data_2FJX
# 
_entry.id   2FJX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FJX         
NDB   PD0758       
RCSB  RCSB035965   
WWPDB D_1000035965 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2FJW 'D(CTTGAATGCATTCAAG) in complex with MMLV RT catalytic fragment'                                                          
unspecified 
PDB 2FJV 'RT29 bound to d(CTTAATTCGAATTAAG) COMPLEXED WITH MOLONEY MURINE LEUKEMIA VIRUS REVERSE TRANSCRIPTASE CATALYTIC FRAGMENT' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FJX 
_pdbx_database_status.recvd_initial_deposition_date   2006-01-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Goodwin, K.D.'    1 
'Georgiadis, M.M.' 2 
# 
_citation.id                        primary 
_citation.title                     
;A High-Throughput, High-Resolution Strategy for the Study of Site-Selective DNA Binding Agents: Analysis of a "Highly Twisted" Benzimidazole-Diamidine.
;
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            128 
_citation.page_first                7846 
_citation.page_last                 7854 
_citation.year                      2006 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16771498 
_citation.pdbx_database_id_DOI      10.1021/ja0600936 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Goodwin, K.D.'    1 
primary 'Lewis, M.A.'      2 
primary 'Tanious, F.A.'    3 
primary 'Tidwell, R.R.'    4 
primary 'Wilson, W.D.'     5 
primary 'Georgiadis, M.M.' 6 
primary 'Long, E.C.'       7 
# 
_cell.entry_id           2FJX 
_cell.length_a           54.749 
_cell.length_b           145.45 
_cell.length_c           46.855 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2FJX 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*CP*TP*TP*GP*AP*AP*TP*G)-3'"                                            2441.628  1   ?        ? ? ? 
2 polymer     syn "5'-D(P*CP*AP*TP*TP*CP*AP*AP*G)-3'"                                           2410.618  1   ?        ? ? ? 
3 polymer     man 'Reverse transcriptase'                                                       28934.287 1   2.7.7.49 ? 
'RT catalytic domain' ? 
4 non-polymer syn '2-(4-(4-CARBAMIMIDOYLPHENOXY)PHENYL)-1H-BENZO[D]IMIDAZOLE-6-CARBOXIMIDAMIDE' 370.407   1   ?        ? ? ? 
5 water       nat water                                                                         18.015    225 ?        ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        RT 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DT)(DT)(DG)(DA)(DA)(DT)(DG)' CTTGAATG B ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DC)(DA)(DA)(DG)' CATTCAAG G ? 
3 'polypeptide(L)'        no no 
;TWLSDFPQAWAETGGMGLAVRQAPLIIPLKATSTPVSIKQYPMSQEARLGIKPHIQRLLDQGILVPCQSPWNTPLLPVKK
PGTNDYRPVQDLREVNKRVEDIHPTVPNPYNLLSGLPPSHQWYTVLDLKDAFFCLRLHPTSQPLFAFEWRDPEMGISGQL
TWTRLPQGFKNSPTLFDEALHRDLADFRIQHPDLILLQYVDDLLLAATSELDCQQGTRALLQTLGNLGYRASAKKAQICQ
KQVKYLGYLLKEGQR
;
;TWLSDFPQAWAETGGMGLAVRQAPLIIPLKATSTPVSIKQYPMSQEARLGIKPHIQRLLDQGILVPCQSPWNTPLLPVKK
PGTNDYRPVQDLREVNKRVEDIHPTVPNPYNLLSGLPPSHQWYTVLDLKDAFFCLRLHPTSQPLFAFEWRDPEMGISGQL
TWTRLPQGFKNSPTLFDEALHRDLADFRIQHPDLILLQYVDDLLLAATSELDCQQGTRALLQTLGNLGYRASAKKAQICQ
KQVKYLGYLLKEGQR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DT  n 
1 3   DT  n 
1 4   DG  n 
1 5   DA  n 
1 6   DA  n 
1 7   DT  n 
1 8   DG  n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DC  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
3 1   THR n 
3 2   TRP n 
3 3   LEU n 
3 4   SER n 
3 5   ASP n 
3 6   PHE n 
3 7   PRO n 
3 8   GLN n 
3 9   ALA n 
3 10  TRP n 
3 11  ALA n 
3 12  GLU n 
3 13  THR n 
3 14  GLY n 
3 15  GLY n 
3 16  MET n 
3 17  GLY n 
3 18  LEU n 
3 19  ALA n 
3 20  VAL n 
3 21  ARG n 
3 22  GLN n 
3 23  ALA n 
3 24  PRO n 
3 25  LEU n 
3 26  ILE n 
3 27  ILE n 
3 28  PRO n 
3 29  LEU n 
3 30  LYS n 
3 31  ALA n 
3 32  THR n 
3 33  SER n 
3 34  THR n 
3 35  PRO n 
3 36  VAL n 
3 37  SER n 
3 38  ILE n 
3 39  LYS n 
3 40  GLN n 
3 41  TYR n 
3 42  PRO n 
3 43  MET n 
3 44  SER n 
3 45  GLN n 
3 46  GLU n 
3 47  ALA n 
3 48  ARG n 
3 49  LEU n 
3 50  GLY n 
3 51  ILE n 
3 52  LYS n 
3 53  PRO n 
3 54  HIS n 
3 55  ILE n 
3 56  GLN n 
3 57  ARG n 
3 58  LEU n 
3 59  LEU n 
3 60  ASP n 
3 61  GLN n 
3 62  GLY n 
3 63  ILE n 
3 64  LEU n 
3 65  VAL n 
3 66  PRO n 
3 67  CYS n 
3 68  GLN n 
3 69  SER n 
3 70  PRO n 
3 71  TRP n 
3 72  ASN n 
3 73  THR n 
3 74  PRO n 
3 75  LEU n 
3 76  LEU n 
3 77  PRO n 
3 78  VAL n 
3 79  LYS n 
3 80  LYS n 
3 81  PRO n 
3 82  GLY n 
3 83  THR n 
3 84  ASN n 
3 85  ASP n 
3 86  TYR n 
3 87  ARG n 
3 88  PRO n 
3 89  VAL n 
3 90  GLN n 
3 91  ASP n 
3 92  LEU n 
3 93  ARG n 
3 94  GLU n 
3 95  VAL n 
3 96  ASN n 
3 97  LYS n 
3 98  ARG n 
3 99  VAL n 
3 100 GLU n 
3 101 ASP n 
3 102 ILE n 
3 103 HIS n 
3 104 PRO n 
3 105 THR n 
3 106 VAL n 
3 107 PRO n 
3 108 ASN n 
3 109 PRO n 
3 110 TYR n 
3 111 ASN n 
3 112 LEU n 
3 113 LEU n 
3 114 SER n 
3 115 GLY n 
3 116 LEU n 
3 117 PRO n 
3 118 PRO n 
3 119 SER n 
3 120 HIS n 
3 121 GLN n 
3 122 TRP n 
3 123 TYR n 
3 124 THR n 
3 125 VAL n 
3 126 LEU n 
3 127 ASP n 
3 128 LEU n 
3 129 LYS n 
3 130 ASP n 
3 131 ALA n 
3 132 PHE n 
3 133 PHE n 
3 134 CYS n 
3 135 LEU n 
3 136 ARG n 
3 137 LEU n 
3 138 HIS n 
3 139 PRO n 
3 140 THR n 
3 141 SER n 
3 142 GLN n 
3 143 PRO n 
3 144 LEU n 
3 145 PHE n 
3 146 ALA n 
3 147 PHE n 
3 148 GLU n 
3 149 TRP n 
3 150 ARG n 
3 151 ASP n 
3 152 PRO n 
3 153 GLU n 
3 154 MET n 
3 155 GLY n 
3 156 ILE n 
3 157 SER n 
3 158 GLY n 
3 159 GLN n 
3 160 LEU n 
3 161 THR n 
3 162 TRP n 
3 163 THR n 
3 164 ARG n 
3 165 LEU n 
3 166 PRO n 
3 167 GLN n 
3 168 GLY n 
3 169 PHE n 
3 170 LYS n 
3 171 ASN n 
3 172 SER n 
3 173 PRO n 
3 174 THR n 
3 175 LEU n 
3 176 PHE n 
3 177 ASP n 
3 178 GLU n 
3 179 ALA n 
3 180 LEU n 
3 181 HIS n 
3 182 ARG n 
3 183 ASP n 
3 184 LEU n 
3 185 ALA n 
3 186 ASP n 
3 187 PHE n 
3 188 ARG n 
3 189 ILE n 
3 190 GLN n 
3 191 HIS n 
3 192 PRO n 
3 193 ASP n 
3 194 LEU n 
3 195 ILE n 
3 196 LEU n 
3 197 LEU n 
3 198 GLN n 
3 199 TYR n 
3 200 VAL n 
3 201 ASP n 
3 202 ASP n 
3 203 LEU n 
3 204 LEU n 
3 205 LEU n 
3 206 ALA n 
3 207 ALA n 
3 208 THR n 
3 209 SER n 
3 210 GLU n 
3 211 LEU n 
3 212 ASP n 
3 213 CYS n 
3 214 GLN n 
3 215 GLN n 
3 216 GLY n 
3 217 THR n 
3 218 ARG n 
3 219 ALA n 
3 220 LEU n 
3 221 LEU n 
3 222 GLN n 
3 223 THR n 
3 224 LEU n 
3 225 GLY n 
3 226 ASN n 
3 227 LEU n 
3 228 GLY n 
3 229 TYR n 
3 230 ARG n 
3 231 ALA n 
3 232 SER n 
3 233 ALA n 
3 234 LYS n 
3 235 LYS n 
3 236 ALA n 
3 237 GLN n 
3 238 ILE n 
3 239 CYS n 
3 240 GLN n 
3 241 LYS n 
3 242 GLN n 
3 243 VAL n 
3 244 LYS n 
3 245 TYR n 
3 246 LEU n 
3 247 GLY n 
3 248 TYR n 
3 249 LEU n 
3 250 LEU n 
3 251 LYS n 
3 252 GLU n 
3 253 GLY n 
3 254 GLN n 
3 255 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Gammaretrovirus 
_entity_src_gen.pdbx_gene_src_gene                 POL 
_entity_src_gen.gene_src_species                   'Murine leukemia virus' 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Moloney murine leukemia virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11801 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POL_MLVMO P03355 3 
;TWLSDFPQAWAETGGMGLAVRQAPLIIPLKATSTPVSIKQYPMSQEARLGIKPHIQRLLDQGILVPCQSPWNTPLLPVKK
PGTNDYRPVQDLREVNKRVEDIHPTVPNPYNLLSGLPPSHQWYTVLDLKDAFFCLRLHPTSQPLFAFEWRDPEMGISGQL
TWTRLPQGFKNSPTLFDEALHRDLADFRIQHPDLILLQYVDDLLLAATSELDCQQGTRALLQTLGNLGYRASAKKAQICQ
KQVKYLGYLLKEGQR
;
144 ? 
2 PDB 2FJX      2FJX   1 ? ?   ? 
3 PDB 2FJX      2FJX   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2FJX A 1 ? 255 ? P03355 144 ? 398 ? 24 278 
2 2 2FJX B 1 ? 8   ? 2FJX   1   ? 8   ? 1  8   
3 3 2FJX G 1 ? 8   ? 2FJX   9   ? 16  ? 9  16  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                       ? 'C3 H7 N O2'      89.093 
ARG 'L-peptide linking' y ARGININE                                                                      ? 'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                    ? 'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                               ? 'C4 H7 N O4'      
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                      ? 'C3 H7 N O2 S'    
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                          ? 'C10 H14 N5 O6 P' 
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                           ? 'C9 H14 N3 O7 P'  
307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                          ? 'C10 H14 N5 O7 P' 
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                  ? 'C10 H15 N2 O8 P' 
322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                     ? 'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                               ? 'C5 H9 N O4'      
147.129 
GLY 'peptide linking'   y GLYCINE                                                                       ? 'C2 H5 N O2'      75.067 
HIS 'L-peptide linking' y HISTIDINE                                                                     ? 'C6 H10 N3 O2 1'  
156.162 
HOH non-polymer         . WATER                                                                         ? 'H2 O'            18.015 
HXL non-polymer         . '2-(4-(4-CARBAMIMIDOYLPHENOXY)PHENYL)-1H-BENZO[D]IMIDAZOLE-6-CARBOXIMIDAMIDE' 
'2-(4-{4-[AMINO(IMINO)METHYL]PHENOXY}PHENYL)-1H-BENZIMIDAZOLE-5-CARBOXIMIDAMIDE' 'C21 H18 N6 O'    370.407 
ILE 'L-peptide linking' y ISOLEUCINE                                                                    ? 'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                       ? 'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking' y LYSINE                                                                        ? 'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking' y METHIONINE                                                                    ? 'C5 H11 N O2 S'   
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                 ? 'C9 H11 N O2'     
165.189 
PRO 'L-peptide linking' y PROLINE                                                                       ? 'C5 H9 N O2'      
115.130 
SER 'L-peptide linking' y SERINE                                                                        ? 'C3 H7 N O3'      
105.093 
THR 'L-peptide linking' y THREONINE                                                                     ? 'C4 H9 N O3'      
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                    ? 'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                      ? 'C9 H11 N O3'     
181.189 
VAL 'L-peptide linking' y VALINE                                                                        ? 'C5 H11 N O2'     
117.146 
# 
_exptl.entry_id          2FJX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.74 
_exptl_crystal.density_percent_sol   55.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 4000, magnesium acetate, ADA pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 4000'          ? ? ? 
1 2 1 'MAGNESIUM ACETATE' ? ? ? 
1 3 1 ADA                 ? ? ? 
1 4 1 H2O                 ? ? ? 
1 5 2 'PEG 4000'          ? ? ? 
1 6 2 'MAGNESIUM ACETATE' ? ? ? 
1 7 2 ADA                 ? ? ? 
1 8 2 H2O                 ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   SBC-2 
_diffrn_detector.pdbx_collection_date   2005-08-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97952 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97952 
# 
_reflns.entry_id                     2FJX 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   35649 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   92.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2FJX 
_refine.ls_number_reflns_obs                     35649 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.234 
_refine.ls_R_factor_all                          0.27 
_refine.ls_R_factor_R_work                       0.234 
_refine.ls_R_factor_R_free                       0.266 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1698 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2053 
_refine_hist.pdbx_number_atoms_nucleic_acid   325 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             225 
_refine_hist.number_atoms_total               2631 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.004 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.20  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2FJX 
_struct.title                     'RT29 bound to D(CTTGAATGCATTCAAG) in complex with MMLV RT catalytic fragment' 
_struct.pdbx_descriptor           'Reverse Transcriptase (E.C.2.7.7.49/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FJX 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
'MMLV RT, protein-DNA complex, water-mediated interaction, DNA-drug complex, RT29, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR C 1   ? PHE C 6   ? THR A 24  PHE A 29  1 ? 6  
HELX_P HELX_P2 2 TRP C 10  ? GLY C 15  ? TRP A 33  GLY A 38  1 ? 6  
HELX_P HELX_P3 3 SER C 44  ? GLN C 61  ? SER A 67  GLN A 84  1 ? 18 
HELX_P HELX_P4 4 LEU C 92  ? LYS C 97  ? LEU A 115 LYS A 120 1 ? 6  
HELX_P HELX_P5 5 ASN C 108 ? SER C 114 ? ASN A 131 SER A 137 1 ? 7  
HELX_P HELX_P6 6 ALA C 131 ? LEU C 135 ? ALA A 154 LEU A 158 5 ? 5  
HELX_P HELX_P7 7 SER C 141 ? ALA C 146 ? SER A 164 ALA A 169 5 ? 6  
HELX_P HELX_P8 8 ASN C 171 ? HIS C 191 ? ASN A 194 HIS A 214 1 ? 21 
HELX_P HELX_P9 9 SER C 209 ? GLY C 228 ? SER A 232 GLY A 251 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DC 1 N3 ? ? ? 1_555 B DG 8 N1 ? ? B DC 1 G DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DC 1 N4 ? ? ? 1_555 B DG 8 O6 ? ? B DC 1 G DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 1 O2 ? ? ? 1_555 B DG 8 N2 ? ? B DC 1 G DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DT 2 N3 ? ? ? 1_555 B DA 7 N1 ? ? B DT 2 G DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DT 2 O4 ? ? ? 1_555 B DA 7 N6 ? ? B DT 2 G DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DT 3 N3 ? ? ? 1_555 B DA 6 N1 ? ? B DT 3 G DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DT 3 O4 ? ? ? 1_555 B DA 6 N6 ? ? B DT 3 G DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 4 N1 ? ? ? 1_555 B DC 5 N3 ? ? B DG 4 G DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DG 4 N2 ? ? ? 1_555 B DC 5 O2 ? ? B DG 4 G DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DG 4 O6 ? ? ? 1_555 B DC 5 N4 ? ? B DG 4 G DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DA 5 N1 ? ? ? 1_555 B DT 4 N3 ? ? B DA 5 G DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DA 5 N6 ? ? ? 1_555 B DT 4 O4 ? ? B DA 5 G DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DA 6 N1 ? ? ? 1_555 B DT 3 N3 ? ? B DA 6 G DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DA 6 N6 ? ? ? 1_555 B DT 3 O4 ? ? B DA 6 G DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 7 N3 ? ? ? 1_555 B DA 2 N1 ? ? B DT 7 G DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DT 7 O4 ? ? ? 1_555 B DA 2 N6 ? ? B DT 7 G DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 8 N1 ? ? ? 1_555 B DC 1 N3 ? ? B DG 8 G DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 8 N2 ? ? ? 1_555 B DC 1 O2 ? ? B DG 8 G DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 8 O6 ? ? ? 1_555 B DC 1 N4 ? ? B DG 8 G DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU C 64  ? CYS C 67  ? LEU A 87  CYS A 90  
A 2 GLN C 159 ? TRP C 162 ? GLN A 182 TRP A 185 
A 3 PHE C 147 ? GLU C 148 ? PHE A 170 GLU A 171 
B 1 LEU C 75  ? PRO C 77  ? LEU A 98  PRO A 100 
B 2 PRO C 88  ? GLN C 90  ? PRO A 111 GLN A 113 
C 1 ILE C 195 ? TYR C 199 ? ILE A 218 TYR A 222 
C 2 ASP C 202 ? ALA C 207 ? ASP A 225 ALA A 230 
C 3 TRP C 122 ? ASP C 127 ? TRP A 145 ASP A 150 
C 4 GLN C 237 ? GLN C 240 ? GLN A 260 GLN A 263 
D 1 GLN C 242 ? TYR C 245 ? GLN A 265 TYR A 268 
D 2 TYR C 248 ? LYS C 251 ? TYR A 271 LYS A 274 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL C 65  ? N VAL A 88  O THR C 161 ? O THR A 184 
A 2 3 O LEU C 160 ? O LEU A 183 N PHE C 147 ? N PHE A 170 
B 1 2 N LEU C 76  ? N LEU A 99  O VAL C 89  ? O VAL A 112 
C 1 2 N ILE C 195 ? N ILE A 218 O ALA C 206 ? O ALA A 229 
C 2 3 O LEU C 203 ? O LEU A 226 N LEU C 126 ? N LEU A 149 
C 3 4 N TYR C 123 ? N TYR A 146 O GLN C 240 ? O GLN A 263 
D 1 2 N VAL C 243 ? N VAL A 266 O LEU C 250 ? O LEU A 273 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE HXL B 301' 
1   ?        ? ? ? ? ? ?                                    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 DA  A 5 ? DA  B 5   . ? 1_555 ? 
2 AC1 8 DA  A 6 ? DA  B 6   . ? 1_555 ? 
3 AC1 8 DT  A 7 ? DT  B 7   . ? 1_555 ? 
4 AC1 8 DG  A 8 ? DG  B 8   . ? 1_555 ? 
5 AC1 8 DT  B 3 ? DT  G 11  . ? 1_555 ? 
6 AC1 8 DT  B 4 ? DT  G 12  . ? 1_555 ? 
7 AC1 8 DC  B 5 ? DC  G 13  . ? 1_555 ? 
8 AC1 8 HOH F . ? HOH G 114 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FJX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FJX 
_atom_sites.fract_transf_matrix[1][1]   0.018265 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006875 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021342 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DC  A 1 1   ? 38.745 55.469 24.823  1.00 50.75 ? 1   DC  B "O5'" 1 
ATOM   2    C "C5'" . DC  A 1 1   ? 38.816 54.044 24.895  1.00 49.20 ? 1   DC  B "C5'" 1 
ATOM   3    C "C4'" . DC  A 1 1   ? 39.503 53.451 23.687  1.00 48.70 ? 1   DC  B "C4'" 1 
ATOM   4    O "O4'" . DC  A 1 1   ? 38.700 53.709 22.508  1.00 47.17 ? 1   DC  B "O4'" 1 
ATOM   5    C "C3'" . DC  A 1 1   ? 40.883 54.045 23.401  1.00 49.83 ? 1   DC  B "C3'" 1 
ATOM   6    O "O3'" . DC  A 1 1   ? 41.795 53.035 22.963  1.00 51.62 ? 1   DC  B "O3'" 1 
ATOM   7    C "C2'" . DC  A 1 1   ? 40.620 55.037 22.286  1.00 48.25 ? 1   DC  B "C2'" 1 
ATOM   8    C "C1'" . DC  A 1 1   ? 39.462 54.405 21.534  1.00 45.85 ? 1   DC  B "C1'" 1 
ATOM   9    N N1    . DC  A 1 1   ? 38.584 55.397 20.893  1.00 42.97 ? 1   DC  B N1    1 
ATOM   10   C C2    . DC  A 1 1   ? 38.394 55.342 19.505  1.00 41.95 ? 1   DC  B C2    1 
ATOM   11   O O2    . DC  A 1 1   ? 38.937 54.436 18.858  1.00 41.49 ? 1   DC  B O2    1 
ATOM   12   N N3    . DC  A 1 1   ? 37.622 56.278 18.908  1.00 40.89 ? 1   DC  B N3    1 
ATOM   13   C C4    . DC  A 1 1   ? 37.046 57.235 19.641  1.00 41.07 ? 1   DC  B C4    1 
ATOM   14   N N4    . DC  A 1 1   ? 36.307 58.148 19.008  1.00 40.28 ? 1   DC  B N4    1 
ATOM   15   C C5    . DC  A 1 1   ? 37.207 57.300 21.056  1.00 41.21 ? 1   DC  B C5    1 
ATOM   16   C C6    . DC  A 1 1   ? 37.975 56.370 21.635  1.00 41.13 ? 1   DC  B C6    1 
ATOM   17   P P     . DT  A 1 2   ? 43.336 53.414 22.710  1.00 55.89 ? 2   DT  B P     1 
ATOM   18   O OP1   . DT  A 1 2   ? 44.182 52.334 23.279  1.00 56.62 ? 2   DT  B OP1   1 
ATOM   19   O OP2   . DT  A 1 2   ? 43.547 54.820 23.145  1.00 55.55 ? 2   DT  B OP2   1 
ATOM   20   O "O5'" . DT  A 1 2   ? 43.475 53.368 21.127  1.00 54.94 ? 2   DT  B "O5'" 1 
ATOM   21   C "C5'" . DT  A 1 2   ? 42.976 52.255 20.397  1.00 54.65 ? 2   DT  B "C5'" 1 
ATOM   22   C "C4'" . DT  A 1 2   ? 43.012 52.539 18.915  1.00 54.49 ? 2   DT  B "C4'" 1 
ATOM   23   O "O4'" . DT  A 1 2   ? 42.037 53.555 18.575  1.00 53.51 ? 2   DT  B "O4'" 1 
ATOM   24   C "C3'" . DT  A 1 2   ? 44.355 53.044 18.390  1.00 54.34 ? 2   DT  B "C3'" 1 
ATOM   25   O "O3'" . DT  A 1 2   ? 44.620 52.420 17.132  1.00 55.84 ? 2   DT  B "O3'" 1 
ATOM   26   C "C2'" . DT  A 1 2   ? 44.128 54.538 18.223  1.00 52.89 ? 2   DT  B "C2'" 1 
ATOM   27   C "C1'" . DT  A 1 2   ? 42.662 54.590 17.832  1.00 51.98 ? 2   DT  B "C1'" 1 
ATOM   28   N N1    . DT  A 1 2   ? 41.956 55.853 18.134  1.00 50.31 ? 2   DT  B N1    1 
ATOM   29   C C2    . DT  A 1 2   ? 41.325 56.504 17.095  1.00 49.41 ? 2   DT  B C2    1 
ATOM   30   O O2    . DT  A 1 2   ? 41.371 56.119 15.937  1.00 48.94 ? 2   DT  B O2    1 
ATOM   31   N N3    . DT  A 1 2   ? 40.641 57.635 17.461  1.00 48.59 ? 2   DT  B N3    1 
ATOM   32   C C4    . DT  A 1 2   ? 40.537 58.177 18.725  1.00 48.19 ? 2   DT  B C4    1 
ATOM   33   O O4    . DT  A 1 2   ? 39.860 59.187 18.904  1.00 47.04 ? 2   DT  B O4    1 
ATOM   34   C C5    . DT  A 1 2   ? 41.256 57.470 19.759  1.00 48.69 ? 2   DT  B C5    1 
ATOM   35   C C7    . DT  A 1 2   ? 41.239 58.013 21.154  1.00 48.31 ? 2   DT  B C7    1 
ATOM   36   C C6    . DT  A 1 2   ? 41.916 56.354 19.418  1.00 49.44 ? 2   DT  B C6    1 
ATOM   37   P P     . DT  A 1 3   ? 46.118 52.378 16.558  1.00 57.80 ? 3   DT  B P     1 
ATOM   38   O OP1   . DT  A 1 3   ? 46.459 50.974 16.213  1.00 58.52 ? 3   DT  B OP1   1 
ATOM   39   O OP2   . DT  A 1 3   ? 46.990 53.141 17.486  1.00 58.09 ? 3   DT  B OP2   1 
ATOM   40   O "O5'" . DT  A 1 3   ? 45.991 53.206 15.209  1.00 56.94 ? 3   DT  B "O5'" 1 
ATOM   41   C "C5'" . DT  A 1 3   ? 45.017 54.231 15.109  1.00 56.23 ? 3   DT  B "C5'" 1 
ATOM   42   C "C4'" . DT  A 1 3   ? 44.872 54.686 13.679  1.00 55.20 ? 3   DT  B "C4'" 1 
ATOM   43   O "O4'" . DT  A 1 3   ? 43.908 55.759 13.676  1.00 54.27 ? 3   DT  B "O4'" 1 
ATOM   44   C "C3'" . DT  A 1 3   ? 46.147 55.278 13.090  1.00 55.88 ? 3   DT  B "C3'" 1 
ATOM   45   O "O3'" . DT  A 1 3   ? 46.142 55.091 11.668  1.00 57.38 ? 3   DT  B "O3'" 1 
ATOM   46   C "C2'" . DT  A 1 3   ? 46.055 56.741 13.488  1.00 54.01 ? 3   DT  B "C2'" 1 
ATOM   47   C "C1'" . DT  A 1 3   ? 44.553 57.011 13.489  1.00 52.83 ? 3   DT  B "C1'" 1 
ATOM   48   N N1    . DT  A 1 3   ? 44.085 57.905 14.567  1.00 49.44 ? 3   DT  B N1    1 
ATOM   49   C C2    . DT  A 1 3   ? 43.004 58.710 14.305  1.00 48.25 ? 3   DT  B C2    1 
ATOM   50   O O2    . DT  A 1 3   ? 42.440 58.734 13.224  1.00 47.71 ? 3   DT  B O2    1 
ATOM   51   N N3    . DT  A 1 3   ? 42.602 59.490 15.360  1.00 47.44 ? 3   DT  B N3    1 
ATOM   52   C C4    . DT  A 1 3   ? 43.163 59.544 16.622  1.00 47.46 ? 3   DT  B C4    1 
ATOM   53   O O4    . DT  A 1 3   ? 42.683 60.287 17.475  1.00 45.95 ? 3   DT  B O4    1 
ATOM   54   C C5    . DT  A 1 3   ? 44.303 58.684 16.825  1.00 46.83 ? 3   DT  B C5    1 
ATOM   55   C C7    . DT  A 1 3   ? 44.982 58.684 18.158  1.00 47.86 ? 3   DT  B C7    1 
ATOM   56   C C6    . DT  A 1 3   ? 44.703 57.918 15.800  1.00 48.83 ? 3   DT  B C6    1 
ATOM   57   P P     . DG  A 1 4   ? 47.511 55.208 10.836  1.00 58.74 ? 4   DG  B P     1 
ATOM   58   O OP1   . DG  A 1 4   ? 47.612 54.037 9.930   1.00 60.91 ? 4   DG  B OP1   1 
ATOM   59   O OP2   . DG  A 1 4   ? 48.609 55.496 11.793  1.00 59.49 ? 4   DG  B OP2   1 
ATOM   60   O "O5'" . DG  A 1 4   ? 47.280 56.507 9.950   1.00 59.28 ? 4   DG  B "O5'" 1 
ATOM   61   C "C5'" . DG  A 1 4   ? 46.466 57.555 10.446  1.00 60.18 ? 4   DG  B "C5'" 1 
ATOM   62   C "C4'" . DG  A 1 4   ? 46.201 58.585 9.377   1.00 60.13 ? 4   DG  B "C4'" 1 
ATOM   63   O "O4'" . DG  A 1 4   ? 45.340 59.575 9.976   1.00 59.05 ? 4   DG  B "O4'" 1 
ATOM   64   C "C3'" . DG  A 1 4   ? 47.440 59.347 8.917   1.00 60.94 ? 4   DG  B "C3'" 1 
ATOM   65   O "O3'" . DG  A 1 4   ? 47.261 59.797 7.569   1.00 62.62 ? 4   DG  B "O3'" 1 
ATOM   66   C "C2'" . DG  A 1 4   ? 47.528 60.492 9.909   1.00 60.03 ? 4   DG  B "C2'" 1 
ATOM   67   C "C1'" . DG  A 1 4   ? 46.082 60.732 10.333  1.00 58.17 ? 4   DG  B "C1'" 1 
ATOM   68   N N9    . DG  A 1 4   ? 45.932 60.913 11.773  1.00 55.63 ? 4   DG  B N9    1 
ATOM   69   C C8    . DG  A 1 4   ? 46.708 60.355 12.762  1.00 54.63 ? 4   DG  B C8    1 
ATOM   70   N N7    . DG  A 1 4   ? 46.335 60.702 13.963  1.00 53.32 ? 4   DG  B N7    1 
ATOM   71   C C5    . DG  A 1 4   ? 45.248 61.540 13.756  1.00 52.89 ? 4   DG  B C5    1 
ATOM   72   C C6    . DG  A 1 4   ? 44.431 62.230 14.684  1.00 51.31 ? 4   DG  B C6    1 
ATOM   73   O O6    . DG  A 1 4   ? 44.507 62.243 15.917  1.00 51.23 ? 4   DG  B O6    1 
ATOM   74   N N1    . DG  A 1 4   ? 43.442 62.965 14.044  1.00 51.16 ? 4   DG  B N1    1 
ATOM   75   C C2    . DG  A 1 4   ? 43.262 63.032 12.686  1.00 51.19 ? 4   DG  B C2    1 
ATOM   76   N N2    . DG  A 1 4   ? 42.245 63.792 12.262  1.00 51.72 ? 4   DG  B N2    1 
ATOM   77   N N3    . DG  A 1 4   ? 44.019 62.400 11.809  1.00 53.12 ? 4   DG  B N3    1 
ATOM   78   C C4    . DG  A 1 4   ? 44.986 61.677 12.409  1.00 53.87 ? 4   DG  B C4    1 
ATOM   79   P P     . DA  A 1 5   ? 48.193 60.968 6.980   1.00 62.93 ? 5   DA  B P     1 
ATOM   80   O OP1   . DA  A 1 5   ? 48.359 60.736 5.522   1.00 62.89 ? 5   DA  B OP1   1 
ATOM   81   O OP2   . DA  A 1 5   ? 49.394 61.092 7.847   1.00 62.84 ? 5   DA  B OP2   1 
ATOM   82   O "O5'" . DA  A 1 5   ? 47.304 62.274 7.171   1.00 61.48 ? 5   DA  B "O5'" 1 
ATOM   83   C "C5'" . DA  A 1 5   ? 45.966 62.313 6.683   1.00 58.65 ? 5   DA  B "C5'" 1 
ATOM   84   C "C4'" . DA  A 1 5   ? 45.328 63.641 7.014   1.00 57.18 ? 5   DA  B "C4'" 1 
ATOM   85   O "O4'" . DA  A 1 5   ? 45.158 63.757 8.447   1.00 55.24 ? 5   DA  B "O4'" 1 
ATOM   86   C "C3'" . DA  A 1 5   ? 46.136 64.864 6.583   1.00 57.02 ? 5   DA  B "C3'" 1 
ATOM   87   O "O3'" . DA  A 1 5   ? 45.249 65.879 6.109   1.00 58.22 ? 5   DA  B "O3'" 1 
ATOM   88   C "C2'" . DA  A 1 5   ? 46.820 65.304 7.865   1.00 55.44 ? 5   DA  B "C2'" 1 
ATOM   89   C "C1'" . DA  A 1 5   ? 45.788 64.940 8.917   1.00 53.54 ? 5   DA  B "C1'" 1 
ATOM   90   N N9    . DA  A 1 5   ? 46.337 64.656 10.243  1.00 50.24 ? 5   DA  B N9    1 
ATOM   91   C C8    . DA  A 1 5   ? 47.388 63.834 10.571  1.00 49.06 ? 5   DA  B C8    1 
ATOM   92   N N7    . DA  A 1 5   ? 47.622 63.764 11.859  1.00 48.17 ? 5   DA  B N7    1 
ATOM   93   C C5    . DA  A 1 5   ? 46.666 64.602 12.417  1.00 46.97 ? 5   DA  B C5    1 
ATOM   94   C C6    . DA  A 1 5   ? 46.378 64.958 13.745  1.00 45.52 ? 5   DA  B C6    1 
ATOM   95   N N6    . DA  A 1 5   ? 47.048 64.491 14.801  1.00 45.26 ? 5   DA  B N6    1 
ATOM   96   N N1    . DA  A 1 5   ? 45.361 65.820 13.957  1.00 45.35 ? 5   DA  B N1    1 
ATOM   97   C C2    . DA  A 1 5   ? 44.686 66.286 12.900  1.00 45.65 ? 5   DA  B C2    1 
ATOM   98   N N3    . DA  A 1 5   ? 44.859 66.025 11.608  1.00 46.64 ? 5   DA  B N3    1 
ATOM   99   C C4    . DA  A 1 5   ? 45.875 65.165 11.432  1.00 47.63 ? 5   DA  B C4    1 
ATOM   100  P P     . DA  A 1 6   ? 45.845 67.223 5.466   1.00 59.24 ? 6   DA  B P     1 
ATOM   101  O OP1   . DA  A 1 6   ? 45.091 67.511 4.219   1.00 59.59 ? 6   DA  B OP1   1 
ATOM   102  O OP2   . DA  A 1 6   ? 47.325 67.091 5.418   1.00 60.53 ? 6   DA  B OP2   1 
ATOM   103  O "O5'" . DA  A 1 6   ? 45.477 68.337 6.542   1.00 58.74 ? 6   DA  B "O5'" 1 
ATOM   104  C "C5'" . DA  A 1 6   ? 44.128 68.517 6.957   1.00 56.41 ? 6   DA  B "C5'" 1 
ATOM   105  C "C4'" . DA  A 1 6   ? 44.055 69.491 8.109   1.00 56.24 ? 6   DA  B "C4'" 1 
ATOM   106  O "O4'" . DA  A 1 6   ? 44.628 68.902 9.303   1.00 54.87 ? 6   DA  B "O4'" 1 
ATOM   107  C "C3'" . DA  A 1 6   ? 44.786 70.817 7.892   1.00 55.89 ? 6   DA  B "C3'" 1 
ATOM   108  O "O3'" . DA  A 1 6   ? 43.978 71.886 8.395   1.00 57.69 ? 6   DA  B "O3'" 1 
ATOM   109  C "C2'" . DA  A 1 6   ? 46.050 70.659 8.722   1.00 54.64 ? 6   DA  B "C2'" 1 
ATOM   110  C "C1'" . DA  A 1 6   ? 45.559 69.805 9.878   1.00 52.97 ? 6   DA  B "C1'" 1 
ATOM   111  N N9    . DA  A 1 6   ? 46.587 69.020 10.567  1.00 49.35 ? 6   DA  B N9    1 
ATOM   112  C C8    . DA  A 1 6   ? 47.566 68.233 10.014  1.00 48.07 ? 6   DA  B C8    1 
ATOM   113  N N7    . DA  A 1 6   ? 48.336 67.645 10.899  1.00 46.23 ? 6   DA  B N7    1 
ATOM   114  C C5    . DA  A 1 6   ? 47.832 68.076 12.118  1.00 46.20 ? 6   DA  B C5    1 
ATOM   115  C C6    . DA  A 1 6   ? 48.210 67.807 13.450  1.00 45.31 ? 6   DA  B C6    1 
ATOM   116  N N6    . DA  A 1 6   ? 49.221 67.001 13.787  1.00 44.68 ? 6   DA  B N6    1 
ATOM   117  N N1    . DA  A 1 6   ? 47.502 68.399 14.436  1.00 45.10 ? 6   DA  B N1    1 
ATOM   118  C C2    . DA  A 1 6   ? 46.483 69.201 14.098  1.00 46.98 ? 6   DA  B C2    1 
ATOM   119  N N3    . DA  A 1 6   ? 46.030 69.527 12.887  1.00 47.07 ? 6   DA  B N3    1 
ATOM   120  C C4    . DA  A 1 6   ? 46.757 68.925 11.929  1.00 47.44 ? 6   DA  B C4    1 
ATOM   121  P P     . DT  A 1 7   ? 44.275 73.400 7.941   1.00 58.47 ? 7   DT  B P     1 
ATOM   122  O OP1   . DT  A 1 7   ? 43.003 74.010 7.476   1.00 58.68 ? 7   DT  B OP1   1 
ATOM   123  O OP2   . DT  A 1 7   ? 45.456 73.381 7.039   1.00 58.42 ? 7   DT  B OP2   1 
ATOM   124  O "O5'" . DT  A 1 7   ? 44.696 74.099 9.305   1.00 57.35 ? 7   DT  B "O5'" 1 
ATOM   125  C "C5'" . DT  A 1 7   ? 45.341 73.340 10.317  1.00 55.97 ? 7   DT  B "C5'" 1 
ATOM   126  C "C4'" . DT  A 1 7   ? 45.179 74.002 11.664  1.00 54.74 ? 7   DT  B "C4'" 1 
ATOM   127  O "O4'" . DT  A 1 7   ? 45.808 73.145 12.643  1.00 53.41 ? 7   DT  B "O4'" 1 
