649   -13.374 1.00 0.00 ? 99  GLN A O    2  
ATOM 6039  C CB   . GLN A 1 99  ? 74.103  9.082   -14.585 1.00 0.00 ? 99  GLN A CB   2  
ATOM 6040  C CG   . GLN A 1 99  ? 73.454  10.454  -14.783 1.00 0.00 ? 99  GLN A CG   2  
ATOM 6041  C CD   . GLN A 1 99  ? 73.671  11.310  -13.533 1.00 0.00 ? 99  GLN A CD   2  
ATOM 6042  O OE1  . GLN A 1 99  ? 74.793  11.533  -13.124 1.00 0.00 ? 99  GLN A OE1  2  
ATOM 6043  N NE2  . GLN A 1 99  ? 72.638  11.802  -12.906 1.00 0.00 ? 99  GLN A NE2  2  
ATOM 6044  H H    . GLN A 1 99  ? 74.176  9.575   -12.075 1.00 0.00 ? 99  GLN A H    2  
ATOM 6045  H HA   . GLN A 1 99  ? 72.285  8.257   -13.820 1.00 0.00 ? 99  GLN A HA   2  
ATOM 6046  H HB2  . GLN A 1 99  ? 75.123  9.211   -14.255 1.00 0.00 ? 99  GLN A HB2  2  
ATOM 6047  H HB3  . GLN A 1 99  ? 74.092  8.543   -15.520 1.00 0.00 ? 99  GLN A HB3  2  
ATOM 6048  H HG2  . GLN A 1 99  ? 73.901  10.943  -15.636 1.00 0.00 ? 99  GLN A HG2  2  
ATOM 6049  H HG3  . GLN A 1 99  ? 72.394  10.332  -14.953 1.00 0.00 ? 99  GLN A HG3  2  
ATOM 6050  H HE21 . GLN A 1 99  ? 71.733  11.622  -13.236 1.00 0.00 ? 99  GLN A HE21 2  
ATOM 6051  H HE22 . GLN A 1 99  ? 72.767  12.350  -12.104 1.00 0.00 ? 99  GLN A HE22 2  
ATOM 6052  N N    . ILE A 1 100 ? 72.962  5.887   -13.552 1.00 0.00 ? 100 ILE A N    2  
ATOM 6053  C CA   . ILE A 1 100 ? 73.367  4.487   -13.519 1.00 0.00 ? 100 ILE A CA   2  
ATOM 6054  C C    . ILE A 1 100 ? 74.153  4.146   -14.779 1.00 0.00 ? 100 ILE A C    2  
ATOM 6055  O O    . ILE A 1 100 ? 73.698  4.408   -15.893 1.00 0.00 ? 100 ILE A O    2  
ATOM 6056  C CB   . ILE A 1 100 ? 72.135  3.554   -13.417 1.00 0.00 ? 100 ILE A CB   2  
ATOM 6057  C CG1  . ILE A 1 100 ? 71.227  3.698   -14.682 1.00 0.00 ? 100 ILE A CG1  2  
ATOM 6058  C CG2  . ILE A 1 100 ? 71.348  3.930   -12.154 1.00 0.00 ? 100 ILE A CG2  2  
ATOM 6059  C CD1  . ILE A 1 100 ? 71.478  2.540   -15.668 1.00 0.00 ? 100 ILE A CD1  2  
ATOM 6060  H H    . ILE A 1 100 ? 72.013  6.114   -13.636 1.00 0.00 ? 100 ILE A H    2  
ATOM 6061  H HA   . ILE A 1 100 ? 73.999  4.325   -12.660 1.00 0.00 ? 100 ILE A HA   2  
ATOM 6062  H HB   . ILE A 1 100 ? 72.478  2.532   -13.318 1.00 0.00 ? 100 ILE A HB   2  
ATOM 6063  H HG12 . ILE A 1 100 ? 70.184  3.682   -14.389 1.00 0.00 ? 100 ILE A HG12 2  
ATOM 6064  H HG13 . ILE A 1 100 ? 71.433  4.636   -15.180 1.00 0.00 ? 100 ILE A HG13 2  
ATOM 6065  H HG21 . ILE A 1 100 ? 70.949  4.928   -12.264 1.00 0.00 ? 100 ILE A HG21 2  
ATOM 6066  H HG22 . ILE A 1 100 ? 72.004  3.898   -11.297 1.00 0.00 ? 100 ILE A HG22 2  
ATOM 6067  H HG23 . ILE A 1 100 ? 70.536  3.232   -12.014 1.00 0.00 ? 100 ILE A HG23 2  
ATOM 6068  H HD11 . ILE A 1 100 ? 72.534  2.330   -15.724 1.00 0.00 ? 100 ILE A HD11 2  
ATOM 6069  H HD12 . ILE A 1 100 ? 71.114  2.813   -16.647 1.00 0.00 ? 100 ILE A HD12 2  
ATOM 6070  H HD13 . ILE A 1 100 ? 70.955  1.657   -15.325 1.00 0.00 ? 100 ILE A HD13 2  
ATOM 6071  N N    . LYS A 1 101 ? 75.345  3.575   -14.596 1.00 0.00 ? 101 LYS A N    2  
ATOM 6072  C CA   . LYS A 1 101 ? 76.214  3.210   -15.721 1.00 0.00 ? 101 LYS A CA   2  
ATOM 6073  C C    . LYS A 1 101 ? 76.553  1.721   -15.673 1.00 0.00 ? 101 LYS A C    2  
ATOM 6074  O O    . LYS A 1 101 ? 77.315  1.222   -16.502 1.00 0.00 ? 101 LYS A O    2  
ATOM 6075  C CB   . LYS A 1 101 ? 77.504  4.055   -15.659 1.00 0.00 ? 101 LYS A CB   2  
ATOM 6076  C CG   . LYS A 1 101 ? 78.165  4.160   -17.056 1.00 0.00 ? 101 LYS A CG   2  
ATOM 6077  C CD   . LYS A 1 101 ? 77.526  5.306   -17.884 1.00 0.00 ? 101 LYS A CD   2  
ATOM 6078  C CE   . LYS A 1 101 ? 78.211  6.645   -17.567 1.00 0.00 ? 101 LYS A CE   2  
ATOM 6079  N NZ   . LYS A 1 101 ? 79.608  6.622   -18.082 1.00 0.00 ? 101 LYS A NZ   2  
ATOM 6080  H H    . LYS A 1 101 ? 75.654  3.404   -13.681 1.00 0.00 ? 101 LYS A H    2  
ATOM 6081  H HA   . LYS A 1 101 ? 75.706  3.412   -16.656 1.00 0.00 ? 101 LYS A HA   2  
ATOM 6082  H HB2  . LYS A 1 101 ? 77.256  5.043   -15.299 1.00 0.00 ? 101 LYS A HB2  2  
ATOM 6083  H HB3  . LYS A 1 101 ? 78.201  3.598   -14.967 1.00 0.00 ? 101 LYS A HB3  2  
ATOM 6084  H HG2  . LYS A 1 101 ? 79.225  4.348   -16.936 1.00 0.00 ? 101 LYS A HG2  2  
ATOM 6085  H HG3  . LYS A 1 101 ? 78.035  3.224   -17.584 1.00 0.00 ? 101 LYS A HG3  2  
ATOM 6086  H HD2  . LYS A 1 101 ? 77.642  5.094   -18.937 1.00 0.00 ? 101 LYS A HD2  2  
ATOM 6087  H HD3  . LYS A 1 101 ? 76.474  5.384   -17.653 1.00 0.00 ? 101 LYS A HD3  2  
ATOM 6088  H HE2  . LYS A 1 101 ? 77.666  7.447   -18.043 1.00 0.00 ? 101 LYS A HE2  2  
ATOM 6089  H HE3  . LYS A 1 101 ? 78.223  6.805   -16.500 1.00 0.00 ? 101 LYS A HE3  2  
ATOM 6090  H HZ1  . LYS A 1 101 ? 79.594  6.550   -19.119 1.00 0.00 ? 101 LYS A HZ1  2  
ATOM 6091  H HZ2  . LYS A 1 101 ? 80.110  5.805   -17.682 1.00 0.00 ? 101 LYS A HZ2  2  
ATOM 6092  H HZ3  . LYS A 1 101 ? 80.094  7.498   -17.804 1.00 0.00 ? 101 LYS A HZ3  2  
ATOM 6093  N N    . SER A 1 102 ? 75.981  1.016   -14.695 1.00 0.00 ? 102 SER A N    2  
ATOM 6094  C CA   . SER A 1 102 ? 76.219  -0.421  -14.535 1.00 0.00 ? 102 SER A CA   2  
ATOM 6095  C C    . SER A 1 102 ? 74.895  -1.161  -14.378 1.00 0.00 ? 102 SER A C    2  
ATOM 6096  O O    . SER A 1 102 ? 74.044  -0.772  -13.578 1.00 0.00 ? 102 SER A O    2  
ATOM 6097  C CB   . SER A 1 102 ? 77.087  -0.668  -13.301 1.00 0.00 ? 102 SER A CB   2  
ATOM 6098  O OG   . SER A 1 102 ? 76.338  -0.367  -12.131 1.00 0.00 ? 102 SER A OG   2  
ATOM 6099  H H    . SER A 1 102 ? 75.385  1.470   -14.064 1.00 0.00 ? 102 SER A H    2  
ATOM 6100  H HA   . SER A 1 102 ? 76.732  -0.811  -15.405 1.00 0.00 ? 102 SER A HA   2  
ATOM 6101  H HB2  . SER A 1 102 ? 77.390  -1.701  -13.271 1.00 0.00 ? 102 SER A HB2  2  
ATOM 6102  H HB3  . SER A 1 102 ? 77.966  -0.039  -13.350 1.00 0.00 ? 102 SER A HB3  2  
ATOM 6103  H HG   . SER A 1 102 ? 75.850  -1.154  -11.881 1.00 0.00 ? 102 SER A HG   2  
ATOM 6104  N N    . ILE A 1 103 ? 74.733  -2.233  -15.148 1.00 0.00 ? 103 ILE A N    2  
ATOM 6105  C CA   . ILE A 1 103 ? 73.517  -3.042  -15.101 1.00 0.00 ? 103 ILE A CA   2  
ATOM 6106  C C    . ILE A 1 103 ? 73.875  -4.506  -15.325 1.00 0.00 ? 103 ILE A C    2  
ATOM 6107  O O    . ILE A 1 103 ? 74.605  -4.837  -16.258 1.00 0.00 ? 103 ILE A O    2  
ATOM 6108  C CB   . ILE A 1 103 ? 72.515  -2.583  -16.178 1.00 0.00 ? 103 ILE A CB   2  
ATOM 6109  C CG1  . ILE A 1 103 ? 71.200  -3.355  -16.009 1.00 0.00 ? 103 ILE A CG1  2  
ATOM 6110  C CG2  . ILE A 1 103 ? 73.096  -2.832  -17.574 1.00 0.00 ? 103 ILE A CG2  2  
ATOM 6111  C CD1  . ILE A 1 103 ? 70.127  -2.780  -16.941 1.00 0.00 ? 103 ILE A CD1  2  
ATOM 6112  H H    . ILE A 1 103 ? 75.453  -2.490  -15.761 1.00 0.00 ? 103 ILE A H    2  
ATOM 6113  H HA   . ILE A 1 103 ? 73.055  -2.943  -14.129 1.00 0.00 ? 103 ILE A HA   2  
ATOM 6114  H HB   . ILE A 1 103 ? 72.330  -1.524  -16.055 1.00 0.00 ? 103 ILE A HB   2  
ATOM 6115  H HG12 . ILE A 1 103 ? 71.362  -4.395  -16.246 1.00 0.00 ? 103 ILE A HG12 2  
ATOM 6116  H HG13 . ILE A 1 103 ? 70.865  -3.269  -14.985 1.00 0.00 ? 103 ILE A HG13 2  
ATOM 6117  H HG21 . ILE A 1 103 ? 72.512  -2.295  -18.308 1.00 0.00 ? 103 ILE A HG21 2  
ATOM 6118  H HG22 . ILE A 1 103 ? 73.069  -3.887  -17.796 1.00 0.00 ? 103 ILE A HG22 2  
ATOM 6119  H HG23 . ILE A 1 103 ? 74.118  -2.483  -17.607 1.00 0.00 ? 103 ILE A HG23 2  
ATOM 6120  H HD11 . ILE A 1 103 ? 70.145  -1.701  -16.900 1.00 0.00 ? 103 ILE A HD11 2  
ATOM 6121  H HD12 . ILE A 1 103 ? 69.157  -3.131  -16.625 1.00 0.00 ? 103 ILE A HD12 2  
ATOM 6122  H HD13 . ILE A 1 103 ? 70.316  -3.107  -17.952 1.00 0.00 ? 103 ILE A HD13 2  
ATOM 6123  N N    . SER A 1 104 ? 73.380  -5.379  -14.448 1.00 0.00 ? 104 SER A N    2  
ATOM 6124  C CA   . SER A 1 104 ? 73.678  -6.811  -14.542 1.00 0.00 ? 104 SER A CA   2  
ATOM 6125  C C    . SER A 1 104 ? 72.535  -7.648  -13.987 1.00 0.00 ? 104 SER A C    2  
ATOM 6126  O O    . SER A 1 104 ? 71.795  -7.201  -13.117 1.00 0.00 ? 104 SER A O    2  
ATOM 6127  C CB   . SER A 1 104 ? 74.949  -7.118  -13.748 1.00 0.00 ? 104 SER A CB   2  
ATOM 6128  O OG   . SER A 1 104 ? 74.723  -6.831  -12.376 1.00 0.00 ? 104 SER A OG   2  
ATOM 6129  H H    . SER A 1 104 ? 72.817  -5.051  -13.718 1.00 0.00 ? 104 SER A H    2  
ATOM 6130  H HA   . SER A 1 104 ? 73.836  -7.080  -15.575 1.00 0.00 ? 104 SER A HA   2  
ATOM 6131  H HB2  . SER A 1 104 ? 75.199  -8.159  -13.851 1.00 0.00 ? 104 SER A HB2  2  
ATOM 6132  H HB3  . SER A 1 104 ? 75.764  -6.514  -14.122 1.00 0.00 ? 104 SER A HB3  2  
ATOM 6133  H HG   . SER A 1 104 ? 75.297  -7.399  -11.855 1.00 0.00 ? 104 SER A HG   2  
ATOM 6134  N N    . GLU A 1 105 ? 72.406  -8.878  -14.493 1.00 0.00 ? 105 GLU A N    2  
ATOM 6135  C CA   . GLU A 1 105 ? 71.353  -9.792  -14.039 1.00 0.00 ? 105 GLU A CA   2  
ATOM 6136  C C    . GLU A 1 105 ? 71.874  -11.225 -13.974 1.00 0.00 ? 105 GLU A C    2  
ATOM 6137  O O    . GLU A 1 105 ? 73.008  -11.509 -14.361 1.00 0.00 ? 105 GLU A O    2  
ATOM 6138  C CB   . GLU A 1 105 ? 70.149  -9.744  -14.991 1.00 0.00 ? 105 GLU A CB   2  
ATOM 6139  C CG   . GLU A 1 105 ? 69.690  -8.287  -15.231 1.00 0.00 ? 105 GLU A CG   2  
ATOM 6140  C CD   . GLU A 1 105 ? 70.480  -7.668  -16.387 1.00 0.00 ? 105 GLU A CD   2  
ATOM 6141  O OE1  . GLU A 1 105 ? 70.285  -8.107  -17.507 1.00 0.00 ? 105 GLU A OE1  2  
ATOM 6142  O OE2  . GLU A 1 105 ? 71.263  -6.768  -16.133 1.00 0.00 ? 105 GLU A OE2  2  
ATOM 6143  H H    . GLU A 1 105 ? 73.036  -9.179  -15.181 1.00 0.00 ? 105 GLU A H    2  
ATOM 6144  H HA   . GLU A 1 105 ? 71.026  -9.505  -13.052 1.00 0.00 ? 105 GLU A HA   2  
ATOM 6145  H HB2  . GLU A 1 105 ? 70.426  -10.198 -15.932 1.00 0.00 ? 105 GLU A HB2  2  
ATOM 6146  H HB3  . GLU A 1 105 ? 69.336  -10.306 -14.553 1.00 0.00 ? 105 GLU A HB3  2  
ATOM 6147  H HG2  . GLU A 1 105 ? 68.638  -8.280  -15.483 1.00 0.00 ? 105 GLU A HG2  2  
ATOM 6148  H HG3  . GLU A 1 105 ? 69.841  -7.700  -14.340 1.00 0.00 ? 105 GLU A HG3  2  
ATOM 6149  N N    . SER A 1 106 ? 71.024  -12.120 -13.484 1.00 0.00 ? 106 SER A N    2  
ATOM 6150  C CA   . SER A 1 106 ? 71.376  -13.531 -13.364 1.00 0.00 ? 106 SER A CA   2  
ATOM 6151  C C    . SER A 1 106 ? 70.132  -14.352 -13.045 1.00 0.00 ? 106 SER A C    2  
ATOM 6152  O O    . SER A 1 106 ? 69.103  -13.806 -12.648 1.00 0.00 ? 106 SER A O    2  
ATOM 6153  C CB   . SER A 1 106 ? 72.421  -13.724 -12.259 1.00 0.00 ? 106 SER A CB   2  
ATOM 6154  O OG   . SER A 1 106 ? 72.322  -15.045 -11.740 1.00 0.00 ? 106 SER A OG   2  
ATOM 6155  H H    . SER A 1 106 ? 70.137  -11.826 -13.200 1.00 0.00 ? 106 SER A H    2  
ATOM 6156  H HA   . SER A 1 106 ? 71.787  -13.871 -14.305 1.00 0.00 ? 106 SER A HA   2  
ATOM 6157  H HB2  . SER A 1 106 ? 73.410  -13.579 -12.661 1.00 0.00 ? 106 SER A HB2  2  
ATOM 6158  H HB3  . SER A 1 106 ? 72.246  -13.003 -11.471 1.00 0.00 ? 106 SER A HB3  2  
ATOM 6159  H HG   . SER A 1 106 ? 73.211  -15.365 -11.571 1.00 0.00 ? 106 SER A HG   2  
ATOM 6160  N N    . ALA A 1 107 ? 70.231  -15.671 -13.223 1.00 0.00 ? 107 ALA A N    2  
ATOM 6161  C CA   . ALA A 1 107 ? 69.107  -16.574 -12.956 1.00 0.00 ? 107 ALA A CA   2  
ATOM 6162  C C    . ALA A 1 107 ? 69.567  -17.761 -12.117 1.00 0.00 ? 107 ALA A C    2  
ATOM 6163  O O    . ALA A 1 107 ? 70.572  -18.401 -12.425 1.00 0.00 ? 107 ALA A O    2  
ATOM 6164  C CB   . ALA A 1 107 ? 68.529  -17.072 -14.272 1.00 0.00 ? 107 ALA A CB   2  
ATOM 6165  H H    . ALA A 1 107 ? 71.078  -16.045 -13.543 1.00 0.00 ? 107 ALA A H    2  
ATOM 6166  H HA   . ALA A 1 107 ? 68.332  -16.049 -12.414 1.00 0.00 ? 107 ALA A HA   2  
ATOM 6167  H HB1  . ALA A 1 107 ? 69.264  -17.675 -14.784 1.00 0.00 ? 107 ALA A HB1  2  
ATOM 6168  H HB2  . ALA A 1 107 ? 68.263  -16.227 -14.891 1.00 0.00 ? 107 ALA A HB2  2  
ATOM 6169  H HB3  . ALA A 1 107 ? 67.649  -17.666 -14.077 1.00 0.00 ? 107 ALA A HB3  2  
ATOM 6170  N N    . ASP A 1 108 ? 68.818  -18.051 -11.052 1.00 0.00 ? 108 ASP A N    2  
ATOM 6171  C CA   . ASP A 1 108 ? 69.142  -19.165 -10.159 1.00 0.00 ? 108 ASP A CA   2  
ATOM 6172  C C    . ASP A 1 108 ? 67.862  -19.818 -9.654  1.00 0.00 ? 108 ASP A C    2  
ATOM 6173  O O    . ASP A 1 108 ? 67.145  -19.248 -8.832  1.00 0.00 ? 108 ASP A O    2  
ATOM 6174  C CB   . ASP A 1 108 ? 69.961  -18.659 -8.969  1.00 0.00 ? 108 ASP A CB   2  
ATOM 6175  C CG   . ASP A 1 108 ? 69.152  -17.611 -8.203  1.00 0.00 ? 108 ASP A CG   2  
ATOM 6176  O OD1  . ASP A 1 108 ? 68.478  -16.824 -8.847  1.00 0.00 ? 108 ASP A OD1  2  
ATOM 6177  O OD2  . ASP A 1 108 ? 69.221  -17.611 -6.985  1.00 0.00 ? 108 ASP A OD2  2  
ATOM 6178  H H    . ASP A 1 108 ? 68.029  -17.503 -10.860 1.00 0.00 ? 108 ASP A H    2  
ATOM 6179  H HA   . ASP A 1 108 ? 69.724  -19.905 -10.694 1.00 0.00 ? 108 ASP A HA   2  
ATOM 6180  H HB2  . ASP A 1 108 ? 70.192  -19.486 -8.315  1.00 0.00 ? 108 ASP A HB2  2  
ATOM 6181  H HB3  . ASP A 1 108 ? 70.877  -18.214 -9.326  1.00 0.00 ? 108 ASP A HB3  2  
ATOM 6182  N N    . GLY A 1 109 ? 67.577  -21.015 -10.155 1.00 0.00 ? 109 GLY A N    2  
ATOM 6183  C CA   . GLY A 1 109 ? 66.382  -21.729 -9.753  1.00 0.00 ? 109 GLY A CA   2  
ATOM 6184  C C    . GLY A 1 109 ? 65.124  -21.035 -10.236 1.00 0.00 ? 109 GLY A C    2  
ATOM 6185  O O    . GLY A 1 109 ? 64.948  -20.811 -11.434 1.00 0.00 ? 109 GLY A O    2  
ATOM 6186  H H    . GLY A 1 109 ? 68.183  -21.420 -10.810 1.00 0.00 ? 109 GLY A H    2  
ATOM 6187  H HA2  . GLY A 1 109 ? 66.413  -22.727 -10.164 1.00 0.00 ? 109 GLY A HA2  2  
ATOM 6188  H HA3  . GLY A 1 109 ? 66.356  -21.794 -8.675  1.00 0.00 ? 109 GLY A HA3  2  
ATOM 6189  N N    . ASN A 1 110 ? 64.242  -20.692 -9.296  1.00 0.00 ? 110 ASN A N    2  
ATOM 6190  C CA   . ASN A 1 110 ? 62.984  -20.015 -9.624  1.00 0.00 ? 110 ASN A CA   2  
ATOM 6191  C C    . ASN A 1 110 ? 63.072  -18.528 -9.296  1.00 0.00 ? 110 ASN A C    2  
ATOM 6192  O O    . ASN A 1 110 ? 62.053  -17.867 -9.108  1.00 0.00 ? 110 ASN A O    2  
ATOM 6193  C CB   . ASN A 1 110 ? 61.840  -20.639 -8.823  1.00 0.00 ? 110 ASN A CB   2  
ATOM 6194  C CG   . ASN A 1 110 ? 62.135  -20.511 -7.327  1.00 0.00 ? 110 ASN A CG   2  
ATOM 6195  O OD1  . ASN A 1 110 ? 63.280  -20.473 -6.924  1.00 0.00 ? 110 ASN A OD1  2  
ATOM 6196  N ND2  . ASN A 1 110 ? 61.142  -20.443 -6.483  1.00 0.00 ? 110 ASN A ND2  2  
ATOM 6197  H H    . ASN A 1 110 ? 64.441  -20.899 -8.359  1.00 0.00 ? 110 ASN A H    2  
ATOM 6198  H HA   . ASN A 1 110 ? 62.770  -20.128 -10.679 1.00 0.00 ? 110 ASN A HA   2  
ATOM 6199  H HB2  . ASN A 1 110 ? 60.917  -20.127 -9.055  1.00 0.00 ? 110 ASN A HB2  2  
ATOM 6200  H HB3  . ASN A 1 110 ? 61.746  -21.683 -9.082  1.00 0.00 ? 110 ASN A HB3  2  
ATOM 6201  H HD21 . ASN A 1 110 ? 60.218  -20.474 -6.807  1.00 0.00 ? 110 ASN A HD21 2  
ATOM 6202  H HD22 . ASN A 1 110 ? 61.322  -20.361 -5.522  1.00 0.00 ? 110 ASN A HD22 2  
ATOM 6203  N N    . THR A 1 111 ? 64.300  -18.010 -9.202  1.00 0.00 ? 111 THR A N    2  
ATOM 6204  C CA   . THR A 1 111 ? 64.520  -16.594 -8.872  1.00 0.00 ? 111 THR A CA   2  
ATOM 6205  C C    . THR A 1 111 ? 65.455  -15.936 -9.881  1.00 0.00 ? 111 THR A C    2  
ATOM 6206  O O    . THR A 1 111 ? 66.313  -16.590 -10.472 1.00 0.00 ? 111 THR A O    2  
ATOM 6207  C CB   . THR A 1 111 ? 65.148  -16.455 -7.472  1.00 0.00 ? 111 THR A CB   2  
ATOM 6208  O OG1  . THR A 1 111 ? 66.383  -17.156 -7.439  1.00 0.00 ? 111 THR A OG1  2  
ATOM 6209  C CG2  . THR A 1 111 ? 64.201  -17.035 -6.422  1.00 0.00 ? 111 THR A CG2  2  
ATOM 6210  H H    . THR A 1 111 ? 65.074  -18.597 -9.333  1.00 0.00 ? 111 THR A H    2  
ATOM 6211  H HA   . THR A 1 111 ? 63.579  -16.064 -8.880  1.00 0.00 ? 111 THR A HA   2  
ATOM 6212  H HB   . THR A 1 111 ? 65.321  -15.411 -7.259  1.00 0.00 ? 111 THR A HB   2  
ATOM 6213  H HG1  . THR A 1 111 ? 66.297  -17.879 -6.812  1.00 0.00 ? 111 THR A HG1  2  
ATOM 6214  H HG21 . THR A 1 111 ? 63.357  -16.373 -6.293  1.00 0.00 ? 111 THR A HG21 2  
ATOM 6215  H HG22 . THR A 1 111 ? 64.724  -17.137 -5.482  1.00 0.00 ? 111 THR A HG22 2  
ATOM 6216  H HG23 . THR A 1 111 ? 63.852  -18.005 -6.745  1.00 0.00 ? 111 THR A HG23 2  
ATOM 6217  N N    . VAL A 1 112 ? 65.284  -14.622 -10.060 1.00 0.00 ? 112 VAL A N    2  
ATOM 6218  C CA   . VAL A 1 112 ? 66.116  -13.846 -10.984 1.00 0.00 ? 112 VAL A CA   2  
ATOM 6219  C C    . VAL A 1 112 ? 66.581  -12.565 -10.301 1.00 0.00 ? 112 VAL A C    2  
ATOM 6220  O O    . VAL A 1 112 ? 65.808  -11.898 -9.611  1.00 0.00 ? 112 VAL A O    2  
ATOM 6221  C CB   . VAL A 1 112 ? 65.340  -13.487 -12.266 1.00 0.00 ? 112 VAL A CB   2  
ATOM 6222  C CG1  . VAL A 1 112 ? 64.934  -14.776 -12.987 1.00 0.00 ? 112 VAL A CG1  2  
ATOM 6223  C CG2  . VAL A 1 112 ? 64.084  -12.690 -11.908 1.00 0.00 ? 112 VAL A CG2  2  
ATOM 6224  H H    . VAL A 1 112 ? 64.588  -14.162 -9.546  1.00 0.00 ? 112 VAL A H    2  
ATOM 6225  H HA   . VAL A 1 112 ? 66.991  -14.424 -11.259 1.00 0.00 ? 112 VAL A HA   2  
ATOM 6226  H HB   . VAL A 1 112 ? 65.972  -12.897 -12.915 1.00 0.00 ? 112 VAL A HB   2  
ATOM 6227  H HG11 . VAL A 1 112 ? 64.233  -14.545 -13.774 1.00 0.00 ? 112 VAL A HG11 2  
ATOM 6228  H HG12 . VAL A 1 112 ? 64.471  -15.452 -12.284 1.00 0.00 ? 112 VAL A HG12 2  
ATOM 6229  H HG13 . VAL A 1 112 ? 65.810  -15.243 -13.412 1.00 0.00 ? 112 VAL A HG13 2  
ATOM 6230  H HG21 . VAL A 1 112 ? 63.493  -13.253 -11.201 1.00 0.00 ? 112 VAL A HG21 2  
ATOM 6231  H HG22 . VAL A 1 112 ? 63.506  -12.512 -12.800 1.00 0.00 ? 112 VAL A HG22 2  
ATOM 6232  H HG23 . VAL A 1 112 ? 64.367  -11.745 -11.473 1.00 0.00 ? 112 VAL A HG23 2  
ATOM 6233  N N    . ASN A 1 113 ? 67.863  -12.238 -10.469 1.00 0.00 ? 113 ASN A N    2  
ATOM 6234  C CA   . ASN A 1 113 ? 68.446  -11.046 -9.844  1.00 0.00 ? 113 ASN A CA   2  
ATOM 6235  C C    . ASN A 1 113 ? 68.653  -9.927  -10.861 1.00 0.00 ? 113 ASN A C    2  
ATOM 6236  O O    . ASN A 1 113 ? 68.612  -10.151 -12.070 1.00 0.00 ? 113 ASN A O    2  
ATOM 6237  C CB   . ASN A 1 113 ? 69.793  -11.411 -9.221  1.00 0.00 ? 113 ASN A CB   2  
ATOM 6238  C CG   . ASN A 1 113 ? 69.580  -12.438 -8.108  1.00 0.00 ? 113 ASN A CG   2  
ATOM 6239  O OD1  . ASN A 1 113 ? 68.798  -13.357 -8.255  1.00 0.00 ? 113 ASN A OD1  2  
ATOM 6240  N ND2  . ASN A 1 113 ? 70.248  -12.322 -6.993  1.00 0.00 ? 113 ASN A ND2  2  
ATOM 6241  H H    . ASN A 1 113 ? 68.435  -12.822 -11.011 1.00 0.00 ? 113 ASN A H    2  
ATOM 6242  H HA   . ASN A 1 113 ? 67.793  -10.686 -9.059  1.00 0.00 ? 113 ASN A HA   2  
ATOM 6243  H HB2  . ASN A 1 113 ? 70.438  -11.831 -9.980  1.00 0.00 ? 113 ASN A HB2  2  
ATOM 6244  H HB3  . ASN A 1 113 ? 70.250  -10.526 -8.810  1.00 0.00 ? 113 ASN A HB3  2  
ATOM 6245  H HD21 . ASN A 1 113 ? 70.878  -11.581 -6.874  1.00 0.00 ? 113 ASN A HD21 2  
ATOM 6246  H HD22 . ASN A 1 113 ? 70.118  -12.974 -6.274  1.00 0.00 ? 113 ASN A HD22 2  
ATOM 6247  N N    . ALA A 1 114 ? 68.888  -8.721  -10.349 1.00 0.00 ? 114 ALA A N    2  
ATOM 6248  C CA   . ALA A 1 114 ? 69.117  -7.557  -11.199 1.00 0.00 ? 114 ALA A CA   2  
ATOM 6249  C C    . ALA A 1 114 ? 69.752  -6.434  -10.381 1.00 0.00 ? 114 ALA A C    2  
ATOM 6250  O O    . ALA A 1 114 ? 69.191  -5.982  -9.385  1.00 0.00 ? 114 ALA A O    2  
ATOM 6251  C CB   . ALA A 1 114 ? 67.802  -7.098  -11.825 1.00 0.00 ? 114 ALA A CB   2  
ATOM 6252  H H    . ALA A 1 114 ? 68.915  -8.613  -9.375  1.00 0.00 ? 114 ALA A H    2  
ATOM 6253  H HA   . ALA A 1 114 ? 69.800  -7.832  -11.984 1.00 0.00 ? 114 ALA A HA   2  
ATOM 6254  H HB1  . ALA A 1 114 ? 67.541  -7.757  -12.640 1.00 0.00 ? 114 ALA A HB1  2  
ATOM 6255  H HB2  . ALA A 1 114 ? 67.908  -6.090  -12.201 1.00 0.00 ? 114 ALA A HB2  2  
ATOM 6256  H HB3  . ALA A 1 114 ? 67.021  -7.123  -11.083 1.00 0.00 ? 114 ALA A HB3  2  
ATOM 6257  N N    . ARG A 1 115 ? 70.944  -6.004  -10.797 1.00 0.00 ? 115 ARG A N    2  
ATOM 6258  C CA   . ARG A 1 115 ? 71.680  -4.948  -10.093 1.00 0.00 ? 115 ARG A CA   2  
ATOM 6259  C C    . ARG A 1 115 ? 71.835  -3.705  -10.960 1.00 0.00 ? 115 ARG A C    2  
ATOM 6260  O O    . ARG A 1 115 ? 72.587  -3.705  -11.931 1.00 0.00 ? 115 ARG A O    2  
ATOM 6261  C CB   . ARG A 1 115 ? 73.072  -5.457  -9.723  1.00 0.00 ? 115 ARG A CB   2  
ATOM 6262  C CG   . ARG A 1 115 ? 72.957  -6.751  -8.906  1.00 0.00 ? 115 ARG A CG   2  
ATOM 6263  C CD   . ARG A 1 115 ? 72.281  -6.487  -7.542  1.00 0.00 ? 115 ARG A CD   2  
ATOM 6264  N NE   . ARG A 1 115 ? 70.837  -6.859  -7.630  1.00 0.00 ? 115 ARG A NE   2  
ATOM 6265  C CZ   . ARG A 1 115 ? 70.464  -8.101  -7.462  1.00 0.00 ? 115 ARG A CZ   2  
ATOM 6266  N NH1  . ARG A 1 115 ? 71.359  -9.030  -7.261  1.00 0.00 ? 115 ARG A NH1  2  
ATOM 6267  N NH2  . ARG A 1 115 ? 69.197  -8.413  -7.495  1.00 0.00 ? 115 ARG A NH2  2  
ATOM 6268  H H    . ARG A 1 115 ? 71.347  -6.420  -11.583 1.00 0.00 ? 115 ARG A H    2  
ATOM 6269  H HA   . ARG A 1 115 ? 71.162  -4.676  -9.183  1.00 0.00 ? 115 ARG A HA   2  
ATOM 6270  H HB2  . ARG A 1 115 ? 73.631  -5.652  -10.627 1.00 0.00 ? 115 ARG A HB2  2  
ATOM 6271  H HB3  . ARG A 1 115 ? 73.586  -4.708  -9.140  1.00 0.00 ? 115 ARG A HB3  2  
ATOM 6272  H HG2  . ARG A 1 115 ? 72.367  -7.467  -9.461  1.00 0.00 ? 115 ARG A HG2  2  
ATOM 6273  H HG3  . ARG A 1 115 ? 73.944  -7.152  -8.747  1.00 0.00 ? 115 ARG A HG3  2  
ATOM 6274  H HD2  . ARG A 1 115 ? 72.761  -7.086  -6.777  1.00 0.00 ? 115 ARG A HD2  2  
ATOM 6275  H HD3  . ARG A 1 115 ? 72.365  -5.442  -7.273  1.00 0.00 ? 115 ARG A HD3  2  
ATOM 6276  H HE   . ARG A 1 115 ? 70.166  -6.169  -7.814  1.00 0.00 ? 115 ARG A HE   2  
ATOM 6277  H HH11 . ARG A 1 115 ? 72.330  -8.792  -7.235  1.00 0.00 ? 115 ARG A HH11 2  
ATOM 6278  H HH12 . ARG A 1 115 ? 71.074  -9.979  -7.133  1.00 0.00 ? 115 ARG A HH12 2  
ATOM 6279  H HH21 . ARG A 1 115 ? 68.511  -7.701  -7.648  1.00 0.00 ? 115 ARG A HH21 2  
ATOM 6280  H HH22 . ARG A 1 115 ? 68.912  -9.362  -7.367  1.00 0.00 ? 115 ARG A HH22 2  
ATOM 6281  N N    . LEU A 1 116 ? 71.157  -2.628  -10.564 1.00 0.00 ? 116 LEU A N    2  
ATOM 6282  C CA   . LEU A 1 116 ? 71.252  -1.344  -11.263 1.00 0.00 ? 116 LEU A CA   2  
ATOM 6283  C C    . LEU A 1 116 ? 71.980  -0.380  -10.331 1.00 0.00 ? 116 LEU A C    2  
ATOM 6284  O O    . LEU A 1 116 ? 71.519  -0.125  -9.218  1.00 0.00 ? 116 LEU A O    2  
ATOM 6285  C CB   . LEU A 1 116 ? 69.845  -0.795  -11.596 1.00 0.00 ? 116 LEU A CB   2  
ATOM 6286  C CG   . LEU A 1 116 ? 69.289  -1.436  -12.885 1.00 0.00 ? 116 LEU A CG   2  
ATOM 6287  C CD1  . LEU A 1 116 ? 68.856  -2.884  -12.621 1.00 0.00 ? 116 LEU A CD1  2  
ATOM 6288  C CD2  . LEU A 1 116 ? 68.075  -0.632  -13.366 1.00 0.00 ? 116 LEU A CD2  2  
ATOM 6289  H H    . LEU A 1 116 ? 70.612  -2.681  -9.750  1.00 0.00 ? 116 LEU A H    2  
ATOM 6290  H HA   . LEU A 1 116 ? 71.828  -1.453  -12.173 1.00 0.00 ? 116 LEU A HA   2  
ATOM 6291  H HB2  . LEU A 1 116 ? 69.179  -1.010  -10.776 1.00 0.00 ? 116 LEU A HB2  2  
ATOM 6292  H HB3  . LEU A 1 116 ? 69.902  0.278   -11.732 1.00 0.00 ? 116 LEU A HB3  2  
ATOM 6293  H HG   . LEU A 1 116 ? 70.048  -1.426  -13.655 1.00 0.00 ? 116 LEU A HG   2  
ATOM 6294  H HD11 . LEU A 1 116 ? 69.727  -3.500  -12.478 1.00 0.00 ? 116 LEU A HD11 2  
ATOM 6295  H HD12 . LEU A 1 116 ? 68.295  -3.252  -13.468 1.00 0.00 ? 116 LEU A HD12 2  
ATOM 6296  H HD13 . LEU A 1 116 ? 68.236  -2.924  -11.737 1.00 0.00 ? 116 LEU A HD13 2  
ATOM 6297  H HD21 . LEU A 1 116 ? 67.659  -1.100  -14.247 1.00 0.00 ? 116 LEU A HD21 2  
ATOM 6298  H HD22 . LEU A 1 116 ? 68.382  0.375   -13.605 1.00 0.00 ? 116 LEU A HD22 2  
ATOM 6299  H HD23 . LEU A 1 116 ? 67.329  -0.606  -12.586 1.00 0.00 ? 116 LEU A HD23 2  
ATOM 6300  N N    . SER A 1 117 ? 73.133  0.130   -10.759 1.00 0.00 ? 117 SER A N    2  
ATOM 6301  C CA   . SER A 1 117 ? 73.909  1.029   -9.905  1.00 0.00 ? 117 SER A CA   2  
ATOM 6302  C C    . SER A 1 117 ? 74.835  1.921   -10.719 1.00 0.00 ? 117 SER A C    2  
ATOM 6303  O O    . SER A 1 117 ? 74.932  1.798   -11.940 1.00 0.00 ? 117 SER A O    2  
ATOM 6304  C CB   . SER A 1 117 ? 74.753  0.193   -8.941  1.00 0.00 ? 117 SER A CB   2  
ATOM 6305  O OG   . SER A 1 117 ? 75.876  -0.330  -9.637  1.00 0.00 ? 117 SER A OG   2  
ATOM 6306  H H    . SER A 1 117 ? 73.477  -0.116  -11.644 1.00 0.00 ? 117 SER A H    2  
ATOM 6307  H HA   . SER A 1 117 ? 73.239  1.653   -9.331  1.00 0.00 ? 117 SER A HA   2  
ATOM 6308  H HB2  . SER A 1 117 ? 75.096  0.808   -8.129  1.00 0.00 ? 117 SER A HB2  2  
ATOM 6309  H HB3  . SER A 1 117 ? 74.153  -0.618  -8.549  1.00 0.00 ? 117 SER A HB3  2  
ATOM 6310  H HG   . SER A 1 117 ? 76.670  -0.027  -9.188  1.00 0.00 ? 117 SER A HG   2  
ATOM 6311  N N    . SER A 1 118 ? 75.533  2.813   -10.012 1.00 0.00 ? 118 SER A N    2  
ATOM 6312  C CA   . SER A 1 118 ? 76.484  3.728   -10.639 1.00 0.00 ? 118 SER A CA   2  
ATOM 6313  C C    . SER A 1 118 ? 77.879  3.118   -10.600 1.00 0.00 ? 118 SER A C    2  
ATOM 6314  O O    . SER A 1 118 ? 78.123  2.152   -9.878  1.00 0.00 ? 118 SER A O    2  
ATOM 6315  C CB   . SER A 1 118 ? 76.488  5.064   -9.895  1.00 0.00 ? 118 SER A CB   2  
ATOM 6316  O OG   . SER A 1 118 ? 76.692  4.828   -8.508  1.00 0.00 ? 118 SER A OG   2  
ATOM 6317  H H    . SER A 1 118 ? 75.418  2.843   -9.040  1.00 0.00 ? 118 SER A H    2  
ATOM 6318  H HA   . SER A 1 118 ? 76.201  3.900   -11.669 1.00 0.00 ? 118 SER A HA   2  
ATOM 6319  H HB2  . SER A 1 118 ? 77.285  5.684   -10.271 1.00 0.00 ? 118 SER A HB2  2  
ATOM 6320  H HB3  . SER A 1 118 ? 75.541  5.565   -10.052 1.00 0.00 ? 118 SER A HB3  2  
ATOM 6321  H HG   . SER A 1 118 ? 77.264  4.063   -8.418  1.00 0.00 ? 118 SER A HG   2  
ATOM 6322  N N    . VAL A 1 119 ? 78.789  3.673   -11.391 1.00 0.00 ? 119 VAL A N    2  
ATOM 6323  C CA   . VAL A 1 119 ? 80.163  3.168   -11.460 1.00 0.00 ? 119 VAL A CA   2  
ATOM 6324  C C    . VAL A 1 119 ? 81.101  3.986   -10.573 1.00 0.00 ? 119 VAL A C    2  
ATOM 6325  O O    . VAL A 1 119 ? 81.126  5.213   -10.644 1.00 0.00 ? 119 VAL A O    2  
ATOM 6326  C CB   . VAL A 1 119 ? 80.675  3.236   -12.913 1.00 0.00 ? 119 VAL A CB   2  
ATOM 6327  C CG1  . VAL A 1 119 ? 80.642  4.691   -13.411 1.00 0.00 ? 119 VAL A CG1  2  
ATOM 6328  C CG2  . VAL A 1 119 ? 82.107  2.687   -12.978 1.00 0.00 ? 119 VAL A CG2  2  
ATOM 6329  H H    . VAL A 1 119 ? 78.530  4.431   -11.956 1.00 0.00 ? 119 VAL A H    2  
ATOM 6330  H HA   . VAL A 1 119 ? 80.189  2.136   -11.137 1.00 0.00 ? 119 VAL A HA   2  
ATOM 6331  H HB   . VAL A 1 119 ? 80.032  2.634   -13.540 1.00 0.00 ? 119 VAL A HB   2  
ATOM 6332  H HG11 . VAL A 1 119 ? 80.701  4.703   -14.487 1.00 0.00 ? 119 VAL A HG11 2  
ATOM 6333  H HG12 . VAL A 1 119 ? 81.475  5.240   -13.000 1.00 0.00 ? 119 VAL A HG12 2  
ATOM 6334  H HG13 . VAL A 1 119 ? 79.719  5.160   -13.101 1.00 0.00 ? 119 VAL A HG13 2  
ATOM 6335  H HG21 . VAL A 1 119 ? 82.783  3.371   -12.488 1.00 0.00 ? 119 VAL A HG21 2  
ATOM 6336  H HG22 . VAL A 1 119 ? 82.399  2.568   -14.010 1.00 0.00 ? 119 VAL A HG22 2  
ATOM 6337  H HG23 . VAL A 1 119 ? 82.145  1.729   -12.482 1.00 0.00 ? 119 VAL A HG23 2  
ATOM 6338  N N    . SER A 1 120 ? 81.883  3.288   -9.754  1.00 0.00 ? 120 SER A N    2  
ATOM 6339  C CA   . SER A 1 120 ? 82.837  3.945   -8.868  1.00 0.00 ? 120 SER A CA   2  
ATOM 6340  C C    . SER A 1 120 ? 84.018  4.483   -9.684  1.00 0.00 ? 120 SER A C    2  
ATOM 6341  O O    . SER A 1 120 ? 84.326  3.950   -10.750 1.00 0.00 ? 120 SER A O    2  
ATOM 6342  C CB   . SER A 1 120 ? 83.333  2.934   -7.820  1.00 0.00 ? 120 SER A CB   2  
ATOM 6343  O OG   . SER A 1 120 ? 83.526  1.674   -8.447  1.00 0.00 ? 120 SER A OG   2  
ATOM 6344  H H    . SER A 1 120 ? 81.826  2.309   -9.754  1.00 0.00 ? 120 SER A H    2  
ATOM 6345  H HA   . SER A 1 120 ? 82.342  4.762   -8.368  1.00 0.00 ? 120 SER A HA   2  
ATOM 6346  H HB2  . SER A 1 120 ? 84.268  3.262   -7.397  1.00 0.00 ? 120 SER A HB2  2  
ATOM 6347  H HB3  . SER A 1 120 ? 82.597  2.843   -7.031  1.00 0.00 ? 120 SER A HB3  2  
ATOM 6348  H HG   . SER A 1 120 ? 84.464  1.569   -8.621  1.00 0.00 ? 120 SER A HG   2  
ATOM 6349  N N    . PRO A 1 121 ? 84.700  5.545   -9.206  1.00 0.00 ? 121 PRO A N    2  
ATOM 6350  C CA   . PRO A 1 121 ? 85.848  6.125   -9.929  1.00 0.00 ? 121 PRO A CA   2  
ATOM 6351  C C    . PRO A 1 121 ? 86.950  5.087   -10.157 1.00 0.00 ? 121 PRO A C    2  
ATOM 6352  O O    . PRO A 1 121 ? 87.099  4.145   -9.378  1.00 0.00 ? 121 PRO A O    2  
ATOM 6353  C CB   . PRO A 1 121 ? 86.323  7.286   -9.021  1.00 0.00 ? 121 PRO A CB   2  
ATOM 6354  C CG   . PRO A 1 121 ? 85.749  6.980   -7.673  1.00 0.00 ? 121 PRO A CG   2  
ATOM 6355  C CD   . PRO A 1 121 ? 84.428  6.265   -7.949  1.00 0.00 ? 121 PRO A CD   2  
ATOM 6356  H HA   . PRO A 1 121 ? 85.519  6.520   -10.879 1.00 0.00 ? 121 PRO A HA   2  
ATOM 6357  H HB2  . PRO A 1 121 ? 87.406  7.324   -8.977  1.00 0.00 ? 121 PRO A HB2  2  
ATOM 6358  H HB3  . PRO A 1 121 ? 85.936  8.230   -9.382  1.00 0.00 ? 121 PRO A HB3  2  
ATOM 6359  H HG2  . PRO A 1 121 ? 86.420  6.332   -7.118  1.00 0.00 ? 121 PRO A HG2  2  
ATOM 6360  H HG3  . PRO A 1 121 ? 85.566  7.889   -7.118  1.00 0.00 ? 121 PRO A HG3  2  
ATOM 6361  H HD2  . PRO A 1 121 ? 84.191  5.581   -7.147  1.00 0.00 ? 121 PRO A HD2  2  
ATOM 6362  H HD3  . PRO A 1 121 ? 83.630  6.977   -8.093  1.00 0.00 ? 121 PRO A HD3  2  
ATOM 6363  N N    . GLY A 1 122 ? 87.713  5.268   -11.231 1.00 0.00 ? 122 GLY A N    2  
ATOM 6364  C CA   . GLY A 1 122 ? 88.787  4.347   -11.555 1.00 0.00 ? 122 GLY A CA   2  
ATOM 6365  C C    . GLY A 1 122 ? 88.261  3.048   -12.133 1.00 0.00 ? 122 GLY A C    2  
ATOM 6366  O O    . GLY A 1 122 ? 88.632  1.963   -11.686 1.00 0.00 ? 122 GLY A O    2  
ATOM 6367  H H    . GLY A 1 122 ? 87.543  6.035   -11.817 1.00 0.00 ? 122 GLY A H    2  
ATOM 6368  H HA2  . GLY A 1 122 ? 89.441  4.812   -12.277 1.00 0.00 ? 122 GLY A HA2  2  
ATOM 6369  H HA3  . GLY A 1 122 ? 89.351  4.131   -10.659 1.00 0.00 ? 122 GLY A HA3  2  
ATOM 6370  N N    . GLN A 1 123 ? 87.388  3.163   -13.136 1.00 0.00 ? 123 GLN A N    2  
ATOM 6371  C CA   . GLN A 1 123 ? 86.797  1.988   -13.789 1.00 0.00 ? 123 GLN A CA   2  
ATOM 6372  C C    . GLN A 1 123 ? 86.826  2.155   -15.304 1.00 0.00 ? 123 GLN A C    2  
ATOM 6373  O O    . GLN A 1 123 ? 86.783  1.174   -16.047 1.00 0.00 ? 123 GLN A O    2  
ATOM 6374  C CB   . GLN A 1 123 ? 85.349  1.812   -13.329 1.00 0.00 ? 123 GLN A CB   2  
ATOM 6375  C CG   . GLN A 1 123 ? 85.312  1.494   -11.830 1.00 0.00 ? 123 GLN A CG   2  
ATOM 6376  C CD   . GLN A 1 123 ? 85.896  0.101   -11.571 1.00 0.00 ? 123 GLN A CD   2  
ATOM 6377  O OE1  . GLN A 1 123 ? 86.200  -0.240  -10.446 1.00 0.00 ? 123 GLN A OE1  2  
ATOM 6378  N NE2  . GLN A 1 123 ? 86.068  -0.727  -12.567 1.00 0.00 ? 123 GLN A NE2  2  
ATOM 6379  H H    . GLN A 1 123 ? 87.133  4.056   -13.445 1.00 0.00 ? 123 GLN A H    2  
ATOM 6380  H HA   . GLN A 1 123 ? 87.358  1.101   -13.528 1.00 0.00 ? 123 GLN A HA   2  
ATOM 6381  H HB2  . GLN A 1 123 ? 84.805  2.726   -13.515 1.00 0.00 ? 123 GLN A HB2  2  
ATOM 6382  H HB3  . GLN A 1 123 ? 84.889  1.006   -13.879 1.00 0.00 ? 123 GLN A HB3  2  
ATOM 6383  H HG2  . GLN A 1 123 ? 85.893  2.231   -11.294 1.00 0.00 ? 123 GLN A HG2  2  
ATOM 6384  H HG3  . GLN A 1 123 ? 84.291  1.522   -11.483 1.00 0.00 ? 123 GLN A HG3  2  
ATOM 6385  H HE21 . GLN A 1 123 ? 85.826  -0.459  -13.477 1.00 0.00 ? 123 GLN A HE21 2  
ATOM 6386  H HE22 . GLN A 1 123 ? 86.440  -1.619  -12.403 1.00 0.00 ? 123 GLN A HE22 2  
ATOM 6387  N N    . GLY A 1 124 ? 86.902  3.409   -15.758 1.00 0.00 ? 124 GLY A N    2  
ATOM 6388  C CA   . GLY A 1 124 ? 86.941  3.715   -17.186 1.00 0.00 ? 124 GLY A CA   2  
ATOM 6389  C C    . GLY A 1 124 ? 85.669  4.391   -17.653 1.00 0.00 ? 124 GLY A C    2  
ATOM 6390  O O    . GLY A 1 124 ? 85.403  4.477   -18.852 1.00 0.00 ? 124 GLY A O    2  
ATOM 6391  H H    . GLY A 1 124 ? 86.935  4.146   -15.113 1.00 0.00 ? 124 GLY A H    2  
ATOM 6392  H HA2  . GLY A 1 124 ? 87.774  4.376   -17.376 1.00 0.00 ? 124 GLY A HA2  2  
ATOM 6393  H HA3  . GLY A 1 124 ? 87.083  2.806   -17.757 1.00 0.00 ? 124 GLY A HA3  2  
ATOM 6394  N N    . LYS A 1 125 ? 84.874  4.877   -16.699 1.00 0.00 ? 125 LYS A N    2  
ATOM 6395  C CA   . LYS A 1 125 ? 83.614  5.557   -17.010 1.00 0.00 ? 125 LYS A CA   2  
ATOM 6396  C C    . LYS A 1 125 ? 83.489  6.828   -16.172 1.00 0.00 ? 125 LYS A C    2  
ATOM 6397  O O    . LYS A 1 125 ? 84.222  7.017   -15.202 1.00 0.00 ? 125 LYS A O    2  
ATOM 6398  C CB   . LYS A 1 125 ? 82.438  4.614   -16.723 1.00 0.00 ? 125 LYS A CB   2  
ATOM 6399  C CG   . LYS A 1 125 ? 82.357  3.503   -17.795 1.00 0.00 ? 125 LYS A CG   2  
ATOM 6400  C CD   . LYS A 1 125 ? 81.633  4.004   -19.057 1.00 0.00 ? 125 LYS A CD   2  
ATOM 6401  C CE   . LYS A 1 125 ? 81.349  2.820   -19.984 1.00 0.00 ? 125 LYS A CE   2  
ATOM 6402  N NZ   . LYS A 1 125 ? 82.637  2.237   -20.454 1.00 0.00 ? 125 LYS A NZ   2  
ATOM 6403  H H    . LYS A 1 125 ? 85.139  4.779   -15.759 1.00 0.00 ? 125 LYS A H    2  
ATOM 6404  H HA   . LYS A 1 125 ? 83.598  5.835   -18.053 1.00 0.00 ? 125 LYS A HA   2  
ATOM 6405  H HB2  . LYS A 1 125 ? 82.591  4.160   -15.754 1.00 0.00 ? 125 LYS A HB2  2  
ATOM 6406  H HB3  . LYS A 1 125 ? 81.516  5.177   -16.710 1.00 0.00 ? 125 LYS A HB3  2  
ATOM 6407  H HG2  . LYS A 1 125 ? 83.356  3.183   -18.061 1.00 0.00 ? 125 LYS A HG2  2  
ATOM 6408  H HG3  . LYS A 1 125 ? 81.815  2.659   -17.391 1.00 0.00 ? 125 LYS A HG3  2  
ATOM 6409  H HD2  . LYS A 1 125 ? 80.701  4.473   -18.782 1.00 0.00 ? 125 LYS A HD2  2  
ATOM 6410  H HD3  . LYS A 1 125 ? 82.254  4.716   -19.577 1.00 0.00 ? 125 LYS A HD3  2  
ATOM 6411  H HE2  . LYS A 1 125 ? 80.788  2.069   -19.448 1.00 0.00 ? 125 LYS A HE2  2  
ATOM 6412  H HE3  . LYS A 1 125 ? 80.776  3.158   -20.835 1.00 0.00 ? 125 LYS A HE3  2  
ATOM 6413  H HZ1  . LYS A 1 125 ? 83.356  2.986   -20.516 1.00 0.00 ? 125 LYS A HZ1  2  
ATOM 6414  H HZ2  . LYS A 1 125 ? 82.502  1.807   -21.393 1.00 0.00 ? 125 LYS A HZ2  2  
ATOM 6415  H HZ3  . LYS A 1 125 ? 82.955  1.510   -19.782 1.00 0.00 ? 125 LYS A HZ3  2  
ATOM 6416  N N    . ASP A 1 126 ? 82.572  7.703   -16.566 1.00 0.00 ? 126 ASP A N    2  
ATOM 6417  C CA   . ASP A 1 126 ? 82.376  8.965   -15.859 1.00 0.00 ? 126 ASP A CA   2  
ATOM 6418  C C    . ASP A 1 126 ? 81.704  8.756   -14.503 1.00 0.00 ? 126 ASP A C    2  
ATOM 6419  O O    . ASP A 1 126 ? 80.882  7.855   -14.331 1.00 0.00 ? 126 ASP A O    2  
ATOM 6420  C CB   . ASP A 1 126 ? 81.519  9.906   -16.709 1.00 0.00 ? 126 ASP A CB   2  
ATOM 6421  C CG   . ASP A 1 126 ? 82.060  9.935   -18.141 1.00 0.00 ? 126 ASP A CG   2  
ATOM 6422  O OD1  . ASP A 1 126 ? 83.254  10.128  -18.298 1.00 0.00 ? 126 ASP A OD1  2  
ATOM 6423  O OD2  . ASP A 1 126 ? 81.269  9.763   -19.054 1.00 0.00 ? 126 ASP A OD2  2  
ATOM 6424  H H    . ASP A 1 126 ? 82.027  7.506   -17.357 1.00 0.00 ? 126 ASP A H    2  
ATOM 6425  H HA   . ASP A 1 126 ? 83.338  9.427   -15.701 1.00 0.00 ? 126 ASP A HA   2  
ATOM 6426  H HB2  . ASP A 1 126 ? 80.497  9.554   -16.717 1.00 0.00 ? 126 ASP A HB2  2  
ATOM 6427  H HB3  . ASP A 1 126 ? 81.555  10.901  -16.293 1.00 0.00 ? 126 ASP A HB3  2  
ATOM 6428  N N    . SER A 1 127 ? 82.055  9.618   -13.550 1.00 0.00 ? 127 SER A N    2  
ATOM 6429  C CA   . SER A 1 127 ? 81.488  9.565   -12.205 1.00 0.00 ? 127 SER A CA   2  
ATOM 6430  C C    . SER A 1 127 ? 81.576  10.947  -11.553 1.00 0.00 ? 127 SER A C    2  
ATOM 6431  O O    . SER A 1 127 ? 82.259  11.126  -10.546 1.00 0.00 ? 127 SER A O    2  
ATOM 6432  C CB   . SER A 1 127 ? 82.249  8.549   -11.353 1.00 0.00 ? 127 SER A CB   2  
ATOM 6433  O OG   . SER A 1 127 ? 82.182  7.273   -11.975 1.00 0.00 ? 127 SER A OG   2  
ATOM 6434  H H    . SER A 1 127 ? 82.707  10.319  -13.763 1.00 0.00 ? 127 SER A H    2  
ATOM 6435  H HA   . SER A 1 127 ? 80.449  9.270   -12.263 1.00 0.00 ? 127 SER A HA   2  
ATOM 6436  H HB2  . SER A 1 127 ? 83.280  8.847   -11.267 1.00 0.00 ? 127 SER A HB2  2  
ATOM 6437  H HB3  . SER A 1 127 ? 81.806  8.504   -10.366 1.00 0.00 ? 127 SER A HB3  2  
ATOM 6438  H HG   . SER A 1 127 ? 82.467  6.616   -11.335 1.00 0.00 ? 127 SER A HG   2  
ATOM 6439  N N    . PRO A 1 128 ? 80.892  11.947  -12.140 1.00 0.00 ? 128 PRO A N    2  
ATOM 6440  C CA   . PRO A 1 128 ? 80.903  13.331  -11.631 1.00 0.00 ? 128 PRO A CA   2  
ATOM 6441  C C    . PRO A 1 128 ? 80.765  13.419  -10.111 1.00 0.00 ? 128 PRO A C    2  
ATOM 6442  O O    . PRO A 1 128 ? 80.010  12.664  -9.497  1.00 0.00 ? 128 PRO A O    2  
ATOM 6443  C CB   . PRO A 1 128 ? 79.699  13.978  -12.333 1.00 0.00 ? 128 PRO A CB   2  
ATOM 6444  C CG   . PRO A 1 128 ? 79.599  13.257  -13.638 1.00 0.00 ? 128 PRO A CG   2  
ATOM 6445  C CD   . PRO A 1 128 ? 80.048  11.818  -13.349 1.00 0.00 ? 128 PRO A CD   2  
ATOM 6446  H HA   . PRO A 1 128 ? 81.806  13.829  -11.947 1.00 0.00 ? 128 PRO A HA   2  
ATOM 6447  H HB2  . PRO A 1 128 ? 78.797  13.832  -11.748 1.00 0.00 ? 128 PRO A HB2  2  
ATOM 6448  H HB3  . PRO A 1 128 ? 79.872  15.033  -12.499 1.00 0.00 ? 128 PRO A HB3  2  
ATOM 6449  H HG2  . PRO A 1 128 ? 78.576  13.274  -14.001 1.00 0.00 ? 128 PRO A HG2  2  
ATOM 6450  H HG3  . PRO A 1 128 ? 80.259  13.706  -14.368 1.00 0.00 ? 128 PRO A HG3  2  
ATOM 6451  H HD2  . PRO A 1 128 ? 79.193  11.184  -13.148 1.00 0.00 ? 128 PRO A HD2  2  
ATOM 6452  H HD3  . PRO A 1 128 ? 80.626  11.426  -14.170 1.00 0.00 ? 128 PRO A HD3  2  
ATOM 6453  N N    . ALA A 1 129 ? 81.490  14.370  -9.520  1.00 0.00 ? 129 ALA A N    2  
ATOM 6454  C CA   . ALA A 1 129 ? 81.446  14.599  -8.073  1.00 0.00 ? 129 ALA A CA   2  
ATOM 6455  C C    . ALA A 1 129 ? 80.525  15.777  -7.779  1.00 0.00 ? 129 ALA A C    2  
ATOM 6456  O O    . ALA A 1 129 ? 80.386  16.678  -8.607  1.00 0.00 ? 129 ALA A O    2  
ATOM 6457  C CB   . ALA A 1 129 ? 82.845  14.898  -7.558  1.00 0.00 ? 129 ALA A CB   2  
ATOM 6458  H H    . ALA A 1 129 ? 82.056  14.947  -10.073 1.00 0.00 ? 129 ALA A H    2  
ATOM 6459  H HA   . ALA A 1 129 ? 81.066  13.718  -7.572  1.00 0.00 ? 129 ALA A HA   2  
ATOM 6460  H HB1  . ALA A 1 129 ? 83.195  15.826  -7.986  1.00 0.00 ? 129 ALA A HB1  2  
ATOM 6461  H HB2  . ALA A 1 129 ? 83.512  14.097  -7.842  1.00 0.00 ? 129 ALA A HB2  2  
ATOM 6462  H HB3  . ALA A 1 129 ? 82.822  14.983  -6.482  1.00 0.00 ? 129 ALA A HB3  2  
ATOM 6463  N N    . ILE A 1 130 ? 79.885  15.767  -6.606  1.00 0.00 ? 130 ILE A N    2  
ATOM 6464  C CA   . ILE A 1 130 ? 78.961  16.847  -6.224  1.00 0.00 ? 130 ILE A CA   2  
ATOM 6465  C C    . ILE A 1 130 ? 79.277  17.354  -4.809  1.00 0.00 ? 130 ILE A C    2  
ATOM 6466  O O    . ILE A 1 130 ? 80.004  16.706  -4.059  1.00 0.00 ? 130 ILE A O    2  
ATOM 6467  C CB   . ILE A 1 130 ? 77.479  16.342  -6.333  1.00 0.00 ? 130 ILE A CB   2  
ATOM 6468  C CG1  . ILE A 1 130 ? 76.559  17.470  -6.875  1.00 0.00 ? 130 ILE A CG1  2  
ATOM 6469  C CG2  . ILE A 1 130 ? 76.956  15.855  -4.968  1.00 0.00 ? 130 ILE A CG2  2  
ATOM 6470  C CD1  . ILE A 1 130 ? 76.608  17.506  -8.410  1.00 0.00 ? 130 ILE A CD1  2  
ATOM 6471  H H    . ILE A 1 130 ? 80.026  15.016  -5.993  1.00 0.00 ? 130 ILE A H    2  
ATOM 6472  H HA   . ILE A 1 130 ? 79.097  17.681  -6.904  1.00 0.00 ? 130 ILE A HA   2  
ATOM 6473  H HB   . ILE A 1 130 ? 77.456  15.503  -7.018  1.00 0.00 ? 130 ILE A HB   2  
ATOM 6474  H HG12 . ILE A 1 130 ? 75.538  17.295  -6.562  1.00 0.00 ? 130 ILE A HG12 2  
ATOM 6475  H HG13 . ILE A 1 130 ? 76.891  18.423  -6.492  1.00 0.00 ? 130 ILE A HG13 2  
ATOM 6476  H HG21 . ILE A 1 130 ? 76.731  16.707  -4.346  1.00 0.00 ? 130 ILE A HG21 2  
ATOM 6477  H HG22 . ILE A 1 130 ? 77.709  15.248  -4.489  1.00 0.00 ? 130 ILE A HG22 2  
ATOM 6478  H HG23 . ILE A 1 130 ? 76.060  15.269  -5.114  1.00 0.00 ? 130 ILE A HG23 2  
ATOM 6479  H HD11 . ILE A 1 130 ? 77.615  17.714  -8.736  1.00 0.00 ? 130 ILE A HD11 2  
ATOM 6480  H HD12 . ILE A 1 130 ? 75.946  18.279  -8.772  1.00 0.00 ? 130 ILE A HD12 2  
ATOM 6481  H HD13 . ILE A 1 130 ? 76.292  16.551  -8.802  1.00 0.00 ? 130 ILE A HD13 2  
ATOM 6482  N N    . THR A 1 131 ? 78.735  18.525  -4.467  1.00 0.00 ? 131 THR A N    2  
ATOM 6483  C CA   . THR A 1 131 ? 78.966  19.139  -3.162  1.00 0.00 ? 131 THR A CA   2  
ATOM 6484  C C    . THR A 1 131 ? 78.050  18.543  -2.099  1.00 0.00 ? 131 THR A C    2  
ATOM 6485  O O    . THR A 1 131 ? 76.971  18.036  -2.400  1.00 0.00 ? 131 THR A O    2  
ATOM 6486  C CB   . THR A 1 131 ? 78.706  20.658  -3.237  1.00 0.00 ? 131 THR A CB   2  
ATOM 6487  O OG1  . THR A 1 131 ? 79.446  21.209  -4.317  1.00 0.00 ? 131 THR A OG1  2  
ATOM 6488  C CG2  . THR A 1 131 ? 79.135  21.330  -1.931  1.00 0.00 ? 131 THR A CG2  2  
ATOM 6489  H H    . THR A 1 131 ? 78.174  18.992  -5.110  1.00 0.00 ? 131 THR A H    2  
ATOM 6490  H HA   . THR A 1 131 ? 79.994  18.979  -2.872  1.00 0.00 ? 131 THR A HA   2  
ATOM 6491  H HB   . THR A 1 131 ? 77.653  20.834  -3.397  1.00 0.00 ? 131 THR A HB   2  
ATOM 6492  H HG1  . THR A 1 131 ? 78.884  21.842  -4.770  1.00 0.00 ? 131 THR A HG1  2  
ATOM 6493  H HG21 . THR A 1 131 ? 78.468  21.035  -1.136  1.00 0.00 ? 131 THR A HG21 2  
ATOM 6494  H HG22 . THR A 1 131 ? 79.097  22.403  -2.051  1.00 0.00 ? 131 THR A HG22 2  
ATOM 6495  H HG23 . THR A 1 131 ? 80.141  21.032  -1.685  1.00 0.00 ? 131 THR A HG23 2  
ATOM 6496  N N    . HIS A 1 132 ? 78.492  18.620  -0.850  1.00 0.00 ? 132 HIS A N    2  
ATOM 6497  C CA   . HIS A 1 132 ? 77.717  18.097  0.267   1.00 0.00 ? 132 HIS A CA   2  
ATOM 6498  C C    . HIS A 1 132 ? 76.285  18.623  0.224   1.00 0.00 ? 132 HIS A C    2  
ATOM 6499  O O    . HIS A 1 132 ? 75.340  17.905  0.552   1.00 0.00 ? 132 HIS A O    2  
ATOM 6500  C CB   . HIS A 1 132 ? 78.381  18.516  1.582   1.00 0.00 ? 132 HIS A CB   2  
ATOM 6501  C CG   . HIS A 1 132 ? 77.585  18.006  2.754   1.00 0.00 ? 132 HIS A CG   2  
ATOM 6502  N ND1  . HIS A 1 132 ? 78.128  17.149  3.696   1.00 0.00 ? 132 HIS A ND1  2  
ATOM 6503  C CD2  . HIS A 1 132 ? 76.290  18.238  3.158   1.00 0.00 ? 132 HIS A CD2  2  
ATOM 6504  C CE1  . HIS A 1 132 ? 77.178  16.897  4.613   1.00 0.00 ? 132 HIS A CE1  2  
ATOM 6505  N NE2  . HIS A 1 132 ? 76.039  17.536  4.334   1.00 0.00 ? 132 HIS A NE2  2  
ATOM 6506  H H    . HIS A 1 132 ? 79.359  19.042  -0.675  1.00 0.00 ? 132 HIS A H    2  
ATOM 6507  H HA   . HIS A 1 132 ? 77.699  17.019  0.211   1.00 0.00 ? 132 HIS A HA   2  
ATOM 6508  H HB2  . HIS A 1 132 ? 79.379  18.106  1.625   1.00 0.00 ? 132 HIS A HB2  2  
ATOM 6509  H HB3  . HIS A 1 132 ? 78.435  19.593  1.628   1.00 0.00 ? 132 HIS A HB3  2  
ATOM 6510  H HD1  . HIS A 1 132 ? 79.040  16.790  3.695   1.00 0.00 ? 132 HIS A HD1  2  
ATOM 6511  H HD2  . HIS A 1 132 ? 75.647  19.005  2.753   1.00 0.00 ? 132 HIS A HD2  2  
ATOM 6512  H HE1  . HIS A 1 132 ? 77.318  16.257  5.471   1.00 0.00 ? 132 HIS A HE1  2  
ATOM 6513  N N    . GLU A 1 133 ? 76.133  19.888  -0.156  1.00 0.00 ? 133 GLU A N    2  
ATOM 6514  C CA   . GLU A 1 133 ? 74.813  20.509  -0.208  1.00 0.00 ? 133 GLU A CA   2  
ATOM 6515  C C    . GLU A 1 133 ? 73.944  19.863  -1.278  1.00 0.00 ? 133 GLU A C    2  
ATOM 6516  O O    . GLU A 1 133 ? 72.854  19.372  -0.991  1.00 0.00 ? 133 GLU A O    2  
ATOM 6517  C CB   . GLU A 1 133 ? 74.952  22.005  -0.500  1.00 0.00 ? 133 GLU A CB   2  
ATOM 6518  C CG   . GLU A 1 133 ? 75.796  22.662  0.593   1.00 0.00 ? 133 GLU A CG   2  
ATOM 6519  C CD   . GLU A 1 133 ? 75.015  22.669  1.908   1.00 0.00 ? 133 GLU A CD   2  
ATOM 6520  O OE1  . GLU A 1 133 ? 75.136  21.708  2.651   1.00 0.00 ? 133 GLU A OE1  2  
ATOM 6521  O OE2  . GLU A 1 133 ? 74.307  23.633  2.150   1.00 0.00 ? 133 GLU A OE2  2  
ATOM 6522  H H    . GLU A 1 133 ? 76.921  20.422  -0.384  1.00 0.00 ? 133 GLU A H    2  
ATOM 6523  H HA   . GLU A 1 133 ? 74.333  20.388  0.750   1.00 0.00 ? 133 GLU A HA   2  
ATOM 6524  H HB2  . GLU A 1 133 ? 75.434  22.142  -1.457  1.00 0.00 ? 133 GLU A HB2  2  
ATOM 6525  H HB3  . GLU A 1 133 ? 73.974  22.460  -0.522  1.00 0.00 ? 133 GLU A HB3  2  
ATOM 6526  H HG2  . GLU A 1 133 ? 76.715  22.108  0.722   1.00 0.00 ? 133 GLU A HG2  2  
ATOM 6527  H HG3  . GLU A 1 133 ? 76.026  23.679  0.309   1.00 0.00 ? 133 GLU A HG3  2  
ATOM 6528  N N    . GLU A 1 134 ? 74.429  19.872  -2.511  1.00 0.00 ? 134 GLU A N    2  
ATOM 6529  C CA   . GLU A 1 134 ? 73.680  19.288  -3.612  1.00 0.00 ? 134 GLU A CA   2  
ATOM 6530  C C    . GLU A 1 134 ? 73.354  17.829  -3.317  1.00 0.00 ? 134 GLU A C    2  
ATOM 6531  O O    . GLU A 1 134 ? 72.239  17.376  -3.566  1.00 0.00 ? 134 GLU A O    2  
ATOM 6532  C CB   . GLU A 1 134 ? 74.489  19.386  -4.901  1.00 0.00 ? 134 GLU A CB   2  
ATOM 6533  C CG   . GLU A 1 134 ? 74.633  20.855  -5.306  1.00 0.00 ? 134 GLU A CG   2  
ATOM 6534  C CD   . GLU A 1 134 ? 75.302  20.943  -6.679  1.00 0.00 ? 134 GLU A CD   2  
ATOM 6535  O OE1  . GLU A 1 134 ? 74.768  20.367  -7.613  1.00 0.00 ? 134 GLU A OE1  2  
ATOM 6536  O OE2  . GLU A 1 134 ? 76.336  21.585  -6.773  1.00 0.00 ? 134 GLU A OE2  2  
ATOM 6537  H H    . GLU A 1 134 ? 75.303  20.282  -2.684  1.00 0.00 ? 134 GLU A H    2  
ATOM 6538  H HA   . GLU A 1 134 ? 72.757  19.834  -3.736  1.00 0.00 ? 134 GLU A HA   2  
ATOM 6539  H HB2  . GLU A 1 134 ? 75.465  18.960  -4.737  1.00 0.00 ? 134 GLU A HB2  2  
ATOM 6540  H HB3  . GLU A 1 134 ? 73.984  18.843  -5.685  1.00 0.00 ? 134 GLU A HB3  2  
ATOM 6541  H HG2  . GLU A 1 134 ? 73.656  21.314  -5.351  1.00 0.00 ? 134 GLU A HG2  2  
ATOM 6542  H HG3  . GLU A 1 134 ? 75.241  21.372  -4.578  1.00 0.00 ? 134 GLU A HG3  2  
ATOM 6543  N N    . ALA A 1 135 ? 74.325  17.097  -2.776  1.00 0.00 ? 135 ALA A N    2  
ATOM 6544  C CA   . ALA A 1 135 ? 74.102  15.695  -2.448  1.00 0.00 ? 135 ALA A CA   2  
ATOM 6545  C C    . ALA A 1 135 ? 72.919  15.575  -1.496  1.00 0.00 ? 135 ALA A C    2  
ATOM 6546  O O    . ALA A 1 135 ? 71.939  14.887  -1.786  1.00 0.00 ? 135 ALA A O    2  
ATOM 6547  C CB   . ALA A 1 135 ? 75.350  15.109  -1.804  1.00 0.00 ? 135 ALA A CB   2  
ATOM 6548  H H    . ALA A 1 135 ? 75.194  17.508  -2.590  1.00 0.00 ? 135 ALA A H    2  
ATOM 6549  H HA   . ALA A 1 135 ? 73.883  15.150  -3.354  1.00 0.00 ? 135 ALA A HA   2  
ATOM 6550  H HB1  . ALA A 1 135 ? 75.160  14.086  -1.516  1.00 0.00 ? 135 ALA A HB1  2  
ATOM 6551  H HB2  . ALA A 1 135 ? 75.609  15.687  -0.929  1.00 0.00 ? 135 ALA A HB2  2  
ATOM 6552  H HB3  . ALA A 1 135 ? 76.167  15.138  -2.509  1.00 0.00 ? 135 ALA A HB3  2  
ATOM 6553  N N    . LEU A 1 136 ? 73.015  16.263  -0.364  1.00 0.00 ? 136 LEU A N    2  
ATOM 6554  C CA   . LEU A 1 136 ? 71.945  16.246  0.627   1.00 0.00 ? 136 LEU A CA   2  
ATOM 6555  C C    . LEU A 1 136 ? 70.615  16.582  -0.039  1.00 0.00 ? 136 LEU A C    2  
ATOM 6556  O O    . LEU A 1 136 ? 69.569  16.043  0.326   1.00 0.00 ? 136 LEU A O    2  
ATOM 6557  C CB   . LEU A 1 136 ? 72.245  17.274  1.731   1.00 0.00 ? 136 LEU A CB   2  
ATOM 6558  C CG   . LEU A 1 136 ? 71.273  17.095  2.926   1.00 0.00 ? 136 LEU A CG   2  
ATOM 6559  C CD1  . LEU A 1 136 ? 71.778  15.997  3.874   1.00 0.00 ? 136 LEU A CD1  2  
ATOM 6560  C CD2  . LEU A 1 136 ? 71.173  18.410  3.711   1.00 0.00 ? 136 LEU A CD2  2  
ATOM 6561  H H    . LEU A 1 136 ? 73.821  16.791  -0.195  1.00 0.00 ? 136 LEU A H    2  
ATOM 6562  H HA   . LEU A 1 136 ? 71.885  15.263  1.064   1.00 0.00 ? 136 LEU A HA   2  
ATOM 6563  H HB2  . LEU A 1 136 ? 73.266  17.148  2.064   1.00 0.00 ? 136 LEU A HB2  2  
ATOM 6564  H HB3  . LEU A 1 136 ? 72.129  18.267  1.319   1.00 0.00 ? 136 LEU A HB3  2  
ATOM 6565  H HG   . LEU A 1 136 ? 70.293  16.824  2.561   1.00 0.00 ? 136 LEU A HG   2  
ATOM 6566  H HD11 . LEU A 1 136 ? 72.797  16.205  4.164   1.00 0.00 ? 136 LEU A HD11 2  
ATOM 6567  H HD12 . LEU A 1 136 ? 71.734  15.038  3.380   1.00 0.00 ? 136 LEU A HD12 2  
ATOM 6568  H HD13 . LEU A 1 136 ? 71.154  15.972  4.756   1.00 0.00 ? 136 LEU A HD13 2  
ATOM 6569  H HD21 . LEU A 1 136 ? 72.159  18.720  4.024   1.00 0.00 ? 136 LEU A HD21 2  
ATOM 6570  H HD22 . LEU A 1 136 ? 70.549  18.263  4.581   1.00 0.00 ? 136 LEU A HD22 2  
ATOM 6571  H HD23 . LEU A 1 136 ? 70.738  19.172  3.082   1.00 0.00 ? 136 LEU A HD23 2  
ATOM 6572  N N    . ALA A 1 137 ? 70.667  17.473  -1.024  1.00 0.00 ? 137 ALA A N    2  
ATOM 6573  C CA   . ALA A 1 137 ? 69.465  17.875  -1.746  1.00 0.00 ? 137 ALA A CA   2  
ATOM 6574  C C    . ALA A 1 137 ? 68.985  16.753  -2.664  1.00 0.00 ? 137 ALA A C    2  
ATOM 6575  O O    . ALA A 1 137 ? 67.783  16.533  -2.813  1.00 0.00 ? 137 ALA A O    2  
ATOM 6576  C CB   . ALA A 1 137 ? 69.751  19.126  -2.565  1.00 0.00 ? 137 ALA A CB   2  
ATOM 6577  H H    . ALA A 1 137 ? 71.534  17.862  -1.276  1.00 0.00 ? 137 ALA A H    2  
ATOM 6578  H HA   . ALA A 1 137 ? 68.688  18.098  -1.032  1.00 0.00 ? 137 ALA A HA   2  
ATOM 6579  H HB1  . ALA A 1 137 ? 70.246  19.857  -1.944  1.00 0.00 ? 137 ALA A HB1  2  
ATOM 6580  H HB2  . ALA A 1 137 ? 68.821  19.536  -2.930  1.00 0.00 ? 137 ALA A HB2  2  
ATOM 6581  H HB3  . ALA A 1 137 ? 70.386  18.873  -3.400  1.00 0.00 ? 137 ALA A HB3  2  
ATOM 6582  N N    . MET A 1 138 ? 69.932  16.051  -3.281  1.00 0.00 ? 138 MET A N    2  
ATOM 6583  C CA   . MET A 1 138 ? 69.592  14.961  -4.188  1.00 0.00 ? 138 MET A CA   2  
ATOM 6584  C C    . MET A 1 138 ? 69.000  13.787  -3.415  1.00 0.00 ? 138 MET A C    2  
ATOM 6585  O O    . MET A 1 138 ? 67.858  13.405  -3.640  1.00 0.00 ? 138 MET A O    2  
ATOM 6586  C CB   . MET A 1 138 ? 70.843  14.505  -4.951  1.00 0.00 ? 138 MET A CB   2  
ATOM 6587  C CG   . MET A 1 138 ? 71.226  15.559  -5.997  1.00 0.00 ? 138 MET A CG   2  
ATOM 6588  S SD   . MET A 1 138 ? 72.884  15.208  -6.631  1.00 0.00 ? 138 MET A SD   2  
ATOM 6589  C CE   . MET A 1 138 ? 72.907  16.479  -7.920  1.00 0.00 ? 138 MET A CE   2  
ATOM 6590  H H    . MET A 1 138 ? 70.872  16.274  -3.128  1.00 0.00 ? 138 MET A H    2  
ATOM 6591  H HA   . MET A 1 138 ? 68.858  15.312  -4.898  1.00 0.00 ? 138 MET A HA   2  
ATOM 6592  H HB2  . MET A 1 138 ? 71.660  14.375  -4.257  1.00 0.00 ? 138 MET A HB2  2  
ATOM 6593  H HB3  . MET A 1 138 ? 70.642  13.567  -5.451  1.00 0.00 ? 138 MET A HB3  2  
ATOM 6594  H HG2  . MET A 1 138 ? 70.516  15.532  -6.811  1.00 0.00 ? 138 MET A HG2  2  
ATOM 6595  H HG3  . MET A 1 138 ? 71.214  16.539  -5.543  1.00 0.00 ? 138 MET A HG3  2  
ATOM 6596  H HE1  . MET A 1 138 ? 72.514  17.403  -7.522  1.00 0.00 ? 138 MET A HE1  2  
ATOM 6597  H HE2  . MET A 1 138 ? 72.297  16.158  -8.752  1.00 0.00 ? 138 MET A HE2  2  
ATOM 6598  H HE3  . MET A 1 138 ? 73.921  16.634  -8.255  1.00 0.00 ? 138 MET A HE3  2  
ATOM 6599  N N    . ILE A 1 139 ? 69.789  13.205  -2.519  1.00 0.00 ? 139 ILE A N    2  
ATOM 6600  C CA   . ILE A 1 139 ? 69.336  12.054  -1.740  1.00 0.00 ? 139 ILE A CA   2  
ATOM 6601  C C    . ILE A 1 139 ? 67.920  12.272  -1.202  1.00 0.00 ? 139 ILE A C    2  
ATOM 6602  O O    . ILE A 1 139 ? 67.224  11.317  -0.858  1.00 0.00 ? 139 ILE A O    2  
ATOM 6603  C CB   . ILE A 1 139 ? 70.280  11.795  -0.542  1.00 0.00 ? 139 ILE A CB   2  
ATOM 6604  C CG1  . ILE A 1 139 ? 71.732  11.592  -1.051  1.00 0.00 ? 139 ILE A CG1  2  
ATOM 6605  C CG2  . ILE A 1 139 ? 69.803  10.543  0.209   1.00 0.00 ? 139 ILE A CG2  2  
ATOM 6606  C CD1  . ILE A 1 139 ? 72.747  11.907  0.061   1.00 0.00 ? 139 ILE A CD1  2  
ATOM 6607  H H    . ILE A 1 139 ? 70.709  13.529  -2.403  1.00 0.00 ? 139 ILE A H    2  
ATOM 6608  H HA   . ILE A 1 139 ? 69.336  11.181  -2.375  1.00 0.00 ? 139 ILE A HA   2  
ATOM 6609  H HB   . ILE A 1 139 ? 70.238  12.646  0.124   1.00 0.00 ? 139 ILE A HB   2  
ATOM 6610  H HG12 . ILE A 1 139 ? 71.865  10.570  -1.373  1.00 0.00 ? 139 ILE A HG12 2  
ATOM 6611  H HG13 . ILE A 1 139 ? 71.920  12.250  -1.888  1.00 0.00 ? 139 ILE A HG13 2  
ATOM 6612  H HG21 . ILE A 1 139 ? 68.893  10.770  0.745   1.00 0.00 ? 139 ILE A HG21 2  
ATOM 6613  H HG22 . ILE A 1 139 ? 70.559  10.227  0.908   1.00 0.00 ? 139 ILE A HG22 2  
ATOM 6614  H HG23 . ILE A 1 139 ? 69.613  9.747   -0.497  1.00 0.00 ? 139 ILE A HG23 2  
ATOM 6615  H HD11 . ILE A 1 139 ? 73.743  11.909  -0.357  1.00 0.00 ? 139 ILE A HD11 2  
ATOM 6616  H HD12 . ILE A 1 139 ? 72.688  11.156  0.833   1.00 0.00 ? 139 ILE A HD12 2  
ATOM 6617  H HD13 . ILE A 1 139 ? 72.536  12.877  0.483   1.00 0.00 ? 139 ILE A HD13 2  
ATOM 6618  N N    . LYS A 1 140 ? 67.502  13.534  -1.130  1.00 0.00 ? 140 LYS A N    2  
ATOM 6619  C CA   . LYS A 1 140 ? 66.166  13.870  -0.629  1.00 0.00 ? 140 LYS A CA   2  
ATOM 6620  C C    . LYS A 1 140 ? 65.124  13.840  -1.752  1.00 0.00 ? 140 LYS A C    2  
ATOM 6621  O O    . LYS A 1 140 ? 63.963  13.506  -1.516  1.00 0.00 ? 140 LYS A O    2  
ATOM 6622  C CB   . LYS A 1 140 ? 66.200  15.271  0.000   1.00 0.00 ? 140 LYS A CB   2  
ATOM 6623  C CG   . LYS A 1 140 ? 64.890  15.567  0.763   1.00 0.00 ? 140 LYS A CG   2  
ATOM 6624  C CD   . LYS A 1 140 ? 64.882  14.870  2.138   1.00 0.00 ? 140 LYS A CD   2  
ATOM 6625  C CE   . LYS A 1 140 ? 63.782  15.476  3.014   1.00 0.00 ? 140 LYS A CE   2  
ATOM 6626  N NZ   . LYS A 1 140 ? 64.181  16.850  3.430   1.00 0.00 ? 140 LYS A NZ   2  
ATOM 6627  H H    . LYS A 1 140 ? 68.102  14.251  -1.423  1.00 0.00 ? 140 LYS A H    2  
ATOM 6628  H HA   . LYS A 1 140 ? 65.881  13.156  0.129   1.00 0.00 ? 140 LYS A HA   2  
ATOM 6629  H HB2  . LYS A 1 140 ? 67.039  15.336  0.677   1.00 0.00 ? 140 LYS A HB2  2  
ATOM 6630  H HB3  . LYS A 1 140 ? 66.325  16.004  -0.785  1.00 0.00 ? 140 LYS A HB3  2  
ATOM 6631  H HG2  . LYS A 1 140 ? 64.800  16.634  0.906   1.00 0.00 ? 140 LYS A HG2  2  
ATOM 6632  H HG3  . LYS A 1 140 ? 64.048  15.218  0.184   1.00 0.00 ? 140 LYS A HG3  2  
ATOM 6633  H HD2  . LYS A 1 140 ? 64.689  13.815  2.009   1.00 0.00 ? 140 LYS A HD2  2  
ATOM 6634  H HD3  . LYS A 1 140 ? 65.835  15.004  2.624   1.00 0.00 ? 140 LYS A HD3  2  
ATOM 6635  H HE2  . LYS A 1 140 ? 62.859  15.522  2.455   1.00 0.00 ? 140 LYS A HE2  2  
ATOM 6636  H HE3  . LYS A 1 140 ? 63.640  14.862  3.891   1.00 0.00 ? 140 LYS A HE3  2  
ATOM 6637  H HZ1  . LYS A 1 140 ? 65.070  17.112  2.958   1.00 0.00 ? 140 LYS A HZ1  2  
ATOM 6638  H HZ2  . LYS A 1 140 ? 64.314  16.875  4.461   1.00 0.00 ? 140 LYS A HZ2  2  
ATOM 6639  H HZ3  . LYS A 1 140 ? 63.437  17.525  3.160   1.00 0.00 ? 140 LYS A HZ3  2  
ATOM 6640  N N    . ASP A 1 141 ? 65.532  14.214  -2.966  1.00 0.00 ? 141 ASP A N    2  
ATOM 6641  C CA   . ASP A 1 141 ? 64.609  14.252  -4.111  1.00 0.00 ? 141 ASP A CA   2  
ATOM 6642  C C    . ASP A 1 141 ? 64.649  12.960  -4.929  1.00 0.00 ? 141 ASP A C    2  
ATOM 6643  O O    . ASP A 1 141 ? 63.679  12.617  -5.604  1.00 0.00 ? 141 ASP A O    2  
ATOM 6644  C CB   . ASP A 1 141 ? 64.973  15.428  -5.020  1.00 0.00 ? 141 ASP A CB   2  
ATOM 6645  C CG   . ASP A 1 141 ? 64.884  16.737  -4.230  1.00 0.00 ? 141 ASP A CG   2  
ATOM 6646  O OD1  . ASP A 1 141 ? 64.527  16.682  -3.064  1.00 0.00 ? 141 ASP A OD1  2  
ATOM 6647  O OD2  . ASP A 1 141 ? 65.173  17.773  -4.806  1.00 0.00 ? 141 ASP A OD2  2  
ATOM 6648  H H    . ASP A 1 141 ? 66.465  14.489  -3.094  1.00 0.00 ? 141 ASP A H    2  
ATOM 6649  H HA   . ASP A 1 141 ? 63.600  14.402  -3.751  1.00 0.00 ? 141 ASP A HA   2  
ATOM 6650  H HB2  . ASP A 1 141 ? 65.980  15.298  -5.388  1.00 0.00 ? 141 ASP A HB2  2  
ATOM 6651  H HB3  . ASP A 1 141 ? 64.288  15.466  -5.852  1.00 0.00 ? 141 ASP A HB3  2  
ATOM 6652  N N    . CYS A 1 142 ? 65.773  12.258  -4.884  1.00 0.00 ? 142 CYS A N    2  
ATOM 6653  C CA   . CYS A 1 142 ? 65.922  11.023  -5.644  1.00 0.00 ? 142 CYS A CA   2  
ATOM 6654  C C    . CYS A 1 142 ? 64.735  10.088  -5.418  1.00 0.00 ? 142 CYS A C    2  
ATOM 6655  O O    . CYS A 1 142 ? 64.479  9.653   -4.296  1.00 0.00 ? 142 CYS A O    2  
ATOM 6656  C CB   . CYS A 1 142 ? 67.219  10.315  -5.244  1.00 0.00 ? 142 CYS A CB   2  
ATOM 6657  S SG   . CYS A 1 142 ? 67.302  8.692   -6.046  1.00 0.00 ? 142 CYS A SG   2  
ATOM 6658  H H    . CYS A 1 142 ? 66.517  12.580  -4.343  1.00 0.00 ? 142 CYS A H    2  
ATOM 6659  H HA   . CYS A 1 142 ? 65.973  11.271  -6.692  1.00 0.00 ? 142 CYS A HA   2  
ATOM 6660  H HB2  . CYS A 1 142 ? 68.064  10.912  -5.554  1.00 0.00 ? 142 CYS A HB2  2  
ATOM 6661  H HB3  . CYS A 1 142 ? 67.243  10.188  -4.171  1.00 0.00 ? 142 CYS A HB3  2  
ATOM 6662  N N    . GLU A 1 143 ? 64.015  9.785   -6.501  1.00 0.00 ? 143 GLU A N    2  
ATOM 6663  C CA   . GLU A 1 143 ? 62.847  8.898   -6.434  1.00 0.00 ? 143 GLU A CA   2  
ATOM 6664  C C    . GLU A 1 143 ? 62.846  7.933   -7.618  1.00 0.00 ? 143 GLU A C    2  
ATOM 6665  O O    . GLU A 1 143 ? 62.794  8.357   -8.774  1.00 0.00 ? 143 GLU A O    2  
ATOM 6666  C CB   . GLU A 1 143 ? 61.561  9.733   -6.449  1.00 0.00 ? 143 GLU A CB   2  
ATOM 6667  C CG   . GLU A 1 143 ? 60.364  8.855   -6.068  1.00 0.00 ? 143 GLU A CG   2  
ATOM 6668  C CD   . GLU A 1 143 ? 60.429  8.518   -4.577  1.00 0.00 ? 143 GLU A CD   2  
ATOM 6669  O OE1  . GLU A 1 143 ? 60.293  9.429   -3.778  1.00 0.00 ? 143 GLU A OE1  2  
ATOM 6670  O OE2  . GLU A 1 143 ? 60.619  7.357   -4.260  1.00 0.00 ? 143 GLU A OE2  2  
ATOM 6671  H H    . GLU A 1 143 ? 64.271  10.171  -7.364  1.00 0.00 ? 143 GLU A H    2  
ATOM 6672  H HA   . GLU A 1 143 ? 62.881  8.323   -5.519  1.00 0.00 ? 143 GLU A HA   2  
ATOM 6673  H HB2  . GLU A 1 143 ? 61.653  10.544  -5.741  1.00 0.00 ? 143 GLU A HB2  2  
ATOM 6674  H HB3  . GLU A 1 143 ? 61.408  10.139  -7.439  1.00 0.00 ? 143 GLU A HB3  2  
ATOM 6675  H HG2  . GLU A 1 143 ? 59.448  9.387   -6.278  1.00 0.00 ? 143 GLU A HG2  2  
ATOM 6676  H HG3  . GLU A 1 143 ? 60.390  7.941   -6.643  1.00 0.00 ? 143 GLU A HG3  2  
ATOM 6677  N N    . VAL A 1 144 ? 62.910  6.630   -7.322  1.00 0.00 ? 144 VAL A N    2  
ATOM 6678  C CA   . VAL A 1 144 ? 62.924  5.592   -8.364  1.00 0.00 ? 144 VAL A CA   2  
ATOM 6679  C C    . VAL A 1 144 ? 61.668  4.726   -8.281  1.00 0.00 ? 144 VAL A C    2  
ATOM 6680  O O    . VAL A 1 144 ? 61.348  4.183   -7.225  1.00 0.00 ? 144 VAL A O    2  
ATOM 6681  C CB   . VAL A 1 144 ? 64.158  4.678   -8.197  1.00 0.00 ? 144 VAL A CB   2  
ATOM 6682  C CG1  . VAL A 1 144 ? 64.354  3.834   -9.460  1.00 0.00 ? 144 VAL A CG1  2  
ATOM 6683  C CG2  . VAL A 1 144 ? 65.401  5.544   -7.964  1.00 0.00 ? 144 VAL A CG2  2  
ATOM 6684  H H    . VAL A 1 144 ? 62.955  6.358   -6.382  1.00 0.00 ? 144 VAL A H    2  
ATOM 6685  H HA   . VAL A 1 144 ? 62.963  6.054   -9.343  1.00 0.00 ? 144 VAL A HA   2  
ATOM 6686  H HB   . VAL A 1 144 ? 64.013  4.024   -7.348  1.00 0.00 ? 144 VAL A HB   2  
ATOM 6687  H HG11 . VAL A 1 144 ? 65.122  3.096   -9.284  1.00 0.00 ? 144 VAL A HG11 2  
ATOM 6688  H HG12 . VAL A 1 144 ? 64.649  4.473   -10.278 1.00 0.00 ? 144 VAL A HG12 2  
ATOM 6689  H HG13 . VAL A 1 144 ? 63.427  3.337   -9.707  1.00 0.00 ? 144 VAL A HG13 2  
ATOM 6690  H HG21 . VAL A 1 144 ? 66.287  4.930   -8.035  1.00 0.00 ? 144 VAL A HG21 2  
ATOM 6691  H HG22 . VAL A 1 144 ? 65.350  5.988   -6.982  1.00 0.00 ? 144 VAL A HG22 2  
ATOM 6692  H HG23 . VAL A 1 144 ? 65.443  6.323   -8.709  1.00 0.00 ? 144 VAL A HG23 2  
ATOM 6693  N N    . SER A 1 145 ? 60.961  4.597   -9.406  1.00 0.00 ? 145 SER A N    2  
ATOM 6694  C CA   . SER A 1 145 ? 59.735  3.791   -9.462  1.00 0.00 ? 145 SER A CA   2  
ATOM 6695  C C    . SER A 1 145 ? 60.022  2.431   -10.093 1.00 0.00 ? 145 SER A C    2  
ATOM 6696  O O    . SER A 1 145 ? 61.067  2.234   -10.713 1.00 0.00 ? 145 SER A O    2  
ATOM 6697  C CB   . SER A 1 145 ? 58.674  4.518   -10.288 1.00 0.00 ? 145 SER A CB   2  
ATOM 6698  O OG   . SER A 1 145 ? 59.079  4.551   -11.650 1.00 0.00 ? 145 SER A OG   2  
ATOM 6699  H H    . SER A 1 145 ? 61.269  5.055   -10.216 1.00 0.00 ? 145 SER A H    2  
ATOM 6700  H HA   . SER A 1 145 ? 59.351  3.638   -8.463  1.00 0.00 ? 145 SER A HA   2  
ATOM 6701  H HB2  . SER A 1 145 ? 57.736  3.994   -10.211 1.00 0.00 ? 145 SER A HB2  2  
ATOM 6702  H HB3  . SER A 1 145 ? 58.554  5.525   -9.912  1.00 0.00 ? 145 SER A HB3  2  
ATOM 6703  H HG   . SER A 1 145 ? 59.937  4.982   -11.693 1.00 0.00 ? 145 SER A HG   2  
ATOM 6704  N N    . ILE A 1 146 ? 59.084  1.494   -9.929  1.00 0.00 ? 146 ILE A N    2  
ATOM 6705  C CA   . ILE A 1 146 ? 59.233  0.141   -10.476 1.00 0.00 ? 146 ILE A CA   2  
ATOM 6706  C C    . ILE A 1 146 ? 57.883  -0.377  -10.972 1.00 0.00 ? 146 ILE A C    2  
ATOM 6707  O O    . ILE A 1 146 ? 56.832  -0.004  -10.451 1.00 0.00 ? 146 ILE A O    2  
ATOM 6708  C CB   . ILE A 1 146 ? 59.771  -0.843  -9.403  1.00 0.00 ? 146 ILE A CB   2  
ATOM 6709  C CG1  . ILE A 1 146 ? 61.101  -0.306  -8.787  1.00 0.00 ? 146 ILE A CG1  2  
ATOM 6710  C CG2  . ILE A 1 146 ? 60.007  -2.217  -10.057 1.00 0.00 ? 146 ILE A CG2  2  
ATOM 6711  C CD1  . ILE A 1 146 ? 60.815  0.561   -7.547  1.00 0.00 ? 146 ILE A CD1  2  
ATOM 6712  H H    . ILE A 1 146 ? 58.271  1.717   -9.427  1.00 0.00 ? 146 ILE A H    2  
ATOM 6713  H HA   . ILE A 1 146 ? 59.923  0.161   -11.309 1.00 0.00 ? 146 ILE A HA   2  
ATOM 6714  H HB   . ILE A 1 146 ? 59.027  -0.953  -8.626  1.00 0.00 ? 146 ILE A HB   2  
ATOM 6715  H HG12 . ILE A 1 146 ? 61.732  -1.133  -8.490  1.00 0.00 ? 146 ILE A HG12 2  
ATOM 6716  H HG13 . ILE A 1 146 ? 61.629  0.286   -9.519  1.00 0.00 ? 146 ILE A HG13 2  
ATOM 6717  H HG21 . ILE A 1 146 ? 59.063  -2.640  -10.361 1.00 0.00 ? 146 ILE A HG21 2  
ATOM 6718  H HG22 . ILE A 1 146 ? 60.480  -2.882  -9.349  1.00 0.00 ? 146 ILE A HG22 2  
ATOM 6719  H HG23 . ILE A 1 146 ? 60.644  -2.100  -10.920 1.00 0.00 ? 146 ILE A HG23 2  
ATOM 6720  H HD11 . ILE A 1 146 ? 59.961  1.193   -7.730  1.00 0.00 ? 146 ILE A HD11 2  
ATOM 6721  H HD12 . ILE A 1 146 ? 61.676  1.177   -7.330  1.00 0.00 ? 146 ILE A HD12 2  
ATOM 6722  H HD13 . ILE A 1 146 ? 60.610  -0.078  -6.700  1.00 0.00 ? 146 ILE A HD13 2  