ATOM   128  C "C3'" . DT  A 1 7   ? 45.887 75.349 11.778  1.00 54.90 ? 7   DT  B "C3'" 1 
ATOM   129  O "O3'" . DT  A 1 7   ? 45.197 76.179 12.724  1.00 56.41 ? 7   DT  B "O3'" 1 
ATOM   130  C "C2'" . DT  A 1 7   ? 47.276 74.956 12.250  1.00 52.95 ? 7   DT  B "C2'" 1 
ATOM   131  C "C1'" . DT  A 1 7   ? 47.022 73.719 13.106  1.00 51.37 ? 7   DT  B "C1'" 1 
ATOM   132  N N1    . DT  A 1 7   ? 48.071 72.683 12.993  1.00 48.10 ? 7   DT  B N1    1 
ATOM   133  C C2    . DT  A 1 7   ? 48.580 72.129 14.147  1.00 47.27 ? 7   DT  B C2    1 
ATOM   134  O O2    . DT  A 1 7   ? 48.212 72.453 15.260  1.00 46.68 ? 7   DT  B O2    1 
ATOM   135  N N3    . DT  A 1 7   ? 49.546 71.173 13.945  1.00 45.82 ? 7   DT  B N3    1 
ATOM   136  C C4    . DT  A 1 7   ? 50.041 70.727 12.736  1.00 45.42 ? 7   DT  B C4    1 
ATOM   137  O O4    . DT  A 1 7   ? 50.910 69.861 12.713  1.00 45.60 ? 7   DT  B O4    1 
ATOM   138  C C5    . DT  A 1 7   ? 49.463 71.352 11.568  1.00 46.30 ? 7   DT  B C5    1 
ATOM   139  C C7    . DT  A 1 7   ? 49.938 70.933 10.212  1.00 45.82 ? 7   DT  B C7    1 
ATOM   140  C C6    . DT  A 1 7   ? 48.521 72.285 11.753  1.00 46.09 ? 7   DT  B C6    1 
ATOM   141  P P     . DG  A 1 8   ? 45.413 77.776 12.704  1.00 57.84 ? 8   DG  B P     1 
ATOM   142  O OP1   . DG  A 1 8   ? 44.094 78.430 12.912  1.00 58.13 ? 8   DG  B OP1   1 
ATOM   143  O OP2   . DG  A 1 8   ? 46.217 78.105 11.498  1.00 57.75 ? 8   DG  B OP2   1 
ATOM   144  O "O5'" . DG  A 1 8   ? 46.309 78.036 13.993  1.00 57.55 ? 8   DG  B "O5'" 1 
ATOM   145  C "C5'" . DG  A 1 8   ? 47.242 77.050 14.408  1.00 57.88 ? 8   DG  B "C5'" 1 
ATOM   146  C "C4'" . DG  A 1 8   ? 47.494 77.130 15.893  1.00 58.30 ? 8   DG  B "C4'" 1 
ATOM   147  O "O4'" . DG  A 1 8   ? 48.206 75.930 16.260  1.00 57.28 ? 8   DG  B "O4'" 1 
ATOM   148  C "C3'" . DG  A 1 8   ? 48.400 78.284 16.306  1.00 59.40 ? 8   DG  B "C3'" 1 
ATOM   149  O "O3'" . DG  A 1 8   ? 48.125 78.677 17.654  1.00 62.73 ? 8   DG  B "O3'" 1 
ATOM   150  C "C2'" . DG  A 1 8   ? 49.789 77.689 16.173  1.00 57.46 ? 8   DG  B "C2'" 1 
ATOM   151  C "C1'" . DG  A 1 8   ? 49.578 76.214 16.496  1.00 55.38 ? 8   DG  B "C1'" 1 
ATOM   152  N N9    . DG  A 1 8   ? 50.357 75.320 15.647  1.00 51.98 ? 8   DG  B N9    1 
ATOM   153  C C8    . DG  A 1 8   ? 50.396 75.310 14.273  1.00 50.72 ? 8   DG  B C8    1 
ATOM   154  N N7    . DG  A 1 8   ? 51.195 74.398 13.790  1.00 49.13 ? 8   DG  B N7    1 
ATOM   155  C C5    . DG  A 1 8   ? 51.712 73.766 14.912  1.00 48.14 ? 8   DG  B C5    1 
ATOM   156  C C6    . DG  A 1 8   ? 52.637 72.700 15.020  1.00 46.74 ? 8   DG  B C6    1 
ATOM   157  O O6    . DG  A 1 8   ? 53.208 72.081 14.115  1.00 46.37 ? 8   DG  B O6    1 
ATOM   158  N N1    . DG  A 1 8   ? 52.884 72.371 16.349  1.00 46.43 ? 8   DG  B N1    1 
ATOM   159  C C2    . DG  A 1 8   ? 52.316 72.990 17.435  1.00 47.27 ? 8   DG  B C2    1 
ATOM   160  N N2    . DG  A 1 8   ? 52.680 72.530 18.641  1.00 46.70 ? 8   DG  B N2    1 
ATOM   161  N N3    . DG  A 1 8   ? 51.454 73.988 17.347  1.00 48.11 ? 8   DG  B N3    1 
ATOM   162  C C4    . DG  A 1 8   ? 51.200 74.322 16.066  1.00 49.19 ? 8   DG  B C4    1 
ATOM   163  P P     . DC  B 2 1   ? 60.404 65.722 18.390  1.00 65.28 ? 9   DC  G P     1 
ATOM   164  O OP1   . DC  B 2 1   ? 59.885 64.796 17.351  1.00 64.75 ? 9   DC  G OP1   1 
ATOM   165  O OP2   . DC  B 2 1   ? 61.118 65.176 19.572  1.00 64.65 ? 9   DC  G OP2   1 
ATOM   166  O "O5'" . DC  B 2 1   ? 59.191 66.620 18.904  1.00 65.06 ? 9   DC  G "O5'" 1 
ATOM   167  C "C5'" . DC  B 2 1   ? 59.397 67.614 19.905  1.00 65.34 ? 9   DC  G "C5'" 1 
ATOM   168  C "C4'" . DC  B 2 1   ? 58.074 68.180 20.365  1.00 65.32 ? 9   DC  G "C4'" 1 
ATOM   169  O "O4'" . DC  B 2 1   ? 57.499 69.027 19.340  1.00 64.30 ? 9   DC  G "O4'" 1 
ATOM   170  C "C3'" . DC  B 2 1   ? 57.007 67.136 20.697  1.00 66.22 ? 9   DC  G "C3'" 1 
ATOM   171  O "O3'" . DC  B 2 1   ? 56.252 67.574 21.826  1.00 68.03 ? 9   DC  G "O3'" 1 
ATOM   172  C "C2'" . DC  B 2 1   ? 56.121 67.146 19.465  1.00 64.71 ? 9   DC  G "C2'" 1 
ATOM   173  C "C1'" . DC  B 2 1   ? 56.167 68.612 19.084  1.00 63.21 ? 9   DC  G "C1'" 1 
ATOM   174  N N1    . DC  B 2 1   ? 55.859 68.904 17.676  1.00 61.06 ? 9   DC  G N1    1 
ATOM   175  C C2    . DC  B 2 1   ? 54.938 69.913 17.392  1.00 60.16 ? 9   DC  G C2    1 
ATOM   176  O O2    . DC  B 2 1   ? 54.408 70.522 18.334  1.00 59.83 ? 9   DC  G O2    1 
ATOM   177  N N3    . DC  B 2 1   ? 54.645 70.200 16.103  1.00 58.46 ? 9   DC  G N3    1 
ATOM   178  C C4    . DC  B 2 1   ? 55.234 69.518 15.120  1.00 57.68 ? 9   DC  G C4    1 
ATOM   179  N N4    . DC  B 2 1   ? 54.915 69.835 13.863  1.00 56.49 ? 9   DC  G N4    1 
ATOM   180  C C5    . DC  B 2 1   ? 56.176 68.480 15.381  1.00 58.88 ? 9   DC  G C5    1 
ATOM   181  C C6    . DC  B 2 1   ? 56.457 68.210 16.662  1.00 59.79 ? 9   DC  G C6    1 
ATOM   182  P P     . DA  B 2 2   ? 55.384 66.517 22.666  1.00 69.19 ? 10  DA  G P     1 
ATOM   183  O OP1   . DA  B 2 2   ? 56.145 66.162 23.892  1.00 69.86 ? 10  DA  G OP1   1 
ATOM   184  O OP2   . DA  B 2 2   ? 54.947 65.444 21.735  1.00 69.37 ? 10  DA  G OP2   1 
ATOM   185  O "O5'" . DA  B 2 2   ? 54.107 67.360 23.100  1.00 68.01 ? 10  DA  G "O5'" 1 
ATOM   186  C "C5'" . DA  B 2 2   ? 54.258 68.647 23.691  1.00 66.74 ? 10  DA  G "C5'" 1 
ATOM   187  C "C4'" . DA  B 2 2   ? 53.011 69.469 23.474  1.00 65.75 ? 10  DA  G "C4'" 1 
ATOM   188  O "O4'" . DA  B 2 2   ? 52.879 69.798 22.069  1.00 64.64 ? 10  DA  G "O4'" 1 
ATOM   189  C "C3'" . DA  B 2 2   ? 51.718 68.757 23.867  1.00 65.62 ? 10  DA  G "C3'" 1 
ATOM   190  O "O3'" . DA  B 2 2   ? 50.820 69.691 24.478  1.00 66.57 ? 10  DA  G "O3'" 1 
ATOM   191  C "C2'" . DA  B 2 2   ? 51.177 68.255 22.540  1.00 64.26 ? 10  DA  G "C2'" 1 
ATOM   192  C "C1'" . DA  B 2 2   ? 51.633 69.334 21.571  1.00 62.94 ? 10  DA  G "C1'" 1 
ATOM   193  N N9    . DA  B 2 2   ? 51.842 68.878 20.194  1.00 60.58 ? 10  DA  G N9    1 
ATOM   194  C C8    . DA  B 2 2   ? 52.668 67.869 19.757  1.00 59.19 ? 10  DA  G C8    1 
ATOM   195  N N7    . DA  B 2 2   ? 52.660 67.706 18.455  1.00 57.29 ? 10  DA  G N7    1 
ATOM   196  C C5    . DA  B 2 2   ? 51.768 68.669 18.003  1.00 56.94 ? 10  DA  G C5    1 
ATOM   197  C C6    . DA  B 2 2   ? 51.324 69.018 16.713  1.00 56.17 ? 10  DA  G C6    1 
ATOM   198  N N6    . DA  B 2 2   ? 51.743 68.419 15.596  1.00 54.70 ? 10  DA  G N6    1 
ATOM   199  N N1    . DA  B 2 2   ? 50.425 70.021 16.609  1.00 55.64 ? 10  DA  G N1    1 
ATOM   200  C C2    . DA  B 2 2   ? 50.010 70.628 17.728  1.00 56.23 ? 10  DA  G C2    1 
ATOM   201  N N3    . DA  B 2 2   ? 50.357 70.395 18.993  1.00 57.55 ? 10  DA  G N3    1 
ATOM   202  C C4    . DA  B 2 2   ? 51.250 69.393 19.064  1.00 58.21 ? 10  DA  G C4    1 
ATOM   203  P P     . DT  B 2 3   ? 49.559 69.155 25.317  1.00 67.89 ? 11  DT  G P     1 
ATOM   204  O OP1   . DT  B 2 3   ? 49.554 69.811 26.650  1.00 67.63 ? 11  DT  G OP1   1 
ATOM   205  O OP2   . DT  B 2 3   ? 49.564 67.670 25.226  1.00 67.14 ? 11  DT  G OP2   1 
ATOM   206  O "O5'" . DT  B 2 3   ? 48.318 69.699 24.485  1.00 66.52 ? 11  DT  G "O5'" 1 
ATOM   207  C "C5'" . DT  B 2 3   ? 48.377 69.725 23.067  1.00 64.84 ? 11  DT  G "C5'" 1 
ATOM   208  C "C4'" . DT  B 2 3   ? 47.382 70.713 22.508  1.00 64.13 ? 11  DT  G "C4'" 1 
ATOM   209  O "O4'" . DT  B 2 3   ? 47.590 70.766 21.081  1.00 63.06 ? 11  DT  G "O4'" 1 
ATOM   210  C "C3'" . DT  B 2 3   ? 45.925 70.304 22.693  1.00 64.32 ? 11  DT  G "C3'" 1 
ATOM   211  O "O3'" . DT  B 2 3   ? 45.098 71.477 22.719  1.00 65.02 ? 11  DT  G "O3'" 1 
ATOM   212  C "C2'" . DT  B 2 3   ? 45.669 69.440 21.472  1.00 63.47 ? 11  DT  G "C2'" 1 
ATOM   213  C "C1'" . DT  B 2 3   ? 46.548 70.080 20.401  1.00 62.12 ? 11  DT  G "C1'" 1 
ATOM   214  N N1    . DT  B 2 3   ? 47.186 69.114 19.487  1.00 59.79 ? 11  DT  G N1    1 
ATOM   215  C C2    . DT  B 2 3   ? 47.038 69.298 18.131  1.00 58.78 ? 11  DT  G C2    1 
ATOM   216  O O2    . DT  B 2 3   ? 46.392 70.214 17.649  1.00 57.75 ? 11  DT  G O2    1 
ATOM   217  N N3    . DT  B 2 3   ? 47.681 68.364 17.355  1.00 57.50 ? 11  DT  G N3    1 
ATOM   218  C C4    . DT  B 2 3   ? 48.434 67.289 17.790  1.00 57.18 ? 11  DT  G C4    1 
ATOM   219  O O4    . DT  B 2 3   ? 48.958 66.537 16.972  1.00 56.35 ? 11  DT  G O4    1 
ATOM   220  C C5    . DT  B 2 3   ? 48.538 67.152 19.225  1.00 57.38 ? 11  DT  G C5    1 
ATOM   221  C C7    . DT  B 2 3   ? 49.326 66.012 19.789  1.00 56.94 ? 11  DT  G C7    1 
ATOM   222  C C6    . DT  B 2 3   ? 47.918 68.058 19.990  1.00 58.60 ? 11  DT  G C6    1 
ATOM   223  P P     . DT  B 2 4   ? 43.522 71.347 23.024  1.00 66.65 ? 12  DT  G P     1 
ATOM   224  O OP1   . DT  B 2 4   ? 43.130 72.412 23.982  1.00 66.65 ? 12  DT  G OP1   1 
ATOM   225  O OP2   . DT  B 2 4   ? 43.245 69.924 23.352  1.00 66.50 ? 12  DT  G OP2   1 
ATOM   226  O "O5'" . DT  B 2 4   ? 42.853 71.672 21.617  1.00 65.06 ? 12  DT  G "O5'" 1 
ATOM   227  C "C5'" . DT  B 2 4   ? 43.439 71.161 20.428  1.00 62.84 ? 12  DT  G "C5'" 1 
ATOM   228  C "C4'" . DT  B 2 4   ? 42.629 71.540 19.213  1.00 60.56 ? 12  DT  G "C4'" 1 
ATOM   229  O "O4'" . DT  B 2 4   ? 43.230 70.842 18.101  1.00 58.81 ? 12  DT  G "O4'" 1 
ATOM   230  C "C3'" . DT  B 2 4   ? 41.179 71.073 19.244  1.00 60.21 ? 12  DT  G "C3'" 1 
ATOM   231  O "O3'" . DT  B 2 4   ? 40.395 71.927 18.394  1.00 61.28 ? 12  DT  G "O3'" 1 
ATOM   232  C "C2'" . DT  B 2 4   ? 41.278 69.651 18.721  1.00 58.29 ? 12  DT  G "C2'" 1 
ATOM   233  C "C1'" . DT  B 2 4   ? 42.445 69.713 17.738  1.00 57.14 ? 12  DT  G "C1'" 1 
ATOM   234  N N1    . DT  B 2 4   ? 43.331 68.531 17.775  1.00 53.90 ? 12  DT  G N1    1 
ATOM   235  C C2    . DT  B 2 4   ? 43.808 68.032 16.583  1.00 52.04 ? 12  DT  G C2    1 
ATOM   236  O O2    . DT  B 2 4   ? 43.514 68.500 15.500  1.00 51.46 ? 12  DT  G O2    1 
ATOM   237  N N3    . DT  B 2 4   ? 44.644 66.953 16.709  1.00 50.78 ? 12  DT  G N3    1 
ATOM   238  C C4    . DT  B 2 4   ? 45.037 66.330 17.878  1.00 50.90 ? 12  DT  G C4    1 
ATOM   239  O O4    . DT  B 2 4   ? 45.805 65.372 17.832  1.00 48.81 ? 12  DT  G O4    1 
ATOM   240  C C5    . DT  B 2 4   ? 44.485 66.893 19.090  1.00 50.93 ? 12  DT  G C5    1 
ATOM   241  C C7    . DT  B 2 4   ? 44.838 66.271 20.405  1.00 51.35 ? 12  DT  G C7    1 
ATOM   242  C C6    . DT  B 2 4   ? 43.674 67.953 18.979  1.00 52.52 ? 12  DT  G C6    1 
ATOM   243  P P     . DC  B 2 5   ? 38.789 71.806 18.383  1.00 62.43 ? 13  DC  G P     1 
ATOM   244  O OP1   . DC  B 2 5   ? 38.211 73.175 18.379  1.00 62.65 ? 13  DC  G OP1   1 
ATOM   245  O OP2   . DC  B 2 5   ? 38.395 70.845 19.445  1.00 61.38 ? 13  DC  G OP2   1 
ATOM   246  O "O5'" . DC  B 2 5   ? 38.491 71.140 16.969  1.00 60.86 ? 13  DC  G "O5'" 1 
ATOM   247  C "C5'" . DC  B 2 5   ? 39.400 70.188 16.436  1.00 59.43 ? 13  DC  G "C5'" 1 
ATOM   248  C "C4'" . DC  B 2 5   ? 39.141 69.951 14.969  1.00 57.25 ? 13  DC  G "C4'" 1 
ATOM   249  O "O4'" . DC  B 2 5   ? 40.151 69.023 14.514  1.00 55.56 ? 13  DC  G "O4'" 1 
ATOM   250  C "C3'" . DC  B 2 5   ? 37.806 69.277 14.676  1.00 56.68 ? 13  DC  G "C3'" 1 
ATOM   251  O "O3'" . DC  B 2 5   ? 37.366 69.640 13.358  1.00 57.50 ? 13  DC  G "O3'" 1 
ATOM   252  C "C2'" . DC  B 2 5   ? 38.144 67.801 14.797  1.00 54.93 ? 13  DC  G "C2'" 1 
ATOM   253  C "C1'" . DC  B 2 5   ? 39.595 67.728 14.329  1.00 53.56 ? 13  DC  G "C1'" 1 
ATOM   254  N N1    . DC  B 2 5   ? 40.426 66.782 15.096  1.00 50.65 ? 13  DC  G N1    1 
ATOM   255  C C2    . DC  B 2 5   ? 41.270 65.905 14.406  1.00 49.24 ? 13  DC  G C2    1 
ATOM   256  O O2    . DC  B 2 5   ? 41.288 65.941 13.166  1.00 48.27 ? 13  DC  G O2    1 
ATOM   257  N N3    . DC  B 2 5   ? 42.045 65.044 15.108  1.00 47.15 ? 13  DC  G N3    1 
ATOM   258  C C4    . DC  B 2 5   ? 41.996 65.038 16.442  1.00 46.65 ? 13  DC  G C4    1 
ATOM   259  N N4    . DC  B 2 5   ? 42.782 64.177 17.095  1.00 44.08 ? 13  DC  G N4    1 
ATOM   260  C C5    . DC  B 2 5   ? 41.141 65.916 17.169  1.00 48.15 ? 13  DC  G C5    1 
ATOM   261  C C6    . DC  B 2 5   ? 40.380 66.763 16.463  1.00 49.54 ? 13  DC  G C6    1 
ATOM   262  P P     . DA  B 2 6   ? 35.892 69.229 12.859  1.00 57.66 ? 14  DA  G P     1 
ATOM   263  O OP1   . DA  B 2 6   ? 35.273 70.401 12.190  1.00 58.83 ? 14  DA  G OP1   1 
ATOM   264  O OP2   . DA  B 2 6   ? 35.198 68.584 14.003  1.00 57.53 ? 14  DA  G OP2   1 
ATOM   265  O "O5'" . DA  B 2 6   ? 36.178 68.118 11.756  1.00 56.83 ? 14  DA  G "O5'" 1 
ATOM   266  C "C5'" . DA  B 2 6   ? 37.203 67.160 11.974  1.00 55.19 ? 14  DA  G "C5'" 1 
ATOM   267  C "C4'" . DA  B 2 6   ? 37.282 66.172 10.837  1.00 52.80 ? 14  DA  G "C4'" 1 
ATOM   268  O "O4'" . DA  B 2 6   ? 38.239 65.171 11.250  1.00 51.92 ? 14  DA  G "O4'" 1 
ATOM   269  C "C3'" . DA  B 2 6   ? 35.992 65.403 10.576  1.00 52.31 ? 14  DA  G "C3'" 1 
ATOM   270  O "O3'" . DA  B 2 6   ? 35.995 64.931 9.217   1.00 52.86 ? 14  DA  G "O3'" 1 
ATOM   271  C "C2'" . DA  B 2 6   ? 36.069 64.278 11.591  1.00 51.26 ? 14  DA  G "C2'" 1 
ATOM   272  C "C1'" . DA  B 2 6   ? 37.568 64.000 11.702  1.00 50.10 ? 14  DA  G "C1'" 1 
ATOM   273  N N9    . DA  B 2 6   ? 38.020 63.742 13.070  1.00 47.16 ? 14  DA  G N9    1 
ATOM   274  C C8    . DA  B 2 6   ? 37.559 64.324 14.227  1.00 46.81 ? 14  DA  G C8    1 
ATOM   275  N N7    . DA  B 2 6   ? 38.167 63.904 15.310  1.00 45.64 ? 14  DA  G N7    1 
ATOM   276  C C5    . DA  B 2 6   ? 39.090 62.981 14.836  1.00 44.90 ? 14  DA  G C5    1 
ATOM   277  C C6    . DA  B 2 6   ? 40.048 62.182 15.487  1.00 44.39 ? 14  DA  G C6    1 
ATOM   278  N N6    . DA  B 2 6   ? 40.250 62.192 16.806  1.00 43.83 ? 14  DA  G N6    1 
ATOM   279  N N1    . DA  B 2 6   ? 40.804 61.364 14.724  1.00 42.72 ? 14  DA  G N1    1 
ATOM   280  C C2    . DA  B 2 6   ? 40.606 61.359 13.400  1.00 43.99 ? 14  DA  G C2    1 
ATOM   281  N N3    . DA  B 2 6   ? 39.743 62.066 12.672  1.00 43.96 ? 14  DA  G N3    1 
ATOM   282  C C4    . DA  B 2 6   ? 39.006 62.868 13.459  1.00 44.98 ? 14  DA  G C4    1 
ATOM   283  P P     . DA  B 2 7   ? 34.685 64.222 8.602   1.00 53.50 ? 15  DA  G P     1 
ATOM   284  O OP1   . DA  B 2 7   ? 34.489 64.717 7.215   1.00 53.77 ? 15  DA  G OP1   1 
ATOM   285  O OP2   . DA  B 2 7   ? 33.584 64.350 9.594   1.00 53.12 ? 15  DA  G OP2   1 
ATOM   286  O "O5'" . DA  B 2 7   ? 35.108 62.690 8.515   1.00 50.93 ? 15  DA  G "O5'" 1 
ATOM   287  C "C5'" . DA  B 2 7   ? 35.976 62.147 9.496   1.00 49.10 ? 15  DA  G "C5'" 1 
ATOM   288  C "C4'" . DA  B 2 7   ? 36.282 60.699 9.210   1.00 45.97 ? 15  DA  G "C4'" 1 
ATOM   289  O "O4'" . DA  B 2 7   ? 37.108 60.243 10.304  1.00 45.65 ? 15  DA  G "O4'" 1 
ATOM   290  C "C3'" . DA  B 2 7   ? 35.054 59.792 9.210   1.00 44.91 ? 15  DA  G "C3'" 1 
ATOM   291  O "O3'" . DA  B 2 7   ? 35.268 58.675 8.344   1.00 41.75 ? 15  DA  G "O3'" 1 
ATOM   292  C "C2'" . DA  B 2 7   ? 34.948 59.350 10.654  1.00 45.53 ? 15  DA  G "C2'" 1 
ATOM   293  C "C1'" . DA  B 2 7   ? 36.397 59.319 11.117  1.00 46.04 ? 15  DA  G "C1'" 1 
ATOM   294  N N9    . DA  B 2 7   ? 36.555 59.734 12.510  1.00 44.11 ? 15  DA  G N9    1 
ATOM   295  C C8    . DA  B 2 7   ? 35.766 60.613 13.211  1.00 43.86 ? 15  DA  G C8    1 
ATOM   296  N N7    . DA  B 2 7   ? 36.121 60.759 14.464  1.00 44.04 ? 15  DA  G N7    1 
ATOM   297  C C5    . DA  B 2 7   ? 37.224 59.928 14.596  1.00 42.49 ? 15  DA  G C5    1 
ATOM   298  C C6    . DA  B 2 7   ? 38.053 59.628 15.687  1.00 41.55 ? 15  DA  G C6    1 
ATOM   299  N N6    . DA  B 2 7   ? 37.885 60.143 16.907  1.00 41.64 ? 15  DA  G N6    1 
ATOM   300  N N1    . DA  B 2 7   ? 39.070 58.764 15.483  1.00 41.73 ? 15  DA  G N1    1 
ATOM   301  C C2    . DA  B 2 7   ? 39.230 58.240 14.263  1.00 42.12 ? 15  DA  G C2    1 
ATOM   302  N N3    . DA  B 2 7   ? 38.513 58.439 13.160  1.00 43.26 ? 15  DA  G N3    1 
ATOM   303  C C4    . DA  B 2 7   ? 37.511 59.302 13.396  1.00 42.73 ? 15  DA  G C4    1 
ATOM   304  P P     . DG  B 2 8   ? 34.080 57.623 8.088   1.00 37.90 ? 16  DG  G P     1 
ATOM   305  O OP1   . DG  B 2 8   ? 33.960 57.423 6.621   1.00 37.53 ? 16  DG  G OP1   1 
ATOM   306  O OP2   . DG  B 2 8   ? 32.892 58.047 8.872   1.00 39.83 ? 16  DG  G OP2   1 
ATOM   307  O "O5'" . DG  B 2 8   ? 34.638 56.277 8.726   1.00 34.67 ? 16  DG  G "O5'" 1 
ATOM   308  C "C5'" . DG  B 2 8   ? 35.841 55.686 8.238   1.00 29.48 ? 16  DG  G "C5'" 1 
ATOM   309  C "C4'" . DG  B 2 8   ? 36.217 54.497 9.090   1.00 26.91 ? 16  DG  G "C4'" 1 
ATOM   310  O "O4'" . DG  B 2 8   ? 36.629 54.961 10.401  1.00 25.14 ? 16  DG  G "O4'" 1 
ATOM   311  C "C3'" . DG  B 2 8   ? 35.062 53.521 9.325   1.00 25.04 ? 16  DG  G "C3'" 1 
ATOM   312  O "O3'" . DG  B 2 8   ? 35.509 52.175 9.434   1.00 23.77 ? 16  DG  G "O3'" 1 
ATOM   313  C "C2'" . DG  B 2 8   ? 34.541 53.926 10.691  1.00 25.14 ? 16  DG  G "C2'" 1 
ATOM   314  C "C1'" . DG  B 2 8   ? 35.804 54.388 11.405  1.00 24.95 ? 16  DG  G "C1'" 1 
ATOM   315  N N9    . DG  B 2 8   ? 35.555 55.408 12.421  1.00 25.62 ? 16  DG  G N9    1 
ATOM   316  C C8    . DG  B 2 8   ? 34.658 56.448 12.342  1.00 24.71 ? 16  DG  G C8    1 
ATOM   317  N N7    . DG  B 2 8   ? 34.627 57.182 13.420  1.00 24.97 ? 16  DG  G N7    1 
ATOM   318  C C5    . DG  B 2 8   ? 35.565 56.598 14.262  1.00 26.78 ? 16  DG  G C5    1 
ATOM   319  C C6    . DG  B 2 8   ? 35.965 56.951 15.578  1.00 27.35 ? 16  DG  G C6    1 
ATOM   320  O O6    . DG  B 2 8   ? 35.556 57.882 16.285  1.00 27.60 ? 16  DG  G O6    1 
ATOM   321  N N1    . DG  B 2 8   ? 36.944 56.088 16.064  1.00 27.56 ? 16  DG  G N1    1 
ATOM   322  C C2    . DG  B 2 8   ? 37.473 55.022 15.371  1.00 27.01 ? 16  DG  G C2    1 
ATOM   323  N N2    . DG  B 2 8   ? 38.410 54.303 16.010  1.00 26.99 ? 16  DG  G N2    1 
ATOM   324  N N3    . DG  B 2 8   ? 37.109 54.686 14.144  1.00 24.52 ? 16  DG  G N3    1 
ATOM   325  C C4    . DG  B 2 8   ? 36.155 55.508 13.656  1.00 25.83 ? 16  DG  G C4    1 
ATOM   326  N N     . THR C 3 1   ? -2.125 60.875 0.661   1.00 71.73 ? 24  THR A N     1 
ATOM   327  C CA    . THR C 3 1   ? -2.153 59.586 1.412   1.00 71.68 ? 24  THR A CA    1 
ATOM   328  C C     . THR C 3 1   ? -1.228 58.557 0.769   1.00 71.14 ? 24  THR A C     1 
ATOM   329  O O     . THR C 3 1   ? -1.562 57.375 0.686   1.00 71.02 ? 24  THR A O     1 
ATOM   330  C CB    . THR C 3 1   ? -3.578 58.999 1.457   1.00 71.99 ? 24  THR A CB    1 
ATOM   331  O OG1   . THR C 3 1   ? -4.050 58.783 0.121   1.00 71.98 ? 24  THR A OG1   1 
ATOM   332  C CG2   . THR C 3 1   ? -4.523 59.951 2.176   1.00 72.38 ? 24  THR A CG2   1 
ATOM   333  N N     . TRP C 3 2   ? -0.063 59.012 0.318   1.00 70.70 ? 25  TRP A N     1 
ATOM   334  C CA    . TRP C 3 2   ? 0.904  58.124 -0.317  1.00 69.70 ? 25  TRP A CA    1 
ATOM   335  C C     . TRP C 3 2   ? 1.330  57.021 0.644   1.00 68.89 ? 25  TRP A C     1 
ATOM   336  O O     . TRP C 3 2   ? 1.694  55.922 0.223   1.00 68.86 ? 25  TRP A O     1 
ATOM   337  C CB    . TRP C 3 2   ? 2.141  58.907 -0.763  1.00 69.75 ? 25  TRP A CB    1 
ATOM   338  C CG    . TRP C 3 2   ? 1.844  60.063 -1.665  1.00 69.35 ? 25  TRP A CG    1 
ATOM   339  C CD1   . TRP C 3 2   ? 1.295  61.261 -1.310  1.00 69.62 ? 25  TRP A CD1   1 
ATOM   340  C CD2   . TRP C 3 2   ? 2.079  60.131 -3.077  1.00 69.18 ? 25  TRP A CD2   1 
ATOM   341  N NE1   . TRP C 3 2   ? 1.174  62.073 -2.413  1.00 69.56 ? 25  TRP A NE1   1 
ATOM   342  C CE2   . TRP C 3 2   ? 1.647  61.404 -3.511  1.00 69.36 ? 25  TRP A CE2   1 
ATOM   343  C CE3   . TRP C 3 2   ? 2.612  59.241 -4.017  1.00 68.81 ? 25  TRP A CE3   1 
ATOM   344  C CZ2   . TRP C 3 2   ? 1.731  61.810 -4.847  1.00 69.21 ? 25  TRP A CZ2   1 
ATOM   345  C CZ3   . TRP C 3 2   ? 2.695  59.644 -5.347  1.00 68.84 ? 25  TRP A CZ3   1 
ATOM   346  C CH2   . TRP C 3 2   ? 2.256  60.918 -5.748  1.00 69.15 ? 25  TRP A CH2   1 
ATOM   347  N N     . LEU C 3 3   ? 1.281  57.322 1.937   1.00 68.11 ? 26  LEU A N     1 
ATOM   348  C CA    . LEU C 3 3   ? 1.670  56.364 2.964   1.00 67.35 ? 26  LEU A CA    1 
ATOM   349  C C     . LEU C 3 3   ? 0.777  55.126 2.927   1.00 66.32 ? 26  LEU A C     1 
ATOM   350  O O     . LEU C 3 3   ? 1.232  54.013 3.199   1.00 66.14 ? 26  LEU A O     1 
ATOM   351  C CB    . LEU C 3 3   ? 1.597  57.028 4.344   1.00 67.98 ? 26  LEU A CB    1 
ATOM   352  C CG    . LEU C 3 3   ? 2.236  56.325 5.548   1.00 68.85 ? 26  LEU A CG    1 
ATOM   353  C CD1   . LEU C 3 3   ? 2.272  57.290 6.719   1.00 69.11 ? 26  LEU A CD1   1 
ATOM   354  C CD2   . LEU C 3 3   ? 1.463  55.069 5.918   1.00 69.26 ? 26  LEU A CD2   1 
ATOM   355  N N     . SER C 3 4   ? -0.492 55.322 2.582   1.00 64.96 ? 27  SER A N     1 
ATOM   356  C CA    . SER C 3 4   ? -1.445 54.220 2.522   1.00 63.38 ? 27  SER A CA    1 
ATOM   357  C C     . SER C 3 4   ? -1.480 53.522 1.164   1.00 62.02 ? 27  SER A C     1 
ATOM   358  O O     . SER C 3 4   ? -1.714 52.316 1.089   1.00 61.83 ? 27  SER A O     1 
ATOM   359  C CB    . SER C 3 4   ? -2.847 54.723 2.879   1.00 64.07 ? 27  SER A CB    1 
ATOM   360  O OG    . SER C 3 4   ? -3.244 55.782 2.025   1.00 64.09 ? 27  SER A OG    1 
ATOM   361  N N     . ASP C 3 5   ? -1.247 54.276 0.094   1.00 60.72 ? 28  ASP A N     1 
ATOM   362  C CA    . ASP C 3 5   ? -1.263 53.712 -1.253  1.00 59.61 ? 28  ASP A CA    1 
ATOM   363  C C     . ASP C 3 5   ? -0.031 52.864 -1.564  1.00 58.50 ? 28  ASP A C     1 
ATOM   364  O O     . ASP C 3 5   ? -0.059 52.022 -2.462  1.00 58.42 ? 28  ASP A O     1 
ATOM   365  C CB    . ASP C 3 5   ? -1.379 54.828 -2.296  1.00 61.11 ? 28  ASP A CB    1 
ATOM   366  C CG    . ASP C 3 5   ? -2.717 55.538 -2.244  1.00 62.34 ? 28  ASP A CG    1 
ATOM   367  O OD1   . ASP C 3 5   ? -3.755 54.853 -2.357  1.00 62.97 ? 28  ASP A OD1   1 
ATOM   368  O OD2   . ASP C 3 5   ? -2.729 56.779 -2.096  1.00 63.48 ? 28  ASP A OD2   1 
ATOM   369  N N     . PHE C 3 6   ? 1.049  53.089 -0.823  1.00 56.64 ? 29  PHE A N     1 
ATOM   370  C CA    . PHE C 3 6   ? 2.288  52.348 -1.039  1.00 54.99 ? 29  PHE A CA    1 
ATOM   371  C C     . PHE C 3 6   ? 2.890  51.904 0.289   1.00 53.55 ? 29  PHE A C     1 
ATOM   372  O O     . PHE C 3 6   ? 3.972  52.348 0.673   1.00 53.39 ? 29  PHE A O     1 
ATOM   373  C CB    . PHE C 3 6   ? 3.280  53.226 -1.800  1.00 54.15 ? 29  PHE A CB    1 
ATOM   374  C CG    . PHE C 3 6   ? 2.769  53.695 -3.133  1.00 53.63 ? 29  PHE A CG    1 
ATOM   375  C CD1   . PHE C 3 6   ? 2.621  52.800 -4.188  1.00 53.47 ? 29  PHE A CD1   1 
ATOM   376  C CD2   . PHE C 3 6   ? 2.419  55.027 -3.328  1.00 53.69 ? 29  PHE A CD2   1 
ATOM   377  C CE1   . PHE C 3 6   ? 2.132  53.224 -5.421  1.00 53.29 ? 29  PHE A CE1   1 
ATOM   378  C CE2   . PHE C 3 6   ? 1.928  55.463 -4.556  1.00 54.03 ? 29  PHE A CE2   1 
ATOM   379  C CZ    . PHE C 3 6   ? 1.784  54.558 -5.605  1.00 53.81 ? 29  PHE A CZ    1 
ATOM   380  N N     . PRO C 3 7   ? 2.192  51.009 1.005   1.00 52.04 ? 30  PRO A N     1 
ATOM   381  C CA    . PRO C 3 7   ? 2.629  50.484 2.303   1.00 50.68 ? 30  PRO A CA    1 
ATOM   382  C C     . PRO C 3 7   ? 3.993  49.801 2.270   1.00 48.42 ? 30  PRO A C     1 
ATOM   383  O O     . PRO C 3 7   ? 4.780  49.920 3.208   1.00 48.32 ? 30  PRO A O     1 
ATOM   384  C CB    . PRO C 3 7   ? 1.518  49.500 2.670   1.00 50.98 ? 30  PRO A CB    1 
ATOM   385  C CG    . PRO C 3 7   ? 0.318  50.048 1.954   1.00 52.29 ? 30  PRO A CG    1 
ATOM   386  C CD    . PRO C 3 7   ? 0.896  50.425 0.619   1.00 52.65 ? 30  PRO A CD    1 
ATOM   387  N N     . GLN C 3 8   ? 4.261  49.091 1.179   1.00 46.10 ? 31  GLN A N     1 
ATOM   388  C CA    . GLN C 3 8   ? 5.506  48.346 1.008   1.00 43.74 ? 31  GLN A CA    1 
ATOM   389  C C     . GLN C 3 8   ? 6.745  49.201 0.728   1.00 41.14 ? 31  GLN A C     1 
ATOM   390  O O     . GLN C 3 8   ? 7.863  48.797 1.039   1.00 40.55 ? 31  GLN A O     1 
ATOM   391  C CB    . GLN C 3 8   ? 5.332  47.335 -0.127  1.00 44.29 ? 31  GLN A CB    1 
ATOM   392  C CG    . GLN C 3 8   ? 6.349  46.209 -0.144  1.00 45.77 ? 31  GLN A CG    1 
ATOM   393  C CD    . GLN C 3 8   ? 6.291  45.397 -1.428  1.00 47.05 ? 31  GLN A CD    1 
ATOM   394  O OE1   . GLN C 3 8   ? 6.592  44.201 -1.435  1.00 47.12 ? 31  GLN A OE1   1 
ATOM   395  N NE2   . GLN C 3 8   ? 5.918  46.050 -2.527  1.00 46.64 ? 31  GLN A NE2   1 
ATOM   396  N N     . ALA C 3 9   ? 6.544  50.379 0.148   1.00 39.53 ? 32  ALA A N     1 
ATOM   397  C CA    . ALA C 3 9   ? 7.652  51.263 -0.207  1.00 37.91 ? 32  ALA A CA    1 
ATOM   398  C C     . ALA C 3 9   ? 8.209  52.127 0.920   1.00 36.87 ? 32  ALA A C     1 
ATOM   399  O O     . ALA C 3 9   ? 9.320  52.649 0.811   1.00 34.49 ? 32  ALA A O     1 
ATOM   400  C CB    . ALA C 3 9   ? 7.236  52.155 -1.370  1.00 37.37 ? 32  ALA A CB    1 
ATOM   401  N N     . TRP C 3 10  ? 7.446  52.288 1.996   1.00 35.55 ? 33  TRP A N     1 
ATOM   402  C CA    . TRP C 3 10  ? 7.888  53.119 3.108   1.00 35.36 ? 33  TRP A CA    1 
ATOM   403  C C     . TRP C 3 10  ? 8.498  52.337 4.263   1.00 34.38 ? 33  TRP A C     1 
ATOM   404  O O     . TRP C 3 10  ? 8.010  51.275 4.642   1.00 36.69 ? 33  TRP A O     1 
ATOM   405  C CB    . TRP C 3 10  ? 6.723  53.966 3.627   1.00 35.90 ? 33  TRP A CB    1 
ATOM   406  C CG    . TRP C 3 10  ? 6.117  54.850 2.579   1.00 36.11 ? 33  TRP A CG    1 
ATOM   407  C CD1   . TRP C 3 10  ? 4.868  54.742 2.037   1.00 35.37 ? 33  TRP A CD1   1 
ATOM   408  C CD2   . TRP C 3 10  ? 6.735  55.976 1.943   1.00 35.72 ? 33  TRP A CD2   1 
ATOM   409  N NE1   . TRP C 3 10  ? 4.668  55.733 1.104   1.00 36.36 ? 33  TRP A NE1   1 
ATOM   410  C CE2   . TRP C 3 10  ? 5.797  56.504 1.026   1.00 36.08 ? 33  TRP A CE2   1 
ATOM   411  C CE3   . TRP C 3 10  ? 7.989  56.591 2.058   1.00 35.28 ? 33  TRP A CE3   1 
ATOM   412  C CZ2   . TRP C 3 10  ? 6.074  57.620 0.230   1.00 36.25 ? 33  TRP A CZ2   1 
ATOM   413  C CZ3   . TRP C 3 10  ? 8.266  57.703 1.265   1.00 35.17 ? 33  TRP A CZ3   1 
ATOM   414  C CH2   . TRP C 3 10  ? 7.309  58.205 0.362   1.00 36.34 ? 33  TRP A CH2   1 
ATOM   415  N N     . ALA C 3 11  ? 9.572  52.880 4.823   1.00 34.15 ? 34  ALA A N     1 
ATOM   416  C CA    . ALA C 3 11  ? 10.256 52.246 5.942   1.00 34.24 ? 34  ALA A CA    1 
ATOM   417  C C     . ALA C 3 11  ? 9.326  52.143 7.147   1.00 35.27 ? 34  ALA A C     1 
ATOM   418  O O     . ALA C 3 11  ? 9.401  51.189 7.919   1.00 34.96 ? 34  ALA A O     1 
ATOM   419  C CB    . ALA C 3 11  ? 11.494 53.051 6.314   1.00 33.86 ? 34  ALA A CB    1 
ATOM   420  N N     . GLU C 3 12  ? 8.444  53.125 7.294   1.00 37.06 ? 35  GLU A N     1 
ATOM   421  C CA    . GLU C 3 12  ? 7.515  53.155 8.420   1.00 39.54 ? 35  GLU A CA    1 
ATOM   422  C C     . GLU C 3 12  ? 6.393  52.120 8.369   1.00 41.30 ? 35  GLU A C     1 
ATOM   423  O O     . GLU C 3 12  ? 5.709  51.898 9.370   1.00 42.06 ? 35  GLU A O     1 
ATOM   424  C CB    . GLU C 3 12  ? 6.907  54.556 8.565   1.00 40.13 ? 35  GLU A CB    1 
ATOM   425  C CG    . GLU C 3 12  ? 7.921  55.643 8.920   1.00 42.01 ? 35  GLU A CG    1 
ATOM   426  C CD    . GLU C 3 12  ? 8.509  56.335 7.700   1.00 42.85 ? 35  GLU A CD    1 
ATOM   427  O OE1   . GLU C 3 12  ? 8.784  55.651 6.691   1.00 42.40 ? 35  GLU A OE1   1 
ATOM   428  O OE2   . GLU C 3 12  ? 8.703  57.568 7.757   1.00 43.23 ? 35  GLU A OE2   1 
ATOM   429  N N     . THR C 3 13  ? 6.203  51.477 7.221   1.00 40.85 ? 36  THR A N     1 
ATOM   430  C CA    . THR C 3 13  ? 5.137  50.490 7.101   1.00 41.43 ? 36  THR A CA    1 
ATOM   431  C C     . THR C 3 13  ? 5.519  49.208 6.372   1.00 41.04 ? 36  THR A C     1 
ATOM   432  O O     . THR C 3 13  ? 4.824  48.198 6.484   1.00 41.02 ? 36  THR A O     1 
ATOM   433  C CB    . THR C 3 13  ? 3.902  51.094 6.395   1.00 42.15 ? 36  THR A CB    1 
ATOM   434  O OG1   . THR C 3 13  ? 4.288  51.634 5.125   1.00 43.26 ? 36  THR A OG1   1 
ATOM   435  C CG2   . THR C 3 13  ? 3.291  52.200 7.246   1.00 43.22 ? 36  THR A CG2   1 
ATOM   436  N N     . GLY C 3 14  ? 6.624  49.235 5.635   1.00 39.88 ? 37  GLY A N     1 
ATOM   437  C CA    . GLY C 3 14  ? 7.027  48.048 4.902   1.00 37.74 ? 37  GLY A CA    1 
ATOM   438  C C     . GLY C 3 14  ? 8.015  47.154 5.620   1.00 37.03 ? 37  GLY A C     1 
ATOM   439  O O     . GLY C 3 14  ? 8.307  46.050 5.158   1.00 37.25 ? 37  GLY A O     1 
ATOM   440  N N     . GLY C 3 15  ? 8.534  47.624 6.749   1.00 35.92 ? 38  GLY A N     1 
ATOM   441  C CA    . GLY C 3 15  ? 9.500  46.840 7.494   1.00 35.52 ? 38  GLY A CA    1 
ATOM   442  C C     . GLY C 3 15  ? 10.890 46.978 6.898   1.00 34.64 ? 38  GLY A C     1 
ATOM   443  O O     . GLY C 3 15  ? 11.075 47.686 5.905   1.00 33.97 ? 38  GLY A O     1 