ATOM 6723  N N    . ASP A 1 147 ? 57.925  -1.246  -11.979 1.00 0.00 ? 147 ASP A N    2  
ATOM 6724  C CA   . ASP A 1 147 ? 56.709  -1.827  -12.545 1.00 0.00 ? 147 ASP A CA   2  
ATOM 6725  C C    . ASP A 1 147 ? 57.056  -3.095  -13.316 1.00 0.00 ? 147 ASP A C    2  
ATOM 6726  O O    . ASP A 1 147 ? 57.304  -3.051  -14.521 1.00 0.00 ? 147 ASP A O    2  
ATOM 6727  C CB   . ASP A 1 147 ? 56.033  -0.823  -13.482 1.00 0.00 ? 147 ASP A CB   2  
ATOM 6728  C CG   . ASP A 1 147 ? 54.660  -1.355  -13.897 1.00 0.00 ? 147 ASP A CG   2  
ATOM 6729  O OD1  . ASP A 1 147 ? 54.448  -2.550  -13.774 1.00 0.00 ? 147 ASP A OD1  2  
ATOM 6730  O OD2  . ASP A 1 147 ? 53.844  -0.558  -14.330 1.00 0.00 ? 147 ASP A OD2  2  
ATOM 6731  H H    . ASP A 1 147 ? 58.794  -1.506  -12.347 1.00 0.00 ? 147 ASP A H    2  
ATOM 6732  H HA   . ASP A 1 147 ? 56.027  -2.076  -11.744 1.00 0.00 ? 147 ASP A HA   2  
ATOM 6733  H HB2  . ASP A 1 147 ? 55.914  0.122   -12.970 1.00 0.00 ? 147 ASP A HB2  2  
ATOM 6734  H HB3  . ASP A 1 147 ? 56.644  -0.683  -14.360 1.00 0.00 ? 147 ASP A HB3  2  
ATOM 6735  N N    . ILE A 1 148 ? 57.099  -4.222  -12.606 1.00 0.00 ? 148 ILE A N    2  
ATOM 6736  C CA   . ILE A 1 148 ? 57.449  -5.500  -13.226 1.00 0.00 ? 148 ILE A CA   2  
ATOM 6737  C C    . ILE A 1 148 ? 56.245  -6.155  -13.900 1.00 0.00 ? 148 ILE A C    2  
ATOM 6738  O O    . ILE A 1 148 ? 55.100  -5.960  -13.490 1.00 0.00 ? 148 ILE A O    2  
ATOM 6739  C CB   . ILE A 1 148 ? 58.021  -6.473  -12.179 1.00 0.00 ? 148 ILE A CB   2  
ATOM 6740  C CG1  . ILE A 1 148 ? 58.387  -7.804  -12.859 1.00 0.00 ? 148 ILE A CG1  2  
ATOM 6741  C CG2  . ILE A 1 148 ? 56.975  -6.707  -11.092 1.00 0.00 ? 148 ILE A CG2  2  
ATOM 6742  C CD1  . ILE A 1 148 ? 59.219  -8.676  -11.912 1.00 0.00 ? 148 ILE A CD1  2  
ATOM 6743  H H    . ILE A 1 148 ? 56.909  -4.191  -11.645 1.00 0.00 ? 148 ILE A H    2  
ATOM 6744  H HA   . ILE A 1 148 ? 58.202  -5.325  -13.971 1.00 0.00 ? 148 ILE A HA   2  
ATOM 6745  H HB   . ILE A 1 148 ? 58.903  -6.033  -11.737 1.00 0.00 ? 148 ILE A HB   2  
ATOM 6746  H HG12 . ILE A 1 148 ? 57.484  -8.334  -13.126 1.00 0.00 ? 148 ILE A HG12 2  
ATOM 6747  H HG13 . ILE A 1 148 ? 58.961  -7.604  -13.752 1.00 0.00 ? 148 ILE A HG13 2  
ATOM 6748  H HG21 . ILE A 1 148 ? 56.626  -5.755  -10.730 1.00 0.00 ? 148 ILE A HG21 2  
ATOM 6749  H HG22 . ILE A 1 148 ? 57.414  -7.262  -10.278 1.00 0.00 ? 148 ILE A HG22 2  
ATOM 6750  H HG23 . ILE A 1 148 ? 56.144  -7.261  -11.501 1.00 0.00 ? 148 ILE A HG23 2  
ATOM 6751  H HD11 . ILE A 1 148 ? 59.982  -8.079  -11.437 1.00 0.00 ? 148 ILE A HD11 2  
ATOM 6752  H HD12 . ILE A 1 148 ? 59.686  -9.470  -12.475 1.00 0.00 ? 148 ILE A HD12 2  
ATOM 6753  H HD13 . ILE A 1 148 ? 58.576  -9.106  -11.159 1.00 0.00 ? 148 ILE A HD13 2  
ATOM 6754  N N    . ARG A 1 149 ? 56.531  -6.944  -14.936 1.00 0.00 ? 149 ARG A N    2  
ATOM 6755  C CA   . ARG A 1 149 ? 55.499  -7.656  -15.691 1.00 0.00 ? 149 ARG A CA   2  
ATOM 6756  C C    . ARG A 1 149 ? 56.083  -8.966  -16.223 1.00 0.00 ? 149 ARG A C    2  
ATOM 6757  O O    . ARG A 1 149 ? 57.272  -9.233  -16.046 1.00 0.00 ? 149 ARG A O    2  
ATOM 6758  C CB   . ARG A 1 149 ? 55.009  -6.776  -16.852 1.00 0.00 ? 149 ARG A CB   2  
ATOM 6759  C CG   . ARG A 1 149 ? 53.827  -7.449  -17.585 1.00 0.00 ? 149 ARG A CG   2  
ATOM 6760  C CD   . ARG A 1 149 ? 53.008  -6.395  -18.341 1.00 0.00 ? 149 ARG A CD   2  
ATOM 6761  N NE   . ARG A 1 149 ? 51.854  -7.056  -19.014 1.00 0.00 ? 149 ARG A NE   2  
ATOM 6762  C CZ   . ARG A 1 149 ? 50.921  -6.332  -19.571 1.00 0.00 ? 149 ARG A CZ   2  
ATOM 6763  N NH1  . ARG A 1 149 ? 49.978  -5.809  -18.839 1.00 0.00 ? 149 ARG A NH1  2  
ATOM 6764  N NH2  . ARG A 1 149 ? 50.933  -6.135  -20.861 1.00 0.00 ? 149 ARG A NH2  2  
ATOM 6765  H H    . ARG A 1 149 ? 57.466  -7.055  -15.207 1.00 0.00 ? 149 ARG A H    2  
ATOM 6766  H HA   . ARG A 1 149 ? 54.668  -7.882  -15.038 1.00 0.00 ? 149 ARG A HA   2  
ATOM 6767  H HB2  . ARG A 1 149 ? 54.694  -5.820  -16.457 1.00 0.00 ? 149 ARG A HB2  2  
ATOM 6768  H HB3  . ARG A 1 149 ? 55.820  -6.622  -17.550 1.00 0.00 ? 149 ARG A HB3  2  
ATOM 6769  H HG2  . ARG A 1 149 ? 54.205  -8.171  -18.293 1.00 0.00 ? 149 ARG A HG2  2  
ATOM 6770  H HG3  . ARG A 1 149 ? 53.187  -7.947  -16.871 1.00 0.00 ? 149 ARG A HG3  2  
ATOM 6771  H HD2  . ARG A 1 149 ? 52.644  -5.655  -17.645 1.00 0.00 ? 149 ARG A HD2  2  
ATOM 6772  H HD3  . ARG A 1 149 ? 53.633  -5.918  -19.082 1.00 0.00 ? 149 ARG A HD3  2  
ATOM 6773  H HE   . ARG A 1 149 ? 51.795  -8.034  -19.038 1.00 0.00 ? 149 ARG A HE   2  
ATOM 6774  H HH11 . ARG A 1 149 ? 49.968  -5.961  -17.850 1.00 0.00 ? 149 ARG A HH11 2  
ATOM 6775  H HH12 . ARG A 1 149 ? 49.263  -5.255  -19.266 1.00 0.00 ? 149 ARG A HH12 2  
ATOM 6776  H HH21 . ARG A 1 149 ? 51.657  -6.537  -21.422 1.00 0.00 ? 149 ARG A HH21 2  
ATOM 6777  H HH22 . ARG A 1 149 ? 50.219  -5.581  -21.288 1.00 0.00 ? 149 ARG A HH22 2  
ATOM 6778  N N    . CYS A 1 150 ? 55.254  -9.784  -16.870 1.00 0.00 ? 150 CYS A N    2  
ATOM 6779  C CA   . CYS A 1 150 ? 55.717  -11.065 -17.416 1.00 0.00 ? 150 CYS A CA   2  
ATOM 6780  C C    . CYS A 1 150 ? 56.191  -10.893 -18.859 1.00 0.00 ? 150 CYS A C    2  
ATOM 6781  O O    . CYS A 1 150 ? 55.613  -10.120 -19.622 1.00 0.00 ? 150 CYS A O    2  
ATOM 6782  C CB   . CYS A 1 150 ? 54.576  -12.089 -17.372 1.00 0.00 ? 150 CYS A CB   2  
ATOM 6783  S SG   . CYS A 1 150 ? 53.756  -12.020 -15.758 1.00 0.00 ? 150 CYS A SG   2  
ATOM 6784  H H    . CYS A 1 150 ? 54.316  -9.526  -16.984 1.00 0.00 ? 150 CYS A H    2  
ATOM 6785  H HA   . CYS A 1 150 ? 56.539  -11.437 -16.820 1.00 0.00 ? 150 CYS A HA   2  
ATOM 6786  H HB2  . CYS A 1 150 ? 53.858  -11.867 -18.148 1.00 0.00 ? 150 CYS A HB2  2  
ATOM 6787  H HB3  . CYS A 1 150 ? 54.977  -13.080 -17.529 1.00 0.00 ? 150 CYS A HB3  2  
ATOM 6788  N N    . SER A 1 151 ? 57.250  -11.624 -19.229 1.00 0.00 ? 151 SER A N    2  
ATOM 6789  C CA   . SER A 1 151 ? 57.806  -11.557 -20.587 1.00 0.00 ? 151 SER A CA   2  
ATOM 6790  C C    . SER A 1 151 ? 57.976  -12.962 -21.160 1.00 0.00 ? 151 SER A C    2  
ATOM 6791  O O    . SER A 1 151 ? 58.630  -13.813 -20.556 1.00 0.00 ? 151 SER A O    2  
ATOM 6792  C CB   . SER A 1 151 ? 59.162  -10.853 -20.557 1.00 0.00 ? 151 SER A CB   2  
ATOM 6793  O OG   . SER A 1 151 ? 60.118  -11.704 -19.938 1.00 0.00 ? 151 SER A OG   2  
ATOM 6794  H H    . SER A 1 151 ? 57.668  -12.225 -18.578 1.00 0.00 ? 151 SER A H    2  
ATOM 6795  H HA   . SER A 1 151 ? 57.137  -10.998 -21.232 1.00 0.00 ? 151 SER A HA   2  
ATOM 6796  H HB2  . SER A 1 151 ? 59.480  -10.635 -21.563 1.00 0.00 ? 151 SER A HB2  2  
ATOM 6797  H HB3  . SER A 1 151 ? 59.074  -9.928  -20.001 1.00 0.00 ? 151 SER A HB3  2  
ATOM 6798  H HG   . SER A 1 151 ? 60.661  -12.092 -20.629 1.00 0.00 ? 151 SER A HG   2  
ATOM 6799  N N    . GLU A 1 152 ? 57.380  -13.199 -22.329 1.00 0.00 ? 152 GLU A N    2  
ATOM 6800  C CA   . GLU A 1 152 ? 57.458  -14.507 -22.989 1.00 0.00 ? 152 GLU A CA   2  
ATOM 6801  C C    . GLU A 1 152 ? 58.611  -14.531 -23.998 1.00 0.00 ? 152 GLU A C    2  
ATOM 6802  O O    . GLU A 1 152 ? 58.966  -15.584 -24.526 1.00 0.00 ? 152 GLU A O    2  
ATOM 6803  C CB   . GLU A 1 152 ? 56.125  -14.791 -23.706 1.00 0.00 ? 152 GLU A CB   2  
ATOM 6804  C CG   . GLU A 1 152 ? 55.972  -16.294 -23.980 1.00 0.00 ? 152 GLU A CG   2  
ATOM 6805  C CD   . GLU A 1 152 ? 55.702  -17.032 -22.666 1.00 0.00 ? 152 GLU A CD   2  
ATOM 6806  O OE1  . GLU A 1 152 ? 54.675  -16.768 -22.061 1.00 0.00 ? 152 GLU A OE1  2  
ATOM 6807  O OE2  . GLU A 1 152 ? 56.526  -17.847 -22.287 1.00 0.00 ? 152 GLU A OE2  2  
ATOM 6808  H H    . GLU A 1 152 ? 56.870  -12.479 -22.758 1.00 0.00 ? 152 GLU A H    2  
ATOM 6809  H HA   . GLU A 1 152 ? 57.628  -15.274 -22.245 1.00 0.00 ? 152 GLU A HA   2  
ATOM 6810  H HB2  . GLU A 1 152 ? 55.308  -14.457 -23.082 1.00 0.00 ? 152 GLU A HB2  2  
ATOM 6811  H HB3  . GLU A 1 152 ? 56.095  -14.254 -24.644 1.00 0.00 ? 152 GLU A HB3  2  
ATOM 6812  H HG2  . GLU A 1 152 ? 55.144  -16.453 -24.656 1.00 0.00 ? 152 GLU A HG2  2  
ATOM 6813  H HG3  . GLU A 1 152 ? 56.876  -16.676 -24.425 1.00 0.00 ? 152 GLU A HG3  2  
ATOM 6814  N N    . GLU A 1 153 ? 59.188  -13.362 -24.260 1.00 0.00 ? 153 GLU A N    2  
ATOM 6815  C CA   . GLU A 1 153 ? 60.295  -13.261 -25.209 1.00 0.00 ? 153 GLU A CA   2  
ATOM 6816  C C    . GLU A 1 153 ? 61.387  -14.275 -24.877 1.00 0.00 ? 153 GLU A C    2  
ATOM 6817  O O    . GLU A 1 153 ? 62.174  -14.076 -23.951 1.00 0.00 ? 153 GLU A O    2  
ATOM 6818  C CB   . GLU A 1 153 ? 60.876  -11.844 -25.185 1.00 0.00 ? 153 GLU A CB   2  
ATOM 6819  C CG   . GLU A 1 153 ? 59.862  -10.858 -25.775 1.00 0.00 ? 153 GLU A CG   2  
ATOM 6820  C CD   . GLU A 1 153 ? 58.637  -10.771 -24.864 1.00 0.00 ? 153 GLU A CD   2  
ATOM 6821  O OE1  . GLU A 1 153 ? 58.660  -9.967  -23.946 1.00 0.00 ? 153 GLU A OE1  2  
ATOM 6822  O OE2  . GLU A 1 153 ? 57.695  -11.510 -25.099 1.00 0.00 ? 153 GLU A OE2  2  
ATOM 6823  H H    . GLU A 1 153 ? 58.863  -12.555 -23.810 1.00 0.00 ? 153 GLU A H    2  
ATOM 6824  H HA   . GLU A 1 153 ? 59.921  -13.467 -26.201 1.00 0.00 ? 153 GLU A HA   2  
ATOM 6825  H HB2  . GLU A 1 153 ? 61.099  -11.564 -24.165 1.00 0.00 ? 153 GLU A HB2  2  
ATOM 6826  H HB3  . GLU A 1 153 ? 61.781  -11.817 -25.771 1.00 0.00 ? 153 GLU A HB3  2  
ATOM 6827  H HG2  . GLU A 1 153 ? 60.318  -9.881  -25.857 1.00 0.00 ? 153 GLU A HG2  2  
ATOM 6828  H HG3  . GLU A 1 153 ? 59.558  -11.194 -26.754 1.00 0.00 ? 153 GLU A HG3  2  
ATOM 6829  N N    . GLU A 1 154 ? 61.415  -15.377 -25.629 1.00 0.00 ? 154 GLU A N    2  
ATOM 6830  C CA   . GLU A 1 154 ? 62.400  -16.439 -25.405 1.00 0.00 ? 154 GLU A CA   2  
ATOM 6831  C C    . GLU A 1 154 ? 63.683  -16.206 -26.203 1.00 0.00 ? 154 GLU A C    2  
ATOM 6832  O O    . GLU A 1 154 ? 64.476  -17.129 -26.388 1.00 0.00 ? 154 GLU A O    2  
ATOM 6833  C CB   . GLU A 1 154 ? 61.794  -17.796 -25.791 1.00 0.00 ? 154 GLU A CB   2  
ATOM 6834  C CG   . GLU A 1 154 ? 61.371  -17.795 -27.273 1.00 0.00 ? 154 GLU A CG   2  
ATOM 6835  C CD   . GLU A 1 154 ? 62.591  -18.023 -28.172 1.00 0.00 ? 154 GLU A CD   2  
ATOM 6836  O OE1  . GLU A 1 154 ? 63.412  -18.856 -27.823 1.00 0.00 ? 154 GLU A OE1  2  
ATOM 6837  O OE2  . GLU A 1 154 ? 62.683  -17.362 -29.193 1.00 0.00 ? 154 GLU A OE2  2  
ATOM 6838  H H    . GLU A 1 154 ? 60.745  -15.487 -26.335 1.00 0.00 ? 154 GLU A H    2  
ATOM 6839  H HA   . GLU A 1 154 ? 62.651  -16.470 -24.353 1.00 0.00 ? 154 GLU A HA   2  
ATOM 6840  H HB2  . GLU A 1 154 ? 62.525  -18.575 -25.623 1.00 0.00 ? 154 GLU A HB2  2  
ATOM 6841  H HB3  . GLU A 1 154 ? 60.928  -17.984 -25.174 1.00 0.00 ? 154 GLU A HB3  2  
ATOM 6842  H HG2  . GLU A 1 154 ? 60.655  -18.587 -27.441 1.00 0.00 ? 154 GLU A HG2  2  
ATOM 6843  H HG3  . GLU A 1 154 ? 60.917  -16.847 -27.522 1.00 0.00 ? 154 GLU A HG3  2  
ATOM 6844  N N    . LYS A 1 155 ? 63.892  -14.979 -26.677 1.00 0.00 ? 155 LYS A N    2  
ATOM 6845  C CA   . LYS A 1 155 ? 65.096  -14.677 -27.449 1.00 0.00 ? 155 LYS A CA   2  
ATOM 6846  C C    . LYS A 1 155 ? 66.348  -14.978 -26.627 1.00 0.00 ? 155 LYS A C    2  
ATOM 6847  O O    . LYS A 1 155 ? 66.284  -15.100 -25.403 1.00 0.00 ? 155 LYS A O    2  
ATOM 6848  C CB   . LYS A 1 155 ? 65.105  -13.204 -27.883 1.00 0.00 ? 155 LYS A CB   2  
ATOM 6849  C CG   . LYS A 1 155 ? 63.726  -12.804 -28.425 1.00 0.00 ? 155 LYS A CG   2  
ATOM 6850  C CD   . LYS A 1 155 ? 63.323  -13.734 -29.580 1.00 0.00 ? 155 LYS A CD   2  
ATOM 6851  C CE   . LYS A 1 155 ? 62.174  -13.105 -30.375 1.00 0.00 ? 155 LYS A CE   2  
ATOM 6852  N NZ   . LYS A 1 155 ? 61.695  -14.071 -31.404 1.00 0.00 ? 155 LYS A NZ   2  
ATOM 6853  H H    . LYS A 1 155 ? 63.236  -14.273 -26.508 1.00 0.00 ? 155 LYS A H    2  
ATOM 6854  H HA   . LYS A 1 155 ? 65.108  -15.299 -28.332 1.00 0.00 ? 155 LYS A HA   2  
ATOM 6855  H HB2  . LYS A 1 155 ? 65.353  -12.579 -27.038 1.00 0.00 ? 155 LYS A HB2  2  
ATOM 6856  H HB3  . LYS A 1 155 ? 65.844  -13.065 -28.658 1.00 0.00 ? 155 LYS A HB3  2  
ATOM 6857  H HG2  . LYS A 1 155 ? 62.995  -12.876 -27.634 1.00 0.00 ? 155 LYS A HG2  2  
ATOM 6858  H HG3  . LYS A 1 155 ? 63.769  -11.785 -28.781 1.00 0.00 ? 155 LYS A HG3  2  
ATOM 6859  H HD2  . LYS A 1 155 ? 64.169  -13.888 -30.235 1.00 0.00 ? 155 LYS A HD2  2  
ATOM 6860  H HD3  . LYS A 1 155 ? 62.999  -14.684 -29.181 1.00 0.00 ? 155 LYS A HD3  2  
ATOM 6861  H HE2  . LYS A 1 155 ? 61.363  -12.862 -29.704 1.00 0.00 ? 155 LYS A HE2  2  
ATOM 6862  H HE3  . LYS A 1 155 ? 62.522  -12.205 -30.860 1.00 0.00 ? 155 LYS A HE3  2  
ATOM 6863  H HZ1  . LYS A 1 155 ? 61.983  -13.744 -32.348 1.00 0.00 ? 155 LYS A HZ1  2  
ATOM 6864  H HZ2  . LYS A 1 155 ? 60.657  -14.135 -31.361 1.00 0.00 ? 155 LYS A HZ2  2  
ATOM 6865  H HZ3  . LYS A 1 155 ? 62.110  -15.006 -31.222 1.00 0.00 ? 155 LYS A HZ3  2  
ATOM 6866  N N    . ASP A 1 156 ? 67.483  -15.101 -27.309 1.00 0.00 ? 156 ASP A N    2  
ATOM 6867  C CA   . ASP A 1 156 ? 68.744  -15.393 -26.635 1.00 0.00 ? 156 ASP A CA   2  
ATOM 6868  C C    . ASP A 1 156 ? 69.161  -14.229 -25.742 1.00 0.00 ? 156 ASP A C    2  
ATOM 6869  O O    . ASP A 1 156 ? 68.582  -13.145 -25.805 1.00 0.00 ? 156 ASP A O    2  
ATOM 6870  C CB   . ASP A 1 156 ? 69.839  -15.660 -27.670 1.00 0.00 ? 156 ASP A CB   2  
ATOM 6871  C CG   . ASP A 1 156 ? 69.524  -16.954 -28.423 1.00 0.00 ? 156 ASP A CG   2  
ATOM 6872  O OD1  . ASP A 1 156 ? 68.527  -16.979 -29.125 1.00 0.00 ? 156 ASP A OD1  2  
ATOM 6873  O OD2  . ASP A 1 156 ? 70.286  -17.896 -28.286 1.00 0.00 ? 156 ASP A OD2  2  
ATOM 6874  H H    . ASP A 1 156 ? 67.472  -14.996 -28.284 1.00 0.00 ? 156 ASP A H    2  
ATOM 6875  H HA   . ASP A 1 156 ? 68.619  -16.275 -26.026 1.00 0.00 ? 156 ASP A HA   2  
ATOM 6876  H HB2  . ASP A 1 156 ? 69.882  -14.837 -28.368 1.00 0.00 ? 156 ASP A HB2  2  
ATOM 6877  H HB3  . ASP A 1 156 ? 70.791  -15.759 -27.171 1.00 0.00 ? 156 ASP A HB3  2  
ATOM 6878  N N    . SER A 1 157 ? 70.170  -14.465 -24.901 1.00 0.00 ? 157 SER A N    2  
ATOM 6879  C CA   . SER A 1 157 ? 70.669  -13.436 -23.983 1.00 0.00 ? 157 SER A CA   2  
ATOM 6880  C C    . SER A 1 157 ? 71.898  -12.740 -24.558 1.00 0.00 ? 157 SER A C    2  
ATOM 6881  O O    . SER A 1 157 ? 72.688  -13.346 -25.283 1.00 0.00 ? 157 SER A O    2  
ATOM 6882  C CB   . SER A 1 157 ? 71.034  -14.078 -22.645 1.00 0.00 ? 157 SER A CB   2  
ATOM 6883  O OG   . SER A 1 157 ? 71.931  -15.157 -22.871 1.00 0.00 ? 157 SER A OG   2  
ATOM 6884  H H    . SER A 1 157 ? 70.588  -15.351 -24.896 1.00 0.00 ? 157 SER A H    2  
ATOM 6885  H HA   . SER A 1 157 ? 69.898  -12.697 -23.811 1.00 0.00 ? 157 SER A HA   2  
ATOM 6886  H HB2  . SER A 1 157 ? 71.510  -13.349 -22.012 1.00 0.00 ? 157 SER A HB2  2  
ATOM 6887  H HB3  . SER A 1 157 ? 70.135  -14.439 -22.163 1.00 0.00 ? 157 SER A HB3  2  
ATOM 6888  H HG   . SER A 1 157 ? 72.516  -15.222 -22.113 1.00 0.00 ? 157 SER A HG   2  
ATOM 6889  N N    . ASP A 1 158 ? 72.059  -11.460 -24.212 1.00 0.00 ? 158 ASP A N    2  
ATOM 6890  C CA   . ASP A 1 158 ? 73.203  -10.660 -24.672 1.00 0.00 ? 158 ASP A CA   2  
ATOM 6891  C C    . ASP A 1 158 ? 74.032  -10.229 -23.468 1.00 0.00 ? 158 ASP A C    2  
ATOM 6892  O O    . ASP A 1 158 ? 73.780  -9.184  -22.873 1.00 0.00 ? 158 ASP A O    2  
ATOM 6893  C CB   . ASP A 1 158 ? 72.706  -9.421  -25.422 1.00 0.00 ? 158 ASP A CB   2  
ATOM 6894  C CG   . ASP A 1 158 ? 72.046  -9.847  -26.733 1.00 0.00 ? 158 ASP A CG   2  
ATOM 6895  O OD1  . ASP A 1 158 ? 72.445  -10.869 -27.270 1.00 0.00 ? 158 ASP A OD1  2  
ATOM 6896  O OD2  . ASP A 1 158 ? 71.153  -9.147  -27.179 1.00 0.00 ? 158 ASP A OD2  2  
ATOM 6897  H H    . ASP A 1 158 ? 71.397  -11.044 -23.621 1.00 0.00 ? 158 ASP A H    2  
ATOM 6898  H HA   . ASP A 1 158 ? 73.826  -11.247 -25.337 1.00 0.00 ? 158 ASP A HA   2  
ATOM 6899  H HB2  . ASP A 1 158 ? 71.987  -8.895  -24.809 1.00 0.00 ? 158 ASP A HB2  2  
ATOM 6900  H HB3  . ASP A 1 158 ? 73.541  -8.771  -25.635 1.00 0.00 ? 158 ASP A HB3  2  
ATOM 6901  N N    . ILE A 1 159 ? 75.023  -11.045 -23.113 1.00 0.00 ? 159 ILE A N    2  
ATOM 6902  C CA   . ILE A 1 159 ? 75.889  -10.756 -21.964 1.00 0.00 ? 159 ILE A CA   2  
ATOM 6903  C C    . ILE A 1 159 ? 77.241  -10.216 -22.414 1.00 0.00 ? 159 ILE A C    2  
ATOM 6904  O O    . ILE A 1 159 ? 77.520  -10.114 -23.608 1.00 0.00 ? 159 ILE A O    2  
ATOM 6905  C CB   . ILE A 1 159 ? 76.128  -12.033 -21.130 1.00 0.00 ? 159 ILE A CB   2  
ATOM 6906  C CG1  . ILE A 1 159 ? 76.663  -13.145 -22.045 1.00 0.00 ? 159 ILE A CG1  2  
ATOM 6907  C CG2  . ILE A 1 159 ? 74.811  -12.486 -20.487 1.00 0.00 ? 159 ILE A CG2  2  
ATOM 6908  C CD1  . ILE A 1 159 ? 76.912  -14.424 -21.233 1.00 0.00 ? 159 ILE A CD1  2  
ATOM 6909  H H    . ILE A 1 159 ? 75.180  -11.857 -23.638 1.00 0.00 ? 159 ILE A H    2  
ATOM 6910  H HA   . ILE A 1 159 ? 75.418  -10.016 -21.330 1.00 0.00 ? 159 ILE A HA   2  
ATOM 6911  H HB   . ILE A 1 159 ? 76.851  -11.824 -20.354 1.00 0.00 ? 159 ILE A HB   2  
ATOM 6912  H HG12 . ILE A 1 159 ? 75.941  -13.348 -22.823 1.00 0.00 ? 159 ILE A HG12 2  
ATOM 6913  H HG13 . ILE A 1 159 ? 77.592  -12.823 -22.495 1.00 0.00 ? 159 ILE A HG13 2  
ATOM 6914  H HG21 . ILE A 1 159 ? 75.016  -13.227 -19.730 1.00 0.00 ? 159 ILE A HG21 2  
ATOM 6915  H HG22 . ILE A 1 159 ? 74.166  -12.911 -21.242 1.00 0.00 ? 159 ILE A HG22 2  
ATOM 6916  H HG23 . ILE A 1 159 ? 74.319  -11.638 -20.032 1.00 0.00 ? 159 ILE A HG23 2  
ATOM 6917  H HD11 . ILE A 1 159 ? 75.973  -14.926 -21.053 1.00 0.00 ? 159 ILE A HD11 2  
ATOM 6918  H HD12 . ILE A 1 159 ? 77.374  -14.174 -20.288 1.00 0.00 ? 159 ILE A HD12 2  
ATOM 6919  H HD13 . ILE A 1 159 ? 77.566  -15.081 -21.788 1.00 0.00 ? 159 ILE A HD13 2  
ATOM 6920  N N    . LYS A 1 160 ? 78.077  -9.873  -21.433 1.00 0.00 ? 160 LYS A N    2  
ATOM 6921  C CA   . LYS A 1 160 ? 79.412  -9.340  -21.691 1.00 0.00 ? 160 LYS A CA   2  
ATOM 6922  C C    . LYS A 1 160 ? 80.468  -10.404 -21.386 1.00 0.00 ? 160 LYS A C    2  
ATOM 6923  O O    . LYS A 1 160 ? 80.134  -11.558 -21.115 1.00 0.00 ? 160 LYS A O    2  
ATOM 6924  C CB   . LYS A 1 160 ? 79.614  -8.077  -20.815 1.00 0.00 ? 160 LYS A CB   2  
ATOM 6925  C CG   . LYS A 1 160 ? 80.108  -8.410  -19.383 1.00 0.00 ? 160 LYS A CG   2  
ATOM 6926  C CD   . LYS A 1 160 ? 79.198  -9.430  -18.667 1.00 0.00 ? 160 LYS A CD   2  
ATOM 6927  C CE   . LYS A 1 160 ? 79.836  -9.838  -17.325 1.00 0.00 ? 160 LYS A CE   2  
ATOM 6928  N NZ   . LYS A 1 160 ? 79.254  -11.132 -16.878 1.00 0.00 ? 160 LYS A NZ   2  
ATOM 6929  H H    . LYS A 1 160 ? 77.792  -9.982  -20.505 1.00 0.00 ? 160 LYS A H    2  
ATOM 6930  H HA   . LYS A 1 160 ? 79.496  -9.058  -22.734 1.00 0.00 ? 160 LYS A HA   2  
ATOM 6931  H HB2  . LYS A 1 160 ? 80.341  -7.432  -21.287 1.00 0.00 ? 160 LYS A HB2  2  
ATOM 6932  H HB3  . LYS A 1 160 ? 78.674  -7.550  -20.746 1.00 0.00 ? 160 LYS A HB3  2  
ATOM 6933  H HG2  . LYS A 1 160 ? 81.095  -8.805  -19.436 1.00 0.00 ? 160 LYS A HG2  2  
ATOM 6934  H HG3  . LYS A 1 160 ? 80.136  -7.500  -18.806 1.00 0.00 ? 160 LYS A HG3  2  
ATOM 6935  H HD2  . LYS A 1 160 ? 78.234  -8.986  -18.487 1.00 0.00 ? 160 LYS A HD2  2  
ATOM 6936  H HD3  . LYS A 1 160 ? 79.073  -10.308 -19.271 1.00 0.00 ? 160 LYS A HD3  2  
ATOM 6937  H HE2  . LYS A 1 160 ? 80.905  -9.956  -17.441 1.00 0.00 ? 160 LYS A HE2  2  
ATOM 6938  H HE3  . LYS A 1 160 ? 79.640  -9.079  -16.584 1.00 0.00 ? 160 LYS A HE3  2  
ATOM 6939  H HZ1  . LYS A 1 160 ? 79.250  -11.171 -15.839 1.00 0.00 ? 160 LYS A HZ1  2  
ATOM 6940  H HZ2  . LYS A 1 160 ? 79.826  -11.917 -17.254 1.00 0.00 ? 160 LYS A HZ2  2  
ATOM 6941  H HZ3  . LYS A 1 160 ? 78.282  -11.213 -17.229 1.00 0.00 ? 160 LYS A HZ3  2  
ATOM 6942  N N    . THR A 1 161 ? 81.735  -10.004 -21.406 1.00 0.00 ? 161 THR A N    2  
ATOM 6943  C CA   . THR A 1 161 ? 82.843  -10.915 -21.102 1.00 0.00 ? 161 THR A CA   2  
ATOM 6944  C C    . THR A 1 161 ? 83.730  -10.306 -20.018 1.00 0.00 ? 161 THR A C    2  
ATOM 6945  O O    . THR A 1 161 ? 84.665  -10.943 -19.534 1.00 0.00 ? 161 THR A O    2  
ATOM 6946  C CB   . THR A 1 161 ? 83.706  -11.167 -22.354 1.00 0.00 ? 161 THR A CB   2  
ATOM 6947  O OG1  . THR A 1 161 ? 84.921  -11.794 -21.971 1.00 0.00 ? 161 THR A OG1  2  
ATOM 6948  C CG2  . THR A 1 161 ? 84.010  -9.835  -23.042 1.00 0.00 ? 161 THR A CG2  2  
ATOM 6949  H H    . THR A 1 161 ? 81.932  -9.067  -21.614 1.00 0.00 ? 161 THR A H    2  
ATOM 6950  H HA   . THR A 1 161 ? 82.461  -11.863 -20.745 1.00 0.00 ? 161 THR A HA   2  
ATOM 6951  H HB   . THR A 1 161 ? 83.169  -11.807 -23.038 1.00 0.00 ? 161 THR A HB   2  
ATOM 6952  H HG1  . THR A 1 161 ? 85.571  -11.625 -22.657 1.00 0.00 ? 161 THR A HG1  2  
ATOM 6953  H HG21 . THR A 1 161 ? 84.732  -9.994  -23.830 1.00 0.00 ? 161 THR A HG21 2  
ATOM 6954  H HG22 . THR A 1 161 ? 84.414  -9.141  -22.318 1.00 0.00 ? 161 THR A HG22 2  
ATOM 6955  H HG23 . THR A 1 161 ? 83.102  -9.430  -23.461 1.00 0.00 ? 161 THR A HG23 2  
ATOM 6956  N N    . HIS A 1 162 ? 83.430  -9.056  -19.649 1.00 0.00 ? 162 HIS A N    2  
ATOM 6957  C CA   . HIS A 1 162 ? 84.198  -8.336  -18.625 1.00 0.00 ? 162 HIS A CA   2  
ATOM 6958  C C    . HIS A 1 162 ? 83.377  -8.180  -17.331 1.00 0.00 ? 162 HIS A C    2  
ATOM 6959  O O    . HIS A 1 162 ? 82.237  -7.717  -17.383 1.00 0.00 ? 162 HIS A O    2  
ATOM 6960  C CB   . HIS A 1 162 ? 84.562  -6.947  -19.152 1.00 0.00 ? 162 HIS A CB   2  
ATOM 6961  C CG   . HIS A 1 162 ? 85.393  -7.089  -20.398 1.00 0.00 ? 162 HIS A CG   2  
ATOM 6962  N ND1  . HIS A 1 162 ? 85.037  -6.490  -21.596 1.00 0.00 ? 162 HIS A ND1  2  
ATOM 6963  C CD2  . HIS A 1 162 ? 86.565  -7.760  -20.647 1.00 0.00 ? 162 HIS A CD2  2  
ATOM 6964  C CE1  . HIS A 1 162 ? 85.977  -6.811  -22.504 1.00 0.00 ? 162 HIS A CE1  2  
ATOM 6965  N NE2  . HIS A 1 162 ? 86.931  -7.582  -21.978 1.00 0.00 ? 162 HIS A NE2  2  
ATOM 6966  H H    . HIS A 1 162 ? 82.674  -8.606  -20.081 1.00 0.00 ? 162 HIS A H    2  
ATOM 6967  H HA   . HIS A 1 162 ? 85.113  -8.871  -18.424 1.00 0.00 ? 162 HIS A HA   2  
ATOM 6968  H HB2  . HIS A 1 162 ? 83.659  -6.401  -19.381 1.00 0.00 ? 162 HIS A HB2  2  
ATOM 6969  H HB3  . HIS A 1 162 ? 85.127  -6.413  -18.402 1.00 0.00 ? 162 HIS A HB3  2  
ATOM 6970  H HD1  . HIS A 1 162 ? 84.244  -5.936  -21.753 1.00 0.00 ? 162 HIS A HD1  2  
ATOM 6971  H HD2  . HIS A 1 162 ? 87.059  -8.424  -19.952 1.00 0.00 ? 162 HIS A HD2  2  
ATOM 6972  H HE1  . HIS A 1 162 ? 85.961  -6.483  -23.533 1.00 0.00 ? 162 HIS A HE1  2  
ATOM 6973  N N    . PRO A 1 163 ? 83.927  -8.548  -16.144 1.00 0.00 ? 163 PRO A N    2  
ATOM 6974  C CA   . PRO A 1 163 ? 83.201  -8.416  -14.868 1.00 0.00 ? 163 PRO A CA   2  
ATOM 6975  C C    . PRO A 1 163 ? 82.376  -7.129  -14.785 1.00 0.00 ? 163 PRO A C    2  
ATOM 6976  O O    . PRO A 1 163 ? 82.655  -6.152  -15.479 1.00 0.00 ? 163 PRO A O    2  
ATOM 6977  C CB   . PRO A 1 163 ? 84.323  -8.422  -13.823 1.00 0.00 ? 163 PRO A CB   2  
ATOM 6978  C CG   . PRO A 1 163 ? 85.369  -9.316  -14.409 1.00 0.00 ? 163 PRO A CG   2  
ATOM 6979  C CD   . PRO A 1 163 ? 85.278  -9.123  -15.931 1.00 0.00 ? 163 PRO A CD   2  
ATOM 6980  H HA   . PRO A 1 163 ? 82.566  -9.274  -14.714 1.00 0.00 ? 163 PRO A HA   2  
ATOM 6981  H HB2  . PRO A 1 163 ? 84.713  -7.419  -13.682 1.00 0.00 ? 163 PRO A HB2  2  
ATOM 6982  H HB3  . PRO A 1 163 ? 83.969  -8.822  -12.882 1.00 0.00 ? 163 PRO A HB3  2  
ATOM 6983  H HG2  . PRO A 1 163 ? 86.352  -9.034  -14.043 1.00 0.00 ? 163 PRO A HG2  2  
ATOM 6984  H HG3  . PRO A 1 163 ? 85.164  -10.348 -14.157 1.00 0.00 ? 163 PRO A HG3  2  
ATOM 6985  H HD2  . PRO A 1 163 ? 86.041  -8.435  -16.277 1.00 0.00 ? 163 PRO A HD2  2  
ATOM 6986  H HD3  . PRO A 1 163 ? 85.363  -10.072 -16.443 1.00 0.00 ? 163 PRO A HD3  2  
ATOM 6987  N N    . VAL A 1 164 ? 81.358  -7.148  -13.929 1.00 0.00 ? 164 VAL A N    2  
ATOM 6988  C CA   . VAL A 1 164 ? 80.485  -5.989  -13.751 1.00 0.00 ? 164 VAL A CA   2  
ATOM 6989  C C    . VAL A 1 164 ? 81.167  -4.908  -12.916 1.00 0.00 ? 164 VAL A C    2  
ATOM 6990  O O    . VAL A 1 164 ? 81.898  -5.208  -11.972 1.00 0.00 ? 164 VAL A O    2  
ATOM 6991  C CB   . VAL A 1 164 ? 79.185  -6.390  -13.031 1.00 0.00 ? 164 VAL A CB   2  
ATOM 6992  C CG1  . VAL A 1 164 ? 78.456  -7.462  -13.842 1.00 0.00 ? 164 VAL A CG1  2  
ATOM 6993  C CG2  . VAL A 1 164 ? 79.525  -6.941  -11.641 1.00 0.00 ? 164 VAL A CG2  2  
ATOM 6994  H H    . VAL A 1 164 ? 81.187  -7.963  -13.412 1.00 0.00 ? 164 VAL A H    2  
ATOM 6995  H HA   . VAL A 1 164 ? 80.235  -5.583  -14.719 1.00 0.00 ? 164 VAL A HA   2  
ATOM 6996  H HB   . VAL A 1 164 ? 78.550  -5.521  -12.930 1.00 0.00 ? 164 VAL A HB   2  
ATOM 6997  H HG11 . VAL A 1 164 ? 77.595  -7.808  -13.289 1.00 0.00 ? 164 VAL A HG11 2  
ATOM 6998  H HG12 . VAL A 1 164 ? 79.123  -8.291  -14.026 1.00 0.00 ? 164 VAL A HG12 2  
ATOM 6999  H HG13 . VAL A 1 164 ? 78.134  -7.043  -14.783 1.00 0.00 ? 164 VAL A HG13 2  
ATOM 7000  H HG21 . VAL A 1 164 ? 80.301  -7.687  -11.729 1.00 0.00 ? 164 VAL A HG21 2  
ATOM 7001  H HG22 . VAL A 1 164 ? 78.647  -7.385  -11.206 1.00 0.00 ? 164 VAL A HG22 2  
ATOM 7002  H HG23 . VAL A 1 164 ? 79.868  -6.137  -11.005 1.00 0.00 ? 164 VAL A HG23 2  
ATOM 7003  N N    . LEU A 1 165 ? 80.905  -3.649  -13.261 1.00 0.00 ? 165 LEU A N    2  
ATOM 7004  C CA   . LEU A 1 165 ? 81.481  -2.521  -12.529 1.00 0.00 ? 165 LEU A CA   2  
ATOM 7005  C C    . LEU A 1 165 ? 80.622  -2.203  -11.302 1.00 0.00 ? 165 LEU A C    2  
ATOM 7006  O O    . LEU A 1 165 ? 79.456  -1.828  -11.432 1.00 0.00 ? 165 LEU A O    2  
ATOM 7007  C CB   . LEU A 1 165 ? 81.558  -1.291  -13.446 1.00 0.00 ? 165 LEU A CB   2  
ATOM 7008  C CG   . LEU A 1 165 ? 82.035  -1.709  -14.841 1.00 0.00 ? 165 LEU A CG   2  
ATOM 7009  C CD1  . LEU A 1 165 ? 82.199  -0.461  -15.714 1.00 0.00 ? 165 LEU A CD1  2  
ATOM 7010  C CD2  . LEU A 1 165 ? 83.380  -2.441  -14.735 1.00 0.00 ? 165 LEU A CD2  2  
ATOM 7011  H H    . LEU A 1 165 ? 80.309  -3.474  -14.018 1.00 0.00 ? 165 LEU A H    2  
ATOM 7012  H HA   . LEU A 1 165 ? 82.479  -2.776  -12.198 1.00 0.00 ? 165 LEU A HA   2  
ATOM 7013  H HB2  . LEU A 1 165 ? 80.580  -0.834  -13.526 1.00 0.00 ? 165 LEU A HB2  2  
ATOM 7014  H HB3  . LEU A 1 165 ? 82.254  -0.575  -13.031 1.00 0.00 ? 165 LEU A HB3  2  
ATOM 7015  H HG   . LEU A 1 165 ? 81.301  -2.363  -15.289 1.00 0.00 ? 165 LEU A HG   2  
ATOM 7016  H HD11 . LEU A 1 165 ? 81.272  0.093   -15.726 1.00 0.00 ? 165 LEU A HD11 2  
ATOM 7017  H HD12 . LEU A 1 165 ? 82.456  -0.757  -16.719 1.00 0.00 ? 165 LEU A HD12 2  
ATOM 7018  H HD13 . LEU A 1 165 ? 82.984  0.160   -15.309 1.00 0.00 ? 165 LEU A HD13 2  
ATOM 7019  H HD21 . LEU A 1 165 ? 84.041  -1.893  -14.079 1.00 0.00 ? 165 LEU A HD21 2  
ATOM 7020  H HD22 . LEU A 1 165 ? 83.828  -2.518  -15.716 1.00 0.00 ? 165 LEU A HD22 2  
ATOM 7021  H HD23 . LEU A 1 165 ? 83.220  -3.432  -14.339 1.00 0.00 ? 165 LEU A HD23 2  
ATOM 7022  N N    . GLY A 1 166 ? 81.201  -2.363  -10.112 1.00 0.00 ? 166 GLY A N    2  
ATOM 7023  C CA   . GLY A 1 166 ? 80.480  -2.103  -8.871  1.00 0.00 ? 166 GLY A CA   2  
ATOM 7024  C C    . GLY A 1 166 ? 80.500  -0.635  -8.480  1.00 0.00 ? 166 GLY A C    2  
ATOM 7025  O O    . GLY A 1 166 ? 81.191  0.174   -9.099  1.00 0.00 ? 166 GLY A O    2  
ATOM 7026  H H    . GLY A 1 166 ? 82.131  -2.671  -10.069 1.00 0.00 ? 166 GLY A H    2  
ATOM 7027  H HA2  . GLY A 1 166 ? 79.452  -2.421  -8.983  1.00 0.00 ? 166 GLY A HA2  2  
ATOM 7028  H HA3  . GLY A 1 166 ? 80.936  -2.677  -8.079  1.00 0.00 ? 166 GLY A HA3  2  
ATOM 7029  N N    . SER A 1 167 ? 79.734  -0.296  -7.438  1.00 0.00 ? 167 SER A N    2  
ATOM 7030  C CA   . SER A 1 167 ? 79.655  1.082   -6.942  1.00 0.00 ? 167 SER A CA   2  
ATOM 7031  C C    . SER A 1 167 ? 80.440  1.223   -5.642  1.00 0.00 ? 167 SER A C    2  
ATOM 7032  O O    . SER A 1 167 ? 80.383  2.255   -4.979  1.00 0.00 ? 167 SER A O    2  
ATOM 7033  C CB   . SER A 1 167 ? 78.195  1.460   -6.696  1.00 0.00 ? 167 SER A CB   2  
ATOM 7034  O OG   . SER A 1 167 ? 77.427  1.113   -7.838  1.00 0.00 ? 167 SER A OG   2  
ATOM 7035  H H    . SER A 1 167 ? 79.211  -0.992  -6.987  1.00 0.00 ? 167 SER A H    2  
ATOM 7036  H HA   . SER A 1 167 ? 80.070  1.762   -7.677  1.00 0.00 ? 167 SER A HA   2  
ATOM 7037  H HB2  . SER A 1 167 ? 77.821  0.923   -5.840  1.00 0.00 ? 167 SER A HB2  2  
ATOM 7038  H HB3  . SER A 1 167 ? 78.125  2.523   -6.511  1.00 0.00 ? 167 SER A HB3  2  
ATOM 7039  H HG   . SER A 1 167 ? 77.731  0.258   -8.153  1.00 0.00 ? 167 SER A HG   2  
ATOM 7040  N N    . ASN A 1 168 ? 81.182  0.175   -5.300  1.00 0.00 ? 168 ASN A N    2  
ATOM 7041  C CA   . ASN A 1 168 ? 82.000  0.170   -4.090  1.00 0.00 ? 168 ASN A CA   2  
ATOM 7042  C C    . ASN A 1 168 ? 81.163  0.383   -2.826  1.00 0.00 ? 168 ASN A C    2  
ATOM 7043  O O    . ASN A 1 168 ? 81.696  0.331   -1.717  1.00 0.00 ? 168 ASN A O    2  
ATOM 7044  C CB   . ASN A 1 168 ? 83.078  1.253   -4.179  1.00 0.00 ? 168 ASN A CB   2  
ATOM 7045  C CG   . ASN A 1 168 ? 83.885  1.061   -5.464  1.00 0.00 ? 168 ASN A CG   2  
ATOM 7046  O OD1  . ASN A 1 168 ? 83.423  0.435   -6.397  1.00 0.00 ? 168 ASN A OD1  2  
ATOM 7047  N ND2  . ASN A 1 168 ? 85.080  1.577   -5.553  1.00 0.00 ? 168 ASN A ND2  2  
ATOM 7048  H H    . ASN A 1 168 ? 81.193  -0.609  -5.887  1.00 0.00 ? 168 ASN A H    2  
ATOM 7049  H HA   . ASN A 1 168 ? 82.490  -0.788  -4.014  1.00 0.00 ? 168 ASN A HA   2  
ATOM 7050  H HB2  . ASN A 1 168 ? 82.613  2.227   -4.185  1.00 0.00 ? 168 ASN A HB2  2  
ATOM 7051  H HB3  . ASN A 1 168 ? 83.737  1.174   -3.329  1.00 0.00 ? 168 ASN A HB3  2  
ATOM 7052  H HD21 . ASN A 1 168 ? 85.453  2.081   -4.799  1.00 0.00 ? 168 ASN A HD21 2  
ATOM 7053  H HD22 . ASN A 1 168 ? 85.605  1.460   -6.371  1.00 0.00 ? 168 ASN A HD22 2  
ATOM 7054  N N    . ILE A 1 169 ? 79.857  0.609   -2.980  1.00 0.00 ? 169 ILE A N    2  
ATOM 7055  C CA   . ILE A 1 169 ? 78.984  0.808   -1.817  1.00 0.00 ? 169 ILE A CA   2  
ATOM 7056  C C    . ILE A 1 169 ? 78.489  -0.546  -1.312  1.00 0.00 ? 169 ILE A C    2  
ATOM 7057  O O    . ILE A 1 169 ? 78.405  -1.505  -2.080  1.00 0.00 ? 169 ILE A O    2  
ATOM 7058  C CB   . ILE A 1 169 ? 77.764  1.690   -2.186  1.00 0.00 ? 169 ILE A CB   2  
ATOM 7059  C CG1  . ILE A 1 169 ? 78.252  3.115   -2.553  1.00 0.00 ? 169 ILE A CG1  2  
ATOM 7060  C CG2  . ILE A 1 169 ? 76.797  1.759   -0.991  1.00 0.00 ? 169 ILE A CG2  2  
ATOM 7061  C CD1  . ILE A 1 169 ? 77.211  3.847   -3.417  1.00 0.00 ? 169 ILE A CD1  2  
ATOM 7062  H H    . ILE A 1 169 ? 79.466  0.630   -3.878  1.00 0.00 ? 169 ILE A H    2  
ATOM 7063  H HA   . ILE A 1 169 ? 79.539  1.295   -1.026  1.00 0.00 ? 169 ILE A HA   2  
ATOM 7064  H HB   . ILE A 1 169 ? 77.254  1.245   -3.029  1.00 0.00 ? 169 ILE A HB   2  
ATOM 7065  H HG12 . ILE A 1 169 ? 78.422  3.683   -1.649  1.00 0.00 ? 169 ILE A HG12 2  
ATOM 7066  H HG13 . ILE A 1 169 ? 79.178  3.049   -3.104  1.00 0.00 ? 169 ILE A HG13 2  
ATOM 7067  H HG21 . ILE A 1 169 ? 76.080  2.547   -1.146  1.00 0.00 ? 169 ILE A HG21 2  
ATOM 7068  H HG22 . ILE A 1 169 ? 77.355  1.955   -0.087  1.00 0.00 ? 169 ILE A HG22 2  
ATOM 7069  H HG23 . ILE A 1 169 ? 76.277  0.817   -0.894  1.00 0.00 ? 169 ILE A HG23 2  
ATOM 7070  H HD11 . ILE A 1 169 ? 77.665  4.727   -3.850  1.00 0.00 ? 169 ILE A HD11 2  
ATOM 7071  H HD12 . ILE A 1 169 ? 76.373  4.146   -2.807  1.00 0.00 ? 169 ILE A HD12 2  
ATOM 7072  H HD13 . ILE A 1 169 ? 76.868  3.200   -4.210  1.00 0.00 ? 169 ILE A HD13 2  
ATOM 7073  N N    . SER A 1 170 ? 78.148  -0.622  -0.019  1.00 0.00 ? 170 SER A N    2  
ATOM 7074  C CA   . SER A 1 170 ? 77.646  -1.864  0.583   1.00 0.00 ? 170 SER A CA   2  
ATOM 7075  C C    . SER A 1 170 ? 76.230  -1.634  1.098   1.00 0.00 ? 170 SER A C    2  
ATOM 7076  O O    . SER A 1 170 ? 75.947  -0.604  1.708   1.00 0.00 ? 170 SER A O    2  
ATOM 7077  C CB   . SER A 1 170 ? 78.550  -2.285  1.742   1.00 0.00 ? 170 SER A CB   2  
ATOM 7078  O OG   . SER A 1 170 ? 78.314  -1.431  2.854   1.00 0.00 ? 170 SER A OG   2  
ATOM 7079  H H    . SER A 1 170 ? 78.215  0.167   0.557   1.00 0.00 ? 170 SER A H    2  
ATOM 7080  H HA   . SER A 1 170 ? 77.627  -2.657  -0.154  1.00 0.00 ? 170 SER A HA   2  
ATOM 7081  H HB2  . SER A 1 170 ? 78.331  -3.301  2.023   1.00 0.00 ? 170 SER A HB2  2  
ATOM 7082  H HB3  . SER A 1 170 ? 79.585  -2.215  1.433   1.00 0.00 ? 170 SER A HB3  2  
ATOM 7083  H HG   . SER A 1 170 ? 79.029  -0.791  2.893   1.00 0.00 ? 170 SER A HG   2  
ATOM 7084  N N    . HIS A 1 171 ? 75.339  -2.582  0.829   1.00 0.00 ? 171 HIS A N    2  
ATOM 7085  C CA   . HIS A 1 171 ? 73.944  -2.453  1.249   1.00 0.00 ? 171 HIS A CA   2  
ATOM 7086  C C    . HIS A 1 171 ? 73.788  -2.662  2.763   1.00 0.00 ? 171 HIS A C    2  
ATOM 7087  O O    . HIS A 1 171 ? 72.819  -3.268  3.218   1.00 0.00 ? 171 HIS A O    2  
ATOM 7088  C CB   . HIS A 1 171 ? 73.074  -3.465  0.449   1.00 0.00 ? 171 HIS A CB   2  
ATOM 7089  C CG   . HIS A 1 171 ? 71.856  -2.783  -0.125  1.00 0.00 ? 171 HIS A CG   2  
ATOM 7090  N ND1  . HIS A 1 171 ? 71.694  -2.595  -1.488  1.00 0.00 ? 171 HIS A ND1  2  
ATOM 7091  C CD2  . HIS A 1 171 ? 70.752  -2.221  0.468   1.00 0.00 ? 171 HIS A CD2  2  
ATOM 7092  C CE1  . HIS A 1 171 ? 70.535  -1.940  -1.670  1.00 0.00 ? 171 HIS A CE1  2  
ATOM 7093  N NE2  . HIS A 1 171 ? 69.922  -1.684  -0.512  1.00 0.00 ? 171 HIS A NE2  2  
ATOM 7094  H H    . HIS A 1 171 ? 75.618  -3.373  0.323   1.00 0.00 ? 171 HIS A H    2  
ATOM 7095  H HA   . HIS A 1 171 ? 73.619  -1.446  1.017   1.00 0.00 ? 171 HIS A HA   2  
ATOM 7096  H HB2  . HIS A 1 171 ? 73.661  -3.868  -0.362  1.00 0.00 ? 171 HIS A HB2  2  
ATOM 7097  H HB3  . HIS A 1 171 ? 72.759  -4.279  1.088   1.00 0.00 ? 171 HIS A HB3  2  
ATOM 7098  H HD1  . HIS A 1 171 ? 72.312  -2.886  -2.190  1.00 0.00 ? 171 HIS A HD1  2  
ATOM 7099  H HD2  . HIS A 1 171 ? 70.503  -2.303  1.515   1.00 0.00 ? 171 HIS A HD2  2  
ATOM 7100  H HE1  . HIS A 1 171 ? 70.146  -1.656  -2.635  1.00 0.00 ? 171 HIS A HE1  2  
ATOM 7101  N N    . LYS A 1 172 ? 74.735  -2.140  3.537   1.00 0.00 ? 172 LYS A N    2  
ATOM 7102  C CA   . LYS A 1 172 ? 74.669  -2.269  4.989   1.00 0.00 ? 172 LYS A CA   2  
ATOM 7103  C C    . LYS A 1 172 ? 73.486  -1.468  5.536   1.00 0.00 ? 172 LYS A C    2  
ATOM 7104  O O    . LYS A 1 172 ? 72.749  -0.839  4.777   1.00 0.00 ? 172 LYS A O    2  
ATOM 7105  C CB   . LYS A 1 172 ? 75.975  -1.765  5.624   1.00 0.00 ? 172 LYS A CB   2  
ATOM 7106  C CG   . LYS A 1 172 ? 77.143  -2.728  5.302   1.00 0.00 ? 172 LYS A CG   2  
ATOM 7107  C CD   . LYS A 1 172 ? 77.185  -3.888  6.310   1.00 0.00 ? 172 LYS A CD   2  
ATOM 7108  C CE   . LYS A 1 172 ? 78.425  -4.745  6.046   1.00 0.00 ? 172 LYS A CE   2  
ATOM 7109  N NZ   . LYS A 1 172 ? 79.647  -3.984  6.431   1.00 0.00 ? 172 LYS A NZ   2  
ATOM 7110  H H    . LYS A 1 172 ? 75.481  -1.657  3.126   1.00 0.00 ? 172 LYS A H    2  
ATOM 7111  H HA   . LYS A 1 172 ? 74.532  -3.308  5.243   1.00 0.00 ? 172 LYS A HA   2  
ATOM 7112  H HB2  . LYS A 1 172 ? 76.200  -0.785  5.228   1.00 0.00 ? 172 LYS A HB2  2  
ATOM 7113  H HB3  . LYS A 1 172 ? 75.847  -1.691  6.695   1.00 0.00 ? 172 LYS A HB3  2  
ATOM 7114  H HG2  . LYS A 1 172 ? 77.021  -3.127  4.304   1.00 0.00 ? 172 LYS A HG2  2  
ATOM 7115  H HG3  . LYS A 1 172 ? 78.076  -2.185  5.353   1.00 0.00 ? 172 LYS A HG3  2  
ATOM 7116  H HD2  . LYS A 1 172 ? 77.231  -3.492  7.315   1.00 0.00 ? 172 LYS A HD2  2  
ATOM 7117  H HD3  . LYS A 1 172 ? 76.302  -4.497  6.204   1.00 0.00 ? 172 LYS A HD3  2  
ATOM 7118  H HE2  . LYS A 1 172 ? 78.366  -5.652  6.629   1.00 0.00 ? 172 LYS A HE2  2  
ATOM 7119  H HE3  . LYS A 1 172 ? 78.472  -4.995  4.996   1.00 0.00 ? 172 LYS A HE3  2  
ATOM 7120  H HZ1  . LYS A 1 172 ? 80.307  -4.616  6.928   1.00 0.00 ? 172 LYS A HZ1  2  
ATOM 7121  H HZ2  . LYS A 1 172 ? 79.381  -3.196  7.057   1.00 0.00 ? 172 LYS A HZ2  2  
ATOM 7122  H HZ3  . LYS A 1 172 ? 80.106  -3.609  5.577   1.00 0.00 ? 172 LYS A HZ3  2  
ATOM 7123  N N    . LYS A 1 173 ? 73.307  -1.501  6.857   1.00 0.00 ? 173 LYS A N    2  
ATOM 7124  C CA   . LYS A 1 173 ? 72.205  -0.781  7.506   1.00 0.00 ? 173 LYS A CA   2  
ATOM 7125  C C    . LYS A 1 173 ? 72.637  0.629   7.911   1.00 0.00 ? 173 LYS A C    2  
ATOM 7126  O O    . LYS A 1 173 ? 73.593  0.797   8.670   1.00 0.00 ? 173 LYS A O    2  
ATOM 7127  C CB   . LYS A 1 173 ? 71.759  -1.550  8.752   1.00 0.00 ? 173 LYS A CB   2  
ATOM 7128  C CG   . LYS A 1 173 ? 70.564  -0.843  9.398   1.00 0.00 ? 173 LYS A CG   2  
ATOM 7129  C CD   . LYS A 1 173 ? 69.995  -1.721  10.516  1.00 0.00 ? 173 LYS A CD   2  
ATOM 7130  C CE   . LYS A 1 173 ? 68.980  -0.917  11.331  1.00 0.00 ? 173 LYS A CE   2  
ATOM 7131  N NZ   . LYS A 1 173 ? 68.083  -0.166  10.408  1.00 0.00 ? 173 LYS A NZ   2  
ATOM 7132  H H    . LYS A 1 173 ? 73.925  -2.023  7.410   1.00 0.00 ? 173 LYS A H    2  
ATOM 7133  H HA   . LYS A 1 173 ? 71.369  -0.710  6.825   1.00 0.00 ? 173 LYS A HA   2  
ATOM 7134  H HB2  . LYS A 1 173 ? 71.474  -2.554  8.470   1.00 0.00 ? 173 LYS A HB2  2  
ATOM 7135  H HB3  . LYS A 1 173 ? 72.573  -1.592  9.458   1.00 0.00 ? 173 LYS A HB3  2  
ATOM 7136  H HG2  . LYS A 1 173 ? 70.884  0.103   9.809   1.00 0.00 ? 173 LYS A HG2  2  
ATOM 7137  H HG3  . LYS A 1 173 ? 69.801  -0.672  8.653   1.00 0.00 ? 173 LYS A HG3  2  
ATOM 7138  H HD2  . LYS A 1 173 ? 69.510  -2.583  10.084  1.00 0.00 ? 173 LYS A HD2  2  
ATOM 7139  H HD3  . LYS A 1 173 ? 70.797  -2.045  11.163  1.00 0.00 ? 173 LYS A HD3  2  
ATOM 7140  H HE2  . LYS A 1 173 ? 68.392  -1.590  11.937  1.00 0.00 ? 173 LYS A HE2  2  
ATOM 7141  H HE3  . LYS A 1 173 ? 69.503  -0.221  11.971  1.00 0.00 ? 173 LYS A HE3  2  
ATOM 7142  H HZ1  . LYS A 1 173 ? 67.352  0.326   10.959  1.00 0.00 ? 173 LYS A HZ1  2  
ATOM 7143  H HZ2  . LYS A 1 173 ? 67.632  -0.832  9.747   1.00 0.00 ? 173 LYS A HZ2  2  
ATOM 7144  H HZ3  . LYS A 1 173 ? 68.640  0.530   9.874   1.00 0.00 ? 173 LYS A HZ3  2  
ATOM 7145  N N    . VAL A 1 174 ? 71.928  1.642   7.405   1.00 0.00 ? 174 VAL A N    2  
ATOM 7146  C CA   . VAL A 1 174 ? 72.244  3.042   7.723   1.00 0.00 ? 174 VAL A CA   2  
ATOM 7147  C C    . VAL A 1 174 ? 70.950  3.870   7.766   1.00 0.00 ? 174 VAL A C    2  
ATOM 7148  O O    . VAL A 1 174 ? 69.859  3.321   7.922   1.00 0.00 ? 174 VAL A O    2  
ATOM 7149  C CB   . VAL A 1 174 ? 73.228  3.655   6.672   1.00 0.00 ? 174 VAL A CB   2  
ATOM 7150  C CG1  . VAL A 1 174 ? 74.191  4.650   7.350   1.00 0.00 ? 174 VAL A CG1  2  
ATOM 7151  C CG2  . VAL A 1 174 ? 74.051  2.536   6.017   1.00 0.00 ? 174 VAL A CG2  2  
ATOM 7152  H H    . VAL A 1 174 ? 71.181  1.451   6.804   1.00 0.00 ? 174 VAL A H    2  
ATOM 7153  H HA   . VAL A 1 174 ? 72.702  3.080   8.704   1.00 0.00 ? 174 VAL A HA   2  
ATOM 7154  H HB   . VAL A 1 174 ? 72.668  4.176   5.904   1.00 0.00 ? 174 VAL A HB   2  
ATOM 7155  H HG11 . VAL A 1 174 ? 74.950  4.107   7.896   1.00 0.00 ? 174 VAL A HG11 2  
ATOM 7156  H HG12 . VAL A 1 174 ? 73.641  5.275   8.035   1.00 0.00 ? 174 VAL A HG12 2  
ATOM 7157  H HG13 . VAL A 1 174 ? 74.660  5.265   6.598   1.00 0.00 ? 174 VAL A HG13 2  
ATOM 7158  H HG21 . VAL A 1 174 ? 74.757  2.969   5.323   1.00 0.00 ? 174 VAL A HG21 2  
ATOM 7159  H HG22 . VAL A 1 174 ? 73.392  1.866   5.485   1.00 0.00 ? 174 VAL A HG22 2  
ATOM 7160  H HG23 . VAL A 1 174 ? 74.587  1.988   6.777   1.00 0.00 ? 174 VAL A HG23 2  
ATOM 7161  N N    . SER A 1 175 ? 71.082  5.189   7.638   1.00 0.00 ? 175 SER A N    2  
ATOM 7162  C CA   . SER A 1 175 ? 69.923  6.078   7.674   1.00 0.00 ? 175 SER A CA   2  
ATOM 7163  C C    . SER A 1 175 ? 68.839  5.608   6.709   1.00 0.00 ? 175 SER A C    2  
ATOM 7164  O O    . SER A 1 175 ? 69.133  5.147   5.605   1.00 0.00 ? 175 SER A O    2  
ATOM 7165  C CB   . SER A 1 175 ? 70.347  7.500   7.309   1.00 0.00 ? 175 SER A CB   2  
ATOM 7166  O OG   . SER A 1 175 ? 69.215  8.358   7.372   1.00 0.00 ? 175 SER A OG   2  
ATOM 7167  H H    . SER A 1 175 ? 71.974  5.575   7.525   1.00 0.00 ? 175 SER A H    2  
ATOM 7168  H HA   . SER A 1 175 ? 69.520  6.083   8.676   1.00 0.00 ? 175 SER A HA   2  
ATOM 7169  H HB2  . SER A 1 175 ? 71.094  7.846   8.005   1.00 0.00 ? 175 SER A HB2  2  
ATOM 7170  H HB3  . SER A 1 175 ? 70.761  7.506   6.310   1.00 0.00 ? 175 SER A HB3  2  
ATOM 7171  H HG   . SER A 1 175 ? 69.351  8.975   8.096   1.00 0.00 ? 175 SER A HG   2  
ATOM 7172  N N    . TYR A 1 176 ? 67.580  5.723   7.140   1.00 0.00 ? 176 TYR A N    2  
ATOM 7173  C CA   . TYR A 1 176 ? 66.436  5.304   6.321   1.00 0.00 ? 176 TYR A CA   2  
ATOM 7174  C C    . TYR A 1 176 ? 65.707  6.515   5.737   1.00 0.00 ? 176 TYR A C    2  
ATOM 7175  O O    . TYR A 1 176 ? 65.520  7.523   6.419   1.00 0.00 ? 176 TYR A O    2  
ATOM 7176  C CB   . TYR A 1 176 ? 65.459  4.504   7.183   1.00 0.00 ? 176 TYR A CB   2  
ATOM 7177  C CG   . TYR A 1 176 ? 65.020  5.348   8.357   1.00 0.00 ? 176 TYR A CG   2  
ATOM 7178  C CD1  . TYR A 1 176 ? 63.956  6.264   8.208   1.00 0.00 ? 176 TYR A CD1  2  
ATOM 7179  C CD2  . TYR A 1 176 ? 65.674  5.224   9.604   1.00 0.00 ? 176 TYR A CD2  2  
ATOM 7180  C CE1  . TYR A 1 176 ? 63.545  7.056   9.303   1.00 0.00 ? 176 TYR A CE1  2  
ATOM 7181  C CE2  . TYR A 1 176 ? 65.263  6.015   10.699  1.00 0.00 ? 176 TYR A CE2  2  
ATOM 7182  C CZ   . TYR A 1 176 ? 64.199  6.930   10.549  1.00 0.00 ? 176 TYR A CZ   2  
ATOM 7183  O OH   . TYR A 1 176 ? 63.824  7.732   11.608  1.00 0.00 ? 176 TYR A OH   2  
ATOM 7184  H H    . TYR A 1 176 ? 67.414  6.090   8.032   1.00 0.00 ? 176 TYR A H    2  
ATOM 7185  H HA   . TYR A 1 176 ? 66.776  4.677   5.513   1.00 0.00 ? 176 TYR A HA   2  
ATOM 7186  H HB2  . TYR A 1 176 ? 64.597  4.232   6.592   1.00 0.00 ? 176 TYR A HB2  2  
ATOM 7187  H HB3  . TYR A 1 176 ? 65.945  3.609   7.542   1.00 0.00 ? 176 TYR A HB3  2  
ATOM 7188  H HD1  . TYR A 1 176 ? 63.455  6.359   7.256   1.00 0.00 ? 176 TYR A HD1  2  
ATOM 7189  H HD2  . TYR A 1 176 ? 66.488  4.523   9.719   1.00 0.00 ? 176 TYR A HD2  2  
ATOM 7190  H HE1  . TYR A 1 176 ? 62.732  7.756   9.189   1.00 0.00 ? 176 TYR A HE1  2  
ATOM 7191  H HE2  . TYR A 1 176 ? 65.763  5.919   11.652  1.00 0.00 ? 176 TYR A HE2  2  
ATOM 7192  H HH   . TYR A 1 176 ? 63.070  7.322   12.038  1.00 0.00 ? 176 TYR A HH   2  
ATOM 7193  N N    . GLU A 1 177 ? 65.282  6.404   4.476   1.00 0.00 ? 177 GLU A N    2  
ATOM 7194  C CA   . GLU A 1 177 ? 64.557  7.497   3.824   1.00 0.00 ? 177 GLU A CA   2  
ATOM 7195  C C    . GLU A 1 177 ? 63.795  6.981   2.607   1.00 0.00 ? 177 GLU A C    2  
ATOM 7196  O O    . GLU A 1 177 ? 64.242  6.061   1.927   1.00 0.00 ? 177 GLU A O    2  
ATOM 7197  C CB   . GLU A 1 177 ? 65.533  8.601   3.404   1.00 0.00 ? 177 GLU A CB   2  
ATOM 7198  C CG   . GLU A 1 177 ? 64.770  9.864   2.968   1.00 0.00 ? 177 GLU A CG   2  
ATOM 7199  C CD   . GLU A 1 177 ? 64.176  9.663   1.570   1.00 0.00 ? 177 GLU A CD   2  
ATOM 7200  O OE1  . GLU A 1 177 ? 64.881  9.148   0.717   1.00 0.00 ? 177 GLU A OE1  2  
ATOM 7201  O OE2  . GLU A 1 177 ? 63.029  10.029  1.378   1.00 0.00 ? 177 GLU A OE2  2  
ATOM 7202  H H    . GLU A 1 177 ? 65.451  5.574   3.980   1.00 0.00 ? 177 GLU A H    2  
ATOM 7203  H HA   . GLU A 1 177 ? 63.846  7.907   4.526   1.00 0.00 ? 177 GLU A HA   2  
ATOM 7204  H HB2  . GLU A 1 177 ? 66.167  8.845   4.243   1.00 0.00 ? 177 GLU A HB2  2  
ATOM 7205  H HB3  . GLU A 1 177 ? 66.141  8.246   2.585   1.00 0.00 ? 177 GLU A HB3  2  
ATOM 7206  H HG2  . GLU A 1 177 ? 63.975  10.072  3.668   1.00 0.00 ? 177 GLU A HG2  2  
ATOM 7207  H HG3  . GLU A 1 177 ? 65.451  10.701  2.946   1.00 0.00 ? 177 GLU A HG3  2  
ATOM 7208  N N    . ASP A 1 178 ? 62.635  7.579   2.350   1.00 0.00 ? 178 ASP A N    2  
ATOM 7209  C CA   . ASP A 1 178 ? 61.804  7.175   1.221   1.00 0.00 ? 178 ASP A CA   2  
ATOM 7210  C C    . ASP A 1 178 ? 62.488  7.504   -0.102  1.00 0.00 ? 178 ASP A C    2  
ATOM 7211  O O    . ASP A 1 178 ? 62.525  8.661   -0.522  1.00 0.00 ? 178 ASP A O    2  
ATOM 7212  C CB   . ASP A 1 178 ? 60.453  7.890   1.289   1.00 0.00 ? 178 ASP A CB   2  
ATOM 7213  C CG   . ASP A 1 178 ? 59.511  7.307   0.234   1.00 0.00 ? 178 ASP A CG   2  
ATOM 7214  O OD1  . ASP A 1 178 ? 59.999  6.906   -0.810  1.00 0.00 ? 178 ASP A OD1  2  
ATOM 7215  O OD2  . ASP A 1 178 ? 58.319  7.272   0.489   1.00 0.00 ? 178 ASP A OD2  2  
ATOM 7216  H H    . ASP A 1 178 ? 62.329  8.304   2.935   1.00 0.00 ? 178 ASP A H    2  
ATOM 7217  H HA   . ASP A 1 178 ? 61.637  6.111   1.273   1.00 0.00 ? 178 ASP A HA   2  
ATOM 7218  H HB2  . ASP A 1 178 ? 60.024  7.755   2.271   1.00 0.00 ? 178 ASP A HB2  2  
ATOM 7219  H HB3  . ASP A 1 178 ? 60.594  8.944   1.099   1.00 0.00 ? 178 ASP A HB3  2  
ATOM 7220  N N    . ILE A 1 179 ? 63.029  6.473   -0.756  1.00 0.00 ? 179 ILE A N    2  
ATOM 7221  C CA   . ILE A 1 179 ? 63.717  6.640   -2.042  1.00 0.00 ? 179 ILE A CA   2  
ATOM 7222  C C    . ILE A 1 179 ? 62.946  5.931   -3.153  1.00 0.00 ? 179 ILE A C    2  
ATOM 7223  O O    . ILE A 1 179 ? 63.073  6.281   -4.325  1.00 0.00 ? 179 ILE A O    2  
ATOM 7224  C CB   . ILE A 1 179 ? 65.144  6.051   -1.970  1.00 0.00 ? 179 ILE A CB   2  
ATOM 7225  C CG1  . ILE A 1 179 ? 65.946  6.808   -0.888  1.00 0.00 ? 179 ILE A CG1  2  
ATOM 7226  C CG2  . ILE A 1 179 ? 65.833  6.204   -3.334  1.00 0.00 ? 179 ILE A CG2  2  
ATOM 7227  C CD1  . ILE A 1 179 ? 67.236  6.046   -0.519  1.00 0.00 ? 179 ILE A CD1  2  
ATOM 7228  H H    . ILE A 1 179 ? 62.963  5.576   -0.365  1.00 0.00 ? 179 ILE A H    2  
ATOM 7229  H HA   . ILE A 1 179 ? 63.791  7.692   -2.287  1.00 0.00 ? 179 ILE A HA   2  
ATOM 7230  H HB   . ILE A 1 179 ? 65.079  5.005   -1.715  1.00 0.00 ? 179 ILE A HB   2  
ATOM 7231  H HG12 . ILE A 1 179 ? 66.206  7.788   -1.260  1.00 0.00 ? 179 ILE A HG12 2  
ATOM 7232  H HG13 . ILE A 1 179 ? 65.334  6.917   -0.004  1.00 0.00 ? 179 ILE A HG13 2  
ATOM 7233  H HG21 . ILE A 1 179 ? 65.735  7.224   -3.675  1.00 0.00 ? 179 ILE A HG21 2  
ATOM 7234  H HG22 . ILE A 1 179 ? 65.371  5.540   -4.050  1.00 0.00 ? 179 ILE A HG22 2  
ATOM 7235  H HG23 . ILE A 1 179 ? 66.877  5.953   -3.243  1.00 0.00 ? 179 ILE A HG23 2  
ATOM 7236  H HD11 . ILE A 1 179 ? 67.569  6.360   0.461   1.00 0.00 ? 179 ILE A HD11 2  
ATOM 7237  H HD12 . ILE A 1 179 ? 68.010  6.266   -1.239  1.00 0.00 ? 179 ILE A HD12 2  
ATOM 7238  H HD13 . ILE A 1 179 ? 67.050  4.982   -0.506  1.00 0.00 ? 179 ILE A HD13 2  
ATOM 7239  N N    . ILE A 1 180 ? 62.147  4.931   -2.782  1.00 0.00 ? 180 ILE A N    2  
ATOM 7240  C CA   . ILE A 1 180 ? 61.362  4.178   -3.764  1.00 0.00 ? 180 ILE A CA   2  
ATOM 7241  C C    . ILE A 1 180 ? 59.985  4.805   -3.955  1.00 0.00 ? 180 ILE A C    2  
ATOM 7242  O O    . ILE A 1 180 ? 59.333  5.210   -2.992  1.00 0.00 ? 180 ILE A O    2  
ATOM 7243  C CB   . ILE A 1 180 ? 61.172  2.713   -3.323  1.00 0.00 ? 180 ILE A CB   2  
ATOM 7244  C CG1  . ILE A 1 180 ? 60.565  2.671   -1.913  1.00 0.00 ? 180 ILE A CG1  2  
ATOM 7245  C CG2  . ILE A 1 180 ? 62.525  2.000   -3.318  1.00 0.00 ? 180 ILE A CG2  2  
ATOM 7246  C CD1  . ILE A 1 180 ? 60.413  1.216   -1.446  1.00 0.00 ? 180 ILE A CD1  2  
ATOM 7247  H H    . ILE A 1 180 ? 62.086  4.691   -1.834  1.00 0.00 ? 180 ILE A H    2  
ATOM 7248  H HA   . ILE A 1 180 ? 61.877  4.185   -4.716  1.00 0.00 ? 180 ILE A HA   2  
ATOM 7249  H HB   . ILE A 1 180 ? 60.509  2.213   -4.016  1.00 0.00 ? 180 ILE A HB   2  
ATOM 7250  H HG12 . ILE A 1 180 ? 61.209  3.203   -1.229  1.00 0.00 ? 180 ILE A HG12 2  
ATOM 7251  H HG13 . ILE A 1 180 ? 59.594  3.141   -1.928  1.00 0.00 ? 180 ILE A HG13 2  
ATOM 7252  H HG21 . ILE A 1 180 ? 63.036  2.193   -4.249  1.00 0.00 ? 180 ILE A HG21 2  
ATOM 7253  H HG22 . ILE A 1 180 ? 62.371  0.937   -3.207  1.00 0.00 ? 180 ILE A HG22 2  
ATOM 7254  H HG23 . ILE A 1 180 ? 63.124  2.366   -2.496  1.00 0.00 ? 180 ILE A HG23 2  
ATOM 7255  H HD11 . ILE A 1 180 ? 60.084  0.596   -2.270  1.00 0.00 ? 180 ILE A HD11 2  
ATOM 7256  H HD12 . ILE A 1 180 ? 59.680  1.169   -0.653  1.00 0.00 ? 180 ILE A HD12 2  
ATOM 7257  H HD13 . ILE A 1 180 ? 61.361  0.851   -1.078  1.00 0.00 ? 180 ILE A HD13 2  
ATOM 7258  N N    . GLY A 1 181 ? 59.547  4.878   -5.210  1.00 0.00 ? 181 GLY A N    2  
ATOM 7259  C CA   . GLY A 1 181 ? 58.246  5.442   -5.535  1.00 0.00 ? 181 GLY A CA   2  
ATOM 7260  C C    . GLY A 1 181 ? 57.192  4.359   -5.606  1.00 0.00 ? 181 GLY A C    2  
ATOM 7261  O O    . GLY A 1 181 ? 57.132  3.488   -4.740  1.00 0.00 ? 181 GLY A O    2  
ATOM 7262  H H    . GLY A 1 181 ? 60.111  4.540   -5.934  1.00 0.00 ? 181 GLY A H    2  
ATOM 7263  H HA2  . GLY A 1 181 ? 57.961  6.167   -4.784  1.00 0.00 ? 181 GLY A HA2  2  
ATOM 7264  H HA3  . GLY A 1 181 ? 58.308  5.936   -6.493  1.00 0.00 ? 181 GLY A HA3  2  
ATOM 7265  N N    . SER A 1 182 ? 56.365  4.402   -6.642  1.00 0.00 ? 182 SER A N    2  
ATOM 7266  C CA   . SER A 1 182 ? 55.321  3.397   -6.806  1.00 0.00 ? 182 SER A CA   2  
ATOM 7267  C C    . SER A 1 182 ? 55.931  2.062   -7.199  1.00 0.00 ? 182 SER A C    2  
ATOM 7268  O O    . SER A 1 182 ? 57.020  2.019   -7.770  1.00 0.00 ? 182 SER A O    2  
ATOM 7269  C CB   . SER A 1 182 ? 54.319  3.844   -7.869  1.00 0.00 ? 182 SER A CB   2  
ATOM 7270  O OG   . SER A 1 182 ? 53.280  2.879   -7.969  1.00 0.00 ? 182 SER A OG   2  
ATOM 7271  H H    . SER A 1 182 ? 56.460  5.114   -7.309  1.00 0.00 ? 182 SER A H    2  
ATOM 7272  H HA   . SER A 1 182 ? 54.810  3.276   -5.872  1.00 0.00 ? 182 SER A HA   2  
ATOM 7273  H HB2  . SER A 1 182 ? 53.894  4.794   -7.590  1.00 0.00 ? 182 SER A HB2  2  
ATOM 7274  H HB3  . SER A 1 182 ? 54.825  3.943   -8.821  1.00 0.00 ? 182 SER A HB3  2  
ATOM 7275  H HG   . SER A 1 182 ? 53.669  2.010   -7.841  1.00 0.00 ? 182 SER A HG   2  
ATOM 7276  N N    . THR A 1 183 ? 55.235  0.960   -6.892  1.00 0.00 ? 183 THR A N    2  
ATOM 7277  C CA   . THR A 1 183 ? 55.759  -0.366  -7.234  1.00 0.00 ? 183 THR A CA   2  
ATOM 7278  C C    . THR A 1 183 ? 54.629  -1.356  -7.504  1.00 0.00 ? 183 THR A C    2  
ATOM 7279  O O    . THR A 1 183 ? 54.089  -1.974  -6.586  1.00 0.00 ? 183 THR A O    2  
ATOM 7280  C CB   . THR A 1 183 ? 56.656  -0.908  -6.102  1.00 0.00 ? 183 THR A CB   2  
ATOM 7281  O OG1  . THR A 1 183 ? 57.776  -0.048  -5.944  1.00 0.00 ? 183 THR A OG1  2  
ATOM 7282  C CG2  . THR A 1 183 ? 57.145  -2.319  -6.448  1.00 0.00 ? 183 THR A CG2  2  
ATOM 7283  H H    . THR A 1 183 ? 54.360  1.040   -6.428  1.00 0.00 ? 183 THR A H    2  
ATOM 7284  H HA   . THR A 1 183 ? 56.357  -0.290  -8.133  1.00 0.00 ? 183 THR A HA   2  
ATOM 7285  H HB   . THR A 1 183 ? 56.097  -0.936  -5.182  1.00 0.00 ? 183 THR A HB   2  
ATOM 7286  H HG1  . THR A 1 183 ? 58.571  -0.569  -6.080  1.00 0.00 ? 183 THR A HG1  2  
ATOM 7287  H HG21 . THR A 1 183 ? 57.524  -2.331  -7.458  1.00 0.00 ? 183 THR A HG21 2  
ATOM 7288  H HG22 . THR A 1 183 ? 56.329  -3.019  -6.366  1.00 0.00 ? 183 THR A HG22 2  
ATOM 7289  H HG23 . THR A 1 183 ? 57.933  -2.605  -5.766  1.00 0.00 ? 183 THR A HG23 2  
ATOM 7290  N N    . ILE A 1 184 ? 54.281  -1.491  -8.785  1.00 0.00 ? 184 ILE A N    2  
ATOM 7291  C CA   . ILE A 1 184 ? 53.212  -2.400  -9.211  1.00 0.00 ? 184 ILE A CA   2  
ATOM 7292  C C    . ILE A 1 184 ? 53.819  -3.719  -9.684  1.00 0.00 ? 184 ILE A C    2  
ATOM 7293  O O    . ILE A 1 184 ? 54.841  -3.734  -10.369 1.00 0.00 ? 184 ILE A O    2  
ATOM 7294  C CB   . ILE A 1 184 ? 52.387  -1.774  -10.369 1.00 0.00 ? 184 ILE A CB   2  
ATOM 7295  C CG1  . ILE A 1 184 ? 51.543  -0.605  -9.830  1.00 0.00 ? 184 ILE A CG1  2  
ATOM 7296  C CG2  . ILE A 1 184 ? 51.447  -2.827  -10.986 1.00 0.00 ? 184 ILE A CG2  2  
ATOM 7297  C CD1  . ILE A 1 184 ? 52.451  0.513   -9.282  1.00 0.00 ? 184 ILE A CD1  2  
ATOM 7298  H H    . ILE A 1 184 ? 54.751  -0.949  -9.452  1.00 0.00 ? 184 ILE A H    2  
ATOM 7299  H HA   . ILE A 1 184 ? 52.548  -2.597  -8.379  1.00 0.00 ? 184 ILE A HA   2  
ATOM 7300  H HB   . ILE A 1 184 ? 53.062  -1.411  -11.130 1.00 0.00 ? 184 ILE A HB   2  
ATOM 7301  H HG12 . ILE A 1 184 ? 50.934  -0.209  -10.632 1.00 0.00 ? 184 ILE A HG12 2  
ATOM 7302  H HG13 . ILE A 1 184 ? 50.900  -0.964  -9.040  1.00 0.00 ? 184 ILE A HG13 2  
ATOM 7303  H HG21 . ILE A 1 184 ? 52.023  -3.516  -11.586 1.00 0.00 ? 184 ILE A HG21 2  
ATOM 7304  H HG22 . ILE A 1 184 ? 50.712  -2.340  -11.611 1.00 0.00 ? 184 ILE A HG22 2  
ATOM 7305  H HG23 . ILE A 1 184 ? 50.947  -3.369  -10.197 1.00 0.00 ? 184 ILE A HG23 2  
ATOM 7306  H HD11 . ILE A 1 184 ? 51.919  1.454   -9.311  1.00 0.00 ? 184 ILE A HD11 2  
ATOM 7307  H HD12 . ILE A 1 184 ? 53.346  0.590   -9.883  1.00 0.00 ? 184 ILE A HD12 2  
ATOM 7308  H HD13 . ILE A 1 184 ? 52.722  0.292   -8.260  1.00 0.00 ? 184 ILE A HD13 2  
ATOM 7309  N N    . VAL A 1 185 ? 53.185  -4.829  -9.298  1.00 0.00 ? 185 VAL A N    2  
ATOM 7310  C CA   . VAL A 1 185 ? 53.669  -6.163  -9.670  1.00 0.00 ? 185 VAL A CA   2  
ATOM 7311  C C    . VAL A 1 185 ? 52.500  -7.099  -10.007 1.00 0.00 ? 185 VAL A C    2  
ATOM 7312  O O    . VAL A 1 185 ? 51.601  -7.298  -9.191  1.00 0.00 ? 185 VAL A O    2  
ATOM 7313  C CB   . VAL A 1 185 ? 54.515  -6.767  -8.511  1.00 0.00 ? 185 VAL A CB   2  
ATOM 7314  C CG1  . VAL A 1 185 ? 55.361  -5.657  -7.871  1.00 0.00 ? 185 VAL A CG1  2  
ATOM 7315  C CG2  . VAL A 1 185 ? 53.605  -7.384  -7.428  1.00 0.00 ? 185 VAL A CG2  2  
ATOM 7316  H H    . VAL A 1 185 ? 52.380  -4.750  -8.741  1.00 0.00 ? 185 VAL A H    2  
ATOM 7317  H HA   . VAL A 1 185 ? 54.298  -6.082  -10.548 1.00 0.00 ? 185 VAL A HA   2  
ATOM 7318  H HB   . VAL A 1 185 ? 55.171  -7.530  -8.907  1.00 0.00 ? 185 VAL A HB   2  
ATOM 7319  H HG11 . VAL A 1 185 ? 55.839  -5.073  -8.642  1.00 0.00 ? 185 VAL A HG11 2  
ATOM 7320  H HG12 . VAL A 1 185 ? 56.116  -6.099  -7.238  1.00 0.00 ? 185 VAL A HG12 2  
ATOM 7321  H HG13 . VAL A 1 185 ? 54.727  -5.014  -7.277  1.00 0.00 ? 185 VAL A HG13 2  
ATOM 7322  H HG21 . VAL A 1 185 ? 52.789  -6.708  -7.215  1.00 0.00 ? 185 VAL A HG21 2  
ATOM 7323  H HG22 . VAL A 1 185 ? 54.175  -7.554  -6.526  1.00 0.00 ? 185 VAL A HG22 2  
ATOM 7324  H HG23 . VAL A 1 185 ? 53.210  -8.324  -7.782  1.00 0.00 ? 185 VAL A HG23 2  
ATOM 7325  N N    . ASP A 1 186 ? 52.523  -7.675  -11.209 1.00 0.00 ? 186 ASP A N    2  
ATOM 7326  C CA   . ASP A 1 186 ? 51.472  -8.591  -11.631 1.00 0.00 ? 186 ASP A CA   2  
ATOM 7327  C C    . ASP A 1 186 ? 51.702  -9.967  -11.019 1.00 0.00 ? 186 ASP A C    2  
ATOM 7328  O O    . ASP A 1 186 ? 52.642  -10.672 -11.388 1.00 0.00 ? 186 ASP A O    2  
ATOM 7329  C CB   . ASP A 1 186 ? 51.457  -8.703  -13.156 1.00 0.00 ? 186 ASP A CB   2  
ATOM 7330  C CG   . ASP A 1 186 ? 52.829  -9.165  -13.646 1.00 0.00 ? 186 ASP A CG   2  
ATOM 7331  O OD1  . ASP A 1 186 ? 53.774  -9.068  -12.881 1.00 0.00 ? 186 ASP A OD1  2  
ATOM 7332  O OD2  . ASP A 1 186 ? 52.912  -9.608  -14.780 1.00 0.00 ? 186 ASP A OD2  2  
ATOM 7333  H H    . ASP A 1 186 ? 53.257  -7.487  -11.819 1.00 0.00 ? 186 ASP A H    2  
ATOM 7334  H HA   . ASP A 1 186 ? 50.515  -8.214  -11.299 1.00 0.00 ? 186 ASP A HA   2  
ATOM 7335  H HB2  . ASP A 1 186 ? 50.706  -9.419  -13.457 1.00 0.00 ? 186 ASP A HB2  2  
ATOM 7336  H HB3  . ASP A 1 186 ? 51.229  -7.739  -13.585 1.00 0.00 ? 186 ASP A HB3  2  
ATOM 7337  N N    . THR A 1 187 ? 50.838  -10.346 -10.080 1.00 0.00 ? 187 THR A N    2  
ATOM 7338  C CA   . THR A 1 187 ? 50.958  -11.644 -9.421  1.00 0.00 ? 187 THR A CA   2  
ATOM 7339  C C    . THR A 1 187 ? 51.144  -12.746 -10.457 1.00 0.00 ? 187 THR A C    2  
ATOM 7340  O O    . THR A 1 187 ? 51.744  -13.784 -10.175 1.00 0.00 ? 187 THR A O    2  
ATOM 7341  C CB   . THR A 1 187 ? 49.699  -11.959 -8.591  1.00 0.00 ? 187 THR A CB   2  
ATOM 7342  O OG1  . THR A 1 187 ? 49.419  -10.868 -7.726  1.00 0.00 ? 187 THR A OG1  2  
ATOM 7343  C CG2  . THR A 1 187 ? 49.934  -13.223 -7.762  1.00 0.00 ? 187 THR A CG2  2  
ATOM 7344  H H    . THR A 1 187 ? 50.109  -9.743  -9.827  1.00 0.00 ? 187 THR A H    2  
ATOM 7345  H HA   . THR A 1 187 ? 51.814  -11.629 -8.765  1.00 0.00 ? 187 THR A HA   2  
ATOM 7346  H HB   . THR A 1 187 ? 48.861  -12.119 -9.253  1.00 0.00 ? 187 THR A HB   2  
ATOM 7347  H HG1  . THR A 1 187 ? 49.628  -11.138 -6.829  1.00 0.00 ? 187 THR A HG1  2  
ATOM 7348  H HG21 . THR A 1 187 ? 49.072  -13.408 -7.137  1.00 0.00 ? 187 THR A HG21 2  
ATOM 7349  H HG22 . THR A 1 187 ? 50.807  -13.089 -7.141  1.00 0.00 ? 187 THR A HG22 2  
ATOM 7350  H HG23 . THR A 1 187 ? 50.086  -14.064 -8.421  1.00 0.00 ? 187 THR A HG23 2  
ATOM 7351  N N    . LYS A 1 188 ? 50.616  -12.502 -11.656 1.00 0.00 ? 188 LYS A N    2  
ATOM 7352  C CA   . LYS A 1 188 ? 50.707  -13.462 -12.761 1.00 0.00 ? 188 LYS A CA   2  
ATOM 7353  C C    . LYS A 1 188 ? 52.030  -14.229 -12.749 1.00 0.00 ? 188 LYS A C    2  
ATOM 7354  O O    . LYS A 1 188 ? 52.047  -15.448 -12.916 1.00 0.00 ? 188 LYS A O    2  
ATOM 7355  C CB   . LYS A 1 188 ? 50.584  -12.730 -14.100 1.00 0.00 ? 188 LYS A CB   2  
ATOM 7356  C CG   . LYS A 1 188 ? 49.236  -12.013 -14.186 1.00 0.00 ? 188 LYS A CG   2  
ATOM 7357  C CD   . LYS A 1 188 ? 49.095  -11.376 -15.571 1.00 0.00 ? 188 LYS A CD   2  
ATOM 7358  C CE   . LYS A 1 188 ? 47.846  -10.493 -15.614 1.00 0.00 ? 188 LYS A CE   2  
ATOM 7359  N NZ   . LYS A 1 188 ? 47.976  -9.394  -14.616 1.00 0.00 ? 188 LYS A NZ   2  
ATOM 7360  H H    . LYS A 1 188 ? 50.142  -11.654 -11.799 1.00 0.00 ? 188 LYS A H    2  
ATOM 7361  H HA   . LYS A 1 188 ? 49.895  -14.167 -12.677 1.00 0.00 ? 188 LYS A HA   2  
ATOM 7362  H HB2  . LYS A 1 188 ? 51.381  -12.006 -14.185 1.00 0.00 ? 188 LYS A HB2  2  
ATOM 7363  H HB3  . LYS A 1 188 ? 50.661  -13.443 -14.906 1.00 0.00 ? 188 LYS A HB3  2  
ATOM 7364  H HG2  . LYS A 1 188 ? 48.438  -12.724 -14.031 1.00 0.00 ? 188 LYS A HG2  2  
ATOM 7365  H HG3  . LYS A 1 188 ? 49.187  -11.244 -13.430 1.00 0.00 ? 188 LYS A HG3  2  
ATOM 7366  H HD2  . LYS A 1 188 ? 49.968  -10.774 -15.779 1.00 0.00 ? 188 LYS A HD2  2  
ATOM 7367  H HD3  . LYS A 1 188 ? 49.010  -12.152 -16.317 1.00 0.00 ? 188 LYS A HD3  2  
ATOM 7368  H HE2  . LYS A 1 188 ? 47.740  -10.070 -16.602 1.00 0.00 ? 188 LYS A HE2  2  
ATOM 7369  H HE3  . LYS A 1 188 ? 46.975  -11.089 -15.385 1.00 0.00 ? 188 LYS A HE3  2  
ATOM 7370  H HZ1  . LYS A 1 188 ? 48.093  -9.799  -13.666 1.00 0.00 ? 188 LYS A HZ1  2  
ATOM 7371  H HZ2  . LYS A 1 188 ? 47.120  -8.803  -14.638 1.00 0.00 ? 188 LYS A HZ2  2  
ATOM 7372  H HZ3  . LYS A 1 188 ? 48.806  -8.812  -14.846 1.00 0.00 ? 188 LYS A HZ3  2  
ATOM 7373  N N    . CYS A 1 189 ? 53.142  -13.510 -12.567 1.00 0.00 ? 189 CYS A N    2  
ATOM 7374  C CA   . CYS A 1 189 ? 54.464  -14.151 -12.558 1.00 0.00 ? 189 CYS A CA   2  
ATOM 7375  C C    . CYS A 1 189 ? 55.389  -13.499 -11.535 1.00 0.00 ? 189 CYS A C    2  
ATOM 7376  O O    . CYS A 1 189 ? 56.577  -13.314 -11.793 1.00 0.00 ? 189 CYS A O    2  
ATOM 7377  C CB   . CYS A 1 189 ? 55.091  -14.049 -13.950 1.00 0.00 ? 189 CYS A CB   2  
ATOM 7378  S SG   . CYS A 1 189 ? 55.243  -12.308 -14.423 1.00 0.00 ? 189 CYS A SG   2  
ATOM 7379  H H    . CYS A 1 189 ? 53.076  -12.532 -12.449 1.00 0.00 ? 189 CYS A H    2  
ATOM 7380  H HA   . CYS A 1 189 ? 54.358  -15.197 -12.303 1.00 0.00 ? 189 CYS A HA   2  
ATOM 7381  H HB2  . CYS A 1 189 ? 56.070  -14.506 -13.938 1.00 0.00 ? 189 CYS A HB2  2  
ATOM 7382  H HB3  . CYS A 1 189 ? 54.464  -14.563 -14.664 1.00 0.00 ? 189 CYS A HB3  2  
ATOM 7383  N N    . VAL A 1 190 ? 54.844  -13.163 -10.367 1.00 0.00 ? 190 VAL A N    2  
ATOM 7384  C CA   . VAL A 1 190 ? 55.638  -12.540 -9.306  1.00 0.00 ? 190 VAL A CA   2  
ATOM 7385  C C    . VAL A 1 190 ? 55.091  -12.928 -7.935  1.00 0.00 ? 190 VAL A C    2  
ATOM 7386  O O    . VAL A 1 190 ? 54.150  -12.312 -7.436  1.00 0.00 ? 190 VAL A O    2  
ATOM 7387  C CB   . VAL A 1 190 ? 55.618  -11.005 -9.420  1.00 0.00 ? 190 VAL A CB   2  
ATOM 7388  C CG1  . VAL A 1 190 ? 56.555  -10.404 -8.367  1.00 0.00 ? 190 VAL A CG1  2  
ATOM 7389  C CG2  . VAL A 1 190 ? 56.091  -10.592 -10.818 1.00 0.00 ? 190 VAL A CG2  2  
ATOM 7390  H H    . VAL A 1 190 ? 53.893  -13.343 -10.213 1.00 0.00 ? 190 VAL A H    2  
ATOM 7391  H HA   . VAL A 1 190 ? 56.663  -12.881 -9.375  1.00 0.00 ? 190 VAL A HA   2  
ATOM 7392  H HB   . VAL A 1 190 ? 54.613  -10.645 -9.256  1.00 0.00 ? 190 VAL A HB   2  
ATOM 7393  H HG11 . VAL A 1 190 ? 57.525  -10.872 -8.439  1.00 0.00 ? 190 VAL A HG11 2  
ATOM 7394  H HG12 . VAL A 1 190 ? 56.145  -10.574 -7.383  1.00 0.00 ? 190 VAL A HG12 2  
ATOM 7395  H HG13 . VAL A 1 190 ? 56.655  -9.342  -8.534  1.00 0.00 ? 190 VAL A HG13 2  
ATOM 7396  H HG21 . VAL A 1 190 ? 55.342  -10.865 -11.546 1.00 0.00 ? 190 VAL A HG21 2  
ATOM 7397  H HG22 . VAL A 1 190 ? 57.017  -11.097 -11.048 1.00 0.00 ? 190 VAL A HG22 2  
ATOM 7398  H HG23 . VAL A 1 190 ? 56.246  -9.527  -10.847 1.00 0.00 ? 190 VAL A HG23 2  
ATOM 7399  N N    . LYS A 1 191 ? 55.693  -13.949 -7.331  1.00 0.00 ? 191 LYS A N    2  
ATOM 7400  C CA   . LYS A 1 191 ? 55.268  -14.410 -6.011  1.00 0.00 ? 191 LYS A CA   2  
ATOM 7401  C C    . LYS A 1 191 ? 55.850  -13.509 -4.928  1.00 0.00 ? 191 LYS A C    2  
ATOM 7402  O O    . LYS A 1 191 ? 55.117  -12.905 -4.145  1.00 0.00 ? 191 LYS A O    2  
ATOM 7403  C CB   . LYS A 1 191 ? 55.740  -15.853 -5.791  1.00 0.00 ? 191 LYS A CB   2  
ATOM 7404  C CG   . LYS A 1 191 ? 55.050  -16.450 -4.553  1.00 0.00 ? 191 LYS A CG   2  
ATOM 7405  C CD   . LYS A 1 191 ? 55.792  -17.713 -4.097  1.00 0.00 ? 191 LYS A CD   2  
ATOM 7406  C CE   . LYS A 1 191 ? 55.854  -18.726 -5.244  1.00 0.00 ? 191 LYS A CE   2  
ATOM 7407  N NZ   . LYS A 1 191 ? 54.522  -18.813 -5.908  1.00 0.00 ? 191 LYS A NZ   2  
ATOM 7408  H H    . LYS A 1 191 ? 56.443  -14.399 -7.772  1.00 0.00 ? 191 LYS A H    2  
ATOM 7409  H HA   . LYS A 1 191 ? 54.188  -14.381 -5.953  1.00 0.00 ? 191 LYS A HA   2  
ATOM 7410  H HB2  . LYS A 1 191 ? 55.491  -16.445 -6.661  1.00 0.00 ? 191 LYS A HB2  2  
ATOM 7411  H HB3  . LYS A 1 191 ? 56.811  -15.861 -5.647  1.00 0.00 ? 191 LYS A HB3  2  
ATOM 7412  H HG2  . LYS A 1 191 ? 55.056  -15.725 -3.750  1.00 0.00 ? 191 LYS A HG2  2  
ATOM 7413  H HG3  . LYS A 1 191 ? 54.030  -16.704 -4.798  1.00 0.00 ? 191 LYS A HG3  2  
ATOM 7414  H HD2  . LYS A 1 191 ? 56.796  -17.450 -3.797  1.00 0.00 ? 191 LYS A HD2  2  
ATOM 7415  H HD3  . LYS A 1 191 ? 55.271  -18.152 -3.260  1.00 0.00 ? 191 LYS A HD3  2  
ATOM 7416  H HE2  . LYS A 1 191 ? 56.595  -18.413 -5.963  1.00 0.00 ? 191 LYS A HE2  2  
ATOM 7417  H HE3  . LYS A 1 191 ? 56.123  -19.696 -4.851  1.00 0.00 ? 191 LYS A HE3  2  
ATOM 7418  H HZ1  . LYS A 1 191 ? 54.424  -19.739 -6.368  1.00 0.00 ? 191 LYS A HZ1  2  
ATOM 7419  H HZ2  . LYS A 1 191 ? 54.441  -18.060 -6.620  1.00 0.00 ? 191 LYS A HZ2  2  
ATOM 7420  H HZ3  . LYS A 1 191 ? 53.772  -18.701 -5.196  1.00 0.00 ? 191 LYS A HZ3  2  
ATOM 7421  N N    . ASN A 1 192 ? 57.182  -13.426 -4.892  1.00 0.00 ? 192 ASN A N    2  
ATOM 7422  C CA   . ASN A 1 192 ? 57.887  -12.597 -3.902  1.00 0.00 ? 192 ASN A CA   2  
ATOM 7423  C C    . ASN A 1 192 ? 58.864  -11.658 -4.604  1.00 0.00 ? 192 ASN A C    2  
ATOM 7424  O O    . ASN A 1 192 ? 59.551  -12.058 -5.543  1.00 0.00 ? 192 ASN A O    2  
ATOM 7425  C CB   . ASN A 1 192 ? 58.653  -13.494 -2.924  1.00 0.00 ? 192 ASN A CB   2  
ATOM 7426  C CG   . ASN A 1 192 ? 59.343  -12.637 -1.860  1.00 0.00 ? 192 ASN A CG   2  
ATOM 7427  O OD1  . ASN A 1 192 ? 59.878  -11.588 -2.159  1.00 0.00 ? 192 ASN A OD1  2  
ATOM 7428  N ND2  . ASN A 1 192 ? 59.355  -13.044 -0.621  1.00 0.00 ? 192 ASN A ND2  2  
ATOM 7429  H H    . ASN A 1 192 ? 57.706  -13.937 -5.548  1.00 0.00 ? 192 ASN A H    2  
ATOM 7430  H HA   . ASN A 1 192 ? 57.174  -12.002 -3.345  1.00 0.00 ? 192 ASN A HA   2  
ATOM 7431  H HB2  . ASN A 1 192 ? 57.963  -14.174 -2.446  1.00 0.00 ? 192 ASN A HB2  2  
ATOM 7432  H HB3  . ASN A 1 192 ? 59.398  -14.058 -3.462  1.00 0.00 ? 192 ASN A HB3  2  
ATOM 7433  H HD21 . ASN A 1 192 ? 58.926  -13.892 -0.381  1.00 0.00 ? 192 ASN A HD21 2  
ATOM 7434  H HD22 . ASN A 1 192 ? 59.794  -12.504 0.068   1.00 0.00 ? 192 ASN A HD22 2  
ATOM 7435  N N    . LEU A 1 193 ? 58.914  -10.402 -4.155  1.00 0.00 ? 193 LEU A N    2  
ATOM 7436  C CA   . LEU A 1 193 ? 59.805  -9.406  -4.760  1.00 0.00 ? 193 LEU A CA   2  
ATOM 7437  C C    . LEU A 1 193 ? 60.466  -8.544  -3.689  1.00 0.00 ? 193 LEU A C    2  
ATOM 7438  O O    . LEU A 1 193 ? 59.832  -7.674  -3.095  1.00 0.00 ? 193 LEU A O    2  
ATOM 7439  C CB   . LEU A 1 193 ? 58.994  -8.517  -5.722  1.00 0.00 ? 193 LEU A CB   2  
ATOM 7440  C CG   . LEU A 1 193 ? 59.922  -7.516  -6.486  1.00 0.00 ? 193 LEU A CG   2  
ATOM 7441  C CD1  . LEU A 1 193 ? 59.444  -7.356  -7.936  1.00 0.00 ? 193 LEU A CD1  2  
ATOM 7442  C CD2  . LEU A 1 193 ? 59.906  -6.129  -5.818  1.00 0.00 ? 193 LEU A CD2  2  
ATOM 7443  H H    . LEU A 1 193 ? 58.332  -10.134 -3.412  1.00 0.00 ? 193 LEU A H    2  
ATOM 7444  H HA   . LEU A 1 193 ? 60.580  -9.908  -5.325  1.00 0.00 ? 193 LEU A HA   2  
ATOM 7445  H HB2  . LEU A 1 193 ? 58.486  -9.160  -6.429  1.00 0.00 ? 193 LEU A HB2  2  
ATOM 7446  H HB3  . LEU A 1 193 ? 58.252  -7.973  -5.156  1.00 0.00 ? 193 LEU A HB3  2  
ATOM 7447  H HG   . LEU A 1 193 ? 60.937  -7.892  -6.496  1.00 0.00 ? 193 LEU A HG   2  
ATOM 7448  H HD11 . LEU A 1 193 ? 58.419  -7.016  -7.942  1.00 0.00 ? 193 LEU A HD11 2  
ATOM 7449  H HD12 . LEU A 1 193 ? 59.509  -8.307  -8.444  1.00 0.00 ? 193 LEU A HD12 2  
ATOM 7450  H HD13 . LEU A 1 193 ? 60.066  -6.634  -8.443  1.00 0.00 ? 193 LEU A HD13 2  
ATOM 7451  H HD21 . LEU A 1 193 ? 58.886  -5.788  -5.711  1.00 0.00 ? 193 LEU A HD21 2  
ATOM 7452  H HD22 . LEU A 1 193 ? 60.453  -5.430  -6.432  1.00 0.00 ? 193 LEU A HD22 2  
ATOM 7453  H HD23 . LEU A 1 193 ? 60.370  -6.187  -4.848  1.00 0.00 ? 193 LEU A HD23 2  
ATOM 7454  N N    . GLU A 1 194 ? 61.757  -8.779  -3.460  1.00 0.00 ? 194 GLU A N    2  
ATOM 7455  C CA   . GLU A 1 194 ? 62.512  -8.005  -2.474  1.00 0.00 ? 194 GLU A CA   2  
ATOM 7456  C C    . GLU A 1 194 ? 63.193  -6.838  -3.176  1.00 0.00 ? 194 GLU A C    2  
ATOM 7457  O O    . GLU A 1 194 ? 63.672  -6.980  -4.298  1.00 0.00 ? 194 GLU A O    2  
ATOM 7458  C CB   . GLU A 1 194 ? 63.560  -8.894  -1.797  1.00 0.00 ? 194 GLU A CB   2  
ATOM 7459  C CG   . GLU A 1 194 ? 62.911  -10.218 -1.383  1.00 0.00 ? 194 GLU A CG   2  
ATOM 7460  C CD   . GLU A 1 194 ? 63.873  -11.001 -0.487  1.00 0.00 ? 194 GLU A CD   2  
ATOM 7461  O OE1  . GLU A 1 194 ? 63.984  -10.651 0.677   1.00 0.00 ? 194 GLU A OE1  2  
ATOM 7462  O OE2  . GLU A 1 194 ? 64.480  -11.938 -0.979  1.00 0.00 ? 194 GLU A OE2  2  
ATOM 7463  H H    . GLU A 1 194 ? 62.215  -9.476  -3.975  1.00 0.00 ? 194 GLU A H    2  
ATOM 7464  H HA   . GLU A 1 194 ? 61.840  -7.618  -1.719  1.00 0.00 ? 194 GLU A HA   2  
ATOM 7465  H HB2  . GLU A 1 194 ? 64.369  -9.088  -2.485  1.00 0.00 ? 194 GLU A HB2  2  
ATOM 7466  H HB3  . GLU A 1 194 ? 63.945  -8.392  -0.921  1.00 0.00 ? 194 GLU A HB3  2  
ATOM 7467  H HG2  . GLU A 1 194 ? 61.998  -10.018 -0.842  1.00 0.00 ? 194 GLU A HG2  2  
ATOM 7468  H HG3  . GLU A 1 194 ? 62.689  -10.801 -2.264  1.00 0.00 ? 194 GLU A HG3  2  
ATOM 7469  N N    . PHE A 1 195 ? 63.207  -5.676  -2.527  1.00 0.00 ? 195 PHE A N    2  
ATOM 7470  C CA   . PHE A 1 195 ? 63.806  -4.476  -3.121  1.00 0.00 ? 195 PHE A CA   2  
ATOM 7471  C C    . PHE A 1 195 ? 64.624  -3.701  -2.095  1.00 0.00 ? 195 PHE A C    2  
ATOM 7472  O O    . PHE A 1 195 ? 64.172  -3.459  -0.976  1.00 0.00 ? 195 PHE A O    2  
ATOM 7473  C CB   . PHE A 1 195 ? 62.691  -3.581  -3.663  1.00 0.00 ? 195 PHE A CB   2  
ATOM 7474  C CG   . PHE A 1 195 ? 63.290  -2.434  -4.442  1.00 0.00 ? 195 PHE A CG   2  
ATOM 7475  C CD1  . PHE A 1 195 ? 63.799  -1.312  -3.758  1.00 0.00 ? 195 PHE A CD1  2  
ATOM 7476  C CD2  . PHE A 1 195 ? 63.339  -2.482  -5.854  1.00 0.00 ? 195 PHE A CD2  2  
ATOM 7477  C CE1  . PHE A 1 195 ? 64.357  -0.239  -4.481  1.00 0.00 ? 195 PHE A CE1  2  
ATOM 7478  C CE2  . PHE A 1 195 ? 63.896  -1.406  -6.578  1.00 0.00 ? 195 PHE A CE2  2  
ATOM 7479  C CZ   . PHE A 1 195 ? 64.404  -0.283  -5.890  1.00 0.00 ? 195 PHE A CZ   2  
ATOM 7480  H H    . PHE A 1 195 ? 62.786  -5.616  -1.644  1.00 0.00 ? 195 PHE A H    2  
ATOM 7481  H HA   . PHE A 1 195 ? 64.455  -4.755  -3.941  1.00 0.00 ? 195 PHE A HA   2  
ATOM 7482  H HB2  . PHE A 1 195 ? 62.046  -4.162  -4.308  1.00 0.00 ? 195 PHE A HB2  2  
ATOM 7483  H HB3  . PHE A 1 195 ? 62.114  -3.189  -2.838  1.00 0.00 ? 195 PHE A HB3  2  
ATOM 7484  H HD1  . PHE A 1 195 ? 63.761  -1.274  -2.679  1.00 0.00 ? 195 PHE A HD1  2  
ATOM 7485  H HD2  . PHE A 1 195 ? 62.949  -3.342  -6.379  1.00 0.00 ? 195 PHE A HD2  2  
ATOM 7486  H HE1  . PHE A 1 195 ? 64.746  0.618   -3.954  1.00 0.00 ? 195 PHE A HE1  2  
ATOM 7487  H HE2  . PHE A 1 195 ? 63.932  -1.440  -7.656  1.00 0.00 ? 195 PHE A HE2  2  
ATOM 7488  H HZ   . PHE A 1 195 ? 64.780  0.564   -6.444  1.00 0.00 ? 195 PHE A HZ   2  
ATOM 7489  N N    . SER A 1 196 ? 65.834  -3.304  -2.494  1.00 0.00 ? 196 SER A N    2  
ATOM 7490  C CA   . SER A 1 196 ? 66.725  -2.539  -1.619  1.00 0.00 ? 196 SER A CA   2  
ATOM 7491  C C    . SER A 1 196 ? 67.513  -1.516  -2.442  1.00 0.00 ? 196 SER A C    2  
ATOM 7492  O O    . SER A 1 196 ? 67.882  -1.776  -3.586  1.00 0.00 ? 196 SER A O    2  
ATOM 7493  C CB   . SER A 1 196 ? 67.672  -3.497  -0.880  1.00 0.00 ? 196 SER A CB   2  
ATOM 7494  O OG   . SER A 1 196 ? 68.024  -2.930  0.374   1.00 0.00 ? 196 SER A OG   2  
ATOM 7495  H H    . SER A 1 196 ? 66.131  -3.522  -3.401  1.00 0.00 ? 196 SER A H    2  
ATOM 7496  H HA   . SER A 1 196 ? 66.134  -2.005  -0.887  1.00 0.00 ? 196 SER A HA   2  
ATOM 7497  H HB2  . SER A 1 196 ? 67.171  -4.435  -0.712  1.00 0.00 ? 196 SER A HB2  2  
ATOM 7498  H HB3  . SER A 1 196 ? 68.560  -3.671  -1.472  1.00 0.00 ? 196 SER A HB3  2  
ATOM 7499  H HG   . SER A 1 196 ? 67.341  -2.300  0.618   1.00 0.00 ? 196 SER A HG   2  
ATOM 7500  N N    . VAL A 1 197 ? 67.758  -0.345  -1.849  1.00 0.00 ? 197 VAL A N    2  
ATOM 7501  C CA   . VAL A 1 197 ? 68.496  0.732   -2.524  1.00 0.00 ? 197 VAL A CA   2  
ATOM 7502  C C    . VAL A 1 197 ? 69.453  1.403   -1.541  1.00 0.00 ? 197 VAL A C    2  
ATOM 7503  O O    . VAL A 1 197 ? 69.350  1.190   -0.337  1.00 0.00 ? 197 VAL A O    2  
ATOM 7504  C CB   . VAL A 1 197 ? 67.510  1.779   -3.097  1.00 0.00 ? 197 VAL A CB   2  
ATOM 7505  C CG1  . VAL A 1 197 ? 66.514  2.194   -2.014  1.00 0.00 ? 197 VAL A CG1  2  
ATOM 7506  C CG2  . VAL A 1 197 ? 68.261  3.020   -3.605  1.00 0.00 ? 197 VAL A CG2  2  
ATOM 7507  H H    . VAL A 1 197 ? 67.431  -0.204  -0.936  1.00 0.00 ? 197 VAL A H    2  
ATOM 7508  H HA   . VAL A 1 197 ? 69.069  0.318   -3.337  1.00 0.00 ? 197 VAL A HA   2  
ATOM 7509  H HB   . VAL A 1 197 ? 66.970  1.332   -3.919  1.00 0.00 ? 197 VAL A HB   2  
ATOM 7510  H HG11 . VAL A 1 197 ? 67.040  2.683   -1.208  1.00 0.00 ? 197 VAL A HG11 2  
ATOM 7511  H HG12 . VAL A 1 197 ? 66.007  1.319   -1.635  1.00 0.00 ? 197 VAL A HG12 2  
ATOM 7512  H HG13 . VAL A 1 197 ? 65.789  2.873   -2.435  1.00 0.00 ? 197 VAL A HG13 2  
ATOM 7513  H HG21 . VAL A 1 197 ? 67.603  3.601   -4.234  1.00 0.00 ? 197 VAL A HG21 2  
ATOM 7514  H HG22 . VAL A 1 197 ? 69.121  2.711   -4.178  1.00 0.00 ? 197 VAL A HG22 2  
ATOM 7515  H HG23 . VAL A 1 197 ? 68.580  3.623   -2.768  1.00 0.00 ? 197 VAL A HG23 2  
ATOM 7516  N N    . ARG A 1 198 ? 70.386  2.208   -2.050  1.00 0.00 ? 198 ARG A N    2  
ATOM 7517  C CA   . ARG A 1 198 ? 71.338  2.885   -1.175  1.00 0.00 ? 198 ARG A CA   2  
ATOM 7518  C C    . ARG A 1 198 ? 72.140  3.947   -1.924  1.00 0.00 ? 198 ARG A C    2  
ATOM 7519  O O    . ARG A 1 198 ? 72.982  3.628   -2.763  1.00 0.00 ? 198 ARG A O    2  
ATOM 7520  C CB   . ARG A 1 198 ? 72.301  1.865   -0.557  1.00 0.00 ? 198 ARG A CB   2  
ATOM 7521  C CG   . ARG A 1 198 ? 73.297  2.586   0.362   1.00 0.00 ? 198 ARG A CG   2  
ATOM 7522  C CD   . ARG A 1 198 ? 74.087  1.567   1.184   1.00 0.00 ? 198 ARG A CD   2  
ATOM 7523  N NE   . ARG A 1 198 ? 75.305  2.237   1.747   1.00 0.00 ? 198 ARG A NE   2  
ATOM 7524  C CZ   . ARG A 1 198 ? 75.689  2.008   2.978   1.00 0.00 ? 198 ARG A CZ   2  
ATOM 7525  N NH1  . ARG A 1 198 ? 75.265  0.948   3.609   1.00 0.00 ? 198 ARG A NH1  2  
ATOM 7526  N NH2  . ARG A 1 198 ? 76.498  2.841   3.573   1.00 0.00 ? 198 ARG A NH2  2  
ATOM 7527  H H    . ARG A 1 198 ? 70.429  2.351   -3.016  1.00 0.00 ? 198 ARG A H    2  
ATOM 7528  H HA   . ARG A 1 198 ? 70.794  3.365   -0.379  1.00 0.00 ? 198 ARG A HA   2  
ATOM 7529  H HB2  . ARG A 1 198 ? 71.739  1.142   0.016   1.00 0.00 ? 198 ARG A HB2  2  
ATOM 7530  H HB3  . ARG A 1 198 ? 72.841  1.359   -1.343  1.00 0.00 ? 198 ARG A HB3  2  
ATOM 7531  H HG2  . ARG A 1 198 ? 73.983  3.169   -0.236  1.00 0.00 ? 198 ARG A HG2  2  
ATOM 7532  H HG3  . ARG A 1 198 ? 72.758  3.241   1.029   1.00 0.00 ? 198 ARG A HG3  2  
ATOM 7533  H HD2  . ARG A 1 198 ? 73.463  1.189   1.984   1.00 0.00 ? 198 ARG A HD2  2  
ATOM 7534  H HD3  . ARG A 1 198 ? 74.391  0.748   0.547   1.00 0.00 ? 198 ARG A HD3  2  
ATOM 7535  H HE   . ARG A 1 198 ? 75.820  2.854   1.187   1.00 0.00 ? 198 ARG A HE   2  
ATOM 7536  H HH11 . ARG A 1 198 ? 74.645  0.309   3.153   1.00 0.00 ? 198 ARG A HH11 2  
ATOM 7537  H HH12 . ARG A 1 198 ? 75.556  0.777   4.549   1.00 0.00 ? 198 ARG A HH12 2  
ATOM 7538  H HH21 . ARG A 1 198 ? 76.824  3.653   3.090   1.00 0.00 ? 198 ARG A HH21 2  
ATOM 7539  H HH22 . ARG A 1 198 ? 76.792  2.667   4.513   1.00 0.00 ? 198 ARG A HH22 2  
ATOM 7540  N N    . ILE A 1 199 ? 71.886  5.215   -1.592  1.00 0.00 ? 199 ILE A N    2  
ATOM 7541  C CA   . ILE A 1 199 ? 72.599  6.339   -2.206  1.00 0.00 ? 199 ILE A CA   2  
ATOM 7542  C C    . ILE A 1 199 ? 73.657  6.852   -1.234  1.00 0.00 ? 199 ILE A C    2  
ATOM 7543  O O    . ILE A 1 199 ? 73.340  7.223   -0.104  1.00 0.00 ? 199 ILE A O    2  
ATOM 7544  C CB   . ILE A 1 199 ? 71.632  7.499   -2.537  1.00 0.00 ? 199 ILE A CB   2  
ATOM 7545  C CG1  . ILE A 1 199 ? 70.402  6.942   -3.268  1.00 0.00 ? 199 ILE A CG1  2  
ATOM 7546  C CG2  . ILE A 1 199 ? 72.340  8.526   -3.432  1.00 0.00 ? 199 ILE A CG2  2  
ATOM 7547  C CD1  . ILE A 1 199 ? 69.409  8.073   -3.565  1.00 0.00 ? 199 ILE A CD1  2  
ATOM 7548  H H    . ILE A 1 199 ? 71.210  5.401   -0.904  1.00 0.00 ? 199 ILE A H    2  
ATOM 7549  H HA   . ILE A 1 199 ? 73.084  6.013   -3.118  1.00 0.00 ? 199 ILE A HA   2  
ATOM 7550  H HB   . ILE A 1 199 ? 71.318  7.978   -1.621  1.00 0.00 ? 199 ILE A HB   2  
ATOM 7551  H HG12 . ILE A 1 199 ? 70.715  6.487   -4.195  1.00 0.00 ? 199 ILE A HG12 2  
ATOM 7552  H HG13 . ILE A 1 199 ? 69.923  6.199   -2.648  1.00 0.00 ? 199 ILE A HG13 2  
ATOM 7553  H HG21 . ILE A 1 199 ? 73.321  8.738   -3.034  1.00 0.00 ? 199 ILE A HG21 2  
ATOM 7554  H HG22 . ILE A 1 199 ? 71.762  9.437   -3.460  1.00 0.00 ? 199 ILE A HG22 2  
ATOM 7555  H HG23 . ILE A 1 199 ? 72.437  8.130   -4.433  1.00 0.00 ? 199 ILE A HG23 2  
ATOM 7556  H HD11 . ILE A 1 199 ? 68.442  7.651   -3.795  1.00 0.00 ? 199 ILE A HD11 2  
ATOM 7557  H HD12 . ILE A 1 199 ? 69.758  8.647   -4.412  1.00 0.00 ? 199 ILE A HD12 2  
ATOM 7558  H HD13 . ILE A 1 199 ? 69.322  8.719   -2.703  1.00 0.00 ? 199 ILE A HD13 2  
ATOM 7559  N N    . GLY A 1 200 ? 74.915  6.868   -1.668  1.00 0.00 ? 200 GLY A N    2  
ATOM 7560  C CA   . GLY A 1 200 ? 75.992  7.335   -0.808  1.00 0.00 ? 200 GLY A CA   2  
ATOM 7561  C C    . GLY A 1 200 ? 77.252  7.660   -1.579  1.00 0.00 ? 200 GLY A C    2  
ATOM 7562  O O    . GLY A 1 200 ? 77.219  7.857   -2.793  1.00 0.00 ? 200 GLY A O    2  
ATOM 7563  H H    . GLY A 1 200 ? 75.119  6.559   -2.575  1.00 0.00 ? 200 GLY A H    2  
ATOM 7564  H HA2  . GLY A 1 200 ? 75.669  8.224   -0.291  1.00 0.00 ? 200 GLY A HA2  2  
ATOM 7565  H HA3  . GLY A 1 200 ? 76.215  6.568   -0.081  1.00 0.00 ? 200 GLY A HA3  2  
ATOM 7566  N N    . ASP A 1 201 ? 78.371  7.715   -0.862  1.00 0.00 ? 201 ASP A N    2  
ATOM 7567  C CA   . ASP A 1 201 ? 79.656  8.017   -1.480  1.00 0.00 ? 201 ASP A CA   2  
ATOM 7568  C C    . ASP A 1 201 ? 80.215  6.784   -2.178  1.00 0.00 ? 201 ASP A C    2  
ATOM 7569  O O    . ASP A 1 201 ? 80.149  5.674   -1.649  1.00 0.00 ? 201 ASP A O    2  
ATOM 7570  C CB   . ASP A 1 201 ? 80.643  8.488   -0.414  1.00 0.00 ? 201 ASP A CB   2  
ATOM 7571  C CG   . ASP A 1 201 ? 81.934  8.967   -1.083  1.00 0.00 ? 201 ASP A CG   2  
ATOM 7572  O OD1  . ASP A 1 201 ? 81.936  9.099   -2.296  1.00 0.00 ? 201 ASP A OD1  2  
ATOM 7573  O OD2  . ASP A 1 201 ? 82.898  9.194   -0.371  1.00 0.00 ? 201 ASP A OD2  2  
ATOM 7574  H H    . ASP A 1 201 ? 78.334  7.542   0.104   1.00 0.00 ? 201 ASP A H    2  
ATOM 7575  H HA   . ASP A 1 201 ? 79.526  8.806   -2.206  1.00 0.00 ? 201 ASP A HA   2  
ATOM 7576  H HB2  . ASP A 1 201 ? 80.206  9.300   0.149   1.00 0.00 ? 201 ASP A HB2  2  
ATOM 7577  H HB3  . ASP A 1 201 ? 80.866  7.669   0.251   1.00 0.00 ? 201 ASP A HB3  2  
ATOM 7578  N N    . MET A 1 202 ? 80.763  6.989   -3.371  1.00 0.00 ? 202 MET A N    2  
ATOM 7579  C CA   . MET A 1 202 ? 81.335  5.895   -4.156  1.00 0.00 ? 202 MET A CA   2  
ATOM 7580  C C    . MET A 1 202 ? 82.826  5.752   -3.856  1.00 0.00 ? 202 MET A C    2  
ATOM 7581  O O    . MET A 1 202 ? 83.476  4.817   -4.323  1.00 0.00 ? 202 MET A O    2  
ATOM 7582  C CB   . MET A 1 202 ? 81.134  6.182   -5.650  1.00 0.00 ? 202 MET A CB   2  
ATOM 7583  C CG   . MET A 1 202 ? 79.629  6.368   -5.971  1.00 0.00 ? 202 MET A CG   2  
ATOM 7584  S SD   . MET A 1 202 ? 79.427  7.584   -7.304  1.00 0.00 ? 202 MET A SD   2  
ATOM 7585  C CE   . MET A 1 202 ? 80.262  6.657   -8.612  1.00 0.00 ? 202 MET A CE   2  
ATOM 7586  H H    . MET A 1 202 ? 80.782  7.899   -3.737  1.00 0.00 ? 202 MET A H    2  
ATOM 7587  H HA   . MET A 1 202 ? 80.835  4.968   -3.908  1.00 0.00 ? 202 MET A HA   2  
ATOM 7588  H HB2  . MET A 1 202 ? 81.675  7.079   -5.909  1.00 0.00 ? 202 MET A HB2  2  
ATOM 7589  H HB3  . MET A 1 202 ? 81.526  5.355   -6.226  1.00 0.00 ? 202 MET A HB3  2  
ATOM 7590  H HG2  . MET A 1 202 ? 79.203  5.426   -6.283  1.00 0.00 ? 202 MET A HG2  2  
ATOM 7591  H HG3  . MET A 1 202 ? 79.100  6.720   -5.095  1.00 0.00 ? 202 MET A HG3  2  
ATOM 7592  H HE1  . MET A 1 202 ? 79.847  6.932   -9.569  1.00 0.00 ? 202 MET A HE1  2  
ATOM 7593  H HE2  . MET A 1 202 ? 80.122  5.597   -8.452  1.00 0.00 ? 202 MET A HE2  2  
ATOM 7594  H HE3  . MET A 1 202 ? 81.317  6.887   -8.598  1.00 0.00 ? 202 MET A HE3  2  
ATOM 7595  N N    . CYS A 1 203 ? 83.360  6.691   -3.071  1.00 0.00 ? 203 CYS A N    2  
ATOM 7596  C CA   . CYS A 1 203 ? 84.780  6.679   -2.700  1.00 0.00 ? 203 CYS A CA   2  
ATOM 7597  C C    . CYS A 1 203 ? 84.959  6.139   -1.284  1.00 0.00 ? 203 CYS A C    2  
ATOM 7598  O O    . CYS A 1 203 ? 85.671  5.159   -1.067  1.00 0.00 ? 203 CYS A O    2  
ATOM 7599  C CB   . CYS A 1 203 ? 85.344  8.099   -2.771  1.00 0.00 ? 203 CYS A CB   2  
ATOM 7600  S SG   . CYS A 1 203 ? 85.125  8.757   -4.442  1.00 0.00 ? 203 CYS A SG   2  
ATOM 7601  H H    . CYS A 1 203 ? 82.786  7.408   -2.730  1.00 0.00 ? 203 CYS A H    2  
ATOM 7602  H HA   . CYS A 1 203 ? 85.333  6.051   -3.387  1.00 0.00 ? 203 CYS A HA   2  
ATOM 7603  H HB2  . CYS A 1 203 ? 84.823  8.728   -2.065  1.00 0.00 ? 203 CYS A HB2  2  
ATOM 7604  H HB3  . CYS A 1 203 ? 86.397  8.080   -2.526  1.00 0.00 ? 203 CYS A HB3  2  
ATOM 7605  N N    . LYS A 1 204 ? 84.308  6.792   -0.322  1.00 0.00 ? 204 LYS A N    2  
ATOM 7606  C CA   . LYS A 1 204 ? 84.397  6.381   1.079   1.00 0.00 ? 204 LYS A CA   2  
ATOM 7607  C C    . LYS A 1 204 ? 83.161  6.845   1.844   1.00 0.00 ? 204 LYS A C    2  
ATOM 7608  O O    . LYS A 1 204 ? 82.711  7.979   1.686   1.00 0.00 ? 204 LYS A O    2  
ATOM 7609  C CB   . LYS A 1 204 ? 85.654  6.975   1.719   1.00 0.00 ? 204 LYS A CB   2  
ATOM 7610  C CG   . LYS A 1 204 ? 85.623  8.503   1.599   1.00 0.00 ? 204 LYS A CG   2  
ATOM 7611  C CD   . LYS A 1 204 ? 86.994  9.075   1.971   1.00 0.00 ? 204 LYS A CD   2  
ATOM 7612  C CE   . LYS A 1 204 ? 86.911  10.601  2.032   1.00 0.00 ? 204 LYS A CE   2  
ATOM 7613  N NZ   . LYS A 1 204 ? 86.049  11.007  3.178   1.00 0.00 ? 204 LYS A NZ   2  
ATOM 7614  H H    . LYS A 1 204 ? 83.758  7.568   -0.559  1.00 0.00 ? 204 LYS A H    2  
ATOM 7615  H HA   . LYS A 1 204 ? 84.454  5.302   1.133   1.00 0.00 ? 204 LYS A HA   2  
ATOM 7616  H HB2  . LYS A 1 204 ? 85.692  6.697   2.762   1.00 0.00 ? 204 LYS A HB2  2  
ATOM 7617  H HB3  . LYS A 1 204 ? 86.528  6.593   1.213   1.00 0.00 ? 204 LYS A HB3  2  
ATOM 7618  H HG2  . LYS A 1 204 ? 85.381  8.782   0.583   1.00 0.00 ? 204 LYS A HG2  2  
ATOM 7619  H HG3  . LYS A 1 204 ? 84.876  8.901   2.269   1.00 0.00 ? 204 LYS A HG3  2  
ATOM 7620  H HD2  . LYS A 1 204 ? 87.294  8.691   2.935   1.00 0.00 ? 204 LYS A HD2  2  
ATOM 7621  H HD3  . LYS A 1 204 ? 87.719  8.786   1.226   1.00 0.00 ? 204 LYS A HD3  2  
ATOM 7622  H HE2  . LYS A 1 204 ? 87.902  11.010  2.164   1.00 0.00 ? 204 LYS A HE2  2  
ATOM 7623  H HE3  . LYS A 1 204 ? 86.487  10.976  1.112   1.00 0.00 ? 204 LYS A HE3  2  
ATOM 7624  H HZ1  . LYS A 1 204 ? 85.053  11.003  2.882   1.00 0.00 ? 204 LYS A HZ1  2  
ATOM 7625  H HZ2  . LYS A 1 204 ? 86.316  11.963  3.491   1.00 0.00 ? 204 LYS A HZ2  2  
ATOM 7626  H HZ3  . LYS A 1 204 ? 86.178  10.337  3.963   1.00 0.00 ? 204 LYS A HZ3  2  
ATOM 7627  N N    . GLU A 1 205 ? 82.615  5.957   2.673   1.00 0.00 ? 205 GLU A N    2  
ATOM 7628  C CA   . GLU A 1 205 ? 81.420  6.274   3.458   1.00 0.00 ? 205 GLU A CA   2  
ATOM 7629  C C    . GLU A 1 205 ? 81.506  7.678   4.052   1.00 0.00 ? 205 GLU A C    2  
ATOM 7630  O O    . GLU A 1 205 ? 82.592  8.237   4.197   1.00 0.00 ? 205 GLU A O    2  
ATOM 7631  C CB   . GLU A 1 205 ? 81.261  5.255   4.588   1.00 0.00 ? 205 GLU A CB   2  
ATOM 7632  C CG   . GLU A 1 205 ? 82.543  5.222   5.426   1.00 0.00 ? 205 GLU A CG   2  
ATOM 7633  C CD   . GLU A 1 205 ? 82.420  4.148   6.507   1.00 0.00 ? 205 GLU A CD   2  
ATOM 7634  O OE1  . GLU A 1 205 ? 82.479  2.979   6.163   1.00 0.00 ? 205 GLU A OE1  2  
ATOM 7635  O OE2  . GLU A 1 205 ? 82.268  4.512   7.662   1.00 0.00 ? 205 GLU A OE2  2  
ATOM 7636  H H    . GLU A 1 205 ? 83.019  5.067   2.754   1.00 0.00 ? 205 GLU A H    2  
ATOM 7637  H HA   . GLU A 1 205 ? 80.555  6.217   2.815   1.00 0.00 ? 205 GLU A HA   2  
ATOM 7638  H HB2  . GLU A 1 205 ? 80.429  5.539   5.214   1.00 0.00 ? 205 GLU A HB2  2  
ATOM 7639  H HB3  . GLU A 1 205 ? 81.080  4.277   4.168   1.00 0.00 ? 205 GLU A HB3  2  
ATOM 7640  H HG2  . GLU A 1 205 ? 83.384  4.997   4.787   1.00 0.00 ? 205 GLU A HG2  2  
ATOM 7641  H HG3  . GLU A 1 205 ? 82.692  6.185   5.892   1.00 0.00 ? 205 GLU A HG3  2  
ATOM 7642  N N    . SER A 1 206 ? 80.345  8.244   4.390   1.00 0.00 ? 206 SER A N    2  
ATOM 7643  C CA   . SER A 1 206 ? 80.287  9.591   4.966   1.00 0.00 ? 206 SER A CA   2  
ATOM 7644  C C    . SER A 1 206 ? 79.129  9.705   5.957   1.00 0.00 ? 206 SER A C    2  
ATOM 7645  O O    . SER A 1 206 ? 78.845  10.788  6.466   1.00 0.00 ? 206 SER A O    2  
ATOM 7646  C CB   . SER A 1 206 ? 80.109  10.624  3.853   1.00 0.00 ? 206 SER A CB   2  
ATOM 7647  O OG   . SER A 1 206 ? 79.684  11.856  4.419   1.00 0.00 ? 206 SER A OG   2  
ATOM 7648  H H    . SER A 1 206 ? 79.511  7.750   4.248   1.00 0.00 ? 206 SER A H    2  
ATOM 7649  H HA   . SER A 1 206 ? 81.210  9.799   5.492   1.00 0.00 ? 206 SER A HA   2  
ATOM 7650  H HB2  . SER A 1 206 ? 81.047  10.773  3.343   1.00 0.00 ? 206 SER A HB2  2  
ATOM 7651  H HB3  . SER A 1 206 ? 79.372  10.266  3.148   1.00 0.00 ? 206 SER A HB3  2  
ATOM 7652  H HG   . SER A 1 206 ? 78.975  12.204  3.873   1.00 0.00 ? 206 SER A HG   2  
ATOM 7653  N N    . SER A 1 207 ? 78.477  8.580   6.232   1.00 0.00 ? 207 SER A N    2  
ATOM 7654  C CA   . SER A 1 207 ? 77.358  8.552   7.173   1.00 0.00 ? 207 SER A CA   2  
ATOM 7655  C C    . SER A 1 207 ? 76.235  9.496   6.742   1.00 0.00 ? 207 SER A C    2  
ATOM 7656  O O    . SER A 1 207 ? 75.194  9.055   6.256   1.00 0.00 ? 207 SER A O    2  
ATOM 7657  C CB   . SER A 1 207 ? 77.845  8.944   8.569   1.00 0.00 ? 207 SER A CB   2  
ATOM 7658  O OG   . SER A 1 207 ? 79.003  8.187   8.892   1.00 0.00 ? 207 SER A OG   2  
ATOM 7659  H H    . SER A 1 207 ? 78.758  7.746   5.800   1.00 0.00 ? 207 SER A H    2  
ATOM 7660  H HA   . SER A 1 207 ? 76.967  7.547   7.217   1.00 0.00 ? 207 SER A HA   2  
ATOM 7661  H HB2  . SER A 1 207 ? 78.091  9.993   8.586   1.00 0.00 ? 207 SER A HB2  2  
ATOM 7662  H HB3  . SER A 1 207 ? 77.062  8.749   9.290   1.00 0.00 ? 207 SER A HB3  2  
ATOM 7663  H HG   . SER A 1 207 ? 78.737  7.273   9.008   1.00 0.00 ? 207 SER A HG   2  
ATOM 7664  N N    . GLU A 1 208 ? 76.443  10.790  6.946   1.00 0.00 ? 208 GLU A N    2  
ATOM 7665  C CA   . GLU A 1 208 ? 75.437  11.788  6.596   1.00 0.00 ? 208 GLU A CA   2  
ATOM 7666  C C    . GLU A 1 208 ? 74.886  11.571  5.187   1.00 0.00 ? 208 GLU A C    2  
ATOM 7667  O O    . GLU A 1 208 ? 73.673  11.583  4.982   1.00 0.00 ? 208 GLU A O    2  
ATOM 7668  C CB   . GLU A 1 208 ? 76.045  13.189  6.693   1.00 0.00 ? 208 GLU A CB   2  
ATOM 7669  C CG   . GLU A 1 208 ? 76.545  13.429  8.120   1.00 0.00 ? 208 GLU A CG   2  
ATOM 7670  C CD   . GLU A 1 208 ? 77.001  14.882  8.265   1.00 0.00 ? 208 GLU A CD   2  
ATOM 7671  O OE1  . GLU A 1 208 ? 76.143  15.744  8.361   1.00 0.00 ? 208 GLU A OE1  2  
ATOM 7672  O OE2  . GLU A 1 208 ? 78.199  15.107  8.276   1.00 0.00 ? 208 GLU A OE2  2  
ATOM 7673  H H    . GLU A 1 208 ? 77.284  11.082  7.353   1.00 0.00 ? 208 GLU A H    2  
ATOM 7674  H HA   . GLU A 1 208 ? 74.622  11.719  7.300   1.00 0.00 ? 208 GLU A HA   2  
ATOM 7675  H HB2  . GLU A 1 208 ? 76.871  13.272  6.003   1.00 0.00 ? 208 GLU A HB2  2  
ATOM 7676  H HB3  . GLU A 1 208 ? 75.294  13.924  6.447   1.00 0.00 ? 208 GLU A HB3  2  
ATOM 7677  H HG2  . GLU A 1 208 ? 75.746  13.230  8.820   1.00 0.00 ? 208 GLU A HG2  2  
ATOM 7678  H HG3  . GLU A 1 208 ? 77.376  12.771  8.326   1.00 0.00 ? 208 GLU A HG3  2  
ATOM 7679  N N    . LEU A 1 209 ? 75.778  11.394  4.212   1.00 0.00 ? 209 LEU A N    2  
ATOM 7680  C CA   . LEU A 1 209 ? 75.358  11.202  2.820   1.00 0.00 ? 209 LEU A CA   2  
ATOM 7681  C C    . LEU A 1 209 ? 74.987  9.744   2.544   1.00 0.00 ? 209 LEU A C    2  
ATOM 7682  O O    . LEU A 1 209 ? 74.603  9.406   1.427   1.00 0.00 ? 209 LEU A O    2  
ATOM 7683  C CB   . LEU A 1 209 ? 76.492  11.639  1.871   1.00 0.00 ? 209 LEU A CB   2  
ATOM 7684  C CG   . LEU A 1 209 ? 76.504  13.167  1.719   1.00 0.00 ? 209 LEU A CG   2  
ATOM 7685  C CD1  . LEU A 1 209 ? 76.719  13.828  3.084   1.00 0.00 ? 209 LEU A CD1  2  
ATOM 7686  C CD2  . LEU A 1 209 ? 77.637  13.568  0.769   1.00 0.00 ? 209 LEU A CD2  2  
ATOM 7687  H H    . LEU A 1 209 ? 76.734  11.409  4.426   1.00 0.00 ? 209 LEU A H    2  
ATOM 7688  H HA   . LEU A 1 209 ? 74.487  11.817  2.627   1.00 0.00 ? 209 LEU A HA   2  
ATOM 7689  H HB2  . LEU A 1 209 ? 77.439  11.315  2.276   1.00 0.00 ? 209 LEU A HB2  2  
ATOM 7690  H HB3  . LEU A 1 209 ? 76.349  11.190  0.897   1.00 0.00 ? 209 LEU A HB3  2  
ATOM 7691  H HG   . LEU A 1 209 ? 75.559  13.491  1.309   1.00 0.00 ? 209 LEU A HG   2  
ATOM 7692  H HD11 . LEU A 1 209 ? 75.811  13.757  3.666   1.00 0.00 ? 209 LEU A HD11 2  
ATOM 7693  H HD12 . LEU A 1 209 ? 76.973  14.868  2.946   1.00 0.00 ? 209 LEU A HD12 2  
ATOM 7694  H HD13 . LEU A 1 209 ? 77.521  13.329  3.608   1.00 0.00 ? 209 LEU A HD13 2  
ATOM 7695  H HD21 . LEU A 1 209 ? 78.579  13.216  1.162   1.00 0.00 ? 209 LEU A HD21 2  
ATOM 7696  H HD22 . LEU A 1 209 ? 77.665  14.644  0.677   1.00 0.00 ? 209 LEU A HD22 2  
ATOM 7697  H HD23 . LEU A 1 209 ? 77.465  13.128  -0.203  1.00 0.00 ? 209 LEU A HD23 2  
ATOM 7698  N N    . GLU A 1 210 ? 75.081  8.883   3.558   1.00 0.00 ? 210 GLU A N    2  
ATOM 7699  C CA   . GLU A 1 210 ? 74.732  7.466   3.390   1.00 0.00 ? 210 GLU A CA   2  
ATOM 7700  C C    . GLU A 1 210 ? 73.292  7.231   3.838   1.00 0.00 ? 210 GLU A C    2  
ATOM 7701  O O    . GLU A 1 210 ? 72.950  7.452   5.001   1.00 0.00 ? 210 GLU A O    2  
ATOM 7702  C CB   . GLU A 1 210 ? 75.693  6.591   4.215   1.00 0.00 ? 210 GLU A CB   2  
ATOM 7703  C CG   . GLU A 1 210 ? 77.050  6.479   3.505   1.00 0.00 ? 210 GLU A CG   2  
ATOM 7704  C CD   . GLU A 1 210 ? 77.587  7.875   3.170   1.00 0.00 ? 210 GLU A CD   2  
ATOM 7705  O OE1  . GLU A 1 210 ? 77.476  8.748   4.014   1.00 0.00 ? 210 GLU A OE1  2  
ATOM 7706  O OE2  . GLU A 1 210 ? 78.098  8.045   2.076   1.00 0.00 ? 210 GLU A OE2  2  
ATOM 7707  H H    . GLU A 1 210 ? 75.366  9.200   4.440   1.00 0.00 ? 210 GLU A H    2  
ATOM 7708  H HA   . GLU A 1 210 ? 74.818  7.191   2.345   1.00 0.00 ? 210 GLU A HA   2  
ATOM 7709  H HB2  . GLU A 1 210 ? 75.835  7.033   5.189   1.00 0.00 ? 210 GLU A HB2  2  
ATOM 7710  H HB3  . GLU A 1 210 ? 75.273  5.601   4.330   1.00 0.00 ? 210 GLU A HB3  2  
ATOM 7711  H HG2  . GLU A 1 210 ? 77.751  5.970   4.149   1.00 0.00 ? 210 GLU A HG2  2  
ATOM 7712  H HG3  . GLU A 1 210 ? 76.931  5.915   2.591   1.00 0.00 ? 210 GLU A HG3  2  
ATOM 7713  N N    . VAL A 1 211 ? 72.448  6.794   2.901   1.00 0.00 ? 211 VAL A N    2  
ATOM 7714  C CA   . VAL A 1 211 ? 71.034  6.544   3.191   1.00 0.00 ? 211 VAL A CA   2  
ATOM 7715  C C    . VAL A 1 211 ? 70.529  5.362   2.362   1.00 0.00 ? 211 VAL A C    2  
ATOM 7716  O O    . VAL A 1 211 ? 71.172  4.968   1.390   1.00 0.00 ? 211 VAL A O    2  
ATOM 7717  C CB   . VAL A 1 211 ? 70.202  7.801   2.851   1.00 0.00 ? 211 VAL A CB   2  
ATOM 7718  C CG1  . VAL A 1 211 ? 68.821  7.719   3.502   1.00 0.00 ? 211 VAL A CG1  2  
ATOM 7719  C CG2  . VAL A 1 211 ? 70.933  9.044   3.370   1.00 0.00 ? 211 VAL A CG2  2  
ATOM 7720  H H    . VAL A 1 211 ? 72.781  6.646   1.990   1.00 0.00 ? 211 VAL A H    2  
ATOM 7721  H HA   . VAL A 1 211 ? 70.915  6.311   4.241   1.00 0.00 ? 211 VAL A HA   2  
ATOM 7722  H HB   . VAL A 1 211 ? 70.086  7.877   1.778   1.00 0.00 ? 211 VAL A HB   2  
ATOM 7723  H HG11 . VAL A 1 211 ? 68.927  7.518   4.557   1.00 0.00 ? 211 VAL A HG11 2  
ATOM 7724  H HG12 . VAL A 1 211 ? 68.249  6.930   3.038   1.00 0.00 ? 211 VAL A HG12 2  
ATOM 7725  H HG13 . VAL A 1 211 ? 68.314  8.659   3.365   1.00 0.00 ? 211 VAL A HG13 2  
ATOM 7726  H HG21 . VAL A 1 211 ? 70.303  9.913   3.246   1.00 0.00 ? 211 VAL A HG21 2  
ATOM 7727  H HG22 . VAL A 1 211 ? 71.847  9.183   2.813   1.00 0.00 ? 211 VAL A HG22 2  
ATOM 7728  H HG23 . VAL A 1 211 ? 71.164  8.915   4.417   1.00 0.00 ? 211 VAL A HG23 2  
ATOM 7729  N N    . LYS A 1 212 ? 69.384  4.792   2.744   1.00 0.00 ? 212 LYS A N    2  
ATOM 7730  C CA   . LYS A 1 212 ? 68.843  3.650   2.005   1.00 0.00 ? 212 LYS A CA   2  
ATOM 7731  C C    . LYS A 1 212 ? 67.377  3.388   2.341   1.00 0.00 ? 212 LYS A C    2  
ATOM 7732  O O    . LYS A 1 212 ? 66.831  3.928   3.297   1.00 0.00 ? 212 LYS A O    2  
ATOM 7733  C CB   . LYS A 1 212 ? 69.669  2.394   2.310   1.00 0.00 ? 212 LYS A CB   2  
ATOM 7734  C CG   . LYS A 1 212 ? 69.895  2.275   3.817   1.00 0.00 ? 212 LYS A CG   2  
ATOM 7735  C CD   . LYS A 1 212 ? 70.472  0.887   4.147   1.00 0.00 ? 212 LYS A CD   2  
ATOM 7736  C CE   . LYS A 1 212 ? 69.415  -0.222  3.949   1.00 0.00 ? 212 LYS A CE   2  
ATOM 7737  N NZ   . LYS A 1 212 ? 69.713  -1.351  4.874   1.00 0.00 ? 212 LYS A NZ   2  
ATOM 7738  H H    . LYS A 1 212 ? 68.905  5.135   3.527   1.00 0.00 ? 212 LYS A H    2  
ATOM 7739  H HA   . LYS A 1 212 ? 68.915  3.857   0.948   1.00 0.00 ? 212 LYS A HA   2  
ATOM 7740  H HB2  . LYS A 1 212 ? 69.143  1.521   1.957   1.00 0.00 ? 212 LYS A HB2  2  
ATOM 7741  H HB3  . LYS A 1 212 ? 70.626  2.462   1.811   1.00 0.00 ? 212 LYS A HB3  2  
ATOM 7742  H HG2  . LYS A 1 212 ? 70.593  3.037   4.133   1.00 0.00 ? 212 LYS A HG2  2  
ATOM 7743  H HG3  . LYS A 1 212 ? 68.958  2.413   4.337   1.00 0.00 ? 212 LYS A HG3  2  
ATOM 7744  H HD2  . LYS A 1 212 ? 71.319  0.695   3.505   1.00 0.00 ? 212 LYS A HD2  2  
ATOM 7745  H HD3  . LYS A 1 212 ? 70.801  0.880   5.172   1.00 0.00 ? 212 LYS A HD3  2  
ATOM 7746  H HE2  . LYS A 1 212 ? 68.426  0.158   4.163   1.00 0.00 ? 212 LYS A HE2  2  
ATOM 7747  H HE3  . LYS A 1 212 ? 69.447  -0.581  2.929   1.00 0.00 ? 212 LYS A HE3  2  
ATOM 7748  H HZ1  . LYS A 1 212 ? 69.564  -1.044  5.856   1.00 0.00 ? 212 LYS A HZ1  2  
ATOM 7749  H HZ2  . LYS A 1 212 ? 70.703  -1.649  4.748   1.00 0.00 ? 212 LYS A HZ2  2  
ATOM 7750  H HZ3  . LYS A 1 212 ? 69.081  -2.149  4.663   1.00 0.00 ? 212 LYS A HZ3  2  
ATOM 7751  N N    . ASP A 1 213 ? 66.759  2.532   1.528   1.00 0.00 ? 213 ASP A N    2  
ATOM 7752  C CA   . ASP A 1 213 ? 65.356  2.147   1.696   1.00 0.00 ? 213 ASP A CA   2  
ATOM 7753  C C    . ASP A 1 213 ? 65.210  0.662   1.375   1.00 0.00 ? 213 ASP A C    2  
ATOM 7754  O O    . ASP A 1 213 ? 66.151  0.038   0.885   1.00 0.00 ? 213 ASP A O    2  
ATOM 7755  C CB   . ASP A 1 213 ? 64.465  2.974   0.761   1.00 0.00 ? 213 ASP A CB   2  
ATOM 7756  C CG   . ASP A 1 213 ? 62.998  2.812   1.166   1.00 0.00 ? 213 ASP A CG   2  
ATOM 7757  O OD1  . ASP A 1 213 ? 62.431  1.776   0.862   1.00 0.00 ? 213 ASP A OD1  2  
ATOM 7758  O OD2  . ASP A 1 213 ? 62.467  3.727   1.773   1.00 0.00 ? 213 ASP A OD2  2  
ATOM 7759  H H    . ASP A 1 213 ? 67.266  2.141   0.789   1.00 0.00 ? 213 ASP A H    2  
ATOM 7760  H HA   . ASP A 1 213 ? 65.053  2.317   2.722   1.00 0.00 ? 213 ASP A HA   2  
ATOM 7761  H HB2  . ASP A 1 213 ? 64.745  4.014   0.829   1.00 0.00 ? 213 ASP A HB2  2  
ATOM 7762  H HB3  . ASP A 1 213 ? 64.594  2.635   -0.255  1.00 0.00 ? 213 ASP A HB3  2  
ATOM 7763  N N    . GLY A 1 214 ? 64.040  0.094   1.643   1.00 0.00 ? 214 GLY A N    2  
ATOM 7764  C CA   . GLY A 1 214 ? 63.832  -1.313  1.359   1.00 0.00 ? 214 GLY A CA   2  
ATOM 7765  C C    . GLY A 1 214 ? 62.507  -1.835  1.875   1.00 0.00 ? 214 GLY A C    2  
ATOM 7766  O O    . GLY A 1 214 ? 62.000  -1.386  2.903   1.00 0.00 ? 214 GLY A O    2  
ATOM 7767  H H    . GLY A 1 214 ? 63.313  0.631   2.023   1.00 0.00 ? 214 GLY A H    2  
ATOM 7768  H HA2  . GLY A 1 214 ? 63.868  -1.459  0.289   1.00 0.00 ? 214 GLY A HA2  2  
ATOM 7769  H HA3  . GLY A 1 214 ? 64.629  -1.881  1.816   1.00 0.00 ? 214 GLY A HA3  2  
ATOM 7770  N N    . PHE A 1 215 ? 61.954  -2.809  1.150   1.00 0.00 ? 215 PHE A N    2  
ATOM 7771  C CA   . PHE A 1 215 ? 60.680  -3.435  1.514   1.00 0.00 ? 215 PHE A CA   2  
ATOM 7772  C C    . PHE A 1 215 ? 60.781  -4.939  1.260   1.00 0.00 ? 215 PHE A C    2  
ATOM 7773  O O    . PHE A 1 215 ? 61.778  -5.420  0.722   1.00 0.00 ? 215 PHE A O    2  
ATOM 7774  C CB   . PHE A 1 215 ? 59.532  -2.824  0.673   1.00 0.00 ? 215 PHE A CB   2  
ATOM 7775  C CG   . PHE A 1 215 ? 58.912  -1.638  1.393   1.00 0.00 ? 215 PHE A CG   2  
ATOM 7776  C CD1  . PHE A 1 215 ? 59.600  -0.406  1.446   1.00 0.00 ? 215 PHE A CD1  2  
ATOM 7777  C CD2  . PHE A 1 215 ? 57.645  -1.762  2.006   1.00 0.00 ? 215 PHE A CD2  2  
ATOM 7778  C CE1  . PHE A 1 215 ? 59.025  0.699   2.112   1.00 0.00 ? 215 PHE A CE1  2  
ATOM 7779  C CE2  . PHE A 1 215 ? 57.069  -0.658  2.671   1.00 0.00 ? 215 PHE A CE2  2  
ATOM 7780  C CZ   . PHE A 1 215 ? 57.759  0.573   2.723   1.00 0.00 ? 215 PHE A CZ   2  
ATOM 7781  H H    . PHE A 1 215 ? 62.421  -3.121  0.347   1.00 0.00 ? 215 PHE A H    2  
ATOM 7782  H HA   . PHE A 1 215 ? 60.484  -3.278  2.568   1.00 0.00 ? 215 PHE A HA   2  
ATOM 7783  H HB2  . PHE A 1 215 ? 59.928  -2.492  -0.275  1.00 0.00 ? 215 PHE A HB2  2  
ATOM 7784  H HB3  . PHE A 1 215 ? 58.766  -3.570  0.492   1.00 0.00 ? 215 PHE A HB3  2  
ATOM 7785  H HD1  . PHE A 1 215 ? 60.567  -0.307  0.977   1.00 0.00 ? 215 PHE A HD1  2  
ATOM 7786  H HD2  . PHE A 1 215 ? 57.116  -2.703  1.968   1.00 0.00 ? 215 PHE A HD2  2  
ATOM 7787  H HE1  . PHE A 1 215 ? 59.553  1.639   2.152   1.00 0.00 ? 215 PHE A HE1  2  
ATOM 7788  H HE2  . PHE A 1 215 ? 56.101  -0.754  3.140   1.00 0.00 ? 215 PHE A HE2  2  
ATOM 7789  H HZ   . PHE A 1 215 ? 57.351  1.395   3.292   1.00 0.00 ? 215 PHE A HZ   2  
ATOM 7790  N N    . LYS A 1 216 ? 59.745  -5.680  1.651   1.00 0.00 ? 216 LYS A N    2  
ATOM 7791  C CA   . LYS A 1 216 ? 59.727  -7.134  1.464   1.00 0.00 ? 216 LYS A CA   2  
ATOM 7792  C C    . LYS A 1 216 ? 58.346  -7.600  1.015   1.00 0.00 ? 216 LYS A C    2  
ATOM 7793  O O    . LYS A 1 216 ? 57.416  -7.683  1.814   1.00 0.00 ? 216 LYS A O    2  
ATOM 7794  C CB   . LYS A 1 216 ? 60.101  -7.826  2.778   1.00 0.00 ? 216 LYS A CB   2  
ATOM 7795  C CG   . LYS A 1 216 ? 61.342  -7.156  3.372   1.00 0.00 ? 216 LYS A CG   2  
ATOM 7796  C CD   . LYS A 1 216 ? 61.764  -7.895  4.644   1.00 0.00 ? 216 LYS A CD   2  
ATOM 7797  C CE   . LYS A 1 216 ? 63.116  -7.362  5.121   1.00 0.00 ? 216 LYS A CE   2  
ATOM 7798  N NZ   . LYS A 1 216 ? 64.184  -7.803  4.179   1.00 0.00 ? 216 LYS A NZ   2  
ATOM 7799  H H    . LYS A 1 216 ? 58.978  -5.244  2.077   1.00 0.00 ? 216 LYS A H    2  
ATOM 7800  H HA   . LYS A 1 216 ? 60.449  -7.414  0.706   1.00 0.00 ? 216 LYS A HA   2  
ATOM 7801  H HB2  . LYS A 1 216 ? 59.279  -7.746  3.476   1.00 0.00 ? 216 LYS A HB2  2  
ATOM 7802  H HB3  . LYS A 1 216 ? 60.313  -8.868  2.588   1.00 0.00 ? 216 LYS A HB3  2  
ATOM 7803  H HG2  . LYS A 1 216 ? 62.147  -7.188  2.652   1.00 0.00 ? 216 LYS A HG2  2  
ATOM 7804  H HG3  . LYS A 1 216 ? 61.116  -6.129  3.615   1.00 0.00 ? 216 LYS A HG3  2  
ATOM 7805  H HD2  . LYS A 1 216 ? 61.022  -7.739  5.414   1.00 0.00 ? 216 LYS A HD2  2  
ATOM 7806  H HD3  . LYS A 1 216 ? 61.848  -8.951  4.436   1.00 0.00 ? 216 LYS A HD3  2  
ATOM 7807  H HE2  . LYS A 1 216 ? 63.088  -6.283  5.154   1.00 0.00 ? 216 LYS A HE2  2  
ATOM 7808  H HE3  . LYS A 1 216 ? 63.327  -7.747  6.109   1.00 0.00 ? 216 LYS A HE3  2  
ATOM 7809  H HZ1  . LYS A 1 216 ? 64.626  -8.673  4.538   1.00 0.00 ? 216 LYS A HZ1  2  
ATOM 7810  H HZ2  . LYS A 1 216 ? 64.903  -7.055  4.097   1.00 0.00 ? 216 LYS A HZ2  2  
ATOM 7811  H HZ3  . LYS A 1 216 ? 63.768  -7.988  3.245   1.00 0.00 ? 216 LYS A HZ3  2  
ATOM 7812  N N    . TYR A 1 217 ? 58.231  -7.915  -0.274  1.00 0.00 ? 217 TYR A N    2  
ATOM 7813  C CA   . TYR A 1 217 ? 56.972  -8.386  -0.855  1.00 0.00 ? 217 TYR A CA   2  
ATOM 7814  C C    . TYR A 1 217 ? 56.985  -9.907  -0.930  1.00 0.00 ? 217 TYR A C    2  
ATOM 7815  O O    . TYR A 1 217 ? 57.816  -10.489 -1.623  1.00 0.00 ? 217 TYR A O    2  
ATOM 7816  C CB   . TYR A 1 217 ? 56.822  -7.805  -2.263  1.00 0.00 ? 217 TYR A CB   2  
ATOM 7817  C CG   . TYR A 1 217 ? 55.446  -8.100  -2.817  1.00 0.00 ? 217 TYR A CG   2  
ATOM 7818  C CD1  . TYR A 1 217 ? 54.345  -7.305  -2.430  1.00 0.00 ? 217 TYR A CD1  2  
ATOM 7819  C CD2  . TYR A 1 217 ? 55.264  -9.158  -3.736  1.00 0.00 ? 217 TYR A CD2  2  
ATOM 7820  C CE1  . TYR A 1 217 ? 53.063  -7.570  -2.960  1.00 0.00 ? 217 TYR A CE1  2  
ATOM 7821  C CE2  . TYR A 1 217 ? 53.985  -9.418  -4.270  1.00 0.00 ? 217 TYR A CE2  2  
ATOM 7822  C CZ   . TYR A 1 217 ? 52.884  -8.627  -3.881  1.00 0.00 ? 217 TYR A CZ   2  
ATOM 7823  O OH   . TYR A 1 217 ? 51.648  -8.834  -4.459  1.00 0.00 ? 217 TYR A OH   2  
ATOM 7824  H H    . TYR A 1 217 ? 59.017  -7.834  -0.854  1.00 0.00 ? 217 TYR A H    2  
ATOM 7825  H HA   . TYR A 1 217 ? 56.137  -8.063  -0.246  1.00 0.00 ? 217 TYR A HA   2  
ATOM 7826  H HB2  . TYR A 1 217 ? 56.969  -6.735  -2.224  1.00 0.00 ? 217 TYR A HB2  2  
ATOM 7827  H HB3  . TYR A 1 217 ? 57.567  -8.243  -2.906  1.00 0.00 ? 217 TYR A HB3  2  
ATOM 7828  H HD1  . TYR A 1 217 ? 54.482  -6.498  -1.726  1.00 0.00 ? 217 TYR A HD1  2  
ATOM 7829  H HD2  . TYR A 1 217 ? 56.106  -9.766  -4.033  1.00 0.00 ? 217 TYR A HD2  2  
ATOM 7830  H HE1  . TYR A 1 217 ? 52.220  -6.965  -2.663  1.00 0.00 ? 217 TYR A HE1  2  
ATOM 7831  H HE2  . TYR A 1 217 ? 53.847  -10.228 -4.973  1.00 0.00 ? 217 TYR A HE2  2  
ATOM 7832  H HH   . TYR A 1 217 ? 51.599  -9.753  -4.733  1.00 0.00 ? 217 TYR A HH   2  
ATOM 7833  N N    . VAL A 1 218 ? 56.070  -10.553 -0.205  1.00 0.00 ? 218 VAL A N    2  
ATOM 7834  C CA   . VAL A 1 218 ? 56.002  -12.019 -0.193  1.00 0.00 ? 218 VAL A CA   2  
ATOM 7835  C C    . VAL A 1 218 ? 54.554  -12.498 -0.194  1.00 0.00 ? 218 VAL A C    2  
ATOM 7836  O O    . VAL A 1 218 ? 53.788  -12.221 0.725   1.00 0.00 ? 218 VAL A O    2  
ATOM 7837  C CB   . VAL A 1 218 ? 56.732  -12.589 1.046   1.00 0.00 ? 218 VAL A CB   2  
ATOM 7838  C CG1  . VAL A 1 218 ? 56.057  -12.101 2.342   1.00 0.00 ? 218 VAL A CG1  2  
ATOM 7839  C CG2  . VAL A 1 218 ? 56.713  -14.124 0.992   1.00 0.00 ? 218 VAL A CG2  2  
ATOM 7840  H H    . VAL A 1 218 ? 55.436  -10.039 0.336   1.00 0.00 ? 218 VAL A H    2  
ATOM 7841  H HA   . VAL A 1 218 ? 56.487  -12.407 -1.081  1.00 0.00 ? 218 VAL A HA   2  
ATOM 7842  H HB   . VAL A 1 218 ? 57.757  -12.247 1.035   1.00 0.00 ? 218 VAL A HB   2  
ATOM 7843  H HG11 . VAL A 1 218 ? 55.178  -12.693 2.550   1.00 0.00 ? 218 VAL A HG11 2  
ATOM 7844  H HG12 . VAL A 1 218 ? 55.774  -11.064 2.235   1.00 0.00 ? 218 VAL A HG12 2  
ATOM 7845  H HG13 . VAL A 1 218 ? 56.752  -12.196 3.166   1.00 0.00 ? 218 VAL A HG13 2  
ATOM 7846  H HG21 . VAL A 1 218 ? 57.110  -14.453 0.043   1.00 0.00 ? 218 VAL A HG21 2  
ATOM 7847  H HG22 . VAL A 1 218 ? 55.700  -14.481 1.102   1.00 0.00 ? 218 VAL A HG22 2  
ATOM 7848  H HG23 . VAL A 1 218 ? 57.322  -14.519 1.792   1.00 0.00 ? 218 VAL A HG23 2  
ATOM 7849  N N    . ASP A 1 219 ? 54.195  -13.236 -1.238  1.00 0.00 ? 219 ASP A N    2  
ATOM 7850  C CA   . ASP A 1 219 ? 52.845  -13.776 -1.365  1.00 0.00 ? 219 ASP A CA   2  
ATOM 7851  C C    . ASP A 1 219 ? 51.780  -12.708 -1.107  1.00 0.00 ? 219 ASP A C    2  
ATOM 7852  O O    . ASP A 1 219 ? 50.780  -12.974 -0.439  1.00 0.00 ? 219 ASP A O    2  
ATOM 7853  C CB   . ASP A 1 219 ? 52.658  -14.930 -0.377  1.00 0.00 ? 219 ASP A CB   2  
ATOM 7854  C CG   . ASP A 1 219 ? 51.366  -15.683 -0.701  1.00 0.00 ? 219 ASP A CG   2  
ATOM 7855  O OD1  . ASP A 1 219 ? 51.429  -16.617 -1.485  1.00 0.00 ? 219 ASP A OD1  2  
ATOM 7856  O OD2  . ASP A 1 219 ? 50.336  -15.315 -0.161  1.00 0.00 ? 219 ASP A OD2  2  
ATOM 7857  H H    . ASP A 1 219 ? 54.858  -13.433 -1.932  1.00 0.00 ? 219 ASP A H    2  
ATOM 7858  H HA   . ASP A 1 219 ? 52.719  -14.157 -2.367  1.00 0.00 ? 219 ASP A HA   2  
ATOM 7859  H HB2  . ASP A 1 219 ? 53.498  -15.606 -0.451  1.00 0.00 ? 219 ASP A HB2  2  
ATOM 7860  H HB3  . ASP A 1 219 ? 52.599  -14.537 0.627   1.00 0.00 ? 219 ASP A HB3  2  
ATOM 7861  N N    . GLY A 1 220 ? 51.980  -11.509 -1.653  1.00 0.00 ? 220 GLY A N    2  
ATOM 7862  C CA   . GLY A 1 220 ? 51.012  -10.427 -1.488  1.00 0.00 ? 220 GLY A CA   2  
ATOM 7863  C C    . GLY A 1 220 ? 51.189  -9.649  -0.196  1.00 0.00 ? 220 GLY A C    2  
ATOM 7864  O O    . GLY A 1 220 ? 50.483  -8.669  0.043   1.00 0.00 ? 220 GLY A O    2  
ATOM 7865  H H    . GLY A 1 220 ? 52.785  -11.354 -2.190  1.00 0.00 ? 220 GLY A H    2  
ATOM 7866  H HA2  . GLY A 1 220 ? 51.112  -9.745  -2.317  1.00 0.00 ? 220 GLY A HA2  2  
ATOM 7867  H HA3  . GLY A 1 220 ? 50.013  -10.842 -1.507  1.00 0.00 ? 220 GLY A HA3  2  
ATOM 7868  N N    . SER A 1 221 ? 52.124  -10.082 0.648   1.00 0.00 ? 221 SER A N    2  
ATOM 7869  C CA   . SER A 1 221 ? 52.373  -9.409  1.931   1.00 0.00 ? 221 SER A CA   2  
ATOM 7870  C C    . SER A 1 221 ? 53.594  -8.496  1.849   1.00 0.00 ? 221 SER A C    2  
ATOM 7871  O O    . SER A 1 221 ? 54.716  -8.958  1.642   1.00 0.00 ? 221 SER A O    2  
ATOM 7872  C CB   . SER A 1 221 ? 52.597  -10.453 3.026   1.00 0.00 ? 221 SER A CB   2  
ATOM 7873  O OG   . SER A 1 221 ? 52.803  -9.793  4.268   1.00 0.00 ? 221 SER A OG   2  
ATOM 7874  H H    . SER A 1 221 ? 52.652  -10.869 0.412   1.00 0.00 ? 221 SER A H    2  
ATOM 7875  H HA   . SER A 1 221 ? 51.512  -8.812  2.201   1.00 0.00 ? 221 SER A HA   2  
ATOM 7876  H HB2  . SER A 1 221 ? 51.733  -11.090 3.102   1.00 0.00 ? 221 SER A HB2  2  
ATOM 7877  H HB3  . SER A 1 221 ? 53.463  -11.053 2.778   1.00 0.00 ? 221 SER A HB3  2  
ATOM 7878  H HG   . SER A 1 221 ? 52.550  -10.395 4.970   1.00 0.00 ? 221 SER A HG   2  
ATOM 7879  N N    . ALA A 1 222 ? 53.366  -7.192  2.029   1.00 0.00 ? 222 ALA A N    2  
ATOM 7880  C CA   . ALA A 1 222 ? 54.445  -6.198  1.992   1.00 0.00 ? 222 ALA A CA   2  
ATOM 7881  C C    . ALA A 1 222 ? 54.806  -5.774  3.413   1.00 0.00 ? 222 ALA A C    2  
ATOM 7882  O O    . ALA A 1 222 ? 53.955  -5.790  4.302   1.00 0.00 ? 222 ALA A O    2  
ATOM 7883  C CB   . ALA A 1 222 ? 53.995  -4.984  1.194   1.00 0.00 ? 222 ALA A CB   2  
ATOM 7884  H H    . ALA A 1 222 ? 52.449  -6.892  2.200   1.00 0.00 ? 222 ALA A H    2  
ATOM 7885  H HA   . ALA A 1 222 ? 55.320  -6.622  1.518   1.00 0.00 ? 222 ALA A HA   2  
ATOM 7886  H HB1  . ALA A 1 222 ? 54.788  -4.251  1.176   1.00 0.00 ? 222 ALA A HB1  2  
ATOM 7887  H HB2  . ALA A 1 222 ? 53.118  -4.555  1.655   1.00 0.00 ? 222 ALA A HB2  2  
ATOM 7888  H HB3  . ALA A 1 222 ? 53.760  -5.284  0.184   1.00 0.00 ? 222 ALA A HB3  2  
ATOM 7889  N N    . SER A 1 223 ? 56.064  -5.394  3.628   1.00 0.00 ? 223 SER A N    2  
ATOM 7890  C CA   . SER A 1 223 ? 56.494  -4.973  4.959   1.00 0.00 ? 223 SER A CA   2  
ATOM 7891  C C    . SER A 1 223 ? 57.847  -4.271  4.912   1.00 0.00 ? 223 SER A C    2  
ATOM 7892  O O    . SER A 1 223 ? 58.816  -4.800  4.365   1.00 0.00 ? 223 SER A O    2  
ATOM 7893  C CB   . SER A 1 223 ? 56.587  -6.187  5.884   1.00 0.00 ? 223 SER A CB   2  
ATOM 7894  O OG   . SER A 1 223 ? 55.300  -6.774  6.021   1.00 0.00 ? 223 SER A OG   2  
ATOM 7895  H H    . SER A 1 223 ? 56.707  -5.397  2.888   1.00 0.00 ? 223 SER A H    2  
ATOM 7896  H HA   . SER A 1 223 ? 55.763  -4.288  5.363   1.00 0.00 ? 223 SER A HA   2  
ATOM 7897  H HB2  . SER A 1 223 ? 57.264  -6.912  5.464   1.00 0.00 ? 223 SER A HB2  2  
ATOM 7898  H HB3  . SER A 1 223 ? 56.956  -5.873  6.852   1.00 0.00 ? 223 SER A HB3  2  
ATOM 7899  H HG   . SER A 1 223 ? 54.678  -6.077  6.241   1.00 0.00 ? 223 SER A HG   2  
ATOM 7900  N N    . LYS A 1 224 ? 57.910  -3.083  5.510   1.00 0.00 ? 224 LYS A N    2  
ATOM 7901  C CA   . LYS A 1 224 ? 59.152  -2.320  5.555   1.00 0.00 ? 224 LYS A CA   2  
ATOM 7902  C C    . LYS A 1 224 ? 60.068  -2.904  6.622   1.00 0.00 ? 224 LYS A C    2  
ATOM 7903  O O    . LYS A 1 224 ? 59.606  -3.314  7.687   1.00 0.00 ? 224 LYS A O    2  
ATOM 7904  C CB   . LYS A 1 224 ? 58.862  -0.852  5.871   1.00 0.00 ? 224 LYS A CB   2  
ATOM 7905  C CG   . LYS A 1 224 ? 58.181  -0.739  7.238   1.00 0.00 ? 224 LYS A CG   2  
ATOM 7906  C CD   . LYS A 1 224 ? 57.712  0.700   7.456   1.00 0.00 ? 224 LYS A CD   2  
ATOM 7907  C CE   . LYS A 1 224 ? 56.906  0.786   8.754   1.00 0.00 ? 224 LYS A CE   2  
ATOM 7908  N NZ   . LYS A 1 224 ? 56.329  2.153   8.890   1.00 0.00 ? 224 LYS A NZ   2  
ATOM 7909  H H    . LYS A 1 224 ? 57.108  -2.720  5.943   1.00 0.00 ? 224 LYS A H    2  
ATOM 7910  H HA   . LYS A 1 224 ? 59.644  -2.382  4.595   1.00 0.00 ? 224 LYS A HA   2  
ATOM 7911  H HB2  . LYS A 1 224 ? 59.789  -0.297  5.884   1.00 0.00 ? 224 LYS A HB2  2  
ATOM 7912  H HB3  . LYS A 1 224 ? 58.210  -0.443  5.115   1.00 0.00 ? 224 LYS A HB3  2  
ATOM 7913  H HG2  . LYS A 1 224 ? 57.331  -1.406  7.273   1.00 0.00 ? 224 LYS A HG2  2  
ATOM 7914  H HG3  . LYS A 1 224 ? 58.882  -1.007  8.015   1.00 0.00 ? 224 LYS A HG3  2  
ATOM 7915  H HD2  . LYS A 1 224 ? 58.571  1.352   7.522   1.00 0.00 ? 224 LYS A HD2  2  
ATOM 7916  H HD3  . LYS A 1 224 ? 57.090  1.007   6.628   1.00 0.00 ? 224 LYS A HD3  2  
ATOM 7917  H HE2  . LYS A 1 224 ? 56.109  0.058   8.730   1.00 0.00 ? 224 LYS A HE2  2  
ATOM 7918  H HE3  . LYS A 1 224 ? 57.554  0.583   9.594   1.00 0.00 ? 224 LYS A HE3  2  
ATOM 7919  H HZ1  . LYS A 1 224 ? 55.577  2.141   9.607   1.00 0.00 ? 224 LYS A HZ1  2  
ATOM 7920  H HZ2  . LYS A 1 224 ? 55.934  2.455   7.976   1.00 0.00 ? 224 LYS A HZ2  2  
ATOM 7921  H HZ3  . LYS A 1 224 ? 57.073  2.817   9.182   1.00 0.00 ? 224 LYS A HZ3  2  
ATOM 7922  N N    . GLY A 1 225 ? 61.365  -2.945  6.339   1.00 0.00 ? 225 GLY A N    2  
ATOM 7923  C CA   . GLY A 1 225 ? 62.314  -3.488  7.292   1.00 0.00 ? 225 GLY A CA   2  
ATOM 7924  C C    . GLY A 1 225 ? 63.747  -3.201  6.901   1.00 0.00 ? 225 GLY A C    2  
ATOM 7925  O O    . GLY A 1 225 ? 64.311  -3.867  6.034   1.00 0.00 ? 225 GLY A O    2  
ATOM 7926  H H    . GLY A 1 225 ? 61.684  -2.606  5.476   1.00 0.00 ? 225 GLY A H    2  
ATOM 7927  H HA2  . GLY A 1 225 ? 62.123  -3.055  8.264   1.00 0.00 ? 225 GLY A HA2  2  
ATOM 7928  H HA3  . GLY A 1 225 ? 62.175  -4.558  7.353   1.00 0.00 ? 225 GLY A HA3  2  
ATOM 7929  N N    . ALA A 1 226 ? 64.341  -2.207  7.554   1.00 0.00 ? 226 ALA A N    2  
ATOM 7930  C CA   . ALA A 1 226 ? 65.722  -1.841  7.273   1.00 0.00 ? 226 ALA A CA   2  
ATOM 7931  C C    . ALA A 1 226 ? 66.670  -2.890  7.843   1.00 0.00 ? 226 ALA A C    2  
ATOM 7932  O O    . ALA A 1 226 ? 66.988  -2.870  9.032   1.00 0.00 ? 226 ALA A O    2  
ATOM 7933  C CB   . ALA A 1 226 ? 66.028  -0.481  7.878   1.00 0.00 ? 226 ALA A CB   2  
ATOM 7934  H H    . ALA A 1 226 ? 63.843  -1.715  8.239   1.00 0.00 ? 226 ALA A H    2  
ATOM 7935  H HA   . ALA A 1 226 ? 65.861  -1.787  6.202   1.00 0.00 ? 226 ALA A HA   2  
ATOM 7936  H HB1  . ALA A 1 226 ? 67.046  -0.204  7.647   1.00 0.00 ? 226 ALA A HB1  2  
ATOM 7937  H HB2  . ALA A 1 226 ? 65.901  -0.527  8.950   1.00 0.00 ? 226 ALA A HB2  2  
ATOM 7938  H HB3  . ALA A 1 226 ? 65.354  0.257   7.468   1.00 0.00 ? 226 ALA A HB3  2  
ATOM 7939  N N    . THR A 1 227 ? 67.119  -3.809  6.985   1.00 0.00 ? 227 THR A N    2  
ATOM 7940  C CA   . THR A 1 227 ? 68.036  -4.878  7.401   1.00 0.00 ? 227 THR A CA   2  
ATOM 7941  C C    . THR A 1 227 ? 69.239  -4.941  6.465   1.00 0.00 ? 227 THR A C    2  
ATOM 7942  O O    . THR A 1 227 ? 69.192  -4.442  5.341   1.00 0.00 ? 227 THR A O    2  
ATOM 7943  C CB   . THR A 1 227 ? 67.327  -6.245  7.374   1.00 0.00 ? 227 THR A CB   2  
ATOM 7944  O OG1  . THR A 1 227 ? 66.888  -6.524  6.053   1.00 0.00 ? 227 THR A OG1  2  
ATOM 7945  C CG2  . THR A 1 227 ? 66.124  -6.215  8.320   1.00 0.00 ? 227 THR A CG2  2  
ATOM 7946  H H    . THR A 1 227 ? 66.826  -3.770  6.050   1.00 0.00 ? 227 THR A H    2  
ATOM 7947  H HA   . THR A 1 227 ? 68.389  -4.691  8.407   1.00 0.00 ? 227 THR A HA   2  
ATOM 7948  H HB   . THR A 1 227 ? 68.014  -7.013  7.696   1.00 0.00 ? 227 THR A HB   2  
ATOM 7949  H HG1  . THR A 1 227 ? 66.201  -7.193  6.103   1.00 0.00 ? 227 THR A HG1  2  
ATOM 7950  H HG21 . THR A 1 227 ? 66.460  -5.992  9.321   1.00 0.00 ? 227 THR A HG21 2  
ATOM 7951  H HG22 . THR A 1 227 ? 65.634  -7.178  8.308   1.00 0.00 ? 227 THR A HG22 2  
ATOM 7952  H HG23 . THR A 1 227 ? 65.430  -5.454  7.994   1.00 0.00 ? 227 THR A HG23 2  
ATOM 7953  N N    . ASP A 1 228 ? 70.317  -5.557  6.941   1.00 0.00 ? 228 ASP A N    2  
ATOM 7954  C CA   . ASP A 1 228 ? 71.531  -5.678  6.141   1.00 0.00 ? 228 ASP A CA   2  
ATOM 7955  C C    . ASP A 1 228 ? 71.265  -6.515  4.893   1.00 0.00 ? 228 ASP A C    2  
ATOM 7956  O O    . ASP A 1 228 ? 71.317  -7.744  4.936   1.00 0.00 ? 228 ASP A O    2  
ATOM 7957  C CB   . ASP A 1 228 ? 72.640  -6.327  6.974   1.00 0.00 ? 228 ASP A CB   2  
ATOM 7958  C CG   . ASP A 1 228 ? 72.100  -7.589  7.649   1.00 0.00 ? 228 ASP A CG   2  
ATOM 7959  O OD1  . ASP A 1 228 ? 71.325  -7.454  8.581   1.00 0.00 ? 228 ASP A OD1  2  
ATOM 7960  O OD2  . ASP A 1 228 ? 72.469  -8.671  7.221   1.00 0.00 ? 228 ASP A OD2  2  
ATOM 7961  H H    . ASP A 1 228 ? 70.297  -5.934  7.845   1.00 0.00 ? 228 ASP A H    2  
ATOM 7962  H HA   . ASP A 1 228 ? 71.853  -4.692  5.840   1.00 0.00 ? 228 ASP A HA   2  
ATOM 7963  H HB2  . ASP A 1 228 ? 73.470  -6.587  6.332   1.00 0.00 ? 228 ASP A HB2  2  
ATOM 7964  H HB3  . ASP A 1 228 ? 72.974  -5.632  7.731   1.00 0.00 ? 228 ASP A HB3  2  
ATOM 7965  N N    . ASP A 1 229 ? 70.981  -5.837  3.782   1.00 0.00 ? 229 ASP A N    2  
ATOM 7966  C CA   . ASP A 1 229 ? 70.706  -6.518  2.517   1.00 0.00 ? 229 ASP A CA   2  
ATOM 7967  C C    . ASP A 1 229 ? 71.995  -6.723  1.726   1.00 0.00 ? 229 ASP A C    2  
ATOM 7968  O O    . ASP A 1 229 ? 72.001  -6.640  0.498   1.00 0.00 ? 229 ASP A O    2  
ATOM 7969  C CB   . ASP A 1 229 ? 69.728  -5.687  1.685   1.00 0.00 ? 229 ASP A CB   2  
ATOM 7970  C CG   . ASP A 1 229 ? 68.527  -5.296  2.549   1.00 0.00 ? 229 ASP A CG   2  
ATOM 7971  O OD1  . ASP A 1 229 ? 67.903  -6.188  3.099   1.00 0.00 ? 229 ASP A OD1  2  
ATOM 7972  O OD2  . ASP A 1 229 ? 68.253  -4.111  2.646   1.00 0.00 ? 229 ASP A OD2  2  
ATOM 7973  H H    . ASP A 1 229 ? 70.955  -4.858  3.813   1.00 0.00 ? 229 ASP A H    2  
ATOM 7974  H HA   . ASP A 1 229 ? 70.259  -7.482  2.716   1.00 0.00 ? 229 ASP A HA   2  
ATOM 7975  H HB2  . ASP A 1 229 ? 70.224  -4.794  1.333   1.00 0.00 ? 229 ASP A HB2  2  
ATOM 7976  H HB3  . ASP A 1 229 ? 69.387  -6.267  0.840   1.00 0.00 ? 229 ASP A HB3  2  
ATOM 7977  N N    . THR A 1 230 ? 73.085  -6.989  2.438   1.00 0.00 ? 230 THR A N    2  
ATOM 7978  C CA   . THR A 1 230 ? 74.375  -7.197  1.791   1.00 0.00 ? 230 THR A CA   2  
ATOM 7979  C C    . THR A 1 230 ? 74.402  -8.532  1.051   1.00 0.00 ? 230 THR A C    2  
ATOM 7980  O O    . THR A 1 230 ? 74.866  -8.611  -0.087  1.00 0.00 ? 230 THR A O    2  
ATOM 7981  C CB   . THR A 1 230 ? 75.515  -7.189  2.825   1.00 0.00 ? 230 THR A CB   2  
ATOM 7982  O OG1  . THR A 1 230 ? 75.232  -8.134  3.848   1.00 0.00 ? 230 THR A OG1  2  
ATOM 7983  C CG2  . THR A 1 230 ? 75.641  -5.793  3.437   1.00 0.00 ? 230 THR A CG2  2  
ATOM 7984  H H    . THR A 1 230 ? 73.021  -7.040  3.414   1.00 0.00 ? 230 THR A H    2  
ATOM 7985  H HA   . THR A 1 230 ? 74.545  -6.401  1.083   1.00 0.00 ? 230 THR A HA   2  
ATOM 7986  H HB   . THR A 1 230 ? 76.444  -7.450  2.341   1.00 0.00 ? 230 THR A HB   2  
ATOM 7987  H HG1  . THR A 1 230 ? 74.391  -7.897  4.245   1.00 0.00 ? 230 THR A HG1  2  
ATOM 7988  H HG21 . THR A 1 230 ? 75.947  -5.092  2.675   1.00 0.00 ? 230 THR A HG21 2  
ATOM 7989  H HG22 . THR A 1 230 ? 76.378  -5.812  4.227   1.00 0.00 ? 230 THR A HG22 2  
ATOM 7990  H HG23 . THR A 1 230 ? 74.687  -5.491  3.844   1.00 0.00 ? 230 THR A HG23 2  
ATOM 7991  N N    . SER A 1 231 ? 73.911  -9.583  1.708   1.00 0.00 ? 231 SER A N    2  
ATOM 7992  C CA   . SER A 1 231 ? 73.889  -10.923 1.112   1.00 0.00 ? 231 SER A CA   2  
ATOM 7993  C C    . SER A 1 231 ? 72.550  -11.206 0.435   1.00 0.00 ? 231 SER A C    2  
ATOM 7994  O O    . SER A 1 231 ? 72.355  -12.276 -0.141  1.00 0.00 ? 231 SER A O    2  
ATOM 7995  C CB   . SER A 1 231 ? 74.132  -11.970 2.200   1.00 0.00 ? 231 SER A CB   2  
ATOM 7996  O OG   . SER A 1 231 ? 74.074  -13.268 1.622   1.00 0.00 ? 231 SER A OG   2  
ATOM 7997  H H    . SER A 1 231 ? 73.561  -9.458  2.615   1.00 0.00 ? 231 SER A H    2  
ATOM 7998  H HA   . SER A 1 231 ? 74.677  -11.004 0.375   1.00 0.00 ? 231 SER A HA   2  
ATOM 7999  H HB2  . SER A 1 231 ? 75.107  -11.821 2.635   1.00 0.00 ? 231 SER A HB2  2  
ATOM 8000  H HB3  . SER A 1 231 ? 73.378  -11.871 2.969   1.00 0.00 ? 231 SER A HB3  2  
ATOM 8001  H HG   . SER A 1 231 ? 74.599  -13.859 2.166   1.00 0.00 ? 231 SER A HG   2  
ATOM 8002  N N    . LEU A 1 232 ? 71.624  -10.251 0.517   1.00 0.00 ? 232 LEU A N    2  
ATOM 8003  C CA   . LEU A 1 232 ? 70.298  -10.422 -0.086  1.00 0.00 ? 232 LEU A CA   2  
ATOM 8004  C C    . LEU A 1 232 ? 70.401  -11.066 -1.470  1.00 0.00 ? 232 LEU A C    2  
ATOM 8005  O O    . LEU A 1 232 ? 69.433  -11.638 -1.972  1.00 0.00 ? 232 LEU A O    2  
ATOM 8006  C CB   . LEU A 1 232 ? 69.600  -9.058  -0.186  1.00 0.00 ? 232 LEU A CB   2  
ATOM 8007  C CG   . LEU A 1 232 ? 68.195  -9.191  -0.804  1.00 0.00 ? 232 LEU A CG   2  
ATOM 8008  C CD1  . LEU A 1 232 ? 67.320  -10.150 0.029   1.00 0.00 ? 232 LEU A CD1  2  
ATOM 8009  C CD2  . LEU A 1 232 ? 67.545  -7.801  -0.839  1.00 0.00 ? 232 LEU A CD2  2  
ATOM 8010  H H    . LEU A 1 232 ? 71.828  -9.424  1.001   1.00 0.00 ? 232 LEU A H    2  
ATOM 8011  H HA   . LEU A 1 232 ? 69.719  -11.064 0.555   1.00 0.00 ? 232 LEU A HA   2  
ATOM 8012  H HB2  . LEU A 1 232 ? 69.510  -8.635  0.803   1.00 0.00 ? 232 LEU A HB2  2  
ATOM 8013  H HB3  . LEU A 1 232 ? 70.196  -8.398  -0.799  1.00 0.00 ? 232 LEU A HB3  2  
ATOM 8014  H HG   . LEU A 1 232 ? 68.278  -9.566  -1.813  1.00 0.00 ? 232 LEU A HG   2  
ATOM 8015  H HD11 . LEU A 1 232 ? 66.273  -9.947  -0.157  1.00 0.00 ? 232 LEU A HD11 2  
ATOM 8016  H HD12 . LEU A 1 232 ? 67.526  -10.014 1.081   1.00 0.00 ? 232 LEU A HD12 2  
ATOM 8017  H HD13 . LEU A 1 232 ? 67.535  -11.171 -0.251  1.00 0.00 ? 232 LEU A HD13 2  
ATOM 8018  H HD21 . LEU A 1 232 ? 67.336  -7.477  0.169   1.00 0.00 ? 232 LEU A HD21 2  
ATOM 8019  H HD22 . LEU A 1 232 ? 66.623  -7.850  -1.400  1.00 0.00 ? 232 LEU A HD22 2  
ATOM 8020  H HD23 . LEU A 1 232 ? 68.217  -7.101  -1.312  1.00 0.00 ? 232 LEU A HD23 2  
ATOM 8021  N N    . ILE A 1 233 ? 71.585  -10.978 -2.079  1.00 0.00 ? 233 ILE A N    2  
ATOM 8022  C CA   . ILE A 1 233 ? 71.814  -11.560 -3.403  1.00 0.00 ? 233 ILE A CA   2  
ATOM 8023  C C    . ILE A 1 233 ? 73.270  -12.005 -3.543  1.00 0.00 ? 233 ILE A C    2  
ATOM 8024  O O    . ILE A 1 233 ? 74.091  -11.769 -2.657  1.00 0.00 ? 233 ILE A O    2  
ATOM 8025  C CB   . ILE A 1 233 ? 71.484  -10.545 -4.529  1.00 0.00 ? 233 ILE A CB   2  
ATOM 8026  C CG1  . ILE A 1 233 ? 72.079  -9.162  -4.199  1.00 0.00 ? 233 ILE A CG1  2  
ATOM 8027  C CG2  . ILE A 1 233 ? 69.964  -10.409 -4.663  1.00 0.00 ? 233 ILE A CG2  2  
ATOM 8028  C CD1  . ILE A 1 233 ? 73.622  -9.197  -4.241  1.00 0.00 ? 233 ILE A CD1  2  
ATOM 8029  H H    . ILE A 1 233 ? 72.321  -10.515 -1.627  1.00 0.00 ? 233 ILE A H    2  
ATOM 8030  H HA   . ILE A 1 233 ? 71.183  -12.431 -3.523  1.00 0.00 ? 233 ILE A HA   2  
ATOM 8031  H HB   . ILE A 1 233 ? 71.887  -10.901 -5.467  1.00 0.00 ? 233 ILE A HB   2  
ATOM 8032  H HG12 . ILE A 1 233 ? 71.717  -8.445  -4.923  1.00 0.00 ? 233 ILE A HG12 2  
ATOM 8033  H HG13 . ILE A 1 233 ? 71.754  -8.859  -3.214  1.00 0.00 ? 233 ILE A HG13 2  
ATOM 8034  H HG21 . ILE A 1 233 ? 69.530  -11.378 -4.858  1.00 0.00 ? 233 ILE A HG21 2  
ATOM 8035  H HG22 . ILE A 1 233 ? 69.734  -9.741  -5.480  1.00 0.00 ? 233 ILE A HG22 2  
ATOM 8036  H HG23 . ILE A 1 233 ? 69.558  -10.009 -3.747  1.00 0.00 ? 233 ILE A HG23 2  
ATOM 8037  H HD11 . ILE A 1 233 ? 73.959  -9.899  -4.992  1.00 0.00 ? 233 ILE A HD11 2  
ATOM 8038  H HD12 . ILE A 1 233 ? 74.006  -9.492  -3.277  1.00 0.00 ? 233 ILE A HD12 2  
ATOM 8039  H HD13 . ILE A 1 233 ? 73.998  -8.211  -4.483  1.00 0.00 ? 233 ILE A HD13 2  
ATOM 8040  N N    . ASP A 1 234 ? 73.579  -12.654 -4.667  1.00 0.00 ? 234 ASP A N    2  
ATOM 8041  C CA   . ASP A 1 234 ? 74.938  -13.135 -4.937  1.00 0.00 ? 234 ASP A CA   2  
ATOM 8042  C C    . ASP A 1 234 ? 75.622  -12.224 -5.950  1.00 0.00 ? 234 ASP A C    2  
ATOM 8043  O O    . ASP A 1 234 ? 75.468  -12.399 -7.160  1.00 0.00 ? 234 ASP A O    2  
ATOM 8044  C CB   . ASP A 1 234 ? 74.881  -14.560 -5.492  1.00 0.00 ? 234 ASP A CB   2  
ATOM 8045  C CG   . ASP A 1 234 ? 74.294  -15.497 -4.435  1.00 0.00 ? 234 ASP A CG   2  
ATOM 8046  O OD1  . ASP A 1 234 ? 73.079  -15.600 -4.374  1.00 0.00 ? 234 ASP A OD1  2  
ATOM 8047  O OD2  . ASP A 1 234 ? 75.067  -16.095 -3.706  1.00 0.00 ? 234 ASP A OD2  2  
ATOM 8048  H H    . ASP A 1 234 ? 72.878  -12.811 -5.333  1.00 0.00 ? 234 ASP A H    2  
ATOM 8049  H HA   . ASP A 1 234 ? 75.517  -13.141 -4.022  1.00 0.00 ? 234 ASP A HA   2  
ATOM 8050  H HB2  . ASP A 1 234 ? 74.259  -14.577 -6.376  1.00 0.00 ? 234 ASP A HB2  2  
ATOM 8051  H HB3  . ASP A 1 234 ? 75.878  -14.888 -5.747  1.00 0.00 ? 234 ASP A HB3  2  
ATOM 8052  N N    . SER A 1 235 ? 76.366  -11.245 -5.452  1.00 0.00 ? 235 SER A N    2  
ATOM 8053  C CA   . SER A 1 235 ? 77.058  -10.302 -6.324  1.00 0.00 ? 235 SER A CA   2  
ATOM 8054  C C    . SER A 1 235 ? 78.149  -10.999 -7.133  1.00 0.00 ? 235 SER A C    2  
ATOM 8055  O O    . SER A 1 235 ? 78.774  -10.387 -7.999  1.00 0.00 ? 235 SER A O    2  
ATOM 8056  C CB   . SER A 1 235 ? 77.679  -9.182  -5.489  1.00 0.00 ? 235 SER A CB   2  
ATOM 8057  O OG   . SER A 1 235 ? 78.618  -9.739  -4.580  1.00 0.00 ? 235 SER A OG   2  
ATOM 8058  H H    . SER A 1 235 ? 76.445  -11.148 -4.479  1.00 0.00 ? 235 SER A H    2  
ATOM 8059  H HA   . SER A 1 235 ? 76.342  -9.871  -7.004  1.00 0.00 ? 235 SER A HA   2  
ATOM 8060  H HB2  . SER A 1 235 ? 78.184  -8.485  -6.137  1.00 0.00 ? 235 SER A HB2  2  
ATOM 8061  H HB3  . SER A 1 235 ? 76.898  -8.665  -4.946  1.00 0.00 ? 235 SER A HB3  2  
ATOM 8062  H HG   . SER A 1 235 ? 78.833  -10.624 -4.880  1.00 0.00 ? 235 SER A HG   2  
ATOM 8063  N N    . THR A 1 236 ? 78.385  -12.275 -6.840  1.00 0.00 ? 236 THR A N    2  
ATOM 8064  C CA   . THR A 1 236 ? 79.420  -13.044 -7.540  1.00 0.00 ? 236 THR A CA   2  
ATOM 8065  C C    . THR A 1 236 ? 78.863  -13.781 -8.762  1.00 0.00 ? 236 THR A C    2  
ATOM 8066  O O    . THR A 1 236 ? 79.629  -14.231 -9.614  1.00 0.00 ? 236 THR A O    2  
ATOM 8067  C CB   . THR A 1 236 ? 80.044  -14.088 -6.595  1.00 0.00 ? 236 THR A CB   2  
ATOM 8068  O OG1  . THR A 1 236 ? 79.021  -14.927 -6.078  1.00 0.00 ? 236 THR A OG1  2  
ATOM 8069  C CG2  . THR A 1 236 ? 80.752  -13.375 -5.443  1.00 0.00 ? 236 THR A CG2  2  
ATOM 8070  H H    . THR A 1 236 ? 77.866  -12.700 -6.125  1.00 0.00 ? 236 THR A H    2  
ATOM 8071  H HA   . THR A 1 236 ? 80.203  -12.374 -7.867  1.00 0.00 ? 236 THR A HA   2  
ATOM 8072  H HB   . THR A 1 236 ? 80.759  -14.684 -7.139  1.00 0.00 ? 236 THR A HB   2  
ATOM 8073  H HG1  . THR A 1 236 ? 79.409  -15.487 -5.403  1.00 0.00 ? 236 THR A HG1  2  
ATOM 8074  H HG21 . THR A 1 236 ? 81.434  -12.638 -5.840  1.00 0.00 ? 236 THR A HG21 2  
ATOM 8075  H HG22 . THR A 1 236 ? 81.305  -14.098 -4.859  1.00 0.00 ? 236 THR A HG22 2  
ATOM 8076  H HG23 . THR A 1 236 ? 80.021  -12.889 -4.815  1.00 0.00 ? 236 THR A HG23 2  
ATOM 8077  N N    . LYS A 1 237 ? 77.537  -13.936 -8.835  1.00 0.00 ? 237 LYS A N    2  
ATOM 8078  C CA   . LYS A 1 237 ? 76.906  -14.665 -9.954  1.00 0.00 ? 237 LYS A CA   2  
ATOM 8079  C C    . LYS A 1 237 ? 76.228  -13.725 -10.954 1.00 0.00 ? 237 LYS A C    2  
ATOM 8080  O O    . LYS A 1 237 ? 75.584  -14.186 -11.896 1.00 0.00 ? 237 LYS A O    2  
ATOM 8081  C CB   . LYS A 1 237 ? 75.858  -15.643 -9.405  1.00 0.00 ? 237 LYS A CB   2  
ATOM 8082  C CG   . LYS A 1 237 ? 76.490  -16.591 -8.366  1.00 0.00 ? 237 LYS A CG   2  
ATOM 8083  C CD   . LYS A 1 237 ? 77.304  -17.694 -9.061  1.00 0.00 ? 237 LYS A CD   2  
ATOM 8084  C CE   . LYS A 1 237 ? 77.702  -18.755 -8.033  1.00 0.00 ? 237 LYS A CE   2  
ATOM 8085  N NZ   . LYS A 1 237 ? 76.479  -19.441 -7.528  1.00 0.00 ? 237 LYS A NZ   2  
ATOM 8086  H H    . LYS A 1 237 ? 76.972  -13.581 -8.117  1.00 0.00 ? 237 LYS A H    2  
ATOM 8087  H HA   . LYS A 1 237 ? 77.655  -15.233 -10.483 1.00 0.00 ? 237 LYS A HA   2  
ATOM 8088  H HB2  . LYS A 1 237 ? 75.063  -15.080 -8.935  1.00 0.00 ? 237 LYS A HB2  2  
ATOM 8089  H HB3  . LYS A 1 237 ? 75.448  -16.221 -10.219 1.00 0.00 ? 237 LYS A HB3  2  
ATOM 8090  H HG2  . LYS A 1 237 ? 77.138  -16.029 -7.710  1.00 0.00 ? 237 LYS A HG2  2  