ATOM   444  N N     . MET C 3 16  ? 11.868 46.310 7.502   1.00 33.14 ? 39  MET A N     1 
ATOM   445  C CA    . MET C 3 16  ? 13.248 46.362 7.025   1.00 31.34 ? 39  MET A CA    1 
ATOM   446  C C     . MET C 3 16  ? 13.324 45.827 5.595   1.00 30.30 ? 39  MET A C     1 
ATOM   447  O O     . MET C 3 16  ? 12.718 44.805 5.269   1.00 29.42 ? 39  MET A O     1 
ATOM   448  C CB    . MET C 3 16  ? 14.152 45.532 7.948   1.00 32.53 ? 39  MET A CB    1 
ATOM   449  C CG    . MET C 3 16  ? 15.634 45.515 7.575   1.00 33.27 ? 39  MET A CG    1 
ATOM   450  S SD    . MET C 3 16  ? 16.390 47.153 7.453   1.00 35.78 ? 39  MET A SD    1 
ATOM   451  C CE    . MET C 3 16  ? 16.328 47.709 9.172   1.00 36.05 ? 39  MET A CE    1 
ATOM   452  N N     . GLY C 3 17  ? 14.074 46.526 4.748   1.00 26.93 ? 40  GLY A N     1 
ATOM   453  C CA    . GLY C 3 17  ? 14.205 46.106 3.365   1.00 24.71 ? 40  GLY A CA    1 
ATOM   454  C C     . GLY C 3 17  ? 15.154 44.941 3.146   1.00 21.85 ? 40  GLY A C     1 
ATOM   455  O O     . GLY C 3 17  ? 15.807 44.454 4.069   1.00 21.16 ? 40  GLY A O     1 
ATOM   456  N N     . LEU C 3 18  ? 15.210 44.492 1.898   1.00 19.52 ? 41  LEU A N     1 
ATOM   457  C CA    . LEU C 3 18  ? 16.070 43.397 1.466   1.00 19.80 ? 41  LEU A CA    1 
ATOM   458  C C     . LEU C 3 18  ? 15.960 43.401 -0.054  1.00 19.89 ? 41  LEU A C     1 
ATOM   459  O O     . LEU C 3 18  ? 14.885 43.149 -0.597  1.00 19.42 ? 41  LEU A O     1 
ATOM   460  C CB    . LEU C 3 18  ? 15.582 42.046 2.020   1.00 21.18 ? 41  LEU A CB    1 
ATOM   461  C CG    . LEU C 3 18  ? 16.502 40.825 1.834   1.00 23.73 ? 41  LEU A CG    1 
ATOM   462  C CD1   . LEU C 3 18  ? 15.863 39.600 2.489   1.00 27.11 ? 41  LEU A CD1   1 
ATOM   463  C CD2   . LEU C 3 18  ? 16.747 40.546 0.365   1.00 27.28 ? 41  LEU A CD2   1 
ATOM   464  N N     . ALA C 3 19  ? 17.066 43.706 -0.729  1.00 19.96 ? 42  ALA A N     1 
ATOM   465  C CA    . ALA C 3 19  ? 17.103 43.756 -2.194  1.00 19.28 ? 42  ALA A CA    1 
ATOM   466  C C     . ALA C 3 19  ? 17.082 42.330 -2.740  1.00 19.04 ? 42  ALA A C     1 
ATOM   467  O O     . ALA C 3 19  ? 18.125 41.708 -2.921  1.00 17.53 ? 42  ALA A O     1 
ATOM   468  C CB    . ALA C 3 19  ? 18.365 44.497 -2.650  1.00 16.69 ? 42  ALA A CB    1 
ATOM   469  N N     . VAL C 3 20  ? 15.875 41.823 -2.988  1.00 19.82 ? 43  VAL A N     1 
ATOM   470  C CA    . VAL C 3 20  ? 15.667 40.454 -3.455  1.00 20.45 ? 43  VAL A CA    1 
ATOM   471  C C     . VAL C 3 20  ? 16.261 40.072 -4.807  1.00 20.44 ? 43  VAL A C     1 
ATOM   472  O O     . VAL C 3 20  ? 16.516 38.896 -5.059  1.00 18.82 ? 43  VAL A O     1 
ATOM   473  C CB    . VAL C 3 20  ? 14.160 40.108 -3.483  1.00 20.21 ? 43  VAL A CB    1 
ATOM   474  C CG1   . VAL C 3 20  ? 13.558 40.320 -2.094  1.00 21.06 ? 43  VAL A CG1   1 
ATOM   475  C CG2   . VAL C 3 20  ? 13.440 40.974 -4.509  1.00 20.89 ? 43  VAL A CG2   1 
ATOM   476  N N     . ARG C 3 21  ? 16.487 41.055 -5.670  1.00 19.39 ? 44  ARG A N     1 
ATOM   477  C CA    . ARG C 3 21  ? 17.039 40.779 -6.995  1.00 20.01 ? 44  ARG A CA    1 
ATOM   478  C C     . ARG C 3 21  ? 18.566 40.770 -7.013  1.00 19.56 ? 44  ARG A C     1 
ATOM   479  O O     . ARG C 3 21  ? 19.180 40.331 -7.992  1.00 16.98 ? 44  ARG A O     1 
ATOM   480  C CB    . ARG C 3 21  ? 16.523 41.830 -7.982  1.00 24.50 ? 44  ARG A CB    1 
ATOM   481  C CG    . ARG C 3 21  ? 15.021 42.032 -7.902  1.00 31.12 ? 44  ARG A CG    1 
ATOM   482  C CD    . ARG C 3 21  ? 14.282 41.054 -8.784  1.00 35.80 ? 44  ARG A CD    1 
ATOM   483  N NE    . ARG C 3 21  ? 14.002 41.638 -10.091 1.00 41.58 ? 44  ARG A NE    1 
ATOM   484  C CZ    . ARG C 3 21  ? 12.943 42.396 -10.360 1.00 41.63 ? 44  ARG A CZ    1 
ATOM   485  N NH1   . ARG C 3 21  ? 12.051 42.660 -9.414  1.00 42.61 ? 44  ARG A NH1   1 
ATOM   486  N NH2   . ARG C 3 21  ? 12.783 42.903 -11.574 1.00 40.18 ? 44  ARG A NH2   1 
ATOM   487  N N     . GLN C 3 22  ? 19.182 41.251 -5.935  1.00 18.01 ? 45  GLN A N     1 
ATOM   488  C CA    . GLN C 3 22  ? 20.640 41.321 -5.861  1.00 17.74 ? 45  GLN A CA    1 
ATOM   489  C C     . GLN C 3 22  ? 21.289 40.115 -5.204  1.00 18.16 ? 45  GLN A C     1 
ATOM   490  O O     . GLN C 3 22  ? 20.964 39.765 -4.074  1.00 19.25 ? 45  GLN A O     1 
ATOM   491  C CB    . GLN C 3 22  ? 21.061 42.596 -5.114  1.00 18.43 ? 45  GLN A CB    1 
ATOM   492  C CG    . GLN C 3 22  ? 20.754 43.871 -5.878  1.00 21.72 ? 45  GLN A CG    1 
ATOM   493  C CD    . GLN C 3 22  ? 21.410 43.872 -7.244  1.00 23.50 ? 45  GLN A CD    1 
ATOM   494  O OE1   . GLN C 3 22  ? 22.611 43.635 -7.363  1.00 27.07 ? 45  GLN A OE1   1 
ATOM   495  N NE2   . GLN C 3 22  ? 20.624 44.127 -8.283  1.00 25.94 ? 45  GLN A NE2   1 
ATOM   496  N N     . ALA C 3 23  ? 22.215 39.477 -5.915  1.00 16.98 ? 46  ALA A N     1 
ATOM   497  C CA    . ALA C 3 23  ? 22.909 38.321 -5.366  1.00 18.20 ? 46  ALA A CA    1 
ATOM   498  C C     . ALA C 3 23  ? 23.765 38.746 -4.171  1.00 17.40 ? 46  ALA A C     1 
ATOM   499  O O     . ALA C 3 23  ? 24.318 39.846 -4.157  1.00 17.79 ? 46  ALA A O     1 
ATOM   500  C CB    . ALA C 3 23  ? 23.800 37.686 -6.432  1.00 19.56 ? 46  ALA A CB    1 
ATOM   501  N N     . PRO C 3 24  ? 23.867 37.881 -3.147  1.00 16.12 ? 47  PRO A N     1 
ATOM   502  C CA    . PRO C 3 24  ? 24.676 38.192 -1.961  1.00 17.23 ? 47  PRO A CA    1 
ATOM   503  C C     . PRO C 3 24  ? 26.064 38.607 -2.432  1.00 18.92 ? 47  PRO A C     1 
ATOM   504  O O     . PRO C 3 24  ? 26.684 37.915 -3.250  1.00 18.14 ? 47  PRO A O     1 
ATOM   505  C CB    . PRO C 3 24  ? 24.681 36.870 -1.199  1.00 18.69 ? 47  PRO A CB    1 
ATOM   506  C CG    . PRO C 3 24  ? 23.298 36.333 -1.490  1.00 19.93 ? 47  PRO A CG    1 
ATOM   507  C CD    . PRO C 3 24  ? 23.146 36.608 -2.980  1.00 18.64 ? 47  PRO A CD    1 
ATOM   508  N N     . LEU C 3 25  ? 26.548 39.730 -1.910  1.00 18.81 ? 48  LEU A N     1 
ATOM   509  C CA    . LEU C 3 25  ? 27.843 40.275 -2.301  1.00 19.82 ? 48  LEU A CA    1 
ATOM   510  C C     . LEU C 3 25  ? 29.063 39.539 -1.770  1.00 19.40 ? 48  LEU A C     1 
ATOM   511  O O     . LEU C 3 25  ? 29.137 39.208 -0.589  1.00 18.95 ? 48  LEU A O     1 
ATOM   512  C CB    . LEU C 3 25  ? 27.933 41.746 -1.872  1.00 18.90 ? 48  LEU A CB    1 
ATOM   513  C CG    . LEU C 3 25  ? 26.887 42.687 -2.476  1.00 22.06 ? 48  LEU A CG    1 
ATOM   514  C CD1   . LEU C 3 25  ? 26.983 44.062 -1.832  1.00 24.95 ? 48  LEU A CD1   1 
ATOM   515  C CD2   . LEU C 3 25  ? 27.102 42.776 -3.984  1.00 24.88 ? 48  LEU A CD2   1 
ATOM   516  N N     . ILE C 3 26  ? 30.024 39.290 -2.656  1.00 18.60 ? 49  ILE A N     1 
ATOM   517  C CA    . ILE C 3 26  ? 31.278 38.646 -2.275  1.00 19.33 ? 49  ILE A CA    1 
ATOM   518  C C     . ILE C 3 26  ? 32.296 39.787 -2.284  1.00 18.46 ? 49  ILE A C     1 
ATOM   519  O O     . ILE C 3 26  ? 32.383 40.535 -3.259  1.00 18.27 ? 49  ILE A O     1 
ATOM   520  C CB    . ILE C 3 26  ? 31.700 37.563 -3.293  1.00 24.50 ? 49  ILE A CB    1 
ATOM   521  C CG1   . ILE C 3 26  ? 30.728 36.384 -3.229  1.00 26.74 ? 49  ILE A CG1   1 
ATOM   522  C CG2   . ILE C 3 26  ? 33.120 37.100 -3.006  1.00 24.45 ? 49  ILE A CG2   1 
ATOM   523  C CD1   . ILE C 3 26  ? 30.976 35.326 -4.291  1.00 32.01 ? 49  ILE A CD1   1 
ATOM   524  N N     . ILE C 3 27  ? 33.051 39.921 -1.199  1.00 17.20 ? 50  ILE A N     1 
ATOM   525  C CA    . ILE C 3 27  ? 34.040 40.997 -1.038  1.00 16.56 ? 50  ILE A CA    1 
ATOM   526  C C     . ILE C 3 27  ? 35.464 40.476 -1.250  1.00 17.42 ? 50  ILE A C     1 
ATOM   527  O O     . ILE C 3 27  ? 36.036 39.841 -0.359  1.00 17.64 ? 50  ILE A O     1 
ATOM   528  C CB    . ILE C 3 27  ? 33.932 41.586 0.393   1.00 16.27 ? 50  ILE A CB    1 
ATOM   529  C CG1   . ILE C 3 27  ? 32.485 42.012 0.667   1.00 17.28 ? 50  ILE A CG1   1 
ATOM   530  C CG2   . ILE C 3 27  ? 34.912 42.750 0.580   1.00 17.03 ? 50  ILE A CG2   1 
ATOM   531  C CD1   . ILE C 3 27  ? 31.930 43.062 -0.295  1.00 18.67 ? 50  ILE A CD1   1 
ATOM   532  N N     . PRO C 3 28  ? 36.063 40.745 -2.423  1.00 17.57 ? 51  PRO A N     1 
ATOM   533  C CA    . PRO C 3 28  ? 37.426 40.254 -2.668  1.00 17.28 ? 51  PRO A CA    1 
ATOM   534  C C     . PRO C 3 28  ? 38.497 40.939 -1.828  1.00 17.13 ? 51  PRO A C     1 
ATOM   535  O O     . PRO C 3 28  ? 38.496 42.162 -1.682  1.00 16.10 ? 51  PRO A O     1 
ATOM   536  C CB    . PRO C 3 28  ? 37.634 40.515 -4.166  1.00 18.41 ? 51  PRO A CB    1 
ATOM   537  C CG    . PRO C 3 28  ? 36.240 40.521 -4.720  1.00 16.51 ? 51  PRO A CG    1 
ATOM   538  C CD    . PRO C 3 28  ? 35.472 41.278 -3.664  1.00 18.44 ? 51  PRO A CD    1 
ATOM   539  N N     . LEU C 3 29  ? 39.410 40.139 -1.285  1.00 15.97 ? 52  LEU A N     1 
ATOM   540  C CA    . LEU C 3 29  ? 40.509 40.658 -0.482  1.00 16.77 ? 52  LEU A CA    1 
ATOM   541  C C     . LEU C 3 29  ? 41.710 40.900 -1.382  1.00 17.38 ? 52  LEU A C     1 
ATOM   542  O O     . LEU C 3 29  ? 41.794 40.333 -2.479  1.00 17.52 ? 52  LEU A O     1 
ATOM   543  C CB    . LEU C 3 29  ? 40.919 39.649 0.600   1.00 16.83 ? 52  LEU A CB    1 
ATOM   544  C CG    . LEU C 3 29  ? 39.861 39.234 1.621   1.00 17.94 ? 52  LEU A CG    1 
ATOM   545  C CD1   . LEU C 3 29  ? 40.477 38.321 2.686   1.00 16.34 ? 52  LEU A CD1   1 
ATOM   546  C CD2   . LEU C 3 29  ? 39.291 40.506 2.268   1.00 18.86 ? 52  LEU A CD2   1 
ATOM   547  N N     . LYS C 3 30  ? 42.631 41.744 -0.919  1.00 16.25 ? 53  LYS A N     1 
ATOM   548  C CA    . LYS C 3 30  ? 43.856 42.010 -1.658  1.00 18.61 ? 53  LYS A CA    1 
ATOM   549  C C     . LYS C 3 30  ? 44.643 40.702 -1.673  1.00 19.55 ? 53  LYS A C     1 
ATOM   550  O O     . LYS C 3 30  ? 44.494 39.867 -0.777  1.00 19.71 ? 53  LYS A O     1 
ATOM   551  C CB    . LYS C 3 30  ? 44.680 43.100 -0.976  1.00 17.86 ? 53  LYS A CB    1 
ATOM   552  C CG    . LYS C 3 30  ? 44.065 44.491 -1.070  1.00 20.36 ? 53  LYS A CG    1 
ATOM   553  C CD    . LYS C 3 30  ? 44.930 45.524 -0.357  1.00 22.18 ? 53  LYS A CD    1 
ATOM   554  C CE    . LYS C 3 30  ? 44.351 46.930 -0.542  1.00 22.30 ? 53  LYS A CE    1 
ATOM   555  N NZ    . LYS C 3 30  ? 45.158 47.969 0.157   1.00 21.32 ? 53  LYS A NZ    1 
ATOM   556  N N     . ALA C 3 31  ? 45.489 40.542 -2.684  1.00 19.87 ? 54  ALA A N     1 
ATOM   557  C CA    . ALA C 3 31  ? 46.272 39.325 -2.873  1.00 22.67 ? 54  ALA A CA    1 
ATOM   558  C C     . ALA C 3 31  ? 47.044 38.776 -1.679  1.00 22.40 ? 54  ALA A C     1 
ATOM   559  O O     . ALA C 3 31  ? 47.143 37.556 -1.524  1.00 24.47 ? 54  ALA A O     1 
ATOM   560  C CB    . ALA C 3 31  ? 47.231 39.515 -4.048  1.00 24.25 ? 54  ALA A CB    1 
ATOM   561  N N     . THR C 3 32  ? 47.590 39.655 -0.844  1.00 22.63 ? 55  THR A N     1 
ATOM   562  C CA    . THR C 3 32  ? 48.384 39.220 0.306   1.00 24.34 ? 55  THR A CA    1 
ATOM   563  C C     . THR C 3 32  ? 47.705 39.311 1.674   1.00 24.80 ? 55  THR A C     1 
ATOM   564  O O     . THR C 3 32  ? 48.346 39.070 2.694   1.00 24.32 ? 55  THR A O     1 
ATOM   565  C CB    . THR C 3 32  ? 49.696 40.027 0.408   1.00 26.36 ? 55  THR A CB    1 
ATOM   566  O OG1   . THR C 3 32  ? 49.390 41.399 0.683   1.00 29.13 ? 55  THR A OG1   1 
ATOM   567  C CG2   . THR C 3 32  ? 50.489 39.948 -0.899  1.00 28.74 ? 55  THR A CG2   1 
ATOM   568  N N     . SER C 3 33  ? 46.421 39.647 1.707   1.00 21.14 ? 56  SER A N     1 
ATOM   569  C CA    . SER C 3 33  ? 45.720 39.783 2.983   1.00 20.83 ? 56  SER A CA    1 
ATOM   570  C C     . SER C 3 33  ? 45.540 38.516 3.824   1.00 20.64 ? 56  SER A C     1 
ATOM   571  O O     . SER C 3 33  ? 45.261 37.431 3.313   1.00 20.38 ? 56  SER A O     1 
ATOM   572  C CB    . SER C 3 33  ? 44.352 40.424 2.750   1.00 19.95 ? 56  SER A CB    1 
ATOM   573  O OG    . SER C 3 33  ? 44.502 41.718 2.198   1.00 20.77 ? 56  SER A OG    1 
ATOM   574  N N     . THR C 3 34  ? 45.692 38.686 5.134   1.00 20.98 ? 57  THR A N     1 
ATOM   575  C CA    . THR C 3 34  ? 45.522 37.612 6.101   1.00 22.69 ? 57  THR A CA    1 
ATOM   576  C C     . THR C 3 34  ? 44.610 38.227 7.165   1.00 22.12 ? 57  THR A C     1 
ATOM   577  O O     . THR C 3 34  ? 44.658 39.431 7.389   1.00 20.60 ? 57  THR A O     1 
ATOM   578  C CB    . THR C 3 34  ? 46.884 37.207 6.725   1.00 23.65 ? 57  THR A CB    1 
ATOM   579  O OG1   . THR C 3 34  ? 46.692 36.149 7.667   1.00 32.14 ? 57  THR A OG1   1 
ATOM   580  C CG2   . THR C 3 34  ? 47.527 38.376 7.415   1.00 26.77 ? 57  THR A CG2   1 
ATOM   581  N N     . PRO C 3 35  ? 43.761 37.418 7.816   1.00 21.36 ? 58  PRO A N     1 
ATOM   582  C CA    . PRO C 3 35  ? 42.871 37.980 8.836   1.00 20.98 ? 58  PRO A CA    1 
ATOM   583  C C     . PRO C 3 35  ? 43.606 38.735 9.942   1.00 22.85 ? 58  PRO A C     1 
ATOM   584  O O     . PRO C 3 35  ? 44.732 38.395 10.307  1.00 22.12 ? 58  PRO A O     1 
ATOM   585  C CB    . PRO C 3 35  ? 42.141 36.750 9.375   1.00 21.34 ? 58  PRO A CB    1 
ATOM   586  C CG    . PRO C 3 35  ? 42.120 35.819 8.189   1.00 20.91 ? 58  PRO A CG    1 
ATOM   587  C CD    . PRO C 3 35  ? 43.510 35.978 7.631   1.00 21.97 ? 58  PRO A CD    1 
ATOM   588  N N     . VAL C 3 36  ? 42.958 39.767 10.467  1.00 22.27 ? 59  VAL A N     1 
ATOM   589  C CA    . VAL C 3 36  ? 43.519 40.547 11.561  1.00 22.72 ? 59  VAL A CA    1 
ATOM   590  C C     . VAL C 3 36  ? 42.454 40.535 12.651  1.00 22.65 ? 59  VAL A C     1 
ATOM   591  O O     . VAL C 3 36  ? 41.266 40.693 12.364  1.00 19.61 ? 59  VAL A O     1 
ATOM   592  C CB    . VAL C 3 36  ? 43.838 42.002 11.128  1.00 23.86 ? 59  VAL A CB    1 
ATOM   593  C CG1   . VAL C 3 36  ? 42.613 42.665 10.536  1.00 22.71 ? 59  VAL A CG1   1 
ATOM   594  C CG2   . VAL C 3 36  ? 44.343 42.795 12.320  1.00 26.93 ? 59  VAL A CG2   1 
ATOM   595  N N     . SER C 3 37  ? 42.881 40.313 13.891  1.00 22.55 ? 60  SER A N     1 
ATOM   596  C CA    . SER C 3 37  ? 41.962 40.258 15.021  1.00 24.19 ? 60  SER A CA    1 
ATOM   597  C C     . SER C 3 37  ? 42.378 41.306 16.035  1.00 24.92 ? 60  SER A C     1 
ATOM   598  O O     . SER C 3 37  ? 43.351 41.124 16.769  1.00 25.58 ? 60  SER A O     1 
ATOM   599  C CB    . SER C 3 37  ? 41.994 38.865 15.660  1.00 24.47 ? 60  SER A CB    1 
ATOM   600  O OG    . SER C 3 37  ? 41.058 38.755 16.727  1.00 26.32 ? 60  SER A OG    1 
ATOM   601  N N     . ILE C 3 38  ? 41.642 42.409 16.058  1.00 26.77 ? 61  ILE A N     1 
ATOM   602  C CA    . ILE C 3 38  ? 41.931 43.501 16.971  1.00 28.50 ? 61  ILE A CA    1 
ATOM   603  C C     . ILE C 3 38  ? 41.121 43.316 18.245  1.00 30.02 ? 61  ILE A C     1 
ATOM   604  O O     . ILE C 3 38  ? 39.916 43.071 18.199  1.00 28.27 ? 61  ILE A O     1 
ATOM   605  C CB    . ILE C 3 38  ? 41.580 44.850 16.328  1.00 27.73 ? 61  ILE A CB    1 
ATOM   606  C CG1   . ILE C 3 38  ? 42.320 44.982 14.996  1.00 29.68 ? 61  ILE A CG1   1 
ATOM   607  C CG2   . ILE C 3 38  ? 41.951 45.998 17.265  1.00 29.56 ? 61  ILE A CG2   1 
ATOM   608  C CD1   . ILE C 3 38  ? 41.912 46.181 14.196  1.00 32.12 ? 61  ILE A CD1   1 
ATOM   609  N N     . LYS C 3 39  ? 41.797 43.425 19.380  1.00 30.54 ? 62  LYS A N     1 
ATOM   610  C CA    . LYS C 3 39  ? 41.147 43.261 20.667  1.00 33.18 ? 62  LYS A CA    1 
ATOM   611  C C     . LYS C 3 39  ? 40.133 44.374 20.889  1.00 31.46 ? 62  LYS A C     1 
ATOM   612  O O     . LYS C 3 39  ? 40.351 45.516 20.498  1.00 31.97 ? 62  LYS A O     1 
ATOM   613  C CB    . LYS C 3 39  ? 42.192 43.280 21.787  1.00 36.87 ? 62  LYS A CB    1 
ATOM   614  C CG    . LYS C 3 39  ? 42.234 42.015 22.629  1.00 39.97 ? 62  LYS A CG    1 
ATOM   615  C CD    . LYS C 3 39  ? 40.931 41.801 23.380  1.00 44.34 ? 62  LYS A CD    1 
ATOM   616  C CE    . LYS C 3 39  ? 40.998 40.560 24.252  1.00 45.48 ? 62  LYS A CE    1 
ATOM   617  N NZ    . LYS C 3 39  ? 39.734 40.352 25.008  1.00 47.35 ? 62  LYS A NZ    1 
ATOM   618  N N     . GLN C 3 40  ? 39.016 44.024 21.510  1.00 31.82 ? 63  GLN A N     1 
ATOM   619  C CA    . GLN C 3 40  ? 37.965 44.985 21.803  1.00 30.97 ? 63  GLN A CA    1 
ATOM   620  C C     . GLN C 3 40  ? 38.321 45.725 23.089  1.00 32.15 ? 63  GLN A C     1 
ATOM   621  O O     . GLN C 3 40  ? 38.545 45.099 24.126  1.00 32.09 ? 63  GLN A O     1 
ATOM   622  C CB    . GLN C 3 40  ? 36.635 44.248 21.981  1.00 29.72 ? 63  GLN A CB    1 
ATOM   623  C CG    . GLN C 3 40  ? 35.501 45.098 22.531  1.00 28.72 ? 63  GLN A CG    1 
ATOM   624  C CD    . GLN C 3 40  ? 35.094 46.212 21.590  1.00 29.24 ? 63  GLN A CD    1 
ATOM   625  O OE1   . GLN C 3 40  ? 34.728 45.966 20.441  1.00 25.82 ? 63  GLN A OE1   1 
ATOM   626  N NE2   . GLN C 3 40  ? 35.153 47.445 22.074  1.00 27.80 ? 63  GLN A NE2   1 
ATOM   627  N N     A TYR C 3 41  ? 38.410 47.050 23.024  0.50 33.26 ? 64  TYR A N     1 
ATOM   628  N N     B TYR C 3 41  ? 38.360 47.050 23.022  0.50 32.67 ? 64  TYR A N     1 
ATOM   629  C CA    A TYR C 3 41  ? 38.726 47.798 24.231  0.50 34.64 ? 64  TYR A CA    1 
ATOM   630  C CA    B TYR C 3 41  ? 38.677 47.853 24.195  0.50 33.68 ? 64  TYR A CA    1 
ATOM   631  C C     A TYR C 3 41  ? 37.537 47.674 25.165  0.50 33.89 ? 64  TYR A C     1 
ATOM   632  C C     B TYR C 3 41  ? 37.510 47.724 25.171  0.50 33.32 ? 64  TYR A C     1 
ATOM   633  O O     A TYR C 3 41  ? 36.385 47.696 24.727  0.50 31.99 ? 64  TYR A O     1 
ATOM   634  O O     B TYR C 3 41  ? 36.348 47.780 24.763  0.50 31.45 ? 64  TYR A O     1 
ATOM   635  C CB    A TYR C 3 41  ? 38.997 49.282 23.955  0.50 37.06 ? 64  TYR A CB    1 
ATOM   636  C CB    B TYR C 3 41  ? 38.852 49.322 23.800  0.50 34.71 ? 64  TYR A CB    1 
ATOM   637  C CG    A TYR C 3 41  ? 38.691 49.772 22.560  0.50 40.81 ? 64  TYR A CG    1 
ATOM   638  C CG    B TYR C 3 41  ? 39.531 49.524 22.462  0.50 37.04 ? 64  TYR A CG    1 
ATOM   639  C CD1   A TYR C 3 41  ? 39.543 49.483 21.495  0.50 41.96 ? 64  TYR A CD1   1 
ATOM   640  C CD1   B TYR C 3 41  ? 40.823 49.049 22.229  0.50 37.19 ? 64  TYR A CD1   1 
ATOM   641  C CD2   A TYR C 3 41  ? 37.578 50.575 22.314  0.50 41.48 ? 64  TYR A CD2   1 
ATOM   642  C CD2   B TYR C 3 41  ? 38.871 50.176 21.418  0.50 36.39 ? 64  TYR A CD2   1 
ATOM   643  C CE1   A TYR C 3 41  ? 39.300 49.987 20.223  0.50 42.88 ? 64  TYR A CE1   1 
ATOM   644  C CE1   B TYR C 3 41  ? 41.438 49.216 20.986  0.50 37.17 ? 64  TYR A CE1   1 
ATOM   645  C CE2   A TYR C 3 41  ? 37.324 51.083 21.045  0.50 42.58 ? 64  TYR A CE2   1 
ATOM   646  C CE2   B TYR C 3 41  ? 39.477 50.349 20.176  0.50 37.38 ? 64  TYR A CE2   1 
ATOM   647  C CZ    A TYR C 3 41  ? 38.190 50.787 20.006  0.50 42.49 ? 64  TYR A CZ    1 
ATOM   648  C CZ    B TYR C 3 41  ? 40.758 49.867 19.967  0.50 36.80 ? 64  TYR A CZ    1 
ATOM   649  O OH    A TYR C 3 41  ? 37.952 51.299 18.753  0.50 43.12 ? 64  TYR A OH    1 
ATOM   650  O OH    B TYR C 3 41  ? 41.354 50.033 18.737  0.50 37.64 ? 64  TYR A OH    1 
ATOM   651  N N     . PRO C 3 42  ? 37.802 47.536 26.469  1.00 33.99 ? 65  PRO A N     1 
ATOM   652  C CA    . PRO C 3 42  ? 36.741 47.405 27.463  1.00 33.65 ? 65  PRO A CA    1 
ATOM   653  C C     . PRO C 3 42  ? 35.722 48.520 27.286  1.00 32.48 ? 65  PRO A C     1 
ATOM   654  O O     . PRO C 3 42  ? 36.079 49.673 27.055  1.00 34.01 ? 65  PRO A O     1 
ATOM   655  C CB    . PRO C 3 42  ? 37.502 47.495 28.781  1.00 35.33 ? 65  PRO A CB    1 
ATOM   656  C CG    . PRO C 3 42  ? 38.795 46.813 28.441  1.00 35.16 ? 65  PRO A CG    1 
ATOM   657  C CD    . PRO C 3 42  ? 39.129 47.441 27.107  1.00 34.41 ? 65  PRO A CD    1 
ATOM   658  N N     . MET C 3 43  ? 34.450 48.162 27.359  1.00 31.65 ? 66  MET A N     1 
ATOM   659  C CA    . MET C 3 43  ? 33.383 49.134 27.200  1.00 31.41 ? 66  MET A CA    1 
ATOM   660  C C     . MET C 3 43  ? 32.692 49.305 28.543  1.00 29.50 ? 66  MET A C     1 
ATOM   661  O O     . MET C 3 43  ? 32.424 48.322 29.228  1.00 28.97 ? 66  MET A O     1 
ATOM   662  C CB    . MET C 3 43  ? 32.378 48.635 26.168  1.00 32.32 ? 66  MET A CB    1 
ATOM   663  C CG    . MET C 3 43  ? 31.344 49.659 25.780  1.00 37.31 ? 66  MET A CG    1 
ATOM   664  S SD    . MET C 3 43  ? 30.229 49.018 24.528  1.00 40.34 ? 66  MET A SD    1 
ATOM   665  C CE    . MET C 3 43  ? 31.291 49.087 23.061  1.00 39.36 ? 66  MET A CE    1 
ATOM   666  N N     . SER C 3 44  ? 32.413 50.551 28.912  1.00 28.10 ? 67  SER A N     1 
ATOM   667  C CA    . SER C 3 44  ? 31.751 50.834 30.181  1.00 26.29 ? 67  SER A CA    1 
ATOM   668  C C     . SER C 3 44  ? 30.346 50.264 30.154  1.00 25.45 ? 67  SER A C     1 
ATOM   669  O O     . SER C 3 44  ? 29.798 49.974 29.090  1.00 24.92 ? 67  SER A O     1 
ATOM   670  C CB    . SER C 3 44  ? 31.680 52.344 30.425  1.00 26.59 ? 67  SER A CB    1 
ATOM   671  O OG    . SER C 3 44  ? 30.826 52.982 29.487  1.00 23.84 ? 67  SER A OG    1 
ATOM   672  N N     . GLN C 3 45  ? 29.751 50.098 31.326  1.00 22.10 ? 68  GLN A N     1 
ATOM   673  C CA    . GLN C 3 45  ? 28.400 49.567 31.368  1.00 21.01 ? 68  GLN A CA    1 
ATOM   674  C C     . GLN C 3 45  ? 27.453 50.562 30.703  1.00 19.73 ? 68  GLN A C     1 
ATOM   675  O O     . GLN C 3 45  ? 26.512 50.178 30.014  1.00 20.34 ? 68  GLN A O     1 
ATOM   676  C CB    . GLN C 3 45  ? 27.966 49.327 32.812  1.00 18.61 ? 68  GLN A CB    1 
ATOM   677  C CG    . GLN C 3 45  ? 26.537 48.834 32.912  1.00 18.08 ? 68  GLN A CG    1 
ATOM   678  C CD    . GLN C 3 45  ? 26.126 48.545 34.326  1.00 16.46 ? 68  GLN A CD    1 
ATOM   679  O OE1   . GLN C 3 45  ? 26.467 47.501 34.885  1.00 15.63 ? 68  GLN A OE1   1 
ATOM   680  N NE2   . GLN C 3 45  ? 25.395 49.481 34.929  1.00 16.60 ? 68  GLN A NE2   1 
ATOM   681  N N     . GLU C 3 46  ? 27.704 51.846 30.919  1.00 21.37 ? 69  GLU A N     1 
ATOM   682  C CA    . GLU C 3 46  ? 26.867 52.887 30.336  1.00 22.87 ? 69  GLU A CA    1 
ATOM   683  C C     . GLU C 3 46  ? 26.807 52.739 28.814  1.00 23.63 ? 69  GLU A C     1 
ATOM   684  O O     . GLU C 3 46  ? 25.734 52.791 28.209  1.00 21.59 ? 69  GLU A O     1 
ATOM   685  C CB    . GLU C 3 46  ? 27.426 54.261 30.704  1.00 25.69 ? 69  GLU A CB    1 
ATOM   686  C CG    . GLU C 3 46  ? 26.734 55.424 30.027  1.00 32.21 ? 69  GLU A CG    1 
ATOM   687  C CD    . GLU C 3 46  ? 27.238 56.756 30.541  1.00 35.77 ? 69  GLU A CD    1 
ATOM   688  O OE1   . GLU C 3 46  ? 26.815 57.161 31.641  1.00 35.12 ? 69  GLU A OE1   1 
ATOM   689  O OE2   . GLU C 3 46  ? 28.068 57.389 29.856  1.00 38.60 ? 69  GLU A OE2   1 
ATOM   690  N N     . ALA C 3 47  ? 27.965 52.546 28.199  1.00 22.89 ? 70  ALA A N     1 
ATOM   691  C CA    . ALA C 3 47  ? 28.022 52.400 26.750  1.00 24.58 ? 70  ALA A CA    1 
ATOM   692  C C     . ALA C 3 47  ? 27.342 51.112 26.307  1.00 23.90 ? 70  ALA A C     1 
ATOM   693  O O     . ALA C 3 47  ? 26.565 51.111 25.356  1.00 26.53 ? 70  ALA A O     1 
ATOM   694  C CB    . ALA C 3 47  ? 29.470 52.424 26.279  1.00 24.25 ? 70  ALA A CB    1 
ATOM   695  N N     . ARG C 3 48  ? 27.619 50.019 27.010  1.00 24.17 ? 71  ARG A N     1 
ATOM   696  C CA    . ARG C 3 48  ? 27.033 48.725 26.674  1.00 26.40 ? 71  ARG A CA    1 
ATOM   697  C C     . ARG C 3 48  ? 25.504 48.735 26.766  1.00 26.84 ? 71  ARG A C     1 
ATOM   698  O O     . ARG C 3 48  ? 24.818 48.166 25.913  1.00 25.86 ? 71  ARG A O     1 
ATOM   699  C CB    . ARG C 3 48  ? 27.612 47.643 27.588  1.00 29.42 ? 71  ARG A CB    1 
ATOM   700  C CG    . ARG C 3 48  ? 27.128 46.239 27.281  1.00 34.94 ? 71  ARG A CG    1 
ATOM   701  C CD    . ARG C 3 48  ? 27.902 45.196 28.073  1.00 37.97 ? 71  ARG A CD    1 
ATOM   702  N NE    . ARG C 3 48  ? 29.344 45.359 27.918  1.00 42.73 ? 71  ARG A NE    1 
ATOM   703  C CZ    . ARG C 3 48  ? 30.126 45.982 28.796  1.00 43.75 ? 71  ARG A CZ    1 
ATOM   704  N NH1   . ARG C 3 48  ? 29.607 46.501 29.903  1.00 44.05 ? 71  ARG A NH1   1 
ATOM   705  N NH2   . ARG C 3 48  ? 31.426 46.091 28.562  1.00 44.59 ? 71  ARG A NH2   1 
ATOM   706  N N     . LEU C 3 49  ? 24.970 49.371 27.804  1.00 24.42 ? 72  LEU A N     1 
ATOM   707  C CA    . LEU C 3 49  ? 23.522 49.449 27.966  1.00 24.82 ? 72  LEU A CA    1 
ATOM   708  C C     . LEU C 3 49  ? 22.931 50.321 26.871  1.00 23.98 ? 72  LEU A C     1 
ATOM   709  O O     . LEU C 3 49  ? 21.816 50.087 26.409  1.00 25.53 ? 72  LEU A O     1 
ATOM   710  C CB    . LEU C 3 49  ? 23.164 50.038 29.334  1.00 23.38 ? 72  LEU A CB    1 
ATOM   711  C CG    . LEU C 3 49  ? 23.170 49.072 30.517  1.00 25.30 ? 72  LEU A CG    1 
ATOM   712  C CD1   . LEU C 3 49  ? 24.440 48.255 30.522  1.00 27.89 ? 72  LEU A CD1   1 
ATOM   713  C CD2   . LEU C 3 49  ? 23.022 49.863 31.809  1.00 22.66 ? 72  LEU A CD2   1 
ATOM   714  N N     . GLY C 3 50  ? 23.686 51.332 26.458  1.00 24.77 ? 73  GLY A N     1 
ATOM   715  C CA    . GLY C 3 50  ? 23.214 52.215 25.411  1.00 26.71 ? 73  GLY A CA    1 
ATOM   716  C C     . GLY C 3 50  ? 23.199 51.526 24.060  1.00 26.71 ? 73  GLY A C     1 
ATOM   717  O O     . GLY C 3 50  ? 22.322 51.778 23.238  1.00 28.02 ? 73  GLY A O     1 
ATOM   718  N N     . ILE C 3 51  ? 24.168 50.644 23.840  1.00 27.41 ? 74  ILE A N     1 
ATOM   719  C CA    . ILE C 3 51  ? 24.293 49.914 22.579  1.00 28.79 ? 74  ILE A CA    1 
ATOM   720  C C     . ILE C 3 51  ? 23.396 48.679 22.470  1.00 27.93 ? 74  ILE A C     1 
ATOM   721  O O     . ILE C 3 51  ? 22.879 48.369 21.395  1.00 27.43 ? 74  ILE A O     1 
ATOM   722  C CB    . ILE C 3 51  ? 25.766 49.480 22.361  1.00 29.32 ? 74  ILE A CB    1 
ATOM   723  C CG1   . ILE C 3 51  ? 26.620 50.703 22.028  1.00 29.96 ? 74  ILE A CG1   1 
ATOM   724  C CG2   . ILE C 3 51  ? 25.857 48.421 21.271  1.00 32.53 ? 74  ILE A CG2   1 
ATOM   725  C CD1   . ILE C 3 51  ? 28.106 50.391 21.902  1.00 29.75 ? 74  ILE A CD1   1 
ATOM   726  N N     . LYS C 3 52  ? 23.214 47.982 23.588  1.00 28.14 ? 75  LYS A N     1 
ATOM   727  C CA    . LYS C 3 52  ? 22.426 46.754 23.640  1.00 28.21 ? 75  LYS A CA    1 
ATOM   728  C C     . LYS C 3 52  ? 21.111 46.688 22.852  1.00 28.24 ? 75  LYS A C     1 
ATOM   729  O O     . LYS C 3 52  ? 20.883 45.732 22.111  1.00 29.32 ? 75  LYS A O     1 
ATOM   730  C CB    . LYS C 3 52  ? 22.150 46.390 25.100  1.00 27.24 ? 75  LYS A CB    1 
ATOM   731  C CG    . LYS C 3 52  ? 21.455 45.055 25.290  1.00 30.47 ? 75  LYS A CG    1 
ATOM   732  C CD    . LYS C 3 52  ? 21.317 44.731 26.771  1.00 31.70 ? 75  LYS A CD    1 
ATOM   733  C CE    . LYS C 3 52  ? 20.594 43.411 26.988  1.00 33.26 ? 75  LYS A CE    1 
ATOM   734  N NZ    . LYS C 3 52  ? 20.444 43.107 28.441  1.00 36.21 ? 75  LYS A NZ    1 
ATOM   735  N N     . PRO C 3 53  ? 20.226 47.686 23.013  1.00 28.78 ? 76  PRO A N     1 
ATOM   736  C CA    . PRO C 3 53  ? 18.948 47.670 22.288  1.00 29.23 ? 76  PRO A CA    1 
ATOM   737  C C     . PRO C 3 53  ? 19.142 47.599 20.775  1.00 27.74 ? 76  PRO A C     1 
ATOM   738  O O     . PRO C 3 53  ? 18.402 46.907 20.078  1.00 28.22 ? 76  PRO A O     1 
ATOM   739  C CB    . PRO C 3 53  ? 18.285 48.978 22.722  1.00 30.24 ? 76  PRO A CB    1 
ATOM   740  C CG    . PRO C 3 53  ? 18.880 49.231 24.077  1.00 32.80 ? 76  PRO A CG    1 
ATOM   741  C CD    . PRO C 3 53  ? 20.329 48.886 23.859  1.00 29.45 ? 76  PRO A CD    1 
ATOM   742  N N     . HIS C 3 54  ? 20.137 48.322 20.273  1.00 26.36 ? 77  HIS A N     1 
ATOM   743  C CA    . HIS C 3 54  ? 20.412 48.319 18.840  1.00 26.98 ? 77  HIS A CA    1 
ATOM   744  C C     . HIS C 3 54  ? 20.885 46.944 18.388  1.00 24.16 ? 77  HIS A C     1 
ATOM   745  O O     . HIS C 3 54  ? 20.463 46.441 17.348  1.00 22.57 ? 77  HIS A O     1 
ATOM   746  C CB    . HIS C 3 54  ? 21.468 49.365 18.491  1.00 29.94 ? 77  HIS A CB    1 
ATOM   747  C CG    . HIS C 3 54  ? 21.082 50.761 18.863  1.00 35.25 ? 77  HIS A CG    1 
ATOM   748  N ND1   . HIS C 3 54  ? 21.223 51.257 20.142  1.00 38.04 ? 77  HIS A ND1   1 
ATOM   749  C CD2   . HIS C 3 54  ? 20.537 51.760 18.130  1.00 37.20 ? 77  HIS A CD2   1 
ATOM   750  C CE1   . HIS C 3 54  ? 20.782 52.502 20.180  1.00 38.26 ? 77  HIS A CE1   1 
ATOM   751  N NE2   . HIS C 3 54  ? 20.360 52.831 18.973  1.00 40.61 ? 77  HIS A NE2   1 
ATOM   752  N N     . ILE C 3 55  ? 21.768 46.338 19.171  1.00 23.05 ? 78  ILE A N     1 
ATOM   753  C CA    . ILE C 3 55  ? 22.287 45.019 18.842  1.00 23.92 ? 78  ILE A CA    1 
ATOM   754  C C     . ILE C 3 55  ? 21.172 43.976 18.846  1.00 24.27 ? 78  ILE A C     1 
ATOM   755  O O     . ILE C 3 55  ? 21.107 43.121 17.961  1.00 23.35 ? 78  ILE A O     1 
ATOM   756  C CB    . ILE C 3 55  ? 23.381 44.583 19.846  1.00 24.87 ? 78  ILE A CB    1 
ATOM   757  C CG1   . ILE C 3 55  ? 24.547 45.579 19.820  1.00 26.58 ? 78  ILE A CG1   1 
ATOM   758  C CG2   . ILE C 3 55  ? 23.835 43.166 19.537  1.00 26.69 ? 78  ILE A CG2   1 
ATOM   759  C CD1   . ILE C 3 55  ? 25.193 45.760 18.455  1.00 25.77 ? 78  ILE A CD1   1 