ATOM 8091  H HG3  . LYS A 1 237 ? 75.705  -17.048 -7.781  1.00 0.00 ? 237 LYS A HG3  2  
ATOM 8092  H HD2  . LYS A 1 237 ? 76.710  -18.152 -9.837  1.00 0.00 ? 237 LYS A HD2  2  
ATOM 8093  H HD3  . LYS A 1 237 ? 78.196  -17.270 -9.492  1.00 0.00 ? 237 LYS A HD3  2  
ATOM 8094  H HE2  . LYS A 1 237 ? 78.356  -19.479 -8.497  1.00 0.00 ? 237 LYS A HE2  2  
ATOM 8095  H HE3  . LYS A 1 237 ? 78.216  -18.284 -7.209  1.00 0.00 ? 237 LYS A HE3  2  
ATOM 8096  H HZ1  . LYS A 1 237 ? 76.536  -20.456 -7.746  1.00 0.00 ? 237 LYS A HZ1  2  
ATOM 8097  H HZ2  . LYS A 1 237 ? 75.639  -19.033 -7.987  1.00 0.00 ? 237 LYS A HZ2  2  
ATOM 8098  H HZ3  . LYS A 1 237 ? 76.410  -19.314 -6.499  1.00 0.00 ? 237 LYS A HZ3  2  
ATOM 8099  N N    . LEU A 1 238 ? 76.367  -12.417 -10.759 1.00 0.00 ? 238 LEU A N    2  
ATOM 8100  C CA   . LEU A 1 238 ? 75.747  -11.453 -11.676 1.00 0.00 ? 238 LEU A CA   2  
ATOM 8101  C C    . LEU A 1 238 ? 76.538  -11.358 -12.984 1.00 0.00 ? 238 LEU A C    2  
ATOM 8102  O O    . LEU A 1 238 ? 77.703  -11.747 -13.053 1.00 0.00 ? 238 LEU A O    2  
ATOM 8103  C CB   . LEU A 1 238 ? 75.636  -10.060 -11.012 1.00 0.00 ? 238 LEU A CB   2  
ATOM 8104  C CG   . LEU A 1 238 ? 76.821  -9.819  -10.067 1.00 0.00 ? 238 LEU A CG   2  
ATOM 8105  C CD1  . LEU A 1 238 ? 78.156  -10.019 -10.816 1.00 0.00 ? 238 LEU A CD1  2  
ATOM 8106  C CD2  . LEU A 1 238 ? 76.730  -8.390  -9.499  1.00 0.00 ? 238 LEU A CD2  2  
ATOM 8107  H H    . LEU A 1 238 ? 76.890  -12.098 -9.997  1.00 0.00 ? 238 LEU A H    2  
ATOM 8108  H HA   . LEU A 1 238 ? 74.749  -11.797 -11.913 1.00 0.00 ? 238 LEU A HA   2  
ATOM 8109  H HB2  . LEU A 1 238 ? 75.622  -9.290  -11.772 1.00 0.00 ? 238 LEU A HB2  2  
ATOM 8110  H HB3  . LEU A 1 238 ? 74.720  -10.006 -10.441 1.00 0.00 ? 238 LEU A HB3  2  
ATOM 8111  H HG   . LEU A 1 238 ? 76.759  -10.522 -9.257  1.00 0.00 ? 238 LEU A HG   2  
ATOM 8112  H HD11 . LEU A 1 238 ? 78.367  -11.073 -10.899 1.00 0.00 ? 238 LEU A HD11 2  
ATOM 8113  H HD12 . LEU A 1 238 ? 78.960  -9.544  -10.274 1.00 0.00 ? 238 LEU A HD12 2  
ATOM 8114  H HD13 . LEU A 1 238 ? 78.088  -9.589  -11.805 1.00 0.00 ? 238 LEU A HD13 2  
ATOM 8115  H HD21 . LEU A 1 238 ? 77.662  -8.120  -9.025  1.00 0.00 ? 238 LEU A HD21 2  
ATOM 8116  H HD22 . LEU A 1 238 ? 75.941  -8.351  -8.768  1.00 0.00 ? 238 LEU A HD22 2  
ATOM 8117  H HD23 . LEU A 1 238 ? 76.513  -7.691  -10.293 1.00 0.00 ? 238 LEU A HD23 2  
ATOM 8118  N N    . LYS A 1 239 ? 75.885  -10.834 -14.023 1.00 0.00 ? 239 LYS A N    2  
ATOM 8119  C CA   . LYS A 1 239 ? 76.516  -10.677 -15.338 1.00 0.00 ? 239 LYS A CA   2  
ATOM 8120  C C    . LYS A 1 239 ? 76.015  -9.401  -16.007 1.00 0.00 ? 239 LYS A C    2  
ATOM 8121  O O    . LYS A 1 239 ? 74.809  -9.177  -16.092 1.00 0.00 ? 239 LYS A O    2  
ATOM 8122  C CB   . LYS A 1 239 ? 76.187  -11.883 -16.236 1.00 0.00 ? 239 LYS A CB   2  
ATOM 8123  C CG   . LYS A 1 239 ? 76.854  -13.183 -15.696 1.00 0.00 ? 239 LYS A CG   2  
ATOM 8124  C CD   . LYS A 1 239 ? 75.872  -13.973 -14.796 1.00 0.00 ? 239 LYS A CD   2  
ATOM 8125  C CE   . LYS A 1 239 ? 74.968  -14.869 -15.654 1.00 0.00 ? 239 LYS A CE   2  
ATOM 8126  N NZ   . LYS A 1 239 ? 73.867  -15.416 -14.812 1.00 0.00 ? 239 LYS A NZ   2  
ATOM 8127  H H    . LYS A 1 239 ? 74.953  -10.544 -13.904 1.00 0.00 ? 239 LYS A H    2  
ATOM 8128  H HA   . LYS A 1 239 ? 77.587  -10.604 -15.218 1.00 0.00 ? 239 LYS A HA   2  
ATOM 8129  H HB2  . LYS A 1 239 ? 75.113  -12.008 -16.274 1.00 0.00 ? 239 LYS A HB2  2  
ATOM 8130  H HB3  . LYS A 1 239 ? 76.547  -11.684 -17.235 1.00 0.00 ? 239 LYS A HB3  2  
ATOM 8131  H HG2  . LYS A 1 239 ? 77.153  -13.806 -16.531 1.00 0.00 ? 239 LYS A HG2  2  
ATOM 8132  H HG3  . LYS A 1 239 ? 77.736  -12.932 -15.121 1.00 0.00 ? 239 LYS A HG3  2  
ATOM 8133  H HD2  . LYS A 1 239 ? 76.430  -14.591 -14.108 1.00 0.00 ? 239 LYS A HD2  2  
ATOM 8134  H HD3  . LYS A 1 239 ? 75.257  -13.283 -14.235 1.00 0.00 ? 239 LYS A HD3  2  
ATOM 8135  H HE2  . LYS A 1 239 ? 74.548  -14.292 -16.464 1.00 0.00 ? 239 LYS A HE2  2  
ATOM 8136  H HE3  . LYS A 1 239 ? 75.550  -15.683 -16.059 1.00 0.00 ? 239 LYS A HE3  2  
ATOM 8137  H HZ1  . LYS A 1 239 ? 73.958  -16.450 -14.753 1.00 0.00 ? 239 LYS A HZ1  2  
ATOM 8138  H HZ2  . LYS A 1 239 ? 72.951  -15.172 -15.239 1.00 0.00 ? 239 LYS A HZ2  2  
ATOM 8139  H HZ3  . LYS A 1 239 ? 73.926  -15.010 -13.858 1.00 0.00 ? 239 LYS A HZ3  2  
ATOM 8140  N N    . ALA A 1 240 ? 76.938  -8.569  -16.492 1.00 0.00 ? 240 ALA A N    2  
ATOM 8141  C CA   . ALA A 1 240 ? 76.544  -7.329  -17.154 1.00 0.00 ? 240 ALA A CA   2  
ATOM 8142  C C    . ALA A 1 240 ? 75.631  -7.661  -18.329 1.00 0.00 ? 240 ALA A C    2  
ATOM 8143  O O    . ALA A 1 240 ? 75.668  -8.777  -18.848 1.00 0.00 ? 240 ALA A O    2  
ATOM 8144  C CB   . ALA A 1 240 ? 77.787  -6.542  -17.609 1.00 0.00 ? 240 ALA A CB   2  
ATOM 8145  H H    . ALA A 1 240 ? 77.888  -8.796  -16.416 1.00 0.00 ? 240 ALA A H    2  
ATOM 8146  H HA   . ALA A 1 240 ? 75.988  -6.734  -16.449 1.00 0.00 ? 240 ALA A HA   2  
ATOM 8147  H HB1  . ALA A 1 240 ? 78.651  -6.911  -17.081 1.00 0.00 ? 240 ALA A HB1  2  
ATOM 8148  H HB2  . ALA A 1 240 ? 77.658  -5.490  -17.387 1.00 0.00 ? 240 ALA A HB2  2  
ATOM 8149  H HB3  . ALA A 1 240 ? 77.940  -6.661  -18.672 1.00 0.00 ? 240 ALA A HB3  2  
ATOM 8150  N N    . CYS A 1 241 ? 74.795  -6.699  -18.730 1.00 0.00 ? 241 CYS A N    2  
ATOM 8151  C CA   . CYS A 1 241 ? 73.851  -6.914  -19.834 1.00 0.00 ? 241 CYS A CA   2  
ATOM 8152  C C    . CYS A 1 241 ? 74.098  -5.951  -20.990 1.00 0.00 ? 241 CYS A C    2  
ATOM 8153  O O    . CYS A 1 241 ? 73.445  -6.043  -22.029 1.00 0.00 ? 241 CYS A O    2  
ATOM 8154  C CB   . CYS A 1 241 ? 72.425  -6.735  -19.309 1.00 0.00 ? 241 CYS A CB   2  
ATOM 8155  S SG   . CYS A 1 241 ? 71.224  -7.278  -20.551 1.00 0.00 ? 241 CYS A SG   2  
ATOM 8156  H H    . CYS A 1 241 ? 74.799  -5.836  -18.263 1.00 0.00 ? 241 CYS A H    2  
ATOM 8157  H HA   . CYS A 1 241 ? 73.958  -7.917  -20.205 1.00 0.00 ? 241 CYS A HA   2  
ATOM 8158  H HB2  . CYS A 1 241 ? 72.304  -7.321  -18.412 1.00 0.00 ? 241 CYS A HB2  2  
ATOM 8159  H HB3  . CYS A 1 241 ? 72.257  -5.694  -19.080 1.00 0.00 ? 241 CYS A HB3  2  
ATOM 8160  N N    . VAL A 1 242 ? 75.040  -5.035  -20.813 1.00 0.00 ? 242 VAL A N    2  
ATOM 8161  C CA   . VAL A 1 242 ? 75.354  -4.072  -21.864 1.00 0.00 ? 242 VAL A CA   2  
ATOM 8162  C C    . VAL A 1 242 ? 74.081  -3.405  -22.380 1.00 0.00 ? 242 VAL A C    2  
ATOM 8163  O O    . VAL A 1 242 ? 73.471  -3.956  -23.280 1.00 0.00 ? 242 VAL A O    2  
ATOM 8164  C CB   . VAL A 1 242 ? 76.058  -4.762  -23.046 1.00 0.00 ? 242 VAL A CB   2  
ATOM 8165  C CG1  . VAL A 1 242 ? 76.537  -3.706  -24.043 1.00 0.00 ? 242 VAL A CG1  2  
ATOM 8166  C CG2  . VAL A 1 242 ? 77.259  -5.556  -22.530 1.00 0.00 ? 242 VAL A CG2  2  
ATOM 8167  O OXT  . VAL A 1 242 ? 73.699  -2.392  -21.818 1.00 0.00 ? 242 VAL A OXT  2  
ATOM 8168  H H    . VAL A 1 242 ? 75.532  -5.006  -19.965 1.00 0.00 ? 242 VAL A H    2  
ATOM 8169  H HA   . VAL A 1 242 ? 76.010  -3.315  -21.462 1.00 0.00 ? 242 VAL A HA   2  
ATOM 8170  H HB   . VAL A 1 242 ? 75.365  -5.431  -23.537 1.00 0.00 ? 242 VAL A HB   2  
ATOM 8171  H HG11 . VAL A 1 242 ? 77.130  -4.178  -24.811 1.00 0.00 ? 242 VAL A HG11 2  
ATOM 8172  H HG12 . VAL A 1 242 ? 77.136  -2.970  -23.527 1.00 0.00 ? 242 VAL A HG12 2  
ATOM 8173  H HG13 . VAL A 1 242 ? 75.682  -3.223  -24.494 1.00 0.00 ? 242 VAL A HG13 2  
ATOM 8174  H HG21 . VAL A 1 242 ? 77.969  -4.881  -22.074 1.00 0.00 ? 242 VAL A HG21 2  
ATOM 8175  H HG22 . VAL A 1 242 ? 77.731  -6.072  -23.353 1.00 0.00 ? 242 VAL A HG22 2  
ATOM 8176  H HG23 . VAL A 1 242 ? 76.927  -6.277  -21.798 1.00 0.00 ? 242 VAL A HG23 2  
ATOM 8177  N N    . ALA B 2 1   ? 31.535  -16.121 -23.547 1.00 0.00 ? 1   ALA B N    2  
ATOM 8178  C CA   . ALA B 2 1   ? 32.393  -15.077 -22.997 1.00 0.00 ? 1   ALA B CA   2  
ATOM 8179  C C    . ALA B 2 1   ? 32.492  -15.206 -21.480 1.00 0.00 ? 1   ALA B C    2  
ATOM 8180  O O    . ALA B 2 1   ? 32.172  -14.270 -20.747 1.00 0.00 ? 1   ALA B O    2  
ATOM 8181  C CB   . ALA B 2 1   ? 31.836  -13.709 -23.364 1.00 0.00 ? 1   ALA B CB   2  
ATOM 8182  H H1   . ALA B 2 1   ? 30.931  -15.719 -24.291 1.00 0.00 ? 1   ALA B H1   2  
ATOM 8183  H H2   . ALA B 2 1   ? 30.938  -16.512 -22.788 1.00 0.00 ? 1   ALA B H2   2  
ATOM 8184  H H3   . ALA B 2 1   ? 32.122  -16.876 -23.951 1.00 0.00 ? 1   ALA B H3   2  
ATOM 8185  H HA   . ALA B 2 1   ? 33.380  -15.177 -23.422 1.00 0.00 ? 1   ALA B HA   2  
ATOM 8186  H HB1  . ALA B 2 1   ? 31.911  -13.565 -24.431 1.00 0.00 ? 1   ALA B HB1  2  
ATOM 8187  H HB2  . ALA B 2 1   ? 32.403  -12.943 -22.857 1.00 0.00 ? 1   ALA B HB2  2  
ATOM 8188  H HB3  . ALA B 2 1   ? 30.801  -13.650 -23.064 1.00 0.00 ? 1   ALA B HB3  2  
ATOM 8189  N N    . PRO B 2 2   ? 32.939  -16.373 -20.989 1.00 0.00 ? 2   PRO B N    2  
ATOM 8190  C CA   . PRO B 2 2   ? 33.083  -16.623 -19.546 1.00 0.00 ? 2   PRO B CA   2  
ATOM 8191  C C    . PRO B 2 2   ? 34.281  -15.874 -18.961 1.00 0.00 ? 2   PRO B C    2  
ATOM 8192  O O    . PRO B 2 2   ? 35.428  -16.143 -19.321 1.00 0.00 ? 2   PRO B O    2  
ATOM 8193  C CB   . PRO B 2 2   ? 33.272  -18.148 -19.464 1.00 0.00 ? 2   PRO B CB   2  
ATOM 8194  C CG   . PRO B 2 2   ? 33.932  -18.504 -20.758 1.00 0.00 ? 2   PRO B CG   2  
ATOM 8195  C CD   . PRO B 2 2   ? 33.344  -17.541 -21.795 1.00 0.00 ? 2   PRO B CD   2  
ATOM 8196  H HA   . PRO B 2 2   ? 32.181  -16.341 -19.026 1.00 0.00 ? 2   PRO B HA   2  
ATOM 8197  H HB2  . PRO B 2 2   ? 33.900  -18.415 -18.620 1.00 0.00 ? 2   PRO B HB2  2  
ATOM 8198  H HB3  . PRO B 2 2   ? 32.313  -18.644 -19.389 1.00 0.00 ? 2   PRO B HB3  2  
ATOM 8199  H HG2  . PRO B 2 2   ? 35.006  -18.367 -20.678 1.00 0.00 ? 2   PRO B HG2  2  
ATOM 8200  H HG3  . PRO B 2 2   ? 33.708  -19.525 -21.032 1.00 0.00 ? 2   PRO B HG3  2  
ATOM 8201  H HD2  . PRO B 2 2   ? 34.091  -17.261 -22.527 1.00 0.00 ? 2   PRO B HD2  2  
ATOM 8202  H HD3  . PRO B 2 2   ? 32.481  -17.975 -22.277 1.00 0.00 ? 2   PRO B HD3  2  
ATOM 8203  N N    . MET B 2 3   ? 34.006  -14.934 -18.063 1.00 0.00 ? 3   MET B N    2  
ATOM 8204  C CA   . MET B 2 3   ? 35.071  -14.154 -17.444 1.00 0.00 ? 3   MET B CA   2  
ATOM 8205  C C    . MET B 2 3   ? 35.955  -15.051 -16.581 1.00 0.00 ? 3   MET B C    2  
ATOM 8206  O O    . MET B 2 3   ? 35.476  -16.003 -15.966 1.00 0.00 ? 3   MET B O    2  
ATOM 8207  C CB   . MET B 2 3   ? 34.468  -13.035 -16.585 1.00 0.00 ? 3   MET B CB   2  
ATOM 8208  C CG   . MET B 2 3   ? 35.549  -12.007 -16.237 1.00 0.00 ? 3   MET B CG   2  
ATOM 8209  S SD   . MET B 2 3   ? 35.971  -11.052 -17.716 1.00 0.00 ? 3   MET B SD   2  
ATOM 8210  C CE   . MET B 2 3   ? 36.642  -9.600  -16.870 1.00 0.00 ? 3   MET B CE   2  
ATOM 8211  H H    . MET B 2 3   ? 33.074  -14.761 -17.816 1.00 0.00 ? 3   MET B H    2  
ATOM 8212  H HA   . MET B 2 3   ? 35.675  -13.713 -18.222 1.00 0.00 ? 3   MET B HA   2  
ATOM 8213  H HB2  . MET B 2 3   ? 33.676  -12.549 -17.136 1.00 0.00 ? 3   MET B HB2  2  
ATOM 8214  H HB3  . MET B 2 3   ? 34.066  -13.454 -15.675 1.00 0.00 ? 3   MET B HB3  2  
ATOM 8215  H HG2  . MET B 2 3   ? 35.179  -11.340 -15.472 1.00 0.00 ? 3   MET B HG2  2  
ATOM 8216  H HG3  . MET B 2 3   ? 36.430  -12.517 -15.875 1.00 0.00 ? 3   MET B HG3  2  
ATOM 8217  H HE1  . MET B 2 3   ? 35.898  -9.195  -16.201 1.00 0.00 ? 3   MET B HE1  2  
ATOM 8218  H HE2  . MET B 2 3   ? 36.915  -8.852  -17.600 1.00 0.00 ? 3   MET B HE2  2  
ATOM 8219  H HE3  . MET B 2 3   ? 37.517  -9.886  -16.304 1.00 0.00 ? 3   MET B HE3  2  
ATOM 8220  N N    . GLY B 2 4   ? 37.246  -14.741 -16.546 1.00 0.00 ? 4   GLY B N    2  
ATOM 8221  C CA   . GLY B 2 4   ? 38.184  -15.523 -15.762 1.00 0.00 ? 4   GLY B CA   2  
ATOM 8222  C C    . GLY B 2 4   ? 37.706  -15.721 -14.338 1.00 0.00 ? 4   GLY B C    2  
ATOM 8223  O O    . GLY B 2 4   ? 36.609  -15.294 -13.976 1.00 0.00 ? 4   GLY B O    2  
ATOM 8224  H H    . GLY B 2 4   ? 37.571  -13.972 -17.060 1.00 0.00 ? 4   GLY B H    2  
ATOM 8225  H HA2  . GLY B 2 4   ? 38.310  -16.489 -16.229 1.00 0.00 ? 4   GLY B HA2  2  
ATOM 8226  H HA3  . GLY B 2 4   ? 39.137  -15.013 -15.745 1.00 0.00 ? 4   GLY B HA3  2  
ATOM 8227  N N    . SER B 2 5   ? 38.538  -16.373 -13.525 1.00 0.00 ? 5   SER B N    2  
ATOM 8228  C CA   . SER B 2 5   ? 38.205  -16.634 -12.120 1.00 0.00 ? 5   SER B CA   2  
ATOM 8229  C C    . SER B 2 5   ? 39.357  -16.209 -11.217 1.00 0.00 ? 5   SER B C    2  
ATOM 8230  O O    . SER B 2 5   ? 40.495  -16.644 -11.401 1.00 0.00 ? 5   SER B O    2  
ATOM 8231  C CB   . SER B 2 5   ? 37.927  -18.124 -11.922 1.00 0.00 ? 5   SER B CB   2  
ATOM 8232  O OG   . SER B 2 5   ? 37.719  -18.383 -10.540 1.00 0.00 ? 5   SER B OG   2  
ATOM 8233  H H    . SER B 2 5   ? 39.398  -16.685 -13.875 1.00 0.00 ? 5   SER B H    2  
ATOM 8234  H HA   . SER B 2 5   ? 37.321  -16.074 -11.839 1.00 0.00 ? 5   SER B HA   2  
ATOM 8235  H HB2  . SER B 2 5   ? 37.046  -18.404 -12.472 1.00 0.00 ? 5   SER B HB2  2  
ATOM 8236  H HB3  . SER B 2 5   ? 38.771  -18.697 -12.283 1.00 0.00 ? 5   SER B HB3  2  
ATOM 8237  H HG   . SER B 2 5   ? 37.530  -17.547 -10.106 1.00 0.00 ? 5   SER B HG   2  
ATOM 8238  N N    . ASP B 2 6   ? 39.057  -15.367 -10.239 1.00 0.00 ? 6   ASP B N    2  
ATOM 8239  C CA   . ASP B 2 6   ? 40.070  -14.894 -9.301  1.00 0.00 ? 6   ASP B CA   2  
ATOM 8240  C C    . ASP B 2 6   ? 41.322  -14.409 -10.028 1.00 0.00 ? 6   ASP B C    2  
ATOM 8241  O O    . ASP B 2 6   ? 42.354  -15.080 -10.019 1.00 0.00 ? 6   ASP B O    2  
ATOM 8242  C CB   . ASP B 2 6   ? 40.448  -16.018 -8.335  1.00 0.00 ? 6   ASP B CB   2  
ATOM 8243  C CG   . ASP B 2 6   ? 41.342  -15.458 -7.227  1.00 0.00 ? 6   ASP B CG   2  
ATOM 8244  O OD1  . ASP B 2 6   ? 42.507  -15.215 -7.498  1.00 0.00 ? 6   ASP B OD1  2  
ATOM 8245  O OD2  . ASP B 2 6   ? 40.848  -15.282 -6.125  1.00 0.00 ? 6   ASP B OD2  2  
ATOM 8246  H H    . ASP B 2 6   ? 38.131  -15.061 -10.132 1.00 0.00 ? 6   ASP B H    2  
ATOM 8247  H HA   . ASP B 2 6   ? 39.660  -14.076 -8.730  1.00 0.00 ? 6   ASP B HA   2  
ATOM 8248  H HB2  . ASP B 2 6   ? 39.551  -16.435 -7.898  1.00 0.00 ? 6   ASP B HB2  2  
ATOM 8249  H HB3  . ASP B 2 6   ? 40.982  -16.789 -8.869  1.00 0.00 ? 6   ASP B HB3  2  
ATOM 8250  N N    . PRO B 2 7   ? 41.253  -13.223 -10.654 1.00 0.00 ? 7   PRO B N    2  
ATOM 8251  C CA   . PRO B 2 7   ? 42.387  -12.636 -11.373 1.00 0.00 ? 7   PRO B CA   2  
ATOM 8252  C C    . PRO B 2 7   ? 43.276  -11.820 -10.426 1.00 0.00 ? 7   PRO B C    2  
ATOM 8253  O O    . PRO B 2 7   ? 42.834  -11.454 -9.342  1.00 0.00 ? 7   PRO B O    2  
ATOM 8254  C CB   . PRO B 2 7   ? 41.697  -11.738 -12.406 1.00 0.00 ? 7   PRO B CB   2  
ATOM 8255  C CG   . PRO B 2 7   ? 40.473  -11.237 -11.697 1.00 0.00 ? 7   PRO B CG   2  
ATOM 8256  C CD   . PRO B 2 7   ? 40.061  -12.355 -10.718 1.00 0.00 ? 7   PRO B CD   2  
ATOM 8257  H HA   . PRO B 2 7   ? 42.951  -13.403 -11.870 1.00 0.00 ? 7   PRO B HA   2  
ATOM 8258  H HB2  . PRO B 2 7   ? 42.342  -10.916 -12.693 1.00 0.00 ? 7   PRO B HB2  2  
ATOM 8259  H HB3  . PRO B 2 7   ? 41.413  -12.314 -13.275 1.00 0.00 ? 7   PRO B HB3  2  
ATOM 8260  H HG2  . PRO B 2 7   ? 40.706  -10.326 -11.154 1.00 0.00 ? 7   PRO B HG2  2  
ATOM 8261  H HG3  . PRO B 2 7   ? 39.674  -11.051 -12.402 1.00 0.00 ? 7   PRO B HG3  2  
ATOM 8262  H HD2  . PRO B 2 7   ? 39.833  -11.946 -9.741  1.00 0.00 ? 7   PRO B HD2  2  
ATOM 8263  H HD3  . PRO B 2 7   ? 39.217  -12.913 -11.100 1.00 0.00 ? 7   PRO B HD3  2  
ATOM 8264  N N    . PRO B 2 8   ? 44.536  -11.527 -10.827 1.00 0.00 ? 8   PRO B N    2  
ATOM 8265  C CA   . PRO B 2 8   ? 45.498  -10.739 -10.017 1.00 0.00 ? 8   PRO B CA   2  
ATOM 8266  C C    . PRO B 2 8   ? 44.875  -9.563  -9.239  1.00 0.00 ? 8   PRO B C    2  
ATOM 8267  O O    . PRO B 2 8   ? 43.990  -9.753  -8.413  1.00 0.00 ? 8   PRO B O    2  
ATOM 8268  C CB   . PRO B 2 8   ? 46.488  -10.241 -11.076 1.00 0.00 ? 8   PRO B CB   2  
ATOM 8269  C CG   . PRO B 2 8   ? 46.565  -11.363 -12.054 1.00 0.00 ? 8   PRO B CG   2  
ATOM 8270  C CD   . PRO B 2 8   ? 45.148  -11.954 -12.109 1.00 0.00 ? 8   PRO B CD   2  
ATOM 8271  H HA   . PRO B 2 8   ? 46.018  -11.391 -9.335  1.00 0.00 ? 8   PRO B HA   2  
ATOM 8272  H HB2  . PRO B 2 8   ? 46.107  -9.349  -11.561 1.00 0.00 ? 8   PRO B HB2  2  
ATOM 8273  H HB3  . PRO B 2 8   ? 47.458  -10.052 -10.640 1.00 0.00 ? 8   PRO B HB3  2  
ATOM 8274  H HG2  . PRO B 2 8   ? 46.865  -10.993 -13.027 1.00 0.00 ? 8   PRO B HG2  2  
ATOM 8275  H HG3  . PRO B 2 8   ? 47.262  -12.114 -11.709 1.00 0.00 ? 8   PRO B HG3  2  
ATOM 8276  H HD2  . PRO B 2 8   ? 44.598  -11.550 -12.949 1.00 0.00 ? 8   PRO B HD2  2  
ATOM 8277  H HD3  . PRO B 2 8   ? 45.190  -13.032 -12.163 1.00 0.00 ? 8   PRO B HD3  2  
ATOM 8278  N N    . THR B 2 9   ? 45.378  -8.353  -9.498  1.00 0.00 ? 9   THR B N    2  
ATOM 8279  C CA   . THR B 2 9   ? 44.908  -7.142  -8.819  1.00 0.00 ? 9   THR B CA   2  
ATOM 8280  C C    . THR B 2 9   ? 45.995  -6.073  -8.886  1.00 0.00 ? 9   THR B C    2  
ATOM 8281  O O    . THR B 2 9   ? 46.604  -5.735  -7.871  1.00 0.00 ? 9   THR B O    2  
ATOM 8282  C CB   . THR B 2 9   ? 44.596  -7.398  -7.317  1.00 0.00 ? 9   THR B CB   2  
ATOM 8283  O OG1  . THR B 2 9   ? 44.619  -6.156  -6.625  1.00 0.00 ? 9   THR B OG1  2  
ATOM 8284  C CG2  . THR B 2 9   ? 45.644  -8.348  -6.679  1.00 0.00 ? 9   THR B CG2  2  
ATOM 8285  H H    . THR B 2 9   ? 46.097  -8.275  -10.156 1.00 0.00 ? 9   THR B H    2  
ATOM 8286  H HA   . THR B 2 9   ? 44.019  -6.778  -9.311  1.00 0.00 ? 9   THR B HA   2  
ATOM 8287  H HB   . THR B 2 9   ? 43.607  -7.823  -7.222  1.00 0.00 ? 9   THR B HB   2  
ATOM 8288  H HG1  . THR B 2 9   ? 43.878  -6.141  -6.017  1.00 0.00 ? 9   THR B HG1  2  
ATOM 8289  H HG21 . THR B 2 9   ? 46.468  -8.527  -7.363  1.00 0.00 ? 9   THR B HG21 2  
ATOM 8290  H HG22 . THR B 2 9   ? 45.182  -9.293  -6.426  1.00 0.00 ? 9   THR B HG22 2  
ATOM 8291  H HG23 . THR B 2 9   ? 46.027  -7.893  -5.778  1.00 0.00 ? 9   THR B HG23 2  
ATOM 8292  N N    . ALA B 2 10  ? 46.251  -5.554  -10.079 1.00 0.00 ? 10  ALA B N    2  
ATOM 8293  C CA   . ALA B 2 10  ? 47.287  -4.540  -10.231 1.00 0.00 ? 10  ALA B CA   2  
ATOM 8294  C C    . ALA B 2 10  ? 46.883  -3.255  -9.505  1.00 0.00 ? 10  ALA B C    2  
ATOM 8295  O O    . ALA B 2 10  ? 46.389  -2.309  -10.118 1.00 0.00 ? 10  ALA B O    2  
ATOM 8296  C CB   . ALA B 2 10  ? 47.556  -4.281  -11.716 1.00 0.00 ? 10  ALA B CB   2  
ATOM 8297  H H    . ALA B 2 10  ? 45.748  -5.863  -10.860 1.00 0.00 ? 10  ALA B H    2  
ATOM 8298  H HA   . ALA B 2 10  ? 48.197  -4.914  -9.775  1.00 0.00 ? 10  ALA B HA   2  
ATOM 8299  H HB1  . ALA B 2 10  ? 47.989  -3.298  -11.847 1.00 0.00 ? 10  ALA B HB1  2  
ATOM 8300  H HB2  . ALA B 2 10  ? 46.627  -4.340  -12.265 1.00 0.00 ? 10  ALA B HB2  2  
ATOM 8301  H HB3  . ALA B 2 10  ? 48.248  -5.029  -12.096 1.00 0.00 ? 10  ALA B HB3  2  
ATOM 8302  N N    . CYS B 2 11  ? 47.127  -3.231  -8.190  1.00 0.00 ? 11  CYS B N    2  
ATOM 8303  C CA   . CYS B 2 11  ? 46.822  -2.066  -7.352  1.00 0.00 ? 11  CYS B CA   2  
ATOM 8304  C C    . CYS B 2 11  ? 48.118  -1.554  -6.730  1.00 0.00 ? 11  CYS B C    2  
ATOM 8305  O O    . CYS B 2 11  ? 48.876  -2.323  -6.139  1.00 0.00 ? 11  CYS B O    2  
ATOM 8306  C CB   . CYS B 2 11  ? 45.837  -2.455  -6.242  1.00 0.00 ? 11  CYS B CB   2  
ATOM 8307  S SG   . CYS B 2 11  ? 44.194  -2.732  -6.950  1.00 0.00 ? 11  CYS B SG   2  
ATOM 8308  H H    . CYS B 2 11  ? 47.542  -4.010  -7.765  1.00 0.00 ? 11  CYS B H    2  
ATOM 8309  H HA   . CYS B 2 11  ? 46.385  -1.279  -7.954  1.00 0.00 ? 11  CYS B HA   2  
ATOM 8310  H HB2  . CYS B 2 11  ? 46.178  -3.361  -5.763  1.00 0.00 ? 11  CYS B HB2  2  
ATOM 8311  H HB3  . CYS B 2 11  ? 45.785  -1.660  -5.512  1.00 0.00 ? 11  CYS B HB3  2  
ATOM 8312  N N    . CYS B 2 12  ? 48.377  -0.262  -6.877  1.00 0.00 ? 12  CYS B N    2  
ATOM 8313  C CA   . CYS B 2 12  ? 49.597  0.326   -6.336  1.00 0.00 ? 12  CYS B CA   2  
ATOM 8314  C C    . CYS B 2 12  ? 49.547  0.398   -4.820  1.00 0.00 ? 12  CYS B C    2  
ATOM 8315  O O    . CYS B 2 12  ? 48.537  0.805   -4.244  1.00 0.00 ? 12  CYS B O    2  
ATOM 8316  C CB   . CYS B 2 12  ? 49.797  1.722   -6.921  1.00 0.00 ? 12  CYS B CB   2  
ATOM 8317  S SG   . CYS B 2 12  ? 48.614  2.880   -6.183  1.00 0.00 ? 12  CYS B SG   2  
ATOM 8318  H H    . CYS B 2 12  ? 47.744  0.305   -7.366  1.00 0.00 ? 12  CYS B H    2  
ATOM 8319  H HA   . CYS B 2 12  ? 50.440  -0.289  -6.620  1.00 0.00 ? 12  CYS B HA   2  
ATOM 8320  H HB2  . CYS B 2 12  ? 50.804  2.055   -6.715  1.00 0.00 ? 12  CYS B HB2  2  
ATOM 8321  H HB3  . CYS B 2 12  ? 49.641  1.680   -7.989  1.00 0.00 ? 12  CYS B HB3  2  
ATOM 8322  N N    . PHE B 2 13  ? 50.654  0.009   -4.179  1.00 0.00 ? 13  PHE B N    2  
ATOM 8323  C CA   . PHE B 2 13  ? 50.747  0.036   -2.715  1.00 0.00 ? 13  PHE B CA   2  
ATOM 8324  C C    . PHE B 2 13  ? 51.710  1.117   -2.262  1.00 0.00 ? 13  PHE B C    2  
ATOM 8325  O O    . PHE B 2 13  ? 51.712  1.513   -1.096  1.00 0.00 ? 13  PHE B O    2  
ATOM 8326  C CB   . PHE B 2 13  ? 51.152  -1.343  -2.172  1.00 0.00 ? 13  PHE B CB   2  
ATOM 8327  C CG   . PHE B 2 13  ? 52.640  -1.575  -2.304  1.00 0.00 ? 13  PHE B CG   2  
ATOM 8328  C CD1  . PHE B 2 13  ? 53.159  -2.128  -3.491  1.00 0.00 ? 13  PHE B CD1  2  
ATOM 8329  C CD2  . PHE B 2 13  ? 53.502  -1.279  -1.225  1.00 0.00 ? 13  PHE B CD2  2  
ATOM 8330  C CE1  . PHE B 2 13  ? 54.539  -2.393  -3.599  1.00 0.00 ? 13  PHE B CE1  2  
ATOM 8331  C CE2  . PHE B 2 13  ? 54.887  -1.523  -1.340  1.00 0.00 ? 13  PHE B CE2  2  
ATOM 8332  C CZ   . PHE B 2 13  ? 55.407  -2.078  -2.529  1.00 0.00 ? 13  PHE B CZ   2  
ATOM 8333  H H    . PHE B 2 13  ? 51.422  -0.294  -4.709  1.00 0.00 ? 13  PHE B H    2  
ATOM 8334  H HA   . PHE B 2 13  ? 49.784  0.283   -2.317  1.00 0.00 ? 13  PHE B HA   2  
ATOM 8335  H HB2  . PHE B 2 13  ? 50.873  -1.416  -1.131  1.00 0.00 ? 13  PHE B HB2  2  
ATOM 8336  H HB3  . PHE B 2 13  ? 50.628  -2.102  -2.732  1.00 0.00 ? 13  PHE B HB3  2  
ATOM 8337  H HD1  . PHE B 2 13  ? 52.500  -2.344  -4.319  1.00 0.00 ? 13  PHE B HD1  2  
ATOM 8338  H HD2  . PHE B 2 13  ? 53.102  -0.855  -0.315  1.00 0.00 ? 13  PHE B HD2  2  
ATOM 8339  H HE1  . PHE B 2 13  ? 54.932  -2.825  -4.503  1.00 0.00 ? 13  PHE B HE1  2  
ATOM 8340  H HE2  . PHE B 2 13  ? 55.550  -1.281  -0.522  1.00 0.00 ? 13  PHE B HE2  2  
ATOM 8341  H HZ   . PHE B 2 13  ? 56.462  -2.293  -2.609  1.00 0.00 ? 13  PHE B HZ   2  
ATOM 8342  N N    . SER B 2 14  ? 52.511  1.602   -3.200  1.00 0.00 ? 14  SER B N    2  
ATOM 8343  C CA   . SER B 2 14  ? 53.481  2.670   -2.912  1.00 0.00 ? 14  SER B CA   2  
ATOM 8344  C C    . SER B 2 14  ? 53.240  3.868   -3.831  1.00 0.00 ? 14  SER B C    2  
ATOM 8345  O O    . SER B 2 14  ? 52.776  3.713   -4.960  1.00 0.00 ? 14  SER B O    2  
ATOM 8346  C CB   . SER B 2 14  ? 54.901  2.144   -3.114  1.00 0.00 ? 14  SER B CB   2  
ATOM 8347  O OG   . SER B 2 14  ? 55.169  1.136   -2.148  1.00 0.00 ? 14  SER B OG   2  
ATOM 8348  H H    . SER B 2 14  ? 52.446  1.240   -4.115  1.00 0.00 ? 14  SER B H    2  
ATOM 8349  H HA   . SER B 2 14  ? 53.377  2.998   -1.886  1.00 0.00 ? 14  SER B HA   2  
ATOM 8350  H HB2  . SER B 2 14  ? 54.997  1.723   -4.100  1.00 0.00 ? 14  SER B HB2  2  
ATOM 8351  H HB3  . SER B 2 14  ? 55.604  2.959   -3.002  1.00 0.00 ? 14  SER B HB3  2  
ATOM 8352  H HG   . SER B 2 14  ? 54.878  1.460   -1.293  1.00 0.00 ? 14  SER B HG   2  
ATOM 8353  N N    . TYR B 2 15  ? 53.507  5.072   -3.314  1.00 0.00 ? 15  TYR B N    2  
ATOM 8354  C CA   . TYR B 2 15  ? 53.288  6.314   -4.074  1.00 0.00 ? 15  TYR B CA   2  
ATOM 8355  C C    . TYR B 2 15  ? 54.597  7.083   -4.269  1.00 0.00 ? 15  TYR B C    2  
ATOM 8356  O O    . TYR B 2 15  ? 55.524  6.969   -3.465  1.00 0.00 ? 15  TYR B O    2  
ATOM 8357  C CB   . TYR B 2 15  ? 52.286  7.190   -3.315  1.00 0.00 ? 15  TYR B CB   2  
ATOM 8358  C CG   . TYR B 2 15  ? 51.149  6.319   -2.830  1.00 0.00 ? 15  TYR B CG   2  
ATOM 8359  C CD1  . TYR B 2 15  ? 50.110  5.964   -3.717  1.00 0.00 ? 15  TYR B CD1  2  
ATOM 8360  C CD2  . TYR B 2 15  ? 51.129  5.853   -1.496  1.00 0.00 ? 15  TYR B CD2  2  
ATOM 8361  C CE1  . TYR B 2 15  ? 49.052  5.143   -3.272  1.00 0.00 ? 15  TYR B CE1  2  
ATOM 8362  C CE2  . TYR B 2 15  ? 50.070  5.033   -1.050  1.00 0.00 ? 15  TYR B CE2  2  
ATOM 8363  C CZ   . TYR B 2 15  ? 49.029  4.679   -1.937  1.00 0.00 ? 15  TYR B CZ   2  
ATOM 8364  O OH   . TYR B 2 15  ? 47.931  3.988   -1.468  1.00 0.00 ? 15  TYR B OH   2  
ATOM 8365  H H    . TYR B 2 15  ? 53.808  5.128   -2.384  1.00 0.00 ? 15  TYR B H    2  
ATOM 8366  H HA   . TYR B 2 15  ? 52.876  6.083   -5.047  1.00 0.00 ? 15  TYR B HA   2  
ATOM 8367  H HB2  . TYR B 2 15  ? 52.774  7.655   -2.470  1.00 0.00 ? 15  TYR B HB2  2  
ATOM 8368  H HB3  . TYR B 2 15  ? 51.899  7.952   -3.974  1.00 0.00 ? 15  TYR B HB3  2  
ATOM 8369  H HD1  . TYR B 2 15  ? 50.125  6.321   -4.735  1.00 0.00 ? 15  TYR B HD1  2  
ATOM 8370  H HD2  . TYR B 2 15  ? 51.924  6.124   -0.817  1.00 0.00 ? 15  TYR B HD2  2  
ATOM 8371  H HE1  . TYR B 2 15  ? 48.260  4.872   -3.952  1.00 0.00 ? 15  TYR B HE1  2  
ATOM 8372  H HE2  . TYR B 2 15  ? 50.052  4.680   -0.029  1.00 0.00 ? 15  TYR B HE2  2  
ATOM 8373  H HH   . TYR B 2 15  ? 47.495  3.579   -2.220  1.00 0.00 ? 15  TYR B HH   2  
ATOM 8374  N N    . THR B 2 16  ? 54.655  7.875   -5.340  1.00 0.00 ? 16  THR B N    2  
ATOM 8375  C CA   . THR B 2 16  ? 55.844  8.676   -5.636  1.00 0.00 ? 16  THR B CA   2  
ATOM 8376  C C    . THR B 2 16  ? 55.861  9.924   -4.759  1.00 0.00 ? 16  THR B C    2  
ATOM 8377  O O    . THR B 2 16  ? 54.838  10.588  -4.595  1.00 0.00 ? 16  THR B O    2  
ATOM 8378  C CB   . THR B 2 16  ? 55.862  9.113   -7.113  1.00 0.00 ? 16  THR B CB   2  
ATOM 8379  O OG1  . THR B 2 16  ? 56.991  9.942   -7.345  1.00 0.00 ? 16  THR B OG1  2  
ATOM 8380  C CG2  . THR B 2 16  ? 54.583  9.887   -7.439  1.00 0.00 ? 16  THR B CG2  2  
ATOM 8381  H H    . THR B 2 16  ? 53.878  7.928   -5.933  1.00 0.00 ? 16  THR B H    2  
ATOM 8382  H HA   . THR B 2 16  ? 56.727  8.090   -5.433  1.00 0.00 ? 16  THR B HA   2  
ATOM 8383  H HB   . THR B 2 16  ? 55.921  8.241   -7.744  1.00 0.00 ? 16  THR B HB   2  
ATOM 8384  H HG1  . THR B 2 16  ? 56.679  10.843  -7.456  1.00 0.00 ? 16  THR B HG1  2  
ATOM 8385  H HG21 . THR B 2 16  ? 54.613  10.852  -6.956  1.00 0.00 ? 16  THR B HG21 2  
ATOM 8386  H HG22 . THR B 2 16  ? 53.726  9.334   -7.083  1.00 0.00 ? 16  THR B HG22 2  
ATOM 8387  H HG23 . THR B 2 16  ? 54.506  10.021  -8.507  1.00 0.00 ? 16  THR B HG23 2  
ATOM 8388  N N    . ALA B 2 17  ? 57.022  10.233  -4.179  1.00 0.00 ? 17  ALA B N    2  
ATOM 8389  C CA   . ALA B 2 17  ? 57.155  11.397  -3.300  1.00 0.00 ? 17  ALA B CA   2  
ATOM 8390  C C    . ALA B 2 17  ? 57.729  12.584  -4.059  1.00 0.00 ? 17  ALA B C    2  
ATOM 8391  O O    . ALA B 2 17  ? 58.380  13.447  -3.470  1.00 0.00 ? 17  ALA B O    2  
ATOM 8392  C CB   . ALA B 2 17  ? 58.058  11.051  -2.124  1.00 0.00 ? 17  ALA B CB   2  
ATOM 8393  H H    . ALA B 2 17  ? 57.802  9.664   -4.331  1.00 0.00 ? 17  ALA B H    2  
ATOM 8394  H HA   . ALA B 2 17  ? 56.181  11.673  -2.914  1.00 0.00 ? 17  ALA B HA   2  
ATOM 8395  H HB1  . ALA B 2 17  ? 59.083  10.991  -2.459  1.00 0.00 ? 17  ALA B HB1  2  
ATOM 8396  H HB2  . ALA B 2 17  ? 57.759  10.099  -1.710  1.00 0.00 ? 17  ALA B HB2  2  
ATOM 8397  H HB3  . ALA B 2 17  ? 57.972  11.816  -1.367  1.00 0.00 ? 17  ALA B HB3  2  
ATOM 8398  N N    . ARG B 2 18  ? 57.485  12.627  -5.369  1.00 0.00 ? 18  ARG B N    2  
ATOM 8399  C CA   . ARG B 2 18  ? 57.986  13.720  -6.202  1.00 0.00 ? 18  ARG B CA   2  
ATOM 8400  C C    . ARG B 2 18  ? 56.926  14.156  -7.215  1.00 0.00 ? 18  ARG B C    2  
ATOM 8401  O O    . ARG B 2 18  ? 56.399  13.340  -7.970  1.00 0.00 ? 18  ARG B O    2  
ATOM 8402  C CB   . ARG B 2 18  ? 59.278  13.258  -6.929  1.00 0.00 ? 18  ARG B CB   2  
ATOM 8403  C CG   . ARG B 2 18  ? 60.345  14.368  -6.894  1.00 0.00 ? 18  ARG B CG   2  
ATOM 8404  C CD   . ARG B 2 18  ? 60.900  14.537  -5.456  1.00 0.00 ? 18  ARG B CD   2  
ATOM 8405  N NE   . ARG B 2 18  ? 60.798  15.970  -5.056  1.00 0.00 ? 18  ARG B NE   2  
ATOM 8406  C CZ   . ARG B 2 18  ? 61.452  16.408  -4.014  1.00 0.00 ? 18  ARG B CZ   2  
ATOM 8407  N NH1  . ARG B 2 18  ? 61.383  15.763  -2.882  1.00 0.00 ? 18  ARG B NH1  2  
ATOM 8408  N NH2  . ARG B 2 18  ? 62.174  17.491  -4.105  1.00 0.00 ? 18  ARG B NH2  2  
ATOM 8409  H H    . ARG B 2 18  ? 56.965  11.913  -5.783  1.00 0.00 ? 18  ARG B H    2  
ATOM 8410  H HA   . ARG B 2 18  ? 58.213  14.566  -5.568  1.00 0.00 ? 18  ARG B HA   2  
ATOM 8411  H HB2  . ARG B 2 18  ? 59.668  12.383  -6.430  1.00 0.00 ? 18  ARG B HB2  2  
ATOM 8412  H HB3  . ARG B 2 18  ? 59.062  13.007  -7.960  1.00 0.00 ? 18  ARG B HB3  2  
ATOM 8413  H HG2  . ARG B 2 18  ? 61.148  14.110  -7.573  1.00 0.00 ? 18  ARG B HG2  2  
ATOM 8414  H HG3  . ARG B 2 18  ? 59.898  15.297  -7.213  1.00 0.00 ? 18  ARG B HG3  2  
ATOM 8415  H HD2  . ARG B 2 18  ? 60.334  13.933  -4.756  1.00 0.00 ? 18  ARG B HD2  2  
ATOM 8416  H HD3  . ARG B 2 18  ? 61.938  14.232  -5.425  1.00 0.00 ? 18  ARG B HD3  2  
ATOM 8417  H HE   . ARG B 2 18  ? 60.237  16.584  -5.575  1.00 0.00 ? 18  ARG B HE   2  
ATOM 8418  H HH11 . ARG B 2 18  ? 60.830  14.933  -2.812  1.00 0.00 ? 18  ARG B HH11 2  
ATOM 8419  H HH12 . ARG B 2 18  ? 61.884  16.098  -2.083  1.00 0.00 ? 18  ARG B HH12 2  
ATOM 8420  H HH21 . ARG B 2 18  ? 62.226  17.986  -4.972  1.00 0.00 ? 18  ARG B HH21 2  
ATOM 8421  H HH22 . ARG B 2 18  ? 62.674  17.827  -3.307  1.00 0.00 ? 18  ARG B HH22 2  
ATOM 8422  N N    . LYS B 2 19  ? 56.630  15.452  -7.225  1.00 0.00 ? 19  LYS B N    2  
ATOM 8423  C CA   . LYS B 2 19  ? 55.645  15.989  -8.150  1.00 0.00 ? 19  LYS B CA   2  
ATOM 8424  C C    . LYS B 2 19  ? 56.048  15.670  -9.585  1.00 0.00 ? 19  LYS B C    2  
ATOM 8425  O O    . LYS B 2 19  ? 57.194  15.310  -9.852  1.00 0.00 ? 19  LYS B O    2  
ATOM 8426  C CB   . LYS B 2 19  ? 55.532  17.506  -7.976  1.00 0.00 ? 19  LYS B CB   2  
ATOM 8427  C CG   . LYS B 2 19  ? 55.190  17.832  -6.521  1.00 0.00 ? 19  LYS B CG   2  
ATOM 8428  C CD   . LYS B 2 19  ? 55.104  19.350  -6.346  1.00 0.00 ? 19  LYS B CD   2  
ATOM 8429  C CE   . LYS B 2 19  ? 54.942  19.686  -4.863  1.00 0.00 ? 19  LYS B CE   2  
ATOM 8430  N NZ   . LYS B 2 19  ? 54.717  21.151  -4.707  1.00 0.00 ? 19  LYS B NZ   2  
ATOM 8431  H H    . LYS B 2 19  ? 57.083  16.053  -6.598  1.00 0.00 ? 19  LYS B H    2  
ATOM 8432  H HA   . LYS B 2 19  ? 54.684  15.540  -7.945  1.00 0.00 ? 19  LYS B HA   2  
ATOM 8433  H HB2  . LYS B 2 19  ? 56.473  17.968  -8.238  1.00 0.00 ? 19  LYS B HB2  2  
ATOM 8434  H HB3  . LYS B 2 19  ? 54.754  17.885  -8.620  1.00 0.00 ? 19  LYS B HB3  2  
ATOM 8435  H HG2  . LYS B 2 19  ? 54.240  17.385  -6.265  1.00 0.00 ? 19  LYS B HG2  2  
ATOM 8436  H HG3  . LYS B 2 19  ? 55.959  17.439  -5.873  1.00 0.00 ? 19  LYS B HG3  2  
ATOM 8437  H HD2  . LYS B 2 19  ? 56.008  19.806  -6.723  1.00 0.00 ? 19  LYS B HD2  2  
ATOM 8438  H HD3  . LYS B 2 19  ? 54.255  19.729  -6.893  1.00 0.00 ? 19  LYS B HD3  2  
ATOM 8439  H HE2  . LYS B 2 19  ? 54.096  19.148  -4.461  1.00 0.00 ? 19  LYS B HE2  2  
ATOM 8440  H HE3  . LYS B 2 19  ? 55.837  19.401  -4.328  1.00 0.00 ? 19  LYS B HE3  2  
ATOM 8441  H HZ1  . LYS B 2 19  ? 53.716  21.370  -4.885  1.00 0.00 ? 19  LYS B HZ1  2  
ATOM 8442  H HZ2  . LYS B 2 19  ? 55.311  21.667  -5.389  1.00 0.00 ? 19  LYS B HZ2  2  
ATOM 8443  H HZ3  . LYS B 2 19  ? 54.966  21.441  -3.741  1.00 0.00 ? 19  LYS B HZ3  2  
ATOM 8444  N N    . LEU B 2 20  ? 55.097  15.804  -10.503 1.00 0.00 ? 20  LEU B N    2  
ATOM 8445  C CA   . LEU B 2 20  ? 55.339  15.530  -11.921 1.00 0.00 ? 20  LEU B CA   2  
ATOM 8446  C C    . LEU B 2 20  ? 54.772  16.678  -12.763 1.00 0.00 ? 20  LEU B C    2  
ATOM 8447  O O    . LEU B 2 20  ? 53.607  16.637  -13.152 1.00 0.00 ? 20  LEU B O    2  
ATOM 8448  C CB   . LEU B 2 20  ? 54.648  14.203  -12.314 1.00 0.00 ? 20  LEU B CB   2  
ATOM 8449  C CG   . LEU B 2 20  ? 53.326  14.021  -11.506 1.00 0.00 ? 20  LEU B CG   2  
ATOM 8450  C CD1  . LEU B 2 20  ? 52.289  13.285  -12.360 1.00 0.00 ? 20  LEU B CD1  2  
ATOM 8451  C CD2  . LEU B 2 20  ? 53.584  13.204  -10.223 1.00 0.00 ? 20  LEU B CD2  2  
ATOM 8452  H H    . LEU B 2 20  ? 54.204  16.093  -10.222 1.00 0.00 ? 20  LEU B H    2  
ATOM 8453  H HA   . LEU B 2 20  ? 56.401  15.438  -12.105 1.00 0.00 ? 20  LEU B HA   2  
ATOM 8454  H HB2  . LEU B 2 20  ? 54.434  14.213  -13.378 1.00 0.00 ? 20  LEU B HB2  2  
ATOM 8455  H HB3  . LEU B 2 20  ? 55.318  13.378  -12.106 1.00 0.00 ? 20  LEU B HB3  2  
ATOM 8456  H HG   . LEU B 2 20  ? 52.924  14.990  -11.237 1.00 0.00 ? 20  LEU B HG   2  
ATOM 8457  H HD11 . LEU B 2 20  ? 51.440  13.011  -11.751 1.00 0.00 ? 20  LEU B HD11 2  
ATOM 8458  H HD12 . LEU B 2 20  ? 52.736  12.400  -12.774 1.00 0.00 ? 20  LEU B HD12 2  
ATOM 8459  H HD13 . LEU B 2 20  ? 51.961  13.930  -13.162 1.00 0.00 ? 20  LEU B HD13 2  
ATOM 8460  H HD21 . LEU B 2 20  ? 54.222  13.763  -9.558  1.00 0.00 ? 20  LEU B HD21 2  
ATOM 8461  H HD22 . LEU B 2 20  ? 54.062  12.271  -10.478 1.00 0.00 ? 20  LEU B HD22 2  
ATOM 8462  H HD23 . LEU B 2 20  ? 52.647  13.000  -9.732  1.00 0.00 ? 20  LEU B HD23 2  
ATOM 8463  N N    . PRO B 2 21  ? 55.570  17.729  -13.051 1.00 0.00 ? 21  PRO B N    2  
ATOM 8464  C CA   . PRO B 2 21  ? 55.089  18.871  -13.839 1.00 0.00 ? 21  PRO B CA   2  
ATOM 8465  C C    . PRO B 2 21  ? 54.236  18.428  -15.026 1.00 0.00 ? 21  PRO B C    2  
ATOM 8466  O O    . PRO B 2 21  ? 54.506  17.404  -15.654 1.00 0.00 ? 21  PRO B O    2  
ATOM 8467  C CB   . PRO B 2 21  ? 56.377  19.574  -14.282 1.00 0.00 ? 21  PRO B CB   2  
ATOM 8468  C CG   . PRO B 2 21  ? 57.338  19.303  -13.169 1.00 0.00 ? 21  PRO B CG   2  
ATOM 8469  C CD   . PRO B 2 21  ? 56.985  17.900  -12.651 1.00 0.00 ? 21  PRO B CD   2  
ATOM 8470  H HA   . PRO B 2 21  ? 54.519  19.535  -13.208 1.00 0.00 ? 21  PRO B HA   2  
ATOM 8471  H HB2  . PRO B 2 21  ? 56.737  19.150  -15.212 1.00 0.00 ? 21  PRO B HB2  2  
ATOM 8472  H HB3  . PRO B 2 21  ? 56.218  20.638  -14.390 1.00 0.00 ? 21  PRO B HB3  2  
ATOM 8473  H HG2  . PRO B 2 21  ? 58.359  19.330  -13.537 1.00 0.00 ? 21  PRO B HG2  2  
ATOM 8474  H HG3  . PRO B 2 21  ? 57.210  20.027  -12.376 1.00 0.00 ? 21  PRO B HG3  2  
ATOM 8475  H HD2  . PRO B 2 21  ? 57.609  17.154  -13.129 1.00 0.00 ? 21  PRO B HD2  2  
ATOM 8476  H HD3  . PRO B 2 21  ? 57.079  17.845  -11.576 1.00 0.00 ? 21  PRO B HD3  2  
ATOM 8477  N N    . ARG B 2 22  ? 53.198  19.207  -15.317 1.00 0.00 ? 22  ARG B N    2  
ATOM 8478  C CA   . ARG B 2 22  ? 52.289  18.896  -16.418 1.00 0.00 ? 22  ARG B CA   2  
ATOM 8479  C C    . ARG B 2 22  ? 53.052  18.437  -17.660 1.00 0.00 ? 22  ARG B C    2  
ATOM 8480  O O    . ARG B 2 22  ? 52.700  17.431  -18.275 1.00 0.00 ? 22  ARG B O    2  
ATOM 8481  C CB   . ARG B 2 22  ? 51.456  20.134  -16.758 1.00 0.00 ? 22  ARG B CB   2  
ATOM 8482  C CG   . ARG B 2 22  ? 50.337  19.754  -17.731 1.00 0.00 ? 22  ARG B CG   2  
ATOM 8483  C CD   . ARG B 2 22  ? 49.413  20.957  -17.935 1.00 0.00 ? 22  ARG B CD   2  
ATOM 8484  N NE   . ARG B 2 22  ? 48.343  20.604  -18.914 1.00 0.00 ? 22  ARG B NE   2  
ATOM 8485  C CZ   . ARG B 2 22  ? 48.602  20.593  -20.194 1.00 0.00 ? 22  ARG B CZ   2  
ATOM 8486  N NH1  . ARG B 2 22  ? 49.375  21.509  -20.711 1.00 0.00 ? 22  ARG B NH1  2  
ATOM 8487  N NH2  . ARG B 2 22  ? 48.087  19.667  -20.956 1.00 0.00 ? 22  ARG B NH2  2  
ATOM 8488  H H    . ARG B 2 22  ? 53.033  20.004  -14.772 1.00 0.00 ? 22  ARG B H    2  
ATOM 8489  H HA   . ARG B 2 22  ? 51.624  18.106  -16.106 1.00 0.00 ? 22  ARG B HA   2  
ATOM 8490  H HB2  . ARG B 2 22  ? 51.023  20.535  -15.852 1.00 0.00 ? 22  ARG B HB2  2  
ATOM 8491  H HB3  . ARG B 2 22  ? 52.089  20.879  -17.215 1.00 0.00 ? 22  ARG B HB3  2  
ATOM 8492  H HG2  . ARG B 2 22  ? 50.768  19.464  -18.679 1.00 0.00 ? 22  ARG B HG2  2  
ATOM 8493  H HG3  . ARG B 2 22  ? 49.769  18.931  -17.327 1.00 0.00 ? 22  ARG B HG3  2  
ATOM 8494  H HD2  . ARG B 2 22  ? 48.961  21.226  -16.992 1.00 0.00 ? 22  ARG B HD2  2  
ATOM 8495  H HD3  . ARG B 2 22  ? 49.986  21.793  -18.310 1.00 0.00 ? 22  ARG B HD3  2  
ATOM 8496  H HE   . ARG B 2 22  ? 47.445  20.379  -18.595 1.00 0.00 ? 22  ARG B HE   2  
ATOM 8497  H HH11 . ARG B 2 22  ? 49.768  22.218  -20.127 1.00 0.00 ? 22  ARG B HH11 2  
ATOM 8498  H HH12 . ARG B 2 22  ? 49.572  21.501  -21.692 1.00 0.00 ? 22  ARG B HH12 2  
ATOM 8499  H HH21 . ARG B 2 22  ? 47.494  18.966  -20.560 1.00 0.00 ? 22  ARG B HH21 2  
ATOM 8500  H HH22 . ARG B 2 22  ? 48.285  19.660  -21.936 1.00 0.00 ? 22  ARG B HH22 2  
ATOM 8501  N N    . ASN B 2 23  ? 54.081  19.192  -18.035 1.00 0.00 ? 23  ASN B N    2  
ATOM 8502  C CA   . ASN B 2 23  ? 54.881  18.878  -19.220 1.00 0.00 ? 23  ASN B CA   2  
ATOM 8503  C C    . ASN B 2 23  ? 55.094  17.374  -19.404 1.00 0.00 ? 23  ASN B C    2  
ATOM 8504  O O    . ASN B 2 23  ? 55.155  16.891  -20.534 1.00 0.00 ? 23  ASN B O    2  
ATOM 8505  C CB   . ASN B 2 23  ? 56.240  19.571  -19.122 1.00 0.00 ? 23  ASN B CB   2  
ATOM 8506  C CG   . ASN B 2 23  ? 56.033  21.074  -18.919 1.00 0.00 ? 23  ASN B CG   2  
ATOM 8507  O OD1  . ASN B 2 23  ? 56.864  21.740  -18.335 1.00 0.00 ? 23  ASN B OD1  2  
ATOM 8508  N ND2  . ASN B 2 23  ? 54.950  21.638  -19.379 1.00 0.00 ? 23  ASN B ND2  2  
ATOM 8509  H H    . ASN B 2 23  ? 54.307  19.997  -17.523 1.00 0.00 ? 23  ASN B H    2  
ATOM 8510  H HA   . ASN B 2 23  ? 54.369  19.257  -20.089 1.00 0.00 ? 23  ASN B HA   2  
ATOM 8511  H HB2  . ASN B 2 23  ? 56.791  19.166  -18.286 1.00 0.00 ? 23  ASN B HB2  2  
ATOM 8512  H HB3  . ASN B 2 23  ? 56.796  19.406  -20.033 1.00 0.00 ? 23  ASN B HB3  2  
ATOM 8513  H HD21 . ASN B 2 23  ? 54.279  21.101  -19.850 1.00 0.00 ? 23  ASN B HD21 2  
ATOM 8514  H HD22 . ASN B 2 23  ? 54.808  22.600  -19.253 1.00 0.00 ? 23  ASN B HD22 2  
ATOM 8515  N N    . PHE B 2 24  ? 55.219  16.640  -18.297 1.00 0.00 ? 24  PHE B N    2  
ATOM 8516  C CA   . PHE B 2 24  ? 55.444  15.185  -18.358 1.00 0.00 ? 24  PHE B CA   2  
ATOM 8517  C C    . PHE B 2 24  ? 54.189  14.411  -17.937 1.00 0.00 ? 24  PHE B C    2  
ATOM 8518  O O    . PHE B 2 24  ? 54.275  13.427  -17.203 1.00 0.00 ? 24  PHE B O    2  
ATOM 8519  C CB   . PHE B 2 24  ? 56.632  14.810  -17.456 1.00 0.00 ? 24  PHE B CB   2  
ATOM 8520  C CG   . PHE B 2 24  ? 57.714  15.866  -17.592 1.00 0.00 ? 24  PHE B CG   2  
ATOM 8521  C CD1  . PHE B 2 24  ? 58.603  15.847  -18.696 1.00 0.00 ? 24  PHE B CD1  2  
ATOM 8522  C CD2  . PHE B 2 24  ? 57.826  16.883  -16.619 1.00 0.00 ? 24  PHE B CD2  2  
ATOM 8523  C CE1  . PHE B 2 24  ? 59.591  16.847  -18.822 1.00 0.00 ? 24  PHE B CE1  2  
ATOM 8524  C CE2  . PHE B 2 24  ? 58.822  17.875  -16.745 1.00 0.00 ? 24  PHE B CE2  2  
ATOM 8525  C CZ   . PHE B 2 24  ? 59.705  17.858  -17.846 1.00 0.00 ? 24  PHE B CZ   2  
ATOM 8526  H H    . PHE B 2 24  ? 55.172  17.083  -17.425 1.00 0.00 ? 24  PHE B H    2  
ATOM 8527  H HA   . PHE B 2 24  ? 55.688  14.901  -19.375 1.00 0.00 ? 24  PHE B HA   2  
ATOM 8528  H HB2  . PHE B 2 24  ? 56.303  14.757  -16.427 1.00 0.00 ? 24  PHE B HB2  2  
ATOM 8529  H HB3  . PHE B 2 24  ? 57.028  13.850  -17.756 1.00 0.00 ? 24  PHE B HB3  2  
ATOM 8530  H HD1  . PHE B 2 24  ? 58.529  15.071  -19.445 1.00 0.00 ? 24  PHE B HD1  2  
ATOM 8531  H HD2  . PHE B 2 24  ? 57.153  16.897  -15.776 1.00 0.00 ? 24  PHE B HD2  2  
ATOM 8532  H HE1  . PHE B 2 24  ? 60.267  16.832  -19.664 1.00 0.00 ? 24  PHE B HE1  2  
ATOM 8533  H HE2  . PHE B 2 24  ? 58.912  18.649  -15.997 1.00 0.00 ? 24  PHE B HE2  2  
ATOM 8534  H HZ   . PHE B 2 24  ? 60.326  18.716  -18.044 1.00 0.00 ? 24  PHE B HZ   2  
ATOM 8535  N N    . VAL B 2 25  ? 53.025  14.869  -18.408 1.00 0.00 ? 25  VAL B N    2  
ATOM 8536  C CA   . VAL B 2 25  ? 51.742  14.223  -18.090 1.00 0.00 ? 25  VAL B CA   2  
ATOM 8537  C C    . VAL B 2 25  ? 50.803  14.300  -19.296 1.00 0.00 ? 25  VAL B C    2  
ATOM 8538  O O    . VAL B 2 25  ? 50.015  15.238  -19.420 1.00 0.00 ? 25  VAL B O    2  
ATOM 8539  C CB   . VAL B 2 25  ? 51.060  14.922  -16.898 1.00 0.00 ? 25  VAL B CB   2  
ATOM 8540  C CG1  . VAL B 2 25  ? 49.864  14.090  -16.431 1.00 0.00 ? 25  VAL B CG1  2  
ATOM 8541  C CG2  . VAL B 2 25  ? 52.059  15.065  -15.749 1.00 0.00 ? 25  VAL B CG2  2  
ATOM 8542  H H    . VAL B 2 25  ? 53.023  15.666  -18.978 1.00 0.00 ? 25  VAL B H    2  
ATOM 8543  H HA   . VAL B 2 25  ? 51.907  13.183  -17.843 1.00 0.00 ? 25  VAL B HA   2  
ATOM 8544  H HB   . VAL B 2 25  ? 50.719  15.901  -17.204 1.00 0.00 ? 25  VAL B HB   2  
ATOM 8545  H HG11 . VAL B 2 25  ? 49.125  14.049  -17.217 1.00 0.00 ? 25  VAL B HG11 2  
ATOM 8546  H HG12 . VAL B 2 25  ? 49.431  14.544  -15.553 1.00 0.00 ? 25  VAL B HG12 2  
ATOM 8547  H HG13 . VAL B 2 25  ? 50.193  13.088  -16.194 1.00 0.00 ? 25  VAL B HG13 2  
ATOM 8548  H HG21 . VAL B 2 25  ? 52.451  14.093  -15.487 1.00 0.00 ? 25  VAL B HG21 2  
ATOM 8549  H HG22 . VAL B 2 25  ? 51.561  15.496  -14.892 1.00 0.00 ? 25  VAL B HG22 2  
ATOM 8550  H HG23 . VAL B 2 25  ? 52.870  15.709  -16.054 1.00 0.00 ? 25  VAL B HG23 2  
ATOM 8551  N N    . VAL B 2 26  ? 50.911  13.321  -20.195 1.00 0.00 ? 26  VAL B N    2  
ATOM 8552  C CA   . VAL B 2 26  ? 50.086  13.295  -21.409 1.00 0.00 ? 26  VAL B CA   2  
ATOM 8553  C C    . VAL B 2 26  ? 48.742  12.595  -21.185 1.00 0.00 ? 26  VAL B C    2  
ATOM 8554  O O    . VAL B 2 26  ? 47.761  12.907  -21.860 1.00 0.00 ? 26  VAL B O    2  
ATOM 8555  C CB   . VAL B 2 26  ? 50.822  12.561  -22.545 1.00 0.00 ? 26  VAL B CB   2  
ATOM 8556  C CG1  . VAL B 2 26  ? 52.115  13.307  -22.882 1.00 0.00 ? 26  VAL B CG1  2  
ATOM 8557  C CG2  . VAL B 2 26  ? 51.161  11.134  -22.100 1.00 0.00 ? 26  VAL B CG2  2  
ATOM 8558  H H    . VAL B 2 26  ? 51.573  12.612  -20.051 1.00 0.00 ? 26  VAL B H    2  
ATOM 8559  H HA   . VAL B 2 26  ? 49.898  14.309  -21.731 1.00 0.00 ? 26  VAL B HA   2  
ATOM 8560  H HB   . VAL B 2 26  ? 50.190  12.526  -23.421 1.00 0.00 ? 26  VAL B HB   2  
ATOM 8561  H HG11 . VAL B 2 26  ? 51.895  14.351  -23.046 1.00 0.00 ? 26  VAL B HG11 2  
ATOM 8562  H HG12 . VAL B 2 26  ? 52.551  12.885  -23.776 1.00 0.00 ? 26  VAL B HG12 2  
ATOM 8563  H HG13 . VAL B 2 26  ? 52.811  13.209  -22.062 1.00 0.00 ? 26  VAL B HG13 2  
ATOM 8564  H HG21 . VAL B 2 26  ? 51.775  10.660  -22.850 1.00 0.00 ? 26  VAL B HG21 2  
ATOM 8565  H HG22 . VAL B 2 26  ? 50.249  10.571  -21.972 1.00 0.00 ? 26  VAL B HG22 2  
ATOM 8566  H HG23 . VAL B 2 26  ? 51.697  11.168  -21.163 1.00 0.00 ? 26  VAL B HG23 2  
ATOM 8567  N N    . ASP B 2 27  ? 48.697  11.647  -20.251 1.00 0.00 ? 27  ASP B N    2  
ATOM 8568  C CA   . ASP B 2 27  ? 47.454  10.913  -19.979 1.00 0.00 ? 27  ASP B CA   2  
ATOM 8569  C C    . ASP B 2 27  ? 47.480  10.313  -18.580 1.00 0.00 ? 27  ASP B C    2  
ATOM 8570  O O    . ASP B 2 27  ? 48.452  10.486  -17.846 1.00 0.00 ? 27  ASP B O    2  
ATOM 8571  C CB   . ASP B 2 27  ? 47.277  9.797   -21.012 1.00 0.00 ? 27  ASP B CB   2  
ATOM 8572  C CG   . ASP B 2 27  ? 45.886  9.175   -20.864 1.00 0.00 ? 27  ASP B CG   2  
ATOM 8573  O OD1  . ASP B 2 27  ? 44.956  9.915   -20.589 1.00 0.00 ? 27  ASP B OD1  2  
ATOM 8574  O OD2  . ASP B 2 27  ? 45.776  7.972   -21.027 1.00 0.00 ? 27  ASP B OD2  2  
ATOM 8575  H H    . ASP B 2 27  ? 49.509  11.429  -19.745 1.00 0.00 ? 27  ASP B H    2  
ATOM 8576  H HA   . ASP B 2 27  ? 46.615  11.591  -20.052 1.00 0.00 ? 27  ASP B HA   2  
ATOM 8577  H HB2  . ASP B 2 27  ? 47.385  10.206  -22.006 1.00 0.00 ? 27  ASP B HB2  2  
ATOM 8578  H HB3  . ASP B 2 27  ? 48.027  9.036   -20.852 1.00 0.00 ? 27  ASP B HB3  2  
ATOM 8579  N N    . TYR B 2 28  ? 46.407  9.610   -18.200 1.00 0.00 ? 28  TYR B N    2  
ATOM 8580  C CA   . TYR B 2 28  ? 46.348  9.010   -16.871 1.00 0.00 ? 28  TYR B CA   2  
ATOM 8581  C C    . TYR B 2 28  ? 45.267  7.929   -16.775 1.00 0.00 ? 28  TYR B C    2  
ATOM 8582  O O    . TYR B 2 28  ? 44.428  7.784   -17.665 1.00 0.00 ? 28  TYR B O    2  
ATOM 8583  C CB   . TYR B 2 28  ? 46.088  10.108  -15.829 1.00 0.00 ? 28  TYR B CB   2  
ATOM 8584  C CG   . TYR B 2 28  ? 44.653  10.596  -15.935 1.00 0.00 ? 28  TYR B CG   2  
ATOM 8585  C CD1  . TYR B 2 28  ? 44.238  11.320  -17.074 1.00 0.00 ? 28  TYR B CD1  2  
ATOM 8586  C CD2  . TYR B 2 28  ? 43.728  10.323  -14.900 1.00 0.00 ? 28  TYR B CD2  2  
ATOM 8587  C CE1  . TYR B 2 28  ? 42.904  11.770  -17.179 1.00 0.00 ? 28  TYR B CE1  2  
ATOM 8588  C CE2  . TYR B 2 28  ? 42.395  10.775  -15.005 1.00 0.00 ? 28  TYR B CE2  2  
ATOM 8589  C CZ   . TYR B 2 28  ? 41.983  11.498  -16.144 1.00 0.00 ? 28  TYR B CZ   2  
ATOM 8590  O OH   . TYR B 2 28  ? 40.647  11.800  -16.318 1.00 0.00 ? 28  TYR B OH   2  
ATOM 8591  H H    . TYR B 2 28  ? 45.646  9.499   -18.806 1.00 0.00 ? 28  TYR B H    2  
ATOM 8592  H HA   . TYR B 2 28  ? 47.299  8.551   -16.659 1.00 0.00 ? 28  TYR B HA   2  
ATOM 8593  H HB2  . TYR B 2 28  ? 46.267  9.716   -14.840 1.00 0.00 ? 28  TYR B HB2  2  
ATOM 8594  H HB3  . TYR B 2 28  ? 46.759  10.935  -16.009 1.00 0.00 ? 28  TYR B HB3  2  
ATOM 8595  H HD1  . TYR B 2 28  ? 44.942  11.530  -17.866 1.00 0.00 ? 28  TYR B HD1  2  
ATOM 8596  H HD2  . TYR B 2 28  ? 44.042  9.769   -14.027 1.00 0.00 ? 28  TYR B HD2  2  
ATOM 8597  H HE1  . TYR B 2 28  ? 42.589  12.324  -18.050 1.00 0.00 ? 28  TYR B HE1  2  
ATOM 8598  H HE2  . TYR B 2 28  ? 41.691  10.566  -14.213 1.00 0.00 ? 28  TYR B HE2  2  
ATOM 8599  H HH   . TYR B 2 28  ? 40.552  12.755  -16.288 1.00 0.00 ? 28  TYR B HH   2  
ATOM 8600  N N    . TYR B 2 29  ? 45.304  7.183   -15.672 1.00 0.00 ? 29  TYR B N    2  
ATOM 8601  C CA   . TYR B 2 29  ? 44.344  6.113   -15.418 1.00 0.00 ? 29  TYR B CA   2  
ATOM 8602  C C    . TYR B 2 29  ? 44.311  5.816   -13.924 1.00 0.00 ? 29  TYR B C    2  
ATOM 8603  O O    . TYR B 2 29  ? 45.207  6.233   -13.193 1.00 0.00 ? 29  TYR B O    2  
ATOM 8604  C CB   . TYR B 2 29  ? 44.746  4.853   -16.188 1.00 0.00 ? 29  TYR B CB   2  
ATOM 8605  C CG   . TYR B 2 29  ? 43.637  3.827   -16.094 1.00 0.00 ? 29  TYR B CG   2  
ATOM 8606  C CD1  . TYR B 2 29  ? 42.415  4.055   -16.763 1.00 0.00 ? 29  TYR B CD1  2  
ATOM 8607  C CD2  . TYR B 2 29  ? 43.817  2.643   -15.340 1.00 0.00 ? 29  TYR B CD2  2  
ATOM 8608  C CE1  . TYR B 2 29  ? 41.375  3.103   -16.681 1.00 0.00 ? 29  TYR B CE1  2  
ATOM 8609  C CE2  . TYR B 2 29  ? 42.778  1.692   -15.259 1.00 0.00 ? 29  TYR B CE2  2  
ATOM 8610  C CZ   . TYR B 2 29  ? 41.556  1.922   -15.928 1.00 0.00 ? 29  TYR B CZ   2  
ATOM 8611  O OH   . TYR B 2 29  ? 40.523  1.014   -15.810 1.00 0.00 ? 29  TYR B OH   2  
ATOM 8612  H H    . TYR B 2 29  ? 46.000  7.360   -15.006 1.00 0.00 ? 29  TYR B H    2  
ATOM 8613  H HA   . TYR B 2 29  ? 43.362  6.430   -15.740 1.00 0.00 ? 29  TYR B HA   2  
ATOM 8614  H HB2  . TYR B 2 29  ? 44.913  5.107   -17.225 1.00 0.00 ? 29  TYR B HB2  2  
ATOM 8615  H HB3  . TYR B 2 29  ? 45.654  4.448   -15.767 1.00 0.00 ? 29  TYR B HB3  2  
ATOM 8616  H HD1  . TYR B 2 29  ? 42.275  4.959   -17.337 1.00 0.00 ? 29  TYR B HD1  2  
ATOM 8617  H HD2  . TYR B 2 29  ? 44.751  2.466   -14.827 1.00 0.00 ? 29  TYR B HD2  2  
ATOM 8618  H HE1  . TYR B 2 29  ? 40.440  3.278   -17.193 1.00 0.00 ? 29  TYR B HE1  2  
ATOM 8619  H HE2  . TYR B 2 29  ? 42.916  0.788   -14.684 1.00 0.00 ? 29  TYR B HE2  2  
ATOM 8620  H HH   . TYR B 2 29  ? 39.881  1.204   -16.497 1.00 0.00 ? 29  TYR B HH   2  
ATOM 8621  N N    . GLU B 2 30  ? 43.278  5.101   -13.461 1.00 0.00 ? 30  GLU B N    2  
ATOM 8622  C CA   . GLU B 2 30  ? 43.148  4.763   -12.036 1.00 0.00 ? 30  GLU B CA   2  
ATOM 8623  C C    . GLU B 2 30  ? 43.268  3.257   -11.829 1.00 0.00 ? 30  GLU B C    2  
ATOM 8624  O O    . GLU B 2 30  ? 42.959  2.473   -12.725 1.00 0.00 ? 30  GLU B O    2  
ATOM 8625  C CB   . GLU B 2 30  ? 41.790  5.239   -11.513 1.00 0.00 ? 30  GLU B CB   2  
ATOM 8626  C CG   . GLU B 2 30  ? 40.670  4.533   -12.280 1.00 0.00 ? 30  GLU B CG   2  
ATOM 8627  C CD   . GLU B 2 30  ? 39.329  5.185   -11.939 1.00 0.00 ? 30  GLU B CD   2  
ATOM 8628  O OE1  . GLU B 2 30  ? 39.155  6.346   -12.269 1.00 0.00 ? 30  GLU B OE1  2  
ATOM 8629  O OE2  . GLU B 2 30  ? 38.498  4.512   -11.352 1.00 0.00 ? 30  GLU B OE2  2  
ATOM 8630  H H    . GLU B 2 30  ? 42.583  4.791   -14.079 1.00 0.00 ? 30  GLU B H    2  
ATOM 8631  H HA   . GLU B 2 30  ? 43.927  5.253   -11.465 1.00 0.00 ? 30  GLU B HA   2  
ATOM 8632  H HB2  . GLU B 2 30  ? 41.709  5.007   -10.462 1.00 0.00 ? 30  GLU B HB2  2  
ATOM 8633  H HB3  . GLU B 2 30  ? 41.706  6.306   -11.653 1.00 0.00 ? 30  GLU B HB3  2  
ATOM 8634  H HG2  . GLU B 2 30  ? 40.851  4.617   -13.342 1.00 0.00 ? 30  GLU B HG2  2  
ATOM 8635  H HG3  . GLU B 2 30  ? 40.642  3.491   -12.000 1.00 0.00 ? 30  GLU B HG3  2  
ATOM 8636  N N    . THR B 2 31  ? 43.734  2.866   -10.646 1.00 0.00 ? 31  THR B N    2  
ATOM 8637  C CA   . THR B 2 31  ? 43.908  1.450   -10.325 1.00 0.00 ? 31  THR B CA   2  
ATOM 8638  C C    . THR B 2 31  ? 42.597  0.676   -10.515 1.00 0.00 ? 31  THR B C    2  
ATOM 8639  O O    . THR B 2 31  ? 42.087  0.565   -11.628 1.00 0.00 ? 31  THR B O    2  
ATOM 8640  C CB   . THR B 2 31  ? 44.394  1.276   -8.871  1.00 0.00 ? 31  THR B CB   2  
ATOM 8641  O OG1  . THR B 2 31  ? 43.524  1.981   -7.996  1.00 0.00 ? 31  THR B OG1  2  
ATOM 8642  C CG2  . THR B 2 31  ? 45.813  1.828   -8.735  1.00 0.00 ? 31  THR B CG2  2  
ATOM 8643  H H    . THR B 2 31  ? 43.979  3.546   -9.983  1.00 0.00 ? 31  THR B H    2  
ATOM 8644  H HA   . THR B 2 31  ? 44.652  1.036   -10.988 1.00 0.00 ? 31  THR B HA   2  
ATOM 8645  H HB   . THR B 2 31  ? 44.392  0.228   -8.614  1.00 0.00 ? 31  THR B HB   2  
ATOM 8646  H HG1  . THR B 2 31  ? 44.065  2.483   -7.381  1.00 0.00 ? 31  THR B HG1  2  
ATOM 8647  H HG21 . THR B 2 31  ? 45.823  2.870   -9.017  1.00 0.00 ? 31  THR B HG21 2  
ATOM 8648  H HG22 . THR B 2 31  ? 46.479  1.273   -9.380  1.00 0.00 ? 31  THR B HG22 2  
ATOM 8649  H HG23 . THR B 2 31  ? 46.140  1.729   -7.711  1.00 0.00 ? 31  THR B HG23 2  
ATOM 8650  N N    . SER B 2 32  ? 42.061  0.130   -9.421  1.00 0.00 ? 32  SER B N    2  
ATOM 8651  C CA   . SER B 2 32  ? 40.815  -0.641  -9.482  1.00 0.00 ? 32  SER B CA   2  
ATOM 8652  C C    . SER B 2 32  ? 40.041  -0.508  -8.175  1.00 0.00 ? 32  SER B C    2  
ATOM 8653  O O    . SER B 2 32  ? 40.209  0.465   -7.439  1.00 0.00 ? 32  SER B O    2  
ATOM 8654  C CB   . SER B 2 32  ? 41.129  -2.114  -9.742  1.00 0.00 ? 32  SER B CB   2  
ATOM 8655  O OG   . SER B 2 32  ? 41.978  -2.219  -10.878 1.00 0.00 ? 32  SER B OG   2  
ATOM 8656  H H    . SER B 2 32  ? 42.518  0.242   -8.562  1.00 0.00 ? 32  SER B H    2  
ATOM 8657  H HA   . SER B 2 32  ? 40.198  -0.267  -10.288 1.00 0.00 ? 32  SER B HA   2  
ATOM 8658  H HB2  . SER B 2 32  ? 41.628  -2.535  -8.886  1.00 0.00 ? 32  SER B HB2  2  
ATOM 8659  H HB3  . SER B 2 32  ? 40.207  -2.651  -9.919  1.00 0.00 ? 32  SER B HB3  2  
ATOM 8660  H HG   . SER B 2 32  ? 42.844  -1.887  -10.632 1.00 0.00 ? 32  SER B HG   2  
ATOM 8661  N N    . SER B 2 33  ? 39.187  -1.496  -7.891  1.00 0.00 ? 33  SER B N    2  
ATOM 8662  C CA   . SER B 2 33  ? 38.374  -1.497  -6.667  1.00 0.00 ? 33  SER B CA   2  
ATOM 8663  C C    . SER B 2 33  ? 38.577  -2.797  -5.897  1.00 0.00 ? 33  SER B C    2  
ATOM 8664  O O    . SER B 2 33  ? 38.381  -2.848  -4.683  1.00 0.00 ? 33  SER B O    2  
ATOM 8665  C CB   . SER B 2 33  ? 36.897  -1.347  -7.028  1.00 0.00 ? 33  SER B CB   2  
ATOM 8666  O OG   . SER B 2 33  ? 36.682  -0.065  -7.604  1.00 0.00 ? 33  SER B OG   2  
ATOM 8667  H H    . SER B 2 33  ? 39.099  -2.242  -8.519  1.00 0.00 ? 33  SER B H    2  
ATOM 8668  H HA   . SER B 2 33  ? 38.663  -0.669  -6.031  1.00 0.00 ? 33  SER B HA   2  
ATOM 8669  H HB2  . SER B 2 33  ? 36.618  -2.107  -7.739  1.00 0.00 ? 33  SER B HB2  2  
ATOM 8670  H HB3  . SER B 2 33  ? 36.296  -1.456  -6.135  1.00 0.00 ? 33  SER B HB3  2  
ATOM 8671  H HG   . SER B 2 33  ? 37.257  0.561   -7.159  1.00 0.00 ? 33  SER B HG   2  
ATOM 8672  N N    . LEU B 2 34  ? 38.972  -3.845  -6.612  1.00 0.00 ? 34  LEU B N    2  
ATOM 8673  C CA   . LEU B 2 34  ? 39.200  -5.141  -5.996  1.00 0.00 ? 34  LEU B CA   2  
ATOM 8674  C C    . LEU B 2 34  ? 40.161  -5.003  -4.814  1.00 0.00 ? 34  LEU B C    2  
ATOM 8675  O O    . LEU B 2 34  ? 40.344  -5.941  -4.038  1.00 0.00 ? 34  LEU B O    2  
ATOM 8676  C CB   . LEU B 2 34  ? 39.790  -6.107  -7.037  1.00 0.00 ? 34  LEU B CB   2  
ATOM 8677  C CG   . LEU B 2 34  ? 38.713  -6.603  -8.030  1.00 0.00 ? 34  LEU B CG   2  
ATOM 8678  C CD1  . LEU B 2 34  ? 37.785  -7.638  -7.367  1.00 0.00 ? 34  LEU B CD1  2  
ATOM 8679  C CD2  . LEU B 2 34  ? 37.874  -5.431  -8.565  1.00 0.00 ? 34  LEU B CD2  2  
ATOM 8680  H H    . LEU B 2 34  ? 39.111  -3.748  -7.575  1.00 0.00 ? 34  LEU B H    2  
ATOM 8681  H HA   . LEU B 2 34  ? 38.265  -5.531  -5.637  1.00 0.00 ? 34  LEU B HA   2  
ATOM 8682  H HB2  . LEU B 2 34  ? 40.563  -5.592  -7.590  1.00 0.00 ? 34  LEU B HB2  2  
ATOM 8683  H HB3  . LEU B 2 34  ? 40.229  -6.956  -6.534  1.00 0.00 ? 34  LEU B HB3  2  
ATOM 8684  H HG   . LEU B 2 34  ? 39.214  -7.073  -8.862  1.00 0.00 ? 34  LEU B HG   2  
ATOM 8685  H HD11 . LEU B 2 34  ? 38.365  -8.316  -6.760  1.00 0.00 ? 34  LEU B HD11 2  
ATOM 8686  H HD12 . LEU B 2 34  ? 37.270  -8.199  -8.134  1.00 0.00 ? 34  LEU B HD12 2  
ATOM 8687  H HD13 . LEU B 2 34  ? 37.056  -7.136  -6.749  1.00 0.00 ? 34  LEU B HD13 2  
ATOM 8688  H HD21 . LEU B 2 34  ? 38.528  -4.661  -8.942  1.00 0.00 ? 34  LEU B HD21 2  
ATOM 8689  H HD22 . LEU B 2 34  ? 37.256  -5.031  -7.775  1.00 0.00 ? 34  LEU B HD22 2  
ATOM 8690  H HD23 . LEU B 2 34  ? 37.242  -5.785  -9.366  1.00 0.00 ? 34  LEU B HD23 2  
ATOM 8691  N N    . CYS B 2 35  ? 40.767  -3.818  -4.681  1.00 0.00 ? 35  CYS B N    2  
ATOM 8692  C CA   . CYS B 2 35  ? 41.708  -3.538  -3.589  1.00 0.00 ? 35  CYS B CA   2  
ATOM 8693  C C    . CYS B 2 35  ? 41.192  -2.369  -2.752  1.00 0.00 ? 35  CYS B C    2  
ATOM 8694  O O    . CYS B 2 35  ? 40.929  -1.288  -3.276  1.00 0.00 ? 35  CYS B O    2  
ATOM 8695  C CB   . CYS B 2 35  ? 43.091  -3.202  -4.165  1.00 0.00 ? 35  CYS B CB   2  
ATOM 8696  S SG   . CYS B 2 35  ? 42.915  -2.040  -5.543  1.00 0.00 ? 35  CYS B SG   2  
ATOM 8697  H H    . CYS B 2 35  ? 40.571  -3.109  -5.326  1.00 0.00 ? 35  CYS B H    2  
ATOM 8698  H HA   . CYS B 2 35  ? 41.800  -4.407  -2.949  1.00 0.00 ? 35  CYS B HA   2  
ATOM 8699  H HB2  . CYS B 2 35  ? 43.706  -2.758  -3.396  1.00 0.00 ? 35  CYS B HB2  2  
ATOM 8700  H HB3  . CYS B 2 35  ? 43.561  -4.109  -4.519  1.00 0.00 ? 35  CYS B HB3  2  
ATOM 8701  N N    . SER B 2 36  ? 41.034  -2.604  -1.453  1.00 0.00 ? 36  SER B N    2  
ATOM 8702  C CA   . SER B 2 36  ? 40.531  -1.573  -0.551  1.00 0.00 ? 36  SER B CA   2  
ATOM 8703  C C    . SER B 2 36  ? 41.596  -0.516  -0.265  1.00 0.00 ? 36  SER B C    2  
ATOM 8704  O O    . SER B 2 36  ? 41.752  -0.079  0.874   1.00 0.00 ? 36  SER B O    2  
ATOM 8705  C CB   . SER B 2 36  ? 40.086  -2.210  0.766   1.00 0.00 ? 36  SER B CB   2  
ATOM 8706  O OG   . SER B 2 36  ? 39.197  -3.285  0.490   1.00 0.00 ? 36  SER B OG   2  
ATOM 8707  H H    . SER B 2 36  ? 41.249  -3.491  -1.097  1.00 0.00 ? 36  SER B H    2  
ATOM 8708  H HA   . SER B 2 36  ? 39.678  -1.094  -1.006  1.00 0.00 ? 36  SER B HA   2  
ATOM 8709  H HB2  . SER B 2 36  ? 40.946  -2.588  1.294   1.00 0.00 ? 36  SER B HB2  2  
ATOM 8710  H HB3  . SER B 2 36  ? 39.590  -1.466  1.376   1.00 0.00 ? 36  SER B HB3  2  
ATOM 8711  H HG   . SER B 2 36  ? 39.557  -3.785  -0.246  1.00 0.00 ? 36  SER B HG   2  
ATOM 8712  N N    . GLN B 2 37  ? 42.321  -0.104  -1.301  1.00 0.00 ? 37  GLN B N    2  
ATOM 8713  C CA   . GLN B 2 37  ? 43.363  0.905   -1.150  1.00 0.00 ? 37  GLN B CA   2  
ATOM 8714  C C    . GLN B 2 37  ? 43.768  1.406   -2.537  1.00 0.00 ? 37  GLN B C    2  
ATOM 8715  O O    . GLN B 2 37  ? 44.932  1.311   -2.927  1.00 0.00 ? 37  GLN B O    2  
ATOM 8716  C CB   . GLN B 2 37  ? 44.579  0.306   -0.435  1.00 0.00 ? 37  GLN B CB   2  
ATOM 8717  C CG   . GLN B 2 37  ? 44.926  -1.047  -1.058  1.00 0.00 ? 37  GLN B CG   2  
ATOM 8718  C CD   . GLN B 2 37  ? 46.183  -1.609  -0.390  1.00 0.00 ? 37  GLN B CD   2  
ATOM 8719  O OE1  . GLN B 2 37  ? 47.016  -2.208  -1.041  1.00 0.00 ? 37  GLN B OE1  2  
ATOM 8720  N NE2  . GLN B 2 37  ? 46.357  -1.438  0.892   1.00 0.00 ? 37  GLN B NE2  2  
ATOM 8721  H H    . GLN B 2 37  ? 42.170  -0.472  -2.196  1.00 0.00 ? 37  GLN B H    2  
ATOM 8722  H HA   . GLN B 2 37  ? 42.981  1.730   -0.567  1.00 0.00 ? 37  GLN B HA   2  
ATOM 8723  H HB2  . GLN B 2 37  ? 45.421  0.976   -0.532  1.00 0.00 ? 37  GLN B HB2  2  
ATOM 8724  H HB3  . GLN B 2 37  ? 44.348  0.169   0.611   1.00 0.00 ? 37  GLN B HB3  2  
ATOM 8725  H HG2  . GLN B 2 37  ? 44.104  -1.732  -0.913  1.00 0.00 ? 37  GLN B HG2  2  
ATOM 8726  H HG3  . GLN B 2 37  ? 45.108  -0.922  -2.115  1.00 0.00 ? 37  GLN B HG3  2  
ATOM 8727  H HE21 . GLN B 2 37  ? 45.686  -0.954  1.418   1.00 0.00 ? 37  GLN B HE21 2  
ATOM 8728  H HE22 . GLN B 2 37  ? 47.158  -1.793  1.330   1.00 0.00 ? 37  GLN B HE22 2  
ATOM 8729  N N    . PRO B 2 38  ? 42.792  1.917   -3.312  1.00 0.00 ? 38  PRO B N    2  
ATOM 8730  C CA   . PRO B 2 38  ? 43.033  2.402   -4.686  1.00 0.00 ? 38  PRO B CA   2  
ATOM 8731  C C    . PRO B 2 38  ? 43.898  3.667   -4.732  1.00 0.00 ? 38  PRO B C    2  
ATOM 8732  O O    . PRO B 2 38  ? 44.593  3.996   -3.773  1.00 0.00 ? 38  PRO B O    2  
ATOM 8733  C CB   . PRO B 2 38  ? 41.611  2.654   -5.234  1.00 0.00 ? 38  PRO B CB   2  
ATOM 8734  C CG   . PRO B 2 38  ? 40.791  2.947   -4.021  1.00 0.00 ? 38  PRO B CG   2  
ATOM 8735  C CD   . PRO B 2 38  ? 41.377  2.068   -2.916  1.00 0.00 ? 38  PRO B CD   2  
ATOM 8736  H HA   . PRO B 2 38  ? 43.504  1.625   -5.267  1.00 0.00 ? 38  PRO B HA   2  
ATOM 8737  H HB2  . PRO B 2 38  ? 41.598  3.493   -5.920  1.00 0.00 ? 38  PRO B HB2  2  
ATOM 8738  H HB3  . PRO B 2 38  ? 41.235  1.766   -5.726  1.00 0.00 ? 38  PRO B HB3  2  
ATOM 8739  H HG2  . PRO B 2 38  ? 40.877  3.997   -3.758  1.00 0.00 ? 38  PRO B HG2  2  
ATOM 8740  H HG3  . PRO B 2 38  ? 39.754  2.689   -4.187  1.00 0.00 ? 38  PRO B HG3  2  
ATOM 8741  H HD2  . PRO B 2 38  ? 41.295  2.562   -1.956  1.00 0.00 ? 38  PRO B HD2  2  
ATOM 8742  H HD3  . PRO B 2 38  ? 40.893  1.104   -2.892  1.00 0.00 ? 38  PRO B HD3  2  
ATOM 8743  N N    . ALA B 2 39  ? 43.834  4.359   -5.870  1.00 0.00 ? 39  ALA B N    2  
ATOM 8744  C CA   . ALA B 2 39  ? 44.598  5.589   -6.084  1.00 0.00 ? 39  ALA B CA   2  
ATOM 8745  C C    . ALA B 2 39  ? 44.551  5.973   -7.562  1.00 0.00 ? 39  ALA B C    2  
ATOM 8746  O O    . ALA B 2 39  ? 43.976  5.253   -8.379  1.00 0.00 ? 39  ALA B O    2  
ATOM 8747  C CB   . ALA B 2 39  ? 46.047  5.403   -5.622  1.00 0.00 ? 39  ALA B CB   2  
ATOM 8748  H H    . ALA B 2 39  ? 43.243  4.026   -6.578  1.00 0.00 ? 39  ALA B H    2  
ATOM 8749  H HA   . ALA B 2 39  ? 44.143  6.384   -5.509  1.00 0.00 ? 39  ALA B HA   2  
ATOM 8750  H HB1  . ALA B 2 39  ? 46.118  5.599   -4.563  1.00 0.00 ? 39  ALA B HB1  2  
ATOM 8751  H HB2  . ALA B 2 39  ? 46.697  6.088   -6.151  1.00 0.00 ? 39  ALA B HB2  2  
ATOM 8752  H HB3  . ALA B 2 39  ? 46.360  4.388   -5.820  1.00 0.00 ? 39  ALA B HB3  2  
ATOM 8753  N N    . VAL B 2 40  ? 45.164  7.112   -7.900  1.00 0.00 ? 40  VAL B N    2  
ATOM 8754  C CA   . VAL B 2 40  ? 45.195  7.591   -9.287  1.00 0.00 ? 40  VAL B CA   2  
ATOM 8755  C C    . VAL B 2 40  ? 46.594  7.425   -9.866  1.00 0.00 ? 40  VAL B C    2  
ATOM 8756  O O    . VAL B 2 40  ? 47.592  7.754   -9.224  1.00 0.00 ? 40  VAL B O    2  
ATOM 8757  C CB   . VAL B 2 40  ? 44.782  9.081   -9.359  1.00 0.00 ? 40  VAL B CB   2  
ATOM 8758  C CG1  . VAL B 2 40  ? 45.034  9.642   -10.769 1.00 0.00 ? 40  VAL B CG1  2  
ATOM 8759  C CG2  . VAL B 2 40  ? 43.291  9.191   -9.034  1.00 0.00 ? 40  VAL B CG2  2  
ATOM 8760  H H    . VAL B 2 40  ? 45.615  7.641   -7.208  1.00 0.00 ? 40  VAL B H    2  
ATOM 8761  H HA   . VAL B 2 40  ? 44.504  7.013   -9.890  1.00 0.00 ? 40  VAL B HA   2  
ATOM 8762  H HB   . VAL B 2 40  ? 45.352  9.648   -8.638  1.00 0.00 ? 40  VAL B HB   2  
ATOM 8763  H HG11 . VAL B 2 40  ? 46.094  9.786   -10.915 1.00 0.00 ? 40  VAL B HG11 2  
ATOM 8764  H HG12 . VAL B 2 40  ? 44.526  10.589  -10.880 1.00 0.00 ? 40  VAL B HG12 2  
ATOM 8765  H HG13 . VAL B 2 40  ? 44.662  8.945   -11.504 1.00 0.00 ? 40  VAL B HG13 2  
ATOM 8766  H HG21 . VAL B 2 40  ? 42.976  10.220  -9.122  1.00 0.00 ? 40  VAL B HG21 2  
ATOM 8767  H HG22 . VAL B 2 40  ? 43.115  8.844   -8.027  1.00 0.00 ? 40  VAL B HG22 2  
ATOM 8768  H HG23 . VAL B 2 40  ? 42.733  8.580   -9.729  1.00 0.00 ? 40  VAL B HG23 2  
ATOM 8769  N N    . VAL B 2 41  ? 46.650  6.896   -11.086 1.00 0.00 ? 41  VAL B N    2  
ATOM 8770  C CA   . VAL B 2 41  ? 47.921  6.657   -11.776 1.00 0.00 ? 41  VAL B CA   2  
ATOM 8771  C C    . VAL B 2 41  ? 48.059  7.583   -12.970 1.00 0.00 ? 41  VAL B C    2  
ATOM 8772  O O    . VAL B 2 41  ? 47.083  7.845   -13.666 1.00 0.00 ? 41  VAL B O    2  
ATOM 8773  C CB   . VAL B 2 41  ? 47.993  5.198   -12.265 1.00 0.00 ? 41  VAL B CB   2  
ATOM 8774  C CG1  . VAL B 2 41  ? 49.383  4.901   -12.828 1.00 0.00 ? 41  VAL B CG1  2  