ATOM   760  N N     . GLN C 3 56  ? 20.289 44.041 19.840  1.00 21.86 ? 79  GLN A N     1 
ATOM   761  C CA    . GLN C 3 56  ? 19.204 43.073 19.920  1.00 23.62 ? 79  GLN A CA    1 
ATOM   762  C C     . GLN C 3 56  ? 18.267 43.210 18.730  1.00 23.13 ? 79  GLN A C     1 
ATOM   763  O O     . GLN C 3 56  ? 17.828 42.215 18.174  1.00 24.12 ? 79  GLN A O     1 
ATOM   764  C CB    . GLN C 3 56  ? 18.406 43.242 21.218  1.00 26.32 ? 79  GLN A CB    1 
ATOM   765  C CG    . GLN C 3 56  ? 17.368 42.148 21.437  1.00 29.48 ? 79  GLN A CG    1 
ATOM   766  C CD    . GLN C 3 56  ? 17.986 40.760 21.463  1.00 33.72 ? 79  GLN A CD    1 
ATOM   767  O OE1   . GLN C 3 56  ? 17.676 39.908 20.624  1.00 35.87 ? 79  GLN A OE1   1 
ATOM   768  N NE2   . GLN C 3 56  ? 18.871 40.526 22.427  1.00 36.39 ? 79  GLN A NE2   1 
ATOM   769  N N     . ARG C 3 57  ? 17.973 44.445 18.344  1.00 23.74 ? 80  ARG A N     1 
ATOM   770  C CA    . ARG C 3 57  ? 17.091 44.705 17.212  1.00 25.50 ? 80  ARG A CA    1 
ATOM   771  C C     . ARG C 3 57  ? 17.683 44.108 15.931  1.00 24.32 ? 80  ARG A C     1 
ATOM   772  O O     . ARG C 3 57  ? 16.980 43.457 15.149  1.00 21.99 ? 80  ARG A O     1 
ATOM   773  C CB    . ARG C 3 57  ? 16.883 46.216 17.059  1.00 28.66 ? 80  ARG A CB    1 
ATOM   774  C CG    . ARG C 3 57  ? 16.150 46.631 15.794  1.00 34.92 ? 80  ARG A CG    1 
ATOM   775  C CD    . ARG C 3 57  ? 15.765 48.109 15.801  1.00 40.01 ? 80  ARG A CD    1 
ATOM   776  N NE    . ARG C 3 57  ? 16.804 48.999 16.328  1.00 46.02 ? 80  ARG A NE    1 
ATOM   777  C CZ    . ARG C 3 57  ? 18.078 49.003 15.941  1.00 47.07 ? 80  ARG A CZ    1 
ATOM   778  N NH1   . ARG C 3 57  ? 18.504 48.157 15.016  1.00 48.94 ? 80  ARG A NH1   1 
ATOM   779  N NH2   . ARG C 3 57  ? 18.929 49.866 16.477  1.00 48.40 ? 80  ARG A NH2   1 
ATOM   780  N N     . LEU C 3 58  ? 18.980 44.325 15.726  1.00 21.50 ? 81  LEU A N     1 
ATOM   781  C CA    . LEU C 3 58  ? 19.661 43.798 14.543  1.00 21.93 ? 81  LEU A CA    1 
ATOM   782  C C     . LEU C 3 58  ? 19.686 42.268 14.554  1.00 22.95 ? 81  LEU A C     1 
ATOM   783  O O     . LEU C 3 58  ? 19.579 41.628 13.508  1.00 22.67 ? 81  LEU A O     1 
ATOM   784  C CB    . LEU C 3 58  ? 21.081 44.368 14.461  1.00 20.09 ? 81  LEU A CB    1 
ATOM   785  C CG    . LEU C 3 58  ? 21.121 45.872 14.167  1.00 20.49 ? 81  LEU A CG    1 
ATOM   786  C CD1   . LEU C 3 58  ? 22.524 46.428 14.404  1.00 21.32 ? 81  LEU A CD1   1 
ATOM   787  C CD2   . LEU C 3 58  ? 20.676 46.115 12.711  1.00 21.28 ? 81  LEU A CD2   1 
ATOM   788  N N     . LEU C 3 59  ? 19.822 41.680 15.738  1.00 22.44 ? 82  LEU A N     1 
ATOM   789  C CA    . LEU C 3 59  ? 19.821 40.227 15.863  1.00 23.58 ? 82  LEU A CA    1 
ATOM   790  C C     . LEU C 3 59  ? 18.426 39.700 15.522  1.00 25.80 ? 82  LEU A C     1 
ATOM   791  O O     . LEU C 3 59  ? 18.286 38.702 14.810  1.00 26.05 ? 82  LEU A O     1 
ATOM   792  C CB    . LEU C 3 59  ? 20.193 39.811 17.291  1.00 24.66 ? 82  LEU A CB    1 
ATOM   793  C CG    . LEU C 3 59  ? 21.669 39.870 17.686  1.00 26.07 ? 82  LEU A CG    1 
ATOM   794  C CD1   . LEU C 3 59  ? 21.806 39.717 19.198  1.00 28.46 ? 82  LEU A CD1   1 
ATOM   795  C CD2   . LEU C 3 59  ? 22.433 38.775 16.959  1.00 25.73 ? 82  LEU A CD2   1 
ATOM   796  N N     . ASP C 3 60  ? 17.396 40.368 16.037  1.00 27.20 ? 83  ASP A N     1 
ATOM   797  C CA    . ASP C 3 60  ? 16.025 39.948 15.765  1.00 28.56 ? 83  ASP A CA    1 
ATOM   798  C C     . ASP C 3 60  ? 15.700 40.095 14.280  1.00 29.48 ? 83  ASP A C     1 
ATOM   799  O O     . ASP C 3 60  ? 14.896 39.336 13.736  1.00 29.10 ? 83  ASP A O     1 
ATOM   800  C CB    . ASP C 3 60  ? 15.025 40.768 16.589  1.00 31.24 ? 83  ASP A CB    1 
ATOM   801  C CG    . ASP C 3 60  ? 15.174 40.547 18.084  1.00 32.61 ? 83  ASP A CG    1 
ATOM   802  O OD1   . ASP C 3 60  ? 15.663 39.471 18.490  1.00 34.19 ? 83  ASP A OD1   1 
ATOM   803  O OD2   . ASP C 3 60  ? 14.788 41.445 18.856  1.00 35.41 ? 83  ASP A OD2   1 
ATOM   804  N N     . GLN C 3 61  ? 16.336 41.067 13.630  1.00 27.09 ? 84  GLN A N     1 
ATOM   805  C CA    . GLN C 3 61  ? 16.116 41.317 12.209  1.00 26.93 ? 84  GLN A CA    1 
ATOM   806  C C     . GLN C 3 61  ? 16.963 40.424 11.311  1.00 26.15 ? 84  GLN A C     1 
ATOM   807  O O     . GLN C 3 61  ? 16.792 40.421 10.090  1.00 26.68 ? 84  GLN A O     1 
ATOM   808  C CB    . GLN C 3 61  ? 16.392 42.789 11.885  1.00 27.05 ? 84  GLN A CB    1 
ATOM   809  C CG    . GLN C 3 61  ? 15.287 43.727 12.344  1.00 28.48 ? 84  GLN A CG    1 
ATOM   810  C CD    . GLN C 3 61  ? 15.651 45.193 12.208  1.00 29.74 ? 84  GLN A CD    1 
ATOM   811  O OE1   . GLN C 3 61  ? 14.772 46.049 12.097  1.00 32.38 ? 84  GLN A OE1   1 
ATOM   812  N NE2   . GLN C 3 61  ? 16.948 45.494 12.232  1.00 26.19 ? 84  GLN A NE2   1 
ATOM   813  N N     . GLY C 3 62  ? 17.875 39.671 11.919  1.00 25.56 ? 85  GLY A N     1 
ATOM   814  C CA    . GLY C 3 62  ? 18.729 38.776 11.157  1.00 23.54 ? 85  GLY A CA    1 
ATOM   815  C C     . GLY C 3 62  ? 19.875 39.486 10.460  1.00 23.02 ? 85  GLY A C     1 
ATOM   816  O O     . GLY C 3 62  ? 20.598 38.880 9.656   1.00 22.04 ? 85  GLY A O     1 
ATOM   817  N N     . ILE C 3 63  ? 20.037 40.770 10.765  1.00 21.26 ? 86  ILE A N     1 
ATOM   818  C CA    . ILE C 3 63  ? 21.097 41.579 10.171  1.00 19.99 ? 86  ILE A CA    1 
ATOM   819  C C     . ILE C 3 63  ? 22.429 41.254 10.851  1.00 19.73 ? 86  ILE A C     1 
ATOM   820  O O     . ILE C 3 63  ? 23.490 41.331 10.232  1.00 19.57 ? 86  ILE A O     1 
ATOM   821  C CB    . ILE C 3 63  ? 20.745 43.081 10.267  1.00 19.23 ? 86  ILE A CB    1 
ATOM   822  C CG1   . ILE C 3 63  ? 19.484 43.352 9.427   1.00 21.41 ? 86  ILE A CG1   1 
ATOM   823  C CG2   . ILE C 3 63  ? 21.910 43.936 9.774   1.00 21.06 ? 86  ILE A CG2   1 
ATOM   824  C CD1   . ILE C 3 63  ? 19.092 44.820 9.324   1.00 24.56 ? 86  ILE A CD1   1 
ATOM   825  N N     . LEU C 3 64  ? 22.361 40.901 12.132  1.00 19.04 ? 87  LEU A N     1 
ATOM   826  C CA    . LEU C 3 64  ? 23.536 40.471 12.889  1.00 18.29 ? 87  LEU A CA    1 
ATOM   827  C C     . LEU C 3 64  ? 23.292 39.004 13.233  1.00 20.34 ? 87  LEU A C     1 
ATOM   828  O O     . LEU C 3 64  ? 22.150 38.609 13.481  1.00 22.26 ? 87  LEU A O     1 
ATOM   829  C CB    . LEU C 3 64  ? 23.695 41.260 14.200  1.00 18.06 ? 87  LEU A CB    1 
ATOM   830  C CG    . LEU C 3 64  ? 24.316 42.660 14.138  1.00 18.86 ? 87  LEU A CG    1 
ATOM   831  C CD1   . LEU C 3 64  ? 24.352 43.276 15.540  1.00 18.88 ? 87  LEU A CD1   1 
ATOM   832  C CD2   . LEU C 3 64  ? 25.718 42.568 13.584  1.00 15.26 ? 87  LEU A CD2   1 
ATOM   833  N N     . VAL C 3 65  ? 24.351 38.200 13.228  1.00 19.82 ? 88  VAL A N     1 
ATOM   834  C CA    . VAL C 3 65  ? 24.250 36.782 13.574  1.00 21.57 ? 88  VAL A CA    1 
ATOM   835  C C     . VAL C 3 65  ? 25.502 36.360 14.322  1.00 22.38 ? 88  VAL A C     1 
ATOM   836  O O     . VAL C 3 65  ? 26.579 36.928 14.126  1.00 23.12 ? 88  VAL A O     1 
ATOM   837  C CB    . VAL C 3 65  ? 24.116 35.859 12.328  1.00 22.04 ? 88  VAL A CB    1 
ATOM   838  C CG1   . VAL C 3 65  ? 22.795 36.125 11.624  1.00 21.36 ? 88  VAL A CG1   1 
ATOM   839  C CG2   . VAL C 3 65  ? 25.297 36.066 11.387  1.00 20.89 ? 88  VAL A CG2   1 
ATOM   840  N N     . PRO C 3 66  ? 25.375 35.360 15.206  1.00 24.34 ? 89  PRO A N     1 
ATOM   841  C CA    . PRO C 3 66  ? 26.530 34.884 15.968  1.00 25.48 ? 89  PRO A CA    1 
ATOM   842  C C     . PRO C 3 66  ? 27.545 34.275 15.010  1.00 26.77 ? 89  PRO A C     1 
ATOM   843  O O     . PRO C 3 66  ? 27.179 33.778 13.943  1.00 25.62 ? 89  PRO A O     1 
ATOM   844  C CB    . PRO C 3 66  ? 25.925 33.823 16.889  1.00 26.74 ? 89  PRO A CB    1 
ATOM   845  C CG    . PRO C 3 66  ? 24.502 34.273 17.053  1.00 27.72 ? 89  PRO A CG    1 
ATOM   846  C CD    . PRO C 3 66  ? 24.140 34.696 15.652  1.00 25.35 ? 89  PRO A CD    1 
ATOM   847  N N     . CYS C 3 67  ? 28.818 34.317 15.378  1.00 26.71 ? 90  CYS A N     1 
ATOM   848  C CA    . CYS C 3 67  ? 29.837 33.722 14.533  1.00 28.08 ? 90  CYS A CA    1 
ATOM   849  C C     . CYS C 3 67  ? 31.148 33.519 15.272  1.00 28.83 ? 90  CYS A C     1 
ATOM   850  O O     . CYS C 3 67  ? 31.348 34.016 16.386  1.00 28.26 ? 90  CYS A O     1 
ATOM   851  C CB    . CYS C 3 67  ? 30.087 34.589 13.294  1.00 29.54 ? 90  CYS A CB    1 
ATOM   852  S SG    . CYS C 3 67  ? 31.168 36.004 13.584  1.00 30.69 ? 90  CYS A SG    1 
ATOM   853  N N     . GLN C 3 68  ? 32.028 32.761 14.636  1.00 28.01 ? 91  GLN A N     1 
ATOM   854  C CA    . GLN C 3 68  ? 33.357 32.481 15.149  1.00 28.17 ? 91  GLN A CA    1 
ATOM   855  C C     . GLN C 3 68  ? 34.222 32.827 13.946  1.00 26.19 ? 91  GLN A C     1 
ATOM   856  O O     . GLN C 3 68  ? 34.165 32.145 12.924  1.00 27.69 ? 91  GLN A O     1 
ATOM   857  C CB    . GLN C 3 68  ? 33.483 30.996 15.503  1.00 31.00 ? 91  GLN A CB    1 
ATOM   858  C CG    . GLN C 3 68  ? 34.702 30.646 16.334  1.00 37.70 ? 91  GLN A CG    1 
ATOM   859  C CD    . GLN C 3 68  ? 34.681 29.199 16.800  1.00 40.94 ? 91  GLN A CD    1 
ATOM   860  O OE1   . GLN C 3 68  ? 33.709 28.747 17.408  1.00 43.59 ? 91  GLN A OE1   1 
ATOM   861  N NE2   . GLN C 3 68  ? 35.753 28.469 16.519  1.00 43.25 ? 91  GLN A NE2   1 
ATOM   862  N N     . SER C 3 69  ? 35.004 33.895 14.057  1.00 22.47 ? 92  SER A N     1 
ATOM   863  C CA    . SER C 3 69  ? 35.831 34.342 12.940  1.00 22.18 ? 92  SER A CA    1 
ATOM   864  C C     . SER C 3 69  ? 37.251 34.758 13.299  1.00 21.42 ? 92  SER A C     1 
ATOM   865  O O     . SER C 3 69  ? 37.504 35.272 14.386  1.00 22.34 ? 92  SER A O     1 
ATOM   866  C CB    . SER C 3 69  ? 35.140 35.518 12.232  1.00 19.92 ? 92  SER A CB    1 
ATOM   867  O OG    . SER C 3 69  ? 35.989 36.111 11.258  1.00 19.54 ? 92  SER A OG    1 
ATOM   868  N N     . PRO C 3 70  ? 38.196 34.556 12.368  1.00 22.25 ? 93  PRO A N     1 
ATOM   869  C CA    . PRO C 3 70  ? 39.610 34.905 12.544  1.00 23.03 ? 93  PRO A CA    1 
ATOM   870  C C     . PRO C 3 70  ? 39.756 36.420 12.489  1.00 21.92 ? 93  PRO A C     1 
ATOM   871  O O     . PRO C 3 70  ? 40.793 36.971 12.855  1.00 19.98 ? 93  PRO A O     1 
ATOM   872  C CB    . PRO C 3 70  ? 40.297 34.254 11.338  1.00 24.24 ? 93  PRO A CB    1 
ATOM   873  C CG    . PRO C 3 70  ? 39.287 33.275 10.805  1.00 27.56 ? 93  PRO A CG    1 
ATOM   874  C CD    . PRO C 3 70  ? 37.976 33.922 11.058  1.00 24.98 ? 93  PRO A CD    1 
ATOM   875  N N     . TRP C 3 71  ? 38.713 37.082 11.992  1.00 20.70 ? 94  TRP A N     1 
ATOM   876  C CA    . TRP C 3 71  ? 38.706 38.531 11.879  1.00 18.58 ? 94  TRP A CA    1 
ATOM   877  C C     . TRP C 3 71  ? 37.966 39.145 13.058  1.00 18.51 ? 94  TRP A C     1 
ATOM   878  O O     . TRP C 3 71  ? 36.987 38.587 13.537  1.00 17.86 ? 94  TRP A O     1 
ATOM   879  C CB    . TRP C 3 71  ? 37.973 38.989 10.610  1.00 18.98 ? 94  TRP A CB    1 
ATOM   880  C CG    . TRP C 3 71  ? 38.568 38.550 9.312   1.00 17.64 ? 94  TRP A CG    1 
ATOM   881  C CD1   . TRP C 3 71  ? 38.377 37.354 8.684   1.00 20.74 ? 94  TRP A CD1   1 
ATOM   882  C CD2   . TRP C 3 71  ? 39.446 39.310 8.473   1.00 19.98 ? 94  TRP A CD2   1 
ATOM   883  N NE1   . TRP C 3 71  ? 39.081 37.322 7.503   1.00 19.21 ? 94  TRP A NE1   1 
ATOM   884  C CE2   . TRP C 3 71  ? 39.747 38.507 7.349   1.00 19.96 ? 94  TRP A CE2   1 
ATOM   885  C CE3   . TRP C 3 71  ? 40.009 40.592 8.561   1.00 19.60 ? 94  TRP A CE3   1 
ATOM   886  C CZ2   . TRP C 3 71  ? 40.586 38.943 6.319   1.00 19.50 ? 94  TRP A CZ2   1 
ATOM   887  C CZ3   . TRP C 3 71  ? 40.844 41.026 7.535   1.00 21.90 ? 94  TRP A CZ3   1 
ATOM   888  C CH2   . TRP C 3 71  ? 41.124 40.200 6.428   1.00 21.44 ? 94  TRP A CH2   1 
ATOM   889  N N     . ASN C 3 72  ? 38.431 40.300 13.513  1.00 18.49 ? 95  ASN A N     1 
ATOM   890  C CA    . ASN C 3 72  ? 37.737 41.003 14.584  1.00 18.64 ? 95  ASN A CA    1 
ATOM   891  C C     . ASN C 3 72  ? 38.152 42.465 14.618  1.00 17.98 ? 95  ASN A C     1 
ATOM   892  O O     . ASN C 3 72  ? 39.337 42.786 14.592  1.00 19.82 ? 95  ASN A O     1 
ATOM   893  C CB    . ASN C 3 72  ? 38.009 40.382 15.956  1.00 20.06 ? 95  ASN A CB    1 
ATOM   894  C CG    . ASN C 3 72  ? 36.965 40.801 16.991  1.00 21.64 ? 95  ASN A CG    1 
ATOM   895  O OD1   . ASN C 3 72  ? 35.862 40.267 17.013  1.00 22.17 ? 95  ASN A OD1   1 
ATOM   896  N ND2   . ASN C 3 72  ? 37.304 41.778 17.827  1.00 21.19 ? 95  ASN A ND2   1 
ATOM   897  N N     . THR C 3 73  ? 37.168 43.353 14.636  1.00 17.83 ? 96  THR A N     1 
ATOM   898  C CA    . THR C 3 73  ? 37.453 44.773 14.728  1.00 17.47 ? 96  THR A CA    1 
ATOM   899  C C     . THR C 3 73  ? 36.643 45.326 15.882  1.00 18.38 ? 96  THR A C     1 
ATOM   900  O O     . THR C 3 73  ? 35.582 44.795 16.222  1.00 18.92 ? 96  THR A O     1 
ATOM   901  C CB    . THR C 3 73  ? 37.130 45.527 13.425  1.00 16.83 ? 96  THR A CB    1 
ATOM   902  O OG1   . THR C 3 73  ? 35.927 45.011 12.853  1.00 17.66 ? 96  THR A OG1   1 
ATOM   903  C CG2   . THR C 3 73  ? 38.279 45.378 12.451  1.00 15.13 ? 96  THR A CG2   1 
ATOM   904  N N     . PRO C 3 74  ? 37.137 46.407 16.500  1.00 20.30 ? 97  PRO A N     1 
ATOM   905  C CA    . PRO C 3 74  ? 36.510 47.073 17.642  1.00 21.33 ? 97  PRO A CA    1 
ATOM   906  C C     . PRO C 3 74  ? 35.214 47.815 17.388  1.00 22.37 ? 97  PRO A C     1 
ATOM   907  O O     . PRO C 3 74  ? 35.017 48.428 16.341  1.00 22.33 ? 97  PRO A O     1 
ATOM   908  C CB    . PRO C 3 74  ? 37.599 48.035 18.146  1.00 22.70 ? 97  PRO A CB    1 
ATOM   909  C CG    . PRO C 3 74  ? 38.844 47.708 17.338  1.00 23.57 ? 97  PRO A CG    1 
ATOM   910  C CD    . PRO C 3 74  ? 38.317 47.160 16.047  1.00 20.66 ? 97  PRO A CD    1 
ATOM   911  N N     . LEU C 3 75  ? 34.336 47.752 18.379  1.00 23.96 ? 98  LEU A N     1 
ATOM   912  C CA    . LEU C 3 75  ? 33.065 48.449 18.337  1.00 27.77 ? 98  LEU A CA    1 
ATOM   913  C C     . LEU C 3 75  ? 33.297 49.679 19.214  1.00 31.57 ? 98  LEU A C     1 
ATOM   914  O O     . LEU C 3 75  ? 34.007 49.604 20.219  1.00 30.06 ? 98  LEU A O     1 
ATOM   915  C CB    . LEU C 3 75  ? 31.972 47.567 18.941  1.00 29.93 ? 98  LEU A CB    1 
ATOM   916  C CG    . LEU C 3 75  ? 30.535 47.774 18.470  1.00 30.83 ? 98  LEU A CG    1 
ATOM   917  C CD1   . LEU C 3 75  ? 30.449 47.516 16.969  1.00 28.03 ? 98  LEU A CD1   1 
ATOM   918  C CD2   . LEU C 3 75  ? 29.613 46.837 19.239  1.00 26.09 ? 98  LEU A CD2   1 
ATOM   919  N N     . LEU C 3 76  ? 32.727 50.812 18.827  1.00 34.56 ? 99  LEU A N     1 
ATOM   920  C CA    . LEU C 3 76  ? 32.892 52.028 19.606  1.00 40.89 ? 99  LEU A CA    1 
ATOM   921  C C     . LEU C 3 76  ? 31.548 52.617 20.012  1.00 43.55 ? 99  LEU A C     1 
ATOM   922  O O     . LEU C 3 76  ? 30.565 52.522 19.275  1.00 41.69 ? 99  LEU A O     1 
ATOM   923  C CB    . LEU C 3 76  ? 33.670 53.073 18.807  1.00 41.89 ? 99  LEU A CB    1 
ATOM   924  C CG    . LEU C 3 76  ? 35.110 52.744 18.406  1.00 44.52 ? 99  LEU A CG    1 
ATOM   925  C CD1   . LEU C 3 76  ? 35.166 51.519 17.508  1.00 45.12 ? 99  LEU A CD1   1 
ATOM   926  C CD2   . LEU C 3 76  ? 35.680 53.937 17.687  1.00 45.47 ? 99  LEU A CD2   1 
ATOM   927  N N     . PRO C 3 77  ? 31.483 53.203 21.217  1.00 46.55 ? 100 PRO A N     1 
ATOM   928  C CA    . PRO C 3 77  ? 30.253 53.821 21.723  1.00 49.28 ? 100 PRO A CA    1 
ATOM   929  C C     . PRO C 3 77  ? 30.251 55.299 21.321  1.00 51.43 ? 100 PRO A C     1 
ATOM   930  O O     . PRO C 3 77  ? 31.076 56.075 21.805  1.00 50.70 ? 100 PRO A O     1 
ATOM   931  C CB    . PRO C 3 77  ? 30.371 53.651 23.243  1.00 49.26 ? 100 PRO A CB    1 
ATOM   932  C CG    . PRO C 3 77  ? 31.424 52.571 23.421  1.00 49.09 ? 100 PRO A CG    1 
ATOM   933  C CD    . PRO C 3 77  ? 32.395 52.895 22.329  1.00 48.53 ? 100 PRO A CD    1 
ATOM   934  N N     . VAL C 3 78  ? 29.332 55.686 20.441  1.00 54.46 ? 101 VAL A N     1 
ATOM   935  C CA    . VAL C 3 78  ? 29.257 57.072 19.987  1.00 58.34 ? 101 VAL A CA    1 
ATOM   936  C C     . VAL C 3 78  ? 27.938 57.751 20.347  1.00 61.52 ? 101 VAL A C     1 
ATOM   937  O O     . VAL C 3 78  ? 26.861 57.252 20.019  1.00 61.44 ? 101 VAL A O     1 
ATOM   938  C CB    . VAL C 3 78  ? 29.453 57.166 18.453  1.00 57.52 ? 101 VAL A CB    1 
ATOM   939  C CG1   . VAL C 3 78  ? 29.382 58.617 18.003  1.00 56.81 ? 101 VAL A CG1   1 
ATOM   940  C CG2   . VAL C 3 78  ? 30.789 56.554 18.064  1.00 57.08 ? 101 VAL A CG2   1 
ATOM   941  N N     . LYS C 3 79  ? 28.036 58.893 21.022  1.00 65.58 ? 102 LYS A N     1 
ATOM   942  C CA    . LYS C 3 79  ? 26.861 59.665 21.424  1.00 70.08 ? 102 LYS A CA    1 
ATOM   943  C C     . LYS C 3 79  ? 26.980 61.069 20.832  1.00 72.76 ? 102 LYS A C     1 
ATOM   944  O O     . LYS C 3 79  ? 27.991 61.394 20.210  1.00 73.34 ? 102 LYS A O     1 
ATOM   945  C CB    . LYS C 3 79  ? 26.786 59.758 22.951  1.00 70.40 ? 102 LYS A CB    1 
ATOM   946  C CG    . LYS C 3 79  ? 27.859 60.639 23.573  1.00 71.43 ? 102 LYS A CG    1 
ATOM   947  C CD    . LYS C 3 79  ? 27.733 60.686 25.088  1.00 71.88 ? 102 LYS A CD    1 
ATOM   948  C CE    . LYS C 3 79  ? 28.624 61.767 25.687  1.00 72.46 ? 102 LYS A CE    1 
ATOM   949  N NZ    . LYS C 3 79  ? 30.063 61.571 25.356  1.00 73.01 ? 102 LYS A NZ    1 
ATOM   950  N N     . LYS C 3 80  ? 25.956 61.900 21.021  1.00 75.84 ? 103 LYS A N     1 
ATOM   951  C CA    . LYS C 3 80  ? 25.996 63.262 20.493  1.00 78.54 ? 103 LYS A CA    1 
ATOM   952  C C     . LYS C 3 80  ? 25.508 64.339 21.472  1.00 80.11 ? 103 LYS A C     1 
ATOM   953  O O     . LYS C 3 80  ? 26.320 65.101 21.998  1.00 80.20 ? 103 LYS A O     1 
ATOM   954  C CB    . LYS C 3 80  ? 25.220 63.340 19.170  1.00 79.13 ? 103 LYS A CB    1 
ATOM   955  C CG    . LYS C 3 80  ? 25.817 62.496 18.052  1.00 80.34 ? 103 LYS A CG    1 
ATOM   956  C CD    . LYS C 3 80  ? 27.241 62.935 17.730  1.00 80.74 ? 103 LYS A CD    1 
ATOM   957  C CE    . LYS C 3 80  ? 27.873 62.045 16.673  1.00 81.16 ? 103 LYS A CE    1 
ATOM   958  N NZ    . LYS C 3 80  ? 27.119 62.085 15.391  1.00 81.69 ? 103 LYS A NZ    1 
ATOM   959  N N     . PRO C 3 81  ? 24.187 64.426 21.729  1.00 81.58 ? 104 PRO A N     1 
ATOM   960  C CA    . PRO C 3 81  ? 23.713 65.454 22.665  1.00 82.54 ? 104 PRO A CA    1 
ATOM   961  C C     . PRO C 3 81  ? 24.380 65.342 24.034  1.00 83.36 ? 104 PRO A C     1 
ATOM   962  O O     . PRO C 3 81  ? 25.429 65.941 24.278  1.00 83.64 ? 104 PRO A O     1 
ATOM   963  C CB    . PRO C 3 81  ? 22.210 65.188 22.735  1.00 82.36 ? 104 PRO A CB    1 
ATOM   964  C CG    . PRO C 3 81  ? 21.905 64.657 21.377  1.00 82.13 ? 104 PRO A CG    1 
ATOM   965  C CD    . PRO C 3 81  ? 23.044 63.693 21.156  1.00 82.02 ? 104 PRO A CD    1 
ATOM   966  N N     . GLY C 3 82  ? 23.759 64.575 24.924  1.00 83.96 ? 105 GLY A N     1 
ATOM   967  C CA    . GLY C 3 82  ? 24.310 64.387 26.252  1.00 84.22 ? 105 GLY A CA    1 
ATOM   968  C C     . GLY C 3 82  ? 24.955 63.021 26.361  1.00 84.32 ? 105 GLY A C     1 
ATOM   969  O O     . GLY C 3 82  ? 25.205 62.368 25.346  1.00 84.71 ? 105 GLY A O     1 
ATOM   970  N N     . THR C 3 83  ? 25.222 62.582 27.587  1.00 84.03 ? 106 THR A N     1 
ATOM   971  C CA    . THR C 3 83  ? 25.838 61.278 27.814  1.00 83.37 ? 106 THR A CA    1 
ATOM   972  C C     . THR C 3 83  ? 24.865 60.156 27.457  1.00 82.53 ? 106 THR A C     1 
ATOM   973  O O     . THR C 3 83  ? 25.054 59.005 27.852  1.00 82.61 ? 106 THR A O     1 
ATOM   974  C CB    . THR C 3 83  ? 26.269 61.113 29.288  1.00 83.56 ? 106 THR A CB    1 
ATOM   975  O OG1   . THR C 3 83  ? 26.901 59.839 29.464  1.00 83.58 ? 106 THR A OG1   1 
ATOM   976  C CG2   . THR C 3 83  ? 25.061 61.206 30.211  1.00 83.57 ? 106 THR A CG2   1 
ATOM   977  N N     . ASN C 3 84  ? 23.825 60.502 26.703  1.00 81.27 ? 107 ASN A N     1 
ATOM   978  C CA    . ASN C 3 84  ? 22.815 59.536 26.293  1.00 79.51 ? 107 ASN A CA    1 
ATOM   979  C C     . ASN C 3 84  ? 22.903 59.219 24.803  1.00 77.91 ? 107 ASN A C     1 
ATOM   980  O O     . ASN C 3 84  ? 23.934 59.441 24.168  1.00 77.98 ? 107 ASN A O     1 
ATOM   981  C CB    . ASN C 3 84  ? 21.417 60.072 26.619  1.00 80.11 ? 107 ASN A CB    1 
ATOM   982  C CG    . ASN C 3 84  ? 21.216 60.314 28.103  1.00 80.49 ? 107 ASN A CG    1 
ATOM   983  O OD1   . ASN C 3 84  ? 21.955 61.076 28.726  1.00 80.63 ? 107 ASN A OD1   1 
ATOM   984  N ND2   . ASN C 3 84  ? 20.208 59.666 28.675  1.00 80.59 ? 107 ASN A ND2   1 
ATOM   985  N N     . ASP C 3 85  ? 21.805 58.700 24.261  1.00 75.85 ? 108 ASP A N     1 
ATOM   986  C CA    . ASP C 3 85  ? 21.703 58.332 22.853  1.00 73.22 ? 108 ASP A CA    1 
ATOM   987  C C     . ASP C 3 85  ? 22.981 57.739 22.261  1.00 70.89 ? 108 ASP A C     1 
ATOM   988  O O     . ASP C 3 85  ? 23.779 58.440 21.636  1.00 70.85 ? 108 ASP A O     1 
ATOM   989  C CB    . ASP C 3 85  ? 21.259 59.540 22.015  1.00 74.36 ? 108 ASP A CB    1 
ATOM   990  C CG    . ASP C 3 85  ? 22.248 60.690 22.067  1.00 75.37 ? 108 ASP A CG    1 
ATOM   991  O OD1   . ASP C 3 85  ? 22.337 61.363 23.117  1.00 75.96 ? 108 ASP A OD1   1 
ATOM   992  O OD2   . ASP C 3 85  ? 22.943 60.916 21.054  1.00 75.90 ? 108 ASP A OD2   1 
ATOM   993  N N     . TYR C 3 86  ? 23.171 56.439 22.467  1.00 67.24 ? 109 TYR A N     1 
ATOM   994  C CA    . TYR C 3 86  ? 24.334 55.745 21.934  1.00 63.02 ? 109 TYR A CA    1 
ATOM   995  C C     . TYR C 3 86  ? 23.953 55.027 20.647  1.00 59.99 ? 109 TYR A C     1 
ATOM   996  O O     . TYR C 3 86  ? 22.781 54.957 20.286  1.00 60.12 ? 109 TYR A O     1 
ATOM   997  C CB    . TYR C 3 86  ? 24.870 54.717 22.935  1.00 62.66 ? 109 TYR A CB    1 
ATOM   998  C CG    . TYR C 3 86  ? 25.743 55.292 24.027  1.00 62.57 ? 109 TYR A CG    1 
ATOM   999  C CD1   . TYR C 3 86  ? 25.189 55.970 25.112  1.00 62.88 ? 109 TYR A CD1   1 
ATOM   1000 C CD2   . TYR C 3 86  ? 27.128 55.157 23.974  1.00 62.67 ? 109 TYR A CD2   1 
ATOM   1001 C CE1   . TYR C 3 86  ? 25.997 56.497 26.121  1.00 62.36 ? 109 TYR A CE1   1 
ATOM   1002 C CE2   . TYR C 3 86  ? 27.945 55.681 24.973  1.00 62.64 ? 109 TYR A CE2   1 
ATOM   1003 C CZ    . TYR C 3 86  ? 27.374 56.348 26.043  1.00 62.64 ? 109 TYR A CZ    1 
ATOM   1004 O OH    . TYR C 3 86  ? 28.182 56.862 27.032  1.00 62.79 ? 109 TYR A OH    1 
ATOM   1005 N N     . ARG C 3 87  ? 24.958 54.501 19.960  1.00 56.12 ? 110 ARG A N     1 
ATOM   1006 C CA    . ARG C 3 87  ? 24.762 53.765 18.718  1.00 52.00 ? 110 ARG A CA    1 
ATOM   1007 C C     . ARG C 3 87  ? 26.102 53.128 18.360  1.00 46.50 ? 110 ARG A C     1 
ATOM   1008 O O     . ARG C 3 87  ? 27.142 53.782 18.404  1.00 47.02 ? 110 ARG A O     1 
ATOM   1009 C CB    . ARG C 3 87  ? 24.285 54.701 17.603  1.00 54.27 ? 110 ARG A CB    1 
ATOM   1010 C CG    . ARG C 3 87  ? 25.249 55.815 17.245  1.00 57.80 ? 110 ARG A CG    1 
ATOM   1011 C CD    . ARG C 3 87  ? 24.614 56.773 16.244  1.00 60.73 ? 110 ARG A CD    1 
ATOM   1012 N NE    . ARG C 3 87  ? 25.535 57.830 15.839  1.00 62.69 ? 110 ARG A NE    1 
ATOM   1013 C CZ    . ARG C 3 87  ? 26.627 57.631 15.109  1.00 63.74 ? 110 ARG A CZ    1 
ATOM   1014 N NH1   . ARG C 3 87  ? 26.937 56.409 14.697  1.00 64.43 ? 110 ARG A NH1   1 
ATOM   1015 N NH2   . ARG C 3 87  ? 27.412 58.653 14.794  1.00 64.53 ? 110 ARG A NH2   1 
ATOM   1016 N N     . PRO C 3 88  ? 26.090 51.834 18.011  1.00 41.39 ? 111 PRO A N     1 
ATOM   1017 C CA    . PRO C 3 88  ? 27.303 51.092 17.653  1.00 37.40 ? 111 PRO A CA    1 
ATOM   1018 C C     . PRO C 3 88  ? 28.010 51.615 16.410  1.00 32.49 ? 111 PRO A C     1 
ATOM   1019 O O     . PRO C 3 88  ? 27.385 51.798 15.371  1.00 30.94 ? 111 PRO A O     1 
ATOM   1020 C CB    . PRO C 3 88  ? 26.794 49.664 17.439  1.00 38.24 ? 111 PRO A CB    1 
ATOM   1021 C CG    . PRO C 3 88  ? 25.478 49.627 18.162  1.00 40.47 ? 111 PRO A CG    1 
ATOM   1022 C CD    . PRO C 3 88  ? 24.903 50.976 17.883  1.00 41.56 ? 111 PRO A CD    1 
ATOM   1023 N N     . VAL C 3 89  ? 29.311 51.859 16.534  1.00 27.52 ? 112 VAL A N     1 
ATOM   1024 C CA    . VAL C 3 89  ? 30.128 52.315 15.418  1.00 23.95 ? 112 VAL A CA    1 
ATOM   1025 C C     . VAL C 3 89  ? 31.350 51.414 15.407  1.00 22.95 ? 112 VAL A C     1 
ATOM   1026 O O     . VAL C 3 89  ? 32.133 51.390 16.354  1.00 21.56 ? 112 VAL A O     1 
ATOM   1027 C CB    . VAL C 3 89  ? 30.578 53.773 15.574  1.00 26.56 ? 112 VAL A CB    1 
ATOM   1028 C CG1   . VAL C 3 89  ? 31.543 54.143 14.444  1.00 26.32 ? 112 VAL A CG1   1 
ATOM   1029 C CG2   . VAL C 3 89  ? 29.366 54.691 15.553  1.00 27.63 ? 112 VAL A CG2   1 
ATOM   1030 N N     . GLN C 3 90  ? 31.498 50.661 14.328  1.00 19.63 ? 113 GLN A N     1 
ATOM   1031 C CA    . GLN C 3 90  ? 32.600 49.727 14.198  1.00 18.61 ? 113 GLN A CA    1 
ATOM   1032 C C     . GLN C 3 90  ? 33.770 50.365 13.462  1.00 17.72 ? 113 GLN A C     1 
ATOM   1033 O O     . GLN C 3 90  ? 33.583 51.036 12.452  1.00 19.12 ? 113 GLN A O     1 
ATOM   1034 C CB    . GLN C 3 90  ? 32.100 48.496 13.440  1.00 16.57 ? 113 GLN A CB    1 
ATOM   1035 C CG    . GLN C 3 90  ? 33.092 47.363 13.298  1.00 14.27 ? 113 GLN A CG    1 
ATOM   1036 C CD    . GLN C 3 90  ? 32.425 46.126 12.714  1.00 16.84 ? 113 GLN A CD    1 
ATOM   1037 O OE1   . GLN C 3 90  ? 31.318 46.204 12.184  1.00 17.53 ? 113 GLN A OE1   1 
ATOM   1038 N NE2   . GLN C 3 90  ? 33.093 44.987 12.809  1.00 14.88 ? 113 GLN A NE2   1 
ATOM   1039 N N     . ASP C 3 91  ? 34.978 50.162 13.977  1.00 18.35 ? 114 ASP A N     1 
ATOM   1040 C CA    . ASP C 3 91  ? 36.168 50.708 13.334  1.00 18.78 ? 114 ASP A CA    1 
ATOM   1041 C C     . ASP C 3 91  ? 36.683 49.648 12.368  1.00 16.81 ? 114 ASP A C     1 
ATOM   1042 O O     . ASP C 3 91  ? 37.434 48.759 12.764  1.00 16.31 ? 114 ASP A O     1 
ATOM   1043 C CB    . ASP C 3 91  ? 37.252 51.015 14.363  1.00 20.01 ? 114 ASP A CB    1 
ATOM   1044 C CG    . ASP C 3 91  ? 38.510 51.586 13.725  1.00 22.46 ? 114 ASP A CG    1 
ATOM   1045 O OD1   . ASP C 3 91  ? 38.537 51.723 12.483  1.00 18.72 ? 114 ASP A OD1   1 
ATOM   1046 O OD2   . ASP C 3 91  ? 39.463 51.903 14.468  1.00 21.93 ? 114 ASP A OD2   1 
ATOM   1047 N N     . LEU C 3 92  ? 36.283 49.759 11.106  1.00 18.57 ? 115 LEU A N     1 
ATOM   1048 C CA    . LEU C 3 92  ? 36.674 48.793 10.078  1.00 17.57 ? 115 LEU A CA    1 
ATOM   1049 C C     . LEU C 3 92  ? 37.918 49.184 9.284   1.00 18.05 ? 115 LEU A C     1 
ATOM   1050 O O     . LEU C 3 92  ? 38.213 48.592 8.250   1.00 17.34 ? 115 LEU A O     1 
ATOM   1051 C CB    . LEU C 3 92  ? 35.503 48.577 9.113   1.00 16.20 ? 115 LEU A CB    1 
ATOM   1052 C CG    . LEU C 3 92  ? 34.332 47.767 9.685   1.00 16.13 ? 115 LEU A CG    1 
ATOM   1053 C CD1   . LEU C 3 92  ? 33.161 47.777 8.703   1.00 15.38 ? 115 LEU A CD1   1 
ATOM   1054 C CD2   . LEU C 3 92  ? 34.793 46.334 9.949   1.00 15.68 ? 115 LEU A CD2   1 
ATOM   1055 N N     . ARG C 3 93  ? 38.675 50.156 9.773   1.00 18.25 ? 116 ARG A N     1 
ATOM   1056 C CA    . ARG C 3 93  ? 39.853 50.571 9.025   1.00 18.45 ? 116 ARG A CA    1 
ATOM   1057 C C     . ARG C 3 93  ? 40.855 49.462 8.715   1.00 18.90 ? 116 ARG A C     1 
ATOM   1058 O O     . ARG C 3 93  ? 41.390 49.426 7.610   1.00 18.63 ? 116 ARG A O     1 
ATOM   1059 C CB    . ARG C 3 93  ? 40.533 51.744 9.734   1.00 20.63 ? 116 ARG A CB    1 
ATOM   1060 C CG    . ARG C 3 93  ? 39.714 53.026 9.596   1.00 20.93 ? 116 ARG A CG    1 
ATOM   1061 C CD    . ARG C 3 93  ? 40.325 54.179 10.362  1.00 25.77 ? 116 ARG A CD    1 
ATOM   1062 N NE    . ARG C 3 93  ? 40.363 53.909 11.794  1.00 26.78 ? 116 ARG A NE    1 
ATOM   1063 C CZ    . ARG C 3 93  ? 40.874 54.746 12.690  1.00 31.81 ? 116 ARG A CZ    1 
ATOM   1064 N NH1   . ARG C 3 93  ? 41.386 55.905 12.295  1.00 30.61 ? 116 ARG A NH1   1 
ATOM   1065 N NH2   . ARG C 3 93  ? 40.879 54.423 13.975  1.00 32.07 ? 116 ARG A NH2   1 
ATOM   1066 N N     . GLU C 3 94  ? 41.109 48.560 9.661   1.00 18.12 ? 117 GLU A N     1 
ATOM   1067 C CA    . GLU C 3 94  ? 42.060 47.479 9.408   1.00 21.12 ? 117 GLU A CA    1 
ATOM   1068 C C     . GLU C 3 94  ? 41.509 46.472 8.413   1.00 21.69 ? 117 GLU A C     1 
ATOM   1069 O O     . GLU C 3 94  ? 42.271 45.771 7.743   1.00 20.55 ? 117 GLU A O     1 
ATOM   1070 C CB    . GLU C 3 94  ? 42.456 46.783 10.707  1.00 24.25 ? 117 GLU A CB    1 
ATOM   1071 C CG    . GLU C 3 94  ? 43.434 47.603 11.556  1.00 27.73 ? 117 GLU A CG    1 
ATOM   1072 C CD    . GLU C 3 94  ? 44.712 47.952 10.803  1.00 31.01 ? 117 GLU A CD    1 
ATOM   1073 O OE1   . GLU C 3 94  ? 45.377 47.026 10.291  1.00 30.45 ? 117 GLU A OE1   1 
ATOM   1074 O OE2   . GLU C 3 94  ? 45.055 49.152 10.724  1.00 32.69 ? 117 GLU A OE2   1 
ATOM   1075 N N     . VAL C 3 95  ? 40.184 46.392 8.321   1.00 19.75 ? 118 VAL A N     1 