ATOM 8775  C CG2  . VAL B 2 41  ? 47.706  4.254   -11.093 1.00 0.00 ? 41  VAL B CG2  2  
ATOM 8776  H H    . VAL B 2 41  ? 45.810  6.646   -11.530 1.00 0.00 ? 41  VAL B H    2  
ATOM 8777  H HA   . VAL B 2 41  ? 48.743  6.841   -11.106 1.00 0.00 ? 41  VAL B HA   2  
ATOM 8778  H HB   . VAL B 2 41  ? 47.256  5.044   -13.039 1.00 0.00 ? 41  VAL B HB   2  
ATOM 8779  H HG11 . VAL B 2 41  ? 49.485  3.838   -12.985 1.00 0.00 ? 41  VAL B HG11 2  
ATOM 8780  H HG12 . VAL B 2 41  ? 50.134  5.234   -12.129 1.00 0.00 ? 41  VAL B HG12 2  
ATOM 8781  H HG13 . VAL B 2 41  ? 49.510  5.418   -13.768 1.00 0.00 ? 41  VAL B HG13 2  
ATOM 8782  H HG21 . VAL B 2 41  ? 46.747  4.497   -10.660 1.00 0.00 ? 41  VAL B HG21 2  
ATOM 8783  H HG22 . VAL B 2 41  ? 48.478  4.365   -10.345 1.00 0.00 ? 41  VAL B HG22 2  
ATOM 8784  H HG23 . VAL B 2 41  ? 47.693  3.234   -11.447 1.00 0.00 ? 41  VAL B HG23 2  
ATOM 8785  N N    . PHE B 2 42  ? 49.281  8.076   -13.209 1.00 0.00 ? 42  PHE B N    2  
ATOM 8786  C CA   . PHE B 2 42  ? 49.542  8.979   -14.340 1.00 0.00 ? 42  PHE B CA   2  
ATOM 8787  C C    . PHE B 2 42  ? 50.564  8.367   -15.292 1.00 0.00 ? 42  PHE B C    2  
ATOM 8788  O O    . PHE B 2 42  ? 51.431  7.599   -14.874 1.00 0.00 ? 42  PHE B O    2  
ATOM 8789  C CB   . PHE B 2 42  ? 50.047  10.336  -13.840 1.00 0.00 ? 42  PHE B CB   2  
ATOM 8790  C CG   . PHE B 2 42  ? 51.341  10.177  -13.072 1.00 0.00 ? 42  PHE B CG   2  
ATOM 8791  C CD1  . PHE B 2 42  ? 52.561  10.005  -13.766 1.00 0.00 ? 42  PHE B CD1  2  
ATOM 8792  C CD2  . PHE B 2 42  ? 51.334  10.220  -11.659 1.00 0.00 ? 42  PHE B CD2  2  
ATOM 8793  C CE1  . PHE B 2 42  ? 53.769  9.884   -13.045 1.00 0.00 ? 42  PHE B CE1  2  
ATOM 8794  C CE2  . PHE B 2 42  ? 52.543  10.091  -10.942 1.00 0.00 ? 42  PHE B CE2  2  
ATOM 8795  C CZ   . PHE B 2 42  ? 53.758  9.925   -11.635 1.00 0.00 ? 42  PHE B CZ   2  
ATOM 8796  H H    . PHE B 2 42  ? 50.024  7.822   -12.618 1.00 0.00 ? 42  PHE B H    2  
ATOM 8797  H HA   . PHE B 2 42  ? 48.630  9.146   -14.887 1.00 0.00 ? 42  PHE B HA   2  
ATOM 8798  H HB2  . PHE B 2 42  ? 50.217  10.985  -14.686 1.00 0.00 ? 42  PHE B HB2  2  
ATOM 8799  H HB3  . PHE B 2 42  ? 49.299  10.780  -13.199 1.00 0.00 ? 42  PHE B HB3  2  
ATOM 8800  H HD1  . PHE B 2 42  ? 52.571  9.975   -14.845 1.00 0.00 ? 42  PHE B HD1  2  
ATOM 8801  H HD2  . PHE B 2 42  ? 50.403  10.348  -11.126 1.00 0.00 ? 42  PHE B HD2  2  
ATOM 8802  H HE1  . PHE B 2 42  ? 54.701  9.753   -13.572 1.00 0.00 ? 42  PHE B HE1  2  
ATOM 8803  H HE2  . PHE B 2 42  ? 52.538  10.123  -9.864  1.00 0.00 ? 42  PHE B HE2  2  
ATOM 8804  H HZ   . PHE B 2 42  ? 54.685  9.844   -11.086 1.00 0.00 ? 42  PHE B HZ   2  
ATOM 8805  N N    . GLN B 2 43  ? 50.453  8.716   -16.578 1.00 0.00 ? 43  GLN B N    2  
ATOM 8806  C CA   . GLN B 2 43  ? 51.367  8.207   -17.608 1.00 0.00 ? 43  GLN B CA   2  
ATOM 8807  C C    . GLN B 2 43  ? 52.174  9.359   -18.197 1.00 0.00 ? 43  GLN B C    2  
ATOM 8808  O O    . GLN B 2 43  ? 51.639  10.244  -18.866 1.00 0.00 ? 43  GLN B O    2  
ATOM 8809  C CB   . GLN B 2 43  ? 50.557  7.475   -18.697 1.00 0.00 ? 43  GLN B CB   2  
ATOM 8810  C CG   . GLN B 2 43  ? 51.293  7.476   -20.049 1.00 0.00 ? 43  GLN B CG   2  
ATOM 8811  C CD   . GLN B 2 43  ? 50.641  6.466   -20.996 1.00 0.00 ? 43  GLN B CD   2  
ATOM 8812  O OE1  . GLN B 2 43  ? 50.783  5.272   -20.824 1.00 0.00 ? 43  GLN B OE1  2  
ATOM 8813  N NE2  . GLN B 2 43  ? 49.924  6.898   -21.998 1.00 0.00 ? 43  GLN B NE2  2  
ATOM 8814  H H    . GLN B 2 43  ? 49.743  9.334   -16.843 1.00 0.00 ? 43  GLN B H    2  
ATOM 8815  H HA   . GLN B 2 43  ? 52.062  7.503   -17.160 1.00 0.00 ? 43  GLN B HA   2  
ATOM 8816  H HB2  . GLN B 2 43  ? 50.406  6.457   -18.384 1.00 0.00 ? 43  GLN B HB2  2  
ATOM 8817  H HB3  . GLN B 2 43  ? 49.598  7.958   -18.814 1.00 0.00 ? 43  GLN B HB3  2  
ATOM 8818  H HG2  . GLN B 2 43  ? 51.238  8.463   -20.484 1.00 0.00 ? 43  GLN B HG2  2  
ATOM 8819  H HG3  . GLN B 2 43  ? 52.328  7.206   -19.895 1.00 0.00 ? 43  GLN B HG3  2  
ATOM 8820  H HE21 . GLN B 2 43  ? 49.809  7.862   -22.137 1.00 0.00 ? 43  GLN B HE21 2  
ATOM 8821  H HE22 . GLN B 2 43  ? 49.502  6.261   -22.610 1.00 0.00 ? 43  GLN B HE22 2  
ATOM 8822  N N    . THR B 2 44  ? 53.462  9.333   -17.913 1.00 0.00 ? 44  THR B N    2  
ATOM 8823  C CA   . THR B 2 44  ? 54.376  10.370  -18.376 1.00 0.00 ? 44  THR B CA   2  
ATOM 8824  C C    . THR B 2 44  ? 54.706  10.222  -19.862 1.00 0.00 ? 44  THR B C    2  
ATOM 8825  O O    . THR B 2 44  ? 53.835  9.944   -20.688 1.00 0.00 ? 44  THR B O    2  
ATOM 8826  C CB   . THR B 2 44  ? 55.689  10.330  -17.561 1.00 0.00 ? 44  THR B CB   2  
ATOM 8827  O OG1  . THR B 2 44  ? 56.533  9.311   -18.076 1.00 0.00 ? 44  THR B OG1  2  
ATOM 8828  C CG2  . THR B 2 44  ? 55.373  10.039  -16.096 1.00 0.00 ? 44  THR B CG2  2  
ATOM 8829  H H    . THR B 2 44  ? 53.801  8.605   -17.352 1.00 0.00 ? 44  THR B H    2  
ATOM 8830  H HA   . THR B 2 44  ? 53.918  11.330  -18.230 1.00 0.00 ? 44  THR B HA   2  
ATOM 8831  H HB   . THR B 2 44  ? 56.193  11.283  -17.635 1.00 0.00 ? 44  THR B HB   2  
ATOM 8832  H HG1  . THR B 2 44  ? 57.324  9.278   -17.534 1.00 0.00 ? 44  THR B HG1  2  
ATOM 8833  H HG21 . THR B 2 44  ? 54.647  10.751  -15.736 1.00 0.00 ? 44  THR B HG21 2  
ATOM 8834  H HG22 . THR B 2 44  ? 56.277  10.117  -15.510 1.00 0.00 ? 44  THR B HG22 2  
ATOM 8835  H HG23 . THR B 2 44  ? 54.972  9.040   -16.006 1.00 0.00 ? 44  THR B HG23 2  
ATOM 8836  N N    . ALA B 2 45  ? 55.981  10.424  -20.175 1.00 0.00 ? 45  ALA B N    2  
ATOM 8837  C CA   . ALA B 2 45  ? 56.481  10.335  -21.550 1.00 0.00 ? 45  ALA B CA   2  
ATOM 8838  C C    . ALA B 2 45  ? 57.729  9.461   -21.624 1.00 0.00 ? 45  ALA B C    2  
ATOM 8839  O O    . ALA B 2 45  ? 57.956  8.783   -22.627 1.00 0.00 ? 45  ALA B O    2  
ATOM 8840  C CB   . ALA B 2 45  ? 56.797  11.730  -22.067 1.00 0.00 ? 45  ALA B CB   2  
ATOM 8841  H H    . ALA B 2 45  ? 56.585  10.637  -19.437 1.00 0.00 ? 45  ALA B H    2  
ATOM 8842  H HA   . ALA B 2 45  ? 55.722  9.897   -22.185 1.00 0.00 ? 45  ALA B HA   2  
ATOM 8843  H HB1  . ALA B 2 45  ? 57.443  12.235  -21.366 1.00 0.00 ? 45  ALA B HB1  2  
ATOM 8844  H HB2  . ALA B 2 45  ? 55.880  12.289  -22.178 1.00 0.00 ? 45  ALA B HB2  2  
ATOM 8845  H HB3  . ALA B 2 45  ? 57.293  11.656  -23.025 1.00 0.00 ? 45  ALA B HB3  2  
ATOM 8846  N N    . ALA B 2 46  ? 58.534  9.472   -20.557 1.00 0.00 ? 46  ALA B N    2  
ATOM 8847  C CA   . ALA B 2 46  ? 59.763  8.665   -20.504 1.00 0.00 ? 46  ALA B CA   2  
ATOM 8848  C C    . ALA B 2 46  ? 59.779  7.771   -19.266 1.00 0.00 ? 46  ALA B C    2  
ATOM 8849  O O    . ALA B 2 46  ? 60.818  7.612   -18.625 1.00 0.00 ? 46  ALA B O    2  
ATOM 8850  C CB   . ALA B 2 46  ? 60.977  9.580   -20.503 1.00 0.00 ? 46  ALA B CB   2  
ATOM 8851  H H    . ALA B 2 46  ? 58.288  10.017  -19.781 1.00 0.00 ? 46  ALA B H    2  
ATOM 8852  H HA   . ALA B 2 46  ? 59.819  8.028   -21.378 1.00 0.00 ? 46  ALA B HA   2  
ATOM 8853  H HB1  . ALA B 2 46  ? 61.868  9.001   -20.306 1.00 0.00 ? 46  ALA B HB1  2  
ATOM 8854  H HB2  . ALA B 2 46  ? 60.860  10.335  -19.739 1.00 0.00 ? 46  ALA B HB2  2  
ATOM 8855  H HB3  . ALA B 2 46  ? 61.064  10.052  -21.468 1.00 0.00 ? 46  ALA B HB3  2  
ATOM 8856  N N    . SER B 2 47  ? 58.629  7.185   -18.929 1.00 0.00 ? 47  SER B N    2  
ATOM 8857  C CA   . SER B 2 47  ? 58.534  6.305   -17.758 1.00 0.00 ? 47  SER B CA   2  
ATOM 8858  C C    . SER B 2 47  ? 57.594  5.135   -18.037 1.00 0.00 ? 47  SER B C    2  
ATOM 8859  O O    . SER B 2 47  ? 58.045  4.055   -18.412 1.00 0.00 ? 47  SER B O    2  
ATOM 8860  C CB   . SER B 2 47  ? 58.038  7.095   -16.543 1.00 0.00 ? 47  SER B CB   2  
ATOM 8861  O OG   . SER B 2 47  ? 58.074  6.257   -15.395 1.00 0.00 ? 47  SER B OG   2  
ATOM 8862  H H    . SER B 2 47  ? 57.829  7.345   -19.473 1.00 0.00 ? 47  SER B H    2  
ATOM 8863  H HA   . SER B 2 47  ? 59.510  5.905   -17.529 1.00 0.00 ? 47  SER B HA   2  
ATOM 8864  H HB2  . SER B 2 47  ? 58.678  7.945   -16.381 1.00 0.00 ? 47  SER B HB2  2  
ATOM 8865  H HB3  . SER B 2 47  ? 57.029  7.436   -16.720 1.00 0.00 ? 47  SER B HB3  2  
ATOM 8866  H HG   . SER B 2 47  ? 57.239  5.786   -15.344 1.00 0.00 ? 47  SER B HG   2  
ATOM 8867  N N    . ALA B 2 48  ? 56.290  5.375   -17.865 1.00 0.00 ? 48  ALA B N    2  
ATOM 8868  C CA   . ALA B 2 48  ? 55.254  4.359   -18.106 1.00 0.00 ? 48  ALA B CA   2  
ATOM 8869  C C    . ALA B 2 48  ? 54.019  4.677   -17.266 1.00 0.00 ? 48  ALA B C    2  
ATOM 8870  O O    . ALA B 2 48  ? 53.121  5.398   -17.701 1.00 0.00 ? 48  ALA B O    2  
ATOM 8871  C CB   . ALA B 2 48  ? 55.766  2.947   -17.765 1.00 0.00 ? 48  ALA B CB   2  
ATOM 8872  H H    . ALA B 2 48  ? 56.017  6.273   -17.591 1.00 0.00 ? 48  ALA B H    2  
ATOM 8873  H HA   . ALA B 2 48  ? 54.977  4.391   -19.150 1.00 0.00 ? 48  ALA B HA   2  
ATOM 8874  H HB1  . ALA B 2 48  ? 54.936  2.303   -17.502 1.00 0.00 ? 48  ALA B HB1  2  
ATOM 8875  H HB2  . ALA B 2 48  ? 56.450  3.005   -16.932 1.00 0.00 ? 48  ALA B HB2  2  
ATOM 8876  H HB3  . ALA B 2 48  ? 56.279  2.529   -18.620 1.00 0.00 ? 48  ALA B HB3  2  
ATOM 8877  N N    . GLN B 2 49  ? 53.991  4.119   -16.055 1.00 0.00 ? 49  GLN B N    2  
ATOM 8878  C CA   . GLN B 2 49  ? 52.875  4.316   -15.127 1.00 0.00 ? 49  GLN B CA   2  
ATOM 8879  C C    . GLN B 2 49  ? 53.407  4.461   -13.701 1.00 0.00 ? 49  GLN B C    2  
ATOM 8880  O O    . GLN B 2 49  ? 54.281  3.703   -13.281 1.00 0.00 ? 49  GLN B O    2  
ATOM 8881  C CB   . GLN B 2 49  ? 51.924  3.112   -15.192 1.00 0.00 ? 49  GLN B CB   2  
ATOM 8882  C CG   . GLN B 2 49  ? 51.620  2.752   -16.650 1.00 0.00 ? 49  GLN B CG   2  
ATOM 8883  C CD   . GLN B 2 49  ? 50.939  3.936   -17.339 1.00 0.00 ? 49  GLN B CD   2  
ATOM 8884  O OE1  . GLN B 2 49  ? 51.196  4.210   -18.495 1.00 0.00 ? 49  GLN B OE1  2  
ATOM 8885  N NE2  . GLN B 2 49  ? 50.073  4.649   -16.675 1.00 0.00 ? 49  GLN B NE2  2  
ATOM 8886  H H    . GLN B 2 49  ? 54.741  3.553   -15.778 1.00 0.00 ? 49  GLN B H    2  
ATOM 8887  H HA   . GLN B 2 49  ? 52.329  5.212   -15.392 1.00 0.00 ? 49  GLN B HA   2  
ATOM 8888  H HB2  . GLN B 2 49  ? 52.382  2.263   -14.706 1.00 0.00 ? 49  GLN B HB2  2  
ATOM 8889  H HB3  . GLN B 2 49  ? 51.004  3.357   -14.690 1.00 0.00 ? 49  GLN B HB3  2  
ATOM 8890  H HG2  . GLN B 2 49  ? 52.538  2.511   -17.164 1.00 0.00 ? 49  GLN B HG2  2  
ATOM 8891  H HG3  . GLN B 2 49  ? 50.961  1.898   -16.677 1.00 0.00 ? 49  GLN B HG3  2  
ATOM 8892  H HE21 . GLN B 2 49  ? 49.865  4.426   -15.743 1.00 0.00 ? 49  GLN B HE21 2  
ATOM 8893  H HE22 . GLN B 2 49  ? 49.629  5.408   -17.107 1.00 0.00 ? 49  GLN B HE22 2  
ATOM 8894  N N    . VAL B 2 50  ? 52.873  5.431   -12.954 1.00 0.00 ? 50  VAL B N    2  
ATOM 8895  C CA   . VAL B 2 50  ? 53.306  5.653   -11.569 1.00 0.00 ? 50  VAL B CA   2  
ATOM 8896  C C    . VAL B 2 50  ? 52.140  6.188   -10.727 1.00 0.00 ? 50  VAL B C    2  
ATOM 8897  O O    . VAL B 2 50  ? 51.514  7.193   -11.063 1.00 0.00 ? 50  VAL B O    2  
ATOM 8898  C CB   . VAL B 2 50  ? 54.511  6.634   -11.521 1.00 0.00 ? 50  VAL B CB   2  
ATOM 8899  C CG1  . VAL B 2 50  ? 54.723  7.173   -10.095 1.00 0.00 ? 50  VAL B CG1  2  
ATOM 8900  C CG2  . VAL B 2 50  ? 55.783  5.901   -11.975 1.00 0.00 ? 50  VAL B CG2  2  
ATOM 8901  H H    . VAL B 2 50  ? 52.173  6.000   -13.339 1.00 0.00 ? 50  VAL B H    2  
ATOM 8902  H HA   . VAL B 2 50  ? 53.613  4.706   -11.143 1.00 0.00 ? 50  VAL B HA   2  
ATOM 8903  H HB   . VAL B 2 50  ? 54.321  7.455   -12.191 1.00 0.00 ? 50  VAL B HB   2  
ATOM 8904  H HG11 . VAL B 2 50  ? 53.945  7.884   -9.858  1.00 0.00 ? 50  VAL B HG11 2  
ATOM 8905  H HG12 . VAL B 2 50  ? 55.685  7.663   -10.031 1.00 0.00 ? 50  VAL B HG12 2  
ATOM 8906  H HG13 . VAL B 2 50  ? 54.689  6.355   -9.392  1.00 0.00 ? 50  VAL B HG13 2  
ATOM 8907  H HG21 . VAL B 2 50  ? 55.679  5.602   -13.006 1.00 0.00 ? 50  VAL B HG21 2  
ATOM 8908  H HG22 . VAL B 2 50  ? 55.935  5.026   -11.358 1.00 0.00 ? 50  VAL B HG22 2  
ATOM 8909  H HG23 . VAL B 2 50  ? 56.634  6.559   -11.879 1.00 0.00 ? 50  VAL B HG23 2  
ATOM 8910  N N    . CYS B 2 51  ? 51.855  5.468   -9.647  1.00 0.00 ? 51  CYS B N    2  
ATOM 8911  C CA   . CYS B 2 51  ? 50.760  5.799   -8.741  1.00 0.00 ? 51  CYS B CA   2  
ATOM 8912  C C    . CYS B 2 51  ? 51.058  7.035   -7.891  1.00 0.00 ? 51  CYS B C    2  
ATOM 8913  O O    . CYS B 2 51  ? 52.215  7.373   -7.642  1.00 0.00 ? 51  CYS B O    2  
ATOM 8914  C CB   . CYS B 2 51  ? 50.502  4.587   -7.839  1.00 0.00 ? 51  CYS B CB   2  
ATOM 8915  S SG   . CYS B 2 51  ? 48.770  4.555   -7.309  1.00 0.00 ? 51  CYS B SG   2  
ATOM 8916  H H    . CYS B 2 51  ? 52.385  4.668   -9.465  1.00 0.00 ? 51  CYS B H    2  
ATOM 8917  H HA   . CYS B 2 51  ? 49.877  5.985   -9.319  1.00 0.00 ? 51  CYS B HA   2  
ATOM 8918  H HB2  . CYS B 2 51  ? 50.720  3.694   -8.399  1.00 0.00 ? 51  CYS B HB2  2  
ATOM 8919  H HB3  . CYS B 2 51  ? 51.147  4.626   -6.969  1.00 0.00 ? 51  CYS B HB3  2  
ATOM 8920  N N    . ALA B 2 52  ? 49.988  7.693   -7.437  1.00 0.00 ? 52  ALA B N    2  
ATOM 8921  C CA   . ALA B 2 52  ? 50.103  8.885   -6.597  1.00 0.00 ? 52  ALA B CA   2  
ATOM 8922  C C    . ALA B 2 52  ? 48.887  8.974   -5.680  1.00 0.00 ? 52  ALA B C    2  
ATOM 8923  O O    . ALA B 2 52  ? 47.756  8.766   -6.119  1.00 0.00 ? 52  ALA B O    2  
ATOM 8924  C CB   . ALA B 2 52  ? 50.192  10.129  -7.468  1.00 0.00 ? 52  ALA B CB   2  
ATOM 8925  H H    . ALA B 2 52  ? 49.092  7.369   -7.666  1.00 0.00 ? 52  ALA B H    2  
ATOM 8926  H HA   . ALA B 2 52  ? 50.996  8.814   -5.991  1.00 0.00 ? 52  ALA B HA   2  
ATOM 8927  H HB1  . ALA B 2 52  ? 49.409  10.107  -8.210  1.00 0.00 ? 52  ALA B HB1  2  
ATOM 8928  H HB2  . ALA B 2 52  ? 51.152  10.156  -7.958  1.00 0.00 ? 52  ALA B HB2  2  
ATOM 8929  H HB3  . ALA B 2 52  ? 50.079  11.010  -6.852  1.00 0.00 ? 52  ALA B HB3  2  
ATOM 8930  N N    . ASP B 2 53  ? 49.121  9.272   -4.407  1.00 0.00 ? 53  ASP B N    2  
ATOM 8931  C CA   . ASP B 2 53  ? 48.026  9.371   -3.451  1.00 0.00 ? 53  ASP B CA   2  
ATOM 8932  C C    . ASP B 2 53  ? 47.090  10.524  -3.834  1.00 0.00 ? 53  ASP B C    2  
ATOM 8933  O O    . ASP B 2 53  ? 47.555  11.644  -4.034  1.00 0.00 ? 53  ASP B O    2  
ATOM 8934  C CB   . ASP B 2 53  ? 48.583  9.616   -2.048  1.00 0.00 ? 53  ASP B CB   2  
ATOM 8935  C CG   . ASP B 2 53  ? 49.392  8.397   -1.600  1.00 0.00 ? 53  ASP B CG   2  
ATOM 8936  O OD1  . ASP B 2 53  ? 48.826  7.318   -1.564  1.00 0.00 ? 53  ASP B OD1  2  
ATOM 8937  O OD2  . ASP B 2 53  ? 50.563  8.565   -1.302  1.00 0.00 ? 53  ASP B OD2  2  
ATOM 8938  H H    . ASP B 2 53  ? 50.039  9.426   -4.104  1.00 0.00 ? 53  ASP B H    2  
ATOM 8939  H HA   . ASP B 2 53  ? 47.491  8.438   -3.454  1.00 0.00 ? 53  ASP B HA   2  
ATOM 8940  H HB2  . ASP B 2 53  ? 49.221  10.489  -2.061  1.00 0.00 ? 53  ASP B HB2  2  
ATOM 8941  H HB3  . ASP B 2 53  ? 47.766  9.776   -1.360  1.00 0.00 ? 53  ASP B HB3  2  
ATOM 8942  N N    . PRO B 2 54  ? 45.760  10.294  -3.941  1.00 0.00 ? 54  PRO B N    2  
ATOM 8943  C CA   . PRO B 2 54  ? 44.823  11.368  -4.301  1.00 0.00 ? 54  PRO B CA   2  
ATOM 8944  C C    . PRO B 2 54  ? 44.573  12.293  -3.113  1.00 0.00 ? 54  PRO B C    2  
ATOM 8945  O O    . PRO B 2 54  ? 43.802  13.249  -3.203  1.00 0.00 ? 54  PRO B O    2  
ATOM 8946  C CB   . PRO B 2 54  ? 43.549  10.615  -4.708  1.00 0.00 ? 54  PRO B CB   2  
ATOM 8947  C CG   . PRO B 2 54  ? 43.574  9.372   -3.876  1.00 0.00 ? 54  PRO B CG   2  
ATOM 8948  C CD   . PRO B 2 54  ? 45.058  9.009   -3.725  1.00 0.00 ? 54  PRO B CD   2  
ATOM 8949  H HA   . PRO B 2 54  ? 45.200  11.930  -5.140  1.00 0.00 ? 54  PRO B HA   2  
ATOM 8950  H HB2  . PRO B 2 54  ? 42.666  11.207  -4.491  1.00 0.00 ? 54  PRO B HB2  2  
ATOM 8951  H HB3  . PRO B 2 54  ? 43.581  10.359  -5.758  1.00 0.00 ? 54  PRO B HB3  2  
ATOM 8952  H HG2  . PRO B 2 54  ? 43.130  9.566   -2.904  1.00 0.00 ? 54  PRO B HG2  2  
ATOM 8953  H HG3  . PRO B 2 54  ? 43.045  8.569   -4.372  1.00 0.00 ? 54  PRO B HG3  2  
ATOM 8954  H HD2  . PRO B 2 54  ? 45.258  8.625   -2.732  1.00 0.00 ? 54  PRO B HD2  2  
ATOM 8955  H HD3  . PRO B 2 54  ? 45.357  8.293   -4.477  1.00 0.00 ? 54  PRO B HD3  2  
ATOM 8956  N N    . SER B 2 55  ? 45.230  11.989  -2.001  1.00 0.00 ? 55  SER B N    2  
ATOM 8957  C CA   . SER B 2 55  ? 45.077  12.783  -0.790  1.00 0.00 ? 55  SER B CA   2  
ATOM 8958  C C    . SER B 2 55  ? 45.731  14.152  -0.942  1.00 0.00 ? 55  SER B C    2  
ATOM 8959  O O    . SER B 2 55  ? 45.510  15.045  -0.124  1.00 0.00 ? 55  SER B O    2  
ATOM 8960  C CB   . SER B 2 55  ? 45.704  12.048  0.396   1.00 0.00 ? 55  SER B CB   2  
ATOM 8961  O OG   . SER B 2 55  ? 44.992  10.840  0.630   1.00 0.00 ? 55  SER B OG   2  
ATOM 8962  H H    . SER B 2 55  ? 45.824  11.207  -1.994  1.00 0.00 ? 55  SER B H    2  
ATOM 8963  H HA   . SER B 2 55  ? 44.025  12.919  -0.593  1.00 0.00 ? 55  SER B HA   2  
ATOM 8964  H HB2  . SER B 2 55  ? 46.733  11.816  0.175   1.00 0.00 ? 55  SER B HB2  2  
ATOM 8965  H HB3  . SER B 2 55  ? 45.661  12.680  1.273   1.00 0.00 ? 55  SER B HB3  2  
ATOM 8966  H HG   . SER B 2 55  ? 44.138  11.068  1.004   1.00 0.00 ? 55  SER B HG   2  
ATOM 8967  N N    . GLU B 2 56  ? 46.537  14.322  -1.994  1.00 0.00 ? 56  GLU B N    2  
ATOM 8968  C CA   . GLU B 2 56  ? 47.216  15.599  -2.242  1.00 0.00 ? 56  GLU B CA   2  
ATOM 8969  C C    . GLU B 2 56  ? 46.418  16.436  -3.244  1.00 0.00 ? 56  GLU B C    2  
ATOM 8970  O O    . GLU B 2 56  ? 46.026  15.955  -4.307  1.00 0.00 ? 56  GLU B O    2  
ATOM 8971  C CB   . GLU B 2 56  ? 48.633  15.330  -2.777  1.00 0.00 ? 56  GLU B CB   2  
ATOM 8972  C CG   . GLU B 2 56  ? 49.591  15.024  -1.615  1.00 0.00 ? 56  GLU B CG   2  
ATOM 8973  C CD   . GLU B 2 56  ? 49.909  16.315  -0.855  1.00 0.00 ? 56  GLU B CD   2  
ATOM 8974  O OE1  . GLU B 2 56  ? 50.496  17.201  -1.453  1.00 0.00 ? 56  GLU B OE1  2  
ATOM 8975  O OE2  . GLU B 2 56  ? 49.558  16.395  0.310   1.00 0.00 ? 56  GLU B OE2  2  
ATOM 8976  H H    . GLU B 2 56  ? 46.681  13.584  -2.623  1.00 0.00 ? 56  GLU B H    2  
ATOM 8977  H HA   . GLU B 2 56  ? 47.289  16.157  -1.314  1.00 0.00 ? 56  GLU B HA   2  
ATOM 8978  H HB2  . GLU B 2 56  ? 48.605  14.483  -3.440  1.00 0.00 ? 56  GLU B HB2  2  
ATOM 8979  H HB3  . GLU B 2 56  ? 48.990  16.196  -3.315  1.00 0.00 ? 56  GLU B HB3  2  
ATOM 8980  H HG2  . GLU B 2 56  ? 49.127  14.316  -0.944  1.00 0.00 ? 56  GLU B HG2  2  
ATOM 8981  H HG3  . GLU B 2 56  ? 50.505  14.604  -2.005  1.00 0.00 ? 56  GLU B HG3  2  
ATOM 8982  N N    . SER B 2 57  ? 46.167  17.685  -2.872  1.00 0.00 ? 57  SER B N    2  
ATOM 8983  C CA   . SER B 2 57  ? 45.394  18.605  -3.703  1.00 0.00 ? 57  SER B CA   2  
ATOM 8984  C C    . SER B 2 57  ? 45.866  18.638  -5.159  1.00 0.00 ? 57  SER B C    2  
ATOM 8985  O O    . SER B 2 57  ? 45.052  18.515  -6.075  1.00 0.00 ? 57  SER B O    2  
ATOM 8986  C CB   . SER B 2 57  ? 45.481  20.015  -3.118  1.00 0.00 ? 57  SER B CB   2  
ATOM 8987  O OG   . SER B 2 57  ? 44.644  20.886  -3.868  1.00 0.00 ? 57  SER B OG   2  
ATOM 8988  H H    . SER B 2 57  ? 46.489  17.992  -1.999  1.00 0.00 ? 57  SER B H    2  
ATOM 8989  H HA   . SER B 2 57  ? 44.361  18.297  -3.684  1.00 0.00 ? 57  SER B HA   2  
ATOM 8990  H HB2  . SER B 2 57  ? 45.151  20.002  -2.093  1.00 0.00 ? 57  SER B HB2  2  
ATOM 8991  H HB3  . SER B 2 57  ? 46.506  20.358  -3.159  1.00 0.00 ? 57  SER B HB3  2  
ATOM 8992  H HG   . SER B 2 57  ? 43.881  21.101  -3.328  1.00 0.00 ? 57  SER B HG   2  
ATOM 8993  N N    . TRP B 2 58  ? 47.163  18.846  -5.382  1.00 0.00 ? 58  TRP B N    2  
ATOM 8994  C CA   . TRP B 2 58  ? 47.672  18.937  -6.750  1.00 0.00 ? 58  TRP B CA   2  
ATOM 8995  C C    . TRP B 2 58  ? 47.334  17.692  -7.571  1.00 0.00 ? 58  TRP B C    2  
ATOM 8996  O O    . TRP B 2 58  ? 47.109  17.788  -8.777  1.00 0.00 ? 58  TRP B O    2  
ATOM 8997  C CB   . TRP B 2 58  ? 49.183  19.199  -6.761  1.00 0.00 ? 58  TRP B CB   2  
ATOM 8998  C CG   . TRP B 2 58  ? 49.928  18.092  -6.089  1.00 0.00 ? 58  TRP B CG   2  
ATOM 8999  C CD1  . TRP B 2 58  ? 50.244  18.052  -4.773  1.00 0.00 ? 58  TRP B CD1  2  
ATOM 9000  C CD2  . TRP B 2 58  ? 50.479  16.880  -6.680  1.00 0.00 ? 58  TRP B CD2  2  
ATOM 9001  N NE1  . TRP B 2 58  ? 50.955  16.893  -4.515  1.00 0.00 ? 58  TRP B NE1  2  
ATOM 9002  C CE2  . TRP B 2 58  ? 51.124  16.132  -5.654  1.00 0.00 ? 58  TRP B CE2  2  
ATOM 9003  C CE3  . TRP B 2 58  ? 50.482  16.355  -7.996  1.00 0.00 ? 58  TRP B CE3  2  
ATOM 9004  C CZ2  . TRP B 2 58  ? 51.753  14.905  -5.923  1.00 0.00 ? 58  TRP B CZ2  2  
ATOM 9005  C CZ3  . TRP B 2 58  ? 51.112  15.119  -8.272  1.00 0.00 ? 58  TRP B CZ3  2  
ATOM 9006  C CH2  . TRP B 2 58  ? 51.748  14.396  -7.236  1.00 0.00 ? 58  TRP B CH2  2  
ATOM 9007  H H    . TRP B 2 58  ? 47.773  18.970  -4.625  1.00 0.00 ? 58  TRP B H    2  
ATOM 9008  H HA   . TRP B 2 58  ? 47.188  19.780  -7.222  1.00 0.00 ? 58  TRP B HA   2  
ATOM 9009  H HB2  . TRP B 2 58  ? 49.521  19.282  -7.783  1.00 0.00 ? 58  TRP B HB2  2  
ATOM 9010  H HB3  . TRP B 2 58  ? 49.384  20.128  -6.246  1.00 0.00 ? 58  TRP B HB3  2  
ATOM 9011  H HD1  . TRP B 2 58  ? 49.986  18.806  -4.044  1.00 0.00 ? 58  TRP B HD1  2  
ATOM 9012  H HE1  . TRP B 2 58  ? 51.299  16.624  -3.638  1.00 0.00 ? 58  TRP B HE1  2  
ATOM 9013  H HE3  . TRP B 2 58  ? 49.999  16.901  -8.793  1.00 0.00 ? 58  TRP B HE3  2  
ATOM 9014  H HZ2  . TRP B 2 58  ? 52.237  14.355  -5.128  1.00 0.00 ? 58  TRP B HZ2  2  
ATOM 9015  H HZ3  . TRP B 2 58  ? 51.108  14.728  -9.278  1.00 0.00 ? 58  TRP B HZ3  2  
ATOM 9016  H HH2  . TRP B 2 58  ? 52.227  13.453  -7.450  1.00 0.00 ? 58  TRP B HH2  2  
ATOM 9017  N N    . VAL B 2 59  ? 47.279  16.533  -6.930  1.00 0.00 ? 59  VAL B N    2  
ATOM 9018  C CA   . VAL B 2 59  ? 46.943  15.307  -7.651  1.00 0.00 ? 59  VAL B CA   2  
ATOM 9019  C C    . VAL B 2 59  ? 45.507  15.378  -8.148  1.00 0.00 ? 59  VAL B C    2  
ATOM 9020  O O    . VAL B 2 59  ? 45.185  14.896  -9.234  1.00 0.00 ? 59  VAL B O    2  
ATOM 9021  C CB   . VAL B 2 59  ? 47.083  14.074  -6.744  1.00 0.00 ? 59  VAL B CB   2  
ATOM 9022  C CG1  . VAL B 2 59  ? 46.812  12.806  -7.556  1.00 0.00 ? 59  VAL B CG1  2  
ATOM 9023  C CG2  . VAL B 2 59  ? 48.500  14.030  -6.187  1.00 0.00 ? 59  VAL B CG2  2  
ATOM 9024  H H    . VAL B 2 59  ? 47.453  16.499  -5.967  1.00 0.00 ? 59  VAL B H    2  
ATOM 9025  H HA   . VAL B 2 59  ? 47.606  15.200  -8.495  1.00 0.00 ? 59  VAL B HA   2  
ATOM 9026  H HB   . VAL B 2 59  ? 46.375  14.141  -5.932  1.00 0.00 ? 59  VAL B HB   2  
ATOM 9027  H HG11 . VAL B 2 59  ? 47.068  11.939  -6.965  1.00 0.00 ? 59  VAL B HG11 2  
ATOM 9028  H HG12 . VAL B 2 59  ? 47.412  12.818  -8.455  1.00 0.00 ? 59  VAL B HG12 2  
ATOM 9029  H HG13 . VAL B 2 59  ? 45.767  12.764  -7.821  1.00 0.00 ? 59  VAL B HG13 2  
ATOM 9030  H HG21 . VAL B 2 59  ? 49.193  13.827  -6.988  1.00 0.00 ? 59  VAL B HG21 2  
ATOM 9031  H HG22 . VAL B 2 59  ? 48.573  13.252  -5.443  1.00 0.00 ? 59  VAL B HG22 2  
ATOM 9032  H HG23 . VAL B 2 59  ? 48.734  14.984  -5.739  1.00 0.00 ? 59  VAL B HG23 2  
ATOM 9033  N N    . GLN B 2 60  ? 44.656  15.994  -7.341  1.00 0.00 ? 60  GLN B N    2  
ATOM 9034  C CA   . GLN B 2 60  ? 43.247  16.144  -7.692  1.00 0.00 ? 60  GLN B CA   2  
ATOM 9035  C C    . GLN B 2 60  ? 43.073  17.203  -8.777  1.00 0.00 ? 60  GLN B C    2  
ATOM 9036  O O    . GLN B 2 60  ? 42.237  17.061  -9.670  1.00 0.00 ? 60  GLN B O    2  
ATOM 9037  C CB   . GLN B 2 60  ? 42.437  16.540  -6.456  1.00 0.00 ? 60  GLN B CB   2  
ATOM 9038  C CG   . GLN B 2 60  ? 42.406  15.371  -5.469  1.00 0.00 ? 60  GLN B CG   2  
ATOM 9039  C CD   . GLN B 2 60  ? 41.805  15.838  -4.143  1.00 0.00 ? 60  GLN B CD   2  
ATOM 9040  O OE1  . GLN B 2 60  ? 41.449  16.991  -3.996  1.00 0.00 ? 60  GLN B OE1  2  
ATOM 9041  N NE2  . GLN B 2 60  ? 41.675  14.987  -3.162  1.00 0.00 ? 60  GLN B NE2  2  
ATOM 9042  H H    . GLN B 2 60  ? 44.987  16.362  -6.493  1.00 0.00 ? 60  GLN B H    2  
ATOM 9043  H HA   . GLN B 2 60  ? 42.877  15.202  -8.065  1.00 0.00 ? 60  GLN B HA   2  
ATOM 9044  H HB2  . GLN B 2 60  ? 42.896  17.397  -5.985  1.00 0.00 ? 60  GLN B HB2  2  
ATOM 9045  H HB3  . GLN B 2 60  ? 41.428  16.786  -6.749  1.00 0.00 ? 60  GLN B HB3  2  
ATOM 9046  H HG2  . GLN B 2 60  ? 41.804  14.572  -5.876  1.00 0.00 ? 60  GLN B HG2  2  
ATOM 9047  H HG3  . GLN B 2 60  ? 43.411  15.015  -5.300  1.00 0.00 ? 60  GLN B HG3  2  
ATOM 9048  H HE21 . GLN B 2 60  ? 41.962  14.057  -3.280  1.00 0.00 ? 60  GLN B HE21 2  
ATOM 9049  H HE22 . GLN B 2 60  ? 41.290  15.277  -2.308  1.00 0.00 ? 60  GLN B HE22 2  
ATOM 9050  N N    . GLU B 2 61  ? 43.864  18.266  -8.688  1.00 0.00 ? 61  GLU B N    2  
ATOM 9051  C CA   . GLU B 2 61  ? 43.788  19.351  -9.662  1.00 0.00 ? 61  GLU B CA   2  
ATOM 9052  C C    . GLU B 2 61  ? 44.283  18.889  -11.030 1.00 0.00 ? 61  GLU B C    2  
ATOM 9053  O O    . GLU B 2 61  ? 43.743  19.284  -12.062 1.00 0.00 ? 61  GLU B O    2  
ATOM 9054  C CB   . GLU B 2 61  ? 44.629  20.539  -9.187  1.00 0.00 ? 61  GLU B CB   2  
ATOM 9055  C CG   . GLU B 2 61  ? 44.322  21.766  -10.051 1.00 0.00 ? 61  GLU B CG   2  
ATOM 9056  C CD   . GLU B 2 61  ? 45.232  22.923  -9.637  1.00 0.00 ? 61  GLU B CD   2  
ATOM 9057  O OE1  . GLU B 2 61  ? 46.404  22.675  -9.404  1.00 0.00 ? 61  GLU B OE1  2  
ATOM 9058  O OE2  . GLU B 2 61  ? 44.742  24.037  -9.560  1.00 0.00 ? 61  GLU B OE2  2  
ATOM 9059  H H    . GLU B 2 61  ? 44.507  18.324  -7.952  1.00 0.00 ? 61  GLU B H    2  
ATOM 9060  H HA   . GLU B 2 61  ? 42.760  19.666  -9.752  1.00 0.00 ? 61  GLU B HA   2  
ATOM 9061  H HB2  . GLU B 2 61  ? 44.392  20.758  -8.157  1.00 0.00 ? 61  GLU B HB2  2  
ATOM 9062  H HB3  . GLU B 2 61  ? 45.678  20.294  -9.270  1.00 0.00 ? 61  GLU B HB3  2  
ATOM 9063  H HG2  . GLU B 2 61  ? 44.494  21.525  -11.090 1.00 0.00 ? 61  GLU B HG2  2  
ATOM 9064  H HG3  . GLU B 2 61  ? 43.291  22.054  -9.914  1.00 0.00 ? 61  GLU B HG3  2  
ATOM 9065  N N    . TYR B 2 62  ? 45.308  18.046  -11.027 1.00 0.00 ? 62  TYR B N    2  
ATOM 9066  C CA   . TYR B 2 62  ? 45.859  17.534  -12.276 1.00 0.00 ? 62  TYR B CA   2  
ATOM 9067  C C    . TYR B 2 62  ? 44.802  16.697  -12.994 1.00 0.00 ? 62  TYR B C    2  
ATOM 9068  O O    . TYR B 2 62  ? 44.697  16.728  -14.220 1.00 0.00 ? 62  TYR B O    2  
ATOM 9069  C CB   . TYR B 2 62  ? 47.127  16.695  -11.995 1.00 0.00 ? 62  TYR B CB   2  
ATOM 9070  C CG   . TYR B 2 62  ? 48.358  17.587  -11.999 1.00 0.00 ? 62  TYR B CG   2  
ATOM 9071  C CD1  . TYR B 2 62  ? 48.352  18.803  -11.279 1.00 0.00 ? 62  TYR B CD1  2  
ATOM 9072  C CD2  . TYR B 2 62  ? 49.511  17.209  -12.726 1.00 0.00 ? 62  TYR B CD2  2  
ATOM 9073  C CE1  . TYR B 2 62  ? 49.491  19.636  -11.284 1.00 0.00 ? 62  TYR B CE1  2  
ATOM 9074  C CE2  . TYR B 2 62  ? 50.649  18.043  -12.732 1.00 0.00 ? 62  TYR B CE2  2  
ATOM 9075  C CZ   . TYR B 2 62  ? 50.640  19.256  -12.012 1.00 0.00 ? 62  TYR B CZ   2  
ATOM 9076  O OH   . TYR B 2 62  ? 51.719  20.112  -12.091 1.00 0.00 ? 62  TYR B OH   2  
ATOM 9077  H H    . TYR B 2 62  ? 45.689  17.765  -10.169 1.00 0.00 ? 62  TYR B H    2  
ATOM 9078  H HA   . TYR B 2 62  ? 46.114  18.372  -12.910 1.00 0.00 ? 62  TYR B HA   2  
ATOM 9079  H HB2  . TYR B 2 62  ? 47.032  16.225  -11.026 1.00 0.00 ? 62  TYR B HB2  2  
ATOM 9080  H HB3  . TYR B 2 62  ? 47.237  15.928  -12.752 1.00 0.00 ? 62  TYR B HB3  2  
ATOM 9081  H HD1  . TYR B 2 62  ? 47.475  19.097  -10.724 1.00 0.00 ? 62  TYR B HD1  2  
ATOM 9082  H HD2  . TYR B 2 62  ? 49.520  16.280  -13.279 1.00 0.00 ? 62  TYR B HD2  2  
ATOM 9083  H HE1  . TYR B 2 62  ? 49.485  20.565  -10.733 1.00 0.00 ? 62  TYR B HE1  2  
ATOM 9084  H HE2  . TYR B 2 62  ? 51.525  17.753  -13.290 1.00 0.00 ? 62  TYR B HE2  2  
ATOM 9085  H HH   . TYR B 2 62  ? 52.505  19.583  -12.244 1.00 0.00 ? 62  TYR B HH   2  
ATOM 9086  N N    . VAL B 2 63  ? 44.012  15.967  -12.218 1.00 0.00 ? 63  VAL B N    2  
ATOM 9087  C CA   . VAL B 2 63  ? 42.953  15.144  -12.786 1.00 0.00 ? 63  VAL B CA   2  
ATOM 9088  C C    . VAL B 2 63  ? 41.877  16.046  -13.388 1.00 0.00 ? 63  VAL B C    2  
ATOM 9089  O O    . VAL B 2 63  ? 41.374  15.791  -14.482 1.00 0.00 ? 63  VAL B O    2  
ATOM 9090  C CB   . VAL B 2 63  ? 42.323  14.242  -11.696 1.00 0.00 ? 63  VAL B CB   2  
ATOM 9091  C CG1  . VAL B 2 63  ? 41.043  13.578  -12.223 1.00 0.00 ? 63  VAL B CG1  2  
ATOM 9092  C CG2  . VAL B 2 63  ? 43.330  13.160  -11.297 1.00 0.00 ? 63  VAL B CG2  2  
ATOM 9093  H H    . VAL B 2 63  ? 44.133  15.993  -11.246 1.00 0.00 ? 63  VAL B H    2  
ATOM 9094  H HA   . VAL B 2 63  ? 43.368  14.521  -13.564 1.00 0.00 ? 63  VAL B HA   2  
ATOM 9095  H HB   . VAL B 2 63  ? 42.081  14.844  -10.833 1.00 0.00 ? 63  VAL B HB   2  
ATOM 9096  H HG11 . VAL B 2 63  ? 40.749  12.776  -11.562 1.00 0.00 ? 63  VAL B HG11 2  
ATOM 9097  H HG12 . VAL B 2 63  ? 41.222  13.183  -13.213 1.00 0.00 ? 63  VAL B HG12 2  
ATOM 9098  H HG13 . VAL B 2 63  ? 40.253  14.314  -12.268 1.00 0.00 ? 63  VAL B HG13 2  
ATOM 9099  H HG21 . VAL B 2 63  ? 44.286  13.617  -11.083 1.00 0.00 ? 63  VAL B HG21 2  
ATOM 9100  H HG22 . VAL B 2 63  ? 43.443  12.456  -12.108 1.00 0.00 ? 63  VAL B HG22 2  
ATOM 9101  H HG23 . VAL B 2 63  ? 42.975  12.643  -10.418 1.00 0.00 ? 63  VAL B HG23 2  
ATOM 9102  N N    . TYR B 2 64  ? 41.541  17.103  -12.660 1.00 0.00 ? 64  TYR B N    2  
ATOM 9103  C CA   . TYR B 2 64  ? 40.533  18.053  -13.115 1.00 0.00 ? 64  TYR B CA   2  
ATOM 9104  C C    . TYR B 2 64  ? 40.984  18.733  -14.405 1.00 0.00 ? 64  TYR B C    2  
ATOM 9105  O O    . TYR B 2 64  ? 40.166  19.049  -15.268 1.00 0.00 ? 64  TYR B O    2  
ATOM 9106  C CB   . TYR B 2 64  ? 40.295  19.109  -12.032 1.00 0.00 ? 64  TYR B CB   2  
ATOM 9107  C CG   . TYR B 2 64  ? 39.105  19.963  -12.405 1.00 0.00 ? 64  TYR B CG   2  
ATOM 9108  C CD1  . TYR B 2 64  ? 37.799  19.525  -12.097 1.00 0.00 ? 64  TYR B CD1  2  
ATOM 9109  C CD2  . TYR B 2 64  ? 39.298  21.201  -13.060 1.00 0.00 ? 64  TYR B CD2  2  
ATOM 9110  C CE1  . TYR B 2 64  ? 36.686  20.323  -12.442 1.00 0.00 ? 64  TYR B CE1  2  
ATOM 9111  C CE2  . TYR B 2 64  ? 38.185  21.998  -13.405 1.00 0.00 ? 64  TYR B CE2  2  
ATOM 9112  C CZ   . TYR B 2 64  ? 36.878  21.559  -13.096 1.00 0.00 ? 64  TYR B CZ   2  
ATOM 9113  O OH   . TYR B 2 64  ? 35.803  22.396  -13.313 1.00 0.00 ? 64  TYR B OH   2  
ATOM 9114  H H    . TYR B 2 64  ? 41.986  17.250  -11.800 1.00 0.00 ? 64  TYR B H    2  
ATOM 9115  H HA   . TYR B 2 64  ? 39.611  17.526  -13.298 1.00 0.00 ? 64  TYR B HA   2  
ATOM 9116  H HB2  . TYR B 2 64  ? 40.102  18.617  -11.089 1.00 0.00 ? 64  TYR B HB2  2  
ATOM 9117  H HB3  . TYR B 2 64  ? 41.172  19.732  -11.939 1.00 0.00 ? 64  TYR B HB3  2  
ATOM 9118  H HD1  . TYR B 2 64  ? 37.651  18.579  -11.597 1.00 0.00 ? 64  TYR B HD1  2  
ATOM 9119  H HD2  . TYR B 2 64  ? 40.296  21.537  -13.297 1.00 0.00 ? 64  TYR B HD2  2  
ATOM 9120  H HE1  . TYR B 2 64  ? 35.688  19.986  -12.206 1.00 0.00 ? 64  TYR B HE1  2  
ATOM 9121  H HE2  . TYR B 2 64  ? 38.333  22.943  -13.905 1.00 0.00 ? 64  TYR B HE2  2  
ATOM 9122  H HH   . TYR B 2 64  ? 36.131  23.201  -13.719 1.00 0.00 ? 64  TYR B HH   2  
ATOM 9123  N N    . ASP B 2 65  ? 42.289  18.956  -14.526 1.00 0.00 ? 65  ASP B N    2  
ATOM 9124  C CA   . ASP B 2 65  ? 42.836  19.601  -15.715 1.00 0.00 ? 65  ASP B CA   2  
ATOM 9125  C C    . ASP B 2 65  ? 42.740  18.674  -16.919 1.00 0.00 ? 65  ASP B C    2  
ATOM 9126  O O    . ASP B 2 65  ? 42.283  19.073  -17.990 1.00 0.00 ? 65  ASP B O    2  
ATOM 9127  C CB   . ASP B 2 65  ? 44.298  19.984  -15.476 1.00 0.00 ? 65  ASP B CB   2  
ATOM 9128  C CG   . ASP B 2 65  ? 44.795  20.855  -16.632 1.00 0.00 ? 65  ASP B CG   2  
ATOM 9129  O OD1  . ASP B 2 65  ? 43.963  21.361  -17.366 1.00 0.00 ? 65  ASP B OD1  2  
ATOM 9130  O OD2  . ASP B 2 65  ? 45.999  21.000  -16.763 1.00 0.00 ? 65  ASP B OD2  2  
ATOM 9131  H H    . ASP B 2 65  ? 42.894  18.683  -13.805 1.00 0.00 ? 65  ASP B H    2  
ATOM 9132  H HA   . ASP B 2 65  ? 42.271  20.494  -15.919 1.00 0.00 ? 65  ASP B HA   2  
ATOM 9133  H HB2  . ASP B 2 65  ? 44.379  20.534  -14.549 1.00 0.00 ? 65  ASP B HB2  2  
ATOM 9134  H HB3  . ASP B 2 65  ? 44.900  19.089  -15.417 1.00 0.00 ? 65  ASP B HB3  2  
ATOM 9135  N N    . LEU B 2 66  ? 43.172  17.435  -16.733 1.00 0.00 ? 66  LEU B N    2  
ATOM 9136  C CA   . LEU B 2 66  ? 43.129  16.451  -17.808 1.00 0.00 ? 66  LEU B CA   2  
ATOM 9137  C C    . LEU B 2 66  ? 41.684  16.152  -18.193 1.00 0.00 ? 66  LEU B C    2  
ATOM 9138  O O    . LEU B 2 66  ? 41.413  15.644  -19.281 1.00 0.00 ? 66  LEU B O    2  
ATOM 9139  C CB   . LEU B 2 66  ? 43.825  15.160  -17.356 1.00 0.00 ? 66  LEU B CB   2  
ATOM 9140  C CG   . LEU B 2 66  ? 45.313  15.438  -17.026 1.00 0.00 ? 66  LEU B CG   2  
ATOM 9141  C CD1  . LEU B 2 66  ? 45.852  14.351  -16.091 1.00 0.00 ? 66  LEU B CD1  2  
ATOM 9142  C CD2  . LEU B 2 66  ? 46.158  15.445  -18.312 1.00 0.00 ? 66  LEU B CD2  2  
ATOM 9143  H H    . LEU B 2 66  ? 43.522  17.178  -15.855 1.00 0.00 ? 66  LEU B H    2  
ATOM 9144  H HA   . LEU B 2 66  ? 43.644  16.847  -18.668 1.00 0.00 ? 66  LEU B HA   2  
ATOM 9145  H HB2  . LEU B 2 66  ? 43.321  14.784  -16.475 1.00 0.00 ? 66  LEU B HB2  2  
ATOM 9146  H HB3  . LEU B 2 66  ? 43.757  14.422  -18.143 1.00 0.00 ? 66  LEU B HB3  2  
ATOM 9147  H HG   . LEU B 2 66  ? 45.400  16.398  -16.535 1.00 0.00 ? 66  LEU B HG   2  
ATOM 9148  H HD11 . LEU B 2 66  ? 45.797  13.392  -16.583 1.00 0.00 ? 66  LEU B HD11 2  
ATOM 9149  H HD12 . LEU B 2 66  ? 45.260  14.328  -15.187 1.00 0.00 ? 66  LEU B HD12 2  
ATOM 9150  H HD13 . LEU B 2 66  ? 46.880  14.569  -15.842 1.00 0.00 ? 66  LEU B HD13 2  
ATOM 9151  H HD21 . LEU B 2 66  ? 47.205  15.498  -18.050 1.00 0.00 ? 66  LEU B HD21 2  
ATOM 9152  H HD22 . LEU B 2 66  ? 45.898  16.300  -18.915 1.00 0.00 ? 66  LEU B HD22 2  
ATOM 9153  H HD23 . LEU B 2 66  ? 45.977  14.540  -18.873 1.00 0.00 ? 66  LEU B HD23 2  
ATOM 9154  N N    . GLU B 2 67  ? 40.762  16.470  -17.290 1.00 0.00 ? 67  GLU B N    2  
ATOM 9155  C CA   . GLU B 2 67  ? 39.342  16.233  -17.538 1.00 0.00 ? 67  GLU B CA   2  
ATOM 9156  C C    . GLU B 2 67  ? 38.818  17.222  -18.584 1.00 0.00 ? 67  GLU B C    2  
ATOM 9157  O O    . GLU B 2 67  ? 37.926  16.897  -19.367 1.00 0.00 ? 67  GLU B O    2  
ATOM 9158  C CB   . GLU B 2 67  ? 38.562  16.337  -16.188 1.00 0.00 ? 67  GLU B CB   2  
ATOM 9159  C CG   . GLU B 2 67  ? 37.575  17.519  -16.159 1.00 0.00 ? 67  GLU B CG   2  
ATOM 9160  C CD   . GLU B 2 67  ? 36.926  17.606  -14.775 1.00 0.00 ? 67  GLU B CD   2  
ATOM 9161  O OE1  . GLU B 2 67  ? 37.009  16.634  -14.042 1.00 0.00 ? 67  GLU B OE1  2  
ATOM 9162  O OE2  . GLU B 2 67  ? 36.358  18.642  -14.473 1.00 0.00 ? 67  GLU B OE2  2  
ATOM 9163  H H    . GLU B 2 67  ? 41.040  16.872  -16.440 1.00 0.00 ? 67  GLU B H    2  
ATOM 9164  H HA   . GLU B 2 67  ? 39.229  15.231  -17.933 1.00 0.00 ? 67  GLU B HA   2  
ATOM 9165  H HB2  . GLU B 2 67  ? 38.012  15.420  -16.013 1.00 0.00 ? 67  GLU B HB2  2  
ATOM 9166  H HB3  . GLU B 2 67  ? 39.275  16.470  -15.389 1.00 0.00 ? 67  GLU B HB3  2  
ATOM 9167  H HG2  . GLU B 2 67  ? 38.103  18.437  -16.365 1.00 0.00 ? 67  GLU B HG2  2  
ATOM 9168  H HG3  . GLU B 2 67  ? 36.806  17.367  -16.902 1.00 0.00 ? 67  GLU B HG3  2  
ATOM 9169  N N    . LEU B 2 68  ? 39.380  18.429  -18.586 1.00 0.00 ? 68  LEU B N    2  
ATOM 9170  C CA   . LEU B 2 68  ? 38.976  19.457  -19.522 1.00 0.00 ? 68  LEU B CA   2  
ATOM 9171  C C    . LEU B 2 68  ? 39.713  19.254  -20.838 1.00 0.00 ? 68  LEU B C    2  
ATOM 9172  O O    . LEU B 2 68  ? 39.155  18.711  -21.791 1.00 0.00 ? 68  LEU B O    2  
ATOM 9173  C CB   . LEU B 2 68  ? 39.291  20.812  -18.878 1.00 0.00 ? 68  LEU B CB   2  
ATOM 9174  C CG   . LEU B 2 68  ? 38.956  21.997  -19.822 1.00 0.00 ? 68  LEU B CG   2  
ATOM 9175  C CD1  . LEU B 2 68  ? 38.751  23.260  -18.971 1.00 0.00 ? 68  LEU B CD1  2  
ATOM 9176  C CD2  . LEU B 2 68  ? 40.114  22.251  -20.824 1.00 0.00 ? 68  LEU B CD2  2  
ATOM 9177  H H    . LEU B 2 68  ? 40.091  18.640  -17.945 1.00 0.00 ? 68  LEU B H    2  
ATOM 9178  H HA   . LEU B 2 68  ? 37.914  19.391  -19.699 1.00 0.00 ? 68  LEU B HA   2  
ATOM 9179  H HB2  . LEU B 2 68  ? 38.697  20.894  -17.976 1.00 0.00 ? 68  LEU B HB2  2  
ATOM 9180  H HB3  . LEU B 2 68  ? 40.332  20.839  -18.602 1.00 0.00 ? 68  LEU B HB3  2  
ATOM 9181  H HG   . LEU B 2 68  ? 38.044  21.780  -20.361 1.00 0.00 ? 68  LEU B HG   2  
ATOM 9182  H HD11 . LEU B 2 68  ? 38.512  24.096  -19.613 1.00 0.00 ? 68  LEU B HD11 2  
ATOM 9183  H HD12 . LEU B 2 68  ? 39.662  23.465  -18.432 1.00 0.00 ? 68  LEU B HD12 2  
ATOM 9184  H HD13 . LEU B 2 68  ? 37.943  23.100  -18.271 1.00 0.00 ? 68  LEU B HD13 2  
ATOM 9185  H HD21 . LEU B 2 68  ? 39.947  21.681  -21.727 1.00 0.00 ? 68  LEU B HD21 2  
ATOM 9186  H HD22 . LEU B 2 68  ? 41.054  21.958  -20.380 1.00 0.00 ? 68  LEU B HD22 2  
ATOM 9187  H HD23 . LEU B 2 68  ? 40.162  23.302  -21.084 1.00 0.00 ? 68  LEU B HD23 2  
ATOM 9188  N N    . ASN B 2 69  ? 40.964  19.686  -20.891 1.00 0.00 ? 69  ASN B N    2  
ATOM 9189  C CA   . ASN B 2 69  ? 41.758  19.538  -22.107 1.00 0.00 ? 69  ASN B CA   2  
ATOM 9190  C C    . ASN B 2 69  ? 42.090  18.070  -22.353 1.00 0.00 ? 69  ASN B C    2  
ATOM 9191  O O    . ASN B 2 69  ? 41.421  17.463  -23.172 1.00 0.00 ? 69  ASN B O    2  
ATOM 9192  C CB   . ASN B 2 69  ? 43.058  20.341  -21.993 1.00 0.00 ? 69  ASN B CB   2  
ATOM 9193  C CG   . ASN B 2 69  ? 43.854  20.209  -23.293 1.00 0.00 ? 69  ASN B CG   2  
ATOM 9194  O OD1  . ASN B 2 69  ? 43.334  20.459  -24.364 1.00 0.00 ? 69  ASN B OD1  2  
ATOM 9195  N ND2  . ASN B 2 69  ? 45.099  19.826  -23.246 1.00 0.00 ? 69  ASN B ND2  2  
ATOM 9196  O OXT  . ASN B 2 69  ? 43.070  17.605  -21.795 1.00 0.00 ? 69  ASN B OXT  2  
ATOM 9197  H H    . ASN B 2 69  ? 41.360  20.127  -20.106 1.00 0.00 ? 69  ASN B H    2  
ATOM 9198  H HA   . ASN B 2 69  ? 41.190  19.913  -22.944 1.00 0.00 ? 69  ASN B HA   2  
ATOM 9199  H HB2  . ASN B 2 69  ? 42.826  21.380  -21.819 1.00 0.00 ? 69  ASN B HB2  2  
ATOM 9200  H HB3  . ASN B 2 69  ? 43.647  19.960  -21.173 1.00 0.00 ? 69  ASN B HB3  2  
ATOM 9201  H HD21 . ASN B 2 69  ? 45.518  19.626  -22.383 1.00 0.00 ? 69  ASN B HD21 2  
ATOM 9202  H HD22 . ASN B 2 69  ? 45.617  19.740  -24.073 1.00 0.00 ? 69  ASN B HD22 2  
ATOM 9203  N N    . MET A 1 1   ? 90.612  0.966   -24.408 1.00 0.00 ? 1   MET A N    3  
ATOM 9204  C CA   . MET A 1 1   ? 90.366  1.678   -25.656 1.00 0.00 ? 1   MET A CA   3  
ATOM 9205  C C    . MET A 1 1   ? 90.663  3.178   -25.522 1.00 0.00 ? 1   MET A C    3  
ATOM 9206  O O    . MET A 1 1   ? 91.121  3.802   -26.480 1.00 0.00 ? 1   MET A O    3  
ATOM 9207  C CB   . MET A 1 1   ? 88.912  1.473   -26.107 1.00 0.00 ? 1   MET A CB   3  
ATOM 9208  C CG   . MET A 1 1   ? 88.506  0.015   -25.884 1.00 0.00 ? 1   MET A CG   3  
ATOM 9209  S SD   . MET A 1 1   ? 89.675  -1.076  -26.733 1.00 0.00 ? 1   MET A SD   3  
ATOM 9210  C CE   . MET A 1 1   ? 88.806  -2.632  -26.415 1.00 0.00 ? 1   MET A CE   3  
ATOM 9211  H H1   . MET A 1 1   ? 90.917  -0.006  -24.617 1.00 0.00 ? 1   MET A H1   3  
ATOM 9212  H H2   . MET A 1 1   ? 89.737  0.942   -23.845 1.00 0.00 ? 1   MET A H2   3  
ATOM 9213  H H3   . MET A 1 1   ? 91.359  1.451   -23.872 1.00 0.00 ? 1   MET A H3   3  
ATOM 9214  H HA   . MET A 1 1   ? 91.019  1.270   -26.414 1.00 0.00 ? 1   MET A HA   3  
ATOM 9215  H HB2  . MET A 1 1   ? 88.258  2.119   -25.539 1.00 0.00 ? 1   MET A HB2  3  
ATOM 9216  H HB3  . MET A 1 1   ? 88.824  1.710   -27.157 1.00 0.00 ? 1   MET A HB3  3  
ATOM 9217  H HG2  . MET A 1 1   ? 88.514  -0.204  -24.826 1.00 0.00 ? 1   MET A HG2  3  
ATOM 9218  H HG3  . MET A 1 1   ? 87.514  -0.147  -26.277 1.00 0.00 ? 1   MET A HG3  3  
ATOM 9219  H HE1  . MET A 1 1   ? 87.870  -2.639  -26.954 1.00 0.00 ? 1   MET A HE1  3  
ATOM 9220  H HE2  . MET A 1 1   ? 88.612  -2.725  -25.356 1.00 0.00 ? 1   MET A HE2  3  
ATOM 9221  H HE3  . MET A 1 1   ? 89.417  -3.460  -26.742 1.00 0.00 ? 1   MET A HE3  3  
ATOM 9222  N N    . PRO A 1 2   ? 90.410  3.793   -24.345 1.00 0.00 ? 2   PRO A N    3  
ATOM 9223  C CA   . PRO A 1 2   ? 90.664  5.233   -24.145 1.00 0.00 ? 2   PRO A CA   3  
ATOM 9224  C C    . PRO A 1 2   ? 92.087  5.626   -24.552 1.00 0.00 ? 2   PRO A C    3  
ATOM 9225  O O    . PRO A 1 2   ? 92.832  4.814   -25.100 1.00 0.00 ? 2   PRO A O    3  
ATOM 9226  C CB   . PRO A 1 2   ? 90.424  5.447   -22.639 1.00 0.00 ? 2   PRO A CB   3  
ATOM 9227  C CG   . PRO A 1 2   ? 89.464  4.365   -22.263 1.00 0.00 ? 2   PRO A CG   3  
ATOM 9228  C CD   . PRO A 1 2   ? 89.864  3.166   -23.122 1.00 0.00 ? 2   PRO A CD   3  
ATOM 9229  H HA   . PRO A 1 2   ? 89.949  5.812   -24.709 1.00 0.00 ? 2   PRO A HA   3  
ATOM 9230  H HB2  . PRO A 1 2   ? 91.351  5.339   -22.086 1.00 0.00 ? 2   PRO A HB2  3  
ATOM 9231  H HB3  . PRO A 1 2   ? 89.985  6.417   -22.453 1.00 0.00 ? 2   PRO A HB3  3  
ATOM 9232  H HG2  . PRO A 1 2   ? 89.554  4.129   -21.208 1.00 0.00 ? 2   PRO A HG2  3  
ATOM 9233  H HG3  . PRO A 1 2   ? 88.451  4.660   -22.497 1.00 0.00 ? 2   PRO A HG3  3  
ATOM 9234  H HD2  . PRO A 1 2   ? 90.624  2.580   -22.620 1.00 0.00 ? 2   PRO A HD2  3  
ATOM 9235  H HD3  . PRO A 1 2   ? 89.006  2.557   -23.361 1.00 0.00 ? 2   PRO A HD3  3  
ATOM 9236  N N    . ALA A 1 3   ? 92.451  6.874   -24.279 1.00 0.00 ? 3   ALA A N    3  
ATOM 9237  C CA   . ALA A 1 3   ? 93.782  7.364   -24.620 1.00 0.00 ? 3   ALA A CA   3  
ATOM 9238  C C    . ALA A 1 3   ? 94.848  6.624   -23.818 1.00 0.00 ? 3   ALA A C    3  
ATOM 9239  O O    . ALA A 1 3   ? 94.532  5.842   -22.921 1.00 0.00 ? 3   ALA A O    3  
ATOM 9240  C CB   . ALA A 1 3   ? 93.868  8.856   -24.341 1.00 0.00 ? 3   ALA A CB   3  
ATOM 9241  H H    . ALA A 1 3   ? 91.814  7.477   -23.841 1.00 0.00 ? 3   ALA A H    3  
ATOM 9242  H HA   . ALA A 1 3   ? 93.957  7.195   -25.672 1.00 0.00 ? 3   ALA A HA   3  
ATOM 9243  H HB1  . ALA A 1 3   ? 93.625  9.044   -23.307 1.00 0.00 ? 3   ALA A HB1  3  
ATOM 9244  H HB2  . ALA A 1 3   ? 93.170  9.381   -24.976 1.00 0.00 ? 3   ALA A HB2  3  
ATOM 9245  H HB3  . ALA A 1 3   ? 94.871  9.203   -24.545 1.00 0.00 ? 3   ALA A HB3  3  
ATOM 9246  N N    . SER A 1 4   ? 96.110  6.877   -24.148 1.00 0.00 ? 4   SER A N    3  
ATOM 9247  C CA   . SER A 1 4   ? 97.216  6.230   -23.451 1.00 0.00 ? 4   SER A CA   3  
ATOM 9248  C C    . SER A 1 4   ? 97.200  6.592   -21.970 1.00 0.00 ? 4   SER A C    3  
ATOM 9249  O O    . SER A 1 4   ? 97.480  5.754   -21.112 1.00 0.00 ? 4   SER A O    3  
ATOM 9250  C CB   . SER A 1 4   ? 98.546  6.662   -24.070 1.00 0.00 ? 4   SER A CB   3  
ATOM 9251  O OG   . SER A 1 4   ? 99.615  6.185   -23.264 1.00 0.00 ? 4   SER A OG   3  
ATOM 9252  H H    . SER A 1 4   ? 96.301  7.509   -24.872 1.00 0.00 ? 4   SER A H    3  
ATOM 9253  H HA   . SER A 1 4   ? 97.116  5.159   -23.552 1.00 0.00 ? 4   SER A HA   3  
ATOM 9254  H HB2  . SER A 1 4   ? 98.636  6.249   -25.060 1.00 0.00 ? 4   SER A HB2  3  
ATOM 9255  H HB3  . SER A 1 4   ? 98.580  7.743   -24.129 1.00 0.00 ? 4   SER A HB3  3  
ATOM 9256  H HG   . SER A 1 4   ? 100.063 5.488   -23.749 1.00 0.00 ? 4   SER A HG   3  
ATOM 9257  N N    . LEU A 1 5   ? 96.869  7.845   -21.677 1.00 0.00 ? 5   LEU A N    3  
ATOM 9258  C CA   . LEU A 1 5   ? 96.818  8.311   -20.295 1.00 0.00 ? 5   LEU A CA   3  
ATOM 9259  C C    . LEU A 1 5   ? 96.232  9.716   -20.226 1.00 0.00 ? 5   LEU A C    3  
ATOM 9260  O O    . LEU A 1 5   ? 96.229  10.446  -21.217 1.00 0.00 ? 5   LEU A O    3  
ATOM 9261  C CB   . LEU A 1 5   ? 98.228  8.287   -19.671 1.00 0.00 ? 5   LEU A CB   3  
ATOM 9262  C CG   . LEU A 1 5   ? 99.253  9.070   -20.551 1.00 0.00 ? 5   LEU A CG   3  
ATOM 9263  C CD1  . LEU A 1 5   ? 99.375  10.533  -20.092 1.00 0.00 ? 5   LEU A CD1  3  
ATOM 9264  C CD2  . LEU A 1 5   ? 100.638 8.415   -20.443 1.00 0.00 ? 5   LEU A CD2  3  
ATOM 9265  H H    . LEU A 1 5   ? 96.656  8.468   -22.402 1.00 0.00 ? 5   LEU A H    3  
ATOM 9266  H HA   . LEU A 1 5   ? 96.183  7.645   -19.732 1.00 0.00 ? 5   LEU A HA   3  
ATOM 9267  H HB2  . LEU A 1 5   ? 98.180  8.723   -18.683 1.00 0.00 ? 5   LEU A HB2  3  
ATOM 9268  H HB3  . LEU A 1 5   ? 98.541  7.255   -19.580 1.00 0.00 ? 5   LEU A HB3  3  
ATOM 9269  H HG   . LEU A 1 5   ? 98.938  9.054   -21.586 1.00 0.00 ? 5   LEU A HG   3  
ATOM 9270  H HD11 . LEU A 1 5   ? 100.185 11.009  -20.626 1.00 0.00 ? 5   LEU A HD11 3  
ATOM 9271  H HD12 . LEU A 1 5   ? 99.578  10.567  -19.033 1.00 0.00 ? 5   LEU A HD12 3  
ATOM 9272  H HD13 . LEU A 1 5   ? 98.457  11.059  -20.300 1.00 0.00 ? 5   LEU A HD13 3  
ATOM 9273  H HD21 . LEU A 1 5   ? 100.584 7.396   -20.797 1.00 0.00 ? 5   LEU A HD21 3  
ATOM 9274  H HD22 . LEU A 1 5   ? 100.961 8.421   -19.413 1.00 0.00 ? 5   LEU A HD22 3  
ATOM 9275  H HD23 . LEU A 1 5   ? 101.346 8.967   -21.044 1.00 0.00 ? 5   LEU A HD23 3  
ATOM 9276  N N    . GLN A 1 6   ? 95.733  10.091  -19.048 1.00 0.00 ? 6   GLN A N    3  
ATOM 9277  C CA   . GLN A 1 6   ? 95.139  11.416  -18.854 1.00 0.00 ? 6   GLN A CA   3  
ATOM 9278  C C    . GLN A 1 6   ? 95.334  11.885  -17.416 1.00 0.00 ? 6   GLN A C    3  
ATOM 9279  O O    . GLN A 1 6   ? 95.963  11.201  -16.608 1.00 0.00 ? 6   GLN A O    3  
ATOM 9280  C CB   . GLN A 1 6   ? 93.642  11.373  -19.174 1.00 0.00 ? 6   GLN A CB   3  
ATOM 9281  C CG   . GLN A 1 6   ? 93.437  11.022  -20.652 1.00 0.00 ? 6   GLN A CG   3  
ATOM 9282  C CD   . GLN A 1 6   ? 91.976  11.269  -21.041 1.00 0.00 ? 6   GLN A CD   3  
ATOM 9283  O OE1  . GLN A 1 6   ? 91.208  10.338  -21.184 1.00 0.00 ? 6   GLN A OE1  3  
ATOM 9284  N NE2  . GLN A 1 6   ? 91.560  12.493  -21.218 1.00 0.00 ? 6   GLN A NE2  3  
ATOM 9285  H H    . GLN A 1 6   ? 95.762  9.465   -18.295 1.00 0.00 ? 6   GLN A H    3  
ATOM 9286  H HA   . GLN A 1 6   ? 95.616  12.127  -19.516 1.00 0.00 ? 6   GLN A HA   3  
ATOM 9287  H HB2  . GLN A 1 6   ? 93.166  10.624  -18.557 1.00 0.00 ? 6   GLN A HB2  3  
ATOM 9288  H HB3  . GLN A 1 6   ? 93.204  12.338  -18.970 1.00 0.00 ? 6   GLN A HB3  3  
ATOM 9289  H HG2  . GLN A 1 6   ? 94.081  11.639  -21.262 1.00 0.00 ? 6   GLN A HG2  3  
ATOM 9290  H HG3  . GLN A 1 6   ? 93.676  9.982   -20.812 1.00 0.00 ? 6   GLN A HG3  3  
ATOM 9291  H HE21 . GLN A 1 6   ? 92.180  13.243  -21.102 1.00 0.00 ? 6   GLN A HE21 3  
ATOM 9292  H HE22 . GLN A 1 6   ? 90.627  12.661  -21.467 1.00 0.00 ? 6   GLN A HE22 3  
ATOM 9293  N N    . GLN A 1 7   ? 94.790  13.057  -17.104 1.00 0.00 ? 7   GLN A N    3  
ATOM 9294  C CA   . GLN A 1 7   ? 94.909  13.614  -15.761 1.00 0.00 ? 7   GLN A CA   3  
ATOM 9295  C C    . GLN A 1 7   ? 94.288  12.673  -14.733 1.00 0.00 ? 7   GLN A C    3  
ATOM 9296  O O    . GLN A 1 7   ? 93.214  12.114  -14.957 1.00 0.00 ? 7   GLN A O    3  
ATOM 9297  C CB   . GLN A 1 7   ? 94.210  14.973  -15.695 1.00 0.00 ? 7   GLN A CB   3  
ATOM 9298  C CG   . GLN A 1 7   ? 94.761  15.890  -16.790 1.00 0.00 ? 7   GLN A CG   3  
ATOM 9299  C CD   . GLN A 1 7   ? 96.237  16.185  -16.516 1.00 0.00 ? 7   GLN A CD   3  
ATOM 9300  O OE1  . GLN A 1 7   ? 97.109  15.546  -17.070 1.00 0.00 ? 7   GLN A OE1  3  
ATOM 9301  N NE2  . GLN A 1 7   ? 96.555  17.133  -15.677 1.00 0.00 ? 7   GLN A NE2  3  
ATOM 9302  H H    . GLN A 1 7   ? 94.301  13.558  -17.791 1.00 0.00 ? 7   GLN A H    3  
ATOM 9303  H HA   . GLN A 1 7   ? 95.955  13.747  -15.528 1.00 0.00 ? 7   GLN A HA   3  
ATOM 9304  H HB2  . GLN A 1 7   ? 93.147  14.839  -15.838 1.00 0.00 ? 7   GLN A HB2  3  
ATOM 9305  H HB3  . GLN A 1 7   ? 94.389  15.423  -14.729 1.00 0.00 ? 7   GLN A HB3  3  
ATOM 9306  H HG2  . GLN A 1 7   ? 94.662  15.404  -17.751 1.00 0.00 ? 7   GLN A HG2  3  
ATOM 9307  H HG3  . GLN A 1 7   ? 94.207  16.816  -16.797 1.00 0.00 ? 7   GLN A HG3  3  
ATOM 9308  H HE21 . GLN A 1 7   ? 95.852  17.648  -15.231 1.00 0.00 ? 7   GLN A HE21 3  
ATOM 9309  H HE22 . GLN A 1 7   ? 97.498  17.329  -15.495 1.00 0.00 ? 7   GLN A HE22 3  
ATOM 9310  N N    . SER A 1 8   ? 94.971  12.504  -13.605 1.00 0.00 ? 8   SER A N    3  
ATOM 9311  C CA   . SER A 1 8   ? 94.479  11.629  -12.544 1.00 0.00 ? 8   SER A CA   3  
ATOM 9312  C C    . SER A 1 8   ? 93.353  12.306  -11.771 1.00 0.00 ? 8   SER A C    3  
ATOM 9313  O O    . SER A 1 8   ? 92.709  11.689  -10.923 1.00 0.00 ? 8   SER A O    3  
ATOM 9314  C CB   . SER A 1 8   ? 95.619  11.282  -11.585 1.00 0.00 ? 8   SER A CB   3  
ATOM 9315  O OG   . SER A 1 8   ? 96.747  10.851  -12.334 1.00 0.00 ? 8   SER A OG   3  
ATOM 9316  H H    . SER A 1 8   ? 95.821  12.976  -13.482 1.00 0.00 ? 8   SER A H    3  
ATOM 9317  H HA   . SER A 1 8   ? 94.104  10.716  -12.983 1.00 0.00 ? 8   SER A HA   3  
ATOM 9318  H HB2  . SER A 1 8   ? 95.887  12.153  -11.010 1.00 0.00 ? 8   SER A HB2  3  
ATOM 9319  H HB3  . SER A 1 8   ? 95.296  10.496  -10.915 1.00 0.00 ? 8   SER A HB3  3  
ATOM 9320  H HG   . SER A 1 8   ? 96.556  9.977   -12.683 1.00 0.00 ? 8   SER A HG   3  
ATOM 9321  N N    . SER A 1 9   ? 93.120  13.582  -12.070 1.00 0.00 ? 9   SER A N    3  
ATOM 9322  C CA   . SER A 1 9   ? 92.068  14.340  -11.397 1.00 0.00 ? 9   SER A CA   3  
ATOM 9323  C C    . SER A 1 9   ? 90.694  13.966  -11.946 1.00 0.00 ? 9   SER A C    3  
ATOM 9324  O O    . SER A 1 9   ? 89.673  14.205  -11.300 1.00 0.00 ? 9   SER A O    3  
ATOM 9325  C CB   . SER A 1 9   ? 92.303  15.838  -11.591 1.00 0.00 ? 9   SER A CB   3  
ATOM 9326  O OG   . SER A 1 9   ? 93.657  16.144  -11.289 1.00 0.00 ? 9   SER A OG   3  
ATOM 9327  H H    . SER A 1 9   ? 93.666  14.022  -12.754 1.00 0.00 ? 9   SER A H    3  
ATOM 9328  H HA   . SER A 1 9   ? 92.095  14.119  -10.339 1.00 0.00 ? 9   SER A HA   3  
ATOM 9329  H HB2  . SER A 1 9   ? 92.098  16.107  -12.614 1.00 0.00 ? 9   SER A HB2  3  
ATOM 9330  H HB3  . SER A 1 9   ? 91.642  16.392  -10.936 1.00 0.00 ? 9   SER A HB3  3  
ATOM 9331  H HG   . SER A 1 9   ? 93.959  16.806  -11.915 1.00 0.00 ? 9   SER A HG   3  
ATOM 9332  N N    . SER A 1 10  ? 90.675  13.380  -13.139 1.00 0.00 ? 10  SER A N    3  
ATOM 9333  C CA   . SER A 1 10  ? 89.416  12.982  -13.763 1.00 0.00 ? 10  SER A CA   3  
ATOM 9334  C C    . SER A 1 10  ? 88.564  12.175  -12.787 1.00 0.00 ? 10  SER A C    3  
ATOM 9335  O O    . SER A 1 10  ? 89.081  11.360  -12.023 1.00 0.00 ? 10  SER A O    3  
ATOM 9336  C CB   . SER A 1 10  ? 89.695  12.143  -15.012 1.00 0.00 ? 10  SER A CB   3  
ATOM 9337  O OG   . SER A 1 10  ? 89.956  10.801  -14.627 1.00 0.00 ? 10  SER A OG   3  
ATOM 9338  H H    . SER A 1 10  ? 91.519  13.216  -13.608 1.00 0.00 ? 10  SER A H    3  
ATOM 9339  H HA   . SER A 1 10  ? 88.874  13.870  -14.051 1.00 0.00 ? 10  SER A HA   3  
ATOM 9340  H HB2  . SER A 1 10  ? 88.838  12.162  -15.666 1.00 0.00 ? 10  SER A HB2  3  
ATOM 9341  H HB3  . SER A 1 10  ? 90.551  12.551  -15.535 1.00 0.00 ? 10  SER A HB3  3  
ATOM 9342  H HG   . SER A 1 10  ? 89.173  10.460  -14.190 1.00 0.00 ? 10  SER A HG   3  
ATOM 9343  N N    . SER A 1 11  ? 87.257  12.410  -12.819 1.00 0.00 ? 11  SER A N    3  
ATOM 9344  C CA   . SER A 1 11  ? 86.341  11.701  -11.931 1.00 0.00 ? 11  SER A CA   3  
ATOM 9345  C C    . SER A 1 11  ? 86.249  10.228  -12.318 1.00 0.00 ? 11  SER A C    3  
ATOM 9346  O O    . SER A 1 11  ? 85.608  9.435   -11.629 1.00 0.00 ? 11  SER A O    3  
ATOM 9347  C CB   . SER A 1 11  ? 84.953  12.338  -12.001 1.00 0.00 ? 11  SER A CB   3  
ATOM 9348  O OG   . SER A 1 11  ? 84.545  12.430  -13.359 1.00 0.00 ? 11  SER A OG   3  
ATOM 9349  H H    . SER A 1 11  ? 86.901  13.071  -13.449 1.00 0.00 ? 11  SER A H    3  
ATOM 9350  H HA   . SER A 1 11  ? 86.708  11.775  -10.919 1.00 0.00 ? 11  SER A HA   3  
ATOM 9351  H HB2  . SER A 1 11  ? 84.248  11.729  -11.459 1.00 0.00 ? 11  SER A HB2  3  
ATOM 9352  H HB3  . SER A 1 11  ? 84.988  13.324  -11.557 1.00 0.00 ? 11  SER A HB3  3  
ATOM 9353  H HG   . SER A 1 11  ? 84.404  13.357  -13.565 1.00 0.00 ? 11  SER A HG   3  
ATOM 9354  N N    . SER A 1 12  ? 86.893  9.868   -13.429 1.00 0.00 ? 12  SER A N    3  
ATOM 9355  C CA   . SER A 1 12  ? 86.887  8.483   -13.915 1.00 0.00 ? 12  SER A CA   3  
ATOM 9356  C C    . SER A 1 12  ? 88.199  7.788   -13.568 1.00 0.00 ? 12  SER A C    3  
ATOM 9357  O O    . SER A 1 12  ? 88.286  6.560   -13.585 1.00 0.00 ? 12  SER A O    3  
ATOM 9358  C CB   . SER A 1 12  ? 86.699  8.472   -15.432 1.00 0.00 ? 12  SER A CB   3  
ATOM 9359  O OG   . SER A 1 12  ? 87.766  9.186   -16.042 1.00 0.00 ? 12  SER A OG   3  
ATOM 9360  H H    . SER A 1 12  ? 87.387  10.547  -13.935 1.00 0.00 ? 12  SER A H    3  
ATOM 9361  H HA   . SER A 1 12  ? 86.070  7.938   -13.460 1.00 0.00 ? 12  SER A HA   3  
ATOM 9362  H HB2  . SER A 1 12  ? 86.703  7.456   -15.790 1.00 0.00 ? 12  SER A HB2  3  
ATOM 9363  H HB3  . SER A 1 12  ? 85.754  8.935   -15.680 1.00 0.00 ? 12  SER A HB3  3  
ATOM 9364  H HG   . SER A 1 12  ? 88.483  8.568   -16.202 1.00 0.00 ? 12  SER A HG   3  
ATOM 9365  N N    . SER A 1 13  ? 89.224  8.584   -13.262 1.00 0.00 ? 13  SER A N    3  
ATOM 9366  C CA   . SER A 1 13  ? 90.540  8.042   -12.920 1.00 0.00 ? 13  SER A CA   3  
ATOM 9367  C C    . SER A 1 13  ? 90.631  7.719   -11.430 1.00 0.00 ? 13  SER A C    3  
ATOM 9368  O O    . SER A 1 13  ? 91.067  6.632   -11.049 1.00 0.00 ? 13  SER A O    3  
ATOM 9369  C CB   . SER A 1 13  ? 91.626  9.055   -13.289 1.00 0.00 ? 13  SER A CB   3  
ATOM 9370  O OG   . SER A 1 13  ? 91.703  9.165   -14.704 1.00 0.00 ? 13  SER A OG   3  
ATOM 9371  H H    . SER A 1 13  ? 89.094  9.555   -13.272 1.00 0.00 ? 13  SER A H    3  
ATOM 9372  H HA   . SER A 1 13  ? 90.711  7.135   -13.483 1.00 0.00 ? 13  SER A HA   3  
ATOM 9373  H HB2  . SER A 1 13  ? 91.382  10.017  -12.871 1.00 0.00 ? 13  SER A HB2  3  
ATOM 9374  H HB3  . SER A 1 13  ? 92.578  8.724   -12.891 1.00 0.00 ? 13  SER A HB3  3  
ATOM 9375  H HG   . SER A 1 13  ? 91.873  8.290   -15.061 1.00 0.00 ? 13  SER A HG   3  
ATOM 9376  N N    . SER A 1 14  ? 90.229  8.670   -10.587 1.00 0.00 ? 14  SER A N    3  
ATOM 9377  C CA   . SER A 1 14  ? 90.284  8.471   -9.139  1.00 0.00 ? 14  SER A CA   3  
ATOM 9378  C C    . SER A 1 14  ? 89.292  9.383   -8.422  1.00 0.00 ? 14  SER A C    3  
ATOM 9379  O O    . SER A 1 14  ? 88.609  10.194  -9.048  1.00 0.00 ? 14  SER A O    3  
ATOM 9380  C CB   . SER A 1 14  ? 91.696  8.759   -8.629  1.00 0.00 ? 14  SER A CB   3  
ATOM 9381  O OG   . SER A 1 14  ? 91.962  10.151  -8.743  1.00 0.00 ? 14  SER A OG   3  
ATOM 9382  H H    . SER A 1 14  ? 89.897  9.521   -10.944 1.00 0.00 ? 14  SER A H    3  
ATOM 9383  H HA   . SER A 1 14  ? 90.036  7.444   -8.910  1.00 0.00 ? 14  SER A HA   3  
ATOM 9384  H HB2  . SER A 1 14  ? 91.775  8.466   -7.595  1.00 0.00 ? 14  SER A HB2  3  
ATOM 9385  H HB3  . SER A 1 14  ? 92.411  8.197   -9.216  1.00 0.00 ? 14  SER A HB3  3  
ATOM 9386  H HG   . SER A 1 14  ? 92.721  10.354  -8.192  1.00 0.00 ? 14  SER A HG   3  
ATOM 9387  N N    . CYS A 1 15  ? 89.221  9.236   -7.101  1.00 0.00 ? 15  CYS A N    3  
ATOM 9388  C CA   . CYS A 1 15  ? 88.311  10.040  -6.288  1.00 0.00 ? 15  CYS A CA   3  
ATOM 9389  C C    . CYS A 1 15  ? 88.876  11.446  -6.078  1.00 0.00 ? 15  CYS A C    3  
ATOM 9390  O O    . CYS A 1 15  ? 90.081  11.620  -5.898  1.00 0.00 ? 15  CYS A O    3  
ATOM 9391  C CB   . CYS A 1 15  ? 88.096  9.351   -4.932  1.00 0.00 ? 15  CYS A CB   3  
ATOM 9392  S SG   . CYS A 1 15  ? 86.531  9.904   -4.207  1.00 0.00 ? 15  CYS A SG   3  
ATOM 9393  H H    . CYS A 1 15  ? 89.790  8.570   -6.662  1.00 0.00 ? 15  CYS A H    3  
ATOM 9394  H HA   . CYS A 1 15  ? 87.360  10.117  -6.794  1.00 0.00 ? 15  CYS A HA   3  
ATOM 9395  H HB2  . CYS A 1 15  ? 88.061  8.282   -5.078  1.00 0.00 ? 15  CYS A HB2  3  
ATOM 9396  H HB3  . CYS A 1 15  ? 88.908  9.593   -4.261  1.00 0.00 ? 15  CYS A HB3  3  
ATOM 9397  N N    . THR A 1 16  ? 87.997  12.443  -6.100  1.00 0.00 ? 16  THR A N    3  
ATOM 9398  C CA   . THR A 1 16  ? 88.421  13.827  -5.907  1.00 0.00 ? 16  THR A CA   3  
ATOM 9399  C C    . THR A 1 16  ? 89.056  13.989  -4.523  1.00 0.00 ? 16  THR A C    3  
ATOM 9400  O O    . THR A 1 16  ? 88.932  13.106  -3.674  1.00 0.00 ? 16  THR A O    3  
ATOM 9401  C CB   . THR A 1 16  ? 87.213  14.792  -6.042  1.00 0.00 ? 16  THR A CB   3  
ATOM 9402  O OG1  . THR A 1 16  ? 86.366  14.331  -7.084  1.00 0.00 ? 16  THR A OG1  3  
ATOM 9403  C CG2  . THR A 1 16  ? 87.691  16.211  -6.377  1.00 0.00 ? 16  THR A CG2  3  
ATOM 9404  H H    . THR A 1 16  ? 87.048  12.247  -6.245  1.00 0.00 ? 16  THR A H    3  
ATOM 9405  H HA   . THR A 1 16  ? 89.157  14.070  -6.659  1.00 0.00 ? 16  THR A HA   3  
ATOM 9406  H HB   . THR A 1 16  ? 86.657  14.813  -5.116  1.00 0.00 ? 16  THR A HB   3  
ATOM 9407  H HG1  . THR A 1 16  ? 85.467  14.595  -6.874  1.00 0.00 ? 16  THR A HG1  3  
ATOM 9408  H HG21 . THR A 1 16  ? 88.302  16.187  -7.266  1.00 0.00 ? 16  THR A HG21 3  
ATOM 9409  H HG22 . THR A 1 16  ? 88.269  16.602  -5.554  1.00 0.00 ? 16  THR A HG22 3  
ATOM 9410  H HG23 . THR A 1 16  ? 86.835  16.847  -6.547  1.00 0.00 ? 16  THR A HG23 3  
ATOM 9411  N N    . GLU A 1 17  ? 89.736  15.119  -4.304  1.00 0.00 ? 17  GLU A N    3  
ATOM 9412  C CA   . GLU A 1 17  ? 90.396  15.397  -3.018  1.00 0.00 ? 17  GLU A CA   3  
ATOM 9413  C C    . GLU A 1 17  ? 89.790  16.654  -2.381  1.00 0.00 ? 17  GLU A C    3  
ATOM 9414  O O    . GLU A 1 17  ? 90.302  17.172  -1.390  1.00 0.00 ? 17  GLU A O    3  
ATOM 9415  C CB   . GLU A 1 17  ? 91.918  15.586  -3.260  1.00 0.00 ? 17  GLU A CB   3  
ATOM 9416  C CG   . GLU A 1 17  ? 92.740  14.973  -2.115  1.00 0.00 ? 17  GLU A CG   3  
ATOM 9417  C CD   . GLU A 1 17  ? 92.344  15.620  -0.787  1.00 0.00 ? 17  GLU A CD   3  
ATOM 9418  O OE1  . GLU A 1 17  ? 92.601  16.802  -0.626  1.00 0.00 ? 17  GLU A OE1  3  
ATOM 9419  O OE2  . GLU A 1 17  ? 91.790  14.923  0.047   1.00 0.00 ? 17  GLU A OE2  3  
ATOM 9420  H H    . GLU A 1 17  ? 89.799  15.785  -5.020  1.00 0.00 ? 17  GLU A H    3  
ATOM 9421  H HA   . GLU A 1 17  ? 90.242  14.563  -2.343  1.00 0.00 ? 17  GLU A HA   3  
ATOM 9422  H HB2  . GLU A 1 17  ? 92.186  15.095  -4.184  1.00 0.00 ? 17  GLU A HB2  3  
ATOM 9423  H HB3  . GLU A 1 17  ? 92.154  16.639  -3.343  1.00 0.00 ? 17  GLU A HB3  3  
ATOM 9424  H HG2  . GLU A 1 17  ? 92.551  13.910  -2.067  1.00 0.00 ? 17  GLU A HG2  3  
ATOM 9425  H HG3  . GLU A 1 17  ? 93.791  15.144  -2.296  1.00 0.00 ? 17  GLU A HG3  3  
ATOM 9426  N N    . GLU A 1 18  ? 88.690  17.134  -2.961  1.00 0.00 ? 18  GLU A N    3  
ATOM 9427  C CA   . GLU A 1 18  ? 88.012  18.327  -2.451  1.00 0.00 ? 18  GLU A CA   3  
ATOM 9428  C C    . GLU A 1 18  ? 87.028  17.948  -1.345  1.00 0.00 ? 18  GLU A C    3  
ATOM 9429  O O    . GLU A 1 18  ? 85.872  17.621  -1.611  1.00 0.00 ? 18  GLU A O    3  
ATOM 9430  C CB   . GLU A 1 18  ? 87.268  19.025  -3.595  1.00 0.00 ? 18  GLU A CB   3  
ATOM 9431  C CG   . GLU A 1 18  ? 88.275  19.716  -4.522  1.00 0.00 ? 18  GLU A CG   3  
ATOM 9432  C CD   . GLU A 1 18  ? 87.526  20.429  -5.648  1.00 0.00 ? 18  GLU A CD   3  
ATOM 9433  O OE1  . GLU A 1 18  ? 86.901  19.746  -6.444  1.00 0.00 ? 18  GLU A OE1  3  
ATOM 9434  O OE2  . GLU A 1 18  ? 87.588  21.646  -5.696  1.00 0.00 ? 18  GLU A OE2  3  
ATOM 9435  H H    . GLU A 1 18  ? 88.327  16.678  -3.746  1.00 0.00 ? 18  GLU A H    3  
ATOM 9436  H HA   . GLU A 1 18  ? 88.746  19.011  -2.043  1.00 0.00 ? 18  GLU A HA   3  
ATOM 9437  H HB2  . GLU A 1 18  ? 86.713  18.291  -4.158  1.00 0.00 ? 18  GLU A HB2  3  
ATOM 9438  H HB3  . GLU A 1 18  ? 86.588  19.761  -3.192  1.00 0.00 ? 18  GLU A HB3  3  
ATOM 9439  H HG2  . GLU A 1 18  ? 88.848  20.436  -3.957  1.00 0.00 ? 18  GLU A HG2  3  
ATOM 9440  H HG3  . GLU A 1 18  ? 88.940  18.979  -4.945  1.00 0.00 ? 18  GLU A HG3  3  
ATOM 9441  N N    . GLU A 1 19  ? 87.514  17.977  -0.106  1.00 0.00 ? 19  GLU A N    3  
ATOM 9442  C CA   . GLU A 1 19  ? 86.707  17.619  1.066   1.00 0.00 ? 19  GLU A CA   3  
ATOM 9443  C C    . GLU A 1 19  ? 85.233  18.014  0.916   1.00 0.00 ? 19  GLU A C    3  
ATOM 9444  O O    . GLU A 1 19  ? 84.343  17.255  1.300   1.00 0.00 ? 19  GLU A O    3  
ATOM 9445  C CB   . GLU A 1 19  ? 87.287  18.287  2.315   1.00 0.00 ? 19  GLU A CB   3  
ATOM 9446  C CG   . GLU A 1 19  ? 87.325  19.806  2.122   1.00 0.00 ? 19  GLU A CG   3  
ATOM 9447  C CD   . GLU A 1 19  ? 88.146  20.444  3.243   1.00 0.00 ? 19  GLU A CD   3  
ATOM 9448  O OE1  . GLU A 1 19  ? 87.921  20.094  4.390   1.00 0.00 ? 19  GLU A OE1  3  
ATOM 9449  O OE2  . GLU A 1 19  ? 88.987  21.273  2.936   1.00 0.00 ? 19  GLU A OE2  3  
ATOM 9450  H H    . GLU A 1 19  ? 88.454  18.224  0.021   1.00 0.00 ? 19  GLU A H    3  
ATOM 9451  H HA   . GLU A 1 19  ? 86.760  16.550  1.201   1.00 0.00 ? 19  GLU A HA   3  
ATOM 9452  H HB2  . GLU A 1 19  ? 86.669  18.049  3.169   1.00 0.00 ? 19  GLU A HB2  3  
ATOM 9453  H HB3  . GLU A 1 19  ? 88.289  17.920  2.485   1.00 0.00 ? 19  GLU A HB3  3  
ATOM 9454  H HG2  . GLU A 1 19  ? 87.775  20.037  1.168   1.00 0.00 ? 19  GLU A HG2  3  
ATOM 9455  H HG3  . GLU A 1 19  ? 86.318  20.197  2.149   1.00 0.00 ? 19  GLU A HG3  3  
ATOM 9456  N N    . ASN A 1 20  ? 84.978  19.203  0.376   1.00 0.00 ? 20  ASN A N    3  
ATOM 9457  C CA   . ASN A 1 20  ? 83.602  19.681  0.208   1.00 0.00 ? 20  ASN A CA   3  
ATOM 9458  C C    . ASN A 1 20  ? 82.947  19.079  -1.034  1.00 0.00 ? 20  ASN A C    3  