ATOM   1076 C CA    . VAL C 3 95  ? 39.561 45.492 7.349   1.00 18.43 ? 118 VAL A CA    1 
ATOM   1077 C C     . VAL C 3 95  ? 39.606 46.195 5.989   1.00 19.08 ? 118 VAL A C     1 
ATOM   1078 O O     . VAL C 3 95  ? 39.968 45.591 4.976   1.00 16.48 ? 118 VAL A O     1 
ATOM   1079 C CB    . VAL C 3 95  ? 38.096 45.166 7.730   1.00 19.42 ? 118 VAL A CB    1 
ATOM   1080 C CG1   . VAL C 3 95  ? 37.341 44.597 6.514   1.00 17.88 ? 118 VAL A CG1   1 
ATOM   1081 C CG2   . VAL C 3 95  ? 38.079 44.146 8.875   1.00 18.50 ? 118 VAL A CG2   1 
ATOM   1082 N N     . ASN C 3 96  ? 39.260 47.481 5.970   1.00 16.58 ? 119 ASN A N     1 
ATOM   1083 C CA    . ASN C 3 96  ? 39.283 48.243 4.724   1.00 18.00 ? 119 ASN A CA    1 
ATOM   1084 C C     . ASN C 3 96  ? 40.642 48.154 4.036   1.00 19.27 ? 119 ASN A C     1 
ATOM   1085 O O     . ASN C 3 96  ? 40.713 48.010 2.818   1.00 18.54 ? 119 ASN A O     1 
ATOM   1086 C CB    . ASN C 3 96  ? 38.924 49.715 4.975   1.00 17.58 ? 119 ASN A CB    1 
ATOM   1087 C CG    . ASN C 3 96  ? 37.452 49.905 5.290   1.00 18.87 ? 119 ASN A CG    1 
ATOM   1088 O OD1   . ASN C 3 96  ? 36.614 49.129 4.829   1.00 15.91 ? 119 ASN A OD1   1 
ATOM   1089 N ND2   . ASN C 3 96  ? 37.125 50.952 6.062   1.00 17.77 ? 119 ASN A ND2   1 
ATOM   1090 N N     . LYS C 3 97  ? 41.713 48.226 4.822   1.00 18.23 ? 120 LYS A N     1 
ATOM   1091 C CA    . LYS C 3 97  ? 43.076 48.148 4.284   1.00 20.96 ? 120 LYS A CA    1 
ATOM   1092 C C     . LYS C 3 97  ? 43.373 46.820 3.600   1.00 20.66 ? 120 LYS A C     1 
ATOM   1093 O O     . LYS C 3 97  ? 44.242 46.747 2.737   1.00 21.43 ? 120 LYS A O     1 
ATOM   1094 C CB    . LYS C 3 97  ? 44.115 48.307 5.403   1.00 23.23 ? 120 LYS A CB    1 
ATOM   1095 C CG    . LYS C 3 97  ? 44.239 49.676 6.028   1.00 28.59 ? 120 LYS A CG    1 
ATOM   1096 C CD    . LYS C 3 97  ? 45.299 49.604 7.129   1.00 32.99 ? 120 LYS A CD    1 
ATOM   1097 C CE    . LYS C 3 97  ? 45.571 50.950 7.773   1.00 35.35 ? 120 LYS A CE    1 
ATOM   1098 N NZ    . LYS C 3 97  ? 46.556 50.806 8.881   1.00 36.70 ? 120 LYS A NZ    1 
ATOM   1099 N N     . ARG C 3 98  ? 42.669 45.765 3.994   1.00 19.66 ? 121 ARG A N     1 
ATOM   1100 C CA    . ARG C 3 98  ? 42.937 44.448 3.423   1.00 18.57 ? 121 ARG A CA    1 
ATOM   1101 C C     . ARG C 3 98  ? 42.001 44.024 2.294   1.00 18.50 ? 121 ARG A C     1 
ATOM   1102 O O     . ARG C 3 98  ? 42.175 42.963 1.700   1.00 18.43 ? 121 ARG A O     1 
ATOM   1103 C CB    . ARG C 3 98  ? 42.939 43.407 4.545   1.00 17.81 ? 121 ARG A CB    1 
ATOM   1104 C CG    . ARG C 3 98  ? 44.092 43.617 5.531   1.00 20.92 ? 121 ARG A CG    1 
ATOM   1105 C CD    . ARG C 3 98  ? 43.976 42.727 6.754   1.00 21.83 ? 121 ARG A CD    1 
ATOM   1106 N NE    . ARG C 3 98  ? 45.192 42.765 7.573   1.00 23.37 ? 121 ARG A NE    1 
ATOM   1107 C CZ    . ARG C 3 98  ? 45.579 43.793 8.323   1.00 24.66 ? 121 ARG A CZ    1 
ATOM   1108 N NH1   . ARG C 3 98  ? 44.852 44.902 8.385   1.00 25.61 ? 121 ARG A NH1   1 
ATOM   1109 N NH2   . ARG C 3 98  ? 46.709 43.712 9.015   1.00 26.96 ? 121 ARG A NH2   1 
ATOM   1110 N N     . VAL C 3 99  ? 41.028 44.873 1.988   1.00 16.33 ? 122 VAL A N     1 
ATOM   1111 C CA    . VAL C 3 99  ? 40.064 44.598 0.931   1.00 16.47 ? 122 VAL A CA    1 
ATOM   1112 C C     . VAL C 3 99  ? 40.501 45.250 -0.380  1.00 17.49 ? 122 VAL A C     1 
ATOM   1113 O O     . VAL C 3 99  ? 40.929 46.402 -0.394  1.00 17.88 ? 122 VAL A O     1 
ATOM   1114 C CB    . VAL C 3 99  ? 38.664 45.114 1.339   1.00 15.37 ? 122 VAL A CB    1 
ATOM   1115 C CG1   . VAL C 3 99  ? 37.709 45.072 0.143   1.00 15.57 ? 122 VAL A CG1   1 
ATOM   1116 C CG2   . VAL C 3 99  ? 38.120 44.246 2.476   1.00 15.64 ? 122 VAL A CG2   1 
ATOM   1117 N N     . GLU C 3 100 ? 40.396 44.509 -1.477  1.00 16.95 ? 123 GLU A N     1 
ATOM   1118 C CA    . GLU C 3 100 ? 40.798 45.026 -2.788  1.00 18.86 ? 123 GLU A CA    1 
ATOM   1119 C C     . GLU C 3 100 ? 39.988 46.284 -3.130  1.00 20.92 ? 123 GLU A C     1 
ATOM   1120 O O     . GLU C 3 100 ? 38.790 46.348 -2.871  1.00 19.96 ? 123 GLU A O     1 
ATOM   1121 C CB    . GLU C 3 100 ? 40.581 43.945 -3.855  1.00 20.55 ? 123 GLU A CB    1 
ATOM   1122 C CG    . GLU C 3 100 ? 41.058 44.322 -5.257  1.00 26.45 ? 123 GLU A CG    1 
ATOM   1123 C CD    . GLU C 3 100 ? 42.575 44.317 -5.403  1.00 31.36 ? 123 GLU A CD    1 
ATOM   1124 O OE1   . GLU C 3 100 ? 43.075 44.820 -6.435  1.00 37.40 ? 123 GLU A OE1   1 
ATOM   1125 O OE2   . GLU C 3 100 ? 43.271 43.801 -4.505  1.00 33.52 ? 123 GLU A OE2   1 
ATOM   1126 N N     . ASP C 3 101 ? 40.649 47.293 -3.692  1.00 20.62 ? 124 ASP A N     1 
ATOM   1127 C CA    . ASP C 3 101 ? 39.959 48.527 -4.056  1.00 22.84 ? 124 ASP A CA    1 
ATOM   1128 C C     . ASP C 3 101 ? 39.103 48.349 -5.302  1.00 21.06 ? 124 ASP A C     1 
ATOM   1129 O O     . ASP C 3 101 ? 39.389 47.507 -6.156  1.00 21.44 ? 124 ASP A O     1 
ATOM   1130 C CB    . ASP C 3 101 ? 40.962 49.651 -4.339  1.00 25.78 ? 124 ASP A CB    1 
ATOM   1131 C CG    . ASP C 3 101 ? 41.779 50.035 -3.121  1.00 30.24 ? 124 ASP A CG    1 
ATOM   1132 O OD1   . ASP C 3 101 ? 41.183 50.302 -2.060  1.00 31.81 ? 124 ASP A OD1   1 
ATOM   1133 O OD2   . ASP C 3 101 ? 43.019 50.088 -3.237  1.00 34.27 ? 124 ASP A OD2   1 
ATOM   1134 N N     . ILE C 3 102 ? 38.039 49.137 -5.399  1.00 20.89 ? 125 ILE A N     1 
ATOM   1135 C CA    . ILE C 3 102 ? 37.191 49.103 -6.581  1.00 21.26 ? 125 ILE A CA    1 
ATOM   1136 C C     . ILE C 3 102 ? 37.151 50.534 -7.108  1.00 22.36 ? 125 ILE A C     1 
ATOM   1137 O O     . ILE C 3 102 ? 37.447 51.473 -6.369  1.00 21.27 ? 125 ILE A O     1 
ATOM   1138 C CB    . ILE C 3 102 ? 35.760 48.598 -6.269  1.00 21.15 ? 125 ILE A CB    1 
ATOM   1139 C CG1   . ILE C 3 102 ? 35.060 49.534 -5.286  1.00 21.96 ? 125 ILE A CG1   1 
ATOM   1140 C CG2   . ILE C 3 102 ? 35.827 47.174 -5.715  1.00 20.54 ? 125 ILE A CG2   1 
ATOM   1141 C CD1   . ILE C 3 102 ? 33.612 49.156 -5.027  1.00 23.84 ? 125 ILE A CD1   1 
ATOM   1142 N N     . HIS C 3 103 ? 36.818 50.711 -8.381  1.00 22.65 ? 126 HIS A N     1 
ATOM   1143 C CA    . HIS C 3 103 ? 36.769 52.064 -8.936  1.00 25.46 ? 126 HIS A CA    1 
ATOM   1144 C C     . HIS C 3 103 ? 35.601 52.846 -8.328  1.00 24.31 ? 126 HIS A C     1 
ATOM   1145 O O     . HIS C 3 103 ? 34.496 52.324 -8.220  1.00 23.69 ? 126 HIS A O     1 
ATOM   1146 C CB    . HIS C 3 103 ? 36.611 52.018 -10.461 1.00 28.50 ? 126 HIS A CB    1 
ATOM   1147 C CG    . HIS C 3 103 ? 36.759 53.356 -11.114 1.00 35.03 ? 126 HIS A CG    1 
ATOM   1148 N ND1   . HIS C 3 103 ? 37.955 54.042 -11.137 1.00 37.50 ? 126 HIS A ND1   1 
ATOM   1149 C CD2   . HIS C 3 103 ? 35.856 54.155 -11.731 1.00 37.51 ? 126 HIS A CD2   1 
ATOM   1150 C CE1   . HIS C 3 103 ? 37.780 55.207 -11.737 1.00 39.28 ? 126 HIS A CE1   1 
ATOM   1151 N NE2   . HIS C 3 103 ? 36.516 55.300 -12.107 1.00 38.19 ? 126 HIS A NE2   1 
ATOM   1152 N N     . PRO C 3 104 ? 35.836 54.106 -7.918  1.00 24.63 ? 127 PRO A N     1 
ATOM   1153 C CA    . PRO C 3 104 ? 34.789 54.950 -7.321  1.00 25.73 ? 127 PRO A CA    1 
ATOM   1154 C C     . PRO C 3 104 ? 33.847 55.437 -8.419  1.00 24.22 ? 127 PRO A C     1 
ATOM   1155 O O     . PRO C 3 104 ? 34.183 56.361 -9.153  1.00 25.64 ? 127 PRO A O     1 
ATOM   1156 C CB    . PRO C 3 104 ? 35.579 56.115 -6.708  1.00 27.81 ? 127 PRO A CB    1 
ATOM   1157 C CG    . PRO C 3 104 ? 36.999 55.602 -6.621  1.00 30.98 ? 127 PRO A CG    1 
ATOM   1158 C CD    . PRO C 3 104 ? 37.137 54.791 -7.871  1.00 27.22 ? 127 PRO A CD    1 
ATOM   1159 N N     . THR C 3 105 ? 32.665 54.841 -8.520  1.00 22.29 ? 128 THR A N     1 
ATOM   1160 C CA    . THR C 3 105 ? 31.727 55.218 -9.570  1.00 20.54 ? 128 THR A CA    1 
ATOM   1161 C C     . THR C 3 105 ? 30.625 56.196 -9.182  1.00 21.96 ? 128 THR A C     1 
ATOM   1162 O O     . THR C 3 105 ? 29.859 56.629 -10.040 1.00 22.56 ? 128 THR A O     1 
ATOM   1163 C CB    . THR C 3 105 ? 31.051 53.972 -10.162 1.00 20.17 ? 128 THR A CB    1 
ATOM   1164 O OG1   . THR C 3 105 ? 30.364 53.271 -9.120  1.00 19.43 ? 128 THR A OG1   1 
ATOM   1165 C CG2   . THR C 3 105 ? 32.090 53.054 -10.785 1.00 20.03 ? 128 THR A CG2   1 
ATOM   1166 N N     . VAL C 3 106 ? 30.523 56.526 -7.901  1.00 21.37 ? 129 VAL A N     1 
ATOM   1167 C CA    . VAL C 3 106 ? 29.496 57.460 -7.452  1.00 21.76 ? 129 VAL A CA    1 
ATOM   1168 C C     . VAL C 3 106 ? 29.912 58.861 -7.897  1.00 21.74 ? 129 VAL A C     1 
ATOM   1169 O O     . VAL C 3 106 ? 30.998 59.325 -7.555  1.00 20.80 ? 129 VAL A O     1 
ATOM   1170 C CB    . VAL C 3 106 ? 29.352 57.438 -5.914  1.00 22.85 ? 129 VAL A CB    1 
ATOM   1171 C CG1   . VAL C 3 106 ? 28.251 58.405 -5.474  1.00 24.96 ? 129 VAL A CG1   1 
ATOM   1172 C CG2   . VAL C 3 106 ? 29.023 56.025 -5.443  1.00 23.29 ? 129 VAL A CG2   1 
ATOM   1173 N N     . PRO C 3 107 ? 29.059 59.543 -8.676  1.00 24.11 ? 130 PRO A N     1 
ATOM   1174 C CA    . PRO C 3 107 ? 29.358 60.896 -9.163  1.00 25.64 ? 130 PRO A CA    1 
ATOM   1175 C C     . PRO C 3 107 ? 29.370 61.882 -8.004  1.00 24.84 ? 130 PRO A C     1 
ATOM   1176 O O     . PRO C 3 107 ? 28.718 61.643 -6.996  1.00 24.42 ? 130 PRO A O     1 
ATOM   1177 C CB    . PRO C 3 107 ? 28.191 61.202 -10.110 1.00 28.04 ? 130 PRO A CB    1 
ATOM   1178 C CG    . PRO C 3 107 ? 27.549 59.863 -10.383 1.00 28.69 ? 130 PRO A CG    1 
ATOM   1179 C CD    . PRO C 3 107 ? 27.711 59.125 -9.095  1.00 25.87 ? 130 PRO A CD    1 
ATOM   1180 N N     . ASN C 3 108 ? 30.109 62.984 -8.118  1.00 26.33 ? 131 ASN A N     1 
ATOM   1181 C CA    . ASN C 3 108 ? 30.047 63.947 -7.027  1.00 27.36 ? 131 ASN A CA    1 
ATOM   1182 C C     . ASN C 3 108 ? 28.755 64.729 -7.273  1.00 26.14 ? 131 ASN A C     1 
ATOM   1183 O O     . ASN C 3 108 ? 28.337 64.906 -8.418  1.00 25.59 ? 131 ASN A O     1 
ATOM   1184 C CB    . ASN C 3 108 ? 31.284 64.869 -6.981  1.00 29.95 ? 131 ASN A CB    1 
ATOM   1185 C CG    . ASN C 3 108 ? 31.566 65.566 -8.295  1.00 30.67 ? 131 ASN A CG    1 
ATOM   1186 O OD1   . ASN C 3 108 ? 30.773 66.377 -8.775  1.00 31.87 ? 131 ASN A OD1   1 
ATOM   1187 N ND2   . ASN C 3 108 ? 32.721 65.261 -8.880  1.00 32.09 ? 131 ASN A ND2   1 
ATOM   1188 N N     . PRO C 3 109 ? 28.087 65.173 -6.200  1.00 25.79 ? 132 PRO A N     1 
ATOM   1189 C CA    . PRO C 3 109 ? 26.836 65.924 -6.321  1.00 26.11 ? 132 PRO A CA    1 
ATOM   1190 C C     . PRO C 3 109 ? 26.830 67.009 -7.398  1.00 25.40 ? 132 PRO A C     1 
ATOM   1191 O O     . PRO C 3 109 ? 25.852 67.149 -8.130  1.00 25.77 ? 132 PRO A O     1 
ATOM   1192 C CB    . PRO C 3 109 ? 26.642 66.493 -4.918  1.00 26.64 ? 132 PRO A CB    1 
ATOM   1193 C CG    . PRO C 3 109 ? 27.234 65.423 -4.050  1.00 27.70 ? 132 PRO A CG    1 
ATOM   1194 C CD    . PRO C 3 109 ? 28.512 65.091 -4.792  1.00 26.73 ? 132 PRO A CD    1 
ATOM   1195 N N     . TYR C 3 110 ? 27.917 67.765 -7.509  1.00 27.53 ? 133 TYR A N     1 
ATOM   1196 C CA    . TYR C 3 110 ? 27.966 68.836 -8.502  1.00 28.00 ? 133 TYR A CA    1 
ATOM   1197 C C     . TYR C 3 110 ? 27.729 68.318 -9.919  1.00 28.61 ? 133 TYR A C     1 
ATOM   1198 O O     . TYR C 3 110 ? 26.879 68.838 -10.645 1.00 28.67 ? 133 TYR A O     1 
ATOM   1199 C CB    . TYR C 3 110 ? 29.305 69.580 -8.432  1.00 28.58 ? 133 TYR A CB    1 
ATOM   1200 C CG    . TYR C 3 110 ? 29.315 70.851 -9.260  1.00 31.44 ? 133 TYR A CG    1 
ATOM   1201 C CD1   . TYR C 3 110 ? 29.453 70.805 -10.648 1.00 32.28 ? 133 TYR A CD1   1 
ATOM   1202 C CD2   . TYR C 3 110 ? 29.126 72.097 -8.660  1.00 32.05 ? 133 TYR A CD2   1 
ATOM   1203 C CE1   . TYR C 3 110 ? 29.398 71.967 -11.421 1.00 33.69 ? 133 TYR A CE1   1 
ATOM   1204 C CE2   . TYR C 3 110 ? 29.071 73.262 -9.422  1.00 32.82 ? 133 TYR A CE2   1 
ATOM   1205 C CZ    . TYR C 3 110 ? 29.206 73.191 -10.801 1.00 34.12 ? 133 TYR A CZ    1 
ATOM   1206 O OH    . TYR C 3 110 ? 29.144 74.341 -11.559 1.00 34.10 ? 133 TYR A OH    1 
ATOM   1207 N N     . ASN C 3 111 ? 28.468 67.284 -10.311 1.00 29.45 ? 134 ASN A N     1 
ATOM   1208 C CA    . ASN C 3 111 ? 28.310 66.727 -11.647 1.00 30.31 ? 134 ASN A CA    1 
ATOM   1209 C C     . ASN C 3 111 ? 26.963 66.032 -11.829 1.00 30.06 ? 134 ASN A C     1 
ATOM   1210 O O     . ASN C 3 111 ? 26.375 66.093 -12.904 1.00 31.75 ? 134 ASN A O     1 
ATOM   1211 C CB    . ASN C 3 111 ? 29.453 65.754 -11.959 1.00 33.22 ? 134 ASN A CB    1 
ATOM   1212 C CG    . ASN C 3 111 ? 30.799 66.449 -12.041 1.00 35.37 ? 134 ASN A CG    1 
ATOM   1213 O OD1   . ASN C 3 111 ? 30.908 67.542 -12.597 1.00 37.00 ? 134 ASN A OD1   1 
ATOM   1214 N ND2   . ASN C 3 111 ? 31.833 65.815 -11.495 1.00 37.85 ? 134 ASN A ND2   1 
ATOM   1215 N N     . LEU C 3 112 ? 26.470 65.377 -10.781 1.00 29.53 ? 135 LEU A N     1 
ATOM   1216 C CA    . LEU C 3 112 ? 25.184 64.690 -10.868 1.00 29.13 ? 135 LEU A CA    1 
ATOM   1217 C C     . LEU C 3 112 ? 24.060 65.676 -11.184 1.00 31.17 ? 135 LEU A C     1 
ATOM   1218 O O     . LEU C 3 112 ? 23.189 65.396 -12.005 1.00 30.44 ? 135 LEU A O     1 
ATOM   1219 C CB    . LEU C 3 112 ? 24.865 63.969 -9.551  1.00 26.57 ? 135 LEU A CB    1 
ATOM   1220 C CG    . LEU C 3 112 ? 23.534 63.209 -9.495  1.00 24.57 ? 135 LEU A CG    1 
ATOM   1221 C CD1   . LEU C 3 112 ? 23.564 62.031 -10.469 1.00 26.45 ? 135 LEU A CD1   1 
ATOM   1222 C CD2   . LEU C 3 112 ? 23.283 62.707 -8.078  1.00 25.22 ? 135 LEU A CD2   1 
ATOM   1223 N N     . LEU C 3 113 ? 24.086 66.831 -10.526 1.00 33.14 ? 136 LEU A N     1 
ATOM   1224 C CA    . LEU C 3 113 ? 23.058 67.846 -10.727 1.00 36.11 ? 136 LEU A CA    1 
ATOM   1225 C C     . LEU C 3 113 ? 23.085 68.516 -12.098 1.00 37.84 ? 136 LEU A C     1 
ATOM   1226 O O     . LEU C 3 113 ? 22.109 69.146 -12.500 1.00 38.40 ? 136 LEU A O     1 
ATOM   1227 C CB    . LEU C 3 113 ? 23.144 68.907 -9.624  1.00 36.27 ? 136 LEU A CB    1 
ATOM   1228 C CG    . LEU C 3 113 ? 22.404 68.593 -8.317  1.00 37.20 ? 136 LEU A CG    1 
ATOM   1229 C CD1   . LEU C 3 113 ? 20.911 68.515 -8.588  1.00 37.76 ? 136 LEU A CD1   1 
ATOM   1230 C CD2   . LEU C 3 113 ? 22.901 67.286 -7.727  1.00 40.45 ? 136 LEU A CD2   1 
ATOM   1231 N N     . SER C 3 114 ? 24.192 68.374 -12.819 1.00 39.58 ? 137 SER A N     1 
ATOM   1232 C CA    . SER C 3 114 ? 24.299 68.971 -14.146 1.00 43.40 ? 137 SER A CA    1 
ATOM   1233 C C     . SER C 3 114 ? 23.367 68.253 -15.120 1.00 45.01 ? 137 SER A C     1 
ATOM   1234 O O     . SER C 3 114 ? 23.082 68.753 -16.207 1.00 46.23 ? 137 SER A O     1 
ATOM   1235 C CB    . SER C 3 114 ? 25.740 68.890 -14.657 1.00 43.06 ? 137 SER A CB    1 
ATOM   1236 O OG    . SER C 3 114 ? 26.116 67.552 -14.931 1.00 46.60 ? 137 SER A OG    1 
ATOM   1237 N N     . GLY C 3 115 ? 22.890 67.078 -14.719 1.00 46.23 ? 138 GLY A N     1 
ATOM   1238 C CA    . GLY C 3 115 ? 21.998 66.313 -15.570 1.00 47.83 ? 138 GLY A CA    1 
ATOM   1239 C C     . GLY C 3 115 ? 20.529 66.581 -15.302 1.00 48.91 ? 138 GLY A C     1 
ATOM   1240 O O     . GLY C 3 115 ? 19.675 65.746 -15.598 1.00 48.92 ? 138 GLY A O     1 
ATOM   1241 N N     . LEU C 3 116 ? 20.230 67.749 -14.745 1.00 50.07 ? 139 LEU A N     1 
ATOM   1242 C CA    . LEU C 3 116 ? 18.852 68.118 -14.440 1.00 51.07 ? 139 LEU A CA    1 
ATOM   1243 C C     . LEU C 3 116 ? 18.430 69.273 -15.351 1.00 51.59 ? 139 LEU A C     1 
ATOM   1244 O O     . LEU C 3 116 ? 18.860 70.408 -15.164 1.00 51.08 ? 139 LEU A O     1 
ATOM   1245 C CB    . LEU C 3 116 ? 18.737 68.541 -12.970 1.00 51.30 ? 139 LEU A CB    1 
ATOM   1246 C CG    . LEU C 3 116 ? 17.391 68.353 -12.261 1.00 51.47 ? 139 LEU A CG    1 
ATOM   1247 C CD1   . LEU C 3 116 ? 17.478 68.941 -10.861 1.00 51.34 ? 139 LEU A CD1   1 
ATOM   1248 C CD2   . LEU C 3 116 ? 16.279 69.020 -13.043 1.00 52.51 ? 139 LEU A CD2   1 
ATOM   1249 N N     . PRO C 3 117 ? 17.587 68.988 -16.357 1.00 52.70 ? 140 PRO A N     1 
ATOM   1250 C CA    . PRO C 3 117 ? 17.099 69.996 -17.308 1.00 52.97 ? 140 PRO A CA    1 
ATOM   1251 C C     . PRO C 3 117 ? 16.135 71.013 -16.693 1.00 53.62 ? 140 PRO A C     1 
ATOM   1252 O O     . PRO C 3 117 ? 15.384 70.695 -15.769 1.00 53.33 ? 140 PRO A O     1 
ATOM   1253 C CB    . PRO C 3 117 ? 16.413 69.153 -18.385 1.00 53.05 ? 140 PRO A CB    1 
ATOM   1254 C CG    . PRO C 3 117 ? 17.112 67.828 -18.294 1.00 52.33 ? 140 PRO A CG    1 
ATOM   1255 C CD    . PRO C 3 117 ? 17.216 67.636 -16.807 1.00 52.70 ? 140 PRO A CD    1 
ATOM   1256 N N     . PRO C 3 118 ? 16.149 72.256 -17.201 1.00 53.46 ? 141 PRO A N     1 
ATOM   1257 C CA    . PRO C 3 118 ? 15.268 73.315 -16.699 1.00 53.69 ? 141 PRO A CA    1 
ATOM   1258 C C     . PRO C 3 118 ? 13.806 72.982 -16.993 1.00 53.55 ? 141 PRO A C     1 
ATOM   1259 O O     . PRO C 3 118 ? 12.892 73.485 -16.339 1.00 53.66 ? 141 PRO A O     1 
ATOM   1260 C CB    . PRO C 3 118 ? 15.739 74.548 -17.468 1.00 53.92 ? 141 PRO A CB    1 
ATOM   1261 C CG    . PRO C 3 118 ? 17.183 74.256 -17.731 1.00 53.35 ? 141 PRO A CG    1 
ATOM   1262 C CD    . PRO C 3 118 ? 17.141 72.807 -18.140 1.00 54.15 ? 141 PRO A CD    1 
ATOM   1263 N N     . SER C 3 119 ? 13.606 72.126 -17.989 1.00 53.12 ? 142 SER A N     1 
ATOM   1264 C CA    . SER C 3 119 ? 12.276 71.701 -18.407 1.00 52.34 ? 142 SER A CA    1 
ATOM   1265 C C     . SER C 3 119 ? 11.553 70.889 -17.336 1.00 52.01 ? 142 SER A C     1 
ATOM   1266 O O     . SER C 3 119 ? 10.322 70.845 -17.305 1.00 51.15 ? 142 SER A O     1 
ATOM   1267 C CB    . SER C 3 119 ? 12.386 70.881 -19.692 1.00 52.76 ? 142 SER A CB    1 
ATOM   1268 O OG    . SER C 3 119 ? 13.372 69.874 -19.560 1.00 53.08 ? 142 SER A OG    1 
ATOM   1269 N N     . HIS C 3 120 ? 12.322 70.242 -16.464 1.00 51.11 ? 143 HIS A N     1 
ATOM   1270 C CA    . HIS C 3 120 ? 11.750 69.438 -15.390 1.00 49.88 ? 143 HIS A CA    1 
ATOM   1271 C C     . HIS C 3 120 ? 11.878 70.189 -14.069 1.00 49.63 ? 143 HIS A C     1 
ATOM   1272 O O     . HIS C 3 120 ? 12.943 70.191 -13.452 1.00 48.48 ? 143 HIS A O     1 
ATOM   1273 C CB    . HIS C 3 120 ? 12.473 68.090 -15.288 1.00 49.10 ? 143 HIS A CB    1 
ATOM   1274 C CG    . HIS C 3 120 ? 12.382 67.258 -16.529 1.00 48.27 ? 143 HIS A CG    1 
ATOM   1275 N ND1   . HIS C 3 120 ? 12.931 67.650 -17.731 1.00 47.45 ? 143 HIS A ND1   1 
ATOM   1276 C CD2   . HIS C 3 120 ? 11.803 66.054 -16.756 1.00 47.04 ? 143 HIS A CD2   1 
ATOM   1277 C CE1   . HIS C 3 120 ? 12.695 66.724 -18.644 1.00 46.84 ? 143 HIS A CE1   1 
ATOM   1278 N NE2   . HIS C 3 120 ? 12.012 65.745 -18.078 1.00 46.48 ? 143 HIS A NE2   1 
ATOM   1279 N N     . GLN C 3 121 ? 10.793 70.827 -13.638 1.00 49.62 ? 144 GLN A N     1 
ATOM   1280 C CA    . GLN C 3 121 ? 10.818 71.583 -12.394 1.00 49.96 ? 144 GLN A CA    1 
ATOM   1281 C C     . GLN C 3 121 ? 9.921  71.028 -11.292 1.00 49.49 ? 144 GLN A C     1 
ATOM   1282 O O     . GLN C 3 121 ? 9.807  71.625 -10.221 1.00 50.88 ? 144 GLN A O     1 
ATOM   1283 C CB    . GLN C 3 121 ? 10.479 73.051 -12.663 1.00 51.68 ? 144 GLN A CB    1 
ATOM   1284 C CG    . GLN C 3 121 ? 11.520 73.749 -13.526 1.00 53.71 ? 144 GLN A CG    1 
ATOM   1285 C CD    . GLN C 3 121 ? 11.326 75.250 -13.598 1.00 54.39 ? 144 GLN A CD    1 
ATOM   1286 O OE1   . GLN C 3 121 ? 12.073 75.946 -14.286 1.00 55.58 ? 144 GLN A OE1   1 
ATOM   1287 N NE2   . GLN C 3 121 ? 10.326 75.759 -12.886 1.00 54.18 ? 144 GLN A NE2   1 
ATOM   1288 N N     . TRP C 3 122 ? 9.279  69.894 -11.554 1.00 48.63 ? 145 TRP A N     1 
ATOM   1289 C CA    . TRP C 3 122 ? 8.438  69.258 -10.545 1.00 47.64 ? 145 TRP A CA    1 
ATOM   1290 C C     . TRP C 3 122 ? 9.280  68.152 -9.921  1.00 45.87 ? 145 TRP A C     1 
ATOM   1291 O O     . TRP C 3 122 ? 9.527  67.120 -10.543 1.00 44.52 ? 145 TRP A O     1 
ATOM   1292 C CB    . TRP C 3 122 ? 7.167  68.685 -11.173 1.00 50.17 ? 145 TRP A CB    1 
ATOM   1293 C CG    . TRP C 3 122 ? 6.170  69.746 -11.514 1.00 52.08 ? 145 TRP A CG    1 
ATOM   1294 C CD1   . TRP C 3 122 ? 6.092  70.461 -12.675 1.00 52.81 ? 145 TRP A CD1   1 
ATOM   1295 C CD2   . TRP C 3 122 ? 5.147  70.261 -10.654 1.00 53.33 ? 145 TRP A CD2   1 
ATOM   1296 N NE1   . TRP C 3 122 ? 5.082  71.391 -12.591 1.00 53.16 ? 145 TRP A NE1   1 
ATOM   1297 C CE2   . TRP C 3 122 ? 4.487  71.291 -11.361 1.00 53.66 ? 145 TRP A CE2   1 
ATOM   1298 C CE3   . TRP C 3 122 ? 4.726  69.955 -9.353  1.00 53.54 ? 145 TRP A CE3   1 
ATOM   1299 C CZ2   . TRP C 3 122 ? 3.425  72.017 -10.809 1.00 54.53 ? 145 TRP A CZ2   1 
ATOM   1300 C CZ3   . TRP C 3 122 ? 3.670  70.678 -8.804  1.00 54.47 ? 145 TRP A CZ3   1 
ATOM   1301 C CH2   . TRP C 3 122 ? 3.033  71.698 -9.534  1.00 54.61 ? 145 TRP A CH2   1 
ATOM   1302 N N     . TYR C 3 123 ? 9.713  68.378 -8.684  1.00 44.58 ? 146 TYR A N     1 
ATOM   1303 C CA    . TYR C 3 123 ? 10.583 67.433 -7.995  1.00 42.47 ? 146 TYR A CA    1 
ATOM   1304 C C     . TYR C 3 123 ? 9.978  66.553 -6.911  1.00 40.92 ? 146 TYR A C     1 
ATOM   1305 O O     . TYR C 3 123 ? 8.966  66.879 -6.296  1.00 40.88 ? 146 TYR A O     1 
ATOM   1306 C CB    . TYR C 3 123 ? 11.760 68.185 -7.376  1.00 41.82 ? 146 TYR A CB    1 
ATOM   1307 C CG    . TYR C 3 123 ? 12.402 69.206 -8.283  1.00 42.61 ? 146 TYR A CG    1 
ATOM   1308 C CD1   . TYR C 3 123 ? 12.301 70.569 -8.007  1.00 43.16 ? 146 TYR A CD1   1 
ATOM   1309 C CD2   . TYR C 3 123 ? 13.128 68.813 -9.405  1.00 43.03 ? 146 TYR A CD2   1 
ATOM   1310 C CE1   . TYR C 3 123 ? 12.911 71.517 -8.827  1.00 43.70 ? 146 TYR A CE1   1 
ATOM   1311 C CE2   . TYR C 3 123 ? 13.740 69.752 -10.231 1.00 43.22 ? 146 TYR A CE2   1 
ATOM   1312 C CZ    . TYR C 3 123 ? 13.628 71.100 -9.935  1.00 42.77 ? 146 TYR A CZ    1 
ATOM   1313 O OH    . TYR C 3 123 ? 14.237 72.028 -10.746 1.00 44.60 ? 146 TYR A OH    1 
ATOM   1314 N N     . THR C 3 124 ? 10.646 65.428 -6.685  1.00 39.01 ? 147 THR A N     1 
ATOM   1315 C CA    . THR C 3 124 ? 10.275 64.469 -5.659  1.00 35.90 ? 147 THR A CA    1 
ATOM   1316 C C     . THR C 3 124 ? 11.596 63.942 -5.126  1.00 34.84 ? 147 THR A C     1 
ATOM   1317 O O     . THR C 3 124 ? 12.424 63.453 -5.892  1.00 34.46 ? 147 THR A O     1 
ATOM   1318 C CB    . THR C 3 124 ? 9.459  63.288 -6.225  1.00 36.45 ? 147 THR A CB    1 
ATOM   1319 O OG1   . THR C 3 124 ? 8.115  63.711 -6.483  1.00 38.09 ? 147 THR A OG1   1 
ATOM   1320 C CG2   . THR C 3 124 ? 9.436  62.133 -5.231  1.00 34.07 ? 147 THR A CG2   1 
ATOM   1321 N N     . VAL C 3 125 ? 11.804 64.068 -3.822  1.00 33.62 ? 148 VAL A N     1 
ATOM   1322 C CA    . VAL C 3 125 ? 13.033 63.592 -3.211  1.00 32.48 ? 148 VAL A CA    1 
ATOM   1323 C C     . VAL C 3 125 ? 12.747 62.519 -2.177  1.00 31.81 ? 148 VAL A C     1 
ATOM   1324 O O     . VAL C 3 125 ? 11.942 62.708 -1.263  1.00 31.49 ? 148 VAL A O     1 
ATOM   1325 C CB    . VAL C 3 125 ? 13.819 64.743 -2.546  1.00 31.96 ? 148 VAL A CB    1 
ATOM   1326 C CG1   . VAL C 3 125 ? 14.973 64.182 -1.726  1.00 33.14 ? 148 VAL A CG1   1 
ATOM   1327 C CG2   . VAL C 3 125 ? 14.356 65.682 -3.614  1.00 32.37 ? 148 VAL A CG2   1 
ATOM   1328 N N     . LEU C 3 126 ? 13.413 61.383 -2.339  1.00 29.43 ? 149 LEU A N     1 
ATOM   1329 C CA    . LEU C 3 126 ? 13.257 60.263 -1.431  1.00 28.98 ? 149 LEU A CA    1 
ATOM   1330 C C     . LEU C 3 126 ? 14.634 59.814 -0.967  1.00 29.15 ? 149 LEU A C     1 
ATOM   1331 O O     . LEU C 3 126 ? 15.589 59.839 -1.744  1.00 29.61 ? 149 LEU A O     1 
ATOM   1332 C CB    . LEU C 3 126 ? 12.579 59.092 -2.149  1.00 28.53 ? 149 LEU A CB    1 
ATOM   1333 C CG    . LEU C 3 126 ? 11.183 59.271 -2.751  1.00 31.46 ? 149 LEU A CG    1 
ATOM   1334 C CD1   . LEU C 3 126 ? 10.827 58.047 -3.581  1.00 30.86 ? 149 LEU A CD1   1 
ATOM   1335 C CD2   . LEU C 3 126 ? 10.164 59.483 -1.633  1.00 30.80 ? 149 LEU A CD2   1 
ATOM   1336 N N     . ASP C 3 127 ? 14.747 59.440 0.302   1.00 28.41 ? 150 ASP A N     1 
ATOM   1337 C CA    . ASP C 3 127 ? 16.006 58.917 0.808   1.00 29.24 ? 150 ASP A CA    1 
ATOM   1338 C C     . ASP C 3 127 ? 15.671 57.516 1.297   1.00 27.97 ? 150 ASP A C     1 
ATOM   1339 O O     . ASP C 3 127 ? 14.667 57.304 1.979   1.00 27.80 ? 150 ASP A O     1 
ATOM   1340 C CB    . ASP C 3 127 ? 16.580 59.774 1.945   1.00 33.44 ? 150 ASP A CB    1 
ATOM   1341 C CG    . ASP C 3 127 ? 15.673 59.844 3.142   1.00 35.81 ? 150 ASP A CG    1 
ATOM   1342 O OD1   . ASP C 3 127 ? 14.695 60.618 3.095   1.00 39.10 ? 150 ASP A OD1   1 
ATOM   1343 O OD2   . ASP C 3 127 ? 15.939 59.119 4.127   1.00 37.94 ? 150 ASP A OD2   1 
ATOM   1344 N N     . LEU C 3 128 ? 16.496 56.551 0.916   1.00 25.34 ? 151 LEU A N     1 
ATOM   1345 C CA    . LEU C 3 128 ? 16.262 55.171 1.298   1.00 23.92 ? 151 LEU A CA    1 
ATOM   1346 C C     . LEU C 3 128 ? 16.795 54.903 2.692   1.00 25.65 ? 151 LEU A C     1 
ATOM   1347 O O     . LEU C 3 128 ? 17.936 55.223 3.003   1.00 25.53 ? 151 LEU A O     1 
ATOM   1348 C CB    . LEU C 3 128 ? 16.917 54.237 0.282   1.00 23.68 ? 151 LEU A CB    1 
ATOM   1349 C CG    . LEU C 3 128 ? 16.483 54.498 -1.161  1.00 24.22 ? 151 LEU A CG    1 
ATOM   1350 C CD1   . LEU C 3 128 ? 17.218 53.539 -2.089  1.00 22.60 ? 151 LEU A CD1   1 
ATOM   1351 C CD2   . LEU C 3 128 ? 14.964 54.323 -1.299  1.00 22.33 ? 151 LEU A CD2   1 
ATOM   1352 N N     . LYS C 3 129 ? 15.945 54.316 3.527   1.00 24.69 ? 152 LYS A N     1 
ATOM   1353 C CA    . LYS C 3 129 ? 16.290 54.005 4.905   1.00 25.77 ? 152 LYS A CA    1 
ATOM   1354 C C     . LYS C 3 129 ? 17.107 52.725 5.022   1.00 23.59 ? 152 LYS A C     1 
ATOM   1355 O O     . LYS C 3 129 ? 16.780 51.713 4.400   1.00 24.19 ? 152 LYS A O     1 
ATOM   1356 C CB    . LYS C 3 129 ? 15.003 53.872 5.730   1.00 27.80 ? 152 LYS A CB    1 
ATOM   1357 C CG    . LYS C 3 129 ? 15.219 53.698 7.221   1.00 35.81 ? 152 LYS A CG    1 
ATOM   1358 C CD    . LYS C 3 129 ? 15.841 54.940 7.840   1.00 38.28 ? 152 LYS A CD    1 
ATOM   1359 C CE    . LYS C 3 129 ? 16.020 54.767 9.341   1.00 42.31 ? 152 LYS A CE    1 
ATOM   1360 N NZ    . LYS C 3 129 ? 14.726 54.460 10.008  1.00 44.24 ? 152 LYS A NZ    1 
ATOM   1361 N N     . ASP C 3 130 ? 18.162 52.779 5.832   1.00 23.07 ? 153 ASP A N     1 
ATOM   1362 C CA    . ASP C 3 130 ? 19.029 51.624 6.063   1.00 22.57 ? 153 ASP A CA    1 
ATOM   1363 C C     . ASP C 3 130 ? 19.364 50.968 4.735   1.00 21.13 ? 153 ASP A C     1 
ATOM   1364 O O     . ASP C 3 130 ? 19.262 49.753 4.582   1.00 20.60 ? 153 ASP A O     1 
ATOM   1365 C CB    . ASP C 3 130 ? 18.330 50.614 6.974   1.00 26.36 ? 153 ASP A CB    1 
ATOM   1366 C CG    . ASP C 3 130 ? 18.018 51.188 8.343   1.00 30.60 ? 153 ASP A CG    1 
ATOM   1367 O OD1   . ASP C 3 130 ? 18.953 51.688 8.999   1.00 32.90 ? 153 ASP A OD1   1 
ATOM   1368 O OD2   . ASP C 3 130 ? 16.842 51.140 8.759   1.00 34.62 ? 153 ASP A OD2   1 
ATOM   1369 N N     . ALA C 3 131 ? 19.767 51.796 3.780   1.00 18.80 ? 154 ALA A N     1 
ATOM   1370 C CA    . ALA C 3 131 ? 20.098 51.331 2.440   1.00 19.25 ? 154 ALA A CA    1 
ATOM   1371 C C     . ALA C 3 131 ? 21.097 50.180 2.367   1.00 18.00 ? 154 ALA A C     1 
ATOM   1372 O O     . ALA C 3 131 ? 20.820 49.161 1.733   1.00 15.69 ? 154 ALA A O     1 
ATOM   1373 C CB    . ALA C 3 131 ? 20.602 52.504 1.608   1.00 15.81 ? 154 ALA A CB    1 
ATOM   1374 N N     . PHE C 3 132 ? 22.260 50.330 3.000   1.00 17.56 ? 155 PHE A N     1 
ATOM   1375 C CA    . PHE C 3 132 ? 23.266 49.265 2.919   1.00 16.99 ? 155 PHE A CA    1 
ATOM   1376 C C     . PHE C 3 132 ? 22.727 47.936 3.427   1.00 17.45 ? 155 PHE A C     1 
ATOM   1377 O O     . PHE C 3 132 ? 22.986 46.891 2.833   1.00 17.76 ? 155 PHE A O     1 
ATOM   1378 C CB    . PHE C 3 132 ? 24.535 49.622 3.707   1.00 16.95 ? 155 PHE A CB    1 
ATOM   1379 C CG    . PHE C 3 132 ? 25.244 50.862 3.215   1.00 19.10 ? 155 PHE A CG    1 
ATOM   1380 C CD1   . PHE C 3 132 ? 24.951 51.413 1.971   1.00 19.40 ? 155 PHE A CD1   1 
ATOM   1381 C CD2   . PHE C 3 132 ? 26.214 51.475 4.008   1.00 19.29 ? 155 PHE A CD2   1 
ATOM   1382 C CE1   . PHE C 3 132 ? 25.612 52.565 1.521   1.00 21.86 ? 155 PHE A CE1   1 
ATOM   1383 C CE2   . PHE C 3 132 ? 26.881 52.622 3.568   1.00 21.86 ? 155 PHE A CE2   1 
ATOM   1384 C CZ    . PHE C 3 132 ? 26.576 53.168 2.321   1.00 21.42 ? 155 PHE A CZ    1 
ATOM   1385 N N     . PHE C 3 133 ? 21.970 47.973 4.520   1.00 15.94 ? 156 PHE A N     1 
ATOM   1386 C CA    . PHE C 3 133 ? 21.432 46.745 5.087   1.00 18.14 ? 156 PHE A CA    1 
ATOM   1387 C C     . PHE C 3 133 ? 20.499 45.988 4.136   1.00 19.50 ? 156 PHE A C     1 
ATOM   1388 O O     . PHE C 3 133 ? 20.205 44.815 4.365   1.00 20.45 ? 156 PHE A O     1 
ATOM   1389 C CB    . PHE C 3 133 ? 20.705 47.032 6.416   1.00 19.28 ? 156 PHE A CB    1 
ATOM   1390 C CG    . PHE C 3 133 ? 21.620 47.460 7.538   1.00 22.19 ? 156 PHE A CG    1 
ATOM   1391 C CD1   . PHE C 3 133 ? 22.992 47.240 7.468   1.00 22.23 ? 156 PHE A CD1   1 
ATOM   1392 C CD2   . PHE C 3 133 ? 21.099 48.052 8.686   1.00 24.16 ? 156 PHE A CD2   1 