ATOM 9459  O O    . ASN A 1 20  ? 82.020  19.662  -1.596  1.00 0.00 ? 20  ASN A O    3  
ATOM 9460  C CB   . ASN A 1 20  ? 83.599  21.207  0.090   1.00 0.00 ? 20  ASN A CB   3  
ATOM 9461  C CG   . ASN A 1 20  ? 84.523  21.634  -1.051  1.00 0.00 ? 20  ASN A CG   3  
ATOM 9462  O OD1  . ASN A 1 20  ? 85.622  21.130  -1.180  1.00 0.00 ? 20  ASN A OD1  3  
ATOM 9463  N ND2  . ASN A 1 20  ? 84.122  22.547  -1.892  1.00 0.00 ? 20  ASN A ND2  3  
ATOM 9464  H H    . ASN A 1 20  ? 85.723  19.775  0.098   1.00 0.00 ? 20  ASN A H    3  
ATOM 9465  H HA   . ASN A 1 20  ? 83.022  19.403  1.076   1.00 0.00 ? 20  ASN A HA   3  
ATOM 9466  H HB2  . ASN A 1 20  ? 82.594  21.550  -0.111  1.00 0.00 ? 20  ASN A HB2  3  
ATOM 9467  H HB3  . ASN A 1 20  ? 83.949  21.640  1.015   1.00 0.00 ? 20  ASN A HB3  3  
ATOM 9468  H HD21 . ASN A 1 20  ? 83.237  22.953  -1.789  1.00 0.00 ? 20  ASN A HD21 3  
ATOM 9469  H HD22 . ASN A 1 20  ? 84.708  22.828  -2.627  1.00 0.00 ? 20  ASN A HD22 3  
ATOM 9470  N N    . LYS A 1 21  ? 83.425  17.908  -1.457  1.00 0.00 ? 21  LYS A N    3  
ATOM 9471  C CA   . LYS A 1 21  ? 82.870  17.228  -2.636  1.00 0.00 ? 21  LYS A CA   3  
ATOM 9472  C C    . LYS A 1 21  ? 82.751  15.735  -2.370  1.00 0.00 ? 21  LYS A C    3  
ATOM 9473  O O    . LYS A 1 21  ? 83.661  15.118  -1.816  1.00 0.00 ? 21  LYS A O    3  
ATOM 9474  C CB   . LYS A 1 21  ? 83.767  17.443  -3.863  1.00 0.00 ? 21  LYS A CB   3  
ATOM 9475  C CG   . LYS A 1 21  ? 83.851  18.936  -4.234  1.00 0.00 ? 21  LYS A CG   3  
ATOM 9476  C CD   . LYS A 1 21  ? 82.518  19.430  -4.830  1.00 0.00 ? 21  LYS A CD   3  
ATOM 9477  C CE   . LYS A 1 21  ? 82.748  20.735  -5.601  1.00 0.00 ? 21  LYS A CE   3  
ATOM 9478  N NZ   . LYS A 1 21  ? 83.702  20.492  -6.720  1.00 0.00 ? 21  LYS A NZ   3  
ATOM 9479  H H    . LYS A 1 21  ? 84.161  17.488  -0.964  1.00 0.00 ? 21  LYS A H    3  
ATOM 9480  H HA   . LYS A 1 21  ? 81.884  17.614  -2.850  1.00 0.00 ? 21  LYS A HA   3  
ATOM 9481  H HB2  . LYS A 1 21  ? 84.757  17.076  -3.642  1.00 0.00 ? 21  LYS A HB2  3  
ATOM 9482  H HB3  . LYS A 1 21  ? 83.367  16.888  -4.698  1.00 0.00 ? 21  LYS A HB3  3  
ATOM 9483  H HG2  . LYS A 1 21  ? 84.084  19.512  -3.352  1.00 0.00 ? 21  LYS A HG2  3  
ATOM 9484  H HG3  . LYS A 1 21  ? 84.638  19.070  -4.961  1.00 0.00 ? 21  LYS A HG3  3  
ATOM 9485  H HD2  . LYS A 1 21  ? 82.118  18.685  -5.503  1.00 0.00 ? 21  LYS A HD2  3  
ATOM 9486  H HD3  . LYS A 1 21  ? 81.812  19.613  -4.035  1.00 0.00 ? 21  LYS A HD3  3  
ATOM 9487  H HE2  . LYS A 1 21  ? 81.809  21.088  -6.002  1.00 0.00 ? 21  LYS A HE2  3  
ATOM 9488  H HE3  . LYS A 1 21  ? 83.157  21.480  -4.936  1.00 0.00 ? 21  LYS A HE3  3  
ATOM 9489  H HZ1  . LYS A 1 21  ? 83.373  19.685  -7.288  1.00 0.00 ? 21  LYS A HZ1  3  
ATOM 9490  H HZ2  . LYS A 1 21  ? 84.645  20.283  -6.333  1.00 0.00 ? 21  LYS A HZ2  3  
ATOM 9491  H HZ3  . LYS A 1 21  ? 83.754  21.337  -7.322  1.00 0.00 ? 21  LYS A HZ3  3  
ATOM 9492  N N    . HIS A 1 22  ? 81.620  15.160  -2.772  1.00 0.00 ? 22  HIS A N    3  
ATOM 9493  C CA   . HIS A 1 22  ? 81.368  13.730  -2.582  1.00 0.00 ? 22  HIS A CA   3  
ATOM 9494  C C    . HIS A 1 22  ? 80.888  13.106  -3.883  1.00 0.00 ? 22  HIS A C    3  
ATOM 9495  O O    . HIS A 1 22  ? 80.021  13.650  -4.568  1.00 0.00 ? 22  HIS A O    3  
ATOM 9496  C CB   . HIS A 1 22  ? 80.308  13.529  -1.492  1.00 0.00 ? 22  HIS A CB   3  
ATOM 9497  C CG   . HIS A 1 22  ? 80.894  13.858  -0.144  1.00 0.00 ? 22  HIS A CG   3  
ATOM 9498  N ND1  . HIS A 1 22  ? 80.207  14.606  0.799   1.00 0.00 ? 22  HIS A ND1  3  
ATOM 9499  C CD2  . HIS A 1 22  ? 82.101  13.544  0.432   1.00 0.00 ? 22  HIS A CD2  3  
ATOM 9500  C CE1  . HIS A 1 22  ? 80.996  14.714  1.883   1.00 0.00 ? 22  HIS A CE1  3  
ATOM 9501  N NE2  . HIS A 1 22  ? 82.162  14.085  1.712   1.00 0.00 ? 22  HIS A NE2  3  
ATOM 9502  H H    . HIS A 1 22  ? 80.936  15.711  -3.205  1.00 0.00 ? 22  HIS A H    3  
ATOM 9503  H HA   . HIS A 1 22  ? 82.281  13.231  -2.278  1.00 0.00 ? 22  HIS A HA   3  
ATOM 9504  H HB2  . HIS A 1 22  ? 79.467  14.178  -1.685  1.00 0.00 ? 22  HIS A HB2  3  
ATOM 9505  H HB3  . HIS A 1 22  ? 79.976  12.500  -1.494  1.00 0.00 ? 22  HIS A HB3  3  
ATOM 9506  H HD1  . HIS A 1 22  ? 79.310  14.986  0.695   1.00 0.00 ? 22  HIS A HD1  3  
ATOM 9507  H HD2  . HIS A 1 22  ? 82.835  12.875  0.006   1.00 0.00 ? 22  HIS A HD2  3  
ATOM 9508  H HE1  . HIS A 1 22  ? 80.721  15.246  2.782   1.00 0.00 ? 22  HIS A HE1  3  
ATOM 9509  N N    . HIS A 1 23  ? 81.445  11.947  -4.201  1.00 0.00 ? 23  HIS A N    3  
ATOM 9510  C CA   . HIS A 1 23  ? 81.062  11.229  -5.406  1.00 0.00 ? 23  HIS A CA   3  
ATOM 9511  C C    . HIS A 1 23  ? 79.768  10.472  -5.131  1.00 0.00 ? 23  HIS A C    3  
ATOM 9512  O O    . HIS A 1 23  ? 79.774  9.438   -4.469  1.00 0.00 ? 23  HIS A O    3  
ATOM 9513  C CB   . HIS A 1 23  ? 82.179  10.252  -5.804  1.00 0.00 ? 23  HIS A CB   3  
ATOM 9514  C CG   . HIS A 1 23  ? 83.278  10.983  -6.531  1.00 0.00 ? 23  HIS A CG   3  
ATOM 9515  N ND1  . HIS A 1 23  ? 83.642  10.663  -7.830  1.00 0.00 ? 23  HIS A ND1  3  
ATOM 9516  C CD2  . HIS A 1 23  ? 84.103  12.011  -6.151  1.00 0.00 ? 23  HIS A CD2  3  
ATOM 9517  C CE1  . HIS A 1 23  ? 84.648  11.483  -8.181  1.00 0.00 ? 23  HIS A CE1  3  
ATOM 9518  N NE2  . HIS A 1 23  ? 84.969  12.324  -7.195  1.00 0.00 ? 23  HIS A NE2  3  
ATOM 9519  H H    . HIS A 1 23  ? 82.111  11.561  -3.595  1.00 0.00 ? 23  HIS A H    3  
ATOM 9520  H HA   . HIS A 1 23  ? 80.892  11.931  -6.212  1.00 0.00 ? 23  HIS A HA   3  
ATOM 9521  H HB2  . HIS A 1 23  ? 82.587  9.805   -4.913  1.00 0.00 ? 23  HIS A HB2  3  
ATOM 9522  H HB3  . HIS A 1 23  ? 81.778  9.480   -6.446  1.00 0.00 ? 23  HIS A HB3  3  
ATOM 9523  H HD1  . HIS A 1 23  ? 83.241  9.966   -8.389  1.00 0.00 ? 23  HIS A HD1  3  
ATOM 9524  H HD2  . HIS A 1 23  ? 84.147  12.439  -5.160  1.00 0.00 ? 23  HIS A HD2  3  
ATOM 9525  H HE1  . HIS A 1 23  ? 85.137  11.465  -9.144  1.00 0.00 ? 23  HIS A HE1  3  
ATOM 9526  N N    . MET A 1 24  ? 78.660  11.006  -5.624  1.00 0.00 ? 24  MET A N    3  
ATOM 9527  C CA   . MET A 1 24  ? 77.370  10.372  -5.407  1.00 0.00 ? 24  MET A CA   3  
ATOM 9528  C C    . MET A 1 24  ? 77.312  9.033   -6.130  1.00 0.00 ? 24  MET A C    3  
ATOM 9529  O O    . MET A 1 24  ? 78.242  8.664   -6.847  1.00 0.00 ? 24  MET A O    3  
ATOM 9530  C CB   . MET A 1 24  ? 76.248  11.285  -5.905  1.00 0.00 ? 24  MET A CB   3  
ATOM 9531  C CG   . MET A 1 24  ? 76.460  11.601  -7.387  1.00 0.00 ? 24  MET A CG   3  
ATOM 9532  S SD   . MET A 1 24  ? 75.187  12.763  -7.942  1.00 0.00 ? 24  MET A SD   3  
ATOM 9533  C CE   . MET A 1 24  ? 76.051  13.358  -9.417  1.00 0.00 ? 24  MET A CE   3  
ATOM 9534  H H    . MET A 1 24  ? 78.710  11.842  -6.132  1.00 0.00 ? 24  MET A H    3  
ATOM 9535  H HA   . MET A 1 24  ? 77.237  10.204  -4.349  1.00 0.00 ? 24  MET A HA   3  
ATOM 9536  H HB2  . MET A 1 24  ? 75.298  10.791  -5.771  1.00 0.00 ? 24  MET A HB2  3  
ATOM 9537  H HB3  . MET A 1 24  ? 76.255  12.205  -5.339  1.00 0.00 ? 24  MET A HB3  3  
ATOM 9538  H HG2  . MET A 1 24  ? 77.435  12.042  -7.525  1.00 0.00 ? 24  MET A HG2  3  
ATOM 9539  H HG3  . MET A 1 24  ? 76.391  10.691  -7.965  1.00 0.00 ? 24  MET A HG3  3  
ATOM 9540  H HE1  . MET A 1 24  ? 76.311  12.519  -10.046 1.00 0.00 ? 24  MET A HE1  3  
ATOM 9541  H HE2  . MET A 1 24  ? 76.951  13.879  -9.123  1.00 0.00 ? 24  MET A HE2  3  
ATOM 9542  H HE3  . MET A 1 24  ? 75.408  14.031  -9.965  1.00 0.00 ? 24  MET A HE3  3  
ATOM 9543  N N    . GLY A 1 25  ? 76.218  8.311   -5.936  1.00 0.00 ? 25  GLY A N    3  
ATOM 9544  C CA   . GLY A 1 25  ? 76.047  7.018   -6.571  1.00 0.00 ? 25  GLY A CA   3  
ATOM 9545  C C    . GLY A 1 25  ? 74.903  6.246   -5.957  1.00 0.00 ? 25  GLY A C    3  
ATOM 9546  O O    . GLY A 1 25  ? 74.849  6.060   -4.743  1.00 0.00 ? 25  GLY A O    3  
ATOM 9547  H H    . GLY A 1 25  ? 75.509  8.659   -5.357  1.00 0.00 ? 25  GLY A H    3  
ATOM 9548  H HA2  . GLY A 1 25  ? 75.850  7.164   -7.623  1.00 0.00 ? 25  GLY A HA2  3  
ATOM 9549  H HA3  . GLY A 1 25  ? 76.954  6.445   -6.458  1.00 0.00 ? 25  GLY A HA3  3  
ATOM 9550  N N    . ILE A 1 26  ? 73.978  5.795   -6.802  1.00 0.00 ? 26  ILE A N    3  
ATOM 9551  C CA   . ILE A 1 26  ? 72.813  5.039   -6.338  1.00 0.00 ? 26  ILE A CA   3  
ATOM 9552  C C    . ILE A 1 26  ? 72.918  3.586   -6.767  1.00 0.00 ? 26  ILE A C    3  
ATOM 9553  O O    . ILE A 1 26  ? 73.512  3.274   -7.795  1.00 0.00 ? 26  ILE A O    3  
ATOM 9554  C CB   . ILE A 1 26  ? 71.510  5.636   -6.919  1.00 0.00 ? 26  ILE A CB   3  
ATOM 9555  C CG1  . ILE A 1 26  ? 70.302  4.949   -6.266  1.00 0.00 ? 26  ILE A CG1  3  
ATOM 9556  C CG2  . ILE A 1 26  ? 71.468  5.429   -8.441  1.00 0.00 ? 26  ILE A CG2  3  
ATOM 9557  C CD1  . ILE A 1 26  ? 69.004  5.613   -6.738  1.00 0.00 ? 26  ILE A CD1  3  
ATOM 9558  H H    . ILE A 1 26  ? 74.077  5.977   -7.760  1.00 0.00 ? 26  ILE A H    3  
ATOM 9559  H HA   . ILE A 1 26  ? 72.753  5.074   -5.262  1.00 0.00 ? 26  ILE A HA   3  
ATOM 9560  H HB   . ILE A 1 26  ? 71.481  6.694   -6.705  1.00 0.00 ? 26  ILE A HB   3  
ATOM 9561  H HG12 . ILE A 1 26  ? 70.291  3.904   -6.541  1.00 0.00 ? 26  ILE A HG12 3  
ATOM 9562  H HG13 . ILE A 1 26  ? 70.378  5.037   -5.193  1.00 0.00 ? 26  ILE A HG13 3  
ATOM 9563  H HG21 . ILE A 1 26  ? 72.433  5.666   -8.864  1.00 0.00 ? 26  ILE A HG21 3  
ATOM 9564  H HG22 . ILE A 1 26  ? 70.720  6.079   -8.872  1.00 0.00 ? 26  ILE A HG22 3  
ATOM 9565  H HG23 . ILE A 1 26  ? 71.223  4.401   -8.663  1.00 0.00 ? 26  ILE A HG23 3  
ATOM 9566  H HD11 . ILE A 1 26  ? 68.192  5.313   -6.092  1.00 0.00 ? 26  ILE A HD11 3  
ATOM 9567  H HD12 . ILE A 1 26  ? 68.788  5.303   -7.750  1.00 0.00 ? 26  ILE A HD12 3  
ATOM 9568  H HD13 . ILE A 1 26  ? 69.110  6.687   -6.706  1.00 0.00 ? 26  ILE A HD13 3  
ATOM 9569  N N    . ASP A 1 27  ? 72.331  2.703   -5.964  1.00 0.00 ? 27  ASP A N    3  
ATOM 9570  C CA   . ASP A 1 27  ? 72.337  1.266   -6.242  1.00 0.00 ? 27  ASP A CA   3  
ATOM 9571  C C    . ASP A 1 27  ? 70.930  0.724   -6.063  1.00 0.00 ? 27  ASP A C    3  
ATOM 9572  O O    . ASP A 1 27  ? 70.209  1.160   -5.171  1.00 0.00 ? 27  ASP A O    3  
ATOM 9573  C CB   . ASP A 1 27  ? 73.295  0.549   -5.290  1.00 0.00 ? 27  ASP A CB   3  
ATOM 9574  C CG   . ASP A 1 27  ? 73.261  -0.955  -5.566  1.00 0.00 ? 27  ASP A CG   3  
ATOM 9575  O OD1  . ASP A 1 27  ? 72.279  -1.582  -5.205  1.00 0.00 ? 27  ASP A OD1  3  
ATOM 9576  O OD2  . ASP A 1 27  ? 74.220  -1.454  -6.134  1.00 0.00 ? 27  ASP A OD2  3  
ATOM 9577  H H    . ASP A 1 27  ? 71.873  3.027   -5.160  1.00 0.00 ? 27  ASP A H    3  
ATOM 9578  H HA   . ASP A 1 27  ? 72.649  1.090   -7.261  1.00 0.00 ? 27  ASP A HA   3  
ATOM 9579  H HB2  . ASP A 1 27  ? 74.298  0.922   -5.440  1.00 0.00 ? 27  ASP A HB2  3  
ATOM 9580  H HB3  . ASP A 1 27  ? 72.992  0.732   -4.269  1.00 0.00 ? 27  ASP A HB3  3  
ATOM 9581  N N    . VAL A 1 28  ? 70.530  -0.210  -6.925  1.00 0.00 ? 28  VAL A N    3  
ATOM 9582  C CA   . VAL A 1 28  ? 69.181  -0.784  -6.852  1.00 0.00 ? 28  VAL A CA   3  
ATOM 9583  C C    . VAL A 1 28  ? 69.211  -2.294  -7.061  1.00 0.00 ? 28  VAL A C    3  
ATOM 9584  O O    . VAL A 1 28  ? 69.221  -2.773  -8.194  1.00 0.00 ? 28  VAL A O    3  
ATOM 9585  C CB   . VAL A 1 28  ? 68.268  -0.163  -7.929  1.00 0.00 ? 28  VAL A CB   3  
ATOM 9586  C CG1  . VAL A 1 28  ? 66.810  -0.538  -7.652  1.00 0.00 ? 28  VAL A CG1  3  
ATOM 9587  C CG2  . VAL A 1 28  ? 68.413  1.360   -7.904  1.00 0.00 ? 28  VAL A CG2  3  
ATOM 9588  H H    . VAL A 1 28  ? 71.142  -0.510  -7.628  1.00 0.00 ? 28  VAL A H    3  
ATOM 9589  H HA   . VAL A 1 28  ? 68.751  -0.583  -5.879  1.00 0.00 ? 28  VAL A HA   3  
ATOM 9590  H HB   . VAL A 1 28  ? 68.553  -0.535  -8.902  1.00 0.00 ? 28  VAL A HB   3  
ATOM 9591  H HG11 . VAL A 1 28  ? 66.174  -0.091  -8.401  1.00 0.00 ? 28  VAL A HG11 3  
ATOM 9592  H HG12 . VAL A 1 28  ? 66.525  -0.176  -6.676  1.00 0.00 ? 28  VAL A HG12 3  
ATOM 9593  H HG13 . VAL A 1 28  ? 66.703  -1.612  -7.683  1.00 0.00 ? 28  VAL A HG13 3  
ATOM 9594  H HG21 . VAL A 1 28  ? 68.129  1.732   -6.930  1.00 0.00 ? 28  VAL A HG21 3  
ATOM 9595  H HG22 . VAL A 1 28  ? 67.773  1.796   -8.656  1.00 0.00 ? 28  VAL A HG22 3  
ATOM 9596  H HG23 . VAL A 1 28  ? 69.440  1.629   -8.105  1.00 0.00 ? 28  VAL A HG23 3  
ATOM 9597  N N    . ILE A 1 29  ? 69.199  -3.037  -5.959  1.00 0.00 ? 29  ILE A N    3  
ATOM 9598  C CA   . ILE A 1 29  ? 69.196  -4.498  -6.021  1.00 0.00 ? 29  ILE A CA   3  
ATOM 9599  C C    . ILE A 1 29  ? 67.755  -4.992  -6.013  1.00 0.00 ? 29  ILE A C    3  
ATOM 9600  O O    . ILE A 1 29  ? 66.929  -4.489  -5.252  1.00 0.00 ? 29  ILE A O    3  
ATOM 9601  C CB   . ILE A 1 29  ? 69.942  -5.100  -4.808  1.00 0.00 ? 29  ILE A CB   3  
ATOM 9602  C CG1  . ILE A 1 29  ? 71.277  -4.352  -4.581  1.00 0.00 ? 29  ILE A CG1  3  
ATOM 9603  C CG2  . ILE A 1 29  ? 70.186  -6.603  -5.032  1.00 0.00 ? 29  ILE A CG2  3  
ATOM 9604  C CD1  . ILE A 1 29  ? 72.053  -4.179  -5.896  1.00 0.00 ? 29  ILE A CD1  3  
ATOM 9605  H H    . ILE A 1 29  ? 69.172  -2.596  -5.085  1.00 0.00 ? 29  ILE A H    3  
ATOM 9606  H HA   . ILE A 1 29  ? 69.678  -4.823  -6.933  1.00 0.00 ? 29  ILE A HA   3  
ATOM 9607  H HB   . ILE A 1 29  ? 69.324  -4.981  -3.927  1.00 0.00 ? 29  ILE A HB   3  
ATOM 9608  H HG12 . ILE A 1 29  ? 71.066  -3.376  -4.170  1.00 0.00 ? 29  ILE A HG12 3  
ATOM 9609  H HG13 . ILE A 1 29  ? 71.886  -4.903  -3.879  1.00 0.00 ? 29  ILE A HG13 3  
ATOM 9610  H HG21 . ILE A 1 29  ? 70.918  -6.959  -4.326  1.00 0.00 ? 29  ILE A HG21 3  
ATOM 9611  H HG22 . ILE A 1 29  ? 70.541  -6.779  -6.034  1.00 0.00 ? 29  ILE A HG22 3  
ATOM 9612  H HG23 . ILE A 1 29  ? 69.261  -7.141  -4.884  1.00 0.00 ? 29  ILE A HG23 3  
ATOM 9613  H HD11 . ILE A 1 29  ? 72.101  -5.119  -6.421  1.00 0.00 ? 29  ILE A HD11 3  
ATOM 9614  H HD12 . ILE A 1 29  ? 73.054  -3.841  -5.676  1.00 0.00 ? 29  ILE A HD12 3  
ATOM 9615  H HD13 . ILE A 1 29  ? 71.557  -3.444  -6.513  1.00 0.00 ? 29  ILE A HD13 3  
ATOM 9616  N N    . ILE A 1 30  ? 67.442  -5.967  -6.867  1.00 0.00 ? 30  ILE A N    3  
ATOM 9617  C CA   . ILE A 1 30  ? 66.076  -6.492  -6.940  1.00 0.00 ? 30  ILE A CA   3  
ATOM 9618  C C    . ILE A 1 30  ? 66.068  -7.998  -7.189  1.00 0.00 ? 30  ILE A C    3  
ATOM 9619  O O    . ILE A 1 30  ? 66.666  -8.491  -8.142  1.00 0.00 ? 30  ILE A O    3  
ATOM 9620  C CB   . ILE A 1 30  ? 65.277  -5.776  -8.060  1.00 0.00 ? 30  ILE A CB   3  
ATOM 9621  C CG1  . ILE A 1 30  ? 65.839  -6.144  -9.472  1.00 0.00 ? 30  ILE A CG1  3  
ATOM 9622  C CG2  . ILE A 1 30  ? 65.383  -4.258  -7.838  1.00 0.00 ? 30  ILE A CG2  3  
ATOM 9623  C CD1  . ILE A 1 30  ? 64.974  -7.231  -10.135 1.00 0.00 ? 30  ILE A CD1  3  
ATOM 9624  H H    . ILE A 1 30  ? 68.132  -6.330  -7.462  1.00 0.00 ? 30  ILE A H    3  
ATOM 9625  H HA   . ILE A 1 30  ? 65.573  -6.309  -5.998  1.00 0.00 ? 30  ILE A HA   3  
ATOM 9626  H HB   . ILE A 1 30  ? 64.236  -6.064  -7.987  1.00 0.00 ? 30  ILE A HB   3  
ATOM 9627  H HG12 . ILE A 1 30  ? 65.834  -5.268  -10.111 1.00 0.00 ? 30  ILE A HG12 3  
ATOM 9628  H HG13 . ILE A 1 30  ? 66.855  -6.501  -9.385  1.00 0.00 ? 30  ILE A HG13 3  
ATOM 9629  H HG21 . ILE A 1 30  ? 65.180  -4.026  -6.803  1.00 0.00 ? 30  ILE A HG21 3  
ATOM 9630  H HG22 . ILE A 1 30  ? 64.666  -3.751  -8.467  1.00 0.00 ? 30  ILE A HG22 3  
ATOM 9631  H HG23 . ILE A 1 30  ? 66.380  -3.927  -8.092  1.00 0.00 ? 30  ILE A HG23 3  
ATOM 9632  H HD11 . ILE A 1 30  ? 64.071  -6.785  -10.524 1.00 0.00 ? 30  ILE A HD11 3  
ATOM 9633  H HD12 . ILE A 1 30  ? 64.713  -7.984  -9.408  1.00 0.00 ? 30  ILE A HD12 3  
ATOM 9634  H HD13 . ILE A 1 30  ? 65.525  -7.690  -10.943 1.00 0.00 ? 30  ILE A HD13 3  
ATOM 9635  N N    . LYS A 1 31  ? 65.355  -8.716  -6.322  1.00 0.00 ? 31  LYS A N    3  
ATOM 9636  C CA   . LYS A 1 31  ? 65.218  -10.172 -6.430  1.00 0.00 ? 31  LYS A CA   3  
ATOM 9637  C C    . LYS A 1 31  ? 63.757  -10.505 -6.692  1.00 0.00 ? 31  LYS A C    3  
ATOM 9638  O O    . LYS A 1 31  ? 62.883  -10.060 -5.956  1.00 0.00 ? 31  LYS A O    3  
ATOM 9639  C CB   . LYS A 1 31  ? 65.671  -10.843 -5.131  1.00 0.00 ? 31  LYS A CB   3  
ATOM 9640  C CG   . LYS A 1 31  ? 65.697  -12.364 -5.323  1.00 0.00 ? 31  LYS A CG   3  
ATOM 9641  C CD   . LYS A 1 31  ? 66.307  -13.042 -4.086  1.00 0.00 ? 31  LYS A CD   3  
ATOM 9642  C CE   . LYS A 1 31  ? 65.331  -12.988 -2.904  1.00 0.00 ? 31  LYS A CE   3  
ATOM 9643  N NZ   . LYS A 1 31  ? 65.768  -13.957 -1.859  1.00 0.00 ? 31  LYS A NZ   3  
ATOM 9644  H H    . LYS A 1 31  ? 64.890  -8.249  -5.597  1.00 0.00 ? 31  LYS A H    3  
ATOM 9645  H HA   . LYS A 1 31  ? 65.819  -10.543 -7.252  1.00 0.00 ? 31  LYS A HA   3  
ATOM 9646  H HB2  . LYS A 1 31  ? 66.660  -10.494 -4.872  1.00 0.00 ? 31  LYS A HB2  3  
ATOM 9647  H HB3  . LYS A 1 31  ? 64.982  -10.592 -4.340  1.00 0.00 ? 31  LYS A HB3  3  
ATOM 9648  H HG2  . LYS A 1 31  ? 64.690  -12.723 -5.478  1.00 0.00 ? 31  LYS A HG2  3  
ATOM 9649  H HG3  . LYS A 1 31  ? 66.296  -12.604 -6.189  1.00 0.00 ? 31  LYS A HG3  3  
ATOM 9650  H HD2  . LYS A 1 31  ? 66.527  -14.074 -4.320  1.00 0.00 ? 31  LYS A HD2  3  
ATOM 9651  H HD3  . LYS A 1 31  ? 67.222  -12.537 -3.816  1.00 0.00 ? 31  LYS A HD3  3  
ATOM 9652  H HE2  . LYS A 1 31  ? 65.323  -11.994 -2.485  1.00 0.00 ? 31  LYS A HE2  3  
ATOM 9653  H HE3  . LYS A 1 31  ? 64.336  -13.246 -3.235  1.00 0.00 ? 31  LYS A HE3  3  
ATOM 9654  H HZ1  . LYS A 1 31  ? 65.897  -14.895 -2.289  1.00 0.00 ? 31  LYS A HZ1  3  
ATOM 9655  H HZ2  . LYS A 1 31  ? 65.044  -14.013 -1.114  1.00 0.00 ? 31  LYS A HZ2  3  
ATOM 9656  H HZ3  . LYS A 1 31  ? 66.668  -13.641 -1.447  1.00 0.00 ? 31  LYS A HZ3  3  
ATOM 9657  N N    . VAL A 1 32  ? 63.495  -11.278 -7.748  1.00 0.00 ? 32  VAL A N    3  
ATOM 9658  C CA   . VAL A 1 32  ? 62.120  -11.656 -8.110  1.00 0.00 ? 32  VAL A CA   3  
ATOM 9659  C C    . VAL A 1 32  ? 61.978  -13.166 -8.251  1.00 0.00 ? 32  VAL A C    3  
ATOM 9660  O O    . VAL A 1 32  ? 62.788  -13.815 -8.912  1.00 0.00 ? 32  VAL A O    3  
ATOM 9661  C CB   . VAL A 1 32  ? 61.712  -11.001 -9.445  1.00 0.00 ? 32  VAL A CB   3  
ATOM 9662  C CG1  . VAL A 1 32  ? 60.272  -11.391 -9.796  1.00 0.00 ? 32  VAL A CG1  3  
ATOM 9663  C CG2  . VAL A 1 32  ? 61.808  -9.477  -9.310  1.00 0.00 ? 32  VAL A CG2  3  
ATOM 9664  H H    . VAL A 1 32  ? 64.243  -11.603 -8.292  1.00 0.00 ? 32  VAL A H    3  
ATOM 9665  H HA   . VAL A 1 32  ? 61.433  -11.320 -7.344  1.00 0.00 ? 32  VAL A HA   3  
ATOM 9666  H HB   . VAL A 1 32  ? 62.376  -11.337 -10.228 1.00 0.00 ? 32  VAL A HB   3  
ATOM 9667  H HG11 . VAL A 1 32  ? 59.639  -11.247 -8.933  1.00 0.00 ? 32  VAL A HG11 3  
ATOM 9668  H HG12 . VAL A 1 32  ? 60.243  -12.428 -10.096 1.00 0.00 ? 32  VAL A HG12 3  
ATOM 9669  H HG13 . VAL A 1 32  ? 59.917  -10.774 -10.609 1.00 0.00 ? 32  VAL A HG13 3  
ATOM 9670  H HG21 . VAL A 1 32  ? 62.762  -9.214  -8.880  1.00 0.00 ? 32  VAL A HG21 3  
ATOM 9671  H HG22 . VAL A 1 32  ? 61.014  -9.121  -8.670  1.00 0.00 ? 32  VAL A HG22 3  
ATOM 9672  H HG23 . VAL A 1 32  ? 61.715  -9.023  -10.285 1.00 0.00 ? 32  VAL A HG23 3  
ATOM 9673  N N    . THR A 1 33  ? 60.922  -13.716 -7.645  1.00 0.00 ? 33  THR A N    3  
ATOM 9674  C CA   . THR A 1 33  ? 60.646  -15.155 -7.721  1.00 0.00 ? 33  THR A CA   3  
ATOM 9675  C C    . THR A 1 33  ? 59.470  -15.395 -8.665  1.00 0.00 ? 33  THR A C    3  
ATOM 9676  O O    . THR A 1 33  ? 58.428  -14.751 -8.545  1.00 0.00 ? 33  THR A O    3  
ATOM 9677  C CB   . THR A 1 33  ? 60.299  -15.738 -6.325  1.00 0.00 ? 33  THR A CB   3  
ATOM 9678  O OG1  . THR A 1 33  ? 61.097  -15.098 -5.340  1.00 0.00 ? 33  THR A OG1  3  
ATOM 9679  C CG2  . THR A 1 33  ? 60.575  -17.246 -6.298  1.00 0.00 ? 33  THR A CG2  3  
ATOM 9680  H H    . THR A 1 33  ? 60.304  -13.140 -7.150  1.00 0.00 ? 33  THR A H    3  
ATOM 9681  H HA   . THR A 1 33  ? 61.514  -15.669 -8.111  1.00 0.00 ? 33  THR A HA   3  
ATOM 9682  H HB   . THR A 1 33  ? 59.255  -15.568 -6.107  1.00 0.00 ? 33  THR A HB   3  
ATOM 9683  H HG1  . THR A 1 33  ? 60.820  -15.419 -4.479  1.00 0.00 ? 33  THR A HG1  3  
ATOM 9684  H HG21 . THR A 1 33  ? 61.620  -17.425 -6.507  1.00 0.00 ? 33  THR A HG21 3  
ATOM 9685  H HG22 . THR A 1 33  ? 59.969  -17.737 -7.045  1.00 0.00 ? 33  THR A HG22 3  
ATOM 9686  H HG23 . THR A 1 33  ? 60.330  -17.639 -5.322  1.00 0.00 ? 33  THR A HG23 3  
ATOM 9687  N N    . LYS A 1 34  ? 59.640  -16.324 -9.598  1.00 0.00 ? 34  LYS A N    3  
ATOM 9688  C CA   . LYS A 1 34  ? 58.578  -16.638 -10.550 1.00 0.00 ? 34  LYS A CA   3  
ATOM 9689  C C    . LYS A 1 34  ? 57.553  -17.566 -9.909  1.00 0.00 ? 34  LYS A C    3  
ATOM 9690  O O    . LYS A 1 34  ? 57.870  -18.308 -8.979  1.00 0.00 ? 34  LYS A O    3  
ATOM 9691  C CB   . LYS A 1 34  ? 59.165  -17.317 -11.792 1.00 0.00 ? 34  LYS A CB   3  
ATOM 9692  C CG   . LYS A 1 34  ? 60.370  -16.522 -12.301 1.00 0.00 ? 34  LYS A CG   3  
ATOM 9693  C CD   . LYS A 1 34  ? 60.906  -17.166 -13.589 1.00 0.00 ? 34  LYS A CD   3  
ATOM 9694  C CE   . LYS A 1 34  ? 62.312  -16.640 -13.896 1.00 0.00 ? 34  LYS A CE   3  
ATOM 9695  N NZ   . LYS A 1 34  ? 63.291  -17.287 -12.978 1.00 0.00 ? 34  LYS A NZ   3  
ATOM 9696  H H    . LYS A 1 34  ? 60.488  -16.812 -9.641  1.00 0.00 ? 34  LYS A H    3  
ATOM 9697  H HA   . LYS A 1 34  ? 58.086  -15.724 -10.853 1.00 0.00 ? 34  LYS A HA   3  
ATOM 9698  H HB2  . LYS A 1 34  ? 59.477  -18.320 -11.541 1.00 0.00 ? 34  LYS A HB2  3  
ATOM 9699  H HB3  . LYS A 1 34  ? 58.414  -17.357 -12.565 1.00 0.00 ? 34  LYS A HB3  3  
ATOM 9700  H HG2  . LYS A 1 34  ? 60.068  -15.506 -12.504 1.00 0.00 ? 34  LYS A HG2  3  
ATOM 9701  H HG3  . LYS A 1 34  ? 61.145  -16.522 -11.549 1.00 0.00 ? 34  LYS A HG3  3  
ATOM 9702  H HD2  . LYS A 1 34  ? 60.947  -18.240 -13.469 1.00 0.00 ? 34  LYS A HD2  3  
ATOM 9703  H HD3  . LYS A 1 34  ? 60.248  -16.924 -14.411 1.00 0.00 ? 34  LYS A HD3  3  
ATOM 9704  H HE2  . LYS A 1 34  ? 62.568  -16.874 -14.918 1.00 0.00 ? 34  LYS A HE2  3  
ATOM 9705  H HE3  . LYS A 1 34  ? 62.338  -15.568 -13.755 1.00 0.00 ? 34  LYS A HE3  3  
ATOM 9706  H HZ1  . LYS A 1 34  ? 63.064  -18.297 -12.884 1.00 0.00 ? 34  LYS A HZ1  3  
ATOM 9707  H HZ2  . LYS A 1 34  ? 63.243  -16.832 -12.043 1.00 0.00 ? 34  LYS A HZ2  3  
ATOM 9708  H HZ3  . LYS A 1 34  ? 64.251  -17.185 -13.366 1.00 0.00 ? 34  LYS A HZ3  3  
ATOM 9709  N N    . GLN A 1 35  ? 56.328  -17.533 -10.418 1.00 0.00 ? 35  GLN A N    3  
ATOM 9710  C CA   . GLN A 1 35  ? 55.277  -18.392 -9.888  1.00 0.00 ? 35  GLN A CA   3  
ATOM 9711  C C    . GLN A 1 35  ? 55.615  -19.854 -10.198 1.00 0.00 ? 35  GLN A C    3  
ATOM 9712  O O    . GLN A 1 35  ? 56.645  -20.142 -10.805 1.00 0.00 ? 35  GLN A O    3  
ATOM 9713  C CB   . GLN A 1 35  ? 53.914  -17.994 -10.509 1.00 0.00 ? 35  GLN A CB   3  
ATOM 9714  C CG   . GLN A 1 35  ? 52.783  -18.127 -9.474  1.00 0.00 ? 35  GLN A CG   3  
ATOM 9715  C CD   . GLN A 1 35  ? 52.893  -17.001 -8.443  1.00 0.00 ? 35  GLN A CD   3  
ATOM 9716  O OE1  . GLN A 1 35  ? 53.087  -15.855 -8.797  1.00 0.00 ? 35  GLN A OE1  3  
ATOM 9717  N NE2  . GLN A 1 35  ? 52.777  -17.280 -7.174  1.00 0.00 ? 35  GLN A NE2  3  
ATOM 9718  H H    . GLN A 1 35  ? 56.130  -16.932 -11.166 1.00 0.00 ? 35  GLN A H    3  
ATOM 9719  H HA   . GLN A 1 35  ? 55.239  -18.262 -8.815  1.00 0.00 ? 35  GLN A HA   3  
ATOM 9720  H HB2  . GLN A 1 35  ? 53.966  -16.969 -10.844 1.00 0.00 ? 35  GLN A HB2  3  
ATOM 9721  H HB3  . GLN A 1 35  ? 53.692  -18.629 -11.357 1.00 0.00 ? 35  GLN A HB3  3  
ATOM 9722  H HG2  . GLN A 1 35  ? 51.827  -18.064 -9.976  1.00 0.00 ? 35  GLN A HG2  3  
ATOM 9723  H HG3  . GLN A 1 35  ? 52.862  -19.079 -8.973  1.00 0.00 ? 35  GLN A HG3  3  
ATOM 9724  H HE21 . GLN A 1 35  ? 52.620  -18.204 -6.888  1.00 0.00 ? 35  GLN A HE21 3  
ATOM 9725  H HE22 . GLN A 1 35  ? 52.846  -16.566 -6.507  1.00 0.00 ? 35  GLN A HE22 3  
ATOM 9726  N N    . ASP A 1 36  ? 54.750  -20.770 -9.776  1.00 0.00 ? 36  ASP A N    3  
ATOM 9727  C CA   . ASP A 1 36  ? 54.980  -22.192 -10.017 1.00 0.00 ? 36  ASP A CA   3  
ATOM 9728  C C    . ASP A 1 36  ? 54.634  -22.565 -11.457 1.00 0.00 ? 36  ASP A C    3  
ATOM 9729  O O    . ASP A 1 36  ? 55.234  -23.474 -12.033 1.00 0.00 ? 36  ASP A O    3  
ATOM 9730  C CB   . ASP A 1 36  ? 54.128  -23.024 -9.057  1.00 0.00 ? 36  ASP A CB   3  
ATOM 9731  C CG   . ASP A 1 36  ? 54.536  -22.718 -7.615  1.00 0.00 ? 36  ASP A CG   3  
ATOM 9732  O OD1  . ASP A 1 36  ? 55.716  -22.517 -7.384  1.00 0.00 ? 36  ASP A OD1  3  
ATOM 9733  O OD2  . ASP A 1 36  ? 53.661  -22.690 -6.765  1.00 0.00 ? 36  ASP A OD2  3  
ATOM 9734  H H    . ASP A 1 36  ? 53.946  -20.488 -9.294  1.00 0.00 ? 36  ASP A H    3  
ATOM 9735  H HA   . ASP A 1 36  ? 56.021  -22.418 -9.838  1.00 0.00 ? 36  ASP A HA   3  
ATOM 9736  H HB2  . ASP A 1 36  ? 53.085  -22.779 -9.197  1.00 0.00 ? 36  ASP A HB2  3  
ATOM 9737  H HB3  . ASP A 1 36  ? 54.280  -24.074 -9.257  1.00 0.00 ? 36  ASP A HB3  3  
ATOM 9738  N N    . GLN A 1 37  ? 53.656  -21.866 -12.032 1.00 0.00 ? 37  GLN A N    3  
ATOM 9739  C CA   . GLN A 1 37  ? 53.225  -22.140 -13.404 1.00 0.00 ? 37  GLN A CA   3  
ATOM 9740  C C    . GLN A 1 37  ? 54.153  -21.473 -14.419 1.00 0.00 ? 37  GLN A C    3  
ATOM 9741  O O    . GLN A 1 37  ? 54.386  -22.007 -15.503 1.00 0.00 ? 37  GLN A O    3  
ATOM 9742  C CB   . GLN A 1 37  ? 51.798  -21.629 -13.608 1.00 0.00 ? 37  GLN A CB   3  
ATOM 9743  C CG   . GLN A 1 37  ? 50.877  -22.261 -12.563 1.00 0.00 ? 37  GLN A CG   3  
ATOM 9744  C CD   . GLN A 1 37  ? 49.433  -21.826 -12.823 1.00 0.00 ? 37  GLN A CD   3  
ATOM 9745  O OE1  . GLN A 1 37  ? 49.161  -21.119 -13.773 1.00 0.00 ? 37  GLN A OE1  3  
ATOM 9746  N NE2  . GLN A 1 37  ? 48.490  -22.223 -12.013 1.00 0.00 ? 37  GLN A NE2  3  
ATOM 9747  H H    . GLN A 1 37  ? 53.209  -21.159 -11.521 1.00 0.00 ? 37  GLN A H    3  
ATOM 9748  H HA   . GLN A 1 37  ? 53.236  -23.207 -13.573 1.00 0.00 ? 37  GLN A HA   3  
ATOM 9749  H HB2  . GLN A 1 37  ? 51.782  -20.553 -13.502 1.00 0.00 ? 37  GLN A HB2  3  
ATOM 9750  H HB3  . GLN A 1 37  ? 51.456  -21.898 -14.596 1.00 0.00 ? 37  GLN A HB3  3  
ATOM 9751  H HG2  . GLN A 1 37  ? 50.947  -23.337 -12.626 1.00 0.00 ? 37  GLN A HG2  3  
ATOM 9752  H HG3  . GLN A 1 37  ? 51.176  -21.938 -11.577 1.00 0.00 ? 37  GLN A HG3  3  
ATOM 9753  H HE21 . GLN A 1 37  ? 48.709  -22.794 -11.248 1.00 0.00 ? 37  GLN A HE21 3  
ATOM 9754  H HE22 . GLN A 1 37  ? 47.562  -21.951 -12.171 1.00 0.00 ? 37  GLN A HE22 3  
ATOM 9755  N N    . THR A 1 38  ? 54.676  -20.302 -14.063 1.00 0.00 ? 38  THR A N    3  
ATOM 9756  C CA   . THR A 1 38  ? 55.576  -19.558 -14.950 1.00 0.00 ? 38  THR A CA   3  
ATOM 9757  C C    . THR A 1 38  ? 56.568  -20.504 -15.656 1.00 0.00 ? 38  THR A C    3  
ATOM 9758  O O    . THR A 1 38  ? 57.520  -20.971 -15.031 1.00 0.00 ? 38  THR A O    3  
ATOM 9759  C CB   . THR A 1 38  ? 56.390  -18.523 -14.140 1.00 0.00 ? 38  THR A CB   3  
ATOM 9760  O OG1  . THR A 1 38  ? 56.901  -19.143 -12.970 1.00 0.00 ? 38  THR A OG1  3  
ATOM 9761  C CG2  . THR A 1 38  ? 55.490  -17.348 -13.743 1.00 0.00 ? 38  THR A CG2  3  
ATOM 9762  H H    . THR A 1 38  ? 54.451  -19.924 -13.188 1.00 0.00 ? 38  THR A H    3  
ATOM 9763  H HA   . THR A 1 38  ? 54.987  -19.033 -15.681 1.00 0.00 ? 38  THR A HA   3  
ATOM 9764  H HB   . THR A 1 38  ? 57.210  -18.152 -14.739 1.00 0.00 ? 38  THR A HB   3  
ATOM 9765  H HG1  . THR A 1 38  ? 56.572  -18.659 -12.209 1.00 0.00 ? 38  THR A HG1  3  
ATOM 9766  H HG21 . THR A 1 38  ? 55.305  -16.729 -14.608 1.00 0.00 ? 38  THR A HG21 3  
ATOM 9767  H HG22 . THR A 1 38  ? 55.980  -16.763 -12.980 1.00 0.00 ? 38  THR A HG22 3  
ATOM 9768  H HG23 . THR A 1 38  ? 54.552  -17.723 -13.363 1.00 0.00 ? 38  THR A HG23 3  
ATOM 9769  N N    . PRO A 1 39  ? 56.378  -20.803 -16.964 1.00 0.00 ? 39  PRO A N    3  
ATOM 9770  C CA   . PRO A 1 39  ? 57.291  -21.694 -17.699 1.00 0.00 ? 39  PRO A CA   3  
ATOM 9771  C C    . PRO A 1 39  ? 58.758  -21.375 -17.408 1.00 0.00 ? 39  PRO A C    3  
ATOM 9772  O O    . PRO A 1 39  ? 59.079  -20.313 -16.876 1.00 0.00 ? 39  PRO A O    3  
ATOM 9773  C CB   . PRO A 1 39  ? 56.937  -21.437 -19.172 1.00 0.00 ? 39  PRO A CB   3  
ATOM 9774  C CG   . PRO A 1 39  ? 55.484  -21.089 -19.141 1.00 0.00 ? 39  PRO A CG   3  
ATOM 9775  C CD   . PRO A 1 39  ? 55.281  -20.316 -17.831 1.00 0.00 ? 39  PRO A CD   3  
ATOM 9776  H HA   . PRO A 1 39  ? 57.080  -22.722 -17.453 1.00 0.00 ? 39  PRO A HA   3  
ATOM 9777  H HB2  . PRO A 1 39  ? 57.519  -20.610 -19.563 1.00 0.00 ? 39  PRO A HB2  3  
ATOM 9778  H HB3  . PRO A 1 39  ? 57.098  -22.325 -19.766 1.00 0.00 ? 39  PRO A HB3  3  
ATOM 9779  H HG2  . PRO A 1 39  ? 55.226  -20.473 -19.996 1.00 0.00 ? 39  PRO A HG2  3  
ATOM 9780  H HG3  . PRO A 1 39  ? 54.882  -21.987 -19.133 1.00 0.00 ? 39  PRO A HG3  3  
ATOM 9781  H HD2  . PRO A 1 39  ? 55.375  -19.250 -18.002 1.00 0.00 ? 39  PRO A HD2  3  
ATOM 9782  H HD3  . PRO A 1 39  ? 54.324  -20.548 -17.389 1.00 0.00 ? 39  PRO A HD3  3  
ATOM 9783  N N    . THR A 1 40  ? 59.642  -22.304 -17.759 1.00 0.00 ? 40  THR A N    3  
ATOM 9784  C CA   . THR A 1 40  ? 61.069  -22.114 -17.527 1.00 0.00 ? 40  THR A CA   3  
ATOM 9785  C C    . THR A 1 40  ? 61.619  -21.005 -18.420 1.00 0.00 ? 40  THR A C    3  
ATOM 9786  O O    . THR A 1 40  ? 61.173  -20.827 -19.554 1.00 0.00 ? 40  THR A O    3  
ATOM 9787  C CB   . THR A 1 40  ? 61.851  -23.410 -17.815 1.00 0.00 ? 40  THR A CB   3  
ATOM 9788  O OG1  . THR A 1 40  ? 61.966  -23.589 -19.220 1.00 0.00 ? 40  THR A OG1  3  
ATOM 9789  C CG2  . THR A 1 40  ? 61.110  -24.600 -17.206 1.00 0.00 ? 40  THR A CG2  3  
ATOM 9790  H H    . THR A 1 40  ? 59.329  -23.132 -18.178 1.00 0.00 ? 40  THR A H    3  
ATOM 9791  H HA   . THR A 1 40  ? 61.222  -21.839 -16.494 1.00 0.00 ? 40  THR A HA   3  
ATOM 9792  H HB   . THR A 1 40  ? 62.836  -23.341 -17.379 1.00 0.00 ? 40  THR A HB   3  
ATOM 9793  H HG1  . THR A 1 40  ? 61.784  -24.511 -19.416 1.00 0.00 ? 40  THR A HG1  3  
ATOM 9794  H HG21 . THR A 1 40  ? 60.903  -24.401 -16.164 1.00 0.00 ? 40  THR A HG21 3  
ATOM 9795  H HG22 . THR A 1 40  ? 61.722  -25.485 -17.288 1.00 0.00 ? 40  THR A HG22 3  
ATOM 9796  H HG23 . THR A 1 40  ? 60.181  -24.754 -17.734 1.00 0.00 ? 40  THR A HG23 3  
ATOM 9797  N N    . ASN A 1 41  ? 62.592  -20.263 -17.899 1.00 0.00 ? 41  ASN A N    3  
ATOM 9798  C CA   . ASN A 1 41  ? 63.202  -19.174 -18.653 1.00 0.00 ? 41  ASN A CA   3  
ATOM 9799  C C    . ASN A 1 41  ? 64.417  -18.629 -17.909 1.00 0.00 ? 41  ASN A C    3  
ATOM 9800  O O    . ASN A 1 41  ? 64.285  -17.802 -17.007 1.00 0.00 ? 41  ASN A O    3  
ATOM 9801  C CB   . ASN A 1 41  ? 62.184  -18.052 -18.864 1.00 0.00 ? 41  ASN A CB   3  
ATOM 9802  C CG   . ASN A 1 41  ? 62.818  -16.939 -19.703 1.00 0.00 ? 41  ASN A CG   3  
ATOM 9803  O OD1  . ASN A 1 41  ? 62.339  -16.623 -20.774 1.00 0.00 ? 41  ASN A OD1  3  
ATOM 9804  N ND2  . ASN A 1 41  ? 63.881  -16.328 -19.258 1.00 0.00 ? 41  ASN A ND2  3  
ATOM 9805  H H    . ASN A 1 41  ? 62.907  -20.454 -16.991 1.00 0.00 ? 41  ASN A H    3  
ATOM 9806  H HA   . ASN A 1 41  ? 63.517  -19.545 -19.617 1.00 0.00 ? 41  ASN A HA   3  
ATOM 9807  H HB2  . ASN A 1 41  ? 61.319  -18.443 -19.379 1.00 0.00 ? 41  ASN A HB2  3  
ATOM 9808  H HB3  . ASN A 1 41  ? 61.885  -17.651 -17.907 1.00 0.00 ? 41  ASN A HB3  3  
ATOM 9809  H HD21 . ASN A 1 41  ? 64.266  -16.582 -18.394 1.00 0.00 ? 41  ASN A HD21 3  
ATOM 9810  H HD22 . ASN A 1 41  ? 64.294  -15.614 -19.787 1.00 0.00 ? 41  ASN A HD22 3  
ATOM 9811  N N    . ASP A 1 42  ? 65.605  -19.102 -18.293 1.00 0.00 ? 42  ASP A N    3  
ATOM 9812  C CA   . ASP A 1 42  ? 66.854  -18.664 -17.659 1.00 0.00 ? 42  ASP A CA   3  
ATOM 9813  C C    . ASP A 1 42  ? 67.589  -17.667 -18.550 1.00 0.00 ? 42  ASP A C    3  
ATOM 9814  O O    . ASP A 1 42  ? 68.662  -17.180 -18.197 1.00 0.00 ? 42  ASP A O    3  
ATOM 9815  C CB   . ASP A 1 42  ? 67.756  -19.875 -17.406 1.00 0.00 ? 42  ASP A CB   3  
ATOM 9816  C CG   . ASP A 1 42  ? 67.028  -20.875 -16.506 1.00 0.00 ? 42  ASP A CG   3  
ATOM 9817  O OD1  . ASP A 1 42  ? 66.575  -20.468 -15.448 1.00 0.00 ? 42  ASP A OD1  3  
ATOM 9818  O OD2  . ASP A 1 42  ? 66.937  -22.029 -16.888 1.00 0.00 ? 42  ASP A OD2  3  
ATOM 9819  H H    . ASP A 1 42  ? 65.645  -19.760 -19.017 1.00 0.00 ? 42  ASP A H    3  
ATOM 9820  H HA   . ASP A 1 42  ? 66.638  -18.191 -16.710 1.00 0.00 ? 42  ASP A HA   3  
ATOM 9821  H HB2  . ASP A 1 42  ? 67.997  -20.347 -18.349 1.00 0.00 ? 42  ASP A HB2  3  
ATOM 9822  H HB3  . ASP A 1 42  ? 68.665  -19.552 -16.923 1.00 0.00 ? 42  ASP A HB3  3  
ATOM 9823  N N    . LYS A 1 43  ? 67.004  -17.368 -19.705 1.00 0.00 ? 43  LYS A N    3  
ATOM 9824  C CA   . LYS A 1 43  ? 67.614  -16.426 -20.636 1.00 0.00 ? 43  LYS A CA   3  
ATOM 9825  C C    . LYS A 1 43  ? 67.665  -15.030 -20.023 1.00 0.00 ? 43  LYS A C    3  
ATOM 9826  O O    . LYS A 1 43  ? 66.752  -14.226 -20.206 1.00 0.00 ? 43  LYS A O    3  
ATOM 9827  C CB   . LYS A 1 43  ? 66.817  -16.396 -21.942 1.00 0.00 ? 43  LYS A CB   3  
ATOM 9828  C CG   . LYS A 1 43  ? 66.526  -17.831 -22.392 1.00 0.00 ? 43  LYS A CG   3  
ATOM 9829  C CD   . LYS A 1 43  ? 65.969  -17.821 -23.816 1.00 0.00 ? 43  LYS A CD   3  
ATOM 9830  C CE   . LYS A 1 43  ? 65.641  -19.252 -24.246 1.00 0.00 ? 43  LYS A CE   3  
ATOM 9831  N NZ   . LYS A 1 43  ? 64.541  -19.788 -23.396 1.00 0.00 ? 43  LYS A NZ   3  
ATOM 9832  H H    . LYS A 1 43  ? 66.148  -17.787 -19.934 1.00 0.00 ? 43  LYS A H    3  
ATOM 9833  H HA   . LYS A 1 43  ? 68.621  -16.751 -20.850 1.00 0.00 ? 43  LYS A HA   3  
ATOM 9834  H HB2  . LYS A 1 43  ? 65.886  -15.871 -21.784 1.00 0.00 ? 43  LYS A HB2  3  
ATOM 9835  H HB3  . LYS A 1 43  ? 67.392  -15.892 -22.703 1.00 0.00 ? 43  LYS A HB3  3  
ATOM 9836  H HG2  . LYS A 1 43  ? 67.439  -18.409 -22.367 1.00 0.00 ? 43  LYS A HG2  3  
ATOM 9837  H HG3  . LYS A 1 43  ? 65.801  -18.277 -21.727 1.00 0.00 ? 43  LYS A HG3  3  
ATOM 9838  H HD2  . LYS A 1 43  ? 65.072  -17.219 -23.848 1.00 0.00 ? 43  LYS A HD2  3  
ATOM 9839  H HD3  . LYS A 1 43  ? 66.706  -17.407 -24.487 1.00 0.00 ? 43  LYS A HD3  3  
ATOM 9840  H HE2  . LYS A 1 43  ? 65.329  -19.254 -25.281 1.00 0.00 ? 43  LYS A HE2  3  
ATOM 9841  H HE3  . LYS A 1 43  ? 66.518  -19.873 -24.134 1.00 0.00 ? 43  LYS A HE3  3  
ATOM 9842  H HZ1  . LYS A 1 43  ? 63.829  -19.046 -23.241 1.00 0.00 ? 43  LYS A HZ1  3  
ATOM 9843  H HZ2  . LYS A 1 43  ? 64.930  -20.092 -22.480 1.00 0.00 ? 43  LYS A HZ2  3  
ATOM 9844  H HZ3  . LYS A 1 43  ? 64.097  -20.598 -23.872 1.00 0.00 ? 43  LYS A HZ3  3  
ATOM 9845  N N    . ILE A 1 44  ? 68.743  -14.752 -19.291 1.00 0.00 ? 44  ILE A N    3  
ATOM 9846  C CA   . ILE A 1 44  ? 68.920  -13.454 -18.642 1.00 0.00 ? 44  ILE A CA   3  
ATOM 9847  C C    . ILE A 1 44  ? 69.539  -12.447 -19.607 1.00 0.00 ? 44  ILE A C    3  
ATOM 9848  O O    . ILE A 1 44  ? 70.278  -12.820 -20.518 1.00 0.00 ? 44  ILE A O    3  
ATOM 9849  C CB   . ILE A 1 44  ? 69.841  -13.592 -17.414 1.00 0.00 ? 44  ILE A CB   3  
ATOM 9850  C CG1  . ILE A 1 44  ? 71.118  -14.348 -17.821 1.00 0.00 ? 44  ILE A CG1  3  
ATOM 9851  C CG2  . ILE A 1 44  ? 69.110  -14.374 -16.321 1.00 0.00 ? 44  ILE A CG2  3  
ATOM 9852  C CD1  . ILE A 1 44  ? 72.158  -14.302 -16.690 1.00 0.00 ? 44  ILE A CD1  3  
ATOM 9853  H H    . ILE A 1 44  ? 69.438  -15.435 -19.183 1.00 0.00 ? 44  ILE A H    3  
ATOM 9854  H HA   . ILE A 1 44  ? 67.960  -13.081 -18.317 1.00 0.00 ? 44  ILE A HA   3  
ATOM 9855  H HB   . ILE A 1 44  ? 70.098  -12.610 -17.043 1.00 0.00 ? 44  ILE A HB   3  
ATOM 9856  H HG12 . ILE A 1 44  ? 70.870  -15.377 -18.036 1.00 0.00 ? 44  ILE A HG12 3  
ATOM 9857  H HG13 . ILE A 1 44  ? 71.534  -13.893 -18.705 1.00 0.00 ? 44  ILE A HG13 3  
ATOM 9858  H HG21 . ILE A 1 44  ? 68.955  -15.390 -16.650 1.00 0.00 ? 44  ILE A HG21 3  
ATOM 9859  H HG22 . ILE A 1 44  ? 68.154  -13.911 -16.121 1.00 0.00 ? 44  ILE A HG22 3  
ATOM 9860  H HG23 . ILE A 1 44  ? 69.700  -14.374 -15.420 1.00 0.00 ? 44  ILE A HG23 3  
ATOM 9861  H HD11 . ILE A 1 44  ? 73.133  -14.546 -17.091 1.00 0.00 ? 44  ILE A HD11 3  
ATOM 9862  H HD12 . ILE A 1 44  ? 71.898  -15.020 -15.928 1.00 0.00 ? 44  ILE A HD12 3  
ATOM 9863  H HD13 . ILE A 1 44  ? 72.189  -13.312 -16.258 1.00 0.00 ? 44  ILE A HD13 3  
ATOM 9864  N N    . CYS A 1 45  ? 69.218  -11.173 -19.406 1.00 0.00 ? 45  CYS A N    3  
ATOM 9865  C CA   . CYS A 1 45  ? 69.732  -10.112 -20.263 1.00 0.00 ? 45  CYS A CA   3  
ATOM 9866  C C    . CYS A 1 45  ? 69.361  -10.369 -21.716 1.00 0.00 ? 45  CYS A C    3  
ATOM 9867  O O    . CYS A 1 45  ? 70.229  -10.570 -22.566 1.00 0.00 ? 45  CYS A O    3  
ATOM 9868  C CB   . CYS A 1 45  ? 71.250  -9.997  -20.140 1.00 0.00 ? 45  CYS A CB   3  
ATOM 9869  S SG   . CYS A 1 45  ? 71.838  -8.765  -21.328 1.00 0.00 ? 45  CYS A SG   3  
ATOM 9870  H H    . CYS A 1 45  ? 68.608  -10.939 -18.675 1.00 0.00 ? 45  CYS A H    3  
ATOM 9871  H HA   . CYS A 1 45  ? 69.289  -9.177  -19.955 1.00 0.00 ? 45  CYS A HA   3  
ATOM 9872  H HB2  . CYS A 1 45  ? 71.510  -9.686  -19.138 1.00 0.00 ? 45  CYS A HB2  3  
ATOM 9873  H HB3  . CYS A 1 45  ? 71.709  -10.949 -20.354 1.00 0.00 ? 45  CYS A HB3  3  
ATOM 9874  N N    . GLN A 1 46  ? 68.068  -10.352 -21.998 1.00 0.00 ? 46  GLN A N    3  
ATOM 9875  C CA   . GLN A 1 46  ? 67.592  -10.569 -23.357 1.00 0.00 ? 46  GLN A CA   3  
ATOM 9876  C C    . GLN A 1 46  ? 67.797  -9.294  -24.178 1.00 0.00 ? 46  GLN A C    3  
ATOM 9877  O O    . GLN A 1 46  ? 67.955  -9.350  -25.397 1.00 0.00 ? 46  GLN A O    3  
ATOM 9878  C CB   . GLN A 1 46  ? 66.102  -10.957 -23.327 1.00 0.00 ? 46  GLN A CB   3  
ATOM 9879  C CG   . GLN A 1 46  ? 65.947  -12.442 -22.979 1.00 0.00 ? 46  GLN A CG   3  
ATOM 9880  C CD   . GLN A 1 46  ? 66.383  -13.298 -24.167 1.00 0.00 ? 46  GLN A CD   3  
ATOM 9881  O OE1  . GLN A 1 46  ? 65.664  -13.414 -25.137 1.00 0.00 ? 46  GLN A OE1  3  
ATOM 9882  N NE2  . GLN A 1 46  ? 67.537  -13.906 -24.131 1.00 0.00 ? 46  GLN A NE2  3  
ATOM 9883  H H    . GLN A 1 46  ? 67.420  -10.180 -21.282 1.00 0.00 ? 46  GLN A H    3  
ATOM 9884  H HA   . GLN A 1 46  ? 68.160  -11.370 -23.811 1.00 0.00 ? 46  GLN A HA   3  
ATOM 9885  H HB2  . GLN A 1 46  ? 65.602  -10.369 -22.576 1.00 0.00 ? 46  GLN A HB2  3  
ATOM 9886  H HB3  . GLN A 1 46  ? 65.652  -10.767 -24.292 1.00 0.00 ? 46  GLN A HB3  3  
ATOM 9887  H HG2  . GLN A 1 46  ? 66.559  -12.678 -22.120 1.00 0.00 ? 46  GLN A HG2  3  
ATOM 9888  H HG3  . GLN A 1 46  ? 64.913  -12.652 -22.754 1.00 0.00 ? 46  GLN A HG3  3  
ATOM 9889  H HE21 . GLN A 1 46  ? 68.115  -13.812 -23.345 1.00 0.00 ? 46  GLN A HE21 3  
ATOM 9890  H HE22 . GLN A 1 46  ? 67.822  -14.458 -24.887 1.00 0.00 ? 46  GLN A HE22 3  
ATOM 9891  N N    . SER A 1 47  ? 67.804  -8.149  -23.495 1.00 0.00 ? 47  SER A N    3  
ATOM 9892  C CA   . SER A 1 47  ? 68.002  -6.866  -24.165 1.00 0.00 ? 47  SER A CA   3  
ATOM 9893  C C    . SER A 1 47  ? 67.826  -5.709  -23.181 1.00 0.00 ? 47  SER A C    3  
ATOM 9894  O O    . SER A 1 47  ? 67.287  -5.883  -22.088 1.00 0.00 ? 47  SER A O    3  
ATOM 9895  C CB   . SER A 1 47  ? 67.001  -6.714  -25.319 1.00 0.00 ? 47  SER A CB   3  
ATOM 9896  O OG   . SER A 1 47  ? 66.798  -5.332  -25.589 1.00 0.00 ? 47  SER A OG   3  
ATOM 9897  H H    . SER A 1 47  ? 67.680  -8.168  -22.522 1.00 0.00 ? 47  SER A H    3  
ATOM 9898  H HA   . SER A 1 47  ? 69.006  -6.832  -24.564 1.00 0.00 ? 47  SER A HA   3  
ATOM 9899  H HB2  . SER A 1 47  ? 67.385  -7.193  -26.205 1.00 0.00 ? 47  SER A HB2  3  
ATOM 9900  H HB3  . SER A 1 47  ? 66.065  -7.178  -25.043 1.00 0.00 ? 47  SER A HB3  3  
ATOM 9901  H HG   . SER A 1 47  ? 67.587  -4.995  -26.019 1.00 0.00 ? 47  SER A HG   3  
ATOM 9902  N N    . VAL A 1 48  ? 68.287  -4.524  -23.585 1.00 0.00 ? 48  VAL A N    3  
ATOM 9903  C CA   . VAL A 1 48  ? 68.186  -3.320  -22.753 1.00 0.00 ? 48  VAL A CA   3  
ATOM 9904  C C    . VAL A 1 48  ? 67.930  -2.103  -23.637 1.00 0.00 ? 48  VAL A C    3  
ATOM 9905  O O    . VAL A 1 48  ? 68.514  -1.977  -24.713 1.00 0.00 ? 48  VAL A O    3  
ATOM 9906  C CB   . VAL A 1 48  ? 69.488  -3.084  -21.966 1.00 0.00 ? 48  VAL A CB   3  
ATOM 9907  C CG1  . VAL A 1 48  ? 69.281  -1.957  -20.953 1.00 0.00 ? 48  VAL A CG1  3  
ATOM 9908  C CG2  . VAL A 1 48  ? 69.875  -4.367  -21.232 1.00 0.00 ? 48  VAL A CG2  3  
ATOM 9909  H H    . VAL A 1 48  ? 68.704  -4.454  -24.470 1.00 0.00 ? 48  VAL A H    3  
ATOM 9910  H HA   . VAL A 1 48  ? 67.366  -3.426  -22.057 1.00 0.00 ? 48  VAL A HA   3  
ATOM 9911  H HB   . VAL A 1 48  ? 70.277  -2.807  -22.652 1.00 0.00 ? 48  VAL A HB   3  
ATOM 9912  H HG11 . VAL A 1 48  ? 69.124  -1.026  -21.476 1.00 0.00 ? 48  VAL A HG11 3  
ATOM 9913  H HG12 . VAL A 1 48  ? 70.154  -1.874  -20.323 1.00 0.00 ? 48  VAL A HG12 3  
ATOM 9914  H HG13 . VAL A 1 48  ? 68.417  -2.175  -20.342 1.00 0.00 ? 48  VAL A HG13 3  
ATOM 9915  H HG21 . VAL A 1 48  ? 70.746  -4.185  -20.622 1.00 0.00 ? 48  VAL A HG21 3  
ATOM 9916  H HG22 . VAL A 1 48  ? 70.095  -5.138  -21.955 1.00 0.00 ? 48  VAL A HG22 3  
ATOM 9917  H HG23 . VAL A 1 48  ? 69.055  -4.685  -20.604 1.00 0.00 ? 48  VAL A HG23 3  
ATOM 9918  N N    . THR A 1 49  ? 67.047  -1.211  -23.184 1.00 0.00 ? 49  THR A N    3  
ATOM 9919  C CA   . THR A 1 49  ? 66.711  -0.005  -23.953 1.00 0.00 ? 49  THR A CA   3  
ATOM 9920  C C    . THR A 1 49  ? 66.652  1.217   -23.045 1.00 0.00 ? 49  THR A C    3  
ATOM 9921  O O    . THR A 1 49  ? 65.675  1.419   -22.326 1.00 0.00 ? 49  THR A O    3  
ATOM 9922  C CB   . THR A 1 49  ? 65.341  -0.163  -24.641 1.00 0.00 ? 49  THR A CB   3  
ATOM 9923  O OG1  . THR A 1 49  ? 65.333  -1.361  -25.406 1.00 0.00 ? 49  THR A OG1  3  
ATOM 9924  C CG2  . THR A 1 49  ? 65.088  1.033   -25.559 1.00 0.00 ? 49  THR A CG2  3  
ATOM 9925  H H    . THR A 1 49  ? 66.607  -1.368  -22.323 1.00 0.00 ? 49  THR A H    3  
ATOM 9926  H HA   . THR A 1 49  ? 67.462  0.166   -24.714 1.00 0.00 ? 49  THR A HA   3  
ATOM 9927  H HB   . THR A 1 49  ? 64.566  -0.209  -23.893 1.00 0.00 ? 49  THR A HB   3  
ATOM 9928  H HG1  . THR A 1 49  ? 64.439  -1.505  -25.722 1.00 0.00 ? 49  THR A HG1  3  
ATOM 9929  H HG21 . THR A 1 49  ? 64.975  1.926   -24.964 1.00 0.00 ? 49  THR A HG21 3  
ATOM 9930  H HG22 . THR A 1 49  ? 64.185  0.863   -26.129 1.00 0.00 ? 49  THR A HG22 3  
ATOM 9931  H HG23 . THR A 1 49  ? 65.922  1.152   -26.235 1.00 0.00 ? 49  THR A HG23 3  
ATOM 9932  N N    . GLU A 1 50  ? 67.702  2.035   -23.090 1.00 0.00 ? 50  GLU A N    3  
ATOM 9933  C CA   . GLU A 1 50  ? 67.767  3.244   -22.270 1.00 0.00 ? 50  GLU A CA   3  
ATOM 9934  C C    . GLU A 1 50  ? 66.998  4.381   -22.939 1.00 0.00 ? 50  GLU A C    3  
ATOM 9935  O O    . GLU A 1 50  ? 67.241  4.712   -24.100 1.00 0.00 ? 50  GLU A O    3  
ATOM 9936  C CB   . GLU A 1 50  ? 69.234  3.654   -22.075 1.00 0.00 ? 50  GLU A CB   3  
ATOM 9937  C CG   . GLU A 1 50  ? 69.355  4.723   -20.977 1.00 0.00 ? 50  GLU A CG   3  
ATOM 9938  C CD   . GLU A 1 50  ? 68.859  6.073   -21.505 1.00 0.00 ? 50  GLU A CD   3  
ATOM 9939  O OE1  . GLU A 1 50  ? 69.145  6.380   -22.651 1.00 0.00 ? 50  GLU A OE1  3  
ATOM 9940  O OE2  . GLU A 1 50  ? 68.203  6.774   -20.754 1.00 0.00 ? 50  GLU A OE2  3  
ATOM 9941  H H    . GLU A 1 50  ? 68.448  1.823   -23.690 1.00 0.00 ? 50  GLU A H    3  
ATOM 9942  H HA   . GLU A 1 50  ? 67.327  3.041   -21.305 1.00 0.00 ? 50  GLU A HA   3  
ATOM 9943  H HB2  . GLU A 1 50  ? 69.810  2.786   -21.791 1.00 0.00 ? 50  GLU A HB2  3  
ATOM 9944  H HB3  . GLU A 1 50  ? 69.621  4.047   -23.005 1.00 0.00 ? 50  GLU A HB3  3  
ATOM 9945  H HG2  . GLU A 1 50  ? 68.768  4.435   -20.119 1.00 0.00 ? 50  GLU A HG2  3  
ATOM 9946  H HG3  . GLU A 1 50  ? 70.390  4.817   -20.685 1.00 0.00 ? 50  GLU A HG3  3  
ATOM 9947  N N    . ILE A 1 51  ? 66.065  4.974   -22.191 1.00 0.00 ? 51  ILE A N    3  
ATOM 9948  C CA   . ILE A 1 51  ? 65.242  6.080   -22.695 1.00 0.00 ? 51  ILE A CA   3  
ATOM 9949  C C    . ILE A 1 51  ? 65.343  7.273   -21.745 1.00 0.00 ? 51  ILE A C    3  
ATOM 9950  O O    . ILE A 1 51  ? 65.580  7.105   -20.551 1.00 0.00 ? 51  ILE A O    3  
ATOM 9951  C CB   . ILE A 1 51  ? 63.763  5.639   -22.812 1.00 0.00 ? 51  ILE A CB   3  
ATOM 9952  C CG1  . ILE A 1 51  ? 63.713  4.232   -23.427 1.00 0.00 ? 51  ILE A CG1  3  
ATOM 9953  C CG2  . ILE A 1 51  ? 62.986  6.618   -23.705 1.00 0.00 ? 51  ILE A CG2  3  
ATOM 9954  C CD1  . ILE A 1 51  ? 62.257  3.806   -23.671 1.00 0.00 ? 51  ILE A CD1  3  
ATOM 9955  H H    . ILE A 1 51  ? 65.924  4.657   -21.274 1.00 0.00 ? 51  ILE A H    3  
ATOM 9956  H HA   . ILE A 1 51  ? 65.597  6.385   -23.673 1.00 0.00 ? 51  ILE A HA   3  
ATOM 9957  H HB   . ILE A 1 51  ? 63.312  5.616   -21.829 1.00 0.00 ? 51  ILE A HB   3  
ATOM 9958  H HG12 . ILE A 1 51  ? 64.248  4.233   -24.366 1.00 0.00 ? 51  ILE A HG12 3  
ATOM 9959  H HG13 . ILE A 1 51  ? 64.180  3.531   -22.752 1.00 0.00 ? 51  ILE A HG13 3  
ATOM 9960  H HG21 . ILE A 1 51  ? 63.282  6.482   -24.735 1.00 0.00 ? 51  ILE A HG21 3  
ATOM 9961  H HG22 . ILE A 1 51  ? 63.196  7.630   -23.401 1.00 0.00 ? 51  ILE A HG22 3  
ATOM 9962  H HG23 . ILE A 1 51  ? 61.927  6.430   -23.608 1.00 0.00 ? 51  ILE A HG23 3  
ATOM 9963  H HD11 . ILE A 1 51  ? 62.212  2.733   -23.790 1.00 0.00 ? 51  ILE A HD11 3  
ATOM 9964  H HD12 . ILE A 1 51  ? 61.888  4.280   -24.570 1.00 0.00 ? 51  ILE A HD12 3  
ATOM 9965  H HD13 . ILE A 1 51  ? 61.645  4.100   -22.830 1.00 0.00 ? 51  ILE A HD13 3  
ATOM 9966  N N    . THR A 1 52  ? 65.151  8.470   -22.285 1.00 0.00 ? 52  THR A N    3  
ATOM 9967  C CA   . THR A 1 52  ? 65.200  9.698   -21.500 1.00 0.00 ? 52  THR A CA   3  
ATOM 9968  C C    . THR A 1 52  ? 64.344  10.753  -22.185 1.00 0.00 ? 52  THR A C    3  
ATOM 9969  O O    . THR A 1 52  ? 64.379  10.879  -23.410 1.00 0.00 ? 52  THR A O    3  
ATOM 9970  C CB   . THR A 1 52  ? 66.642  10.228  -21.379 1.00 0.00 ? 52  THR A CB   3  
ATOM 9971  O OG1  . THR A 1 52  ? 66.611  11.590  -20.975 1.00 0.00 ? 52  THR A OG1  3  
ATOM 9972  C CG2  . THR A 1 52  ? 67.346  10.109  -22.731 1.00 0.00 ? 52  THR A CG2  3  
ATOM 9973  H H    . THR A 1 52  ? 64.937  8.531   -23.237 1.00 0.00 ? 52  THR A H    3  
ATOM 9974  H HA   . THR A 1 52  ? 64.806  9.512   -20.510 1.00 0.00 ? 52  THR A HA   3  
ATOM 9975  H HB   . THR A 1 52  ? 67.178  9.646   -20.645 1.00 0.00 ? 52  THR A HB   3  
ATOM 9976  H HG1  . THR A 1 52  ? 65.693  11.853  -20.891 1.00 0.00 ? 52  THR A HG1  3  
ATOM 9977  H HG21 . THR A 1 52  ? 66.777  10.638  -23.481 1.00 0.00 ? 52  THR A HG21 3  
ATOM 9978  H HG22 . THR A 1 52  ? 67.426  9.067   -23.006 1.00 0.00 ? 52  THR A HG22 3  
ATOM 9979  H HG23 . THR A 1 52  ? 68.335  10.539  -22.660 1.00 0.00 ? 52  THR A HG23 3  
ATOM 9980  N N    . GLU A 1 53  ? 63.571  11.509  -21.415 1.00 0.00 ? 53  GLU A N    3  
ATOM 9981  C CA   . GLU A 1 53  ? 62.725  12.536  -22.013 1.00 0.00 ? 53  GLU A CA   3  
ATOM 9982  C C    . GLU A 1 53  ? 63.564  13.446  -22.905 1.00 0.00 ? 53  GLU A C    3  
ATOM 9983  O O    . GLU A 1 53  ? 64.759  13.217  -23.094 1.00 0.00 ? 53  GLU A O    3  
ATOM 9984  C CB   . GLU A 1 53  ? 62.009  13.359  -20.925 1.00 0.00 ? 53  GLU A CB   3  
ATOM 9985  C CG   . GLU A 1 53  ? 60.790  14.152  -21.511 1.00 0.00 ? 53  GLU A CG   3  
ATOM 9986  C CD   . GLU A 1 53  ? 61.103  15.654  -21.633 1.00 0.00 ? 53  GLU A CD   3  
ATOM 9987  O OE1  . GLU A 1 53  ? 62.269  16.004  -21.673 1.00 0.00 ? 53  GLU A OE1  3  
ATOM 9988  O OE2  . GLU A 1 53  ? 60.161  16.427  -21.687 1.00 0.00 ? 53  GLU A OE2  3  
ATOM 9989  H H    . GLU A 1 53  ? 63.569  11.376  -20.444 1.00 0.00 ? 53  GLU A H    3  
ATOM 9990  H HA   . GLU A 1 53  ? 61.986  12.041  -22.624 1.00 0.00 ? 53  GLU A HA   3  
ATOM 9991  H HB2  . GLU A 1 53  ? 61.656  12.678  -20.163 1.00 0.00 ? 53  GLU A HB2  3  
ATOM 9992  H HB3  . GLU A 1 53  ? 62.717  14.040  -20.482 1.00 0.00 ? 53  GLU A HB3  3  
ATOM 9993  H HG2  . GLU A 1 53  ? 60.526  13.776  -22.489 1.00 0.00 ? 53  GLU A HG2  3  
ATOM 9994  H HG3  . GLU A 1 53  ? 59.937  14.032  -20.855 1.00 0.00 ? 53  GLU A HG3  3  
ATOM 9995  N N    . SER A 1 54  ? 62.936  14.473  -23.451 1.00 0.00 ? 54  SER A N    3  
ATOM 9996  C CA   . SER A 1 54  ? 63.636  15.405  -24.324 1.00 0.00 ? 54  SER A CA   3  
ATOM 9997  C C    . SER A 1 54  ? 64.859  15.989  -23.626 1.00 0.00 ? 54  SER A C    3  
ATOM 9998  O O    . SER A 1 54  ? 65.812  16.414  -24.278 1.00 0.00 ? 54  SER A O    3  
ATOM 9999  C CB   . SER A 1 54  ? 62.696  16.537  -24.737 1.00 0.00 ? 54  SER A CB   3  
ATOM 10000 O OG   . SER A 1 54  ? 63.428  17.514  -25.465 1.00 0.00 ? 54  SER A OG   3  
ATOM 10001 H H    . SER A 1 54  ? 61.988  14.613  -23.247 1.00 0.00 ? 54  SER A H    3  
ATOM 10002 H HA   . SER A 1 54  ? 63.957  14.880  -25.211 1.00 0.00 ? 54  SER A HA   3  
ATOM 10003 H HB2  . SER A 1 54  ? 61.910  16.146  -25.360 1.00 0.00 ? 54  SER A HB2  3  
ATOM 10004 H HB3  . SER A 1 54  ? 62.262  16.983  -23.852 1.00 0.00 ? 54  SER A HB3  3  
ATOM 10005 H HG   . SER A 1 54  ? 63.479  18.308  -24.927 1.00 0.00 ? 54  SER A HG   3  
ATOM 10006 N N    . GLU A 1 55  ? 64.824  16.005  -22.295 1.00 0.00 ? 55  GLU A N    3  
ATOM 10007 C CA   . GLU A 1 55  ? 65.944  16.545  -21.519 1.00 0.00 ? 55  GLU A CA   3  
ATOM 10008 C C    . GLU A 1 55  ? 66.320  17.937  -22.052 1.00 0.00 ? 55  GLU A C    3  
ATOM 10009 O O    . GLU A 1 55  ? 65.726  18.424  -23.014 1.00 0.00 ? 55  GLU A O    3  
ATOM 10010 C CB   . GLU A 1 55  ? 67.156  15.569  -21.612 1.00 0.00 ? 55  GLU A CB   3  
ATOM 10011 C CG   . GLU A 1 55  ? 67.695  15.210  -20.216 1.00 0.00 ? 55  GLU A CG   3  
ATOM 10012 C CD   . GLU A 1 55  ? 68.092  16.483  -19.469 1.00 0.00 ? 55  GLU A CD   3  
ATOM 10013 O OE1  . GLU A 1 55  ? 69.109  17.059  -19.820 1.00 0.00 ? 55  GLU A OE1  3  
ATOM 10014 O OE2  . GLU A 1 55  ? 67.373  16.862  -18.559 1.00 0.00 ? 55  GLU A OE2  3  
ATOM 10015 H H    . GLU A 1 55  ? 64.033  15.639  -21.834 1.00 0.00 ? 55  GLU A H    3  
ATOM 10016 H HA   . GLU A 1 55  ? 65.634  16.647  -20.492 1.00 0.00 ? 55  GLU A HA   3  
ATOM 10017 H HB2  . GLU A 1 55  ? 66.837  14.662  -22.104 1.00 0.00 ? 55  GLU A HB2  3  
ATOM 10018 H HB3  . GLU A 1 55  ? 67.954  16.015  -22.191 1.00 0.00 ? 55  GLU A HB3  3  
ATOM 10019 H HG2  . GLU A 1 55  ? 66.932  14.689  -19.659 1.00 0.00 ? 55  GLU A HG2  3  
ATOM 10020 H HG3  . GLU A 1 55  ? 68.561  14.572  -20.320 1.00 0.00 ? 55  GLU A HG3  3  
ATOM 10021 N N    . SER A 1 56  ? 67.304  18.572  -21.418 1.00 0.00 ? 56  SER A N    3  
ATOM 10022 C CA   . SER A 1 56  ? 67.750  19.904  -21.833 1.00 0.00 ? 56  SER A CA   3  
ATOM 10023 C C    . SER A 1 56  ? 68.894  19.799  -22.838 1.00 0.00 ? 56  SER A C    3  
ATOM 10024 O O    . SER A 1 56  ? 69.987  20.312  -22.599 1.00 0.00 ? 56  SER A O    3  
ATOM 10025 C CB   . SER A 1 56  ? 68.222  20.693  -20.612 1.00 0.00 ? 56  SER A CB   3  
ATOM 10026 O OG   . SER A 1 56  ? 68.743  21.947  -21.036 1.00 0.00 ? 56  SER A OG   3  
ATOM 10027 H H    . SER A 1 56  ? 67.738  18.141  -20.655 1.00 0.00 ? 56  SER A H    3  
ATOM 10028 H HA   . SER A 1 56  ? 66.927  20.435  -22.292 1.00 0.00 ? 56  SER A HA   3  
ATOM 10029 H HB2  . SER A 1 56  ? 67.392  20.861  -19.946 1.00 0.00 ? 56  SER A HB2  3  
ATOM 10030 H HB3  . SER A 1 56  ? 68.987  20.130  -20.094 1.00 0.00 ? 56  SER A HB3  3  
ATOM 10031 H HG   . SER A 1 56  ? 69.665  21.821  -21.270 1.00 0.00 ? 56  SER A HG   3  
ATOM 10032 N N    . ASP A 1 57  ? 68.638  19.133  -23.966 1.00 0.00 ? 57  ASP A N    3  
ATOM 10033 C CA   . ASP A 1 57  ? 69.659  18.971  -25.002 1.00 0.00 ? 57  ASP A CA   3  
ATOM 10034 C C    . ASP A 1 57  ? 69.005  18.649  -26.358 1.00 0.00 ? 57  ASP A C    3  
ATOM 10035 O O    . ASP A 1 57  ? 68.034  17.896  -26.402 1.00 0.00 ? 57  ASP A O    3  
ATOM 10036 C CB   . ASP A 1 57  ? 70.606  17.830  -24.621 1.00 0.00 ? 57  ASP A CB   3  
ATOM 10037 C CG   . ASP A 1 57  ? 71.426  18.230  -23.392 1.00 0.00 ? 57  ASP A CG   3  
ATOM 10038 O OD1  . ASP A 1 57  ? 72.016  19.297  -23.421 1.00 0.00 ? 57  ASP A OD1  3  
ATOM 10039 O OD2  . ASP A 1 57  ? 71.449  17.463  -22.445 1.00 0.00 ? 57  ASP A OD2  3  
ATOM 10040 H H    . ASP A 1 57  ? 67.748  18.747  -24.103 1.00 0.00 ? 57  ASP A H    3  
ATOM 10041 H HA   . ASP A 1 57  ? 70.226  19.882  -25.072 1.00 0.00 ? 57  ASP A HA   3  
ATOM 10042 H HB2  . ASP A 1 57  ? 70.029  16.945  -24.395 1.00 0.00 ? 57  ASP A HB2  3  
ATOM 10043 H HB3  . ASP A 1 57  ? 71.273  17.624  -25.444 1.00 0.00 ? 57  ASP A HB3  3  
ATOM 10044 N N    . PRO A 1 58  ? 69.519  19.193  -27.491 1.00 0.00 ? 58  PRO A N    3  
ATOM 10045 C CA   . PRO A 1 58  ? 68.947  18.908  -28.819 1.00 0.00 ? 58  PRO A CA   3  
ATOM 10046 C C    . PRO A 1 58  ? 68.588  17.427  -29.005 1.00 0.00 ? 58  PRO A C    3  
ATOM 10047 O O    . PRO A 1 58  ? 69.401  16.640  -29.490 1.00 0.00 ? 58  PRO A O    3  
ATOM 10048 C CB   . PRO A 1 58  ? 70.063  19.334  -29.790 1.00 0.00 ? 58  PRO A CB   3  
ATOM 10049 C CG   . PRO A 1 58  ? 70.765  20.449  -29.086 1.00 0.00 ? 58  PRO A CG   3  
ATOM 10050 C CD   . PRO A 1 58  ? 70.672  20.123  -27.586 1.00 0.00 ? 58  PRO A CD   3  
ATOM 10051 H HA   . PRO A 1 58  ? 68.077  19.522  -28.985 1.00 0.00 ? 58  PRO A HA   3  
ATOM 10052 H HB2  . PRO A 1 58  ? 70.746  18.511  -29.969 1.00 0.00 ? 58  PRO A HB2  3  
ATOM 10053 H HB3  . PRO A 1 58  ? 69.644  19.683  -30.723 1.00 0.00 ? 58  PRO A HB3  3  
ATOM 10054 H HG2  . PRO A 1 58  ? 71.803  20.500  -29.403 1.00 0.00 ? 58  PRO A HG2  3  
ATOM 10055 H HG3  . PRO A 1 58  ? 70.270  21.390  -29.288 1.00 0.00 ? 58  PRO A HG3  3  
ATOM 10056 H HD2  . PRO A 1 58  ? 71.579  19.643  -27.241 1.00 0.00 ? 58  PRO A HD2  3  
ATOM 10057 H HD3  . PRO A 1 58  ? 70.476  21.021  -27.019 1.00 0.00 ? 58  PRO A HD3  3  
ATOM 10058 N N    . ASP A 1 59  ? 67.362  17.063  -28.639 1.00 0.00 ? 59  ASP A N    3  
ATOM 10059 C CA   . ASP A 1 59  ? 66.898  15.683  -28.790 1.00 0.00 ? 59  ASP A CA   3  
ATOM 10060 C C    . ASP A 1 59  ? 65.456  15.539  -28.305 1.00 0.00 ? 59  ASP A C    3  
ATOM 10061 O O    . ASP A 1 59  ? 65.174  14.761  -27.394 1.00 0.00 ? 59  ASP A O    3  
ATOM 10062 C CB   . ASP A 1 59  ? 67.805  14.715  -28.011 1.00 0.00 ? 59  ASP A CB   3  
ATOM 10063 C CG   . ASP A 1 59  ? 68.065  15.263  -26.609 1.00 0.00 ? 59  ASP A CG   3  
ATOM 10064 O OD1  . ASP A 1 59  ? 67.179  15.154  -25.779 1.00 0.00 ? 59  ASP A OD1  3  
ATOM 10065 O OD2  . ASP A 1 59  ? 69.149  15.777  -26.387 1.00 0.00 ? 59  ASP A OD2  3  
ATOM 10066 H H    . ASP A 1 59  ? 66.750  17.739  -28.277 1.00 0.00 ? 59  ASP A H    3  
ATOM 10067 H HA   . ASP A 1 59  ? 66.936  15.421  -29.838 1.00 0.00 ? 59  ASP A HA   3  
ATOM 10068 H HB2  . ASP A 1 59  ? 67.323  13.750  -27.936 1.00 0.00 ? 59  ASP A HB2  3  
ATOM 10069 H HB3  . ASP A 1 59  ? 68.743  14.600  -28.531 1.00 0.00 ? 59  ASP A HB3  3  
ATOM 10070 N N    . PRO A 1 60  ? 64.521  16.286  -28.916 1.00 0.00 ? 60  PRO A N    3  
ATOM 10071 C CA   . PRO A 1 60  ? 63.098  16.231  -28.548 1.00 0.00 ? 60  PRO A CA   3  
ATOM 10072 C C    . PRO A 1 60  ? 62.407  15.007  -29.152 1.00 0.00 ? 60  PRO A C    3  
ATOM 10073 O O    . PRO A 1 60  ? 61.645  15.124  -30.111 1.00 0.00 ? 60  PRO A O    3  
ATOM 10074 C CB   . PRO A 1 60  ? 62.539  17.535  -29.133 1.00 0.00 ? 60  PRO A CB   3  
ATOM 10075 C CG   . PRO A 1 60  ? 63.364  17.766  -30.358 1.00 0.00 ? 60  PRO A CG   3  
ATOM 10076 C CD   . PRO A 1 60  ? 64.768  17.245  -30.012 1.00 0.00 ? 60  PRO A CD   3  
ATOM 10077 H HA   . PRO A 1 60  ? 62.986  16.234  -27.476 1.00 0.00 ? 60  PRO A HA   3  
ATOM 10078 H HB2  . PRO A 1 60  ? 61.490  17.427  -29.385 1.00 0.00 ? 60  PRO A HB2  3  
ATOM 10079 H HB3  . PRO A 1 60  ? 62.675  18.351  -28.435 1.00 0.00 ? 60  PRO A HB3  3  
ATOM 10080 H HG2  . PRO A 1 60  ? 62.950  17.213  -31.195 1.00 0.00 ? 60  PRO A HG2  3  
ATOM 10081 H HG3  . PRO A 1 60  ? 63.409  18.820  -30.596 1.00 0.00 ? 60  PRO A HG3  3  
ATOM 10082 H HD2  . PRO A 1 60  ? 65.214  16.747  -30.864 1.00 0.00 ? 60  PRO A HD2  3  
ATOM 10083 H HD3  . PRO A 1 60  ? 65.400  18.048  -29.667 1.00 0.00 ? 60  PRO A HD3  3  
ATOM 10084 N N    . GLU A 1 61  ? 62.682  13.836  -28.587 1.00 0.00 ? 61  GLU A N    3  
ATOM 10085 C CA   . GLU A 1 61  ? 62.081  12.604  -29.087 1.00 0.00 ? 61  GLU A CA   3  
ATOM 10086 C C    . GLU A 1 61  ? 60.555  12.689  -29.017 1.00 0.00 ? 61  GLU A C    3  
ATOM 10087 O O    . GLU A 1 61  ? 59.866  12.383  -29.991 1.00 0.00 ? 61  GLU A O    3  
ATOM 10088 C CB   . GLU A 1 61  ? 62.597  11.391  -28.282 1.00 0.00 ? 61  GLU A CB   3  
ATOM 10089 C CG   . GLU A 1 61  ? 62.787  11.781  -26.810 1.00 0.00 ? 61  GLU A CG   3  
ATOM 10090 C CD   . GLU A 1 61  ? 62.998  10.521  -25.967 1.00 0.00 ? 61  GLU A CD   3  
ATOM 10091 O OE1  . GLU A 1 61  ? 63.945  9.801   -26.240 1.00 0.00 ? 61  GLU A OE1  3  
ATOM 10092 O OE2  . GLU A 1 61  ? 62.209  10.297  -25.064 1.00 0.00 ? 61  GLU A OE2  3  
ATOM 10093 H H    . GLU A 1 61  ? 63.298  13.800  -27.827 1.00 0.00 ? 61  GLU A H    3  
ATOM 10094 H HA   . GLU A 1 61  ? 62.368  12.479  -30.122 1.00 0.00 ? 61  GLU A HA   3  
ATOM 10095 H HB2  . GLU A 1 61  ? 61.890  10.576  -28.351 1.00 0.00 ? 61  GLU A HB2  3  
ATOM 10096 H HB3  . GLU A 1 61  ? 63.548  11.070  -28.684 1.00 0.00 ? 61  GLU A HB3  3  
ATOM 10097 H HG2  . GLU A 1 61  ? 63.652  12.422  -26.717 1.00 0.00 ? 61  GLU A HG2  3  
ATOM 10098 H HG3  . GLU A 1 61  ? 61.913  12.303  -26.459 1.00 0.00 ? 61  GLU A HG3  3  
ATOM 10099 N N    . VAL A 1 62  ? 60.030  13.111  -27.867 1.00 0.00 ? 62  VAL A N    3  
ATOM 10100 C CA   . VAL A 1 62  ? 58.582  13.238  -27.692 1.00 0.00 ? 62  VAL A CA   3  
ATOM 10101 C C    . VAL A 1 62  ? 58.109  14.593  -28.207 1.00 0.00 ? 62  VAL A C    3  
ATOM 10102 O O    . VAL A 1 62  ? 57.339  14.664  -29.164 1.00 0.00 ? 62  VAL A O    3  
ATOM 10103 C CB   . VAL A 1 62  ? 58.193  13.114  -26.207 1.00 0.00 ? 62  VAL A CB   3  
ATOM 10104 C CG1  . VAL A 1 62  ? 56.671  13.211  -26.067 1.00 0.00 ? 62  VAL A CG1  3  
ATOM 10105 C CG2  . VAL A 1 62  ? 58.667  11.761  -25.670 1.00 0.00 ? 62  VAL A CG2  3  
ATOM 10106 H H    . VAL A 1 62  ? 60.622  13.347  -27.125 1.00 0.00 ? 62  VAL A H    3  
ATOM 10107 H HA   . VAL A 1 62  ? 58.083  12.457  -28.248 1.00 0.00 ? 62  VAL A HA   3  
ATOM 10108 H HB   . VAL A 1 62  ? 58.658  13.911  -25.645 1.00 0.00 ? 62  VAL A HB   3  
ATOM 10109 H HG11 . VAL A 1 62  ? 56.355  14.223  -26.268 1.00 0.00 ? 62  VAL A HG11 3  
ATOM 10110 H HG12 . VAL A 1 62  ? 56.384  12.938  -25.062 1.00 0.00 ? 62  VAL A HG12 3  
ATOM 10111 H HG13 . VAL A 1 62  ? 56.202  12.540  -26.771 1.00 0.00 ? 62  VAL A HG13 3  
ATOM 10112 H HG21 . VAL A 1 62  ? 59.707  11.619  -25.921 1.00 0.00 ? 62  VAL A HG21 3  
ATOM 10113 H HG22 . VAL A 1 62  ? 58.079  10.971  -26.113 1.00 0.00 ? 62  VAL A HG22 3  
ATOM 10114 H HG23 . VAL A 1 62  ? 58.550  11.738  -24.597 1.00 0.00 ? 62  VAL A HG23 3  
ATOM 10115 N N    . GLU A 1 63  ? 58.575  15.662  -27.552 1.00 0.00 ? 63  GLU A N    3  
ATOM 10116 C CA   . GLU A 1 63  ? 58.211  17.039  -27.917 1.00 0.00 ? 63  GLU A CA   3  
ATOM 10117 C C    . GLU A 1 63  ? 56.932  17.454  -27.189 1.00 0.00 ? 63  GLU A C    3  
ATOM 10118 O O    . GLU A 1 63  ? 56.244  16.616  -26.605 1.00 0.00 ? 63  GLU A O    3  
ATOM 10119 C CB   . GLU A 1 63  ? 58.033  17.179  -29.452 1.00 0.00 ? 63  GLU A CB   3  
ATOM 10120 C CG   . GLU A 1 63  ? 58.338  18.613  -29.908 1.00 0.00 ? 63  GLU A CG   3  
ATOM 10121 C CD   . GLU A 1 63  ? 58.263  18.687  -31.435 1.00 0.00 ? 63  GLU A CD   3  
ATOM 10122 O OE1  . GLU A 1 63  ? 59.179  18.200  -32.077 1.00 0.00 ? 63  GLU A OE1  3  
ATOM 10123 O OE2  . GLU A 1 63  ? 57.292  19.230  -31.935 1.00 0.00 ? 63  GLU A OE2  3  
ATOM 10124 H H    . GLU A 1 63  ? 59.173  15.522  -26.789 1.00 0.00 ? 63  GLU A H    3  
ATOM 10125 H HA   . GLU A 1 63  ? 59.011  17.689  -27.594 1.00 0.00 ? 63  GLU A HA   3  
ATOM 10126 H HB2  . GLU A 1 63  ? 58.710  16.499  -29.949 1.00 0.00 ? 63  GLU A HB2  3  
ATOM 10127 H HB3  . GLU A 1 63  ? 57.018  16.930  -29.728 1.00 0.00 ? 63  GLU A HB3  3  
ATOM 10128 H HG2  . GLU A 1 63  ? 57.613  19.290  -29.481 1.00 0.00 ? 63  GLU A HG2  3  
ATOM 10129 H HG3  . GLU A 1 63  ? 59.330  18.895  -29.586 1.00 0.00 ? 63  GLU A HG3  3  
ATOM 10130 N N    . SER A 1 64  ? 56.620  18.749  -27.233 1.00 0.00 ? 64  SER A N    3  
ATOM 10131 C CA   . SER A 1 64  ? 55.418  19.273  -26.578 1.00 0.00 ? 64  SER A CA   3  
ATOM 10132 C C    . SER A 1 64  ? 55.487  20.795  -26.461 1.00 0.00 ? 64  SER A C    3  
ATOM 10133 O O    . SER A 1 64  ? 54.471  21.450  -26.227 1.00 0.00 ? 64  SER A O    3  
ATOM 10134 C CB   . SER A 1 64  ? 55.260  18.662  -25.173 1.00 0.00 ? 64  SER A CB   3  
ATOM 10135 O OG   . SER A 1 64  ? 54.568  19.575  -24.330 1.00 0.00 ? 64  SER A OG   3  
ATOM 10136 H H    . SER A 1 64  ? 57.206  19.358  -27.728 1.00 0.00 ? 64  SER A H    3  
ATOM 10137 H HA   . SER A 1 64  ? 54.556  19.012  -27.175 1.00 0.00 ? 64  SER A HA   3  
ATOM 10138 H HB2  . SER A 1 64  ? 54.695  17.744  -25.230 1.00 0.00 ? 64  SER A HB2  3  
ATOM 10139 H HB3  . SER A 1 64  ? 56.239  18.452  -24.764 1.00 0.00 ? 64  SER A HB3  3  
ATOM 10140 H HG   . SER A 1 64  ? 53.672  19.664  -24.660 1.00 0.00 ? 64  SER A HG   3  
ATOM 10141 N N    . GLU A 1 65  ? 56.686  21.355  -26.612 1.00 0.00 ? 65  GLU A N    3  
ATOM 10142 C CA   . GLU A 1 65  ? 56.861  22.805  -26.508 1.00 0.00 ? 65  GLU A CA   3  