ATOM   1393 C CE1   . PHE C 3 133 ? 23.833 47.601 8.522   1.00 23.43 ? 156 PHE A CE1   1 
ATOM   1394 C CE2   . PHE C 3 133 ? 21.933 48.415 9.748   1.00 25.49 ? 156 PHE A CE2   1 
ATOM   1395 C CZ    . PHE C 3 133 ? 23.300 48.189 9.664   1.00 24.77 ? 156 PHE A CZ    1 
ATOM   1396 N N     . CYS C 3 134 ? 20.035 46.644 3.073   1.00 18.30 ? 157 CYS A N     1 
ATOM   1397 C CA    . CYS C 3 134 ? 19.161 45.969 2.116   1.00 19.58 ? 157 CYS A CA    1 
ATOM   1398 C C     . CYS C 3 134 ? 19.943 44.997 1.237   1.00 17.10 ? 157 CYS A C     1 
ATOM   1399 O O     . CYS C 3 134 ? 19.367 44.085 0.646   1.00 20.33 ? 157 CYS A O     1 
ATOM   1400 C CB    . CYS C 3 134 ? 18.427 46.985 1.231   1.00 19.31 ? 157 CYS A CB    1 
ATOM   1401 S SG    . CYS C 3 134 ? 17.189 47.938 2.127   1.00 23.11 ? 157 CYS A SG    1 
ATOM   1402 N N     . LEU C 3 135 ? 21.256 45.181 1.165   1.00 17.14 ? 158 LEU A N     1 
ATOM   1403 C CA    . LEU C 3 135 ? 22.098 44.306 0.348   1.00 17.85 ? 158 LEU A CA    1 
ATOM   1404 C C     . LEU C 3 135 ? 22.733 43.177 1.149   1.00 17.48 ? 158 LEU A C     1 
ATOM   1405 O O     . LEU C 3 135 ? 23.517 43.411 2.062   1.00 18.33 ? 158 LEU A O     1 
ATOM   1406 C CB    . LEU C 3 135 ? 23.201 45.117 -0.346  1.00 19.08 ? 158 LEU A CB    1 
ATOM   1407 C CG    . LEU C 3 135 ? 22.732 46.232 -1.287  1.00 22.06 ? 158 LEU A CG    1 
ATOM   1408 C CD1   . LEU C 3 135 ? 23.937 46.861 -1.970  1.00 22.21 ? 158 LEU A CD1   1 
ATOM   1409 C CD2   . LEU C 3 135 ? 21.774 45.668 -2.325  1.00 22.64 ? 158 LEU A CD2   1 
ATOM   1410 N N     . ARG C 3 136 ? 22.387 41.942 0.806   1.00 16.44 ? 159 ARG A N     1 
ATOM   1411 C CA    . ARG C 3 136 ? 22.951 40.790 1.497   1.00 17.82 ? 159 ARG A CA    1 
ATOM   1412 C C     . ARG C 3 136 ? 24.428 40.600 1.197   1.00 18.25 ? 159 ARG A C     1 
ATOM   1413 O O     . ARG C 3 136 ? 24.901 40.931 0.109   1.00 19.67 ? 159 ARG A O     1 
ATOM   1414 C CB    . ARG C 3 136 ? 22.219 39.515 1.084   1.00 15.41 ? 159 ARG A CB    1 
ATOM   1415 C CG    . ARG C 3 136 ? 20.772 39.462 1.518   1.00 18.46 ? 159 ARG A CG    1 
ATOM   1416 C CD    . ARG C 3 136 ? 20.039 38.319 0.824   1.00 18.48 ? 159 ARG A CD    1 
ATOM   1417 N NE    . ARG C 3 136 ? 19.845 38.575 -0.604  1.00 18.91 ? 159 ARG A NE    1 
ATOM   1418 C CZ    . ARG C 3 136 ? 19.323 37.688 -1.449  1.00 19.24 ? 159 ARG A CZ    1 
ATOM   1419 N NH1   . ARG C 3 136 ? 18.952 36.494 -1.002  1.00 19.04 ? 159 ARG A NH1   1 
ATOM   1420 N NH2   . ARG C 3 136 ? 19.169 37.987 -2.738  1.00 21.12 ? 159 ARG A NH2   1 
ATOM   1421 N N     . LEU C 3 137 ? 25.143 40.057 2.179   1.00 17.75 ? 160 LEU A N     1 
ATOM   1422 C CA    . LEU C 3 137 ? 26.557 39.731 2.057   1.00 18.31 ? 160 LEU A CA    1 
ATOM   1423 C C     . LEU C 3 137 ? 26.613 38.210 1.896   1.00 18.98 ? 160 LEU A C     1 
ATOM   1424 O O     . LEU C 3 137 ? 25.929 37.491 2.615   1.00 20.54 ? 160 LEU A O     1 
ATOM   1425 C CB    . LEU C 3 137 ? 27.324 40.085 3.339   1.00 21.10 ? 160 LEU A CB    1 
ATOM   1426 C CG    . LEU C 3 137 ? 28.045 41.419 3.486   1.00 22.02 ? 160 LEU A CG    1 
ATOM   1427 C CD1   . LEU C 3 137 ? 28.778 41.451 4.839   1.00 17.75 ? 160 LEU A CD1   1 
ATOM   1428 C CD2   . LEU C 3 137 ? 29.038 41.583 2.358   1.00 21.46 ? 160 LEU A CD2   1 
ATOM   1429 N N     . HIS C 3 138 ? 27.418 37.726 0.959   1.00 18.58 ? 161 HIS A N     1 
ATOM   1430 C CA    . HIS C 3 138 ? 27.563 36.285 0.770   1.00 19.90 ? 161 HIS A CA    1 
ATOM   1431 C C     . HIS C 3 138 ? 28.153 35.715 2.064   1.00 21.29 ? 161 HIS A C     1 
ATOM   1432 O O     . HIS C 3 138 ? 28.988 36.350 2.706   1.00 19.51 ? 161 HIS A O     1 
ATOM   1433 C CB    . HIS C 3 138 ? 28.510 36.007 -0.401  1.00 21.84 ? 161 HIS A CB    1 
ATOM   1434 C CG    . HIS C 3 138 ? 28.639 34.554 -0.748  1.00 27.22 ? 161 HIS A CG    1 
ATOM   1435 N ND1   . HIS C 3 138 ? 28.024 33.993 -1.847  1.00 29.28 ? 161 HIS A ND1   1 
ATOM   1436 C CD2   . HIS C 3 138 ? 29.312 33.548 -0.141  1.00 26.28 ? 161 HIS A CD2   1 
ATOM   1437 C CE1   . HIS C 3 138 ? 28.312 32.704 -1.902  1.00 29.03 ? 161 HIS A CE1   1 
ATOM   1438 N NE2   . HIS C 3 138 ? 29.093 32.409 -0.878  1.00 31.81 ? 161 HIS A NE2   1 
ATOM   1439 N N     . PRO C 3 139 ? 27.716 34.510 2.471   1.00 21.93 ? 162 PRO A N     1 
ATOM   1440 C CA    . PRO C 3 139 ? 28.231 33.894 3.697   1.00 21.12 ? 162 PRO A CA    1 
ATOM   1441 C C     . PRO C 3 139 ? 29.755 33.827 3.771   1.00 20.83 ? 162 PRO A C     1 
ATOM   1442 O O     . PRO C 3 139 ? 30.330 33.898 4.854   1.00 20.34 ? 162 PRO A O     1 
ATOM   1443 C CB    . PRO C 3 139 ? 27.591 32.508 3.675   1.00 22.96 ? 162 PRO A CB    1 
ATOM   1444 C CG    . PRO C 3 139 ? 26.247 32.795 3.061   1.00 25.59 ? 162 PRO A CG    1 
ATOM   1445 C CD    . PRO C 3 139 ? 26.613 33.710 1.907   1.00 22.32 ? 162 PRO A CD    1 
ATOM   1446 N N     . THR C 3 140 ? 30.411 33.688 2.624   1.00 19.93 ? 163 THR A N     1 
ATOM   1447 C CA    . THR C 3 140 ? 31.861 33.601 2.605   1.00 19.91 ? 163 THR A CA    1 
ATOM   1448 C C     . THR C 3 140 ? 32.536 34.909 3.016   1.00 19.86 ? 163 THR A C     1 
ATOM   1449 O O     . THR C 3 140 ? 33.668 34.903 3.505   1.00 18.60 ? 163 THR A O     1 
ATOM   1450 C CB    . THR C 3 140 ? 32.367 33.199 1.202   1.00 25.22 ? 163 THR A CB    1 
ATOM   1451 O OG1   . THR C 3 140 ? 31.772 31.949 0.819   1.00 27.57 ? 163 THR A OG1   1 
ATOM   1452 C CG2   . THR C 3 140 ? 33.864 33.046 1.207   1.00 27.31 ? 163 THR A CG2   1 
ATOM   1453 N N     . SER C 3 141 ? 31.836 36.024 2.824   1.00 17.74 ? 164 SER A N     1 
ATOM   1454 C CA    . SER C 3 141 ? 32.384 37.338 3.154   1.00 18.09 ? 164 SER A CA    1 
ATOM   1455 C C     . SER C 3 141 ? 31.946 37.874 4.510   1.00 17.17 ? 164 SER A C     1 
ATOM   1456 O O     . SER C 3 141 ? 32.517 38.841 5.013   1.00 18.84 ? 164 SER A O     1 
ATOM   1457 C CB    . SER C 3 141 ? 31.995 38.351 2.068   1.00 18.08 ? 164 SER A CB    1 
ATOM   1458 O OG    . SER C 3 141 ? 32.588 38.027 0.818   1.00 18.75 ? 164 SER A OG    1 
ATOM   1459 N N     . GLN C 3 142 ? 30.935 37.253 5.101   1.00 16.50 ? 165 GLN A N     1 
ATOM   1460 C CA    . GLN C 3 142 ? 30.428 37.696 6.392   1.00 18.13 ? 165 GLN A CA    1 
ATOM   1461 C C     . GLN C 3 142 ? 31.445 37.704 7.535   1.00 17.72 ? 165 GLN A C     1 
ATOM   1462 O O     . GLN C 3 142 ? 31.467 38.638 8.330   1.00 19.49 ? 165 GLN A O     1 
ATOM   1463 C CB    . GLN C 3 142 ? 29.213 36.853 6.790   1.00 17.70 ? 165 GLN A CB    1 
ATOM   1464 C CG    . GLN C 3 142 ? 27.948 37.213 6.009   1.00 17.60 ? 165 GLN A CG    1 
ATOM   1465 C CD    . GLN C 3 142 ? 26.796 36.269 6.282   1.00 18.81 ? 165 GLN A CD    1 
ATOM   1466 O OE1   . GLN C 3 142 ? 26.747 35.613 7.325   1.00 20.90 ? 165 GLN A OE1   1 
ATOM   1467 N NE2   . GLN C 3 142 ? 25.846 36.210 5.348   1.00 17.99 ? 165 GLN A NE2   1 
ATOM   1468 N N     . PRO C 3 143 ? 32.305 36.676 7.627   1.00 19.54 ? 166 PRO A N     1 
ATOM   1469 C CA    . PRO C 3 143 ? 33.305 36.617 8.706   1.00 19.01 ? 166 PRO A CA    1 
ATOM   1470 C C     . PRO C 3 143 ? 34.257 37.812 8.775   1.00 19.60 ? 166 PRO A C     1 
ATOM   1471 O O     . PRO C 3 143 ? 34.804 38.132 9.829   1.00 16.61 ? 166 PRO A O     1 
ATOM   1472 C CB    . PRO C 3 143 ? 34.052 35.316 8.408   1.00 21.44 ? 166 PRO A CB    1 
ATOM   1473 C CG    . PRO C 3 143 ? 32.986 34.455 7.799   1.00 21.86 ? 166 PRO A CG    1 
ATOM   1474 C CD    . PRO C 3 143 ? 32.309 35.422 6.848   1.00 19.36 ? 166 PRO A CD    1 
ATOM   1475 N N     . LEU C 3 144 ? 34.453 38.466 7.641   1.00 17.20 ? 167 LEU A N     1 
ATOM   1476 C CA    . LEU C 3 144 ? 35.351 39.605 7.557   1.00 18.26 ? 167 LEU A CA    1 
ATOM   1477 C C     . LEU C 3 144 ? 34.986 40.761 8.501   1.00 17.76 ? 167 LEU A C     1 
ATOM   1478 O O     . LEU C 3 144 ? 35.870 41.451 9.015   1.00 18.44 ? 167 LEU A O     1 
ATOM   1479 C CB    . LEU C 3 144 ? 35.357 40.097 6.102   1.00 19.76 ? 167 LEU A CB    1 
ATOM   1480 C CG    . LEU C 3 144 ? 36.185 41.292 5.644   1.00 24.14 ? 167 LEU A CG    1 
ATOM   1481 C CD1   . LEU C 3 144 ? 37.665 41.012 5.855   1.00 22.92 ? 167 LEU A CD1   1 
ATOM   1482 C CD2   . LEU C 3 144 ? 35.895 41.545 4.153   1.00 24.12 ? 167 LEU A CD2   1 
ATOM   1483 N N     . PHE C 3 145 ? 33.693 40.942 8.752   1.00 15.24 ? 168 PHE A N     1 
ATOM   1484 C CA    . PHE C 3 145 ? 33.216 42.069 9.550   1.00 17.09 ? 168 PHE A CA    1 
ATOM   1485 C C     . PHE C 3 145 ? 32.821 41.781 10.992  1.00 17.66 ? 168 PHE A C     1 
ATOM   1486 O O     . PHE C 3 145 ? 32.071 42.552 11.597  1.00 17.98 ? 168 PHE A O     1 
ATOM   1487 C CB    . PHE C 3 145 ? 32.031 42.701 8.812   1.00 16.83 ? 168 PHE A CB    1 
ATOM   1488 C CG    . PHE C 3 145 ? 32.347 43.096 7.394   1.00 17.22 ? 168 PHE A CG    1 
ATOM   1489 C CD1   . PHE C 3 145 ? 33.077 44.253 7.125   1.00 14.75 ? 168 PHE A CD1   1 
ATOM   1490 C CD2   . PHE C 3 145 ? 31.935 42.294 6.322   1.00 17.61 ? 168 PHE A CD2   1 
ATOM   1491 C CE1   . PHE C 3 145 ? 33.394 44.612 5.800   1.00 16.64 ? 168 PHE A CE1   1 
ATOM   1492 C CE2   . PHE C 3 145 ? 32.246 42.642 5.009   1.00 17.88 ? 168 PHE A CE2   1 
ATOM   1493 C CZ    . PHE C 3 145 ? 32.976 43.802 4.747   1.00 17.41 ? 168 PHE A CZ    1 
ATOM   1494 N N     . ALA C 3 146 ? 33.348 40.698 11.548  1.00 16.68 ? 169 ALA A N     1 
ATOM   1495 C CA    . ALA C 3 146 ? 33.015 40.294 12.910  1.00 16.35 ? 169 ALA A CA    1 
ATOM   1496 C C     . ALA C 3 146 ? 33.550 41.221 13.992  1.00 17.31 ? 169 ALA A C     1 
ATOM   1497 O O     . ALA C 3 146 ? 34.566 41.895 13.811  1.00 15.54 ? 169 ALA A O     1 
ATOM   1498 C CB    . ALA C 3 146 ? 33.522 38.875 13.160  1.00 15.41 ? 169 ALA A CB    1 
ATOM   1499 N N     . PHE C 3 147 ? 32.829 41.259 15.107  1.00 17.57 ? 170 PHE A N     1 
ATOM   1500 C CA    . PHE C 3 147 ? 33.219 42.047 16.268  1.00 17.67 ? 170 PHE A CA    1 
ATOM   1501 C C     . PHE C 3 147 ? 32.753 41.288 17.499  1.00 20.27 ? 170 PHE A C     1 
ATOM   1502 O O     . PHE C 3 147 ? 31.947 40.364 17.404  1.00 17.59 ? 170 PHE A O     1 
ATOM   1503 C CB    . PHE C 3 147 ? 32.605 43.458 16.238  1.00 17.61 ? 170 PHE A CB    1 
ATOM   1504 C CG    . PHE C 3 147 ? 31.103 43.480 16.183  1.00 18.26 ? 170 PHE A CG    1 
ATOM   1505 C CD1   . PHE C 3 147 ? 30.434 43.458 14.958  1.00 16.43 ? 170 PHE A CD1   1 
ATOM   1506 C CD2   . PHE C 3 147 ? 30.356 43.546 17.358  1.00 17.62 ? 170 PHE A CD2   1 
ATOM   1507 C CE1   . PHE C 3 147 ? 29.042 43.503 14.907  1.00 21.67 ? 170 PHE A CE1   1 
ATOM   1508 C CE2   . PHE C 3 147 ? 28.964 43.591 17.320  1.00 20.48 ? 170 PHE A CE2   1 
ATOM   1509 C CZ    . PHE C 3 147 ? 28.303 43.570 16.096  1.00 18.61 ? 170 PHE A CZ    1 
ATOM   1510 N N     . GLU C 3 148 ? 33.271 41.673 18.657  1.00 19.34 ? 171 GLU A N     1 
ATOM   1511 C CA    . GLU C 3 148 ? 32.925 41.004 19.897  1.00 22.81 ? 171 GLU A CA    1 
ATOM   1512 C C     . GLU C 3 148 ? 31.728 41.647 20.592  1.00 22.88 ? 171 GLU A C     1 
ATOM   1513 O O     . GLU C 3 148 ? 31.563 42.863 20.564  1.00 22.86 ? 171 GLU A O     1 
ATOM   1514 C CB    . GLU C 3 148 ? 34.144 41.033 20.823  1.00 25.93 ? 171 GLU A CB    1 
ATOM   1515 C CG    . GLU C 3 148 ? 33.939 40.429 22.195  1.00 33.58 ? 171 GLU A CG    1 
ATOM   1516 C CD    . GLU C 3 148 ? 35.187 40.544 23.055  1.00 38.85 ? 171 GLU A CD    1 
ATOM   1517 O OE1   . GLU C 3 148 ? 36.242 40.015 22.646  1.00 43.31 ? 171 GLU A OE1   1 
ATOM   1518 O OE2   . GLU C 3 148 ? 35.113 41.168 24.137  1.00 43.27 ? 171 GLU A OE2   1 
ATOM   1519 N N     . TRP C 3 149 ? 30.873 40.830 21.192  1.00 23.93 ? 172 TRP A N     1 
ATOM   1520 C CA    . TRP C 3 149 ? 29.744 41.381 21.923  1.00 28.82 ? 172 TRP A CA    1 
ATOM   1521 C C     . TRP C 3 149 ? 29.550 40.630 23.226  1.00 33.23 ? 172 TRP A C     1 
ATOM   1522 O O     . TRP C 3 149 ? 29.443 39.406 23.236  1.00 34.04 ? 172 TRP A O     1 
ATOM   1523 C CB    . TRP C 3 149 ? 28.447 41.336 21.112  1.00 24.91 ? 172 TRP A CB    1 
ATOM   1524 C CG    . TRP C 3 149 ? 27.310 41.947 21.882  1.00 26.17 ? 172 TRP A CG    1 
ATOM   1525 C CD1   . TRP C 3 149 ? 26.207 41.304 22.370  1.00 26.23 ? 172 TRP A CD1   1 
ATOM   1526 C CD2   . TRP C 3 149 ? 27.216 43.305 22.334  1.00 26.66 ? 172 TRP A CD2   1 
ATOM   1527 N NE1   . TRP C 3 149 ? 25.434 42.178 23.105  1.00 27.50 ? 172 TRP A NE1   1 
ATOM   1528 C CE2   . TRP C 3 149 ? 26.030 43.411 23.098  1.00 27.36 ? 172 TRP A CE2   1 
ATOM   1529 C CE3   . TRP C 3 149 ? 28.020 44.441 22.169  1.00 27.48 ? 172 TRP A CE3   1 
ATOM   1530 C CZ2   . TRP C 3 149 ? 25.627 44.610 23.697  1.00 27.77 ? 172 TRP A CZ2   1 
ATOM   1531 C CZ3   . TRP C 3 149 ? 27.617 45.639 22.768  1.00 29.14 ? 172 TRP A CZ3   1 
ATOM   1532 C CH2   . TRP C 3 149 ? 26.430 45.709 23.522  1.00 27.93 ? 172 TRP A CH2   1 
ATOM   1533 N N     . ARG C 3 150 ? 29.510 41.385 24.319  1.00 40.87 ? 173 ARG A N     1 
ATOM   1534 C CA    . ARG C 3 150 ? 29.327 40.832 25.657  1.00 48.29 ? 173 ARG A CA    1 
ATOM   1535 C C     . ARG C 3 150 ? 28.165 41.563 26.325  1.00 52.01 ? 173 ARG A C     1 
ATOM   1536 O O     . ARG C 3 150 ? 28.039 42.782 26.203  1.00 51.25 ? 173 ARG A O     1 
ATOM   1537 C CB    . ARG C 3 150 ? 30.601 41.037 26.485  1.00 50.06 ? 173 ARG A CB    1 
ATOM   1538 C CG    . ARG C 3 150 ? 31.863 40.482 25.840  1.00 53.93 ? 173 ARG A CG    1 
ATOM   1539 C CD    . ARG C 3 150 ? 32.097 39.019 26.190  1.00 57.63 ? 173 ARG A CD    1 
ATOM   1540 N NE    . ARG C 3 150 ? 30.902 38.197 26.021  1.00 60.33 ? 173 ARG A NE    1 
ATOM   1541 C CZ    . ARG C 3 150 ? 30.861 36.890 26.258  1.00 61.50 ? 173 ARG A CZ    1 
ATOM   1542 N NH1   . ARG C 3 150 ? 31.950 36.253 26.670  1.00 62.36 ? 173 ARG A NH1   1 
ATOM   1543 N NH2   . ARG C 3 150 ? 29.729 36.220 26.099  1.00 61.65 ? 173 ARG A NH2   1 
ATOM   1544 N N     . ASP C 3 151 ? 27.311 40.817 27.017  1.00 57.23 ? 174 ASP A N     1 
ATOM   1545 C CA    . ASP C 3 151 ? 26.177 41.420 27.707  1.00 62.62 ? 174 ASP A CA    1 
ATOM   1546 C C     . ASP C 3 151 ? 26.658 41.894 29.078  1.00 66.17 ? 174 ASP A C     1 
ATOM   1547 O O     . ASP C 3 151 ? 27.579 41.307 29.653  1.00 66.88 ? 174 ASP A O     1 
ATOM   1548 C CB    . ASP C 3 151 ? 25.045 40.397 27.854  1.00 63.04 ? 174 ASP A CB    1 
ATOM   1549 C CG    . ASP C 3 151 ? 23.787 40.996 28.454  1.00 63.54 ? 174 ASP A CG    1 
ATOM   1550 O OD1   . ASP C 3 151 ? 23.745 41.199 29.686  1.00 64.76 ? 174 ASP A OD1   1 
ATOM   1551 O OD2   . ASP C 3 151 ? 22.840 41.274 27.689  1.00 63.74 ? 174 ASP A OD2   1 
ATOM   1552 N N     . PRO C 3 152 ? 26.053 42.971 29.614  1.00 69.26 ? 175 PRO A N     1 
ATOM   1553 C CA    . PRO C 3 152 ? 26.415 43.536 30.920  1.00 71.71 ? 175 PRO A CA    1 
ATOM   1554 C C     . PRO C 3 152 ? 26.528 42.531 32.068  1.00 73.97 ? 175 PRO A C     1 
ATOM   1555 O O     . PRO C 3 152 ? 26.678 42.923 33.228  1.00 74.26 ? 175 PRO A O     1 
ATOM   1556 C CB    . PRO C 3 152 ? 25.313 44.564 31.161  1.00 70.61 ? 175 PRO A CB    1 
ATOM   1557 C CG    . PRO C 3 152 ? 25.043 45.065 29.788  1.00 69.89 ? 175 PRO A CG    1 
ATOM   1558 C CD    . PRO C 3 152 ? 25.011 43.792 28.968  1.00 69.66 ? 175 PRO A CD    1 
ATOM   1559 N N     . GLU C 3 153 ? 26.458 41.241 31.748  1.00 76.17 ? 176 GLU A N     1 
ATOM   1560 C CA    . GLU C 3 153 ? 26.557 40.201 32.764  1.00 78.21 ? 176 GLU A CA    1 
ATOM   1561 C C     . GLU C 3 153 ? 26.644 38.799 32.165  1.00 78.95 ? 176 GLU A C     1 
ATOM   1562 O O     . GLU C 3 153 ? 27.372 37.946 32.675  1.00 79.57 ? 176 GLU A O     1 
ATOM   1563 C CB    . GLU C 3 153 ? 25.360 40.293 33.715  1.00 79.07 ? 176 GLU A CB    1 
ATOM   1564 C CG    . GLU C 3 153 ? 24.007 40.072 33.054  1.00 80.37 ? 176 GLU A CG    1 
ATOM   1565 C CD    . GLU C 3 153 ? 23.617 38.608 32.993  1.00 81.39 ? 176 GLU A CD    1 
ATOM   1566 O OE1   . GLU C 3 153 ? 22.608 38.287 32.329  1.00 81.02 ? 176 GLU A OE1   1 
ATOM   1567 O OE2   . GLU C 3 153 ? 24.316 37.780 33.618  1.00 81.79 ? 176 GLU A OE2   1 
ATOM   1568 N N     . MET C 3 154 ? 25.905 38.565 31.084  1.00 79.32 ? 177 MET A N     1 
ATOM   1569 C CA    . MET C 3 154 ? 25.898 37.260 30.426  1.00 79.26 ? 177 MET A CA    1 
ATOM   1570 C C     . MET C 3 154 ? 25.174 37.302 29.083  1.00 78.40 ? 177 MET A C     1 
ATOM   1571 O O     . MET C 3 154 ? 23.944 37.360 29.030  1.00 78.64 ? 177 MET A O     1 
ATOM   1572 C CB    . MET C 3 154 ? 25.239 36.221 31.341  1.00 80.41 ? 177 MET A CB    1 
ATOM   1573 C CG    . MET C 3 154 ? 24.913 34.891 30.679  1.00 82.02 ? 177 MET A CG    1 
ATOM   1574 S SD    . MET C 3 154 ? 26.291 34.176 29.765  1.00 84.26 ? 177 MET A SD    1 
ATOM   1575 C CE    . MET C 3 154 ? 25.547 33.993 28.149  1.00 83.62 ? 177 MET A CE    1 
ATOM   1576 N N     . GLY C 3 155 ? 25.947 37.264 28.000  1.00 76.76 ? 178 GLY A N     1 
ATOM   1577 C CA    . GLY C 3 155 ? 25.360 37.304 26.674  1.00 74.60 ? 178 GLY A CA    1 
ATOM   1578 C C     . GLY C 3 155 ? 25.956 36.299 25.707  1.00 72.92 ? 178 GLY A C     1 
ATOM   1579 O O     . GLY C 3 155 ? 26.757 35.448 26.093  1.00 73.03 ? 178 GLY A O     1 
ATOM   1580 N N     . ILE C 3 156 ? 25.558 36.411 24.442  1.00 71.02 ? 179 ILE A N     1 
ATOM   1581 C CA    . ILE C 3 156 ? 26.020 35.528 23.373  1.00 68.16 ? 179 ILE A CA    1 
ATOM   1582 C C     . ILE C 3 156 ? 27.471 35.082 23.551  1.00 65.44 ? 179 ILE A C     1 
ATOM   1583 O O     . ILE C 3 156 ? 28.284 35.800 24.128  1.00 65.75 ? 179 ILE A O     1 
ATOM   1584 C CB    . ILE C 3 156 ? 25.875 36.220 22.000  1.00 69.35 ? 179 ILE A CB    1 
ATOM   1585 C CG1   . ILE C 3 156 ? 24.457 36.781 21.852  1.00 69.44 ? 179 ILE A CG1   1 
ATOM   1586 C CG2   . ILE C 3 156 ? 26.161 35.227 20.881  1.00 69.76 ? 179 ILE A CG2   1 
ATOM   1587 C CD1   . ILE C 3 156 ? 24.227 37.555 20.574  1.00 68.96 ? 179 ILE A CD1   1 
ATOM   1588 N N     . SER C 3 157 ? 27.783 33.892 23.043  1.00 61.60 ? 180 SER A N     1 
ATOM   1589 C CA    . SER C 3 157 ? 29.122 33.314 23.141  1.00 57.17 ? 180 SER A CA    1 
ATOM   1590 C C     . SER C 3 157 ? 30.271 34.316 23.040  1.00 53.03 ? 180 SER A C     1 
ATOM   1591 O O     . SER C 3 157 ? 30.985 34.550 24.019  1.00 52.95 ? 180 SER A O     1 
ATOM   1592 C CB    . SER C 3 157 ? 29.303 32.229 22.075  1.00 58.49 ? 180 SER A CB    1 
ATOM   1593 O OG    . SER C 3 157 ? 28.409 31.150 22.286  1.00 59.94 ? 180 SER A OG    1 
ATOM   1594 N N     . GLY C 3 158 ? 30.459 34.903 21.861  1.00 47.58 ? 181 GLY A N     1 
ATOM   1595 C CA    . GLY C 3 158 ? 31.546 35.852 21.708  1.00 38.55 ? 181 GLY A CA    1 
ATOM   1596 C C     . GLY C 3 158 ? 31.403 36.873 20.596  1.00 34.12 ? 181 GLY A C     1 
ATOM   1597 O O     . GLY C 3 158 ? 31.132 38.042 20.856  1.00 31.98 ? 181 GLY A O     1 
ATOM   1598 N N     . GLN C 3 159 ? 31.579 36.434 19.354  1.00 28.44 ? 182 GLN A N     1 
ATOM   1599 C CA    . GLN C 3 159 ? 31.497 37.343 18.214  1.00 24.59 ? 182 GLN A CA    1 
ATOM   1600 C C     . GLN C 3 159 ? 30.167 37.358 17.476  1.00 22.16 ? 182 GLN A C     1 
ATOM   1601 O O     . GLN C 3 159 ? 29.405 36.394 17.502  1.00 20.63 ? 182 GLN A O     1 
ATOM   1602 C CB    . GLN C 3 159 ? 32.578 36.999 17.192  1.00 22.60 ? 182 GLN A CB    1 
ATOM   1603 C CG    . GLN C 3 159 ? 34.001 37.242 17.629  1.00 23.97 ? 182 GLN A CG    1 
ATOM   1604 C CD    . GLN C 3 159 ? 34.986 36.638 16.647  1.00 24.53 ? 182 GLN A CD    1 
ATOM   1605 O OE1   . GLN C 3 159 ? 35.012 35.422 16.457  1.00 25.09 ? 182 GLN A OE1   1 
ATOM   1606 N NE2   . GLN C 3 159 ? 35.786 37.482 16.010  1.00 22.98 ? 182 GLN A NE2   1 
ATOM   1607 N N     . LEU C 3 160 ? 29.916 38.476 16.802  1.00 20.54 ? 183 LEU A N     1 
ATOM   1608 C CA    . LEU C 3 160 ? 28.725 38.650 15.983  1.00 19.81 ? 183 LEU A CA    1 
ATOM   1609 C C     . LEU C 3 160 ? 29.221 39.208 14.663  1.00 18.70 ? 183 LEU A C     1 
ATOM   1610 O O     . LEU C 3 160 ? 30.297 39.803 14.605  1.00 17.78 ? 183 LEU A O     1 
ATOM   1611 C CB    . LEU C 3 160 ? 27.778 39.683 16.584  1.00 19.32 ? 183 LEU A CB    1 
ATOM   1612 C CG    . LEU C 3 160 ? 27.086 39.411 17.916  1.00 17.88 ? 183 LEU A CG    1 
ATOM   1613 C CD1   . LEU C 3 160 ? 26.187 40.597 18.230  1.00 19.03 ? 183 LEU A CD1   1 
ATOM   1614 C CD2   . LEU C 3 160 ? 26.275 38.126 17.836  1.00 21.21 ? 183 LEU A CD2   1 
ATOM   1615 N N     . THR C 3 161 ? 28.467 38.997 13.592  1.00 18.34 ? 184 THR A N     1 
ATOM   1616 C CA    . THR C 3 161 ? 28.867 39.601 12.331  1.00 16.82 ? 184 THR A CA    1 
ATOM   1617 C C     . THR C 3 161 ? 27.639 39.980 11.530  1.00 14.99 ? 184 THR A C     1 
ATOM   1618 O O     . THR C 3 161 ? 26.516 39.591 11.867  1.00 16.34 ? 184 THR A O     1 
ATOM   1619 C CB    . THR C 3 161 ? 29.804 38.715 11.483  1.00 16.86 ? 184 THR A CB    1 
ATOM   1620 O OG1   . THR C 3 161 ? 30.489 39.554 10.539  1.00 18.91 ? 184 THR A OG1   1 
ATOM   1621 C CG2   . THR C 3 161 ? 29.026 37.649 10.717  1.00 18.25 ? 184 THR A CG2   1 
ATOM   1622 N N     . TRP C 3 162 ? 27.871 40.763 10.483  1.00 15.85 ? 185 TRP A N     1 
ATOM   1623 C CA    . TRP C 3 162 ? 26.819 41.275 9.619   1.00 17.24 ? 185 TRP A CA    1 
ATOM   1624 C C     . TRP C 3 162 ? 26.452 40.337 8.473   1.00 17.22 ? 185 TRP A C     1 
ATOM   1625 O O     . TRP C 3 162 ? 27.315 39.683 7.904   1.00 16.91 ? 185 TRP A O     1 
ATOM   1626 C CB    . TRP C 3 162 ? 27.261 42.623 9.030   1.00 18.53 ? 185 TRP A CB    1 
ATOM   1627 C CG    . TRP C 3 162 ? 27.721 43.595 10.069  1.00 17.79 ? 185 TRP A CG    1 
ATOM   1628 C CD1   . TRP C 3 162 ? 28.985 43.739 10.560  1.00 18.28 ? 185 TRP A CD1   1 
ATOM   1629 C CD2   . TRP C 3 162 ? 26.892 44.484 10.822  1.00 18.47 ? 185 TRP A CD2   1 
ATOM   1630 N NE1   . TRP C 3 162 ? 28.996 44.661 11.580  1.00 18.29 ? 185 TRP A NE1   1 
ATOM   1631 C CE2   . TRP C 3 162 ? 27.722 45.134 11.763  1.00 17.72 ? 185 TRP A CE2   1 
ATOM   1632 C CE3   . TRP C 3 162 ? 25.523 44.790 10.798  1.00 18.55 ? 185 TRP A CE3   1 
ATOM   1633 C CZ2   . TRP C 3 162 ? 27.231 46.074 12.676  1.00 18.21 ? 185 TRP A CZ2   1 
ATOM   1634 C CZ3   . TRP C 3 162 ? 25.031 45.728 11.708  1.00 18.29 ? 185 TRP A CZ3   1 
ATOM   1635 C CH2   . TRP C 3 162 ? 25.888 46.358 12.633  1.00 18.72 ? 185 TRP A CH2   1 
ATOM   1636 N N     . THR C 3 163 ? 25.167 40.278 8.140   1.00 17.74 ? 186 THR A N     1 
ATOM   1637 C CA    . THR C 3 163 ? 24.739 39.435 7.027   1.00 19.12 ? 186 THR A CA    1 
ATOM   1638 C C     . THR C 3 163 ? 24.377 40.347 5.865   1.00 18.96 ? 186 THR A C     1 
ATOM   1639 O O     . THR C 3 163 ? 23.950 39.876 4.808   1.00 18.46 ? 186 THR A O     1 
ATOM   1640 C CB    . THR C 3 163 ? 23.512 38.562 7.380   1.00 19.15 ? 186 THR A CB    1 
ATOM   1641 O OG1   . THR C 3 163 ? 22.371 39.394 7.620   1.00 18.40 ? 186 THR A OG1   1 
ATOM   1642 C CG2   . THR C 3 163 ? 23.799 37.721 8.617   1.00 21.99 ? 186 THR A CG2   1 
ATOM   1643 N N     . ARG C 3 164 ? 24.554 41.654 6.076   1.00 19.87 ? 187 ARG A N     1 
ATOM   1644 C CA    . ARG C 3 164 ? 24.260 42.674 5.068   1.00 18.62 ? 187 ARG A CA    1 
ATOM   1645 C C     . ARG C 3 164 ? 25.461 43.617 4.953   1.00 19.85 ? 187 ARG A C     1 
ATOM   1646 O O     . ARG C 3 164 ? 26.338 43.625 5.819   1.00 19.85 ? 187 ARG A O     1 
ATOM   1647 C CB    . ARG C 3 164 ? 23.014 43.497 5.467   1.00 16.62 ? 187 ARG A CB    1 
ATOM   1648 C CG    . ARG C 3 164 ? 21.771 42.693 5.879   1.00 18.06 ? 187 ARG A CG    1 
ATOM   1649 C CD    . ARG C 3 164 ? 21.199 41.871 4.721   1.00 21.48 ? 187 ARG A CD    1 
ATOM   1650 N NE    . ARG C 3 164 ? 19.990 41.127 5.084   1.00 21.81 ? 187 ARG A NE    1 
ATOM   1651 C CZ    . ARG C 3 164 ? 18.757 41.632 5.103   1.00 24.70 ? 187 ARG A CZ    1 
ATOM   1652 N NH1   . ARG C 3 164 ? 18.537 42.899 4.782   1.00 22.22 ? 187 ARG A NH1   1 
ATOM   1653 N NH2   . ARG C 3 164 ? 17.726 40.858 5.428   1.00 27.26 ? 187 ARG A NH2   1 
ATOM   1654 N N     . LEU C 3 165 ? 25.499 44.406 3.881   1.00 18.85 ? 188 LEU A N     1 
ATOM   1655 C CA    . LEU C 3 165 ? 26.575 45.376 3.647   1.00 19.62 ? 188 LEU A CA    1 
ATOM   1656 C C     . LEU C 3 165 ? 26.643 46.294 4.874   1.00 19.40 ? 188 LEU A C     1 
ATOM   1657 O O     . LEU C 3 165 ? 25.682 46.995 5.182   1.00 19.23 ? 188 LEU A O     1 
ATOM   1658 C CB    . LEU C 3 165 ? 26.241 46.187 2.399   1.00 20.99 ? 188 LEU A CB    1 
ATOM   1659 C CG    . LEU C 3 165 ? 27.311 47.038 1.727   1.00 22.42 ? 188 LEU A CG    1 
ATOM   1660 C CD1   . LEU C 3 165 ? 28.528 46.179 1.356   1.00 21.06 ? 188 LEU A CD1   1 
ATOM   1661 C CD2   . LEU C 3 165 ? 26.693 47.669 0.487   1.00 21.57 ? 188 LEU A CD2   1 
ATOM   1662 N N     . PRO C 3 166 ? 27.791 46.321 5.574   1.00 19.98 ? 189 PRO A N     1 
ATOM   1663 C CA    . PRO C 3 166 ? 27.909 47.161 6.770   1.00 19.98 ? 189 PRO A CA    1 
ATOM   1664 C C     . PRO C 3 166 ? 28.361 48.605 6.641   1.00 19.86 ? 189 PRO A C     1 
ATOM   1665 O O     . PRO C 3 166 ? 29.009 48.996 5.669   1.00 17.66 ? 189 PRO A O     1 
ATOM   1666 C CB    . PRO C 3 166 ? 28.860 46.357 7.647   1.00 20.32 ? 189 PRO A CB    1 
ATOM   1667 C CG    . PRO C 3 166 ? 29.808 45.794 6.649   1.00 20.17 ? 189 PRO A CG    1 
ATOM   1668 C CD    . PRO C 3 166 ? 28.924 45.379 5.477   1.00 20.17 ? 189 PRO A CD    1 
ATOM   1669 N N     . GLN C 3 167 ? 27.989 49.397 7.643   1.00 19.71 ? 190 GLN A N     1 
ATOM   1670 C CA    . GLN C 3 167 ? 28.395 50.794 7.710   1.00 20.39 ? 190 GLN A CA    1 
ATOM   1671 C C     . GLN C 3 167 ? 29.882 50.750 8.035   1.00 18.16 ? 190 GLN A C     1 
ATOM   1672 O O     . GLN C 3 167 ? 30.348 49.796 8.650   1.00 20.26 ? 190 GLN A O     1 
ATOM   1673 C CB    . GLN C 3 167 ? 27.665 51.509 8.854   1.00 21.55 ? 190 GLN A CB    1 
ATOM   1674 C CG    . GLN C 3 167 ? 26.162 51.611 8.694   1.00 28.62 ? 190 GLN A CG    1 
ATOM   1675 C CD    . GLN C 3 167 ? 25.768 52.492 7.531   1.00 32.48 ? 190 GLN A CD    1 
ATOM   1676 O OE1   . GLN C 3 167 ? 26.303 53.591 7.362   1.00 34.78 ? 190 GLN A OE1   1 
ATOM   1677 N NE2   . GLN C 3 167 ? 24.821 52.022 6.727   1.00 36.05 ? 190 GLN A NE2   1 
ATOM   1678 N N     . GLY C 3 168 ? 30.627 51.771 7.624   1.00 18.05 ? 191 GLY A N     1 
ATOM   1679 C CA    . GLY C 3 168 ? 32.045 51.801 7.927   1.00 17.84 ? 191 GLY A CA    1 
ATOM   1680 C C     . GLY C 3 168 ? 32.949 51.058 6.961   1.00 17.58 ? 191 GLY A C     1 
ATOM   1681 O O     . GLY C 3 168 ? 34.168 51.173 7.057   1.00 15.95 ? 191 GLY A O     1 
ATOM   1682 N N     . PHE C 3 169 ? 32.359 50.289 6.048   1.00 17.26 ? 192 PHE A N     1 
ATOM   1683 C CA    . PHE C 3 169 ? 33.126 49.540 5.052   1.00 15.45 ? 192 PHE A CA    1 
ATOM   1684 C C     . PHE C 3 169 ? 33.360 50.483 3.872   1.00 16.14 ? 192 PHE A C     1 
ATOM   1685 O O     . PHE C 3 169 ? 32.409 51.069 3.334   1.00 16.75 ? 192 PHE A O     1 
ATOM   1686 C CB    . PHE C 3 169 ? 32.345 48.287 4.626   1.00 14.74 ? 192 PHE A CB    1 
ATOM   1687 C CG    . PHE C 3 169 ? 32.957 47.552 3.457   1.00 16.74 ? 192 PHE A CG    1 
ATOM   1688 C CD1   . PHE C 3 169 ? 34.328 47.299 3.412   1.00 14.75 ? 192 PHE A CD1   1 
ATOM   1689 C CD2   . PHE C 3 169 ? 32.153 47.090 2.416   1.00 14.94 ? 192 PHE A CD2   1 
ATOM   1690 C CE1   . PHE C 3 169 ? 34.895 46.592 2.336   1.00 14.80 ? 192 PHE A CE1   1 
ATOM   1691 C CE2   . PHE C 3 169 ? 32.702 46.385 1.341   1.00 16.62 ? 192 PHE A CE2   1 
ATOM   1692 C CZ    . PHE C 3 169 ? 34.078 46.136 1.300   1.00 15.04 ? 192 PHE A CZ    1 
ATOM   1693 N N     . LYS C 3 170 ? 34.620 50.616 3.462   1.00 16.53 ? 193 LYS A N     1 
ATOM   1694 C CA    . LYS C 3 170 ? 34.999 51.559 2.411   1.00 15.78 ? 193 LYS A CA    1 
ATOM   1695 C C     . LYS C 3 170 ? 34.256 51.454 1.091   1.00 16.15 ? 193 LYS A C     1 
ATOM   1696 O O     . LYS C 3 170 ? 34.056 52.467 0.416   1.00 15.78 ? 193 LYS A O     1 
ATOM   1697 C CB    . LYS C 3 170 ? 36.511 51.492 2.135   1.00 15.41 ? 193 LYS A CB    1 
ATOM   1698 C CG    . LYS C 3 170 ? 36.960 50.245 1.380   1.00 16.17 ? 193 LYS A CG    1 
ATOM   1699 C CD    . LYS C 3 170 ? 38.456 50.316 1.053   1.00 15.96 ? 193 LYS A CD    1 
ATOM   1700 C CE    . LYS C 3 170 ? 38.939 49.053 0.355   1.00 19.13 ? 193 LYS A CE    1 
ATOM   1701 N NZ    . LYS C 3 170 ? 40.426 49.084 0.152   1.00 18.41 ? 193 LYS A NZ    1 
ATOM   1702 N N     . ASN C 3 171 ? 33.832 50.252 0.723   1.00 14.46 ? 194 ASN A N     1 
ATOM   1703 C CA    . ASN C 3 171 ? 33.138 50.085 -0.547  1.00 17.20 ? 194 ASN A CA    1 
ATOM   1704 C C     . ASN C 3 171 ? 31.614 50.058 -0.489  1.00 15.64 ? 194 ASN A C     1 
ATOM   1705 O O     . ASN C 3 171 ? 30.965 49.883 -1.514  1.00 16.01 ? 194 ASN A O     1 
ATOM   1706 C CB    . ASN C 3 171 ? 33.634 48.815 -1.256  1.00 16.13 ? 194 ASN A CB    1 
ATOM   1707 C CG    . ASN C 3 171 ? 35.080 48.921 -1.693  1.00 16.81 ? 194 ASN A CG    1 
ATOM   1708 O OD1   . ASN C 3 171 ? 35.621 50.021 -1.803  1.00 16.52 ? 194 ASN A OD1   1 