ATOM 10143 C C    . GLU A 1 65  ? 58.122  23.249  -27.252 1.00 0.00 ? 65  GLU A C    3  
ATOM 10144 O O    . GLU A 1 65  ? 59.110  22.517  -27.312 1.00 0.00 ? 65  GLU A O    3  
ATOM 10145 C CB   . GLU A 1 65  ? 56.947  23.200  -25.020 1.00 0.00 ? 65  GLU A CB   3  
ATOM 10146 C CG   . GLU A 1 65  ? 56.610  24.686  -24.823 1.00 0.00 ? 65  GLU A CG   3  
ATOM 10147 C CD   . GLU A 1 65  ? 57.740  25.549  -25.383 1.00 0.00 ? 65  GLU A CD   3  
ATOM 10148 O OE1  . GLU A 1 65  ? 58.865  25.373  -24.947 1.00 0.00 ? 65  GLU A OE1  3  
ATOM 10149 O OE2  . GLU A 1 65  ? 57.461  26.373  -26.239 1.00 0.00 ? 65  GLU A OE2  3  
ATOM 10150 H H    . GLU A 1 65  ? 57.465  20.786  -26.790 1.00 0.00 ? 65  GLU A H    3  
ATOM 10151 H HA   . GLU A 1 65  ? 56.007  23.294  -26.956 1.00 0.00 ? 65  GLU A HA   3  
ATOM 10152 H HB2  . GLU A 1 65  ? 56.248  22.601  -24.455 1.00 0.00 ? 65  GLU A HB2  3  
ATOM 10153 H HB3  . GLU A 1 65  ? 57.947  23.010  -24.654 1.00 0.00 ? 65  GLU A HB3  3  
ATOM 10154 H HG2  . GLU A 1 65  ? 55.687  24.923  -25.330 1.00 0.00 ? 65  GLU A HG2  3  
ATOM 10155 H HG3  . GLU A 1 65  ? 56.499  24.889  -23.768 1.00 0.00 ? 65  GLU A HG3  3  
ATOM 10156 N N    . ASP A 1 66  ? 58.072  24.450  -27.820 1.00 0.00 ? 66  ASP A N    3  
ATOM 10157 C CA   . ASP A 1 66  ? 59.206  24.988  -28.565 1.00 0.00 ? 66  ASP A CA   3  
ATOM 10158 C C    . ASP A 1 66  ? 60.451  25.072  -27.686 1.00 0.00 ? 66  ASP A C    3  
ATOM 10159 O O    . ASP A 1 66  ? 61.406  24.320  -27.877 1.00 0.00 ? 66  ASP A O    3  
ATOM 10160 C CB   . ASP A 1 66  ? 58.864  26.381  -29.099 1.00 0.00 ? 66  ASP A CB   3  
ATOM 10161 C CG   . ASP A 1 66  ? 60.048  26.926  -29.899 1.00 0.00 ? 66  ASP A CG   3  
ATOM 10162 O OD1  . ASP A 1 66  ? 60.262  26.452  -31.002 1.00 0.00 ? 66  ASP A OD1  3  
ATOM 10163 O OD2  . ASP A 1 66  ? 60.721  27.810  -29.394 1.00 0.00 ? 66  ASP A OD2  3  
ATOM 10164 H H    . ASP A 1 66  ? 57.254  24.984  -27.739 1.00 0.00 ? 66  ASP A H    3  
ATOM 10165 H HA   . ASP A 1 66  ? 59.413  24.338  -29.402 1.00 0.00 ? 66  ASP A HA   3  
ATOM 10166 H HB2  . ASP A 1 66  ? 57.995  26.317  -29.738 1.00 0.00 ? 66  ASP A HB2  3  
ATOM 10167 H HB3  . ASP A 1 66  ? 58.656  27.042  -28.271 1.00 0.00 ? 66  ASP A HB3  3  
ATOM 10168 N N    . ASP A 1 67  ? 60.434  25.992  -26.722 1.00 0.00 ? 67  ASP A N    3  
ATOM 10169 C CA   . ASP A 1 67  ? 61.570  26.170  -25.816 1.00 0.00 ? 67  ASP A CA   3  
ATOM 10170 C C    . ASP A 1 67  ? 61.128  26.868  -24.533 1.00 0.00 ? 67  ASP A C    3  
ATOM 10171 O O    . ASP A 1 67  ? 60.026  27.411  -24.459 1.00 0.00 ? 67  ASP A O    3  
ATOM 10172 C CB   . ASP A 1 67  ? 62.656  27.006  -26.497 1.00 0.00 ? 67  ASP A CB   3  
ATOM 10173 C CG   . ASP A 1 67  ? 63.207  26.252  -27.707 1.00 0.00 ? 67  ASP A CG   3  
ATOM 10174 O OD1  . ASP A 1 67  ? 64.151  25.499  -27.535 1.00 0.00 ? 67  ASP A OD1  3  
ATOM 10175 O OD2  . ASP A 1 67  ? 62.673  26.439  -28.790 1.00 0.00 ? 67  ASP A OD2  3  
ATOM 10176 H H    . ASP A 1 67  ? 59.644  26.560  -26.613 1.00 0.00 ? 67  ASP A H    3  
ATOM 10177 H HA   . ASP A 1 67  ? 61.981  25.202  -25.564 1.00 0.00 ? 67  ASP A HA   3  
ATOM 10178 H HB2  . ASP A 1 67  ? 62.235  27.947  -26.819 1.00 0.00 ? 67  ASP A HB2  3  
ATOM 10179 H HB3  . ASP A 1 67  ? 63.458  27.191  -25.797 1.00 0.00 ? 67  ASP A HB3  3  
ATOM 10180 N N    . SER A 1 68  ? 61.998  26.850  -23.524 1.00 0.00 ? 68  SER A N    3  
ATOM 10181 C CA   . SER A 1 68  ? 61.694  27.486  -22.243 1.00 0.00 ? 68  SER A CA   3  
ATOM 10182 C C    . SER A 1 68  ? 62.982  27.826  -21.499 1.00 0.00 ? 68  SER A C    3  
ATOM 10183 O O    . SER A 1 68  ? 64.034  27.244  -21.763 1.00 0.00 ? 68  SER A O    3  
ATOM 10184 C CB   . SER A 1 68  ? 60.841  26.550  -21.386 1.00 0.00 ? 68  SER A CB   3  
ATOM 10185 O OG   . SER A 1 68  ? 61.655  25.489  -20.898 1.00 0.00 ? 68  SER A OG   3  
ATOM 10186 H H    . SER A 1 68  ? 62.862  26.402  -23.642 1.00 0.00 ? 68  SER A H    3  
ATOM 10187 H HA   . SER A 1 68  ? 61.141  28.399  -22.418 1.00 0.00 ? 68  SER A HA   3  
ATOM 10188 H HB2  . SER A 1 68  ? 60.432  27.093  -20.552 1.00 0.00 ? 68  SER A HB2  3  
ATOM 10189 H HB3  . SER A 1 68  ? 60.033  26.151  -21.985 1.00 0.00 ? 68  SER A HB3  3  
ATOM 10190 H HG   . SER A 1 68  ? 62.302  25.865  -20.297 1.00 0.00 ? 68  SER A HG   3  
ATOM 10191 N N    . THR A 1 69  ? 62.892  28.779  -20.568 1.00 0.00 ? 69  THR A N    3  
ATOM 10192 C CA   . THR A 1 69  ? 64.058  29.204  -19.785 1.00 0.00 ? 69  THR A CA   3  
ATOM 10193 C C    . THR A 1 69  ? 63.665  29.465  -18.334 1.00 0.00 ? 69  THR A C    3  
ATOM 10194 O O    . THR A 1 69  ? 64.358  29.040  -17.410 1.00 0.00 ? 69  THR A O    3  
ATOM 10195 C CB   . THR A 1 69  ? 64.662  30.497  -20.365 1.00 0.00 ? 69  THR A CB   3  
ATOM 10196 O OG1  . THR A 1 69  ? 65.037  30.278  -21.718 1.00 0.00 ? 69  THR A OG1  3  
ATOM 10197 C CG2  . THR A 1 69  ? 65.894  30.901  -19.552 1.00 0.00 ? 69  THR A CG2  3  
ATOM 10198 H H    . THR A 1 69  ? 62.027  29.209  -20.409 1.00 0.00 ? 69  THR A H    3  
ATOM 10199 H HA   . THR A 1 69  ? 64.814  28.430  -19.805 1.00 0.00 ? 69  THR A HA   3  
ATOM 10200 H HB   . THR A 1 69  ? 63.931  31.290  -20.319 1.00 0.00 ? 69  THR A HB   3  
ATOM 10201 H HG1  . THR A 1 69  ? 65.584  31.015  -21.998 1.00 0.00 ? 69  THR A HG1  3  
ATOM 10202 H HG21 . THR A 1 69  ? 65.584  31.267  -18.585 1.00 0.00 ? 69  THR A HG21 3  
ATOM 10203 H HG22 . THR A 1 69  ? 66.431  31.679  -20.076 1.00 0.00 ? 69  THR A HG22 3  
ATOM 10204 H HG23 . THR A 1 69  ? 66.539  30.044  -19.423 1.00 0.00 ? 69  THR A HG23 3  
ATOM 10205 N N    . SER A 1 70  ? 62.553  30.167  -18.140 1.00 0.00 ? 70  SER A N    3  
ATOM 10206 C CA   . SER A 1 70  ? 62.083  30.479  -16.794 1.00 0.00 ? 70  SER A CA   3  
ATOM 10207 C C    . SER A 1 70  ? 63.208  31.092  -15.965 1.00 0.00 ? 70  SER A C    3  
ATOM 10208 O O    . SER A 1 70  ? 64.206  31.564  -16.510 1.00 0.00 ? 70  SER A O    3  
ATOM 10209 C CB   . SER A 1 70  ? 61.574  29.210  -16.111 1.00 0.00 ? 70  SER A CB   3  
ATOM 10210 O OG   . SER A 1 70  ? 62.670  28.341  -15.857 1.00 0.00 ? 70  SER A OG   3  
ATOM 10211 H H    . SER A 1 70  ? 62.042  30.483  -18.915 1.00 0.00 ? 70  SER A H    3  
ATOM 10212 H HA   . SER A 1 70  ? 61.271  31.188  -16.862 1.00 0.00 ? 70  SER A HA   3  
ATOM 10213 H HB2  . SER A 1 70  ? 61.101  29.466  -15.177 1.00 0.00 ? 70  SER A HB2  3  
ATOM 10214 H HB3  . SER A 1 70  ? 60.854  28.720  -16.753 1.00 0.00 ? 70  SER A HB3  3  
ATOM 10215 H HG   . SER A 1 70  ? 62.475  27.492  -16.261 1.00 0.00 ? 70  SER A HG   3  
ATOM 10216 N N    . VAL A 1 71  ? 63.043  31.081  -14.644 1.00 0.00 ? 71  VAL A N    3  
ATOM 10217 C CA   . VAL A 1 71  ? 64.054  31.640  -13.751 1.00 0.00 ? 71  VAL A CA   3  
ATOM 10218 C C    . VAL A 1 71  ? 65.255  30.704  -13.641 1.00 0.00 ? 71  VAL A C    3  
ATOM 10219 O O    . VAL A 1 71  ? 65.933  30.670  -12.614 1.00 0.00 ? 71  VAL A O    3  
ATOM 10220 C CB   . VAL A 1 71  ? 63.477  31.862  -12.341 1.00 0.00 ? 71  VAL A CB   3  
ATOM 10221 C CG1  . VAL A 1 71  ? 62.353  32.898  -12.405 1.00 0.00 ? 71  VAL A CG1  3  
ATOM 10222 C CG2  . VAL A 1 71  ? 62.921  30.541  -11.804 1.00 0.00 ? 71  VAL A CG2  3  
ATOM 10223 H H    . VAL A 1 71  ? 62.228  30.694  -14.264 1.00 0.00 ? 71  VAL A H    3  
ATOM 10224 H HA   . VAL A 1 71  ? 64.384  32.590  -14.143 1.00 0.00 ? 71  VAL A HA   3  
ATOM 10225 H HB   . VAL A 1 71  ? 64.259  32.220  -11.685 1.00 0.00 ? 71  VAL A HB   3  
ATOM 10226 H HG11 . VAL A 1 71  ? 61.631  32.600  -13.151 1.00 0.00 ? 71  VAL A HG11 3  
ATOM 10227 H HG12 . VAL A 1 71  ? 62.766  33.861  -12.669 1.00 0.00 ? 71  VAL A HG12 3  
ATOM 10228 H HG13 . VAL A 1 71  ? 61.870  32.965  -11.441 1.00 0.00 ? 71  VAL A HG13 3  
ATOM 10229 H HG21 . VAL A 1 71  ? 62.420  30.718  -10.864 1.00 0.00 ? 71  VAL A HG21 3  
ATOM 10230 H HG22 . VAL A 1 71  ? 63.731  29.842  -11.657 1.00 0.00 ? 71  VAL A HG22 3  
ATOM 10231 H HG23 . VAL A 1 71  ? 62.218  30.131  -12.515 1.00 0.00 ? 71  VAL A HG23 3  
ATOM 10232 N N    . GLU A 1 72  ? 65.512  29.949  -14.704 1.00 0.00 ? 72  GLU A N    3  
ATOM 10233 C CA   . GLU A 1 72  ? 66.633  29.015  -14.716 1.00 0.00 ? 72  GLU A CA   3  
ATOM 10234 C C    . GLU A 1 72  ? 66.548  28.056  -13.533 1.00 0.00 ? 72  GLU A C    3  
ATOM 10235 O O    . GLU A 1 72  ? 67.274  28.202  -12.549 1.00 0.00 ? 72  GLU A O    3  
ATOM 10236 C CB   . GLU A 1 72  ? 67.956  29.783  -14.658 1.00 0.00 ? 72  GLU A CB   3  
ATOM 10237 C CG   . GLU A 1 72  ? 68.043  30.742  -15.846 1.00 0.00 ? 72  GLU A CG   3  
ATOM 10238 C CD   . GLU A 1 72  ? 69.442  31.358  -15.905 1.00 0.00 ? 72  GLU A CD   3  
ATOM 10239 O OE1  . GLU A 1 72  ? 70.399  30.601  -15.934 1.00 0.00 ? 72  GLU A OE1  3  
ATOM 10240 O OE2  . GLU A 1 72  ? 69.533  32.574  -15.920 1.00 0.00 ? 72  GLU A OE2  3  
ATOM 10241 H H    . GLU A 1 72  ? 64.936  30.018  -15.492 1.00 0.00 ? 72  GLU A H    3  
ATOM 10242 H HA   . GLU A 1 72  ? 66.603  28.444  -15.631 1.00 0.00 ? 72  GLU A HA   3  
ATOM 10243 H HB2  . GLU A 1 72  ? 68.007  30.345  -13.738 1.00 0.00 ? 72  GLU A HB2  3  
ATOM 10244 H HB3  . GLU A 1 72  ? 68.779  29.084  -14.699 1.00 0.00 ? 72  GLU A HB3  3  
ATOM 10245 H HG2  . GLU A 1 72  ? 67.847  30.201  -16.761 1.00 0.00 ? 72  GLU A HG2  3  
ATOM 10246 H HG3  . GLU A 1 72  ? 67.311  31.528  -15.729 1.00 0.00 ? 72  GLU A HG3  3  
ATOM 10247 N N    . ASP A 1 73  ? 65.656  27.076  -13.636 1.00 0.00 ? 73  ASP A N    3  
ATOM 10248 C CA   . ASP A 1 73  ? 65.483  26.094  -12.569 1.00 0.00 ? 73  ASP A CA   3  
ATOM 10249 C C    . ASP A 1 73  ? 64.707  24.881  -13.072 1.00 0.00 ? 73  ASP A C    3  
ATOM 10250 O O    . ASP A 1 73  ? 64.116  24.141  -12.284 1.00 0.00 ? 73  ASP A O    3  
ATOM 10251 C CB   . ASP A 1 73  ? 64.736  26.728  -11.394 1.00 0.00 ? 73  ASP A CB   3  
ATOM 10252 C CG   . ASP A 1 73  ? 63.370  27.227  -11.868 1.00 0.00 ? 73  ASP A CG   3  
ATOM 10253 O OD1  . ASP A 1 73  ? 63.188  27.346  -13.068 1.00 0.00 ? 73  ASP A OD1  3  
ATOM 10254 O OD2  . ASP A 1 73  ? 62.528  27.483  -11.023 1.00 0.00 ? 73  ASP A OD2  3  
ATOM 10255 H H    . ASP A 1 73  ? 65.106  27.009  -14.445 1.00 0.00 ? 73  ASP A H    3  
ATOM 10256 H HA   . ASP A 1 73  ? 66.455  25.770  -12.228 1.00 0.00 ? 73  ASP A HA   3  
ATOM 10257 H HB2  . ASP A 1 73  ? 64.600  25.993  -10.614 1.00 0.00 ? 73  ASP A HB2  3  
ATOM 10258 H HB3  . ASP A 1 73  ? 65.307  27.560  -11.010 1.00 0.00 ? 73  ASP A HB3  3  
ATOM 10259 N N    . VAL A 1 74  ? 64.711  24.681  -14.386 1.00 0.00 ? 74  VAL A N    3  
ATOM 10260 C CA   . VAL A 1 74  ? 64.001  23.553  -14.978 1.00 0.00 ? 74  VAL A CA   3  
ATOM 10261 C C    . VAL A 1 74  ? 64.523  22.236  -14.398 1.00 0.00 ? 74  VAL A C    3  
ATOM 10262 O O    . VAL A 1 74  ? 65.675  21.861  -14.611 1.00 0.00 ? 74  VAL A O    3  
ATOM 10263 C CB   . VAL A 1 74  ? 64.164  23.542  -16.522 1.00 0.00 ? 74  VAL A CB   3  
ATOM 10264 C CG1  . VAL A 1 74  ? 63.191  24.543  -17.155 1.00 0.00 ? 74  VAL A CG1  3  
ATOM 10265 C CG2  . VAL A 1 74  ? 65.597  23.941  -16.894 1.00 0.00 ? 74  VAL A CG2  3  
ATOM 10266 H H    . VAL A 1 74  ? 65.197  25.304  -14.964 1.00 0.00 ? 74  VAL A H    3  
ATOM 10267 H HA   . VAL A 1 74  ? 62.951  23.639  -14.736 1.00 0.00 ? 74  VAL A HA   3  
ATOM 10268 H HB   . VAL A 1 74  ? 63.952  22.553  -16.907 1.00 0.00 ? 74  VAL A HB   3  
ATOM 10269 H HG11 . VAL A 1 74  ? 63.408  24.640  -18.208 1.00 0.00 ? 74  VAL A HG11 3  
ATOM 10270 H HG12 . VAL A 1 74  ? 63.300  25.504  -16.675 1.00 0.00 ? 74  VAL A HG12 3  
ATOM 10271 H HG13 . VAL A 1 74  ? 62.178  24.191  -17.028 1.00 0.00 ? 74  VAL A HG13 3  
ATOM 10272 H HG21 . VAL A 1 74  ? 65.749  24.987  -16.672 1.00 0.00 ? 74  VAL A HG21 3  
ATOM 10273 H HG22 . VAL A 1 74  ? 65.753  23.772  -17.950 1.00 0.00 ? 74  VAL A HG22 3  
ATOM 10274 H HG23 . VAL A 1 74  ? 66.298  23.349  -16.329 1.00 0.00 ? 74  VAL A HG23 3  
ATOM 10275 N N    . ASP A 1 75  ? 63.662  21.540  -13.662 1.00 0.00 ? 75  ASP A N    3  
ATOM 10276 C CA   . ASP A 1 75  ? 64.043  20.269  -13.056 1.00 0.00 ? 75  ASP A CA   3  
ATOM 10277 C C    . ASP A 1 75  ? 64.299  19.225  -14.148 1.00 0.00 ? 75  ASP A C    3  
ATOM 10278 O O    . ASP A 1 75  ? 63.697  19.292  -15.220 1.00 0.00 ? 75  ASP A O    3  
ATOM 10279 C CB   . ASP A 1 75  ? 62.925  19.788  -12.126 1.00 0.00 ? 75  ASP A CB   3  
ATOM 10280 C CG   . ASP A 1 75  ? 61.576  19.929  -12.836 1.00 0.00 ? 75  ASP A CG   3  
ATOM 10281 O OD1  . ASP A 1 75  ? 61.161  21.054  -13.056 1.00 0.00 ? 75  ASP A OD1  3  
ATOM 10282 O OD2  . ASP A 1 75  ? 60.983  18.909  -13.145 1.00 0.00 ? 75  ASP A OD2  3  
ATOM 10283 H H    . ASP A 1 75  ? 62.756  21.887  -13.524 1.00 0.00 ? 75  ASP A H    3  
ATOM 10284 H HA   . ASP A 1 75  ? 64.941  20.419  -12.480 1.00 0.00 ? 75  ASP A HA   3  
ATOM 10285 H HB2  . ASP A 1 75  ? 63.087  18.752  -11.865 1.00 0.00 ? 75  ASP A HB2  3  
ATOM 10286 H HB3  . ASP A 1 75  ? 62.920  20.388  -11.229 1.00 0.00 ? 75  ASP A HB3  3  
ATOM 10287 N N    . PRO A 1 76  ? 65.191  18.242  -13.905 1.00 0.00 ? 76  PRO A N    3  
ATOM 10288 C CA   . PRO A 1 76  ? 65.493  17.201  -14.902 1.00 0.00 ? 76  PRO A CA   3  
ATOM 10289 C C    . PRO A 1 76  ? 64.347  16.186  -15.020 1.00 0.00 ? 76  PRO A C    3  
ATOM 10290 O O    . PRO A 1 76  ? 63.571  16.013  -14.080 1.00 0.00 ? 76  PRO A O    3  
ATOM 10291 C CB   . PRO A 1 76  ? 66.774  16.545  -14.359 1.00 0.00 ? 76  PRO A CB   3  
ATOM 10292 C CG   . PRO A 1 76  ? 66.667  16.705  -12.877 1.00 0.00 ? 76  PRO A CG   3  
ATOM 10293 C CD   . PRO A 1 76  ? 65.975  18.056  -12.665 1.00 0.00 ? 76  PRO A CD   3  
ATOM 10294 H HA   . PRO A 1 76  ? 65.695  17.659  -15.855 1.00 0.00 ? 76  PRO A HA   3  
ATOM 10295 H HB2  . PRO A 1 76  ? 66.818  15.497  -14.634 1.00 0.00 ? 76  PRO A HB2  3  
ATOM 10296 H HB3  . PRO A 1 76  ? 67.650  17.066  -14.726 1.00 0.00 ? 76  PRO A HB3  3  
ATOM 10297 H HG2  . PRO A 1 76  ? 66.069  15.902  -12.459 1.00 0.00 ? 76  PRO A HG2  3  
ATOM 10298 H HG3  . PRO A 1 76  ? 67.648  16.716  -12.422 1.00 0.00 ? 76  PRO A HG3  3  
ATOM 10299 H HD2  . PRO A 1 76  ? 65.326  18.022  -11.800 1.00 0.00 ? 76  PRO A HD2  3  
ATOM 10300 H HD3  . PRO A 1 76  ? 66.703  18.848  -12.564 1.00 0.00 ? 76  PRO A HD3  3  
ATOM 10301 N N    . PRO A 1 77  ? 64.225  15.493  -16.172 1.00 0.00 ? 77  PRO A N    3  
ATOM 10302 C CA   . PRO A 1 77  ? 63.167  14.493  -16.385 1.00 0.00 ? 77  PRO A CA   3  
ATOM 10303 C C    . PRO A 1 77  ? 63.520  13.155  -15.722 1.00 0.00 ? 77  PRO A C    3  
ATOM 10304 O O    . PRO A 1 77  ? 64.114  13.138  -14.645 1.00 0.00 ? 77  PRO A O    3  
ATOM 10305 C CB   . PRO A 1 77  ? 63.114  14.391  -17.910 1.00 0.00 ? 77  PRO A CB   3  
ATOM 10306 C CG   . PRO A 1 77  ? 64.536  14.553  -18.316 1.00 0.00 ? 77  PRO A CG   3  
ATOM 10307 C CD   . PRO A 1 77  ? 65.096  15.617  -17.364 1.00 0.00 ? 77  PRO A CD   3  
ATOM 10308 H HA   . PRO A 1 77  ? 62.223  14.857  -16.011 1.00 0.00 ? 77  PRO A HA   3  
ATOM 10309 H HB2  . PRO A 1 77  ? 62.726  13.437  -18.222 1.00 0.00 ? 77  PRO A HB2  3  
ATOM 10310 H HB3  . PRO A 1 77  ? 62.519  15.193  -18.321 1.00 0.00 ? 77  PRO A HB3  3  
ATOM 10311 H HG2  . PRO A 1 77  ? 65.067  13.614  -18.196 1.00 0.00 ? 77  PRO A HG2  3  
ATOM 10312 H HG3  . PRO A 1 77  ? 64.603  14.893  -19.337 1.00 0.00 ? 77  PRO A HG3  3  
ATOM 10313 H HD2  . PRO A 1 77  ? 66.127  15.405  -17.113 1.00 0.00 ? 77  PRO A HD2  3  
ATOM 10314 H HD3  . PRO A 1 77  ? 64.999  16.601  -17.797 1.00 0.00 ? 77  PRO A HD3  3  
ATOM 10315 N N    . THR A 1 78  ? 63.159  12.034  -16.358 1.00 0.00 ? 78  THR A N    3  
ATOM 10316 C CA   . THR A 1 78  ? 63.448  10.711  -15.802 1.00 0.00 ? 78  THR A CA   3  
ATOM 10317 C C    . THR A 1 78  ? 63.895  9.746   -16.897 1.00 0.00 ? 78  THR A C    3  
ATOM 10318 O O    . THR A 1 78  ? 63.401  9.800   -18.023 1.00 0.00 ? 78  THR A O    3  
ATOM 10319 C CB   . THR A 1 78  ? 62.195  10.126  -15.125 1.00 0.00 ? 78  THR A CB   3  
ATOM 10320 O OG1  . THR A 1 78  ? 62.500  8.849   -14.584 1.00 0.00 ? 78  THR A OG1  3  
ATOM 10321 C CG2  . THR A 1 78  ? 61.073  9.990   -16.155 1.00 0.00 ? 78  THR A CG2  3  
ATOM 10322 H H    . THR A 1 78  ? 62.689  12.095  -17.211 1.00 0.00 ? 78  THR A H    3  
ATOM 10323 H HA   . THR A 1 78  ? 64.237  10.790  -15.067 1.00 0.00 ? 78  THR A HA   3  
ATOM 10324 H HB   . THR A 1 78  ? 61.872  10.785  -14.337 1.00 0.00 ? 78  THR A HB   3  
ATOM 10325 H HG1  . THR A 1 78  ? 62.013  8.750   -13.763 1.00 0.00 ? 78  THR A HG1  3  
ATOM 10326 H HG21 . THR A 1 78  ? 60.145  9.765   -15.650 1.00 0.00 ? 78  THR A HG21 3  
ATOM 10327 H HG22 . THR A 1 78  ? 61.309  9.191   -16.843 1.00 0.00 ? 78  THR A HG22 3  
ATOM 10328 H HG23 . THR A 1 78  ? 60.971  10.916  -16.702 1.00 0.00 ? 78  THR A HG23 3  
ATOM 10329 N N    . THR A 1 79  ? 64.822  8.849   -16.549 1.00 0.00 ? 79  THR A N    3  
ATOM 10330 C CA   . THR A 1 79  ? 65.326  7.848   -17.497 1.00 0.00 ? 79  THR A CA   3  
ATOM 10331 C C    . THR A 1 79  ? 64.727  6.494   -17.150 1.00 0.00 ? 79  THR A C    3  
ATOM 10332 O O    . THR A 1 79  ? 64.740  6.092   -15.989 1.00 0.00 ? 79  THR A O    3  
ATOM 10333 C CB   . THR A 1 79  ? 66.864  7.743   -17.436 1.00 0.00 ? 79  THR A CB   3  
ATOM 10334 O OG1  . THR A 1 79  ? 67.232  6.829   -16.414 1.00 0.00 ? 79  THR A OG1  3  
ATOM 10335 C CG2  . THR A 1 79  ? 67.459  9.120   -17.131 1.00 0.00 ? 79  THR A CG2  3  
ATOM 10336 H H    . THR A 1 79  ? 65.165  8.846   -15.629 1.00 0.00 ? 79  THR A H    3  
ATOM 10337 H HA   . THR A 1 79  ? 65.028  8.118   -18.502 1.00 0.00 ? 79  THR A HA   3  
ATOM 10338 H HB   . THR A 1 79  ? 67.246  7.393   -18.383 1.00 0.00 ? 79  THR A HB   3  
ATOM 10339 H HG1  . THR A 1 79  ? 67.612  6.054   -16.833 1.00 0.00 ? 79  THR A HG1  3  
ATOM 10340 H HG21 . THR A 1 79  ? 68.536  9.068   -17.193 1.00 0.00 ? 79  THR A HG21 3  
ATOM 10341 H HG22 . THR A 1 79  ? 67.168  9.425   -16.137 1.00 0.00 ? 79  THR A HG22 3  
ATOM 10342 H HG23 . THR A 1 79  ? 67.090  9.837   -17.851 1.00 0.00 ? 79  THR A HG23 3  
ATOM 10343 N N    . TYR A 1 80  ? 64.184  5.803   -18.153 1.00 0.00 ? 80  TYR A N    3  
ATOM 10344 C CA   . TYR A 1 80  ? 63.543  4.495   -17.941 1.00 0.00 ? 80  TYR A CA   3  
ATOM 10345 C C    . TYR A 1 80  ? 64.182  3.421   -18.832 1.00 0.00 ? 80  TYR A C    3  
ATOM 10346 O O    . TYR A 1 80  ? 64.019  3.437   -20.052 1.00 0.00 ? 80  TYR A O    3  
ATOM 10347 C CB   . TYR A 1 80  ? 62.013  4.660   -18.220 1.00 0.00 ? 80  TYR A CB   3  
ATOM 10348 C CG   . TYR A 1 80  ? 61.442  3.518   -19.053 1.00 0.00 ? 80  TYR A CG   3  
ATOM 10349 C CD1  . TYR A 1 80  ? 61.570  2.186   -18.607 1.00 0.00 ? 80  TYR A CD1  3  
ATOM 10350 C CD2  . TYR A 1 80  ? 60.777  3.789   -20.276 1.00 0.00 ? 80  TYR A CD2  3  
ATOM 10351 C CE1  . TYR A 1 80  ? 61.038  1.128   -19.375 1.00 0.00 ? 80  TYR A CE1  3  
ATOM 10352 C CE2  . TYR A 1 80  ? 60.244  2.732   -21.040 1.00 0.00 ? 80  TYR A CE2  3  
ATOM 10353 C CZ   . TYR A 1 80  ? 60.375  1.401   -20.592 1.00 0.00 ? 80  TYR A CZ   3  
ATOM 10354 O OH   . TYR A 1 80  ? 59.778  0.375   -21.295 1.00 0.00 ? 80  TYR A OH   3  
ATOM 10355 H H    . TYR A 1 80  ? 64.195  6.184   -19.057 1.00 0.00 ? 80  TYR A H    3  
ATOM 10356 H HA   . TYR A 1 80  ? 63.676  4.190   -16.908 1.00 0.00 ? 80  TYR A HA   3  
ATOM 10357 H HB2  . TYR A 1 80  ? 61.478  4.702   -17.282 1.00 0.00 ? 80  TYR A HB2  3  
ATOM 10358 H HB3  . TYR A 1 80  ? 61.857  5.594   -18.743 1.00 0.00 ? 80  TYR A HB3  3  
ATOM 10359 H HD1  . TYR A 1 80  ? 62.075  1.975   -17.676 1.00 0.00 ? 80  TYR A HD1  3  
ATOM 10360 H HD2  . TYR A 1 80  ? 60.676  4.807   -20.624 1.00 0.00 ? 80  TYR A HD2  3  
ATOM 10361 H HE1  . TYR A 1 80  ? 61.139  0.111   -19.034 1.00 0.00 ? 80  TYR A HE1  3  
ATOM 10362 H HE2  . TYR A 1 80  ? 59.737  2.940   -21.972 1.00 0.00 ? 80  TYR A HE2  3  
ATOM 10363 H HH   . TYR A 1 80  ? 59.001  0.729   -21.735 1.00 0.00 ? 80  TYR A HH   3  
ATOM 10364 N N    . TYR A 1 81  ? 64.889  2.473   -18.202 1.00 0.00 ? 81  TYR A N    3  
ATOM 10365 C CA   . TYR A 1 81  ? 65.533  1.368   -18.933 1.00 0.00 ? 81  TYR A CA   3  
ATOM 10366 C C    . TYR A 1 81  ? 64.692  0.095   -18.779 1.00 0.00 ? 81  TYR A C    3  
ATOM 10367 O O    . TYR A 1 81  ? 64.455  -0.376  -17.666 1.00 0.00 ? 81  TYR A O    3  
ATOM 10368 C CB   . TYR A 1 81  ? 66.988  1.132   -18.424 1.00 0.00 ? 81  TYR A CB   3  
ATOM 10369 C CG   . TYR A 1 81  ? 67.212  1.825   -17.098 1.00 0.00 ? 81  TYR A CG   3  
ATOM 10370 C CD1  . TYR A 1 81  ? 66.883  1.171   -15.892 1.00 0.00 ? 81  TYR A CD1  3  
ATOM 10371 C CD2  . TYR A 1 81  ? 67.763  3.126   -17.067 1.00 0.00 ? 81  TYR A CD2  3  
ATOM 10372 C CE1  . TYR A 1 81  ? 67.106  1.816   -14.655 1.00 0.00 ? 81  TYR A CE1  3  
ATOM 10373 C CE2  . TYR A 1 81  ? 67.982  3.770   -15.832 1.00 0.00 ? 81  TYR A CE2  3  
ATOM 10374 C CZ   . TYR A 1 81  ? 67.653  3.117   -14.625 1.00 0.00 ? 81  TYR A CZ   3  
ATOM 10375 O OH   . TYR A 1 81  ? 67.754  3.793   -13.427 1.00 0.00 ? 81  TYR A OH   3  
ATOM 10376 H H    . TYR A 1 81  ? 64.971  2.508   -17.226 1.00 0.00 ? 81  TYR A H    3  
ATOM 10377 H HA   . TYR A 1 81  ? 65.568  1.617   -19.985 1.00 0.00 ? 81  TYR A HA   3  
ATOM 10378 H HB2  . TYR A 1 81  ? 67.173  0.073   -18.301 1.00 0.00 ? 81  TYR A HB2  3  
ATOM 10379 H HB3  . TYR A 1 81  ? 67.692  1.524   -19.149 1.00 0.00 ? 81  TYR A HB3  3  
ATOM 10380 H HD1  . TYR A 1 81  ? 66.462  0.177   -15.913 1.00 0.00 ? 81  TYR A HD1  3  
ATOM 10381 H HD2  . TYR A 1 81  ? 68.015  3.627   -17.990 1.00 0.00 ? 81  TYR A HD2  3  
ATOM 10382 H HE1  . TYR A 1 81  ? 66.854  1.315   -13.732 1.00 0.00 ? 81  TYR A HE1  3  
ATOM 10383 H HE2  . TYR A 1 81  ? 68.402  4.765   -15.812 1.00 0.00 ? 81  TYR A HE2  3  
ATOM 10384 H HH   . TYR A 1 81  ? 66.870  4.061   -13.162 1.00 0.00 ? 81  TYR A HH   3  
ATOM 10385 N N    . SER A 1 82  ? 64.235  -0.445  -19.911 1.00 0.00 ? 82  SER A N    3  
ATOM 10386 C CA   . SER A 1 82  ? 63.406  -1.654  -19.913 1.00 0.00 ? 82  SER A CA   3  
ATOM 10387 C C    . SER A 1 82  ? 64.255  -2.919  -20.032 1.00 0.00 ? 82  SER A C    3  
ATOM 10388 O O    . SER A 1 82  ? 64.340  -3.516  -21.105 1.00 0.00 ? 82  SER A O    3  
ATOM 10389 C CB   . SER A 1 82  ? 62.424  -1.599  -21.085 1.00 0.00 ? 82  SER A CB   3  
ATOM 10390 O OG   . SER A 1 82  ? 61.410  -2.578  -20.895 1.00 0.00 ? 82  SER A OG   3  
ATOM 10391 H H    . SER A 1 82  ? 64.451  -0.012  -20.764 1.00 0.00 ? 82  SER A H    3  
ATOM 10392 H HA   . SER A 1 82  ? 62.838  -1.701  -18.993 1.00 0.00 ? 82  SER A HA   3  
ATOM 10393 H HB2  . SER A 1 82  ? 61.969  -0.625  -21.130 1.00 0.00 ? 82  SER A HB2  3  
ATOM 10394 H HB3  . SER A 1 82  ? 62.953  -1.788  -22.010 1.00 0.00 ? 82  SER A HB3  3  
ATOM 10395 H HG   . SER A 1 82  ? 60.607  -2.258  -21.311 1.00 0.00 ? 82  SER A HG   3  
ATOM 10396 N N    . ILE A 1 83  ? 64.873  -3.329  -18.929 1.00 0.00 ? 83  ILE A N    3  
ATOM 10397 C CA   . ILE A 1 83  ? 65.697  -4.533  -18.939 1.00 0.00 ? 83  ILE A CA   3  
ATOM 10398 C C    . ILE A 1 83  ? 64.809  -5.769  -19.057 1.00 0.00 ? 83  ILE A C    3  
ATOM 10399 O O    . ILE A 1 83  ? 64.138  -6.157  -18.101 1.00 0.00 ? 83  ILE A O    3  
ATOM 10400 C CB   . ILE A 1 83  ? 66.537  -4.649  -17.649 1.00 0.00 ? 83  ILE A CB   3  
ATOM 10401 C CG1  . ILE A 1 83  ? 67.237  -3.308  -17.388 1.00 0.00 ? 83  ILE A CG1  3  
ATOM 10402 C CG2  . ILE A 1 83  ? 67.589  -5.766  -17.801 1.00 0.00 ? 83  ILE A CG2  3  
ATOM 10403 C CD1  . ILE A 1 83  ? 68.054  -3.391  -16.098 1.00 0.00 ? 83  ILE A CD1  3  
ATOM 10404 H H    . ILE A 1 83  ? 64.771  -2.817  -18.099 1.00 0.00 ? 83  ILE A H    3  
ATOM 10405 H HA   . ILE A 1 83  ? 66.363  -4.497  -19.789 1.00 0.00 ? 83  ILE A HA   3  
ATOM 10406 H HB   . ILE A 1 83  ? 65.885  -4.881  -16.818 1.00 0.00 ? 83  ILE A HB   3  
ATOM 10407 H HG12 . ILE A 1 83  ? 67.895  -3.081  -18.215 1.00 0.00 ? 83  ILE A HG12 3  
ATOM 10408 H HG13 . ILE A 1 83  ? 66.497  -2.528  -17.293 1.00 0.00 ? 83  ILE A HG13 3  
ATOM 10409 H HG21 . ILE A 1 83  ? 67.941  -6.063  -16.824 1.00 0.00 ? 83  ILE A HG21 3  
ATOM 10410 H HG22 . ILE A 1 83  ? 68.422  -5.407  -18.388 1.00 0.00 ? 83  ILE A HG22 3  
ATOM 10411 H HG23 . ILE A 1 83  ? 67.149  -6.621  -18.293 1.00 0.00 ? 83  ILE A HG23 3  
ATOM 10412 H HD11 . ILE A 1 83  ? 67.444  -3.808  -15.311 1.00 0.00 ? 83  ILE A HD11 3  
ATOM 10413 H HD12 . ILE A 1 83  ? 68.379  -2.400  -15.816 1.00 0.00 ? 83  ILE A HD12 3  
ATOM 10414 H HD13 . ILE A 1 83  ? 68.917  -4.017  -16.256 1.00 0.00 ? 83  ILE A HD13 3  
ATOM 10415 N N    . ILE A 1 84  ? 64.812  -6.386  -20.241 1.00 0.00 ? 84  ILE A N    3  
ATOM 10416 C CA   . ILE A 1 84  ? 64.006  -7.586  -20.490 1.00 0.00 ? 84  ILE A CA   3  
ATOM 10417 C C    . ILE A 1 84  ? 64.868  -8.838  -20.341 1.00 0.00 ? 84  ILE A C    3  
ATOM 10418 O O    . ILE A 1 84  ? 66.061  -8.822  -20.644 1.00 0.00 ? 84  ILE A O    3  
ATOM 10419 C CB   . ILE A 1 84  ? 63.369  -7.539  -21.900 1.00 0.00 ? 84  ILE A CB   3  
ATOM 10420 C CG1  . ILE A 1 84  ? 62.645  -8.868  -22.187 1.00 0.00 ? 84  ILE A CG1  3  
ATOM 10421 C CG2  . ILE A 1 84  ? 64.448  -7.286  -22.957 1.00 0.00 ? 84  ILE A CG2  3  
ATOM 10422 C CD1  . ILE A 1 84  ? 61.753  -8.737  -23.429 1.00 0.00 ? 84  ILE A CD1  3  
ATOM 10423 H H    . ILE A 1 84  ? 65.370  -6.031  -20.963 1.00 0.00 ? 84  ILE A H    3  
ATOM 10424 H HA   . ILE A 1 84  ? 63.212  -7.639  -19.763 1.00 0.00 ? 84  ILE A HA   3  
ATOM 10425 H HB   . ILE A 1 84  ? 62.655  -6.728  -21.928 1.00 0.00 ? 84  ILE A HB   3  
ATOM 10426 H HG12 . ILE A 1 84  ? 63.374  -9.644  -22.356 1.00 0.00 ? 84  ILE A HG12 3  
ATOM 10427 H HG13 . ILE A 1 84  ? 62.034  -9.132  -21.337 1.00 0.00 ? 84  ILE A HG13 3  
ATOM 10428 H HG21 . ILE A 1 84  ? 65.036  -6.428  -22.673 1.00 0.00 ? 84  ILE A HG21 3  
ATOM 10429 H HG22 . ILE A 1 84  ? 63.980  -7.094  -23.910 1.00 0.00 ? 84  ILE A HG22 3  
ATOM 10430 H HG23 . ILE A 1 84  ? 65.086  -8.148  -23.038 1.00 0.00 ? 84  ILE A HG23 3  
ATOM 10431 H HD11 . ILE A 1 84  ? 61.199  -7.812  -23.387 1.00 0.00 ? 84  ILE A HD11 3  
ATOM 10432 H HD12 . ILE A 1 84  ? 61.062  -9.566  -23.459 1.00 0.00 ? 84  ILE A HD12 3  
ATOM 10433 H HD13 . ILE A 1 84  ? 62.366  -8.752  -24.318 1.00 0.00 ? 84  ILE A HD13 3  
ATOM 10434 N N    . GLY A 1 85  ? 64.254  -9.926  -19.866 1.00 0.00 ? 85  GLY A N    3  
ATOM 10435 C CA   . GLY A 1 85  ? 64.968  -11.182 -19.671 1.00 0.00 ? 85  GLY A CA   3  
ATOM 10436 C C    . GLY A 1 85  ? 64.374  -11.999 -18.542 1.00 0.00 ? 85  GLY A C    3  
ATOM 10437 O O    . GLY A 1 85  ? 63.486  -11.533 -17.827 1.00 0.00 ? 85  GLY A O    3  
ATOM 10438 H H    . GLY A 1 85  ? 63.295  -9.881  -19.650 1.00 0.00 ? 85  GLY A H    3  
ATOM 10439 H HA2  . GLY A 1 85  ? 64.919  -11.758 -20.580 1.00 0.00 ? 85  GLY A HA2  3  
ATOM 10440 H HA3  . GLY A 1 85  ? 66.006  -10.978 -19.441 1.00 0.00 ? 85  GLY A HA3  3  
ATOM 10441 N N    . GLY A 1 86  ? 64.869  -13.220 -18.376 1.00 0.00 ? 86  GLY A N    3  
ATOM 10442 C CA   . GLY A 1 86  ? 64.382  -14.087 -17.323 1.00 0.00 ? 86  GLY A CA   3  
ATOM 10443 C C    . GLY A 1 86  ? 62.886  -14.319 -17.413 1.00 0.00 ? 86  GLY A C    3  
ATOM 10444 O O    . GLY A 1 86  ? 62.254  -14.736 -16.443 1.00 0.00 ? 86  GLY A O    3  
ATOM 10445 H H    . GLY A 1 86  ? 65.582  -13.538 -18.967 1.00 0.00 ? 86  GLY A H    3  
ATOM 10446 H HA2  . GLY A 1 86  ? 64.889  -15.038 -17.387 1.00 0.00 ? 86  GLY A HA2  3  
ATOM 10447 H HA3  . GLY A 1 86  ? 64.608  -13.633 -16.373 1.00 0.00 ? 86  GLY A HA3  3  
ATOM 10448 N N    . GLY A 1 87  ? 62.318  -14.047 -18.585 1.00 0.00 ? 87  GLY A N    3  
ATOM 10449 C CA   . GLY A 1 87  ? 60.891  -14.229 -18.795 1.00 0.00 ? 87  GLY A CA   3  
ATOM 10450 C C    . GLY A 1 87  ? 60.079  -13.086 -18.217 1.00 0.00 ? 87  GLY A C    3  
ATOM 10451 O O    . GLY A 1 87  ? 58.849  -13.107 -18.258 1.00 0.00 ? 87  GLY A O    3  
ATOM 10452 H H    . GLY A 1 87  ? 62.874  -13.716 -19.322 1.00 0.00 ? 87  GLY A H    3  
ATOM 10453 H HA2  . GLY A 1 87  ? 60.700  -14.291 -19.857 1.00 0.00 ? 87  GLY A HA2  3  
ATOM 10454 H HA3  . GLY A 1 87  ? 60.578  -15.154 -18.330 1.00 0.00 ? 87  GLY A HA3  3  
ATOM 10455 N N    . LEU A 1 88  ? 60.774  -12.078 -17.685 1.00 0.00 ? 88  LEU A N    3  
ATOM 10456 C CA   . LEU A 1 88  ? 60.115  -10.903 -17.096 1.00 0.00 ? 88  LEU A CA   3  
ATOM 10457 C C    . LEU A 1 88  ? 60.717  -9.621  -17.658 1.00 0.00 ? 88  LEU A C    3  
ATOM 10458 O O    . LEU A 1 88  ? 61.851  -9.612  -18.138 1.00 0.00 ? 88  LEU A O    3  
ATOM 10459 C CB   . LEU A 1 88  ? 60.296  -10.899 -15.573 1.00 0.00 ? 88  LEU A CB   3  
ATOM 10460 C CG   . LEU A 1 88  ? 59.852  -12.237 -14.968 1.00 0.00 ? 88  LEU A CG   3  
ATOM 10461 C CD1  . LEU A 1 88  ? 60.266  -12.278 -13.494 1.00 0.00 ? 88  LEU A CD1  3  
ATOM 10462 C CD2  . LEU A 1 88  ? 58.326  -12.389 -15.067 1.00 0.00 ? 88  LEU A CD2  3  
ATOM 10463 H H    . LEU A 1 88  ? 61.753  -12.121 -17.695 1.00 0.00 ? 88  LEU A H    3  
ATOM 10464 H HA   . LEU A 1 88  ? 59.059  -10.917 -17.325 1.00 0.00 ? 88  LEU A HA   3  
ATOM 10465 H HB2  . LEU A 1 88  ? 61.339  -10.734 -15.344 1.00 0.00 ? 88  LEU A HB2  3  
ATOM 10466 H HB3  . LEU A 1 88  ? 59.709  -10.099 -15.147 1.00 0.00 ? 88  LEU A HB3  3  
ATOM 10467 H HG   . LEU A 1 88  ? 60.332  -13.048 -15.496 1.00 0.00 ? 88  LEU A HG   3  
ATOM 10468 H HD11 . LEU A 1 88  ? 61.337  -12.195 -13.420 1.00 0.00 ? 88  LEU A HD11 3  
ATOM 10469 H HD12 . LEU A 1 88  ? 59.946  -13.210 -13.055 1.00 0.00 ? 88  LEU A HD12 3  
ATOM 10470 H HD13 . LEU A 1 88  ? 59.804  -11.455 -12.968 1.00 0.00 ? 88  LEU A HD13 3  
ATOM 10471 H HD21 . LEU A 1 88  ? 58.003  -13.190 -14.420 1.00 0.00 ? 88  LEU A HD21 3  
ATOM 10472 H HD22 . LEU A 1 88  ? 58.049  -12.622 -16.082 1.00 0.00 ? 88  LEU A HD22 3  
ATOM 10473 H HD23 . LEU A 1 88  ? 57.846  -11.470 -14.765 1.00 0.00 ? 88  LEU A HD23 3  
ATOM 10474 N N    . ARG A 1 89  ? 59.949  -8.532  -17.576 1.00 0.00 ? 89  ARG A N    3  
ATOM 10475 C CA   . ARG A 1 89  ? 60.399  -7.220  -18.058 1.00 0.00 ? 89  ARG A CA   3  
ATOM 10476 C C    . ARG A 1 89  ? 60.261  -6.192  -16.941 1.00 0.00 ? 89  ARG A C    3  
ATOM 10477 O O    . ARG A 1 89  ? 59.155  -5.870  -16.510 1.00 0.00 ? 89  ARG A O    3  
ATOM 10478 C CB   . ARG A 1 89  ? 59.582  -6.797  -19.294 1.00 0.00 ? 89  ARG A CB   3  
ATOM 10479 C CG   . ARG A 1 89  ? 58.124  -7.241  -19.133 1.00 0.00 ? 89  ARG A CG   3  
ATOM 10480 C CD   . ARG A 1 89  ? 57.288  -6.731  -20.317 1.00 0.00 ? 89  ARG A CD   3  
ATOM 10481 N NE   . ARG A 1 89  ? 56.040  -7.537  -20.425 1.00 0.00 ? 89  ARG A NE   3  
ATOM 10482 C CZ   . ARG A 1 89  ? 55.122  -7.208  -21.292 1.00 0.00 ? 89  ARG A CZ   3  
ATOM 10483 N NH1  . ARG A 1 89  ? 55.407  -6.381  -22.261 1.00 0.00 ? 89  ARG A NH1  3  
ATOM 10484 N NH2  . ARG A 1 89  ? 53.920  -7.704  -21.190 1.00 0.00 ? 89  ARG A NH2  3  
ATOM 10485 H H    . ARG A 1 89  ? 59.059  -8.608  -17.172 1.00 0.00 ? 89  ARG A H    3  
ATOM 10486 H HA   . ARG A 1 89  ? 61.442  -7.274  -18.332 1.00 0.00 ? 89  ARG A HA   3  
ATOM 10487 H HB2  . ARG A 1 89  ? 59.620  -5.722  -19.410 1.00 0.00 ? 89  ARG A HB2  3  
ATOM 10488 H HB3  . ARG A 1 89  ? 59.997  -7.264  -20.176 1.00 0.00 ? 89  ARG A HB3  3  
ATOM 10489 H HG2  . ARG A 1 89  ? 58.079  -8.321  -19.104 1.00 0.00 ? 89  ARG A HG2  3  
ATOM 10490 H HG3  . ARG A 1 89  ? 57.729  -6.841  -18.213 1.00 0.00 ? 89  ARG A HG3  3  
ATOM 10491 H HD2  . ARG A 1 89  ? 57.033  -5.693  -20.158 1.00 0.00 ? 89  ARG A HD2  3  
ATOM 10492 H HD3  . ARG A 1 89  ? 57.854  -6.826  -21.234 1.00 0.00 ? 89  ARG A HD3  3  
ATOM 10493 H HE   . ARG A 1 89  ? 55.908  -8.316  -19.844 1.00 0.00 ? 89  ARG A HE   3  
ATOM 10494 H HH11 . ARG A 1 89  ? 56.329  -6.001  -22.339 1.00 0.00 ? 89  ARG A HH11 3  
ATOM 10495 H HH12 . ARG A 1 89  ? 54.703  -6.130  -22.925 1.00 0.00 ? 89  ARG A HH12 3  
ATOM 10496 H HH21 . ARG A 1 89  ? 53.702  -8.338  -20.447 1.00 0.00 ? 89  ARG A HH21 3  
ATOM 10497 H HH22 . ARG A 1 89  ? 53.216  -7.452  -21.854 1.00 0.00 ? 89  ARG A HH22 3  
ATOM 10498 N N    . MET A 1 90  ? 61.404  -5.696  -16.466 1.00 0.00 ? 90  MET A N    3  
ATOM 10499 C CA   . MET A 1 90  ? 61.436  -4.716  -15.376 1.00 0.00 ? 90  MET A CA   3  
ATOM 10500 C C    . MET A 1 90  ? 61.678  -3.313  -15.918 1.00 0.00 ? 90  MET A C    3  
ATOM 10501 O O    . MET A 1 90  ? 62.768  -3.003  -16.399 1.00 0.00 ? 90  MET A O    3  
ATOM 10502 C CB   . MET A 1 90  ? 62.567  -5.067  -14.401 1.00 0.00 ? 90  MET A CB   3  
ATOM 10503 C CG   . MET A 1 90  ? 62.386  -6.489  -13.854 1.00 0.00 ? 90  MET A CG   3  
ATOM 10504 S SD   . MET A 1 90  ? 63.976  -7.090  -13.226 1.00 0.00 ? 90  MET A SD   3  
ATOM 10505 C CE   . MET A 1 90  ? 63.738  -8.846  -13.597 1.00 0.00 ? 90  MET A CE   3  
ATOM 10506 H H    . MET A 1 90  ? 62.251  -6.009  -16.847 1.00 0.00 ? 90  MET A H    3  
ATOM 10507 H HA   . MET A 1 90  ? 60.497  -4.732  -14.839 1.00 0.00 ? 90  MET A HA   3  
ATOM 10508 H HB2  . MET A 1 90  ? 63.514  -5.002  -14.918 1.00 0.00 ? 90  MET A HB2  3  
ATOM 10509 H HB3  . MET A 1 90  ? 62.562  -4.364  -13.581 1.00 0.00 ? 90  MET A HB3  3  
ATOM 10510 H HG2  . MET A 1 90  ? 61.664  -6.478  -13.049 1.00 0.00 ? 90  MET A HG2  3  
ATOM 10511 H HG3  . MET A 1 90  ? 62.038  -7.146  -14.639 1.00 0.00 ? 90  MET A HG3  3  
ATOM 10512 H HE1  . MET A 1 90  ? 62.749  -9.149  -13.282 1.00 0.00 ? 90  MET A HE1  3  
ATOM 10513 H HE2  . MET A 1 90  ? 64.478  -9.428  -13.068 1.00 0.00 ? 90  MET A HE2  3  
ATOM 10514 H HE3  . MET A 1 90  ? 63.843  -9.008  -14.659 1.00 0.00 ? 90  MET A HE3  3  
ATOM 10515 N N    . ASN A 1 91  ? 60.657  -2.463  -15.824 1.00 0.00 ? 91  ASN A N    3  
ATOM 10516 C CA   . ASN A 1 91  ? 60.761  -1.080  -16.294 1.00 0.00 ? 91  ASN A CA   3  
ATOM 10517 C C    . ASN A 1 91  ? 61.017  -0.152  -15.112 1.00 0.00 ? 91  ASN A C    3  
ATOM 10518 O O    . ASN A 1 91  ? 60.259  -0.142  -14.142 1.00 0.00 ? 91  ASN A O    3  
ATOM 10519 C CB   . ASN A 1 91  ? 59.468  -0.667  -17.000 1.00 0.00 ? 91  ASN A CB   3  
ATOM 10520 C CG   . ASN A 1 91  ? 59.248  -1.539  -18.240 1.00 0.00 ? 91  ASN A CG   3  
ATOM 10521 O OD1  . ASN A 1 91  ? 58.537  -1.154  -19.147 1.00 0.00 ? 91  ASN A OD1  3  
ATOM 10522 N ND2  . ASN A 1 91  ? 59.829  -2.706  -18.320 1.00 0.00 ? 91  ASN A ND2  3  
ATOM 10523 H H    . ASN A 1 91  ? 59.816  -2.768  -15.423 1.00 0.00 ? 91  ASN A H    3  
ATOM 10524 H HA   . ASN A 1 91  ? 61.584  -0.992  -16.992 1.00 0.00 ? 91  ASN A HA   3  
ATOM 10525 H HB2  . ASN A 1 91  ? 58.640  -0.789  -16.325 1.00 0.00 ? 91  ASN A HB2  3  
ATOM 10526 H HB3  . ASN A 1 91  ? 59.538  0.368   -17.299 1.00 0.00 ? 91  ASN A HB3  3  
ATOM 10527 H HD21 . ASN A 1 91  ? 60.403  -3.019  -17.593 1.00 0.00 ? 91  ASN A HD21 3  
ATOM 10528 H HD22 . ASN A 1 91  ? 59.690  -3.268  -19.111 1.00 0.00 ? 91  ASN A HD22 3  
ATOM 10529 N N    . PHE A 1 92  ? 62.097  0.624   -15.196 1.00 0.00 ? 92  PHE A N    3  
ATOM 10530 C CA   . PHE A 1 92  ? 62.468  1.558   -14.127 1.00 0.00 ? 92  PHE A CA   3  
ATOM 10531 C C    . PHE A 1 92  ? 62.079  2.985   -14.503 1.00 0.00 ? 92  PHE A C    3  
ATOM 10532 O O    . PHE A 1 92  ? 61.325  3.201   -15.450 1.00 0.00 ? 92  PHE A O    3  
ATOM 10533 C CB   . PHE A 1 92  ? 63.978  1.478   -13.885 1.00 0.00 ? 92  PHE A CB   3  
ATOM 10534 C CG   . PHE A 1 92  ? 64.316  0.148   -13.248 1.00 0.00 ? 92  PHE A CG   3  
ATOM 10535 C CD1  . PHE A 1 92  ? 64.384  -1.016  -14.044 1.00 0.00 ? 92  PHE A CD1  3  
ATOM 10536 C CD2  . PHE A 1 92  ? 64.556  0.066   -11.857 1.00 0.00 ? 92  PHE A CD2  3  
ATOM 10537 C CE1  . PHE A 1 92  ? 64.692  -2.260  -13.452 1.00 0.00 ? 92  PHE A CE1  3  
ATOM 10538 C CE2  . PHE A 1 92  ? 64.867  -1.178  -11.266 1.00 0.00 ? 92  PHE A CE2  3  
ATOM 10539 C CZ   . PHE A 1 92  ? 64.935  -2.341  -12.063 1.00 0.00 ? 92  PHE A CZ   3  
ATOM 10540 H H    . PHE A 1 92  ? 62.659  0.564   -15.998 1.00 0.00 ? 92  PHE A H    3  
ATOM 10541 H HA   . PHE A 1 92  ? 61.954  1.290   -13.212 1.00 0.00 ? 92  PHE A HA   3  
ATOM 10542 H HB2  . PHE A 1 92  ? 64.493  1.568   -14.829 1.00 0.00 ? 92  PHE A HB2  3  
ATOM 10543 H HB3  . PHE A 1 92  ? 64.285  2.282   -13.230 1.00 0.00 ? 92  PHE A HB3  3  
ATOM 10544 H HD1  . PHE A 1 92  ? 64.201  -0.955  -15.107 1.00 0.00 ? 92  PHE A HD1  3  
ATOM 10545 H HD2  . PHE A 1 92  ? 64.504  0.956   -11.248 1.00 0.00 ? 92  PHE A HD2  3  
ATOM 10546 H HE1  . PHE A 1 92  ? 64.744  -3.150  -14.061 1.00 0.00 ? 92  PHE A HE1  3  
ATOM 10547 H HE2  . PHE A 1 92  ? 65.052  -1.240  -10.204 1.00 0.00 ? 92  PHE A HE2  3  
ATOM 10548 H HZ   . PHE A 1 92  ? 65.106  -3.302  -11.601 1.00 0.00 ? 92  PHE A HZ   3  
ATOM 10549 N N    . GLY A 1 93  ? 62.593  3.952   -13.749 1.00 0.00 ? 93  GLY A N    3  
ATOM 10550 C CA   . GLY A 1 93  ? 62.290  5.349   -14.008 1.00 0.00 ? 93  GLY A CA   3  
ATOM 10551 C C    . GLY A 1 93  ? 62.866  6.261   -12.940 1.00 0.00 ? 93  GLY A C    3  
ATOM 10552 O O    . GLY A 1 93  ? 62.127  6.805   -12.120 1.00 0.00 ? 93  GLY A O    3  
ATOM 10553 H H    . GLY A 1 93  ? 63.184  3.719   -13.004 1.00 0.00 ? 93  GLY A H    3  
ATOM 10554 H HA2  . GLY A 1 93  ? 62.693  5.625   -14.966 1.00 0.00 ? 93  GLY A HA2  3  
ATOM 10555 H HA3  . GLY A 1 93  ? 61.218  5.474   -14.030 1.00 0.00 ? 93  GLY A HA3  3  
ATOM 10556 N N    . PHE A 1 94  ? 64.194  6.428   -12.936 1.00 0.00 ? 94  PHE A N    3  
ATOM 10557 C CA   . PHE A 1 94  ? 64.837  7.282   -11.934 1.00 0.00 ? 94  PHE A CA   3  
ATOM 10558 C C    . PHE A 1 94  ? 64.660  8.749   -12.301 1.00 0.00 ? 94  PHE A C    3  
ATOM 10559 O O    . PHE A 1 94  ? 64.602  9.102   -13.476 1.00 0.00 ? 94  PHE A O    3  
ATOM 10560 C CB   . PHE A 1 94  ? 66.339  6.901   -11.773 1.00 0.00 ? 94  PHE A CB   3  
ATOM 10561 C CG   . PHE A 1 94  ? 67.261  7.748   -12.647 1.00 0.00 ? 94  PHE A CG   3  
ATOM 10562 C CD1  . PHE A 1 94  ? 67.504  9.104   -12.320 1.00 0.00 ? 94  PHE A CD1  3  
ATOM 10563 C CD2  . PHE A 1 94  ? 67.899  7.176   -13.773 1.00 0.00 ? 94  PHE A CD2  3  
ATOM 10564 C CE1  . PHE A 1 94  ? 68.372  9.881   -13.115 1.00 0.00 ? 94  PHE A CE1  3  
ATOM 10565 C CE2  . PHE A 1 94  ? 68.767  7.958   -14.568 1.00 0.00 ? 94  PHE A CE2  3  
ATOM 10566 C CZ   . PHE A 1 94  ? 69.005  9.309   -14.238 1.00 0.00 ? 94  PHE A CZ   3  
ATOM 10567 H H    . PHE A 1 94  ? 64.744  5.967   -13.604 1.00 0.00 ? 94  PHE A H    3  
ATOM 10568 H HA   . PHE A 1 94  ? 64.343  7.120   -10.986 1.00 0.00 ? 94  PHE A HA   3  
ATOM 10569 H HB2  . PHE A 1 94  ? 66.631  7.035   -10.740 1.00 0.00 ? 94  PHE A HB2  3  
ATOM 10570 H HB3  . PHE A 1 94  ? 66.461  5.859   -12.034 1.00 0.00 ? 94  PHE A HB3  3  
ATOM 10571 H HD1  . PHE A 1 94  ? 67.022  9.546   -11.461 1.00 0.00 ? 94  PHE A HD1  3  
ATOM 10572 H HD2  . PHE A 1 94  ? 67.718  6.143   -14.026 1.00 0.00 ? 94  PHE A HD2  3  
ATOM 10573 H HE1  . PHE A 1 94  ? 68.554  10.915  -12.862 1.00 0.00 ? 94  PHE A HE1  3  
ATOM 10574 H HE2  . PHE A 1 94  ? 69.257  7.520   -15.425 1.00 0.00 ? 94  PHE A HE2  3  
ATOM 10575 H HZ   . PHE A 1 94  ? 69.616  9.922   -14.882 1.00 0.00 ? 94  PHE A HZ   3  
ATOM 10576 N N    . THR A 1 95  ? 64.576  9.601   -11.278 1.00 0.00 ? 95  THR A N    3  
ATOM 10577 C CA   . THR A 1 95  ? 64.404  11.042  -11.482 1.00 0.00 ? 95  THR A CA   3  
ATOM 10578 C C    . THR A 1 95  ? 65.324  11.825  -10.555 1.00 0.00 ? 95  THR A C    3  
ATOM 10579 O O    . THR A 1 95  ? 65.169  11.796  -9.334  1.00 0.00 ? 95  THR A O    3  
ATOM 10580 C CB   . THR A 1 95  ? 62.949  11.468  -11.195 1.00 0.00 ? 95  THR A CB   3  
ATOM 10581 O OG1  . THR A 1 95  ? 62.065  10.682  -11.980 1.00 0.00 ? 95  THR A OG1  3  
ATOM 10582 C CG2  . THR A 1 95  ? 62.749  12.957  -11.532 1.00 0.00 ? 95  THR A CG2  3  
ATOM 10583 H H    . THR A 1 95  ? 64.632  9.252   -10.364 1.00 0.00 ? 95  THR A H    3  
ATOM 10584 H HA   . THR A 1 95  ? 64.646  11.295  -12.507 1.00 0.00 ? 95  THR A HA   3  
ATOM 10585 H HB   . THR A 1 95  ? 62.731  11.307  -10.149 1.00 0.00 ? 95  THR A HB   3  
ATOM 10586 H HG1  . THR A 1 95  ? 61.246  10.578  -11.490 1.00 0.00 ? 95  THR A HG1  3  
ATOM 10587 H HG21 . THR A 1 95  ? 61.703  13.143  -11.720 1.00 0.00 ? 95  THR A HG21 3  
ATOM 10588 H HG22 . THR A 1 95  ? 63.317  13.218  -12.412 1.00 0.00 ? 95  THR A HG22 3  
ATOM 10589 H HG23 . THR A 1 95  ? 63.077  13.565  -10.701 1.00 0.00 ? 95  THR A HG23 3  
ATOM 10590 N N    . LYS A 1 96  ? 66.279  12.528  -11.149 1.00 0.00 ? 96  LYS A N    3  
ATOM 10591 C CA   . LYS A 1 96  ? 67.227  13.329  -10.386 1.00 0.00 ? 96  LYS A CA   3  
ATOM 10592 C C    . LYS A 1 96  ? 68.100  12.443  -9.495  1.00 0.00 ? 96  LYS A C    3  
ATOM 10593 O O    . LYS A 1 96  ? 68.409  12.800  -8.358  1.00 0.00 ? 96  LYS A O    3  
ATOM 10594 C CB   . LYS A 1 96  ? 66.472  14.368  -9.537  1.00 0.00 ? 96  LYS A CB   3  
ATOM 10595 C CG   . LYS A 1 96  ? 67.411  15.513  -9.120  1.00 0.00 ? 96  LYS A CG   3  
ATOM 10596 C CD   . LYS A 1 96  ? 66.587  16.666  -8.540  1.00 0.00 ? 96  LYS A CD   3  
ATOM 10597 C CE   . LYS A 1 96  ? 67.527  17.720  -7.951  1.00 0.00 ? 96  LYS A CE   3  
ATOM 10598 N NZ   . LYS A 1 96  ? 66.740  18.925  -7.562  1.00 0.00 ? 96  LYS A NZ   3  
ATOM 10599 H H    . LYS A 1 96  ? 66.346  12.511  -12.127 1.00 0.00 ? 96  LYS A H    3  
ATOM 10600 H HA   . LYS A 1 96  ? 67.866  13.845  -11.085 1.00 0.00 ? 96  LYS A HA   3  
ATOM 10601 H HB2  . LYS A 1 96  ? 65.654  14.771  -10.117 1.00 0.00 ? 96  LYS A HB2  3  
ATOM 10602 H HB3  . LYS A 1 96  ? 66.077  13.892  -8.651  1.00 0.00 ? 96  LYS A HB3  3  
ATOM 10603 H HG2  . LYS A 1 96  ? 68.105  15.158  -8.374  1.00 0.00 ? 96  LYS A HG2  3  
ATOM 10604 H HG3  . LYS A 1 96  ? 67.959  15.871  -9.979  1.00 0.00 ? 96  LYS A HG3  3  
ATOM 10605 H HD2  . LYS A 1 96  ? 65.992  17.111  -9.323  1.00 0.00 ? 96  LYS A HD2  3  
ATOM 10606 H HD3  . LYS A 1 96  ? 65.938  16.290  -7.764  1.00 0.00 ? 96  LYS A HD3  3  
ATOM 10607 H HE2  . LYS A 1 96  ? 68.020  17.315  -7.080  1.00 0.00 ? 96  LYS A HE2  3  
ATOM 10608 H HE3  . LYS A 1 96  ? 68.266  17.995  -8.688  1.00 0.00 ? 96  LYS A HE3  3  
ATOM 10609 H HZ1  . LYS A 1 96  ? 65.727  18.734  -7.692  1.00 0.00 ? 96  LYS A HZ1  3  
ATOM 10610 H HZ2  . LYS A 1 96  ? 67.023  19.729  -8.159  1.00 0.00 ? 96  LYS A HZ2  3  
ATOM 10611 H HZ3  . LYS A 1 96  ? 66.923  19.151  -6.564  1.00 0.00 ? 96  LYS A HZ3  3  
ATOM 10612 N N    . CYS A 1 97  ? 68.514  11.292  -10.036 1.00 0.00 ? 97  CYS A N    3  
ATOM 10613 C CA   . CYS A 1 97  ? 69.381  10.351  -9.310  1.00 0.00 ? 97  CYS A CA   3  
ATOM 10614 C C    . CYS A 1 97  ? 70.635  10.076  -10.146 1.00 0.00 ? 97  CYS A C    3  
ATOM 10615 O O    . CYS A 1 97  ? 70.572  10.119  -11.374 1.00 0.00 ? 97  CYS A O    3  
ATOM 10616 C CB   . CYS A 1 97  ? 68.638  9.031   -9.061  1.00 0.00 ? 97  CYS A CB   3  
ATOM 10617 S SG   . CYS A 1 97  ? 66.991  9.375   -8.400  1.00 0.00 ? 97  CYS A SG   3  
ATOM 10618 H H    . CYS A 1 97  ? 68.244  11.076  -10.952 1.00 0.00 ? 97  CYS A H    3  
ATOM 10619 H HA   . CYS A 1 97  ? 69.664  10.778  -8.360  1.00 0.00 ? 97  CYS A HA   3  
ATOM 10620 H HB2  . CYS A 1 97  ? 68.547  8.486   -9.987  1.00 0.00 ? 97  CYS A HB2  3  
ATOM 10621 H HB3  . CYS A 1 97  ? 69.191  8.437   -8.350  1.00 0.00 ? 97  CYS A HB3  3  
ATOM 10622 N N    . PRO A 1 98  ? 71.797  9.788   -9.514  1.00 0.00 ? 98  PRO A N    3  
ATOM 10623 C CA   . PRO A 1 98  ? 73.040  9.510   -10.252 1.00 0.00 ? 98  PRO A CA   3  
ATOM 10624 C C    . PRO A 1 98  ? 72.793  8.705   -11.529 1.00 0.00 ? 98  PRO A C    3  
ATOM 10625 O O    . PRO A 1 98  ? 71.878  7.883   -11.588 1.00 0.00 ? 98  PRO A O    3  
ATOM 10626 C CB   . PRO A 1 98  ? 73.876  8.716   -9.244  1.00 0.00 ? 98  PRO A CB   3  
ATOM 10627 C CG   . PRO A 1 98  ? 73.488  9.289   -7.918  1.00 0.00 ? 98  PRO A CG   3  
ATOM 10628 C CD   . PRO A 1 98  ? 72.012  9.708   -8.051  1.00 0.00 ? 98  PRO A CD   3  
ATOM 10629 H HA   . PRO A 1 98  ? 73.544  10.433  -10.489 1.00 0.00 ? 98  PRO A HA   3  
ATOM 10630 H HB2  . PRO A 1 98  ? 73.625  7.662   -9.294  1.00 0.00 ? 98  PRO A HB2  3  
ATOM 10631 H HB3  . PRO A 1 98  ? 74.932  8.861   -9.423  1.00 0.00 ? 98  PRO A HB3  3  
ATOM 10632 H HG2  . PRO A 1 98  ? 73.607  8.543   -7.139  1.00 0.00 ? 98  PRO A HG2  3  
ATOM 10633 H HG3  . PRO A 1 98  ? 74.095  10.155  -7.695  1.00 0.00 ? 98  PRO A HG3  3  
ATOM 10634 H HD2  . PRO A 1 98  ? 71.363  8.964   -7.610  1.00 0.00 ? 98  PRO A HD2  3  
ATOM 10635 H HD3  . PRO A 1 98  ? 71.848  10.674  -7.596  1.00 0.00 ? 98  PRO A HD3  3  
ATOM 10636 N N    . GLN A 1 99  ? 73.610  8.953   -12.545 1.00 0.00 ? 99  GLN A N    3  
ATOM 10637 C CA   . GLN A 1 99  ? 73.471  8.253   -13.818 1.00 0.00 ? 99  GLN A CA   3  
ATOM 10638 C C    . GLN A 1 99  ? 73.983  6.821   -13.708 1.00 0.00 ? 99  GLN A C    3  
ATOM 10639 O O    . GLN A 1 99  ? 75.186  6.591   -13.591 1.00 0.00 ? 99  GLN A O    3  
ATOM 10640 C CB   . GLN A 1 99  ? 74.256  8.988   -14.906 1.00 0.00 ? 99  GLN A CB   3  
ATOM 10641 C CG   . GLN A 1 99  ? 73.681  10.393  -15.095 1.00 0.00 ? 99  GLN A CG   3  
ATOM 10642 C CD   . GLN A 1 99  ? 74.334  11.051  -16.312 1.00 0.00 ? 99  GLN A CD   3  
ATOM 10643 O OE1  . GLN A 1 99  ? 75.196  10.471  -16.941 1.00 0.00 ? 99  GLN A OE1  3  
ATOM 10644 N NE2  . GLN A 1 99  ? 73.959  12.248  -16.672 1.00 0.00 ? 99  GLN A NE2  3  
ATOM 10645 H H    . GLN A 1 99  ? 74.319  9.623   -12.440 1.00 0.00 ? 99  GLN A H    3  
ATOM 10646 H HA   . GLN A 1 99  ? 72.428  8.232   -14.097 1.00 0.00 ? 99  GLN A HA   3  
ATOM 10647 H HB2  . GLN A 1 99  ? 75.294  9.060   -14.614 1.00 0.00 ? 99  GLN A HB2  3  
ATOM 10648 H HB3  . GLN A 1 99  ? 74.179  8.443   -15.835 1.00 0.00 ? 99  GLN A HB3  3  
ATOM 10649 H HG2  . GLN A 1 99  ? 72.613  10.328  -15.249 1.00 0.00 ? 99  GLN A HG2  3  
ATOM 10650 H HG3  . GLN A 1 99  ? 73.883  10.986  -14.215 1.00 0.00 ? 99  GLN A HG3  3  
ATOM 10651 H HE21 . GLN A 1 99  ? 73.265  12.717  -16.165 1.00 0.00 ? 99  GLN A HE21 3  
ATOM 10652 H HE22 . GLN A 1 99  ? 74.372  12.677  -17.450 1.00 0.00 ? 99  GLN A HE22 3  
ATOM 10653 N N    . ILE A 1 100 ? 73.065  5.861   -13.755 1.00 0.00 ? 100 ILE A N    3  
ATOM 10654 C CA   . ILE A 1 100 ? 73.446  4.456   -13.667 1.00 0.00 ? 100 ILE A CA   3  
ATOM 10655 C C    . ILE A 1 100 ? 74.235  4.049   -14.906 1.00 0.00 ? 100 ILE A C    3  
ATOM 10656 O O    . ILE A 1 100 ? 73.846  4.366   -16.030 1.00 0.00 ? 100 ILE A O    3  
ATOM 10657 C CB   . ILE A 1 100 ? 72.197  3.552   -13.537 1.00 0.00 ? 100 ILE A CB   3  
ATOM 10658 C CG1  . ILE A 1 100 ? 71.222  3.785   -14.737 1.00 0.00 ? 100 ILE A CG1  3  
ATOM 10659 C CG2  . ILE A 1 100 ? 71.495  3.885   -12.212 1.00 0.00 ? 100 ILE A CG2  3  
ATOM 10660 C CD1  . ILE A 1 100 ? 71.382  2.675   -15.791 1.00 0.00 ? 100 ILE A CD1  3  
ATOM 10661 H H    . ILE A 1 100 ? 72.120  6.101   -13.851 1.00 0.00 ? 100 ILE A H    3  
ATOM 10662 H HA   . ILE A 1 100 ? 74.068  4.317   -12.796 1.00 0.00 ? 100 ILE A HA   3  
ATOM 10663 H HB   . ILE A 1 100 ? 72.515  2.517   -13.510 1.00 0.00 ? 100 ILE A HB   3  
ATOM 10664 H HG12 . ILE A 1 100 ? 70.198  3.782   -14.385 1.00 0.00 ? 100 ILE A HG12 3  
ATOM 10665 H HG13 . ILE A 1 100 ? 71.427  4.742   -15.199 1.00 0.00 ? 100 ILE A HG13 3  
ATOM 10666 H HG21 . ILE A 1 100 ? 71.115  4.895   -12.250 1.00 0.00 ? 100 ILE A HG21 3  
ATOM 10667 H HG22 . ILE A 1 100 ? 72.199  3.795   -11.399 1.00 0.00 ? 100 ILE A HG22 3  
ATOM 10668 H HG23 . ILE A 1 100 ? 70.676  3.198   -12.057 1.00 0.00 ? 100 ILE A HG23 3  
ATOM 10669 H HD11 . ILE A 1 100 ? 72.428  2.453   -15.931 1.00 0.00 ? 100 ILE A HD11 3  
ATOM 10670 H HD12 . ILE A 1 100 ? 70.957  3.002   -16.728 1.00 0.00 ? 100 ILE A HD12 3  
ATOM 10671 H HD13 . ILE A 1 100 ? 70.869  1.784   -15.457 1.00 0.00 ? 100 ILE A HD13 3  
ATOM 10672 N N    . LYS A 1 101 ? 75.352  3.352   -14.693 1.00 0.00 ? 101 LYS A N    3  
ATOM 10673 C CA   . LYS A 1 101 ? 76.212  2.902   -15.796 1.00 0.00 ? 101 LYS A CA   3  
ATOM 10674 C C    . LYS A 1 101 ? 76.427  1.393   -15.726 1.00 0.00 ? 101 LYS A C    3  
ATOM 10675 O O    . LYS A 1 101 ? 76.909  0.784   -16.680 1.00 0.00 ? 101 LYS A O    3  
ATOM 10676 C CB   . LYS A 1 101 ? 77.574  3.604   -15.714 1.00 0.00 ? 101 LYS A CB   3  
ATOM 10677 C CG   . LYS A 1 101 ? 77.398  5.135   -15.763 1.00 0.00 ? 101 LYS A CG   3  
ATOM 10678 C CD   . LYS A 1 101 ? 77.180  5.611   -17.208 1.00 0.00 ? 101 LYS A CD   3  
ATOM 10679 C CE   . LYS A 1 101 ? 77.259  7.139   -17.255 1.00 0.00 ? 101 LYS A CE   3  
ATOM 10680 N NZ   . LYS A 1 101 ? 78.659  7.574   -16.986 1.00 0.00 ? 101 LYS A NZ   3  
ATOM 10681 H H    . LYS A 1 101 ? 75.610  3.137   -13.772 1.00 0.00 ? 101 LYS A H    3  
ATOM 10682 H HA   . LYS A 1 101 ? 75.753  3.141   -16.746 1.00 0.00 ? 101 LYS A HA   3  
ATOM 10683 H HB2  . LYS A 1 101 ? 78.053  3.330   -14.783 1.00 0.00 ? 101 LYS A HB2  3  
ATOM 10684 H HB3  . LYS A 1 101 ? 78.193  3.282   -16.536 1.00 0.00 ? 101 LYS A HB3  3  
ATOM 10685 H HG2  . LYS A 1 101 ? 76.548  5.421   -15.162 1.00 0.00 ? 101 LYS A HG2  3  
ATOM 10686 H HG3  . LYS A 1 101 ? 78.286  5.607   -15.366 1.00 0.00 ? 101 LYS A HG3  3  
ATOM 10687 H HD2  . LYS A 1 101 ? 77.944  5.195   -17.849 1.00 0.00 ? 101 LYS A HD2  3  
ATOM 10688 H HD3  . LYS A 1 101 ? 76.208  5.295   -17.551 1.00 0.00 ? 101 LYS A HD3  3  
ATOM 10689 H HE2  . LYS A 1 101 ? 76.958  7.484   -18.234 1.00 0.00 ? 101 LYS A HE2  3  
ATOM 10690 H HE3  . LYS A 1 101 ? 76.601  7.556   -16.508 1.00 0.00 ? 101 LYS A HE3  3  
ATOM 10691 H HZ1  . LYS A 1 101 ? 78.686  8.606   -16.872 1.00 0.00 ? 101 LYS A HZ1  3  
ATOM 10692 H HZ2  . LYS A 1 101 ? 79.267  7.295   -17.782 1.00 0.00 ? 101 LYS A HZ2  3  
ATOM 10693 H HZ3  . LYS A 1 101 ? 79.000  7.123   -16.113 1.00 0.00 ? 101 LYS A HZ3  3  
ATOM 10694 N N    . SER A 1 102 ? 76.073  0.794   -14.587 1.00 0.00 ? 102 SER A N    3  
ATOM 10695 C CA   . SER A 1 102 ? 76.236  -0.651  -14.392 1.00 0.00 ? 102 SER A CA   3  
ATOM 10696 C C    . SER A 1 102 ? 74.890  -1.364  -14.469 1.00 0.00 ? 102 SER A C    3  
ATOM 10697 O O    . SER A 1 102 ? 73.974  -1.070  -13.702 1.00 0.00 ? 102 SER A O    3  
ATOM 10698 C CB   . SER A 1 102 ? 76.866  -0.915  -13.025 1.00 0.00 ? 102 SER A CB   3  
ATOM 10699 O OG   . SER A 1 102 ? 77.075  -2.313  -12.866 1.00 0.00 ? 102 SER A OG   3  
ATOM 10700 H H    . SER A 1 102 ? 75.697  1.331   -13.858 1.00 0.00 ? 102 SER A H    3  
ATOM 10701 H HA   . SER A 1 102 ? 76.889  -1.054  -15.156 1.00 0.00 ? 102 SER A HA   3  
ATOM 10702 H HB2  . SER A 1 102 ? 77.812  -0.405  -12.957 1.00 0.00 ? 102 SER A HB2  3  
ATOM 10703 H HB3  . SER A 1 102 ? 76.205  -0.549  -12.249 1.00 0.00 ? 102 SER A HB3  3  
ATOM 10704 H HG   . SER A 1 102 ? 77.706  -2.596  -13.532 1.00 0.00 ? 102 SER A HG   3  
ATOM 10705 N N    . ILE A 1 103 ? 74.783  -2.313  -15.401 1.00 0.00 ? 103 ILE A N    3  
ATOM 10706 C CA   . ILE A 1 103 ? 73.553  -3.087  -15.586 1.00 0.00 ? 103 ILE A CA   3  
ATOM 10707 C C    . ILE A 1 103 ? 73.899  -4.566  -15.752 1.00 0.00 ? 103 ILE A C    3  
ATOM 10708 O O    . ILE A 1 103 ? 74.646  -4.938  -16.657 1.00 0.00 ? 103 ILE A O    3  
ATOM 10709 C CB   . ILE A 1 103 ? 72.788  -2.603  -16.840 1.00 0.00 ? 103 ILE A CB   3  
ATOM 10710 C CG1  . ILE A 1 103 ? 72.774  -1.068  -16.855 1.00 0.00 ? 103 ILE A CG1  3  
ATOM 10711 C CG2  . ILE A 1 103 ? 71.350  -3.135  -16.811 1.00 0.00 ? 103 ILE A CG2  3  
ATOM 10712 C CD1  . ILE A 1 103 ? 71.938  -0.560  -18.037 1.00 0.00 ? 103 ILE A CD1  3  
ATOM 10713 H H    . ILE A 1 103 ? 75.552  -2.500  -15.979 1.00 0.00 ? 103 ILE A H    3  
ATOM 10714 H HA   . ILE A 1 103 ? 72.915  -2.974  -14.718 1.00 0.00 ? 103 ILE A HA   3  
ATOM 10715 H HB   . ILE A 1 103 ? 73.285  -2.966  -17.730 1.00 0.00 ? 103 ILE A HB   3  
ATOM 10716 H HG12 . ILE A 1 103 ? 72.346  -0.706  -15.932 1.00 0.00 ? 103 ILE A HG12 3  
ATOM 10717 H HG13 . ILE A 1 103 ? 73.786  -0.702  -16.950 1.00 0.00 ? 103 ILE A HG13 3  
ATOM 10718 H HG21 . ILE A 1 103 ? 70.903  -3.018  -17.788 1.00 0.00 ? 103 ILE A HG21 3  
ATOM 10719 H HG22 . ILE A 1 103 ? 70.775  -2.580  -16.083 1.00 0.00 ? 103 ILE A HG22 3  
ATOM 10720 H HG23 . ILE A 1 103 ? 71.356  -4.181  -16.542 1.00 0.00 ? 103 ILE A HG23 3  
ATOM 10721 H HD11 . ILE A 1 103 ? 72.168  -1.136  -18.922 1.00 0.00 ? 103 ILE A HD11 3  
ATOM 10722 H HD12 . ILE A 1 103 ? 72.169  0.481   -18.219 1.00 0.00 ? 103 ILE A HD12 3  
ATOM 10723 H HD13 . ILE A 1 103 ? 70.888  -0.657  -17.805 1.00 0.00 ? 103 ILE A HD13 3  
ATOM 10724 N N    . SER A 1 104 ? 73.366  -5.406  -14.863 1.00 0.00 ? 104 SER A N    3  
ATOM 10725 C CA   . SER A 1 104 ? 73.637  -6.847  -14.905 1.00 0.00 ? 104 SER A CA   3  
ATOM 10726 C C    . SER A 1 104 ? 72.366  -7.650  -14.652 1.00 0.00 ? 104 SER A C    3  
ATOM 10727 O O    . SER A 1 104 ? 71.297  -7.086  -14.417 1.00 0.00 ? 104 SER A O    3  
ATOM 10728 C CB   . SER A 1 104 ? 74.676  -7.205  -13.840 1.00 0.00 ? 104 SER A CB   3  
ATOM 10729 O OG   . SER A 1 104 ? 74.678  -8.611  -13.639 1.00 0.00 ? 104 SER A OG   3  
ATOM 10730 H H    . SER A 1 104 ? 72.787  -5.048  -14.159 1.00 0.00 ? 104 SER A H    3  
ATOM 10731 H HA   . SER A 1 104 ? 74.029  -7.117  -15.876 1.00 0.00 ? 104 SER A HA   3  
ATOM 10732 H HB2  . SER A 1 104 ? 75.654  -6.891  -14.166 1.00 0.00 ? 104 SER A HB2  3  
ATOM 10733 H HB3  . SER A 1 104 ? 74.430  -6.700  -12.916 1.00 0.00 ? 104 SER A HB3  3  
ATOM 10734 H HG   . SER A 1 104 ? 74.458  -8.780  -12.719 1.00 0.00 ? 104 SER A HG   3  
ATOM 10735 N N    . GLU A 1 105 ? 72.494  -8.973  -14.705 1.00 0.00 ? 105 GLU A N    3  
ATOM 10736 C CA   . GLU A 1 105 ? 71.356  -9.860  -14.483 1.00 0.00 ? 105 GLU A CA   3  
ATOM 10737 C C    . GLU A 1 105 ? 71.837  -11.272 -14.152 1.00 0.00 ? 105 GLU A C    3  
ATOM 10738 O O    . GLU A 1 105 ? 72.939  -11.667 -14.533 1.00 0.00 ? 105 GLU A O    3  
ATOM 10739 C CB   . GLU A 1 105 ? 70.468  -9.891  -15.732 1.00 0.00 ? 105 GLU A CB   3  
ATOM 10740 C CG   . GLU A 1 105 ? 69.119  -10.534 -15.394 1.00 0.00 ? 105 GLU A CG   3  
ATOM 10741 C CD   . GLU A 1 105 ? 68.214  -10.499 -16.626 1.00 0.00 ? 105 GLU A CD   3  
ATOM 10742 O OE1  . GLU A 1 105 ? 68.373  -9.595  -17.429 1.00 0.00 ? 105 GLU A OE1  3  
ATOM 10743 O OE2  . GLU A 1 105 ? 67.376  -11.379 -16.746 1.00 0.00 ? 105 GLU A OE2  3  
ATOM 10744 H H    . GLU A 1 105 ? 73.374  -9.362  -14.897 1.00 0.00 ? 105 GLU A H    3  
ATOM 10745 H HA   . GLU A 1 105 ? 70.778  -9.487  -13.651 1.00 0.00 ? 105 GLU A HA   3  
ATOM 10746 H HB2  . GLU A 1 105 ? 70.307  -8.882  -16.081 1.00 0.00 ? 105 GLU A HB2  3  
ATOM 10747 H HB3  . GLU A 1 105 ? 70.956  -10.465 -16.506 1.00 0.00 ? 105 GLU A HB3  3  
ATOM 10748 H HG2  . GLU A 1 105 ? 69.273  -11.558 -15.087 1.00 0.00 ? 105 GLU A HG2  3  
ATOM 10749 H HG3  . GLU A 1 105 ? 68.651  -9.984  -14.591 1.00 0.00 ? 105 GLU A HG3  3  
ATOM 10750 N N    . SER A 1 106 ? 71.003  -12.023 -13.435 1.00 0.00 ? 106 SER A N    3  
ATOM 10751 C CA   . SER A 1 106 ? 71.347  -13.392 -13.045 1.00 0.00 ? 106 SER A CA   3  
ATOM 10752 C C    . SER A 1 106 ? 70.081  -14.220 -12.821 1.00 0.00 ? 106 SER A C    3  
ATOM 10753 O O    . SER A 1 106 ? 69.045  -13.694 -12.417 1.00 0.00 ? 106 SER A O    3  
ATOM 10754 C CB   . SER A 1 106 ? 72.189  -13.363 -11.753 1.00 0.00 ? 106 SER A CB   3  
ATOM 10755 O OG   . SER A 1 106 ? 71.387  -13.750 -10.641 1.00 0.00 ? 106 SER A OG   3  
ATOM 10756 H H    . SER A 1 106 ? 70.145  -11.647 -13.159 1.00 0.00 ? 106 SER A H    3  
ATOM 10757 H HA   . SER A 1 106 ? 71.925  -13.852 -13.837 1.00 0.00 ? 106 SER A HA   3  
ATOM 10758 H HB2  . SER A 1 106 ? 73.023  -14.042 -11.835 1.00 0.00 ? 106 SER A HB2  3  
ATOM 10759 H HB3  . SER A 1 106 ? 72.561  -12.360 -11.599 1.00 0.00 ? 106 SER A HB3  3  
ATOM 10760 H HG   . SER A 1 106 ? 71.896  -13.596 -9.841  1.00 0.00 ? 106 SER A HG   3  
ATOM 10761 N N    . ALA A 1 107 ? 70.182  -15.526 -13.077 1.00 0.00 ? 107 ALA A N    3  
ATOM 10762 C CA   . ALA A 1 107 ? 69.053  -16.445 -12.894 1.00 0.00 ? 107 ALA A CA   3  
ATOM 10763 C C    . ALA A 1 107 ? 69.511  -17.684 -12.129 1.00 0.00 ? 107 ALA A C    3  
ATOM 10764 O O    . ALA A 1 107 ? 70.548  -18.270 -12.439 1.00 0.00 ? 107 ALA A O    3  
ATOM 10765 C CB   . ALA A 1 107 ? 68.484  -16.843 -14.253 1.00 0.00 ? 107 ALA A CB   3  
ATOM 10766 H H    . ALA A 1 107 ? 71.040  -15.884 -13.389 1.00 0.00 ? 107 ALA A H    3  
ATOM 10767 H HA   . ALA A 1 107 ? 68.276  -15.959 -12.320 1.00 0.00 ? 107 ALA A HA   3  
ATOM 10768 H HB1  . ALA A 1 107 ? 69.295  -17.064 -14.931 1.00 0.00 ? 107 ALA A HB1  3  
ATOM 10769 H HB2  . ALA A 1 107 ? 67.896  -16.028 -14.648 1.00 0.00 ? 107 ALA A HB2  3  
ATOM 10770 H HB3  . ALA A 1 107 ? 67.856  -17.717 -14.146 1.00 0.00 ? 107 ALA A HB3  3  
ATOM 10771 N N    . ASP A 1 108 ? 68.726  -18.073 -11.126 1.00 0.00 ? 108 ASP A N    3  
ATOM 10772 C CA   . ASP A 1 108 ? 69.049  -19.243 -10.307 1.00 0.00 ? 108 ASP A CA   3  
ATOM 10773 C C    . ASP A 1 108 ? 67.771  -19.915 -9.820  1.00 0.00 ? 108 ASP A C    3  
ATOM 10774 O O    . ASP A 1 108 ? 67.005  -19.334 -9.052  1.00 0.00 ? 108 ASP A O    3  
ATOM 10775 C CB   . ASP A 1 108 ? 69.893  -18.819 -9.103  1.00 0.00 ? 108 ASP A CB   3  
ATOM 10776 C CG   . ASP A 1 108 ? 71.205  -18.203 -9.591  1.00 0.00 ? 108 ASP A CG   3  
ATOM 10777 O OD1  . ASP A 1 108 ? 71.204  -17.021 -9.893  1.00 0.00 ? 108 ASP A OD1  3  
ATOM 10778 O OD2  . ASP A 1 108 ? 72.188  -18.923 -9.653  1.00 0.00 ? 108 ASP A OD2  3  
ATOM 10779 H H    . ASP A 1 108 ? 67.915  -17.562 -10.930 1.00 0.00 ? 108 ASP A H    3  
ATOM 10780 H HA   . ASP A 1 108 ? 69.613  -19.954 -10.896 1.00 0.00 ? 108 ASP A HA   3  
ATOM 10781 H HB2  . ASP A 1 108 ? 69.347  -18.093 -8.519  1.00 0.00 ? 108 ASP A HB2  3  
ATOM 10782 H HB3  . ASP A 1 108 ? 70.108  -19.683 -8.493  1.00 0.00 ? 108 ASP A HB3  3  
ATOM 10783 N N    . GLY A 1 109 ? 67.547  -21.143 -10.274 1.00 0.00 ? 109 GLY A N    3  
ATOM 10784 C CA   . GLY A 1 109 ? 66.363  -21.884 -9.884  1.00 0.00 ? 109 GLY A CA   3  
ATOM 10785 C C    . GLY A 1 109 ? 65.113  -21.344 -10.548 1.00 0.00 ? 109 GLY A C    3  
ATOM 10786 O O    . GLY A 1 109 ? 64.880  -21.574 -11.735 1.00 0.00 ? 109 GLY A O    3  
ATOM 10787 H H    . GLY A 1 109 ? 68.192  -21.555 -10.886 1.00 0.00 ? 109 GLY A H    3  
ATOM 10788 H HA2  . GLY A 1 109 ? 66.489  -22.920 -10.163 1.00 0.00 ? 109 GLY A HA2  3  
ATOM 10789 H HA3  . GLY A 1 109 ? 66.246  -21.822 -8.812  1.00 0.00 ? 109 GLY A HA3  3  
ATOM 10790 N N    . ASN A 1 110 ? 64.303  -20.618 -9.776  1.00 0.00 ? 110 ASN A N    3  
ATOM 10791 C CA   . ASN A 1 110 ? 63.060  -20.033 -10.286 1.00 0.00 ? 110 ASN A CA   3  
ATOM 10792 C C    . ASN A 1 110 ? 62.991  -18.551 -9.940  1.00 0.00 ? 110 ASN A C    3  
ATOM 10793 O O    . ASN A 1 110 ? 61.908  -17.978 -9.844  1.00 0.00 ? 110 ASN A O    3  
ATOM 10794 C CB   . ASN A 1 110 ? 61.857  -20.755 -9.675  1.00 0.00 ? 110 ASN A CB   3  
ATOM 10795 C CG   . ASN A 1 110 ? 61.882  -20.591 -8.155  1.00 0.00 ? 110 ASN A CG   3  
ATOM 10796 O OD1  . ASN A 1 110 ? 61.977  -19.489 -7.653  1.00 0.00 ? 110 ASN A OD1  3  
ATOM 10797 N ND2  . ASN A 1 110 ? 61.798  -21.649 -7.396  1.00 0.00 ? 110 ASN A ND2  3  
ATOM 10798 H H    . ASN A 1 110 ? 64.547  -20.471 -8.838  1.00 0.00 ? 110 ASN A H    3  
ATOM 10799 H HA   . ASN A 1 110 ? 63.017  -20.138 -11.364 1.00 0.00 ? 110 ASN A HA   3  
ATOM 10800 H HB2  . ASN A 1 110 ? 60.945  -20.331 -10.070 1.00 0.00 ? 110 ASN A HB2  3  
ATOM 10801 H HB3  . ASN A 1 110 ? 61.903  -21.805 -9.923  1.00 0.00 ? 110 ASN A HB3  3  
ATOM 10802 H HD21 . ASN A 1 110 ? 61.722  -22.538 -7.801  1.00 0.00 ? 110 ASN A HD21 3  
ATOM 10803 H HD22 . ASN A 1 110 ? 61.813  -21.555 -6.420  1.00 0.00 ? 110 ASN A HD22 3  
ATOM 10804 N N    . THR A 1 111 ? 64.161  -17.936 -9.744  1.00 0.00 ? 111 THR A N    3  
ATOM 10805 C CA   . THR A 1 111 ? 64.238  -16.511 -9.401  1.00 0.00 ? 111 THR A CA   3  
ATOM 10806 C C    . THR A 1 111 ? 65.273  -15.806 -10.267 1.00 0.00 ? 111 THR A C    3  
ATOM 10807 O O    . THR A 1 111 ? 66.162  -16.441 -10.835 1.00 0.00 ? 111 THR A O    3  
ATOM 10808 C CB   . THR A 1 111 ? 64.621  -16.318 -7.921  1.00 0.00 ? 111 THR A CB   3  
ATOM 10809 O OG1  . THR A 1 111 ? 65.051  -14.980 -7.716  1.00 0.00 ? 111 THR A OG1  3  
ATOM 10810 C CG2  . THR A 1 111 ? 65.749  -17.281 -7.553  1.00 0.00 ? 111 THR A CG2  3  
ATOM 10811 H H    . THR A 1 111 ? 64.990  -18.453 -9.825  1.00 0.00 ? 111 THR A H    3  
ATOM 10812 H HA   . THR A 1 111 ? 63.281  -16.045 -9.575  1.00 0.00 ? 111 THR A HA   3  
ATOM 10813 H HB   . THR A 1 111 ? 63.763  -16.520 -7.297  1.00 0.00 ? 111 THR A HB   3  
ATOM 10814 H HG1  . THR A 1 111 ? 65.698  -14.982 -7.007  1.00 0.00 ? 111 THR A HG1  3  
ATOM 10815 H HG21 . THR A 1 111 ? 66.579  -17.137 -8.227  1.00 0.00 ? 111 THR A HG21 3  
ATOM 10816 H HG22 . THR A 1 111 ? 65.394  -18.298 -7.631  1.00 0.00 ? 111 THR A HG22 3  
ATOM 10817 H HG23 . THR A 1 111 ? 66.071  -17.089 -6.540  1.00 0.00 ? 111 THR A HG23 3  
ATOM 10818 N N    . VAL A 1 112 ? 65.145  -14.480 -10.368 1.00 0.00 ? 112 VAL A N    3  
ATOM 10819 C CA   . VAL A 1 112 ? 66.068  -13.673 -11.175 1.00 0.00 ? 112 VAL A CA   3  
ATOM 10820 C C    . VAL A 1 112 ? 66.471  -12.408 -10.428 1.00 0.00 ? 112 VAL A C    3  
ATOM 10821 O O    . VAL A 1 112 ? 65.644  -11.759 -9.788  1.00 0.00 ? 112 VAL A O    3  
ATOM 10822 C CB   . VAL A 1 112 ? 65.424  -13.273 -12.516 1.00 0.00 ? 112 VAL A CB   3  
ATOM 10823 C CG1  . VAL A 1 112 ? 65.006  -14.536 -13.271 1.00 0.00 ? 112 VAL A CG1  3  
ATOM 10824 C CG2  . VAL A 1 112 ? 64.188  -12.406 -12.264 1.00 0.00 ? 112 VAL A CG2  3  
ATOM 10825 H H    . VAL A 1 112 ? 64.415  -14.037 -9.890  1.00 0.00 ? 112 VAL A H    3  
ATOM 10826 H HA   . VAL A 1 112 ? 66.962  -14.244 -11.380 1.00 0.00 ? 112 VAL A HA   3  