ATOM   1709 N ND2   . ASN C 3 171 ? 35.720 47.773 -1.949  1.00 15.72 ? 194 ASN A ND2   1 
ATOM   1710 N N     . SER C 3 172 ? 31.026 50.254 0.684   1.00 16.49 ? 195 SER A N     1 
ATOM   1711 C CA    . SER C 3 172 ? 29.572 50.191 0.763   1.00 15.06 ? 195 SER A CA    1 
ATOM   1712 C C     . SER C 3 172 ? 28.833 51.207 -0.106  1.00 13.61 ? 195 SER A C     1 
ATOM   1713 O O     . SER C 3 172 ? 27.902 50.839 -0.830  1.00 14.61 ? 195 SER A O     1 
ATOM   1714 C CB    . SER C 3 172 ? 29.110 50.281 2.221   1.00 15.01 ? 195 SER A CB    1 
ATOM   1715 O OG    . SER C 3 172 ? 29.459 49.087 2.917   1.00 14.29 ? 195 SER A OG    1 
ATOM   1716 N N     . PRO C 3 173 ? 29.239 52.490 -0.072  1.00 16.15 ? 196 PRO A N     1 
ATOM   1717 C CA    . PRO C 3 173 ? 28.532 53.473 -0.905  1.00 16.63 ? 196 PRO A CA    1 
ATOM   1718 C C     . PRO C 3 173 ? 28.531 53.118 -2.393  1.00 15.93 ? 196 PRO A C     1 
ATOM   1719 O O     . PRO C 3 173 ? 27.488 53.159 -3.059  1.00 16.81 ? 196 PRO A O     1 
ATOM   1720 C CB    . PRO C 3 173 ? 29.295 54.773 -0.627  1.00 18.16 ? 196 PRO A CB    1 
ATOM   1721 C CG    . PRO C 3 173 ? 29.783 54.583 0.789   1.00 19.15 ? 196 PRO A CG    1 
ATOM   1722 C CD    . PRO C 3 173 ? 30.271 53.147 0.754   1.00 16.13 ? 196 PRO A CD    1 
ATOM   1723 N N     . THR C 3 174 ? 29.705 52.780 -2.913  1.00 15.19 ? 197 THR A N     1 
ATOM   1724 C CA    . THR C 3 174 ? 29.836 52.435 -4.322  1.00 15.35 ? 197 THR A CA    1 
ATOM   1725 C C     . THR C 3 174 ? 29.057 51.177 -4.690  1.00 15.31 ? 197 THR A C     1 
ATOM   1726 O O     . THR C 3 174 ? 28.350 51.149 -5.700  1.00 13.79 ? 197 THR A O     1 
ATOM   1727 C CB    . THR C 3 174 ? 31.312 52.255 -4.694  1.00 19.95 ? 197 THR A CB    1 
ATOM   1728 O OG1   . THR C 3 174 ? 31.999 53.501 -4.489  1.00 23.04 ? 197 THR A OG1   1 
ATOM   1729 C CG2   . THR C 3 174 ? 31.451 51.819 -6.150  1.00 19.84 ? 197 THR A CG2   1 
ATOM   1730 N N     . LEU C 3 175 ? 29.181 50.134 -3.876  1.00 14.22 ? 198 LEU A N     1 
ATOM   1731 C CA    . LEU C 3 175 ? 28.467 48.891 -4.161  1.00 14.53 ? 198 LEU A CA    1 
ATOM   1732 C C     . LEU C 3 175 ? 26.968 49.109 -4.084  1.00 14.11 ? 198 LEU A C     1 
ATOM   1733 O O     . LEU C 3 175 ? 26.203 48.540 -4.862  1.00 14.55 ? 198 LEU A O     1 
ATOM   1734 C CB    . LEU C 3 175 ? 28.901 47.788 -3.183  1.00 14.67 ? 198 LEU A CB    1 
ATOM   1735 C CG    . LEU C 3 175 ? 30.361 47.327 -3.319  1.00 17.02 ? 198 LEU A CG    1 
ATOM   1736 C CD1   . LEU C 3 175 ? 30.689 46.318 -2.214  1.00 15.25 ? 198 LEU A CD1   1 
ATOM   1737 C CD2   . LEU C 3 175 ? 30.580 46.696 -4.696  1.00 18.35 ? 198 LEU A CD2   1 
ATOM   1738 N N     . PHE C 3 176 ? 26.522 49.929 -3.144  1.00 15.24 ? 199 PHE A N     1 
ATOM   1739 C CA    . PHE C 3 176 ? 25.090 50.163 -3.070  1.00 14.59 ? 199 PHE A CA    1 
ATOM   1740 C C     . PHE C 3 176 ? 24.629 50.952 -4.297  1.00 13.76 ? 199 PHE A C     1 
ATOM   1741 O O     . PHE C 3 176 ? 23.659 50.577 -4.946  1.00 14.60 ? 199 PHE A O     1 
ATOM   1742 C CB    . PHE C 3 176 ? 24.688 50.935 -1.805  1.00 14.44 ? 199 PHE A CB    1 
ATOM   1743 C CG    . PHE C 3 176 ? 23.213 51.173 -1.716  1.00 14.64 ? 199 PHE A CG    1 
ATOM   1744 C CD1   . PHE C 3 176 ? 22.368 50.185 -1.207  1.00 16.66 ? 199 PHE A CD1   1 
ATOM   1745 C CD2   . PHE C 3 176 ? 22.647 52.320 -2.271  1.00 15.83 ? 199 PHE A CD2   1 
ATOM   1746 C CE1   . PHE C 3 176 ? 20.989 50.327 -1.259  1.00 16.71 ? 199 PHE A CE1   1 
ATOM   1747 C CE2   . PHE C 3 176 ? 21.263 52.474 -2.332  1.00 14.92 ? 199 PHE A CE2   1 
ATOM   1748 C CZ    . PHE C 3 176 ? 20.429 51.468 -1.824  1.00 17.68 ? 199 PHE A CZ    1 
ATOM   1749 N N     . ASP C 3 177 ? 25.336 52.031 -4.626  1.00 14.47 ? 200 ASP A N     1 
ATOM   1750 C CA    . ASP C 3 177 ? 24.961 52.862 -5.773  1.00 16.22 ? 200 ASP A CA    1 
ATOM   1751 C C     . ASP C 3 177 ? 24.886 52.003 -7.041  1.00 15.54 ? 200 ASP A C     1 
ATOM   1752 O O     . ASP C 3 177 ? 23.945 52.121 -7.834  1.00 12.65 ? 200 ASP A O     1 
ATOM   1753 C CB    . ASP C 3 177 ? 25.981 53.993 -5.960  1.00 14.95 ? 200 ASP A CB    1 
ATOM   1754 C CG    . ASP C 3 177 ? 25.457 55.120 -6.839  1.00 18.64 ? 200 ASP A CG    1 
ATOM   1755 O OD1   . ASP C 3 177 ? 24.423 55.722 -6.479  1.00 17.82 ? 200 ASP A OD1   1 
ATOM   1756 O OD2   . ASP C 3 177 ? 26.086 55.413 -7.885  1.00 18.93 ? 200 ASP A OD2   1 
ATOM   1757 N N     . GLU C 3 178 ? 25.870 51.128 -7.229  1.00 14.81 ? 201 GLU A N     1 
ATOM   1758 C CA    . GLU C 3 178 ? 25.882 50.274 -8.410  1.00 14.33 ? 201 GLU A CA    1 
ATOM   1759 C C     . GLU C 3 178 ? 24.728 49.276 -8.391  1.00 15.26 ? 201 GLU A C     1 
ATOM   1760 O O     . GLU C 3 178 ? 24.116 49.006 -9.422  1.00 15.98 ? 201 GLU A O     1 
ATOM   1761 C CB    . GLU C 3 178 ? 27.238 49.550 -8.532  1.00 13.83 ? 201 GLU A CB    1 
ATOM   1762 C CG    . GLU C 3 178 ? 28.380 50.518 -8.877  1.00 17.83 ? 201 GLU A CG    1 
ATOM   1763 C CD    . GLU C 3 178 ? 29.755 49.863 -8.952  1.00 22.03 ? 201 GLU A CD    1 
ATOM   1764 O OE1   . GLU C 3 178 ? 29.846 48.621 -8.863  1.00 27.14 ? 201 GLU A OE1   1 
ATOM   1765 O OE2   . GLU C 3 178 ? 30.752 50.602 -9.106  1.00 22.83 ? 201 GLU A OE2   1 
ATOM   1766 N N     . ALA C 3 179 ? 24.408 48.748 -7.213  1.00 14.24 ? 202 ALA A N     1 
ATOM   1767 C CA    . ALA C 3 179 ? 23.315 47.789 -7.119  1.00 15.56 ? 202 ALA A CA    1 
ATOM   1768 C C     . ALA C 3 179 ? 21.971 48.430 -7.441  1.00 15.60 ? 202 ALA A C     1 
ATOM   1769 O O     . ALA C 3 179 ? 21.172 47.861 -8.190  1.00 17.29 ? 202 ALA A O     1 
ATOM   1770 C CB    . ALA C 3 179 ? 23.278 47.159 -5.724  1.00 16.65 ? 202 ALA A CB    1 
ATOM   1771 N N     . LEU C 3 180 ? 21.714 49.614 -6.887  1.00 13.44 ? 203 LEU A N     1 
ATOM   1772 C CA    . LEU C 3 180 ? 20.439 50.266 -7.145  1.00 13.65 ? 203 LEU A CA    1 
ATOM   1773 C C     . LEU C 3 180 ? 20.332 50.674 -8.612  1.00 15.86 ? 203 LEU A C     1 
ATOM   1774 O O     . LEU C 3 180 ? 19.242 50.642 -9.180  1.00 16.43 ? 203 LEU A O     1 
ATOM   1775 C CB    . LEU C 3 180 ? 20.242 51.473 -6.215  1.00 12.69 ? 203 LEU A CB    1 
ATOM   1776 C CG    . LEU C 3 180 ? 18.866 52.158 -6.282  1.00 16.46 ? 203 LEU A CG    1 
ATOM   1777 C CD1   . LEU C 3 180 ? 17.763 51.194 -5.843  1.00 16.99 ? 203 LEU A CD1   1 
ATOM   1778 C CD2   . LEU C 3 180 ? 18.874 53.385 -5.387  1.00 17.53 ? 203 LEU A CD2   1 
ATOM   1779 N N     . HIS C 3 181 ? 21.453 51.031 -9.237  1.00 16.78 ? 204 HIS A N     1 
ATOM   1780 C CA    . HIS C 3 181 ? 21.410 51.399 -10.654 1.00 17.70 ? 204 HIS A CA    1 
ATOM   1781 C C     . HIS C 3 181 ? 20.947 50.188 -11.460 1.00 19.76 ? 204 HIS A C     1 
ATOM   1782 O O     . HIS C 3 181 ? 20.146 50.313 -12.390 1.00 19.70 ? 204 HIS A O     1 
ATOM   1783 C CB    . HIS C 3 181 ? 22.780 51.867 -11.145 1.00 17.38 ? 204 HIS A CB    1 
ATOM   1784 C CG    . HIS C 3 181 ? 22.969 53.351 -11.070 1.00 18.90 ? 204 HIS A CG    1 
ATOM   1785 N ND1   . HIS C 3 181 ? 22.256 54.230 -11.859 1.00 18.26 ? 204 HIS A ND1   1 
ATOM   1786 C CD2   . HIS C 3 181 ? 23.763 54.113 -10.281 1.00 18.11 ? 204 HIS A CD2   1 
ATOM   1787 C CE1   . HIS C 3 181 ? 22.602 55.470 -11.557 1.00 20.52 ? 204 HIS A CE1   1 
ATOM   1788 N NE2   . HIS C 3 181 ? 23.514 55.427 -10.603 1.00 20.53 ? 204 HIS A NE2   1 
ATOM   1789 N N     . ARG C 3 182 ? 21.449 49.010 -11.109 1.00 18.75 ? 205 ARG A N     1 
ATOM   1790 C CA    . ARG C 3 182 ? 21.038 47.804 -11.819 1.00 21.07 ? 205 ARG A CA    1 
ATOM   1791 C C     . ARG C 3 182 ? 19.543 47.563 -11.607 1.00 20.69 ? 205 ARG A C     1 
ATOM   1792 O O     . ARG C 3 182 ? 18.812 47.247 -12.550 1.00 21.02 ? 205 ARG A O     1 
ATOM   1793 C CB    . ARG C 3 182 ? 21.827 46.583 -11.332 1.00 20.92 ? 205 ARG A CB    1 
ATOM   1794 C CG    . ARG C 3 182 ? 23.308 46.609 -11.674 1.00 20.24 ? 205 ARG A CG    1 
ATOM   1795 C CD    . ARG C 3 182 ? 23.974 45.253 -11.428 1.00 19.54 ? 205 ARG A CD    1 
ATOM   1796 N NE    . ARG C 3 182 ? 24.065 44.858 -10.016 1.00 17.55 ? 205 ARG A NE    1 
ATOM   1797 C CZ    . ARG C 3 182 ? 25.008 45.271 -9.171  1.00 17.33 ? 205 ARG A CZ    1 
ATOM   1798 N NH1   . ARG C 3 182 ? 25.955 46.110 -9.576  1.00 15.72 ? 205 ARG A NH1   1 
ATOM   1799 N NH2   . ARG C 3 182 ? 25.025 44.821 -7.919  1.00 19.01 ? 205 ARG A NH2   1 
ATOM   1800 N N     . ASP C 3 183 ? 19.084 47.718 -10.369 1.00 18.99 ? 206 ASP A N     1 
ATOM   1801 C CA    . ASP C 3 183 ? 17.674 47.496 -10.067 1.00 20.21 ? 206 ASP A CA    1 
ATOM   1802 C C     . ASP C 3 183 ? 16.708 48.532 -10.641 1.00 20.27 ? 206 ASP A C     1 
ATOM   1803 O O     . ASP C 3 183 ? 15.534 48.230 -10.843 1.00 21.49 ? 206 ASP A O     1 
ATOM   1804 C CB    . ASP C 3 183 ? 17.455 47.395 -8.550  1.00 18.37 ? 206 ASP A CB    1 
ATOM   1805 C CG    . ASP C 3 183 ? 17.784 46.016 -8.005  1.00 21.32 ? 206 ASP A CG    1 
ATOM   1806 O OD1   . ASP C 3 183 ? 17.852 45.061 -8.807  1.00 22.99 ? 206 ASP A OD1   1 
ATOM   1807 O OD2   . ASP C 3 183 ? 17.957 45.879 -6.775  1.00 20.47 ? 206 ASP A OD2   1 
ATOM   1808 N N     . LEU C 3 184 ? 17.186 49.745 -10.902 1.00 19.23 ? 207 LEU A N     1 
ATOM   1809 C CA    . LEU C 3 184 ? 16.306 50.784 -11.433 1.00 21.01 ? 207 LEU A CA    1 
ATOM   1810 C C     . LEU C 3 184 ? 16.480 51.033 -12.930 1.00 22.10 ? 207 LEU A C     1 
ATOM   1811 O O     . LEU C 3 184 ? 15.867 51.942 -13.493 1.00 22.69 ? 207 LEU A O     1 
ATOM   1812 C CB    . LEU C 3 184 ? 16.504 52.095 -10.670 1.00 20.66 ? 207 LEU A CB    1 
ATOM   1813 C CG    . LEU C 3 184 ? 16.125 52.066 -9.184  1.00 20.65 ? 207 LEU A CG    1 
ATOM   1814 C CD1   . LEU C 3 184 ? 16.342 53.443 -8.583  1.00 19.65 ? 207 LEU A CD1   1 
ATOM   1815 C CD2   . LEU C 3 184 ? 14.666 51.629 -9.029  1.00 19.15 ? 207 LEU A CD2   1 
ATOM   1816 N N     . ALA C 3 185 ? 17.305 50.217 -13.571 1.00 22.17 ? 208 ALA A N     1 
ATOM   1817 C CA    . ALA C 3 185 ? 17.544 50.352 -15.003 1.00 25.62 ? 208 ALA A CA    1 
ATOM   1818 C C     . ALA C 3 185 ? 16.248 50.233 -15.812 1.00 28.61 ? 208 ALA A C     1 
ATOM   1819 O O     . ALA C 3 185 ? 16.007 51.030 -16.722 1.00 29.83 ? 208 ALA A O     1 
ATOM   1820 C CB    . ALA C 3 185 ? 18.549 49.298 -15.463 1.00 25.29 ? 208 ALA A CB    1 
ATOM   1821 N N     . ASP C 3 186 ? 15.410 49.252 -15.482 1.00 28.81 ? 209 ASP A N     1 
ATOM   1822 C CA    . ASP C 3 186 ? 14.154 49.071 -16.211 1.00 31.36 ? 209 ASP A CA    1 
ATOM   1823 C C     . ASP C 3 186 ? 13.209 50.251 -16.004 1.00 32.48 ? 209 ASP A C     1 
ATOM   1824 O O     . ASP C 3 186 ? 12.553 50.707 -16.944 1.00 32.16 ? 209 ASP A O     1 
ATOM   1825 C CB    . ASP C 3 186 ? 13.447 47.786 -15.782 1.00 33.23 ? 209 ASP A CB    1 
ATOM   1826 C CG    . ASP C 3 186 ? 12.157 47.553 -16.555 1.00 38.17 ? 209 ASP A CG    1 
ATOM   1827 O OD1   . ASP C 3 186 ? 12.226 47.434 -17.798 1.00 40.20 ? 209 ASP A OD1   1 
ATOM   1828 O OD2   . ASP C 3 186 ? 11.078 47.498 -15.927 1.00 38.36 ? 209 ASP A OD2   1 
ATOM   1829 N N     . PHE C 3 187 ? 13.132 50.737 -14.769 1.00 30.76 ? 210 PHE A N     1 
ATOM   1830 C CA    . PHE C 3 187 ? 12.273 51.870 -14.461 1.00 32.39 ? 210 PHE A CA    1 
ATOM   1831 C C     . PHE C 3 187 ? 12.638 53.042 -15.365 1.00 32.68 ? 210 PHE A C     1 
ATOM   1832 O O     . PHE C 3 187 ? 11.759 53.722 -15.899 1.00 33.83 ? 210 PHE A O     1 
ATOM   1833 C CB    . PHE C 3 187 ? 12.415 52.266 -12.985 1.00 31.75 ? 210 PHE A CB    1 
ATOM   1834 C CG    . PHE C 3 187 ? 11.695 53.540 -12.623 1.00 32.02 ? 210 PHE A CG    1 
ATOM   1835 C CD1   . PHE C 3 187 ? 12.298 54.778 -12.822 1.00 30.78 ? 210 PHE A CD1   1 
ATOM   1836 C CD2   . PHE C 3 187 ? 10.403 53.502 -12.108 1.00 32.97 ? 210 PHE A CD2   1 
ATOM   1837 C CE1   . PHE C 3 187 ? 11.627 55.960 -12.514 1.00 32.65 ? 210 PHE A CE1   1 
ATOM   1838 C CE2   . PHE C 3 187 ? 9.722  54.679 -11.798 1.00 32.37 ? 210 PHE A CE2   1 
ATOM   1839 C CZ    . PHE C 3 187 ? 10.336 55.909 -12.002 1.00 31.29 ? 210 PHE A CZ    1 
ATOM   1840 N N     . ARG C 3 188 ? 13.935 53.275 -15.543 1.00 31.85 ? 211 ARG A N     1 
ATOM   1841 C CA    . ARG C 3 188 ? 14.390 54.368 -16.397 1.00 32.63 ? 211 ARG A CA    1 
ATOM   1842 C C     . ARG C 3 188 ? 13.887 54.161 -17.824 1.00 34.02 ? 211 ARG A C     1 
ATOM   1843 O O     . ARG C 3 188 ? 13.398 55.093 -18.461 1.00 34.45 ? 211 ARG A O     1 
ATOM   1844 C CB    . ARG C 3 188 ? 15.918 54.449 -16.400 1.00 30.81 ? 211 ARG A CB    1 
ATOM   1845 C CG    . ARG C 3 188 ? 16.523 54.962 -15.102 1.00 29.70 ? 211 ARG A CG    1 
ATOM   1846 C CD    . ARG C 3 188 ? 18.042 54.881 -15.137 1.00 30.01 ? 211 ARG A CD    1 
ATOM   1847 N NE    . ARG C 3 188 ? 18.650 55.386 -13.908 1.00 27.31 ? 211 ARG A NE    1 
ATOM   1848 C CZ    . ARG C 3 188 ? 18.745 56.675 -13.589 1.00 29.75 ? 211 ARG A CZ    1 
ATOM   1849 N NH1   . ARG C 3 188 ? 18.273 57.603 -14.412 1.00 27.50 ? 211 ARG A NH1   1 
ATOM   1850 N NH2   . ARG C 3 188 ? 19.314 57.038 -12.446 1.00 25.51 ? 211 ARG A NH2   1 
ATOM   1851 N N     . ILE C 3 189 ? 14.004 52.932 -18.313 1.00 34.71 ? 212 ILE A N     1 
ATOM   1852 C CA    . ILE C 3 189 ? 13.564 52.591 -19.663 1.00 37.78 ? 212 ILE A CA    1 
ATOM   1853 C C     . ILE C 3 189 ? 12.052 52.735 -19.837 1.00 39.43 ? 212 ILE A C     1 
ATOM   1854 O O     . ILE C 3 189 ? 11.582 53.139 -20.902 1.00 40.95 ? 212 ILE A O     1 
ATOM   1855 C CB    . ILE C 3 189 ? 13.980 51.144 -20.029 1.00 36.76 ? 212 ILE A CB    1 
ATOM   1856 C CG1   . ILE C 3 189 ? 15.500 51.075 -20.192 1.00 36.43 ? 212 ILE A CG1   1 
ATOM   1857 C CG2   . ILE C 3 189 ? 13.274 50.694 -21.303 1.00 36.75 ? 212 ILE A CG2   1 
ATOM   1858 C CD1   . ILE C 3 189 ? 16.043 49.682 -20.421 1.00 35.67 ? 212 ILE A CD1   1 
ATOM   1859 N N     . GLN C 3 190 ? 11.291 52.416 -18.794 1.00 41.28 ? 213 GLN A N     1 
ATOM   1860 C CA    . GLN C 3 190 ? 9.834  52.513 -18.863 1.00 43.55 ? 213 GLN A CA    1 
ATOM   1861 C C     . GLN C 3 190 ? 9.314  53.940 -18.677 1.00 43.76 ? 213 GLN A C     1 
ATOM   1862 O O     . GLN C 3 190 ? 8.130  54.207 -18.887 1.00 43.83 ? 213 GLN A O     1 
ATOM   1863 C CB    . GLN C 3 190 ? 9.193  51.595 -17.818 1.00 45.96 ? 213 GLN A CB    1 
ATOM   1864 C CG    . GLN C 3 190 ? 9.611  50.133 -17.936 1.00 50.13 ? 213 GLN A CG    1 
ATOM   1865 C CD    . GLN C 3 190 ? 9.249  49.512 -19.278 1.00 52.32 ? 213 GLN A CD    1 
ATOM   1866 O OE1   . GLN C 3 190 ? 9.727  48.429 -19.620 1.00 52.66 ? 213 GLN A OE1   1 
ATOM   1867 N NE2   . GLN C 3 190 ? 8.397  50.192 -20.039 1.00 53.08 ? 213 GLN A NE2   1 
ATOM   1868 N N     . HIS C 3 191 ? 10.200 54.853 -18.292 1.00 43.46 ? 214 HIS A N     1 
ATOM   1869 C CA    . HIS C 3 191 ? 9.819  56.246 -18.077 1.00 44.08 ? 214 HIS A CA    1 
ATOM   1870 C C     . HIS C 3 191 ? 10.853 57.179 -18.700 1.00 44.24 ? 214 HIS A C     1 
ATOM   1871 O O     . HIS C 3 191 ? 11.572 57.889 -17.997 1.00 43.27 ? 214 HIS A O     1 
ATOM   1872 C CB    . HIS C 3 191 ? 9.696  56.519 -16.579 1.00 44.54 ? 214 HIS A CB    1 
ATOM   1873 C CG    . HIS C 3 191 ? 8.740  55.604 -15.881 1.00 46.15 ? 214 HIS A CG    1 
ATOM   1874 N ND1   . HIS C 3 191 ? 7.372  55.737 -15.983 1.00 47.03 ? 214 HIS A ND1   1 
ATOM   1875 C CD2   . HIS C 3 191 ? 8.955  54.516 -15.103 1.00 45.94 ? 214 HIS A CD2   1 
ATOM   1876 C CE1   . HIS C 3 191 ? 6.786  54.771 -15.298 1.00 47.27 ? 214 HIS A CE1   1 
ATOM   1877 N NE2   . HIS C 3 191 ? 7.724  54.017 -14.755 1.00 47.20 ? 214 HIS A NE2   1 
ATOM   1878 N N     . PRO C 3 192 ? 10.928 57.192 -20.040 1.00 44.97 ? 215 PRO A N     1 
ATOM   1879 C CA    . PRO C 3 192 ? 11.856 58.011 -20.828 1.00 46.01 ? 215 PRO A CA    1 
ATOM   1880 C C     . PRO C 3 192 ? 11.800 59.509 -20.532 1.00 46.19 ? 215 PRO A C     1 
ATOM   1881 O O     . PRO C 3 192 ? 12.824 60.190 -20.553 1.00 46.80 ? 215 PRO A O     1 
ATOM   1882 C CB    . PRO C 3 192 ? 11.444 57.708 -22.267 1.00 45.81 ? 215 PRO A CB    1 
ATOM   1883 C CG    . PRO C 3 192 ? 10.880 56.323 -22.180 1.00 45.94 ? 215 PRO A CG    1 
ATOM   1884 C CD    . PRO C 3 192 ? 10.059 56.399 -20.927 1.00 44.75 ? 215 PRO A CD    1 
ATOM   1885 N N     . ASP C 3 193 ? 10.602 60.013 -20.259 1.00 46.77 ? 216 ASP A N     1 
ATOM   1886 C CA    . ASP C 3 193 ? 10.403 61.432 -19.990 1.00 47.58 ? 216 ASP A CA    1 
ATOM   1887 C C     . ASP C 3 193 ? 10.777 61.874 -18.578 1.00 46.58 ? 216 ASP A C     1 
ATOM   1888 O O     . ASP C 3 193 ? 10.801 63.070 -18.284 1.00 46.94 ? 216 ASP A O     1 
ATOM   1889 C CB    . ASP C 3 193 ? 8.946  61.811 -20.269 1.00 49.79 ? 216 ASP A CB    1 
ATOM   1890 C CG    . ASP C 3 193 ? 8.545  61.569 -21.712 1.00 52.16 ? 216 ASP A CG    1 
ATOM   1891 O OD1   . ASP C 3 193 ? 7.364  61.806 -22.047 1.00 54.44 ? 216 ASP A OD1   1 
ATOM   1892 O OD2   . ASP C 3 193 ? 9.407  61.143 -22.512 1.00 52.31 ? 216 ASP A OD2   1 
ATOM   1893 N N     . LEU C 3 194 ? 11.064 60.918 -17.702 1.00 44.41 ? 217 LEU A N     1 
ATOM   1894 C CA    . LEU C 3 194 ? 11.428 61.253 -16.331 1.00 42.13 ? 217 LEU A CA    1 
ATOM   1895 C C     . LEU C 3 194 ? 12.934 61.350 -16.122 1.00 40.28 ? 217 LEU A C     1 
ATOM   1896 O O     . LEU C 3 194 ? 13.715 60.660 -16.778 1.00 38.89 ? 217 LEU A O     1 
ATOM   1897 C CB    . LEU C 3 194 ? 10.847 60.222 -15.359 1.00 42.53 ? 217 LEU A CB    1 
ATOM   1898 C CG    . LEU C 3 194 ? 9.328  60.220 -15.177 1.00 43.35 ? 217 LEU A CG    1 
ATOM   1899 C CD1   . LEU C 3 194 ? 8.929  59.123 -14.197 1.00 43.09 ? 217 LEU A CD1   1 
ATOM   1900 C CD2   . LEU C 3 194 ? 8.873  61.582 -14.666 1.00 43.93 ? 217 LEU A CD2   1 
ATOM   1901 N N     . ILE C 3 195 ? 13.327 62.227 -15.206 1.00 37.48 ? 218 ILE A N     1 
ATOM   1902 C CA    . ILE C 3 195 ? 14.727 62.416 -14.864 1.00 34.75 ? 218 ILE A CA    1 
ATOM   1903 C C     . ILE C 3 195 ? 14.922 61.813 -13.480 1.00 32.47 ? 218 ILE A C     1 
ATOM   1904 O O     . ILE C 3 195 ? 14.232 62.188 -12.536 1.00 32.34 ? 218 ILE A O     1 
ATOM   1905 C CB    . ILE C 3 195 ? 15.100 63.914 -14.814 1.00 35.06 ? 218 ILE A CB    1 
ATOM   1906 C CG1   . ILE C 3 195 ? 15.082 64.506 -16.226 1.00 35.47 ? 218 ILE A CG1   1 
ATOM   1907 C CG2   . ILE C 3 195 ? 16.470 64.093 -14.167 1.00 34.19 ? 218 ILE A CG2   1 
ATOM   1908 C CD1   . ILE C 3 195 ? 16.204 64.021 -17.124 1.00 36.63 ? 218 ILE A CD1   1 
ATOM   1909 N N     . LEU C 3 196 ? 15.846 60.867 -13.364 1.00 30.51 ? 219 LEU A N     1 
ATOM   1910 C CA    . LEU C 3 196 ? 16.112 60.234 -12.078 1.00 28.69 ? 219 LEU A CA    1 
ATOM   1911 C C     . LEU C 3 196 ? 17.585 60.351 -11.731 1.00 27.58 ? 219 LEU A C     1 
ATOM   1912 O O     . LEU C 3 196 ? 18.445 59.861 -12.458 1.00 25.44 ? 219 LEU A O     1 
ATOM   1913 C CB    . LEU C 3 196 ? 15.713 58.758 -12.109 1.00 29.07 ? 219 LEU A CB    1 
ATOM   1914 C CG    . LEU C 3 196 ? 16.038 57.956 -10.842 1.00 29.45 ? 219 LEU A CG    1 
ATOM   1915 C CD1   . LEU C 3 196 ? 15.293 58.533 -9.647  1.00 27.24 ? 219 LEU A CD1   1 
ATOM   1916 C CD2   . LEU C 3 196 ? 15.656 56.502 -11.058 1.00 28.85 ? 219 LEU A CD2   1 
ATOM   1917 N N     . LEU C 3 197 ? 17.869 61.018 -10.620 1.00 24.88 ? 220 LEU A N     1 
ATOM   1918 C CA    . LEU C 3 197 ? 19.242 61.185 -10.165 1.00 26.71 ? 220 LEU A CA    1 
ATOM   1919 C C     . LEU C 3 197 ? 19.435 60.308 -8.939  1.00 23.81 ? 220 LEU A C     1 
ATOM   1920 O O     . LEU C 3 197 ? 18.593 60.296 -8.044  1.00 24.23 ? 220 LEU A O     1 
ATOM   1921 C CB    . LEU C 3 197 ? 19.511 62.650 -9.811  1.00 28.58 ? 220 LEU A CB    1 
ATOM   1922 C CG    . LEU C 3 197 ? 20.137 63.562 -10.878 1.00 31.73 ? 220 LEU A CG    1 
ATOM   1923 C CD1   . LEU C 3 197 ? 19.518 63.312 -12.239 1.00 31.05 ? 220 LEU A CD1   1 
ATOM   1924 C CD2   . LEU C 3 197 ? 19.967 65.018 -10.455 1.00 31.43 ? 220 LEU A CD2   1 
ATOM   1925 N N     . GLN C 3 198 ? 20.534 59.562 -8.910  1.00 22.01 ? 221 GLN A N     1 
ATOM   1926 C CA    . GLN C 3 198 ? 20.823 58.687 -7.778  1.00 20.27 ? 221 GLN A CA    1 
ATOM   1927 C C     . GLN C 3 198 ? 22.174 59.018 -7.176  1.00 19.14 ? 221 GLN A C     1 
ATOM   1928 O O     . GLN C 3 198 ? 23.175 59.100 -7.887  1.00 19.49 ? 221 GLN A O     1 
ATOM   1929 C CB    . GLN C 3 198 ? 20.869 57.214 -8.205  1.00 21.41 ? 221 GLN A CB    1 
ATOM   1930 C CG    . GLN C 3 198 ? 19.626 56.659 -8.851  1.00 23.60 ? 221 GLN A CG    1 
ATOM   1931 C CD    . GLN C 3 198 ? 19.829 55.220 -9.312  1.00 24.66 ? 221 GLN A CD    1 
ATOM   1932 O OE1   . GLN C 3 198 ? 19.374 54.828 -10.389 1.00 24.62 ? 221 GLN A OE1   1 
ATOM   1933 N NE2   . GLN C 3 198 ? 20.513 54.425 -8.489  1.00 21.88 ? 221 GLN A NE2   1 
ATOM   1934 N N     . TYR C 3 199 ? 22.197 59.211 -5.864  1.00 18.68 ? 222 TYR A N     1 
ATOM   1935 C CA    . TYR C 3 199 ? 23.436 59.476 -5.150  1.00 19.61 ? 222 TYR A CA    1 
ATOM   1936 C C     . TYR C 3 199 ? 23.357 58.539 -3.956  1.00 20.81 ? 222 TYR A C     1 
ATOM   1937 O O     . TYR C 3 199 ? 22.913 58.918 -2.868  1.00 17.72 ? 222 TYR A O     1 
ATOM   1938 C CB    . TYR C 3 199 ? 23.522 60.929 -4.684  1.00 21.18 ? 222 TYR A CB    1 
ATOM   1939 C CG    . TYR C 3 199 ? 24.847 61.254 -4.039  1.00 20.60 ? 222 TYR A CG    1 
ATOM   1940 C CD1   . TYR C 3 199 ? 26.010 61.370 -4.807  1.00 23.89 ? 222 TYR A CD1   1 
ATOM   1941 C CD2   . TYR C 3 199 ? 24.952 61.400 -2.657  1.00 24.00 ? 222 TYR A CD2   1 
ATOM   1942 C CE1   . TYR C 3 199 ? 27.247 61.618 -4.217  1.00 22.72 ? 222 TYR A CE1   1 
ATOM   1943 C CE2   . TYR C 3 199 ? 26.190 61.652 -2.052  1.00 24.31 ? 222 TYR A CE2   1 
ATOM   1944 C CZ    . TYR C 3 199 ? 27.329 61.757 -2.837  1.00 26.43 ? 222 TYR A CZ    1 
ATOM   1945 O OH    . TYR C 3 199 ? 28.546 61.994 -2.240  1.00 28.71 ? 222 TYR A OH    1 
ATOM   1946 N N     . VAL C 3 200 ? 23.786 57.300 -4.186  1.00 20.44 ? 223 VAL A N     1 
ATOM   1947 C CA    . VAL C 3 200 ? 23.747 56.251 -3.174  1.00 20.13 ? 223 VAL A CA    1 
ATOM   1948 C C     . VAL C 3 200 ? 22.298 56.050 -2.722  1.00 20.40 ? 223 VAL A C     1 
ATOM   1949 O O     . VAL C 3 200 ? 21.502 55.476 -3.465  1.00 21.81 ? 223 VAL A O     1 
ATOM   1950 C CB    . VAL C 3 200 ? 24.655 56.573 -1.962  1.00 21.19 ? 223 VAL A CB    1 
ATOM   1951 C CG1   . VAL C 3 200 ? 24.760 55.333 -1.047  1.00 20.16 ? 223 VAL A CG1   1 
ATOM   1952 C CG2   . VAL C 3 200 ? 26.046 56.973 -2.444  1.00 19.18 ? 223 VAL A CG2   1 
ATOM   1953 N N     . ASP C 3 201 ? 21.943 56.534 -1.532  1.00 22.50 ? 224 ASP A N     1 
ATOM   1954 C CA    . ASP C 3 201 ? 20.577 56.366 -1.030  1.00 23.75 ? 224 ASP A CA    1 
ATOM   1955 C C     . ASP C 3 201 ? 19.669 57.592 -1.169  1.00 24.92 ? 224 ASP A C     1 
ATOM   1956 O O     . ASP C 3 201 ? 18.544 57.593 -0.658  1.00 25.74 ? 224 ASP A O     1 
ATOM   1957 C CB    . ASP C 3 201 ? 20.605 55.916 0.438   1.00 23.37 ? 224 ASP A CB    1 
ATOM   1958 C CG    . ASP C 3 201 ? 21.373 56.866 1.328   1.00 25.10 ? 224 ASP A CG    1 
ATOM   1959 O OD1   . ASP C 3 201 ? 21.799 57.929 0.838   1.00 23.53 ? 224 ASP A OD1   1 
ATOM   1960 O OD2   . ASP C 3 201 ? 21.549 56.553 2.523   1.00 27.86 ? 224 ASP A OD2   1 
ATOM   1961 N N     . ASP C 3 202 ? 20.149 58.624 -1.857  1.00 23.87 ? 225 ASP A N     1 
ATOM   1962 C CA    . ASP C 3 202 ? 19.368 59.846 -2.052  1.00 24.98 ? 225 ASP A CA    1 
ATOM   1963 C C     . ASP C 3 202 ? 18.904 59.955 -3.498  1.00 24.42 ? 225 ASP A C     1 
ATOM   1964 O O     . ASP C 3 202 ? 19.713 60.094 -4.419  1.00 24.05 ? 225 ASP A O     1 
ATOM   1965 C CB    . ASP C 3 202 ? 20.200 61.061 -1.663  1.00 25.69 ? 225 ASP A CB    1 
ATOM   1966 C CG    . ASP C 3 202 ? 20.612 61.030 -0.210  1.00 28.00 ? 225 ASP A CG    1 
ATOM   1967 O OD1   . ASP C 3 202 ? 19.719 60.930 0.658   1.00 30.11 ? 225 ASP A OD1   1 
ATOM   1968 O OD2   . ASP C 3 202 ? 21.824 61.102 0.067   1.00 31.83 ? 225 ASP A OD2   1 
ATOM   1969 N N     . LEU C 3 203 ? 17.590 59.900 -3.688  1.00 24.11 ? 226 LEU A N     1 
ATOM   1970 C CA    . LEU C 3 203 ? 17.009 59.940 -5.024  1.00 22.38 ? 226 LEU A CA    1 
ATOM   1971 C C     . LEU C 3 203 ? 16.236 61.214 -5.349  1.00 25.34 ? 226 LEU A C     1 
ATOM   1972 O O     . LEU C 3 203 ? 15.526 61.752 -4.504  1.00 23.01 ? 226 LEU A O     1 
ATOM   1973 C CB    . LEU C 3 203 ? 16.073 58.747 -5.200  1.00 24.12 ? 226 LEU A CB    1 
ATOM   1974 C CG    . LEU C 3 203 ? 16.582 57.401 -4.685  1.00 24.55 ? 226 LEU A CG    1 
ATOM   1975 C CD1   . LEU C 3 203 ? 15.513 56.332 -4.900  1.00 24.95 ? 226 LEU A CD1   1 
ATOM   1976 C CD2   . LEU C 3 203 ? 17.875 57.034 -5.404  1.00 26.96 ? 226 LEU A CD2   1 
ATOM   1977 N N     . LEU C 3 204 ? 16.383 61.679 -6.583  1.00 25.68 ? 227 LEU A N     1 
ATOM   1978 C CA    . LEU C 3 204 ? 15.675 62.867 -7.056  1.00 28.21 ? 227 LEU A CA    1 
ATOM   1979 C C     . LEU C 3 204 ? 14.962 62.506 -8.350  1.00 29.08 ? 227 LEU A C     1 
ATOM   1980 O O     . LEU C 3 204 ? 15.594 62.098 -9.324  1.00 28.75 ? 227 LEU A O     1 
ATOM   1981 C CB    . LEU C 3 204 ? 16.645 64.024 -7.322  1.00 28.12 ? 227 LEU A CB    1 
ATOM   1982 C CG    . LEU C 3 204 ? 16.005 65.268 -7.966  1.00 33.03 ? 227 LEU A CG    1 
ATOM   1983 C CD1   . LEU C 3 204 ? 15.037 65.898 -6.989  1.00 31.97 ? 227 LEU A CD1   1 
ATOM   1984 C CD2   . LEU C 3 204 ? 17.078 66.278 -8.371  1.00 34.12 ? 227 LEU A CD2   1 
ATOM   1985 N N     . LEU C 3 205 ? 13.641 62.642 -8.352  1.00 29.26 ? 228 LEU A N     1 
ATOM   1986 C CA    . LEU C 3 205 ? 12.859 62.356 -9.543  1.00 32.71 ? 228 LEU A CA    1 
ATOM   1987 C C     . LEU C 3 205 ? 12.376 63.710 -10.064 1.00 34.82 ? 228 LEU A C     1 
ATOM   1988 O O     . LEU C 3 205 ? 11.912 64.546 -9.288  1.00 33.14 ? 228 LEU A O     1 
ATOM   1989 C CB    . LEU C 3 205 ? 11.669 61.458 -9.194  1.00 32.67 ? 228 LEU A CB    1 
ATOM   1990 C CG    . LEU C 3 205 ? 10.852 60.909 -10.366 1.00 33.49 ? 228 LEU A CG    1 
ATOM   1991 C CD1   . LEU C 3 205 ? 11.706 59.954 -11.189 1.00 35.25 ? 228 LEU A CD1   1 
ATOM   1992 C CD2   . LEU C 3 205 ? 9.621  60.196 -9.838  1.00 35.42 ? 228 LEU A CD2   1 
ATOM   1993 N N     . ALA C 3 206 ? 12.510 63.936 -11.368 1.00 36.35 ? 229 ALA A N     1 
ATOM   1994 C CA    . ALA C 3 206 ? 12.088 65.199 -11.963 1.00 38.93 ? 229 ALA A CA    1 
ATOM   1995 C C     . ALA C 3 206 ? 11.168 64.969 -13.150 1.00 40.69 ? 229 ALA A C     1 
ATOM   1996 O O     . ALA C 3 206 ? 11.448 64.138 -14.015 1.00 41.49 ? 229 ALA A O     1 
ATOM   1997 C CB    . ALA C 3 206 ? 13.305 66.007 -12.392 1.00 38.40 ? 229 ALA A CB    1 
ATOM   1998 N N     . ALA C 3 207 ? 10.067 65.715 -13.185 1.00 43.24 ? 230 ALA A N     1 
ATOM   1999 C CA    . ALA C 3 207 ? 9.092  65.603 -14.261 1.00 44.95 ? 230 ALA A CA    1 
ATOM   2000 C C     . ALA C 3 207 ? 8.752  66.979 -14.830 1.00 46.81 ? 230 ALA A C     1 
ATOM   2001 O O     . ALA C 3 207 ? 9.045  68.007 -14.218 1.00 46.55 ? 230 ALA A O     1 
ATOM   2002 C CB    . ALA C 3 207 ? 7.832  64.921 -13.747 1.00 44.94 ? 230 ALA A CB    1 
ATOM   2003 N N     . THR C 3 208 ? 8.129  66.987 -16.004 1.00 48.68 ? 231 THR A N     1 
ATOM   2004 C CA    . THR C 3 208 ? 7.750  68.230 -16.667 1.00 50.96 ? 231 THR A CA    1 
ATOM   2005 C C     . THR C 3 208 ? 6.535  68.890 -16.021 1.00 51.54 ? 231 THR A C     1 
ATOM   2006 O O     . THR C 3 208 ? 6.444  70.118 -15.970 1.00 52.19 ? 231 THR A O     1 
ATOM   2007 C CB    . THR C 3 208 ? 7.442  67.984 -18.160 1.00 51.76 ? 231 THR A CB    1 
ATOM   2008 O OG1   . THR C 3 208 ? 8.628  67.529 -18.823 1.00 54.18 ? 231 THR A OG1   1 
ATOM   2009 C CG2   . THR C 3 208 ? 6.956  69.263 -18.826 1.00 53.80 ? 231 THR A CG2   1 
ATOM   2010 N N     . SER C 3 209 ? 5.605  68.077 -15.528 1.00 51.75 ? 232 SER A N     1 
ATOM   2011 C CA    . SER C 3 209 ? 4.396  68.596 -14.896 1.00 52.50 ? 232 SER A CA    1 
ATOM   2012 C C     . SER C 3 209 ? 4.127  67.939 -13.547 1.00 53.01 ? 232 SER A C     1 
ATOM   2013 O O     . SER C 3 209 ? 4.812  66.994 -13.156 1.00 53.43 ? 232 SER A O     1 
ATOM   2014 C CB    . SER C 3 209 ? 3.190  68.379 -15.813 1.00 52.48 ? 232 SER A CB    1 
ATOM   2015 O OG    . SER C 3 209 ? 2.972  66.998 -16.046 1.00 52.54 ? 232 SER A OG    1 
ATOM   2016 N N     . GLU C 3 210 ? 3.121  68.448 -12.842 1.00 53.20 ? 233 GLU A N     1 
ATOM   2017 C CA    . GLU C 3 210 ? 2.749  67.917 -11.538 1.00 53.86 ? 233 GLU A CA    1 
ATOM   2018 C C     . GLU C 3 210 ? 2.134  66.532 -11.687 1.00 53.92 ? 233 GLU A C     1 
ATOM   2019 O O     . GLU C 3 210 ? 2.290  65.672 -10.817 1.00 52.76 ? 233 GLU A O     1 
ATOM   2020 C CB    . GLU C 3 210 ? 1.752  68.854 -10.851 1.00 54.64 ? 233 GLU A CB    1 
ATOM   2021 C CG    . GLU C 3 210 ? 1.270  68.363 -9.494  1.00 56.51 ? 233 GLU A CG    1 
ATOM   2022 C CD    . GLU C 3 210 ? 0.398  69.379 -8.780  1.00 57.54 ? 233 GLU A CD    1 
ATOM   2023 O OE1   . GLU C 3 210 ? -0.611 69.816 -9.373  1.00 58.65 ? 233 GLU A OE1   1 
ATOM   2024 O OE2   . GLU C 3 210 ? 0.722  69.738 -7.627  1.00 57.18 ? 233 GLU A OE2   1 