ATOM 10827 H HB   . VAL A 1 112 ? 66.141  -12.722 -13.108 1.00 0.00 ? 112 VAL A HB   3  
ATOM 10828 H HG11 . VAL A 1 112 ? 65.885  -15.090 -13.562 1.00 0.00 ? 112 VAL A HG11 3  
ATOM 10829 H HG12 . VAL A 1 112 ? 64.447  -14.261 -14.148 1.00 0.00 ? 112 VAL A HG12 3  
ATOM 10830 H HG13 . VAL A 1 112 ? 64.389  -15.147 -12.634 1.00 0.00 ? 112 VAL A HG13 3  
ATOM 10831 H HG21 . VAL A 1 112 ? 64.487  -11.458 -11.845 1.00 0.00 ? 112 VAL A HG21 3  
ATOM 10832 H HG22 . VAL A 1 112 ? 63.526  -12.912 -11.577 1.00 0.00 ? 112 VAL A HG22 3  
ATOM 10833 H HG23 . VAL A 1 112 ? 63.676  -12.235 -13.198 1.00 0.00 ? 112 VAL A HG23 3  
ATOM 10834 N N    . ASN A 1 113 ? 67.758  -12.067 -10.513 1.00 0.00 ? 113 ASN A N    3  
ATOM 10835 C CA   . ASN A 1 113 ? 68.299  -10.877 -9.846  1.00 0.00 ? 113 ASN A CA   3  
ATOM 10836 C C    . ASN A 1 113 ? 68.830  -9.882  -10.874 1.00 0.00 ? 113 ASN A C    3  
ATOM 10837 O O    . ASN A 1 113 ? 69.337  -10.273 -11.924 1.00 0.00 ? 113 ASN A O    3  
ATOM 10838 C CB   . ASN A 1 113 ? 69.434  -11.291 -8.905  1.00 0.00 ? 113 ASN A CB   3  
ATOM 10839 C CG   . ASN A 1 113 ? 70.005  -10.054 -8.208  1.00 0.00 ? 113 ASN A CG   3  
ATOM 10840 O OD1  . ASN A 1 113 ? 71.112  -10.080 -7.709  1.00 0.00 ? 113 ASN A OD1  3  
ATOM 10841 N ND2  . ASN A 1 113 ? 69.290  -8.964  -8.150  1.00 0.00 ? 113 ASN A ND2  3  
ATOM 10842 H H    . ASN A 1 113 ? 68.364  -12.635 -11.035 1.00 0.00 ? 113 ASN A H    3  
ATOM 10843 H HA   . ASN A 1 113 ? 67.525  -10.397 -9.263  1.00 0.00 ? 113 ASN A HA   3  
ATOM 10844 H HB2  . ASN A 1 113 ? 69.054  -11.979 -8.164  1.00 0.00 ? 113 ASN A HB2  3  
ATOM 10845 H HB3  . ASN A 1 113 ? 70.215  -11.773 -9.475  1.00 0.00 ? 113 ASN A HB3  3  
ATOM 10846 H HD21 . ASN A 1 113 ? 68.397  -8.943  -8.552  1.00 0.00 ? 113 ASN A HD21 3  
ATOM 10847 H HD22 . ASN A 1 113 ? 69.647  -8.167  -7.706  1.00 0.00 ? 113 ASN A HD22 3  
ATOM 10848 N N    . ALA A 1 114 ? 68.713  -8.591  -10.557 1.00 0.00 ? 114 ALA A N    3  
ATOM 10849 C CA   . ALA A 1 114 ? 69.186  -7.528  -11.449 1.00 0.00 ? 114 ALA A CA   3  
ATOM 10850 C C    . ALA A 1 114 ? 69.774  -6.386  -10.628 1.00 0.00 ? 114 ALA A C    3  
ATOM 10851 O O    . ALA A 1 114 ? 69.150  -5.910  -9.679  1.00 0.00 ? 114 ALA A O    3  
ATOM 10852 C CB   . ALA A 1 114 ? 68.034  -7.016  -12.305 1.00 0.00 ? 114 ALA A CB   3  
ATOM 10853 H H    . ALA A 1 114 ? 68.301  -8.347  -9.702  1.00 0.00 ? 114 ALA A H    3  
ATOM 10854 H HA   . ALA A 1 114 ? 69.958  -7.916  -12.098 1.00 0.00 ? 114 ALA A HA   3  
ATOM 10855 H HB1  . ALA A 1 114 ? 68.425  -6.419  -13.114 1.00 0.00 ? 114 ALA A HB1  3  
ATOM 10856 H HB2  . ALA A 1 114 ? 67.372  -6.415  -11.701 1.00 0.00 ? 114 ALA A HB2  3  
ATOM 10857 H HB3  . ALA A 1 114 ? 67.488  -7.856  -12.710 1.00 0.00 ? 114 ALA A HB3  3  
ATOM 10858 N N    . ARG A 1 115 ? 70.987  -5.959  -10.991 1.00 0.00 ? 115 ARG A N    3  
ATOM 10859 C CA   . ARG A 1 115 ? 71.673  -4.876  -10.276 1.00 0.00 ? 115 ARG A CA   3  
ATOM 10860 C C    . ARG A 1 115 ? 71.867  -3.655  -11.167 1.00 0.00 ? 115 ARG A C    3  
ATOM 10861 O O    . ARG A 1 115 ? 72.617  -3.692  -12.143 1.00 0.00 ? 115 ARG A O    3  
ATOM 10862 C CB   . ARG A 1 115 ? 73.044  -5.360  -9.796  1.00 0.00 ? 115 ARG A CB   3  
ATOM 10863 C CG   . ARG A 1 115 ? 73.748  -4.236  -9.027  1.00 0.00 ? 115 ARG A CG   3  
ATOM 10864 C CD   . ARG A 1 115 ? 74.970  -4.798  -8.297  1.00 0.00 ? 115 ARG A CD   3  
ATOM 10865 N NE   . ARG A 1 115 ? 75.773  -3.674  -7.739  1.00 0.00 ? 115 ARG A NE   3  
ATOM 10866 C CZ   . ARG A 1 115 ? 76.744  -3.917  -6.902  1.00 0.00 ? 115 ARG A CZ   3  
ATOM 10867 N NH1  . ARG A 1 115 ? 76.687  -4.960  -6.120  1.00 0.00 ? 115 ARG A NH1  3  
ATOM 10868 N NH2  . ARG A 1 115 ? 77.774  -3.116  -6.846  1.00 0.00 ? 115 ARG A NH2  3  
ATOM 10869 H H    . ARG A 1 115 ? 71.434  -6.386  -11.751 1.00 0.00 ? 115 ARG A H    3  
ATOM 10870 H HA   . ARG A 1 115 ? 71.094  -4.581  -9.410  1.00 0.00 ? 115 ARG A HA   3  
ATOM 10871 H HB2  . ARG A 1 115 ? 72.915  -6.216  -9.149  1.00 0.00 ? 115 ARG A HB2  3  
ATOM 10872 H HB3  . ARG A 1 115 ? 73.643  -5.638  -10.650 1.00 0.00 ? 115 ARG A HB3  3  
ATOM 10873 H HG2  . ARG A 1 115 ? 74.065  -3.470  -9.719  1.00 0.00 ? 115 ARG A HG2  3  
ATOM 10874 H HG3  . ARG A 1 115 ? 73.067  -3.810  -8.307  1.00 0.00 ? 115 ARG A HG3  3  
ATOM 10875 H HD2  . ARG A 1 115 ? 74.645  -5.443  -7.494  1.00 0.00 ? 115 ARG A HD2  3  
ATOM 10876 H HD3  . ARG A 1 115 ? 75.576  -5.363  -8.991  1.00 0.00 ? 115 ARG A HD3  3  
ATOM 10877 H HE   . ARG A 1 115 ? 75.570  -2.751  -7.999  1.00 0.00 ? 115 ARG A HE   3  
ATOM 10878 H HH11 . ARG A 1 115 ? 75.899  -5.574  -6.162  1.00 0.00 ? 115 ARG A HH11 3  
ATOM 10879 H HH12 . ARG A 1 115 ? 77.432  -5.146  -5.479  1.00 0.00 ? 115 ARG A HH12 3  
ATOM 10880 H HH21 . ARG A 1 115 ? 77.817  -2.316  -7.445  1.00 0.00 ? 115 ARG A HH21 3  
ATOM 10881 H HH22 . ARG A 1 115 ? 78.517  -3.301  -6.206  1.00 0.00 ? 115 ARG A HH22 3  
ATOM 10882 N N    . LEU A 1 116 ? 71.215  -2.556  -10.788 1.00 0.00 ? 116 LEU A N    3  
ATOM 10883 C CA   . LEU A 1 116 ? 71.332  -1.287  -11.507 1.00 0.00 ? 116 LEU A CA   3  
ATOM 10884 C C    . LEU A 1 116 ? 71.978  -0.284  -10.561 1.00 0.00 ? 116 LEU A C    3  
ATOM 10885 O O    . LEU A 1 116 ? 71.448  -0.028  -9.479  1.00 0.00 ? 116 LEU A O    3  
ATOM 10886 C CB   . LEU A 1 116 ? 69.952  -0.766  -11.942 1.00 0.00 ? 116 LEU A CB   3  
ATOM 10887 C CG   . LEU A 1 116 ? 69.118  -1.892  -12.591 1.00 0.00 ? 116 LEU A CG   3  
ATOM 10888 C CD1  . LEU A 1 116 ? 68.631  -2.925  -11.527 1.00 0.00 ? 116 LEU A CD1  3  
ATOM 10889 C CD2  . LEU A 1 116 ? 67.908  -1.255  -13.296 1.00 0.00 ? 116 LEU A CD2  3  
ATOM 10890 H H    . LEU A 1 116 ? 70.664  -2.588  -9.978  1.00 0.00 ? 116 LEU A H    3  
ATOM 10891 H HA   . LEU A 1 116 ? 71.963  -1.408  -12.380 1.00 0.00 ? 116 LEU A HA   3  
ATOM 10892 H HB2  . LEU A 1 116 ? 69.423  -0.373  -11.087 1.00 0.00 ? 116 LEU A HB2  3  
ATOM 10893 H HB3  . LEU A 1 116 ? 70.093  0.028   -12.662 1.00 0.00 ? 116 LEU A HB3  3  
ATOM 10894 H HG   . LEU A 1 116 ? 69.728  -2.398  -13.329 1.00 0.00 ? 116 LEU A HG   3  
ATOM 10895 H HD11 . LEU A 1 116 ? 68.646  -2.485  -10.539 1.00 0.00 ? 116 LEU A HD11 3  
ATOM 10896 H HD12 . LEU A 1 116 ? 69.278  -3.790  -11.535 1.00 0.00 ? 116 LEU A HD12 3  
ATOM 10897 H HD13 . LEU A 1 116 ? 67.623  -3.249  -11.754 1.00 0.00 ? 116 LEU A HD13 3  
ATOM 10898 H HD21 . LEU A 1 116 ? 67.317  -0.711  -12.575 1.00 0.00 ? 116 LEU A HD21 3  
ATOM 10899 H HD22 . LEU A 1 116 ? 67.304  -2.027  -13.747 1.00 0.00 ? 116 LEU A HD22 3  
ATOM 10900 H HD23 . LEU A 1 116 ? 68.255  -0.577  -14.062 1.00 0.00 ? 116 LEU A HD23 3  
ATOM 10901 N N    . SER A 1 117 ? 73.128  0.268   -10.937 1.00 0.00 ? 117 SER A N    3  
ATOM 10902 C CA   . SER A 1 117 ? 73.805  1.214   -10.053 1.00 0.00 ? 117 SER A CA   3  
ATOM 10903 C C    . SER A 1 117 ? 74.783  2.107   -10.806 1.00 0.00 ? 117 SER A C    3  
ATOM 10904 O O    . SER A 1 117 ? 74.943  2.000   -12.021 1.00 0.00 ? 117 SER A O    3  
ATOM 10905 C CB   . SER A 1 117 ? 74.566  0.439   -8.972  1.00 0.00 ? 117 SER A CB   3  
ATOM 10906 O OG   . SER A 1 117 ? 74.919  1.326   -7.918  1.00 0.00 ? 117 SER A OG   3  
ATOM 10907 H H    . SER A 1 117 ? 73.530  0.028   -11.797 1.00 0.00 ? 117 SER A H    3  
ATOM 10908 H HA   . SER A 1 117 ? 73.069  1.839   -9.575  1.00 0.00 ? 117 SER A HA   3  
ATOM 10909 H HB2  . SER A 1 117 ? 73.943  -0.347  -8.582  1.00 0.00 ? 117 SER A HB2  3  
ATOM 10910 H HB3  . SER A 1 117 ? 75.460  0.002   -9.402  1.00 0.00 ? 117 SER A HB3  3  
ATOM 10911 H HG   . SER A 1 117 ? 75.689  1.827   -8.197  1.00 0.00 ? 117 SER A HG   3  
ATOM 10912 N N    . SER A 1 118 ? 75.451  2.977   -10.047 1.00 0.00 ? 118 SER A N    3  
ATOM 10913 C CA   . SER A 1 118 ? 76.442  3.892   -10.603 1.00 0.00 ? 118 SER A CA   3  
ATOM 10914 C C    . SER A 1 118 ? 77.821  3.248   -10.536 1.00 0.00 ? 118 SER A C    3  
ATOM 10915 O O    . SER A 1 118 ? 78.039  2.305   -9.777  1.00 0.00 ? 118 SER A O    3  
ATOM 10916 C CB   . SER A 1 118 ? 76.449  5.198   -9.809  1.00 0.00 ? 118 SER A CB   3  
ATOM 10917 O OG   . SER A 1 118 ? 76.730  4.917   -8.444  1.00 0.00 ? 118 SER A OG   3  
ATOM 10918 H H    . SER A 1 118 ? 75.284  2.990   -9.082  1.00 0.00 ? 118 SER A H    3  
ATOM 10919 H HA   . SER A 1 118 ? 76.201  4.110   -11.635 1.00 0.00 ? 118 SER A HA   3  
ATOM 10920 H HB2  . SER A 1 118 ? 77.209  5.855   -10.199 1.00 0.00 ? 118 SER A HB2  3  
ATOM 10921 H HB3  . SER A 1 118 ? 75.483  5.677   -9.898  1.00 0.00 ? 118 SER A HB3  3  
ATOM 10922 H HG   . SER A 1 118 ? 77.129  4.045   -8.397  1.00 0.00 ? 118 SER A HG   3  
ATOM 10923 N N    . VAL A 1 119 ? 78.742  3.742   -11.352 1.00 0.00 ? 119 VAL A N    3  
ATOM 10924 C CA   . VAL A 1 119 ? 80.100  3.196   -11.402 1.00 0.00 ? 119 VAL A CA   3  
ATOM 10925 C C    . VAL A 1 119 ? 81.053  3.979   -10.499 1.00 0.00 ? 119 VAL A C    3  
ATOM 10926 O O    . VAL A 1 119 ? 80.918  5.192   -10.333 1.00 0.00 ? 119 VAL A O    3  
ATOM 10927 C CB   . VAL A 1 119 ? 80.625  3.264   -12.845 1.00 0.00 ? 119 VAL A CB   3  
ATOM 10928 C CG1  . VAL A 1 119 ? 80.696  4.728   -13.293 1.00 0.00 ? 119 VAL A CG1  3  
ATOM 10929 C CG2  . VAL A 1 119 ? 82.015  2.629   -12.918 1.00 0.00 ? 119 VAL A CG2  3  
ATOM 10930 H H    . VAL A 1 119 ? 78.504  4.481   -11.951 1.00 0.00 ? 119 VAL A H    3  
ATOM 10931 H HA   . VAL A 1 119 ? 80.089  2.162   -11.089 1.00 0.00 ? 119 VAL A HA   3  
ATOM 10932 H HB   . VAL A 1 119 ? 79.948  2.726   -13.495 1.00 0.00 ? 119 VAL A HB   3  
ATOM 10933 H HG11 . VAL A 1 119 ? 81.506  5.228   -12.784 1.00 0.00 ? 119 VAL A HG11 3  
ATOM 10934 H HG12 . VAL A 1 119 ? 79.765  5.222   -13.055 1.00 0.00 ? 119 VAL A HG12 3  
ATOM 10935 H HG13 . VAL A 1 119 ? 80.859  4.771   -14.357 1.00 0.00 ? 119 VAL A HG13 3  
ATOM 10936 H HG21 . VAL A 1 119 ? 82.309  2.525   -13.952 1.00 0.00 ? 119 VAL A HG21 3  
ATOM 10937 H HG22 . VAL A 1 119 ? 81.990  1.656   -12.452 1.00 0.00 ? 119 VAL A HG22 3  
ATOM 10938 H HG23 . VAL A 1 119 ? 82.724  3.254   -12.405 1.00 0.00 ? 119 VAL A HG23 3  
ATOM 10939 N N    . SER A 1 120 ? 82.032  3.270   -9.932  1.00 0.00 ? 120 SER A N    3  
ATOM 10940 C CA   . SER A 1 120 ? 83.033  3.887   -9.057  1.00 0.00 ? 120 SER A CA   3  
ATOM 10941 C C    . SER A 1 120 ? 84.202  4.415   -9.899  1.00 0.00 ? 120 SER A C    3  
ATOM 10942 O O    . SER A 1 120 ? 84.480  3.883   -10.971 1.00 0.00 ? 120 SER A O    3  
ATOM 10943 C CB   . SER A 1 120 ? 83.538  2.843   -8.051  1.00 0.00 ? 120 SER A CB   3  
ATOM 10944 O OG   . SER A 1 120 ? 83.736  1.607   -8.722  1.00 0.00 ? 120 SER A OG   3  
ATOM 10945 H H    . SER A 1 120 ? 82.091  2.309   -10.115 1.00 0.00 ? 120 SER A H    3  
ATOM 10946 H HA   . SER A 1 120 ? 82.580  4.703   -8.523  1.00 0.00 ? 120 SER A HA   3  
ATOM 10947 H HB2  . SER A 1 120 ? 84.473  3.163   -7.621  1.00 0.00 ? 120 SER A HB2  3  
ATOM 10948 H HB3  . SER A 1 120 ? 82.807  2.720   -7.262  1.00 0.00 ? 120 SER A HB3  3  
ATOM 10949 H HG   . SER A 1 120 ? 82.908  1.360   -9.141  1.00 0.00 ? 120 SER A HG   3  
ATOM 10950 N N    . PRO A 1 121 ? 84.913  5.464   -9.438  1.00 0.00 ? 121 PRO A N    3  
ATOM 10951 C CA   . PRO A 1 121 ? 86.049  6.025   -10.188 1.00 0.00 ? 121 PRO A CA   3  
ATOM 10952 C C    . PRO A 1 121 ? 87.155  4.990   -10.375 1.00 0.00 ? 121 PRO A C    3  
ATOM 10953 O O    . PRO A 1 121 ? 87.191  3.972   -9.683  1.00 0.00 ? 121 PRO A O    3  
ATOM 10954 C CB   . PRO A 1 121 ? 86.519  7.218   -9.327  1.00 0.00 ? 121 PRO A CB   3  
ATOM 10955 C CG   . PRO A 1 121 ? 86.012  6.911   -7.955  1.00 0.00 ? 121 PRO A CG   3  
ATOM 10956 C CD   . PRO A 1 121 ? 84.690  6.182   -8.176  1.00 0.00 ? 121 PRO A CD   3  
ATOM 10957 H HA   . PRO A 1 121 ? 85.714  6.381   -11.151 1.00 0.00 ? 121 PRO A HA   3  
ATOM 10958 H HB2  . PRO A 1 121 ? 87.602  7.298   -9.329  1.00 0.00 ? 121 PRO A HB2  3  
ATOM 10959 H HB3  . PRO A 1 121 ? 86.078  8.140   -9.684  1.00 0.00 ? 121 PRO A HB3  3  
ATOM 10960 H HG2  . PRO A 1 121 ? 86.715  6.271   -7.431  1.00 0.00 ? 121 PRO A HG2  3  
ATOM 10961 H HG3  . PRO A 1 121 ? 85.844  7.820   -7.394  1.00 0.00 ? 121 PRO A HG3  3  
ATOM 10962 H HD2  . PRO A 1 121 ? 84.495  5.492   -7.371  1.00 0.00 ? 121 PRO A HD2  3  
ATOM 10963 H HD3  . PRO A 1 121 ? 83.882  6.885   -8.289  1.00 0.00 ? 121 PRO A HD3  3  
ATOM 10964 N N    . GLY A 1 122 ? 88.053  5.257   -11.316 1.00 0.00 ? 122 GLY A N    3  
ATOM 10965 C CA   . GLY A 1 122 ? 89.151  4.348   -11.589 1.00 0.00 ? 122 GLY A CA   3  
ATOM 10966 C C    . GLY A 1 122 ? 88.698  3.128   -12.367 1.00 0.00 ? 122 GLY A C    3  
ATOM 10967 O O    . GLY A 1 122 ? 89.507  2.266   -12.710 1.00 0.00 ? 122 GLY A O    3  
ATOM 10968 H H    . GLY A 1 122 ? 87.973  6.083   -11.836 1.00 0.00 ? 122 GLY A H    3  
ATOM 10969 H HA2  . GLY A 1 122 ? 89.902  4.869   -12.162 1.00 0.00 ? 122 GLY A HA2  3  
ATOM 10970 H HA3  . GLY A 1 122 ? 89.586  4.025   -10.653 1.00 0.00 ? 122 GLY A HA3  3  
ATOM 10971 N N    . GLN A 1 123 ? 87.399  3.056   -12.648 1.00 0.00 ? 123 GLN A N    3  
ATOM 10972 C CA   . GLN A 1 123 ? 86.846  1.926   -13.395 1.00 0.00 ? 123 GLN A CA   3  
ATOM 10973 C C    . GLN A 1 123 ? 87.070  2.113   -14.893 1.00 0.00 ? 123 GLN A C    3  
ATOM 10974 O O    . GLN A 1 123 ? 87.666  1.258   -15.548 1.00 0.00 ? 123 GLN A O    3  
ATOM 10975 C CB   . GLN A 1 123 ? 85.348  1.795   -13.107 1.00 0.00 ? 123 GLN A CB   3  
ATOM 10976 C CG   . GLN A 1 123 ? 85.141  1.302   -11.668 1.00 0.00 ? 123 GLN A CG   3  
ATOM 10977 C CD   . GLN A 1 123 ? 85.534  -0.174  -11.566 1.00 0.00 ? 123 GLN A CD   3  
ATOM 10978 O OE1  . GLN A 1 123 ? 86.592  -0.500  -11.064 1.00 0.00 ? 123 GLN A OE1  3  
ATOM 10979 N NE2  . GLN A 1 123 ? 84.722  -1.086  -12.025 1.00 0.00 ? 123 GLN A NE2  3  
ATOM 10980 H H    . GLN A 1 123 ? 86.802  3.772   -12.350 1.00 0.00 ? 123 GLN A H    3  
ATOM 10981 H HA   . GLN A 1 123 ? 87.341  1.017   -13.081 1.00 0.00 ? 123 GLN A HA   3  
ATOM 10982 H HB2  . GLN A 1 123 ? 84.877  2.758   -13.229 1.00 0.00 ? 123 GLN A HB2  3  
ATOM 10983 H HB3  . GLN A 1 123 ? 84.907  1.088   -13.794 1.00 0.00 ? 123 GLN A HB3  3  
ATOM 10984 H HG2  . GLN A 1 123 ? 85.755  1.884   -10.995 1.00 0.00 ? 123 GLN A HG2  3  
ATOM 10985 H HG3  . GLN A 1 123 ? 84.102  1.415   -11.394 1.00 0.00 ? 123 GLN A HG3  3  
ATOM 10986 H HE21 . GLN A 1 123 ? 83.869  -0.824  -12.430 1.00 0.00 ? 123 GLN A HE21 3  
ATOM 10987 H HE22 . GLN A 1 123 ? 84.965  -2.033  -11.964 1.00 0.00 ? 123 GLN A HE22 3  
ATOM 10988 N N    . GLY A 1 124 ? 86.596  3.236   -15.432 1.00 0.00 ? 124 GLY A N    3  
ATOM 10989 C CA   . GLY A 1 124 ? 86.759  3.520   -16.854 1.00 0.00 ? 124 GLY A CA   3  
ATOM 10990 C C    . GLY A 1 124 ? 85.658  4.408   -17.402 1.00 0.00 ? 124 GLY A C    3  
ATOM 10991 O O    . GLY A 1 124 ? 85.742  4.875   -18.537 1.00 0.00 ? 124 GLY A O    3  
ATOM 10992 H H    . GLY A 1 124 ? 86.135  3.885   -14.862 1.00 0.00 ? 124 GLY A H    3  
ATOM 10993 H HA2  . GLY A 1 124 ? 87.708  4.014   -17.002 1.00 0.00 ? 124 GLY A HA2  3  
ATOM 10994 H HA3  . GLY A 1 124 ? 86.759  2.591   -17.409 1.00 0.00 ? 124 GLY A HA3  3  
ATOM 10995 N N    . LYS A 1 125 ? 84.620  4.648   -16.594 1.00 0.00 ? 125 LYS A N    3  
ATOM 10996 C CA   . LYS A 1 125 ? 83.492  5.495   -17.005 1.00 0.00 ? 125 LYS A CA   3  
ATOM 10997 C C    . LYS A 1 125 ? 83.467  6.763   -16.147 1.00 0.00 ? 125 LYS A C    3  
ATOM 10998 O O    . LYS A 1 125 ? 84.269  6.915   -15.224 1.00 0.00 ? 125 LYS A O    3  
ATOM 10999 C CB   . LYS A 1 125 ? 82.170  4.707   -16.841 1.00 0.00 ? 125 LYS A CB   3  
ATOM 11000 C CG   . LYS A 1 125 ? 81.809  3.964   -18.139 1.00 0.00 ? 125 LYS A CG   3  
ATOM 11001 C CD   . LYS A 1 125 ? 82.965  3.045   -18.566 1.00 0.00 ? 125 LYS A CD   3  
ATOM 11002 C CE   . LYS A 1 125 ? 82.459  2.007   -19.574 1.00 0.00 ? 125 LYS A CE   3  
ATOM 11003 N NZ   . LYS A 1 125 ? 81.546  2.668   -20.550 1.00 0.00 ? 125 LYS A NZ   3  
ATOM 11004 H H    . LYS A 1 125 ? 84.608  4.258   -15.696 1.00 0.00 ? 125 LYS A H    3  
ATOM 11005 H HA   . LYS A 1 125 ? 83.607  5.790   -18.042 1.00 0.00 ? 125 LYS A HA   3  
ATOM 11006 H HB2  . LYS A 1 125 ? 82.288  3.984   -16.048 1.00 0.00 ? 125 LYS A HB2  3  
ATOM 11007 H HB3  . LYS A 1 125 ? 81.363  5.383   -16.589 1.00 0.00 ? 125 LYS A HB3  3  
ATOM 11008 H HG2  . LYS A 1 125 ? 80.919  3.374   -17.972 1.00 0.00 ? 125 LYS A HG2  3  
ATOM 11009 H HG3  . LYS A 1 125 ? 81.618  4.684   -18.922 1.00 0.00 ? 125 LYS A HG3  3  
ATOM 11010 H HD2  . LYS A 1 125 ? 83.742  3.637   -19.024 1.00 0.00 ? 125 LYS A HD2  3  
ATOM 11011 H HD3  . LYS A 1 125 ? 83.364  2.535   -17.699 1.00 0.00 ? 125 LYS A HD3  3  
ATOM 11012 H HE2  . LYS A 1 125 ? 83.297  1.576   -20.101 1.00 0.00 ? 125 LYS A HE2  3  
ATOM 11013 H HE3  . LYS A 1 125 ? 81.923  1.228   -19.053 1.00 0.00 ? 125 LYS A HE3  3  
ATOM 11014 H HZ1  . LYS A 1 125 ? 80.669  2.947   -20.070 1.00 0.00 ? 125 LYS A HZ1  3  
ATOM 11015 H HZ2  . LYS A 1 125 ? 81.325  2.004   -21.321 1.00 0.00 ? 125 LYS A HZ2  3  
ATOM 11016 H HZ3  . LYS A 1 125 ? 82.009  3.512   -20.942 1.00 0.00 ? 125 LYS A HZ3  3  
ATOM 11017 N N    . ASP A 1 126 ? 82.549  7.670   -16.466 1.00 0.00 ? 126 ASP A N    3  
ATOM 11018 C CA   . ASP A 1 126 ? 82.433  8.927   -15.728 1.00 0.00 ? 126 ASP A CA   3  
ATOM 11019 C C    . ASP A 1 126 ? 81.736  8.719   -14.387 1.00 0.00 ? 126 ASP A C    3  
ATOM 11020 O O    . ASP A 1 126 ? 80.913  7.817   -14.231 1.00 0.00 ? 126 ASP A O    3  
ATOM 11021 C CB   . ASP A 1 126 ? 81.646  9.942   -16.559 1.00 0.00 ? 126 ASP A CB   3  
ATOM 11022 C CG   . ASP A 1 126 ? 82.203  9.977   -17.984 1.00 0.00 ? 126 ASP A CG   3  
ATOM 11023 O OD1  . ASP A 1 126 ? 83.367  9.651   -18.152 1.00 0.00 ? 126 ASP A OD1  3  
ATOM 11024 O OD2  . ASP A 1 126 ? 81.457  10.330  -18.883 1.00 0.00 ? 126 ASP A OD2  3  
ATOM 11025 H H    . ASP A 1 126 ? 81.944  7.497   -17.216 1.00 0.00 ? 126 ASP A H    3  
ATOM 11026 H HA   . ASP A 1 126 ? 83.421  9.322   -15.550 1.00 0.00 ? 126 ASP A HA   3  
ATOM 11027 H HB2  . ASP A 1 126 ? 80.604  9.654   -16.587 1.00 0.00 ? 126 ASP A HB2  3  
ATOM 11028 H HB3  . ASP A 1 126 ? 81.739  10.921  -16.115 1.00 0.00 ? 126 ASP A HB3  3  
ATOM 11029 N N    . SER A 1 127 ? 82.070  9.578   -13.425 1.00 0.00 ? 127 SER A N    3  
ATOM 11030 C CA   . SER A 1 127 ? 81.477  9.516   -12.090 1.00 0.00 ? 127 SER A CA   3  
ATOM 11031 C C    . SER A 1 127 ? 81.527  10.898  -11.441 1.00 0.00 ? 127 SER A C    3  
ATOM 11032 O O    . SER A 1 127 ? 82.194  11.096  -10.426 1.00 0.00 ? 127 SER A O    3  
ATOM 11033 C CB   . SER A 1 127 ? 82.239  8.513   -11.224 1.00 0.00 ? 127 SER A CB   3  
ATOM 11034 O OG   . SER A 1 127 ? 82.374  7.288   -11.934 1.00 0.00 ? 127 SER A OG   3  
ATOM 11035 H H    . SER A 1 127 ? 82.726  10.279  -13.621 1.00 0.00 ? 127 SER A H    3  
ATOM 11036 H HA   . SER A 1 127 ? 80.445  9.202   -12.168 1.00 0.00 ? 127 SER A HA   3  
ATOM 11037 H HB2  . SER A 1 127 ? 83.217  8.900   -10.996 1.00 0.00 ? 127 SER A HB2  3  
ATOM 11038 H HB3  . SER A 1 127 ? 81.695  8.349   -10.302 1.00 0.00 ? 127 SER A HB3  3  
ATOM 11039 H HG   . SER A 1 127 ? 82.339  6.571   -11.296 1.00 0.00 ? 127 SER A HG   3  
ATOM 11040 N N    . PRO A 1 128 ? 80.827  11.879  -12.039 1.00 0.00 ? 128 PRO A N    3  
ATOM 11041 C CA   . PRO A 1 128 ? 80.795  13.263  -11.538 1.00 0.00 ? 128 PRO A CA   3  
ATOM 11042 C C    . PRO A 1 128 ? 80.704  13.352  -10.014 1.00 0.00 ? 128 PRO A C    3  
ATOM 11043 O O    . PRO A 1 128 ? 80.147  12.471  -9.358  1.00 0.00 ? 128 PRO A O    3  
ATOM 11044 C CB   . PRO A 1 128 ? 79.543  13.848  -12.203 1.00 0.00 ? 128 PRO A CB   3  
ATOM 11045 C CG   . PRO A 1 128 ? 79.456  13.135  -13.515 1.00 0.00 ? 128 PRO A CG   3  
ATOM 11046 C CD   . PRO A 1 128 ? 80.000  11.721  -13.255 1.00 0.00 ? 128 PRO A CD   3  
ATOM 11047 H HA   . PRO A 1 128 ? 81.663  13.798  -11.885 1.00 0.00 ? 128 PRO A HA   3  
ATOM 11048 H HB2  . PRO A 1 128 ? 78.664  13.645  -11.601 1.00 0.00 ? 128 PRO A HB2  3  
ATOM 11049 H HB3  . PRO A 1 128 ? 79.653  14.913  -12.360 1.00 0.00 ? 128 PRO A HB3  3  
ATOM 11050 H HG2  . PRO A 1 128 ? 78.425  13.094  -13.854 1.00 0.00 ? 128 PRO A HG2  3  
ATOM 11051 H HG3  . PRO A 1 128 ? 80.070  13.633  -14.254 1.00 0.00 ? 128 PRO A HG3  3  
ATOM 11052 H HD2  . PRO A 1 128 ? 79.189  11.027  -13.075 1.00 0.00 ? 128 PRO A HD2  3  
ATOM 11053 H HD3  . PRO A 1 128 ? 80.610  11.387  -14.079 1.00 0.00 ? 128 PRO A HD3  3  
ATOM 11054 N N    . ALA A 1 129 ? 81.243  14.443  -9.469  1.00 0.00 ? 129 ALA A N    3  
ATOM 11055 C CA   . ALA A 1 129 ? 81.223  14.695  -8.024  1.00 0.00 ? 129 ALA A CA   3  
ATOM 11056 C C    . ALA A 1 129 ? 80.503  16.011  -7.757  1.00 0.00 ? 129 ALA A C    3  
ATOM 11057 O O    . ALA A 1 129 ? 80.516  16.911  -8.597  1.00 0.00 ? 129 ALA A O    3  
ATOM 11058 C CB   . ALA A 1 129 ? 82.646  14.767  -7.494  1.00 0.00 ? 129 ALA A CB   3  
ATOM 11059 H H    . ALA A 1 129 ? 81.657  15.109  -10.058 1.00 0.00 ? 129 ALA A H    3  
ATOM 11060 H HA   . ALA A 1 129 ? 80.696  13.898  -7.516  1.00 0.00 ? 129 ALA A HA   3  
ATOM 11061 H HB1  . ALA A 1 129 ? 83.186  13.880  -7.790  1.00 0.00 ? 129 ALA A HB1  3  
ATOM 11062 H HB2  . ALA A 1 129 ? 82.626  14.834  -6.416  1.00 0.00 ? 129 ALA A HB2  3  
ATOM 11063 H HB3  . ALA A 1 129 ? 83.138  15.639  -7.899  1.00 0.00 ? 129 ALA A HB3  3  
ATOM 11064 N N    . ILE A 1 130 ? 79.859  16.121  -6.595  1.00 0.00 ? 130 ILE A N    3  
ATOM 11065 C CA   . ILE A 1 130 ? 79.119  17.342  -6.250  1.00 0.00 ? 130 ILE A CA   3  
ATOM 11066 C C    . ILE A 1 130 ? 79.224  17.629  -4.745  1.00 0.00 ? 130 ILE A C    3  
ATOM 11067 O O    . ILE A 1 130 ? 79.628  16.763  -3.969  1.00 0.00 ? 130 ILE A O    3  
ATOM 11068 C CB   . ILE A 1 130 ? 77.634  17.193  -6.693  1.00 0.00 ? 130 ILE A CB   3  
ATOM 11069 C CG1  . ILE A 1 130 ? 76.981  18.576  -6.902  1.00 0.00 ? 130 ILE A CG1  3  
ATOM 11070 C CG2  . ILE A 1 130 ? 76.832  16.402  -5.649  1.00 0.00 ? 130 ILE A CG2  3  
ATOM 11071 C CD1  . ILE A 1 130 ? 77.588  19.307  -8.128  1.00 0.00 ? 130 ILE A CD1  3  
ATOM 11072 H H    . ILE A 1 130 ? 79.869  15.368  -5.968  1.00 0.00 ? 130 ILE A H    3  
ATOM 11073 H HA   . ILE A 1 130 ? 79.559  18.175  -6.778  1.00 0.00 ? 130 ILE A HA   3  
ATOM 11074 H HB   . ILE A 1 130 ? 77.607  16.645  -7.625  1.00 0.00 ? 130 ILE A HB   3  
ATOM 11075 H HG12 . ILE A 1 130 ? 75.921  18.437  -7.061  1.00 0.00 ? 130 ILE A HG12 3  
ATOM 11076 H HG13 . ILE A 1 130 ? 77.130  19.177  -6.017  1.00 0.00 ? 130 ILE A HG13 3  
ATOM 11077 H HG21 . ILE A 1 130 ? 77.409  15.549  -5.322  1.00 0.00 ? 130 ILE A HG21 3  
ATOM 11078 H HG22 . ILE A 1 130 ? 75.905  16.063  -6.086  1.00 0.00 ? 130 ILE A HG22 3  
ATOM 11079 H HG23 . ILE A 1 130 ? 76.618  17.035  -4.802  1.00 0.00 ? 130 ILE A HG23 3  
ATOM 11080 H HD11 . ILE A 1 130 ? 77.928  18.590  -8.861  1.00 0.00 ? 130 ILE A HD11 3  
ATOM 11081 H HD12 . ILE A 1 130 ? 78.422  19.919  -7.814  1.00 0.00 ? 130 ILE A HD12 3  
ATOM 11082 H HD13 . ILE A 1 130 ? 76.837  19.944  -8.576  1.00 0.00 ? 130 ILE A HD13 3  
ATOM 11083 N N    . THR A 1 131 ? 78.878  18.854  -4.343  1.00 0.00 ? 131 THR A N    3  
ATOM 11084 C CA   . THR A 1 131 ? 78.961  19.245  -2.942  1.00 0.00 ? 131 THR A CA   3  
ATOM 11085 C C    . THR A 1 131 ? 77.925  18.518  -2.100  1.00 0.00 ? 131 THR A C    3  
ATOM 11086 O O    . THR A 1 131 ? 77.042  17.840  -2.621  1.00 0.00 ? 131 THR A O    3  
ATOM 11087 C CB   . THR A 1 131 ? 78.733  20.761  -2.781  1.00 0.00 ? 131 THR A CB   3  
ATOM 11088 O OG1  . THR A 1 131 ? 77.489  21.115  -3.368  1.00 0.00 ? 131 THR A OG1  3  
ATOM 11089 C CG2  . THR A 1 131 ? 79.860  21.529  -3.473  1.00 0.00 ? 131 THR A CG2  3  
ATOM 11090 H H    . THR A 1 131 ? 78.575  19.510  -4.999  1.00 0.00 ? 131 THR A H    3  
ATOM 11091 H HA   . THR A 1 131 ? 79.945  19.004  -2.570  1.00 0.00 ? 131 THR A HA   3  
ATOM 11092 H HB   . THR A 1 131 ? 78.721  21.014  -1.732  1.00 0.00 ? 131 THR A HB   3  
ATOM 11093 H HG1  . THR A 1 131 ? 77.026  21.692  -2.756  1.00 0.00 ? 131 THR A HG1  3  
ATOM 11094 H HG21 . THR A 1 131 ? 79.598  22.575  -3.533  1.00 0.00 ? 131 THR A HG21 3  
ATOM 11095 H HG22 . THR A 1 131 ? 80.007  21.136  -4.467  1.00 0.00 ? 131 THR A HG22 3  
ATOM 11096 H HG23 . THR A 1 131 ? 80.772  21.419  -2.903  1.00 0.00 ? 131 THR A HG23 3  
ATOM 11097 N N    . HIS A 1 132 ? 78.038  18.679  -0.789  1.00 0.00 ? 132 HIS A N    3  
ATOM 11098 C CA   . HIS A 1 132 ? 77.107  18.048  0.132   1.00 0.00 ? 132 HIS A CA   3  
ATOM 11099 C C    . HIS A 1 132 ? 75.722  18.671  -0.011  1.00 0.00 ? 132 HIS A C    3  
ATOM 11100 O O    . HIS A 1 132 ? 74.706  17.997  0.158   1.00 0.00 ? 132 HIS A O    3  
ATOM 11101 C CB   . HIS A 1 132 ? 77.607  18.213  1.572   1.00 0.00 ? 132 HIS A CB   3  
ATOM 11102 C CG   . HIS A 1 132 ? 79.085  17.939  1.623   1.00 0.00 ? 132 HIS A CG   3  
ATOM 11103 N ND1  . HIS A 1 132 ? 79.864  18.295  2.712   1.00 0.00 ? 132 HIS A ND1  3  
ATOM 11104 C CD2  . HIS A 1 132 ? 79.940  17.349  0.726   1.00 0.00 ? 132 HIS A CD2  3  
ATOM 11105 C CE1  . HIS A 1 132 ? 81.128  17.919  2.445   1.00 0.00 ? 132 HIS A CE1  3  
ATOM 11106 N NE2  . HIS A 1 132 ? 81.230  17.338  1.247   1.00 0.00 ? 132 HIS A NE2  3  
ATOM 11107 H H    . HIS A 1 132 ? 78.759  19.239  -0.434  1.00 0.00 ? 132 HIS A H    3  
ATOM 11108 H HA   . HIS A 1 132 ? 77.045  16.995  -0.099  1.00 0.00 ? 132 HIS A HA   3  
ATOM 11109 H HB2  . HIS A 1 132 ? 77.418  19.223  1.908   1.00 0.00 ? 132 HIS A HB2  3  
ATOM 11110 H HB3  . HIS A 1 132 ? 77.090  17.517  2.215   1.00 0.00 ? 132 HIS A HB3  3  
ATOM 11111 H HD1  . HIS A 1 132 ? 79.551  18.738  3.528   1.00 0.00 ? 132 HIS A HD1  3  
ATOM 11112 H HD2  . HIS A 1 132 ? 79.639  16.871  -0.195  1.00 0.00 ? 132 HIS A HD2  3  
ATOM 11113 H HE1  . HIS A 1 132 ? 81.959  18.071  3.119   1.00 0.00 ? 132 HIS A HE1  3  
ATOM 11114 N N    . GLU A 1 133 ? 75.691  19.967  -0.306  1.00 0.00 ? 133 GLU A N    3  
ATOM 11115 C CA   . GLU A 1 133 ? 74.426  20.679  -0.449  1.00 0.00 ? 133 GLU A CA   3  
ATOM 11116 C C    . GLU A 1 133 ? 73.538  20.003  -1.484  1.00 0.00 ? 133 GLU A C    3  
ATOM 11117 O O    . GLU A 1 133 ? 72.409  19.614  -1.190  1.00 0.00 ? 133 GLU A O    3  
ATOM 11118 C CB   . GLU A 1 133 ? 74.686  22.127  -0.869  1.00 0.00 ? 133 GLU A CB   3  
ATOM 11119 C CG   . GLU A 1 133 ? 75.597  22.802  0.157   1.00 0.00 ? 133 GLU A CG   3  
ATOM 11120 C CD   . GLU A 1 133 ? 75.870  24.244  -0.273  1.00 0.00 ? 133 GLU A CD   3  
ATOM 11121 O OE1  . GLU A 1 133 ? 74.954  25.046  -0.201  1.00 0.00 ? 133 GLU A OE1  3  
ATOM 11122 O OE2  . GLU A 1 133 ? 76.991  24.523  -0.667  1.00 0.00 ? 133 GLU A OE2  3  
ATOM 11123 H H    . GLU A 1 133 ? 76.533  20.458  -0.418  1.00 0.00 ? 133 GLU A H    3  
ATOM 11124 H HA   . GLU A 1 133 ? 73.916  20.680  0.501   1.00 0.00 ? 133 GLU A HA   3  
ATOM 11125 H HB2  . GLU A 1 133 ? 75.163  22.140  -1.838  1.00 0.00 ? 133 GLU A HB2  3  
ATOM 11126 H HB3  . GLU A 1 133 ? 73.748  22.660  -0.923  1.00 0.00 ? 133 GLU A HB3  3  
ATOM 11127 H HG2  . GLU A 1 133 ? 75.115  22.798  1.124   1.00 0.00 ? 133 GLU A HG2  3  
ATOM 11128 H HG3  . GLU A 1 133 ? 76.532  22.264  0.217   1.00 0.00 ? 133 GLU A HG3  3  
ATOM 11129 N N    . GLU A 1 134 ? 74.057  19.869  -2.697  1.00 0.00 ? 134 GLU A N    3  
ATOM 11130 C CA   . GLU A 1 134 ? 73.302  19.243  -3.770  1.00 0.00 ? 134 GLU A CA   3  
ATOM 11131 C C    . GLU A 1 134 ? 72.998  17.789  -3.434  1.00 0.00 ? 134 GLU A C    3  
ATOM 11132 O O    . GLU A 1 134 ? 71.883  17.318  -3.649  1.00 0.00 ? 134 GLU A O    3  
ATOM 11133 C CB   . GLU A 1 134 ? 74.095  19.323  -5.070  1.00 0.00 ? 134 GLU A CB   3  
ATOM 11134 C CG   . GLU A 1 134 ? 74.228  20.790  -5.489  1.00 0.00 ? 134 GLU A CG   3  
ATOM 11135 C CD   . GLU A 1 134 ? 74.961  20.880  -6.829  1.00 0.00 ? 134 GLU A CD   3  
ATOM 11136 O OE1  . GLU A 1 134 ? 74.403  20.434  -7.818  1.00 0.00 ? 134 GLU A OE1  3  
ATOM 11137 O OE2  . GLU A 1 134 ? 76.068  21.394  -6.843  1.00 0.00 ? 134 GLU A OE2  3  
ATOM 11138 H H    . GLU A 1 134 ? 74.962  20.202  -2.873  1.00 0.00 ? 134 GLU A H    3  
ATOM 11139 H HA   . GLU A 1 134 ? 72.371  19.775  -3.899  1.00 0.00 ? 134 GLU A HA   3  
ATOM 11140 H HB2  . GLU A 1 134 ? 75.075  18.901  -4.914  1.00 0.00 ? 134 GLU A HB2  3  
ATOM 11141 H HB3  . GLU A 1 134 ? 73.581  18.770  -5.843  1.00 0.00 ? 134 GLU A HB3  3  
ATOM 11142 H HG2  . GLU A 1 134 ? 73.245  21.226  -5.587  1.00 0.00 ? 134 GLU A HG2  3  
ATOM 11143 H HG3  . GLU A 1 134 ? 74.788  21.329  -4.739  1.00 0.00 ? 134 GLU A HG3  3  
ATOM 11144 N N    . ALA A 1 135 ? 73.989  17.080  -2.899  1.00 0.00 ? 135 ALA A N    3  
ATOM 11145 C CA   . ALA A 1 135 ? 73.792  15.680  -2.537  1.00 0.00 ? 135 ALA A CA   3  
ATOM 11146 C C    . ALA A 1 135 ? 72.571  15.543  -1.632  1.00 0.00 ? 135 ALA A C    3  
ATOM 11147 O O    . ALA A 1 135 ? 71.630  14.816  -1.947  1.00 0.00 ? 135 ALA A O    3  
ATOM 11148 C CB   . ALA A 1 135 ? 75.028  15.151  -1.826  1.00 0.00 ? 135 ALA A CB   3  
ATOM 11149 H H    . ALA A 1 135 ? 74.858  17.503  -2.743  1.00 0.00 ? 135 ALA A H    3  
ATOM 11150 H HA   . ALA A 1 135 ? 73.630  15.103  -3.435  1.00 0.00 ? 135 ALA A HA   3  
ATOM 11151 H HB1  . ALA A 1 135 ? 74.957  14.078  -1.729  1.00 0.00 ? 135 ALA A HB1  3  
ATOM 11152 H HB2  . ALA A 1 135 ? 75.098  15.597  -0.844  1.00 0.00 ? 135 ALA A HB2  3  
ATOM 11153 H HB3  . ALA A 1 135 ? 75.908  15.403  -2.399  1.00 0.00 ? 135 ALA A HB3  3  
ATOM 11154 N N    . LEU A 1 136 ? 72.593  16.259  -0.514  1.00 0.00 ? 136 LEU A N    3  
ATOM 11155 C CA   . LEU A 1 136 ? 71.481  16.226  0.427   1.00 0.00 ? 136 LEU A CA   3  
ATOM 11156 C C    . LEU A 1 136 ? 70.188  16.609  -0.283  1.00 0.00 ? 136 LEU A C    3  
ATOM 11157 O O    . LEU A 1 136 ? 69.117  16.093  0.028   1.00 0.00 ? 136 LEU A O    3  
ATOM 11158 C CB   . LEU A 1 136 ? 71.740  17.204  1.581   1.00 0.00 ? 136 LEU A CB   3  
ATOM 11159 C CG   . LEU A 1 136 ? 73.000  16.782  2.374   1.00 0.00 ? 136 LEU A CG   3  
ATOM 11160 C CD1  . LEU A 1 136 ? 73.546  17.985  3.153   1.00 0.00 ? 136 LEU A CD1  3  
ATOM 11161 C CD2  . LEU A 1 136 ? 72.664  15.660  3.371   1.00 0.00 ? 136 LEU A CD2  3  
ATOM 11162 H H    . LEU A 1 136 ? 73.369  16.821  -0.323  1.00 0.00 ? 136 LEU A H    3  
ATOM 11163 H HA   . LEU A 1 136 ? 71.381  15.229  0.822   1.00 0.00 ? 136 LEU A HA   3  
ATOM 11164 H HB2  . LEU A 1 136 ? 71.886  18.194  1.170   1.00 0.00 ? 136 LEU A HB2  3  
ATOM 11165 H HB3  . LEU A 1 136 ? 70.883  17.216  2.238   1.00 0.00 ? 136 LEU A HB3  3  
ATOM 11166 H HG   . LEU A 1 136 ? 73.760  16.435  1.687   1.00 0.00 ? 136 LEU A HG   3  
ATOM 11167 H HD11 . LEU A 1 136 ? 74.406  17.679  3.731   1.00 0.00 ? 136 LEU A HD11 3  
ATOM 11168 H HD12 . LEU A 1 136 ? 72.782  18.362  3.816   1.00 0.00 ? 136 LEU A HD12 3  
ATOM 11169 H HD13 . LEU A 1 136 ? 73.837  18.761  2.459   1.00 0.00 ? 136 LEU A HD13 3  
ATOM 11170 H HD21 . LEU A 1 136 ? 73.508  15.498  4.025   1.00 0.00 ? 136 LEU A HD21 3  
ATOM 11171 H HD22 . LEU A 1 136 ? 72.451  14.748  2.836   1.00 0.00 ? 136 LEU A HD22 3  
ATOM 11172 H HD23 . LEU A 1 136 ? 71.804  15.941  3.962   1.00 0.00 ? 136 LEU A HD23 3  
ATOM 11173 N N    . ALA A 1 137 ? 70.301  17.519  -1.244  1.00 0.00 ? 137 ALA A N    3  
ATOM 11174 C CA   . ALA A 1 137 ? 69.138  17.965  -2.002  1.00 0.00 ? 137 ALA A CA   3  
ATOM 11175 C C    . ALA A 1 137 ? 68.673  16.870  -2.956  1.00 0.00 ? 137 ALA A C    3  
ATOM 11176 O O    . ALA A 1 137 ? 67.486  16.766  -3.267  1.00 0.00 ? 137 ALA A O    3  
ATOM 11177 C CB   . ALA A 1 137 ? 69.486  19.221  -2.787  1.00 0.00 ? 137 ALA A CB   3  
ATOM 11178 H H    . ALA A 1 137 ? 71.183  17.893  -1.450  1.00 0.00 ? 137 ALA A H    3  
ATOM 11179 H HA   . ALA A 1 137 ? 68.338  18.193  -1.314  1.00 0.00 ? 137 ALA A HA   3  
ATOM 11180 H HB1  . ALA A 1 137 ? 68.583  19.655  -3.191  1.00 0.00 ? 137 ALA A HB1  3  
ATOM 11181 H HB2  . ALA A 1 137 ? 70.156  18.967  -3.595  1.00 0.00 ? 137 ALA A HB2  3  
ATOM 11182 H HB3  . ALA A 1 137 ? 69.966  19.933  -2.132  1.00 0.00 ? 137 ALA A HB3  3  
ATOM 11183 N N    . MET A 1 138 ? 69.617  16.057  -3.422  1.00 0.00 ? 138 MET A N    3  
ATOM 11184 C CA   . MET A 1 138 ? 69.299  14.975  -4.346  1.00 0.00 ? 138 MET A CA   3  
ATOM 11185 C C    . MET A 1 138 ? 68.604  13.829  -3.614  1.00 0.00 ? 138 MET A C    3  
ATOM 11186 O O    . MET A 1 138 ? 67.474  13.481  -3.935  1.00 0.00 ? 138 MET A O    3  
ATOM 11187 C CB   . MET A 1 138 ? 70.582  14.465  -5.022  1.00 0.00 ? 138 MET A CB   3  
ATOM 11188 C CG   . MET A 1 138 ? 71.037  15.462  -6.094  1.00 0.00 ? 138 MET A CG   3  
ATOM 11189 S SD   . MET A 1 138 ? 72.721  15.057  -6.620  1.00 0.00 ? 138 MET A SD   3  
ATOM 11190 C CE   . MET A 1 138 ? 72.698  15.980  -8.178  1.00 0.00 ? 138 MET A CE   3  
ATOM 11191 H H    . MET A 1 138 ? 70.546  16.190  -3.140  1.00 0.00 ? 138 MET A H    3  
ATOM 11192 H HA   . MET A 1 138 ? 68.628  15.351  -5.106  1.00 0.00 ? 138 MET A HA   3  
ATOM 11193 H HB2  . MET A 1 138 ? 71.359  14.356  -4.280  1.00 0.00 ? 138 MET A HB2  3  
ATOM 11194 H HB3  . MET A 1 138 ? 70.393  13.507  -5.487  1.00 0.00 ? 138 MET A HB3  3  
ATOM 11195 H HG2  . MET A 1 138 ? 70.373  15.405  -6.943  1.00 0.00 ? 138 MET A HG2  3  
ATOM 11196 H HG3  . MET A 1 138 ? 71.017  16.463  -5.689  1.00 0.00 ? 138 MET A HG3  3  
ATOM 11197 H HE1  . MET A 1 138 ? 73.709  16.234  -8.461  1.00 0.00 ? 138 MET A HE1  3  
ATOM 11198 H HE2  . MET A 1 138 ? 72.121  16.885  -8.051  1.00 0.00 ? 138 MET A HE2  3  
ATOM 11199 H HE3  . MET A 1 138 ? 72.249  15.373  -8.949  1.00 0.00 ? 138 MET A HE3  3  
ATOM 11200 N N    . ILE A 1 139 ? 69.291  13.230  -2.648  1.00 0.00 ? 139 ILE A N    3  
ATOM 11201 C CA   . ILE A 1 139 ? 68.721  12.104  -1.910  1.00 0.00 ? 139 ILE A CA   3  
ATOM 11202 C C    . ILE A 1 139 ? 67.292  12.394  -1.454  1.00 0.00 ? 139 ILE A C    3  
ATOM 11203 O O    . ILE A 1 139 ? 66.523  11.472  -1.179  1.00 0.00 ? 139 ILE A O    3  
ATOM 11204 C CB   . ILE A 1 139 ? 69.587  11.748  -0.678  1.00 0.00 ? 139 ILE A CB   3  
ATOM 11205 C CG1  . ILE A 1 139 ? 69.500  12.871  0.371   1.00 0.00 ? 139 ILE A CG1  3  
ATOM 11206 C CG2  . ILE A 1 139 ? 71.047  11.567  -1.124  1.00 0.00 ? 139 ILE A CG2  3  
ATOM 11207 C CD1  . ILE A 1 139 ? 70.507  12.618  1.501   1.00 0.00 ? 139 ILE A CD1  3  
ATOM 11208 H H    . ILE A 1 139 ? 70.206  13.526  -2.446  1.00 0.00 ? 139 ILE A H    3  
ATOM 11209 H HA   . ILE A 1 139 ? 68.701  11.246  -2.566  1.00 0.00 ? 139 ILE A HA   3  
ATOM 11210 H HB   . ILE A 1 139 ? 69.229  10.823  -0.248  1.00 0.00 ? 139 ILE A HB   3  
ATOM 11211 H HG12 . ILE A 1 139 ? 69.721  13.815  -0.100  1.00 0.00 ? 139 ILE A HG12 3  
ATOM 11212 H HG13 . ILE A 1 139 ? 68.505  12.902  0.788   1.00 0.00 ? 139 ILE A HG13 3  
ATOM 11213 H HG21 . ILE A 1 139 ? 71.504  12.532  -1.278  1.00 0.00 ? 139 ILE A HG21 3  
ATOM 11214 H HG22 . ILE A 1 139 ? 71.076  11.007  -2.046  1.00 0.00 ? 139 ILE A HG22 3  
ATOM 11215 H HG23 . ILE A 1 139 ? 71.591  11.028  -0.361  1.00 0.00 ? 139 ILE A HG23 3  
ATOM 11216 H HD11 . ILE A 1 139 ? 70.461  11.581  1.801   1.00 0.00 ? 139 ILE A HD11 3  
ATOM 11217 H HD12 . ILE A 1 139 ? 70.266  13.248  2.345   1.00 0.00 ? 139 ILE A HD12 3  
ATOM 11218 H HD13 . ILE A 1 139 ? 71.503  12.849  1.155   1.00 0.00 ? 139 ILE A HD13 3  
ATOM 11219 N N    . LYS A 1 140 ? 66.938  13.674  -1.366  1.00 0.00 ? 140 LYS A N    3  
ATOM 11220 C CA   . LYS A 1 140 ? 65.592  14.060  -0.930  1.00 0.00 ? 140 LYS A CA   3  
ATOM 11221 C C    . LYS A 1 140 ? 64.585  14.000  -2.084  1.00 0.00 ? 140 LYS A C    3  
ATOM 11222 O O    . LYS A 1 140 ? 63.399  13.760  -1.863  1.00 0.00 ? 140 LYS A O    3  
ATOM 11223 C CB   . LYS A 1 140 ? 65.622  15.485  -0.356  1.00 0.00 ? 140 LYS A CB   3  
ATOM 11224 C CG   . LYS A 1 140 ? 66.339  15.484  1.002   1.00 0.00 ? 140 LYS A CG   3  
ATOM 11225 C CD   . LYS A 1 140 ? 66.671  16.924  1.421   1.00 0.00 ? 140 LYS A CD   3  
ATOM 11226 C CE   . LYS A 1 140 ? 65.380  17.711  1.680   1.00 0.00 ? 140 LYS A CE   3  
ATOM 11227 N NZ   . LYS A 1 140 ? 65.705  18.955  2.433   1.00 0.00 ? 140 LYS A NZ   3  
ATOM 11228 H H    . LYS A 1 140 ? 67.592  14.371  -1.595  1.00 0.00 ? 140 LYS A H    3  
ATOM 11229 H HA   . LYS A 1 140 ? 65.265  13.384  -0.153  1.00 0.00 ? 140 LYS A HA   3  
ATOM 11230 H HB2  . LYS A 1 140 ? 66.145  16.136  -1.041  1.00 0.00 ? 140 LYS A HB2  3  
ATOM 11231 H HB3  . LYS A 1 140 ? 64.611  15.841  -0.223  1.00 0.00 ? 140 LYS A HB3  3  
ATOM 11232 H HG2  . LYS A 1 140 ? 65.699  15.031  1.745   1.00 0.00 ? 140 LYS A HG2  3  
ATOM 11233 H HG3  . LYS A 1 140 ? 67.254  14.916  0.925   1.00 0.00 ? 140 LYS A HG3  3  
ATOM 11234 H HD2  . LYS A 1 140 ? 67.265  16.905  2.323   1.00 0.00 ? 140 LYS A HD2  3  
ATOM 11235 H HD3  . LYS A 1 140 ? 67.230  17.407  0.635   1.00 0.00 ? 140 LYS A HD3  3  
ATOM 11236 H HE2  . LYS A 1 140 ? 64.922  17.973  0.738   1.00 0.00 ? 140 LYS A HE2  3  
ATOM 11237 H HE3  . LYS A 1 140 ? 64.696  17.110  2.260   1.00 0.00 ? 140 LYS A HE3  3  
ATOM 11238 H HZ1  . LYS A 1 140 ? 65.744  18.746  3.450   1.00 0.00 ? 140 LYS A HZ1  3  
ATOM 11239 H HZ2  . LYS A 1 140 ? 64.971  19.671  2.253   1.00 0.00 ? 140 LYS A HZ2  3  
ATOM 11240 H HZ3  . LYS A 1 140 ? 66.628  19.319  2.121   1.00 0.00 ? 140 LYS A HZ3  3  
ATOM 11241 N N    . ASP A 1 141 ? 65.051  14.248  -3.311  1.00 0.00 ? 141 ASP A N    3  
ATOM 11242 C CA   . ASP A 1 141 ? 64.166  14.248  -4.486  1.00 0.00 ? 141 ASP A CA   3  
ATOM 11243 C C    . ASP A 1 141 ? 64.256  12.943  -5.281  1.00 0.00 ? 141 ASP A C    3  
ATOM 11244 O O    . ASP A 1 141 ? 63.298  12.553  -5.949  1.00 0.00 ? 141 ASP A O    3  
ATOM 11245 C CB   . ASP A 1 141 ? 64.545  15.417  -5.399  1.00 0.00 ? 141 ASP A CB   3  
ATOM 11246 C CG   . ASP A 1 141 ? 64.225  16.738  -4.696  1.00 0.00 ? 141 ASP A CG   3  
ATOM 11247 O OD1  . ASP A 1 141 ? 64.415  16.807  -3.492  1.00 0.00 ? 141 ASP A OD1  3  
ATOM 11248 O OD2  . ASP A 1 141 ? 63.797  17.658  -5.373  1.00 0.00 ? 141 ASP A OD2  3  
ATOM 11249 H H    . ASP A 1 141 ? 66.002  14.455  -3.428  1.00 0.00 ? 141 ASP A H    3  
ATOM 11250 H HA   . ASP A 1 141 ? 63.142  14.387  -4.167  1.00 0.00 ? 141 ASP A HA   3  
ATOM 11251 H HB2  . ASP A 1 141 ? 65.601  15.370  -5.617  1.00 0.00 ? 141 ASP A HB2  3  
ATOM 11252 H HB3  . ASP A 1 141 ? 63.982  15.355  -6.318  1.00 0.00 ? 141 ASP A HB3  3  
ATOM 11253 N N    . CYS A 1 142 ? 65.404  12.283  -5.223  1.00 0.00 ? 142 CYS A N    3  
ATOM 11254 C CA   . CYS A 1 142 ? 65.596  11.039  -5.961  1.00 0.00 ? 142 CYS A CA   3  
ATOM 11255 C C    . CYS A 1 142 ? 64.443  10.067  -5.720  1.00 0.00 ? 142 CYS A C    3  
ATOM 11256 O O    . CYS A 1 142 ? 64.194  9.650   -4.589  1.00 0.00 ? 142 CYS A O    3  
ATOM 11257 C CB   . CYS A 1 142 ? 66.912  10.381  -5.548  1.00 0.00 ? 142 CYS A CB   3  
ATOM 11258 S SG   . CYS A 1 142 ? 67.119  8.831   -6.458  1.00 0.00 ? 142 CYS A SG   3  
ATOM 11259 H H    . CYS A 1 142 ? 66.136  12.641  -4.687  1.00 0.00 ? 142 CYS A H    3  
ATOM 11260 H HA   . CYS A 1 142 ? 65.641  11.268  -7.014  1.00 0.00 ? 142 CYS A HA   3  
ATOM 11261 H HB2  . CYS A 1 142 ? 67.733  11.045  -5.774  1.00 0.00 ? 142 CYS A HB2  3  
ATOM 11262 H HB3  . CYS A 1 142 ? 66.896  10.176  -4.487  1.00 0.00 ? 142 CYS A HB3  3  
ATOM 11263 N N    . GLU A 1 143 ? 63.743  9.710   -6.800  1.00 0.00 ? 143 GLU A N    3  
ATOM 11264 C CA   . GLU A 1 143 ? 62.606  8.782   -6.721  1.00 0.00 ? 143 GLU A CA   3  
ATOM 11265 C C    . GLU A 1 143 ? 62.663  7.778   -7.872  1.00 0.00 ? 143 GLU A C    3  
ATOM 11266 O O    . GLU A 1 143 ? 62.605  8.157   -9.042  1.00 0.00 ? 143 GLU A O    3  
ATOM 11267 C CB   . GLU A 1 143 ? 61.293  9.575   -6.779  1.00 0.00 ? 143 GLU A CB   3  
ATOM 11268 C CG   . GLU A 1 143 ? 60.087  8.636   -6.578  1.00 0.00 ? 143 GLU A CG   3  
ATOM 11269 C CD   . GLU A 1 143 ? 59.758  7.916   -7.890  1.00 0.00 ? 143 GLU A CD   3  
ATOM 11270 O OE1  . GLU A 1 143 ? 59.099  8.516   -8.723  1.00 0.00 ? 143 GLU A OE1  3  
ATOM 11271 O OE2  . GLU A 1 143 ? 60.170  6.779   -8.036  1.00 0.00 ? 143 GLU A OE2  3  
ATOM 11272 H H    . GLU A 1 143 ? 63.992  10.085  -7.670  1.00 0.00 ? 143 GLU A H    3  
ATOM 11273 H HA   . GLU A 1 143 ? 62.646  8.239   -5.785  1.00 0.00 ? 143 GLU A HA   3  
ATOM 11274 H HB2  . GLU A 1 143 ? 61.297  10.320  -5.997  1.00 0.00 ? 143 GLU A HB2  3  
ATOM 11275 H HB3  . GLU A 1 143 ? 61.215  10.068  -7.737  1.00 0.00 ? 143 GLU A HB3  3  
ATOM 11276 H HG2  . GLU A 1 143 ? 60.314  7.906   -5.815  1.00 0.00 ? 143 GLU A HG2  3  
ATOM 11277 H HG3  . GLU A 1 143 ? 59.230  9.217   -6.270  1.00 0.00 ? 143 GLU A HG3  3  
ATOM 11278 N N    . VAL A 1 144 ? 62.789  6.491   -7.529  1.00 0.00 ? 144 VAL A N    3  
ATOM 11279 C CA   . VAL A 1 144 ? 62.869  5.420   -8.533  1.00 0.00 ? 144 VAL A CA   3  
ATOM 11280 C C    . VAL A 1 144 ? 61.576  4.611   -8.579  1.00 0.00 ? 144 VAL A C    3  
ATOM 11281 O O    . VAL A 1 144 ? 61.122  4.087   -7.563  1.00 0.00 ? 144 VAL A O    3  
ATOM 11282 C CB   . VAL A 1 144 ? 64.026  4.458   -8.206  1.00 0.00 ? 144 VAL A CB   3  
ATOM 11283 C CG1  . VAL A 1 144 ? 64.209  3.466   -9.355  1.00 0.00 ? 144 VAL A CG1  3  
ATOM 11284 C CG2  . VAL A 1 144 ? 65.316  5.260   -8.018  1.00 0.00 ? 144 VAL A CG2  3  
ATOM 11285 H H    . VAL A 1 144 ? 62.838  6.257   -6.579  1.00 0.00 ? 144 VAL A H    3  
ATOM 11286 H HA   . VAL A 1 144 ? 63.043  5.847   -9.509  1.00 0.00 ? 144 VAL A HA   3  
ATOM 11287 H HB   . VAL A 1 144 ? 63.800  3.919   -7.297  1.00 0.00 ? 144 VAL A HB   3  
ATOM 11288 H HG11 . VAL A 1 144 ? 64.332  4.006   -10.282 1.00 0.00 ? 144 VAL A HG11 3  
ATOM 11289 H HG12 . VAL A 1 144 ? 63.339  2.828   -9.422  1.00 0.00 ? 144 VAL A HG12 3  
ATOM 11290 H HG13 . VAL A 1 144 ? 65.085  2.861   -9.172  1.00 0.00 ? 144 VAL A HG13 3  
ATOM 11291 H HG21 . VAL A 1 144 ? 66.141  4.583   -7.847  1.00 0.00 ? 144 VAL A HG21 3  
ATOM 11292 H HG22 . VAL A 1 144 ? 65.210  5.919   -7.168  1.00 0.00 ? 144 VAL A HG22 3  
ATOM 11293 H HG23 . VAL A 1 144 ? 65.508  5.846   -8.905  1.00 0.00 ? 144 VAL A HG23 3  
ATOM 11294 N N    . SER A 1 145 ? 60.991  4.510   -9.775  1.00 0.00 ? 145 SER A N    3  
ATOM 11295 C CA   . SER A 1 145 ? 59.745  3.761   -9.967  1.00 0.00 ? 145 SER A CA   3  
ATOM 11296 C C    . SER A 1 145 ? 60.044  2.388   -10.561 1.00 0.00 ? 145 SER A C    3  
ATOM 11297 O O    . SER A 1 145 ? 61.092  2.181   -11.171 1.00 0.00 ? 145 SER A O    3  
ATOM 11298 C CB   . SER A 1 145 ? 58.820  4.530   -10.911 1.00 0.00 ? 145 SER A CB   3  
ATOM 11299 O OG   . SER A 1 145 ? 57.719  3.704   -11.264 1.00 0.00 ? 145 SER A OG   3  
ATOM 11300 H H    . SER A 1 145 ? 61.407  4.950   -10.546 1.00 0.00 ? 145 SER A H    3  
ATOM 11301 H HA   . SER A 1 145 ? 59.244  3.631   -9.017  1.00 0.00 ? 145 SER A HA   3  
ATOM 11302 H HB2  . SER A 1 145 ? 58.455  5.415   -10.417 1.00 0.00 ? 145 SER A HB2  3  
ATOM 11303 H HB3  . SER A 1 145 ? 59.369  4.816   -11.797 1.00 0.00 ? 145 SER A HB3  3  
ATOM 11304 H HG   . SER A 1 145 ? 58.018  3.079   -11.929 1.00 0.00 ? 145 SER A HG   3  
ATOM 11305 N N    . ILE A 1 146 ? 59.110  1.449   -10.377 1.00 0.00 ? 146 ILE A N    3  
ATOM 11306 C CA   . ILE A 1 146 ? 59.272  0.085   -10.896 1.00 0.00 ? 146 ILE A CA   3  
ATOM 11307 C C    . ILE A 1 146 ? 57.936  -0.430  -11.433 1.00 0.00 ? 146 ILE A C    3  
ATOM 11308 O O    . ILE A 1 146 ? 56.878  -0.144  -10.872 1.00 0.00 ? 146 ILE A O    3  
ATOM 11309 C CB   . ILE A 1 146 ? 59.753  -0.900  -9.791  1.00 0.00 ? 146 ILE A CB   3  
ATOM 11310 C CG1  . ILE A 1 146 ? 60.921  -0.303  -8.967  1.00 0.00 ? 146 ILE A CG1  3  
ATOM 11311 C CG2  . ILE A 1 146 ? 60.191  -2.224  -10.429 1.00 0.00 ? 146 ILE A CG2  3  
ATOM 11312 C CD1  . ILE A 1 146 ? 62.238  -0.322  -9.757  1.00 0.00 ? 146 ILE A CD1  3  
ATOM 11313 H H    . ILE A 1 146 ? 58.292  1.679   -9.890  1.00 0.00 ? 146 ILE A H    3  
ATOM 11314 H HA   . ILE A 1 146 ? 59.983  0.087   -11.708 1.00 0.00 ? 146 ILE A HA   3  
ATOM 11315 H HB   . ILE A 1 146 ? 58.925  -1.102  -9.121  1.00 0.00 ? 146 ILE A HB   3  
ATOM 11316 H HG12 . ILE A 1 146 ? 60.686  0.710   -8.688  1.00 0.00 ? 146 ILE A HG12 3  
ATOM 11317 H HG13 . ILE A 1 146 ? 61.045  -0.889  -8.069  1.00 0.00 ? 146 ILE A HG13 3  
ATOM 11318 H HG21 . ILE A 1 146 ? 59.322  -2.744  -10.805 1.00 0.00 ? 146 ILE A HG21 3  
ATOM 11319 H HG22 . ILE A 1 146 ? 60.683  -2.837  -9.688  1.00 0.00 ? 146 ILE A HG22 3  
ATOM 11320 H HG23 . ILE A 1 146 ? 60.873  -2.030  -11.245 1.00 0.00 ? 146 ILE A HG23 3  
ATOM 11321 H HD11 . ILE A 1 146 ? 62.612  -1.335  -9.809  1.00 0.00 ? 146 ILE A HD11 3  
ATOM 11322 H HD12 . ILE A 1 146 ? 62.965  0.299   -9.256  1.00 0.00 ? 146 ILE A HD12 3  
ATOM 11323 H HD13 . ILE A 1 146 ? 62.077  0.053   -10.754 1.00 0.00 ? 146 ILE A HD13 3  
ATOM 11324 N N    . ASP A 1 147 ? 57.995  -1.205  -12.516 1.00 0.00 ? 147 ASP A N    3  
ATOM 11325 C CA   . ASP A 1 147 ? 56.789  -1.776  -13.120 1.00 0.00 ? 147 ASP A CA   3  
ATOM 11326 C C    . ASP A 1 147 ? 57.136  -3.081  -13.836 1.00 0.00 ? 147 ASP A C    3  
ATOM 11327 O O    . ASP A 1 147 ? 57.464  -3.082  -15.023 1.00 0.00 ? 147 ASP A O    3  
ATOM 11328 C CB   . ASP A 1 147 ? 56.160  -0.781  -14.109 1.00 0.00 ? 147 ASP A CB   3  
ATOM 11329 C CG   . ASP A 1 147 ? 56.231  0.634   -13.529 1.00 0.00 ? 147 ASP A CG   3  
ATOM 11330 O OD1  . ASP A 1 147 ? 55.396  0.957   -12.702 1.00 0.00 ? 147 ASP A OD1  3  
ATOM 11331 O OD2  . ASP A 1 147 ? 57.123  1.369   -13.923 1.00 0.00 ? 147 ASP A OD2  3  
ATOM 11332 H H    . ASP A 1 147 ? 58.869  -1.406  -12.912 1.00 0.00 ? 147 ASP A H    3  
ATOM 11333 H HA   . ASP A 1 147 ? 56.075  -1.991  -12.341 1.00 0.00 ? 147 ASP A HA   3  
ATOM 11334 H HB2  . ASP A 1 147 ? 56.692  -0.810  -15.045 1.00 0.00 ? 147 ASP A HB2  3  
ATOM 11335 H HB3  . ASP A 1 147 ? 55.125  -1.043  -14.278 1.00 0.00 ? 147 ASP A HB3  3  
ATOM 11336 N N    . ILE A 1 148 ? 57.078  -4.193  -13.099 1.00 0.00 ? 148 ILE A N    3  
ATOM 11337 C CA   . ILE A 1 148 ? 57.406  -5.506  -13.659 1.00 0.00 ? 148 ILE A CA   3  
ATOM 11338 C C    . ILE A 1 148 ? 56.188  -6.133  -14.335 1.00 0.00 ? 148 ILE A C    3  
ATOM 11339 O O    . ILE A 1 148 ? 55.051  -5.921  -13.913 1.00 0.00 ? 148 ILE A O    3  
ATOM 11340 C CB   . ILE A 1 148 ? 57.905  -6.458  -12.546 1.00 0.00 ? 148 ILE A CB   3  
ATOM 11341 C CG1  . ILE A 1 148 ? 58.896  -5.700  -11.650 1.00 0.00 ? 148 ILE A CG1  3  
ATOM 11342 C CG2  . ILE A 1 148 ? 58.599  -7.676  -13.168 1.00 0.00 ? 148 ILE A CG2  3  
ATOM 11343 C CD1  . ILE A 1 148 ? 59.495  -6.643  -10.596 1.00 0.00 ? 148 ILE A CD1  3  
ATOM 11344 H H    . ILE A 1 148 ? 56.821  -4.127  -12.155 1.00 0.00 ? 148 ILE A H    3  
ATOM 11345 H HA   . ILE A 1 148 ? 58.191  -5.392  -14.392 1.00 0.00 ? 148 ILE A HA   3  
ATOM 11346 H HB   . ILE A 1 148 ? 57.066  -6.791  -11.951 1.00 0.00 ? 148 ILE A HB   3  
ATOM 11347 H HG12 . ILE A 1 148 ? 59.690  -5.293  -12.261 1.00 0.00 ? 148 ILE A HG12 3  
ATOM 11348 H HG13 . ILE A 1 148 ? 58.378  -4.892  -11.154 1.00 0.00 ? 148 ILE A HG13 3  
ATOM 11349 H HG21 . ILE A 1 148 ? 58.769  -8.423  -12.407 1.00 0.00 ? 148 ILE A HG21 3  
ATOM 11350 H HG22 . ILE A 1 148 ? 59.544  -7.375  -13.593 1.00 0.00 ? 148 ILE A HG22 3  
ATOM 11351 H HG23 . ILE A 1 148 ? 57.975  -8.093  -13.942 1.00 0.00 ? 148 ILE A HG23 3  
ATOM 11352 H HD11 . ILE A 1 148 ? 58.724  -7.296  -10.209 1.00 0.00 ? 148 ILE A HD11 3  
ATOM 11353 H HD12 . ILE A 1 148 ? 59.909  -6.061  -9.785  1.00 0.00 ? 148 ILE A HD12 3  
ATOM 11354 H HD13 . ILE A 1 148 ? 60.279  -7.236  -11.045 1.00 0.00 ? 148 ILE A HD13 3  
ATOM 11355 N N    . ARG A 1 149 ? 56.442  -6.920  -15.380 1.00 0.00 ? 149 ARG A N    3  
ATOM 11356 C CA   . ARG A 1 149 ? 55.374  -7.600  -16.115 1.00 0.00 ? 149 ARG A CA   3  
ATOM 11357 C C    . ARG A 1 149 ? 55.898  -8.934  -16.661 1.00 0.00 ? 149 ARG A C    3  
ATOM 11358 O O    . ARG A 1 149 ? 57.062  -9.280  -16.459 1.00 0.00 ? 149 ARG A O    3  
ATOM 11359 C CB   . ARG A 1 149 ? 54.859  -6.686  -17.257 1.00 0.00 ? 149 ARG A CB   3  
ATOM 11360 C CG   . ARG A 1 149 ? 53.334  -6.862  -17.466 1.00 0.00 ? 149 ARG A CG   3  
ATOM 11361 C CD   . ARG A 1 149 ? 52.550  -5.999  -16.464 1.00 0.00 ? 149 ARG A CD   3  
ATOM 11362 N NE   . ARG A 1 149 ? 52.559  -4.580  -16.918 1.00 0.00 ? 149 ARG A NE   3  
ATOM 11363 C CZ   . ARG A 1 149 ? 51.977  -3.662  -16.195 1.00 0.00 ? 149 ARG A CZ   3  
ATOM 11364 N NH1  . ARG A 1 149 ? 50.978  -3.980  -15.418 1.00 0.00 ? 149 ARG A NH1  3  
ATOM 11365 N NH2  . ARG A 1 149 ? 52.393  -2.426  -16.251 1.00 0.00 ? 149 ARG A NH2  3  
ATOM 11366 H H    . ARG A 1 149 ? 57.373  -7.057  -15.656 1.00 0.00 ? 149 ARG A H    3  
ATOM 11367 H HA   . ARG A 1 149 ? 54.562  -7.814  -15.431 1.00 0.00 ? 149 ARG A HA   3  
ATOM 11368 H HB2  . ARG A 1 149 ? 55.069  -5.656  -17.004 1.00 0.00 ? 149 ARG A HB2  3  
ATOM 11369 H HB3  . ARG A 1 149 ? 55.372  -6.928  -18.176 1.00 0.00 ? 149 ARG A HB3  3  
ATOM 11370 H HG2  . ARG A 1 149 ? 53.073  -6.562  -18.471 1.00 0.00 ? 149 ARG A HG2  3  
ATOM 11371 H HG3  . ARG A 1 149 ? 53.067  -7.899  -17.326 1.00 0.00 ? 149 ARG A HG3  3  
ATOM 11372 H HD2  . ARG A 1 149 ? 51.529  -6.349  -16.409 1.00 0.00 ? 149 ARG A HD2  3  
ATOM 11373 H HD3  . ARG A 1 149 ? 53.005  -6.067  -15.488 1.00 0.00 ? 149 ARG A HD3  3  
ATOM 11374 H HE   . ARG A 1 149 ? 53.003  -4.335  -17.757 1.00 0.00 ? 149 ARG A HE   3  
ATOM 11375 H HH11 . ARG A 1 149 ? 50.660  -4.927  -15.375 1.00 0.00 ? 149 ARG A HH11 3  
ATOM 11376 H HH12 . ARG A 1 149 ? 50.532  -3.277  -14.865 1.00 0.00 ? 149 ARG A HH12 3  
ATOM 11377 H HH21 . ARG A 1 149 ? 53.158  -2.182  -16.846 1.00 0.00 ? 149 ARG A HH21 3  
ATOM 11378 H HH22 . ARG A 1 149 ? 51.946  -1.723  -15.698 1.00 0.00 ? 149 ARG A HH22 3  
ATOM 11379 N N    . CYS A 1 150 ? 55.027  -9.687  -17.329 1.00 0.00 ? 150 CYS A N    3  
ATOM 11380 C CA   . CYS A 1 150 ? 55.396  -10.996 -17.879 1.00 0.00 ? 150 CYS A CA   3  
ATOM 11381 C C    . CYS A 1 150 ? 55.892  -10.875 -19.324 1.00 0.00 ? 150 CYS A C    3  
ATOM 11382 O O    . CYS A 1 150 ? 55.185  -10.349 -20.184 1.00 0.00 ? 150 CYS A O    3  
ATOM 11383 C CB   . CYS A 1 150 ? 54.163  -11.916 -17.822 1.00 0.00 ? 150 CYS A CB   3  
ATOM 11384 S SG   . CYS A 1 150 ? 54.680  -13.649 -17.720 1.00 0.00 ? 150 CYS A SG   3  
ATOM 11385 H H    . CYS A 1 150 ? 54.110  -9.366  -17.446 1.00 0.00 ? 150 CYS A H    3  
ATOM 11386 H HA   . CYS A 1 150 ? 56.181  -11.432 -17.275 1.00 0.00 ? 150 CYS A HA   3  
ATOM 11387 H HB2  . CYS A 1 150 ? 53.580  -11.672 -16.946 1.00 0.00 ? 150 CYS A HB2  3  
ATOM 11388 H HB3  . CYS A 1 150 ? 53.553  -11.773 -18.703 1.00 0.00 ? 150 CYS A HB3  3  
ATOM 11389 N N    . SER A 1 151 ? 57.101  -11.387 -19.591 1.00 0.00 ? 151 SER A N    3  
ATOM 11390 C CA   . SER A 1 151 ? 57.675  -11.356 -20.942 1.00 0.00 ? 151 SER A CA   3  
ATOM 11391 C C    . SER A 1 151 ? 57.700  -12.771 -21.517 1.00 0.00 ? 151 SER A C    3  
ATOM 11392 O O    . SER A 1 151 ? 57.584  -13.748 -20.777 1.00 0.00 ? 151 SER A O    3  
ATOM 11393 C CB   . SER A 1 151 ? 59.101  -10.802 -20.889 1.00 0.00 ? 151 SER A CB   3  
ATOM 11394 O OG   . SER A 1 151 ? 59.772  -11.119 -22.102 1.00 0.00 ? 151 SER A OG   3  
ATOM 11395 H H    . SER A 1 151 ? 57.618  -11.813 -18.874 1.00 0.00 ? 151 SER A H    3  
ATOM 11396 H HA   . SER A 1 151 ? 57.076  -10.726 -21.586 1.00 0.00 ? 151 SER A HA   3  
ATOM 11397 H HB2  . SER A 1 151 ? 59.069  -9.732  -20.771 1.00 0.00 ? 151 SER A HB2  3  
ATOM 11398 H HB3  . SER A 1 151 ? 59.626  -11.239 -20.050 1.00 0.00 ? 151 SER A HB3  3  
ATOM 11399 H HG   . SER A 1 151 ? 59.565  -12.029 -22.326 1.00 0.00 ? 151 SER A HG   3  
ATOM 11400 N N    . GLU A 1 152 ? 57.842  -12.881 -22.841 1.00 0.00 ? 152 GLU A N    3  
ATOM 11401 C CA   . GLU A 1 152 ? 57.869  -14.193 -23.502 1.00 0.00 ? 152 GLU A CA   3  
ATOM 11402 C C    . GLU A 1 152 ? 58.918  -14.224 -24.610 1.00 0.00 ? 152 GLU A C    3  
ATOM 11403 O O    . GLU A 1 152 ? 58.870  -15.078 -25.495 1.00 0.00 ? 152 GLU A O    3  
ATOM 11404 C CB   . GLU A 1 152 ? 56.493  -14.510 -24.099 1.00 0.00 ? 152 GLU A CB   3  
ATOM 11405 C CG   . GLU A 1 152 ? 55.394  -14.266 -23.052 1.00 0.00 ? 152 GLU A CG   3  
ATOM 11406 C CD   . GLU A 1 152 ? 55.138  -12.763 -22.895 1.00 0.00 ? 152 GLU A CD   3  
ATOM 11407 O OE1  . GLU A 1 152 ? 55.706  -11.999 -23.659 1.00 0.00 ? 152 GLU A OE1  3  
ATOM 11408 O OE2  . GLU A 1 152 ? 54.378  -12.401 -22.013 1.00 0.00 ? 152 GLU A OE2  3  
ATOM 11409 H H    . GLU A 1 152 ? 57.925  -12.070 -23.383 1.00 0.00 ? 152 GLU A H    3  
ATOM 11410 H HA   . GLU A 1 152 ? 58.114  -14.960 -22.777 1.00 0.00 ? 152 GLU A HA   3  
ATOM 11411 H HB2  . GLU A 1 152 ? 56.320  -13.881 -24.961 1.00 0.00 ? 152 GLU A HB2  3  
ATOM 11412 H HB3  . GLU A 1 152 ? 56.468  -15.546 -24.405 1.00 0.00 ? 152 GLU A HB3  3  
ATOM 11413 H HG2  . GLU A 1 152 ? 54.483  -14.751 -23.372 1.00 0.00 ? 152 GLU A HG2  3  
ATOM 11414 H HG3  . GLU A 1 152 ? 55.702  -14.676 -22.101 1.00 0.00 ? 152 GLU A HG3  3  
ATOM 11415 N N    . GLU A 1 153 ? 59.865  -13.294 -24.555 1.00 0.00 ? 153 GLU A N    3  
ATOM 11416 C CA   . GLU A 1 153 ? 60.924  -13.233 -25.563 1.00 0.00 ? 153 GLU A CA   3  
ATOM 11417 C C    . GLU A 1 153 ? 61.954  -14.334 -25.316 1.00 0.00 ? 153 GLU A C    3  
ATOM 11418 O O    . GLU A 1 153 ? 62.786  -14.228 -24.414 1.00 0.00 ? 153 GLU A O    3  
ATOM 11419 C CB   . GLU A 1 153 ? 61.604  -11.854 -25.520 1.00 0.00 ? 153 GLU A CB   3  
ATOM 11420 C CG   . GLU A 1 153 ? 60.700  -10.800 -26.175 1.00 0.00 ? 153 GLU A CG   3  
ATOM 11421 C CD   . GLU A 1 153 ? 59.317  -10.818 -25.517 1.00 0.00 ? 153 GLU A CD   3  
ATOM 11422 O OE1  . GLU A 1 153 ? 58.536  -11.693 -25.850 1.00 0.00 ? 153 GLU A OE1  3  
ATOM 11423 O OE2  . GLU A 1 153 ? 59.063  -9.955  -24.693 1.00 0.00 ? 153 GLU A OE2  3  
ATOM 11424 H H    . GLU A 1 153 ? 59.858  -12.640 -23.825 1.00 0.00 ? 153 GLU A H    3  
ATOM 11425 H HA   . GLU A 1 153 ? 60.488  -13.379 -26.542 1.00 0.00 ? 153 GLU A HA   3  
ATOM 11426 H HB2  . GLU A 1 153 ? 61.790  -11.579 -24.492 1.00 0.00 ? 153 GLU A HB2  3  
ATOM 11427 H HB3  . GLU A 1 153 ? 62.544  -11.896 -26.054 1.00 0.00 ? 153 GLU A HB3  3  
ATOM 11428 H HG2  . GLU A 1 153 ? 61.143  -9.822  -26.053 1.00 0.00 ? 153 GLU A HG2  3  
ATOM 11429 H HG3  . GLU A 1 153 ? 60.597  -11.020 -27.227 1.00 0.00 ? 153 GLU A HG3  3  
ATOM 11430 N N    . GLU A 1 154 ? 61.886  -15.393 -26.121 1.00 0.00 ? 154 GLU A N    3  
ATOM 11431 C CA   . GLU A 1 154 ? 62.808  -16.521 -25.984 1.00 0.00 ? 154 GLU A CA   3  
ATOM 11432 C C    . GLU A 1 154 ? 64.131  -16.242 -26.696 1.00 0.00 ? 154 GLU A C    3  
ATOM 11433 O O    . GLU A 1 154 ? 64.969  -17.135 -26.827 1.00 0.00 ? 154 GLU A O    3  
ATOM 11434 C CB   . GLU A 1 154 ? 62.173  -17.781 -26.575 1.00 0.00 ? 154 GLU A CB   3  
ATOM 11435 C CG   . GLU A 1 154 ? 60.828  -18.042 -25.895 1.00 0.00 ? 154 GLU A CG   3  
ATOM 11436 C CD   . GLU A 1 154 ? 60.201  -19.312 -26.474 1.00 0.00 ? 154 GLU A CD   3  
ATOM 11437 O OE1  . GLU A 1 154 ? 60.898  -20.310 -26.551 1.00 0.00 ? 154 GLU A OE1  3  
ATOM 11438 O OE2  . GLU A 1 154 ? 59.035  -19.263 -26.832 1.00 0.00 ? 154 GLU A OE2  3  
ATOM 11439 H H    . GLU A 1 154 ? 61.195  -15.421 -26.815 1.00 0.00 ? 154 GLU A H    3  
ATOM 11440 H HA   . GLU A 1 154 ? 63.006  -16.694 -24.936 1.00 0.00 ? 154 GLU A HA   3  
ATOM 11441 H HB2  . GLU A 1 154 ? 62.021  -17.643 -27.635 1.00 0.00 ? 154 GLU A HB2  3  
ATOM 11442 H HB3  . GLU A 1 154 ? 62.828  -18.624 -26.412 1.00 0.00 ? 154 GLU A HB3  3  
ATOM 11443 H HG2  . GLU A 1 154 ? 60.979  -18.166 -24.833 1.00 0.00 ? 154 GLU A HG2  3  
ATOM 11444 H HG3  . GLU A 1 154 ? 60.167  -17.206 -26.070 1.00 0.00 ? 154 GLU A HG3  3  
ATOM 11445 N N    . LYS A 1 155 ? 64.317  -15.009 -27.154 1.00 0.00 ? 155 LYS A N    3  
ATOM 11446 C CA   . LYS A 1 155 ? 65.549  -14.647 -27.850 1.00 0.00 ? 155 LYS A CA   3  
ATOM 11447 C C    . LYS A 1 155 ? 66.763  -15.029 -27.000 1.00 0.00 ? 155 LYS A C    3  
ATOM 11448 O O    . LYS A 1 155 ? 66.620  -15.465 -25.858 1.00 0.00 ? 155 LYS A O    3  
ATOM 11449 C CB   . LYS A 1 155 ? 65.562  -13.136 -28.153 1.00 0.00 ? 155 LYS A CB   3  
ATOM 11450 C CG   . LYS A 1 155 ? 64.696  -12.832 -29.384 1.00 0.00 ? 155 LYS A CG   3  
ATOM 11451 C CD   . LYS A 1 155 ? 63.272  -13.363 -29.168 1.00 0.00 ? 155 LYS A CD   3  
ATOM 11452 C CE   . LYS A 1 155 ? 62.332  -12.760 -30.214 1.00 0.00 ? 155 LYS A CE   3  
ATOM 11453 N NZ   . LYS A 1 155 ? 62.758  -13.193 -31.575 1.00 0.00 ? 155 LYS A NZ   3  
ATOM 11454 H H    . LYS A 1 155 ? 63.618  -14.334 -27.025 1.00 0.00 ? 155 LYS A H    3  
ATOM 11455 H HA   . LYS A 1 155 ? 65.597  -15.195 -28.781 1.00 0.00 ? 155 LYS A HA   3  
ATOM 11456 H HB2  . LYS A 1 155 ? 65.173  -12.597 -27.304 1.00 0.00 ? 155 LYS A HB2  3  
ATOM 11457 H HB3  . LYS A 1 155 ? 66.576  -12.812 -28.348 1.00 0.00 ? 155 LYS A HB3  3  
ATOM 11458 H HG2  . LYS A 1 155 ? 64.664  -11.763 -29.541 1.00 0.00 ? 155 LYS A HG2  3  
ATOM 11459 H HG3  . LYS A 1 155 ? 65.126  -13.309 -30.252 1.00 0.00 ? 155 LYS A HG3  3  
ATOM 11460 H HD2  . LYS A 1 155 ? 63.272  -14.439 -29.266 1.00 0.00 ? 155 LYS A HD2  3  
ATOM 11461 H HD3  . LYS A 1 155 ? 62.930  -13.090 -28.180 1.00 0.00 ? 155 LYS A HD3  3  
ATOM 11462 H HE2  . LYS A 1 155 ? 61.323  -13.097 -30.027 1.00 0.00 ? 155 LYS A HE2  3  
ATOM 11463 H HE3  . LYS A 1 155 ? 62.367  -11.682 -30.152 1.00 0.00 ? 155 LYS A HE3  3  
ATOM 11464 H HZ1  . LYS A 1 155 ? 62.080  -13.890 -31.944 1.00 0.00 ? 155 LYS A HZ1  3  
ATOM 11465 H HZ2  . LYS A 1 155 ? 63.704  -13.624 -31.520 1.00 0.00 ? 155 LYS A HZ2  3  
ATOM 11466 H HZ3  . LYS A 1 155 ? 62.785  -12.370 -32.208 1.00 0.00 ? 155 LYS A HZ3  3  
ATOM 11467 N N    . ASP A 1 156 ? 67.957  -14.868 -27.569 1.00 0.00 ? 156 ASP A N    3  
ATOM 11468 C CA   . ASP A 1 156 ? 69.191  -15.203 -26.858 1.00 0.00 ? 156 ASP A CA   3  
ATOM 11469 C C    . ASP A 1 156 ? 69.597  -14.067 -25.924 1.00 0.00 ? 156 ASP A C    3  
ATOM 11470 O O    . ASP A 1 156 ? 69.011  -12.985 -25.956 1.00 0.00 ? 156 ASP A O    3  
ATOM 11471 C CB   . ASP A 1 156 ? 70.315  -15.461 -27.864 1.00 0.00 ? 156 ASP A CB   3  
ATOM 11472 C CG   . ASP A 1 156 ? 69.972  -16.691 -28.708 1.00 0.00 ? 156 ASP A CG   3  
ATOM 11473 O OD1  . ASP A 1 156 ? 70.090  -17.790 -28.192 1.00 0.00 ? 156 ASP A OD1  3  
ATOM 11474 O OD2  . ASP A 1 156 ? 69.596  -16.511 -29.854 1.00 0.00 ? 156 ASP A OD2  3  
ATOM 11475 H H    . ASP A 1 156 ? 68.009  -14.523 -28.484 1.00 0.00 ? 156 ASP A H    3  
ATOM 11476 H HA   . ASP A 1 156 ? 69.035  -16.098 -26.274 1.00 0.00 ? 156 ASP A HA   3  
ATOM 11477 H HB2  . ASP A 1 156 ? 70.426  -14.601 -28.508 1.00 0.00 ? 156 ASP A HB2  3  
ATOM 11478 H HB3  . ASP A 1 156 ? 71.239  -15.638 -27.334 1.00 0.00 ? 156 ASP A HB3  3  
ATOM 11479 N N    . SER A 1 157 ? 70.606  -14.321 -25.089 1.00 0.00 ? 157 SER A N    3  
ATOM 11480 C CA   . SER A 1 157 ? 71.092  -13.315 -24.139 1.00 0.00 ? 157 SER A CA   3  
ATOM 11481 C C    . SER A 1 157 ? 72.282  -12.553 -24.716 1.00 0.00 ? 157 SER A C    3  
ATOM 11482 O O    . SER A 1 157 ? 73.122  -13.125 -25.411 1.00 0.00 ? 157 SER A O    3  
ATOM 11483 C CB   . SER A 1 157 ? 71.513  -14.000 -22.838 1.00 0.00 ? 157 SER A CB   3  
ATOM 11484 O OG   . SER A 1 157 ? 70.368  -14.560 -22.209 1.00 0.00 ? 157 SER A OG   3  
ATOM 11485 H H    . SER A 1 157 ? 71.032  -15.203 -25.110 1.00 0.00 ? 157 SER A H    3  
ATOM 11486 H HA   . SER A 1 157 ? 70.300  -12.612 -23.917 1.00 0.00 ? 157 SER A HA   3  
ATOM 11487 H HB2  . SER A 1 157 ? 72.219  -14.784 -23.054 1.00 0.00 ? 157 SER A HB2  3  
ATOM 11488 H HB3  . SER A 1 157 ? 71.977  -13.272 -22.184 1.00 0.00 ? 157 SER A HB3  3  
ATOM 11489 H HG   . SER A 1 157 ? 70.422  -15.515 -22.292 1.00 0.00 ? 157 SER A HG   3  
ATOM 11490 N N    . ASP A 1 158 ? 72.351  -11.254 -24.410 1.00 0.00 ? 158 ASP A N    3  
ATOM 11491 C CA   . ASP A 1 158 ? 73.445  -10.393 -24.882 1.00 0.00 ? 158 ASP A CA   3  
ATOM 11492 C C    . ASP A 1 158 ? 74.271  -9.910  -23.693 1.00 0.00 ? 158 ASP A C    3  
ATOM 11493 O O    . ASP A 1 158 ? 73.944  -8.901  -23.068 1.00 0.00 ? 158 ASP A O    3  
ATOM 11494 C CB   . ASP A 1 158 ? 72.870  -9.188  -25.628 1.00 0.00 ? 158 ASP A CB   3  
ATOM 11495 C CG   . ASP A 1 158 ? 72.186  -9.660  -26.912 1.00 0.00 ? 158 ASP A CG   3  
ATOM 11496 O OD1  . ASP A 1 158 ? 72.693  -10.585 -27.526 1.00 0.00 ? 158 ASP A OD1  3  
ATOM 11497 O OD2  . ASP A 1 158 ? 71.164  -9.091  -27.259 1.00 0.00 ? 158 ASP A OD2  3  
ATOM 11498 H H    . ASP A 1 158 ? 71.653  -10.864 -23.843 1.00 0.00 ? 158 ASP A H    3  
ATOM 11499 H HA   . ASP A 1 158 ? 74.088  -10.948 -25.554 1.00 0.00 ? 158 ASP A HA   3  
ATOM 11500 H HB2  . ASP A 1 158 ? 72.151  -8.684  -24.999 1.00 0.00 ? 158 ASP A HB2  3  
ATOM 11501 H HB3  . ASP A 1 158 ? 73.669  -8.506  -25.880 1.00 0.00 ? 158 ASP A HB3  3  
ATOM 11502 N N    . ILE A 1 159 ? 75.332  -10.653 -23.374 1.00 0.00 ? 159 ILE A N    3  
ATOM 11503 C CA   . ILE A 1 159 ? 76.204  -10.324 -22.238 1.00 0.00 ? 159 ILE A CA   3  
ATOM 11504 C C    . ILE A 1 159 ? 77.655  -10.165 -22.691 1.00 0.00 ? 159 ILE A C    3  
ATOM 11505 O O    . ILE A 1 159 ? 78.034  -10.622 -23.771 1.00 0.00 ? 159 ILE A O    3  
ATOM 11506 C CB   . ILE A 1 159 ? 76.132  -11.457 -21.188 1.00 0.00 ? 159 ILE A CB   3  
ATOM 11507 C CG1  . ILE A 1 159 ? 74.709  -11.494 -20.597 1.00 0.00 ? 159 ILE A CG1  3  
ATOM 11508 C CG2  . ILE A 1 159 ? 77.160  -11.221 -20.072 1.00 0.00 ? 159 ILE A CG2  3  
ATOM 11509 C CD1  . ILE A 1 159 ? 74.496  -12.759 -19.730 1.00 0.00 ? 159 ILE A CD1  3  
ATOM 11510 H H    . ILE A 1 159 ? 75.526  -11.454 -23.904 1.00 0.00