ATOM   2025 N N     . LEU C 3 211 ? 1.433  66.321 -12.797 1.00 53.90 ? 234 LEU A N     1 
ATOM   2026 C CA    . LEU C 3 211 ? 0.795  65.040 -13.065 1.00 53.89 ? 234 LEU A CA    1 
ATOM   2027 C C     . LEU C 3 211 ? 1.843  63.960 -13.315 1.00 53.51 ? 234 LEU A C     1 
ATOM   2028 O O     . LEU C 3 211 ? 1.797  62.889 -12.712 1.00 53.49 ? 234 LEU A O     1 
ATOM   2029 C CB    . LEU C 3 211 ? -0.130 65.151 -14.280 1.00 54.28 ? 234 LEU A CB    1 
ATOM   2030 C CG    . LEU C 3 211 ? -0.867 63.872 -14.693 1.00 54.82 ? 234 LEU A CG    1 
ATOM   2031 C CD1   . LEU C 3 211 ? -1.732 63.376 -13.543 1.00 54.37 ? 234 LEU A CD1   1 
ATOM   2032 C CD2   . LEU C 3 211 ? -1.717 64.148 -15.923 1.00 55.55 ? 234 LEU A CD2   1 
ATOM   2033 N N     . ASP C 3 212 ? 2.782  64.242 -14.212 1.00 52.99 ? 235 ASP A N     1 
ATOM   2034 C CA    . ASP C 3 212 ? 3.833  63.283 -14.526 1.00 52.40 ? 235 ASP A CA    1 
ATOM   2035 C C     . ASP C 3 212 ? 4.677  62.983 -13.295 1.00 51.42 ? 235 ASP A C     1 
ATOM   2036 O O     . ASP C 3 212 ? 5.245  61.900 -13.174 1.00 51.62 ? 235 ASP A O     1 
ATOM   2037 C CB    . ASP C 3 212 ? 4.728  63.817 -15.645 1.00 53.25 ? 235 ASP A CB    1 
ATOM   2038 C CG    . ASP C 3 212 ? 4.016  63.878 -16.981 1.00 53.93 ? 235 ASP A CG    1 
ATOM   2039 O OD1   . ASP C 3 212 ? 4.656  64.261 -17.982 1.00 55.25 ? 235 ASP A OD1   1 
ATOM   2040 O OD2   . ASP C 3 212 ? 2.815  63.542 -17.031 1.00 54.29 ? 235 ASP A OD2   1 
ATOM   2041 N N     . CYS C 3 213 ? 4.753  63.944 -12.381 1.00 50.34 ? 236 CYS A N     1 
ATOM   2042 C CA    . CYS C 3 213 ? 5.532  63.763 -11.163 1.00 49.81 ? 236 CYS A CA    1 
ATOM   2043 C C     . CYS C 3 213 ? 4.788  62.840 -10.205 1.00 49.66 ? 236 CYS A C     1 
ATOM   2044 O O     . CYS C 3 213 ? 5.391  61.963 -9.586  1.00 48.89 ? 236 CYS A O     1 
ATOM   2045 C CB    . CYS C 3 213 ? 5.801  65.112 -10.491 1.00 49.56 ? 236 CYS A CB    1 
ATOM   2046 S SG    . CYS C 3 213 ? 7.024  65.045 -9.150  1.00 48.22 ? 236 CYS A SG    1 
ATOM   2047 N N     . GLN C 3 214 ? 3.478  63.032 -10.084 1.00 49.33 ? 237 GLN A N     1 
ATOM   2048 C CA    . GLN C 3 214 ? 2.691  62.185 -9.199  1.00 49.68 ? 237 GLN A CA    1 
ATOM   2049 C C     . GLN C 3 214 ? 2.627  60.785 -9.794  1.00 48.88 ? 237 GLN A C     1 
ATOM   2050 O O     . GLN C 3 214 ? 2.703  59.793 -9.071  1.00 49.36 ? 237 GLN A O     1 
ATOM   2051 C CB    . GLN C 3 214 ? 1.274  62.745 -9.008  1.00 50.71 ? 237 GLN A CB    1 
ATOM   2052 C CG    . GLN C 3 214 ? 0.413  62.760 -10.258 1.00 53.37 ? 237 GLN A CG    1 
ATOM   2053 C CD    . GLN C 3 214 ? -1.011 63.211 -9.978  1.00 54.77 ? 237 GLN A CD    1 
ATOM   2054 O OE1   . GLN C 3 214 ? -1.237 64.287 -9.423  1.00 56.02 ? 237 GLN A OE1   1 
ATOM   2055 N NE2   . GLN C 3 214 ? -1.979 62.388 -10.366 1.00 55.41 ? 237 GLN A NE2   1 
ATOM   2056 N N     . GLN C 3 215 ? 2.494  60.705 -11.116 1.00 47.46 ? 238 GLN A N     1 
ATOM   2057 C CA    . GLN C 3 215 ? 2.441  59.411 -11.787 1.00 46.82 ? 238 GLN A CA    1 
ATOM   2058 C C     . GLN C 3 215 ? 3.796  58.729 -11.635 1.00 44.65 ? 238 GLN A C     1 
ATOM   2059 O O     . GLN C 3 215 ? 3.877  57.547 -11.311 1.00 44.13 ? 238 GLN A O     1 
ATOM   2060 C CB    . GLN C 3 215 ? 2.136  59.574 -13.279 1.00 48.10 ? 238 GLN A CB    1 
ATOM   2061 C CG    . GLN C 3 215 ? 0.773  60.158 -13.612 1.00 51.19 ? 238 GLN A CG    1 
ATOM   2062 C CD    . GLN C 3 215 ? 0.524  60.205 -15.112 1.00 53.84 ? 238 GLN A CD    1 
ATOM   2063 O OE1   . GLN C 3 215 ? 1.315  60.774 -15.868 1.00 54.05 ? 238 GLN A OE1   1 
ATOM   2064 N NE2   . GLN C 3 215 ? -0.578 59.604 -15.550 1.00 54.69 ? 238 GLN A NE2   1 
ATOM   2065 N N     . GLY C 3 216 ? 4.858  59.490 -11.879 1.00 42.80 ? 239 GLY A N     1 
ATOM   2066 C CA    . GLY C 3 216 ? 6.201  58.953 -11.768 1.00 41.16 ? 239 GLY A CA    1 
ATOM   2067 C C     . GLY C 3 216 ? 6.535  58.512 -10.357 1.00 39.72 ? 239 GLY A C     1 
ATOM   2068 O O     . GLY C 3 216 ? 7.082  57.429 -10.154 1.00 39.50 ? 239 GLY A O     1 
ATOM   2069 N N     . THR C 3 217 ? 6.206  59.351 -9.380  1.00 38.37 ? 240 THR A N     1 
ATOM   2070 C CA    . THR C 3 217 ? 6.474  59.033 -7.984  1.00 38.26 ? 240 THR A CA    1 
ATOM   2071 C C     . THR C 3 217 ? 5.747  57.749 -7.590  1.00 38.88 ? 240 THR A C     1 
ATOM   2072 O O     . THR C 3 217 ? 6.326  56.873 -6.943  1.00 36.33 ? 240 THR A O     1 
ATOM   2073 C CB    . THR C 3 217 ? 6.026  60.184 -7.056  1.00 36.36 ? 240 THR A CB    1 
ATOM   2074 O OG1   . THR C 3 217 ? 6.742  61.376 -7.397  1.00 37.72 ? 240 THR A OG1   1 
ATOM   2075 C CG2   . THR C 3 217 ? 6.302  59.842 -5.602  1.00 37.27 ? 240 THR A CG2   1 
ATOM   2076 N N     . ARG C 3 218 ? 4.479  57.637 -7.981  1.00 38.69 ? 241 ARG A N     1 
ATOM   2077 C CA    . ARG C 3 218 ? 3.706  56.441 -7.664  1.00 38.99 ? 241 ARG A CA    1 
ATOM   2078 C C     . ARG C 3 218 ? 4.423  55.199 -8.190  1.00 36.96 ? 241 ARG A C     1 
ATOM   2079 O O     . ARG C 3 218 ? 4.570  54.211 -7.474  1.00 37.21 ? 241 ARG A O     1 
ATOM   2080 C CB    . ARG C 3 218 ? 2.305  56.503 -8.288  1.00 42.42 ? 241 ARG A CB    1 
ATOM   2081 C CG    . ARG C 3 218 ? 1.375  57.558 -7.706  1.00 46.70 ? 241 ARG A CG    1 
ATOM   2082 C CD    . ARG C 3 218 ? -0.060 57.304 -8.160  1.00 50.64 ? 241 ARG A CD    1 
ATOM   2083 N NE    . ARG C 3 218 ? -0.986 58.360 -7.750  1.00 54.73 ? 241 ARG A NE    1 
ATOM   2084 C CZ    . ARG C 3 218 ? -1.059 59.556 -8.326  1.00 56.47 ? 241 ARG A CZ    1 
ATOM   2085 N NH1   . ARG C 3 218 ? -0.261 59.855 -9.343  1.00 57.65 ? 241 ARG A NH1   1 
ATOM   2086 N NH2   . ARG C 3 218 ? -1.934 60.454 -7.890  1.00 57.47 ? 241 ARG A NH2   1 
ATOM   2087 N N     . ALA C 3 219 ? 4.865  55.258 -9.442  1.00 35.50 ? 242 ALA A N     1 
ATOM   2088 C CA    . ALA C 3 219 ? 5.559  54.134 -10.067 1.00 34.37 ? 242 ALA A CA    1 
ATOM   2089 C C     . ALA C 3 219 ? 6.918  53.849 -9.431  1.00 32.81 ? 242 ALA A C     1 
ATOM   2090 O O     . ALA C 3 219 ? 7.307  52.692 -9.284  1.00 32.08 ? 242 ALA A O     1 
ATOM   2091 C CB    . ALA C 3 219 ? 5.731  54.391 -11.554 1.00 35.77 ? 242 ALA A CB    1 
ATOM   2092 N N     . LEU C 3 220 ? 7.645  54.897 -9.062  1.00 30.97 ? 243 LEU A N     1 
ATOM   2093 C CA    . LEU C 3 220 ? 8.953  54.700 -8.444  1.00 30.45 ? 243 LEU A CA    1 
ATOM   2094 C C     . LEU C 3 220 ? 8.783  54.046 -7.078  1.00 31.04 ? 243 LEU A C     1 
ATOM   2095 O O     . LEU C 3 220 ? 9.493  53.097 -6.738  1.00 28.76 ? 243 LEU A O     1 
ATOM   2096 C CB    . LEU C 3 220 ? 9.691  56.033 -8.302  1.00 29.32 ? 243 LEU A CB    1 
ATOM   2097 C CG    . LEU C 3 220 ? 11.061 55.953 -7.613  1.00 28.82 ? 243 LEU A CG    1 
ATOM   2098 C CD1   . LEU C 3 220 ? 11.982 54.997 -8.379  1.00 25.27 ? 243 LEU A CD1   1 
ATOM   2099 C CD2   . LEU C 3 220 ? 11.672 57.335 -7.536  1.00 28.28 ? 243 LEU A CD2   1 
ATOM   2100 N N     . LEU C 3 221 ? 7.838  54.557 -6.294  1.00 30.94 ? 244 LEU A N     1 
ATOM   2101 C CA    . LEU C 3 221 ? 7.576  54.004 -4.975  1.00 31.79 ? 244 LEU A CA    1 
ATOM   2102 C C     . LEU C 3 221 ? 7.160  52.543 -5.103  1.00 30.65 ? 244 LEU A C     1 
ATOM   2103 O O     . LEU C 3 221 ? 7.616  51.692 -4.342  1.00 31.80 ? 244 LEU A O     1 
ATOM   2104 C CB    . LEU C 3 221 ? 6.478  54.805 -4.264  1.00 31.80 ? 244 LEU A CB    1 
ATOM   2105 C CG    . LEU C 3 221 ? 6.882  56.166 -3.691  1.00 32.79 ? 244 LEU A CG    1 
ATOM   2106 C CD1   . LEU C 3 221 ? 5.651  56.915 -3.202  1.00 33.30 ? 244 LEU A CD1   1 
ATOM   2107 C CD2   . LEU C 3 221 ? 7.863  55.959 -2.550  1.00 32.49 ? 244 LEU A CD2   1 
ATOM   2108 N N     . GLN C 3 222 ? 6.304  52.246 -6.076  1.00 31.50 ? 245 GLN A N     1 
ATOM   2109 C CA    . GLN C 3 222 ? 5.857  50.873 -6.267  1.00 31.26 ? 245 GLN A CA    1 
ATOM   2110 C C     . GLN C 3 222 ? 7.036  49.982 -6.646  1.00 30.21 ? 245 GLN A C     1 
ATOM   2111 O O     . GLN C 3 222 ? 7.158  48.863 -6.156  1.00 29.24 ? 245 GLN A O     1 
ATOM   2112 C CB    . GLN C 3 222 ? 4.792  50.794 -7.363  1.00 34.55 ? 245 GLN A CB    1 
ATOM   2113 C CG    . GLN C 3 222 ? 4.235  49.392 -7.563  1.00 38.99 ? 245 GLN A CG    1 
ATOM   2114 C CD    . GLN C 3 222 ? 3.402  48.923 -6.382  1.00 43.15 ? 245 GLN A CD    1 
ATOM   2115 O OE1   . GLN C 3 222 ? 3.173  47.725 -6.204  1.00 44.77 ? 245 GLN A OE1   1 
ATOM   2116 N NE2   . GLN C 3 222 ? 2.934  49.870 -5.573  1.00 44.55 ? 245 GLN A NE2   1 
ATOM   2117 N N     . THR C 3 223 ? 7.901  50.489 -7.518  1.00 28.71 ? 246 THR A N     1 
ATOM   2118 C CA    . THR C 3 223 ? 9.063  49.732 -7.967  1.00 27.45 ? 246 THR A CA    1 
ATOM   2119 C C     . THR C 3 223 ? 10.064 49.485 -6.834  1.00 26.82 ? 246 THR A C     1 
ATOM   2120 O O     . THR C 3 223 ? 10.541 48.364 -6.657  1.00 26.65 ? 246 THR A O     1 
ATOM   2121 C CB    . THR C 3 223 ? 9.772  50.458 -9.130  1.00 29.04 ? 246 THR A CB    1 
ATOM   2122 O OG1   . THR C 3 223 ? 8.861  50.600 -10.231 1.00 31.10 ? 246 THR A OG1   1 
ATOM   2123 C CG2   . THR C 3 223 ? 10.988 49.664 -9.592  1.00 28.58 ? 246 THR A CG2   1 
ATOM   2124 N N     . LEU C 3 224 ? 10.381 50.532 -6.077  1.00 25.21 ? 247 LEU A N     1 
ATOM   2125 C CA    . LEU C 3 224 ? 11.320 50.414 -4.961  1.00 24.83 ? 247 LEU A CA    1 
ATOM   2126 C C     . LEU C 3 224 ? 10.817 49.402 -3.938  1.00 26.16 ? 247 LEU A C     1 
ATOM   2127 O O     . LEU C 3 224 ? 11.562 48.519 -3.504  1.00 24.05 ? 247 LEU A O     1 
ATOM   2128 C CB    . LEU C 3 224 ? 11.520 51.778 -4.294  1.00 23.86 ? 247 LEU A CB    1 
ATOM   2129 C CG    . LEU C 3 224 ? 12.328 52.797 -5.101  1.00 23.86 ? 247 LEU A CG    1 
ATOM   2130 C CD1   . LEU C 3 224 ? 12.159 54.179 -4.486  1.00 25.39 ? 247 LEU A CD1   1 
ATOM   2131 C CD2   . LEU C 3 224 ? 13.811 52.382 -5.121  1.00 22.66 ? 247 LEU A CD2   1 
ATOM   2132 N N     . GLY C 3 225 ? 9.546  49.528 -3.565  1.00 26.40 ? 248 GLY A N     1 
ATOM   2133 C CA    . GLY C 3 225 ? 8.966  48.608 -2.602  1.00 26.78 ? 248 GLY A CA    1 
ATOM   2134 C C     . GLY C 3 225 ? 9.067  47.175 -3.081  1.00 27.43 ? 248 GLY A C     1 
ATOM   2135 O O     . GLY C 3 225 ? 9.483  46.286 -2.340  1.00 27.67 ? 248 GLY A O     1 
ATOM   2136 N N     . ASN C 3 226 ? 8.687  46.955 -4.335  1.00 27.53 ? 249 ASN A N     1 
ATOM   2137 C CA    . ASN C 3 226 ? 8.730  45.632 -4.941  1.00 27.75 ? 249 ASN A CA    1 
ATOM   2138 C C     . ASN C 3 226 ? 10.142 45.051 -4.989  1.00 27.47 ? 249 ASN A C     1 
ATOM   2139 O O     . ASN C 3 226 ? 10.328 43.837 -4.850  1.00 26.71 ? 249 ASN A O     1 
ATOM   2140 C CB    . ASN C 3 226 ? 8.146  45.697 -6.357  1.00 31.60 ? 249 ASN A CB    1 
ATOM   2141 C CG    . ASN C 3 226 ? 8.321  44.402 -7.122  1.00 36.50 ? 249 ASN A CG    1 
ATOM   2142 O OD1   . ASN C 3 226 ? 9.353  44.174 -7.755  1.00 39.19 ? 249 ASN A OD1   1 
ATOM   2143 N ND2   . ASN C 3 226 ? 7.316  43.537 -7.056  1.00 38.44 ? 249 ASN A ND2   1 
ATOM   2144 N N     . LEU C 3 227 ? 11.131 45.918 -5.188  1.00 25.00 ? 250 LEU A N     1 
ATOM   2145 C CA    . LEU C 3 227 ? 12.524 45.490 -5.258  1.00 22.16 ? 250 LEU A CA    1 
ATOM   2146 C C     . LEU C 3 227 ? 13.097 45.178 -3.881  1.00 21.82 ? 250 LEU A C     1 
ATOM   2147 O O     . LEU C 3 227 ? 14.103 44.486 -3.772  1.00 21.07 ? 250 LEU A O     1 
ATOM   2148 C CB    . LEU C 3 227 ? 13.381 46.570 -5.925  1.00 20.66 ? 250 LEU A CB    1 
ATOM   2149 C CG    . LEU C 3 227 ? 13.163 46.779 -7.424  1.00 24.12 ? 250 LEU A CG    1 
ATOM   2150 C CD1   . LEU C 3 227 ? 13.854 48.063 -7.863  1.00 24.53 ? 250 LEU A CD1   1 
ATOM   2151 C CD2   . LEU C 3 227 ? 13.703 45.579 -8.194  1.00 23.59 ? 250 LEU A CD2   1 
ATOM   2152 N N     . GLY C 3 228 ? 12.463 45.703 -2.835  1.00 21.97 ? 251 GLY A N     1 
ATOM   2153 C CA    . GLY C 3 228 ? 12.935 45.445 -1.484  1.00 21.87 ? 251 GLY A CA    1 
ATOM   2154 C C     . GLY C 3 228 ? 13.566 46.624 -0.769  1.00 22.28 ? 251 GLY A C     1 
ATOM   2155 O O     . GLY C 3 228 ? 14.108 46.470 0.328   1.00 21.99 ? 251 GLY A O     1 
ATOM   2156 N N     . TYR C 3 229 ? 13.507 47.801 -1.379  1.00 22.25 ? 252 TYR A N     1 
ATOM   2157 C CA    . TYR C 3 229 ? 14.079 48.995 -0.768  1.00 20.90 ? 252 TYR A CA    1 
ATOM   2158 C C     . TYR C 3 229 ? 12.981 49.721 0.006   1.00 23.01 ? 252 TYR A C     1 
ATOM   2159 O O     . TYR C 3 229 ? 11.797 49.466 -0.196  1.00 22.47 ? 252 TYR A O     1 
ATOM   2160 C CB    . TYR C 3 229 ? 14.665 49.907 -1.847  1.00 21.52 ? 252 TYR A CB    1 
ATOM   2161 C CG    . TYR C 3 229 ? 15.779 49.249 -2.633  1.00 20.64 ? 252 TYR A CG    1 
ATOM   2162 C CD1   . TYR C 3 229 ? 17.065 49.140 -2.102  1.00 20.84 ? 252 TYR A CD1   1 
ATOM   2163 C CD2   . TYR C 3 229 ? 15.541 48.703 -3.896  1.00 21.67 ? 252 TYR A CD2   1 
ATOM   2164 C CE1   . TYR C 3 229 ? 18.089 48.506 -2.811  1.00 19.33 ? 252 TYR A CE1   1 
ATOM   2165 C CE2   . TYR C 3 229 ? 16.560 48.063 -4.610  1.00 18.53 ? 252 TYR A CE2   1 
ATOM   2166 C CZ    . TYR C 3 229 ? 17.827 47.971 -4.063  1.00 20.44 ? 252 TYR A CZ    1 
ATOM   2167 O OH    . TYR C 3 229 ? 18.838 47.350 -4.765  1.00 18.68 ? 252 TYR A OH    1 
ATOM   2168 N N     . ARG C 3 230 ? 13.378 50.631 0.884   1.00 23.84 ? 253 ARG A N     1 
ATOM   2169 C CA    . ARG C 3 230 ? 12.410 51.361 1.695   1.00 25.83 ? 253 ARG A CA    1 
ATOM   2170 C C     . ARG C 3 230 ? 12.803 52.824 1.811   1.00 26.21 ? 253 ARG A C     1 
ATOM   2171 O O     . ARG C 3 230 ? 13.947 53.141 2.132   1.00 27.18 ? 253 ARG A O     1 
ATOM   2172 C CB    . ARG C 3 230 ? 12.341 50.730 3.084   1.00 27.53 ? 253 ARG A CB    1 
ATOM   2173 C CG    . ARG C 3 230 ? 11.983 49.252 3.074   1.00 28.92 ? 253 ARG A CG    1 
ATOM   2174 C CD    . ARG C 3 230 ? 10.499 49.052 2.793   1.00 28.05 ? 253 ARG A CD    1 
ATOM   2175 N NE    . ARG C 3 230 ? 10.107 47.650 2.890   1.00 29.79 ? 253 ARG A NE    1 
ATOM   2176 C CZ    . ARG C 3 230 ? 10.138 46.788 1.879   1.00 30.58 ? 253 ARG A CZ    1 
ATOM   2177 N NH1   . ARG C 3 230 ? 10.542 47.181 0.676   1.00 30.44 ? 253 ARG A NH1   1 
ATOM   2178 N NH2   . ARG C 3 230 ? 9.763  45.532 2.071   1.00 33.82 ? 253 ARG A NH2   1 
ATOM   2179 N N     . ALA C 3 231 ? 11.851 53.712 1.543   1.00 26.27 ? 254 ALA A N     1 
ATOM   2180 C CA    . ALA C 3 231 ? 12.100 55.142 1.619   1.00 26.67 ? 254 ALA A CA    1 
ATOM   2181 C C     . ALA C 3 231 ? 11.517 55.717 2.903   1.00 28.85 ? 254 ALA A C     1 
ATOM   2182 O O     . ALA C 3 231 ? 10.608 55.136 3.494   1.00 28.10 ? 254 ALA A O     1 
ATOM   2183 C CB    . ALA C 3 231 ? 11.487 55.841 0.413   1.00 25.72 ? 254 ALA A CB    1 
ATOM   2184 N N     . SER C 3 232 ? 12.048 56.857 3.330   1.00 30.66 ? 255 SER A N     1 
ATOM   2185 C CA    . SER C 3 232 ? 11.573 57.515 4.545   1.00 32.22 ? 255 SER A CA    1 
ATOM   2186 C C     . SER C 3 232 ? 10.350 58.371 4.251   1.00 32.38 ? 255 SER A C     1 
ATOM   2187 O O     . SER C 3 232 ? 10.447 59.389 3.567   1.00 32.86 ? 255 SER A O     1 
ATOM   2188 C CB    . SER C 3 232 ? 12.674 58.396 5.135   1.00 31.79 ? 255 SER A CB    1 
ATOM   2189 O OG    . SER C 3 232 ? 12.178 59.182 6.210   1.00 36.58 ? 255 SER A OG    1 
ATOM   2190 N N     . ALA C 3 233 ? 9.198  57.959 4.768   1.00 34.18 ? 256 ALA A N     1 
ATOM   2191 C CA    . ALA C 3 233 ? 7.969  58.714 4.552   1.00 35.90 ? 256 ALA A CA    1 
ATOM   2192 C C     . ALA C 3 233 ? 8.086  60.055 5.260   1.00 36.62 ? 256 ALA A C     1 
ATOM   2193 O O     . ALA C 3 233 ? 7.632  61.079 4.756   1.00 37.98 ? 256 ALA A O     1 
ATOM   2194 C CB    . ALA C 3 233 ? 6.770  57.937 5.087   1.00 34.29 ? 256 ALA A CB    1 
ATOM   2195 N N     . LYS C 3 234 ? 8.716  60.033 6.429   1.00 38.57 ? 257 LYS A N     1 
ATOM   2196 C CA    . LYS C 3 234 ? 8.911  61.231 7.235   1.00 41.53 ? 257 LYS A CA    1 
ATOM   2197 C C     . LYS C 3 234 ? 9.671  62.336 6.506   1.00 42.50 ? 257 LYS A C     1 
ATOM   2198 O O     . LYS C 3 234 ? 9.262  63.497 6.529   1.00 43.60 ? 257 LYS A O     1 
ATOM   2199 C CB    . LYS C 3 234 ? 9.653  60.865 8.526   1.00 43.17 ? 257 LYS A CB    1 
ATOM   2200 C CG    . LYS C 3 234 ? 10.081 62.053 9.378   1.00 45.35 ? 257 LYS A CG    1 
ATOM   2201 C CD    . LYS C 3 234 ? 8.891  62.907 9.789   1.00 47.31 ? 257 LYS A CD    1 
ATOM   2202 C CE    . LYS C 3 234 ? 9.319  64.041 10.708  1.00 48.73 ? 257 LYS A CE    1 
ATOM   2203 N NZ    . LYS C 3 234 ? 9.969  63.531 11.949  1.00 49.94 ? 257 LYS A NZ    1 
ATOM   2204 N N     . LYS C 3 235 ? 10.774 61.974 5.856   1.00 41.85 ? 258 LYS A N     1 
ATOM   2205 C CA    . LYS C 3 235 ? 11.600 62.946 5.152   1.00 42.05 ? 258 LYS A CA    1 
ATOM   2206 C C     . LYS C 3 235 ? 11.214 63.164 3.693   1.00 40.22 ? 258 LYS A C     1 
ATOM   2207 O O     . LYS C 3 235 ? 11.686 64.103 3.055   1.00 39.59 ? 258 LYS A O     1 
ATOM   2208 C CB    . LYS C 3 235 ? 13.071 62.523 5.226   1.00 42.78 ? 258 LYS A CB    1 
ATOM   2209 C CG    . LYS C 3 235 ? 13.602 62.354 6.643   1.00 45.92 ? 258 LYS A CG    1 
ATOM   2210 C CD    . LYS C 3 235 ? 15.091 62.032 6.641   1.00 48.96 ? 258 LYS A CD    1 
ATOM   2211 C CE    . LYS C 3 235 ? 15.641 61.923 8.056   1.00 50.18 ? 258 LYS A CE    1 
ATOM   2212 N NZ    . LYS C 3 235 ? 17.119 61.713 8.067   1.00 52.73 ? 258 LYS A NZ    1 
ATOM   2213 N N     . ALA C 3 236 ? 10.352 62.301 3.170   1.00 40.01 ? 259 ALA A N     1 
ATOM   2214 C CA    . ALA C 3 236 ? 9.928  62.390 1.779   1.00 39.99 ? 259 ALA A CA    1 
ATOM   2215 C C     . ALA C 3 236 ? 9.377  63.752 1.367   1.00 41.52 ? 259 ALA A C     1 
ATOM   2216 O O     . ALA C 3 236 ? 8.597  64.371 2.094   1.00 41.32 ? 259 ALA A O     1 
ATOM   2217 C CB    . ALA C 3 236 ? 8.899  61.307 1.486   1.00 40.18 ? 259 ALA A CB    1 
ATOM   2218 N N     . GLN C 3 237 ? 9.801  64.211 0.193   1.00 40.87 ? 260 GLN A N     1 
ATOM   2219 C CA    . GLN C 3 237 ? 9.349  65.478 -0.372  1.00 41.27 ? 260 GLN A CA    1 
ATOM   2220 C C     . GLN C 3 237 ? 8.710  65.096 -1.701  1.00 42.63 ? 260 GLN A C     1 
ATOM   2221 O O     . GLN C 3 237 ? 9.399  64.952 -2.711  1.00 41.56 ? 260 GLN A O     1 
ATOM   2222 C CB    . GLN C 3 237 ? 10.533 66.416 -0.609  1.00 40.44 ? 260 GLN A CB    1 
ATOM   2223 C CG    . GLN C 3 237 ? 11.317 66.751 0.647   1.00 39.42 ? 260 GLN A CG    1 
ATOM   2224 C CD    . GLN C 3 237 ? 12.599 67.507 0.353   1.00 39.91 ? 260 GLN A CD    1 
ATOM   2225 O OE1   . GLN C 3 237 ? 12.576 68.676 -0.042  1.00 36.19 ? 260 GLN A OE1   1 
ATOM   2226 N NE2   . GLN C 3 237 ? 13.732 66.834 0.538   1.00 39.66 ? 260 GLN A NE2   1 
ATOM   2227 N N     . ILE C 3 238 ? 7.393  64.927 -1.696  1.00 43.45 ? 261 ILE A N     1 
ATOM   2228 C CA    . ILE C 3 238 ? 6.682  64.516 -2.899  1.00 44.90 ? 261 ILE A CA    1 
ATOM   2229 C C     . ILE C 3 238 ? 6.114  65.650 -3.745  1.00 46.90 ? 261 ILE A C     1 
ATOM   2230 O O     . ILE C 3 238 ? 5.508  66.591 -3.227  1.00 47.02 ? 261 ILE A O     1 
ATOM   2231 C CB    . ILE C 3 238 ? 5.548  63.538 -2.541  1.00 44.50 ? 261 ILE A CB    1 
ATOM   2232 C CG1   . ILE C 3 238 ? 6.126  62.356 -1.756  1.00 45.21 ? 261 ILE A CG1   1 
ATOM   2233 C CG2   . ILE C 3 238 ? 4.856  63.050 -3.807  1.00 44.85 ? 261 ILE A CG2   1 
ATOM   2234 C CD1   . ILE C 3 238 ? 5.110  61.299 -1.375  1.00 45.80 ? 261 ILE A CD1   1 
ATOM   2235 N N     . CYS C 3 239 ? 6.319  65.533 -5.055  1.00 47.83 ? 262 CYS A N     1 
ATOM   2236 C CA    . CYS C 3 239 ? 5.850  66.504 -6.038  1.00 50.03 ? 262 CYS A CA    1 
ATOM   2237 C C     . CYS C 3 239 ? 5.838  67.931 -5.513  1.00 50.30 ? 262 CYS A C     1 
ATOM   2238 O O     . CYS C 3 239 ? 4.780  68.502 -5.249  1.00 51.52 ? 262 CYS A O     1 
ATOM   2239 C CB    . CYS C 3 239 ? 4.454  66.115 -6.529  1.00 50.60 ? 262 CYS A CB    1 
ATOM   2240 S SG    . CYS C 3 239 ? 4.393  64.489 -7.321  1.00 54.90 ? 262 CYS A SG    1 
ATOM   2241 N N     . GLN C 3 240 ? 7.028  68.500 -5.367  1.00 50.15 ? 263 GLN A N     1 
ATOM   2242 C CA    . GLN C 3 240 ? 7.177  69.860 -4.878  1.00 50.61 ? 263 GLN A CA    1 
ATOM   2243 C C     . GLN C 3 240 ? 7.871  70.708 -5.932  1.00 50.11 ? 263 GLN A C     1 
ATOM   2244 O O     . GLN C 3 240 ? 8.629  70.195 -6.754  1.00 49.96 ? 263 GLN A O     1 
ATOM   2245 C CB    . GLN C 3 240 ? 8.000  69.869 -3.588  1.00 50.86 ? 263 GLN A CB    1 
ATOM   2246 C CG    . GLN C 3 240 ? 7.370  69.100 -2.438  1.00 51.84 ? 263 GLN A CG    1 
ATOM   2247 C CD    . GLN C 3 240 ? 6.081  69.732 -1.951  1.00 53.59 ? 263 GLN A CD    1 
ATOM   2248 O OE1   . GLN C 3 240 ? 6.068  70.885 -1.518  1.00 54.00 ? 263 GLN A OE1   1 
ATOM   2249 N NE2   . GLN C 3 240 ? 4.988  68.978 -2.017  1.00 54.10 ? 263 GLN A NE2   1 
ATOM   2250 N N     . LYS C 3 241 ? 7.597  72.007 -5.909  1.00 49.61 ? 264 LYS A N     1 
ATOM   2251 C CA    . LYS C 3 241 ? 8.206  72.936 -6.852  1.00 49.09 ? 264 LYS A CA    1 
ATOM   2252 C C     . LYS C 3 241 ? 9.571  73.317 -6.302  1.00 47.65 ? 264 LYS A C     1 
ATOM   2253 O O     . LYS C 3 241 ? 10.428 73.833 -7.017  1.00 48.27 ? 264 LYS A O     1 
ATOM   2254 C CB    . LYS C 3 241 ? 7.341  74.192 -6.985  1.00 50.45 ? 264 LYS A CB    1 
ATOM   2255 C CG    . LYS C 3 241 ? 5.943  73.945 -7.540  1.00 51.78 ? 264 LYS A CG    1 
ATOM   2256 C CD    . LYS C 3 241 ? 5.881  74.162 -9.048  1.00 53.74 ? 264 LYS A CD    1 
ATOM   2257 C CE    . LYS C 3 241 ? 6.816  73.233 -9.805  1.00 54.03 ? 264 LYS A CE    1 
ATOM   2258 N NZ    . LYS C 3 241 ? 6.746  73.461 -11.276 1.00 54.81 ? 264 LYS A NZ    1 
ATOM   2259 N N     . GLN C 3 242 ? 9.757  73.046 -5.016  1.00 46.52 ? 265 GLN A N     1 
ATOM   2260 C CA    . GLN C 3 242 ? 10.995 73.359 -4.320  1.00 46.00 ? 265 GLN A CA    1 
ATOM   2261 C C     . GLN C 3 242 ? 11.355 72.211 -3.383  1.00 44.05 ? 265 GLN A C     1 
ATOM   2262 O O     . GLN C 3 242 ? 10.525 71.769 -2.588  1.00 44.20 ? 265 GLN A O     1 
ATOM   2263 C CB    . GLN C 3 242 ? 10.807 74.652 -3.520  1.00 47.03 ? 265 GLN A CB    1 
ATOM   2264 C CG    . GLN C 3 242 ? 11.996 75.073 -2.681  1.00 49.16 ? 265 GLN A CG    1 
ATOM   2265 C CD    . GLN C 3 242 ? 11.712 76.335 -1.885  1.00 50.20 ? 265 GLN A CD    1 
ATOM   2266 O OE1   . GLN C 3 242 ? 11.354 77.369 -2.449  1.00 50.05 ? 265 GLN A OE1   1 
ATOM   2267 N NE2   . GLN C 3 242 ? 11.869 76.254 -0.568  1.00 50.69 ? 265 GLN A NE2   1 
ATOM   2268 N N     . VAL C 3 243 ? 12.591 71.726 -3.479  1.00 42.31 ? 266 VAL A N     1 
ATOM   2269 C CA    . VAL C 3 243 ? 13.039 70.631 -2.624  1.00 38.86 ? 266 VAL A CA    1 
ATOM   2270 C C     . VAL C 3 243 ? 14.488 70.783 -2.191  1.00 37.89 ? 266 VAL A C     1 
ATOM   2271 O O     . VAL C 3 243 ? 15.255 71.543 -2.786  1.00 37.61 ? 266 VAL A O     1 
ATOM   2272 C CB    . VAL C 3 243 ? 12.909 69.262 -3.335  1.00 38.33 ? 266 VAL A CB    1 
ATOM   2273 C CG1   . VAL C 3 243 ? 11.458 68.982 -3.673  1.00 37.57 ? 266 VAL A CG1   1 
ATOM   2274 C CG2   . VAL C 3 243 ? 13.773 69.242 -4.591  1.00 36.85 ? 266 VAL A CG2   1 
ATOM   2275 N N     . LYS C 3 244 ? 14.851 70.059 -1.139  1.00 36.18 ? 267 LYS A N     1 
ATOM   2276 C CA    . LYS C 3 244 ? 16.216 70.063 -0.639  1.00 36.66 ? 267 LYS A CA    1 
ATOM   2277 C C     . LYS C 3 244 ? 16.829 68.745 -1.101  1.00 35.11 ? 267 LYS A C     1 
ATOM   2278 O O     . LYS C 3 244 ? 16.285 67.675 -0.835  1.00 34.03 ? 267 LYS A O     1 
ATOM   2279 C CB    . LYS C 3 244 ? 16.237 70.153 0.889   1.00 38.70 ? 267 LYS A CB    1 
ATOM   2280 C CG    . LYS C 3 244 ? 15.746 71.488 1.432   1.00 41.18 ? 267 LYS A CG    1 
ATOM   2281 C CD    . LYS C 3 244 ? 15.919 71.573 2.940   1.00 45.57 ? 267 LYS A CD    1 
ATOM   2282 C CE    . LYS C 3 244 ? 15.419 72.907 3.477   1.00 47.72 ? 267 LYS A CE    1 
ATOM   2283 N NZ    . LYS C 3 244 ? 13.972 73.109 3.182   1.00 49.83 ? 267 LYS A NZ    1 
ATOM   2284 N N     . TYR C 3 245 ? 17.950 68.828 -1.808  1.00 34.56 ? 268 TYR A N     1 
ATOM   2285 C CA    . TYR C 3 245 ? 18.605 67.628 -2.310  1.00 34.28 ? 268 TYR A CA    1 
ATOM   2286 C C     . TYR C 3 245 ? 20.119 67.753 -2.278  1.00 33.55 ? 268 TYR A C     1 
ATOM   2287 O O     . TYR C 3 245 ? 20.695 68.649 -2.894  1.00 34.81 ? 268 TYR A O     1 
ATOM   2288 C CB    . TYR C 3 245 ? 18.143 67.345 -3.743  1.00 32.86 ? 268 TYR A CB    1 
ATOM   2289 C CG    . TYR C 3 245 ? 18.663 66.044 -4.315  1.00 31.09 ? 268 TYR A CG    1 
ATOM   2290 C CD1   . TYR C 3 245 ? 18.365 64.826 -3.709  1.00 30.61 ? 268 TYR A CD1   1 
ATOM   2291 C CD2   . TYR C 3 245 ? 19.437 66.032 -5.476  1.00 30.36 ? 268 TYR A CD2   1 
ATOM   2292 C CE1   . TYR C 3 245 ? 18.823 63.621 -4.246  1.00 29.45 ? 268 TYR A CE1   1 
ATOM   2293 C CE2   . TYR C 3 245 ? 19.900 64.834 -6.020  1.00 30.08 ? 268 TYR A CE2   1 
ATOM   2294 C CZ    . TYR C 3 245 ? 19.588 63.635 -5.401  1.00 29.45 ? 268 TYR A CZ    1 
ATOM   2295 O OH    . TYR C 3 245 ? 20.036 62.449 -5.939  1.00 28.37 ? 268 TYR A OH    1 
ATOM   2296 N N     . LEU C 3 246 ? 20.757 66.845 -1.548  1.00 34.77 ? 269 LEU A N     1 
ATOM   2297 C CA    . LEU C 3 246 ? 22.208 66.823 -1.438  1.00 34.53 ? 269 LEU A CA    1 
ATOM   2298 C C     . LEU C 3 246 ? 22.780 68.161 -0.981  1.00 35.97 ? 269 LEU A C     1 
ATOM   2299 O O     . LEU C 3 246 ? 23.791 68.627 -1.507  1.00 34.23 ? 269 LEU A O     1 
ATOM   2300 C CB    . LEU C 3 246 ? 22.821 66.426 -2.785  1.00 32.74 ? 269 LEU A CB    1 
ATOM   2301 C CG    . LEU C 3 246 ? 22.308 65.108 -3.379  1.00 32.28 ? 269 LEU A CG    1 
ATOM   2302 C CD1   . LEU C 3 246 ? 23.055 64.809 -4.668  1.00 29.46 ? 269 LEU A CD1   1 
ATOM   2303 C CD2   . LEU C 3 246 ? 22.486 63.976 -2.371  1.00 31.82 ? 269 LEU A CD2   1 
ATOM   2304 N N     . GLY C 3 247 ? 22.127 68.778 -0.003  1.00 38.04 ? 270 GLY A N     1 
ATOM   2305 C CA    . GLY C 3 247 ? 22.607 70.050 0.505   1.00 40.44 ? 270 GLY A CA    1 
ATOM   2306 C C     . GLY C 3 247 ? 22.212 71.263 -0.318  1.00 41.30 ? 270 GLY A C     1 
ATOM   2307 O O     . GLY C 3 247 ? 22.516 72.393 0.065   1.00 41.94 ? 270 GLY A O     1 
ATOM   2308 N N     . TYR C 3 248 ? 21.548 71.040 -1.447  1.00 41.63 ? 271 TYR A N     1 
ATOM   2309 C CA    . TYR C 3 248 ? 21.112 72.142 -2.299  1.00 41.17 ? 271 TYR A CA    1 
ATOM   2310 C C     . TYR C 3 248 ? 19.617 72.386 -2.161  1.00 41.21 ? 271 TYR A C     1 
ATOM   2311 O O     . TYR C 3 248 ? 18.864 71.508 -1.737  1.00 40.06 ? 271 TYR A O     1 
ATOM   2312 C CB    . TYR C 3 248 ? 21.388 71.856 -3.778  1.00 40.91 ? 271 TYR A CB    1 
ATOM   2313 C CG    . TYR C 3 248 ? 22.840 71.820 -4.182  1.00 41.03 ? 271 TYR A CG    1 
ATOM   2314 C CD1   . TYR C 3 248 ? 23.591 70.650 -4.063  1.00 41.05 ? 271 TYR A CD1   1 
ATOM   2315 C CD2   . TYR C 3 248 ? 23.459 72.949 -4.713  1.00 39.97 ? 271 TYR A CD2   1 
ATOM   2316 C CE1   . TYR C 3 248 ? 24.923 70.608 -4.470  1.00 41.00 ? 271 TYR A CE1   1 
ATOM   2317 C CE2   . TYR C 3 248 ? 24.787 72.918 -5.121  1.00 40.57 ? 271 TYR A CE2   1 
ATOM   2318 C CZ    . TYR C 3 248 ? 25.513 71.745 -4.998  1.00 40.68 ? 271 TYR A CZ    1 
ATOM   2319 O OH    . TYR C 3 248 ? 26.829 71.720 -5.403  1.00 41.34 ? 271 TYR A OH    1 
ATOM   2320 N N     . LEU C 3 249 ? 19.196 73.591 -2.523  1.00 40.69 ? 272 LEU A N     1 
ATOM   2321 C CA    . LEU C 3 249 ? 17.786 73.932 -2.501  1.00 41.10 ? 272 LEU A CA    1 
ATOM   2322 C C     . LEU C 3 249 ? 17.417 74.094 -3.969  1.00 40.82 ? 272 LEU A C     1 
ATOM   2323 O O     . LEU C 3 249 ? 17.828 75.053 -4.616  1.00 41.65 ? 272 LEU A O     1 
ATOM   2324 C CB    . LEU C 3 249 ? 17.543 75.245 -1.749  1.00 41.58 ? 272 LEU A CB    1 
ATOM   2325 C CG    . LEU C 3 249 ? 16.073 75.669 -1.636  1.00 43.18 ? 272 LEU A CG    1 
ATOM   2326 C CD1   . LEU C 3 249 ? 15.289 74.624 -0.850  1.00 42.34 ? 272 LEU A CD1   1 
ATOM   2327 C CD2   . LEU C 3 249 ? 15.980 77.024 -0.953  1.00 43.53 ? 272 LEU A CD2   1 
ATOM   2328 N N     . LEU C 3 250 ? 16.671 73.134 -4.502  1.00 42.03 ? 273 LEU A N     1 
ATOM   2329 C CA    . LEU C 3 250 ? 16.259 73.187 -5.897  1.00 43.75 ? 273 LEU A CA    1 
ATOM   2330 C C     . LEU C 3 250 ? 15.005 74.037 -6.013  1.00 45.52 ? 273 LEU A C     1 
ATOM   2331 O O     . LEU C 3 250 ? 13.968 73.713 -5.433  1.00 45.00 ? 273 LEU A O     1 
ATOM   2332 C CB    . LEU C 3 250 ? 16.001 71.772 -6.428  1.00 42.74 ? 273 LEU A CB    1 
ATOM   2333 C CG    . LEU C 3 250 ? 17.203 71.027 -7.027  1.00 43.08 ? 273 LEU A CG    1 
ATOM   2334 C CD1   . LEU C 3 250 ? 18.459 71.275 -6.205  1.00 41.28 ? 273 LEU A CD1   1 
ATOM   2335 C CD2   . LEU C 3 250 ? 16.881 69.538 -7.107  1.00 41.06 ? 273 LEU A CD2   1 
ATOM   2336 N N     . LYS C 3 251 ? 15.112 75.128 -6.764  1.00 48.59 ? 274 LYS A N     1 
ATOM   2337 C CA    . LYS C 3 251 ? 13.997 76.046 -6.945  1.00 52.04 ? 274 LYS A CA    1 
ATOM   2338 C C     . LYS C 3 251 ? 14.154 76.843 -8.234  1.00 53.86 ? 274 LYS A C     1 
ATOM   2339 O O     . LYS C 3 251 ? 15.235 77.350 -8.535  1.00 53.96 ? 274 LYS A O     1 
ATOM   2340 C CB    . LYS C 3 251 ? 13.925 76.999 -5.749  1.00 53.06 ? 274 LYS A CB    1 
ATOM   2341 C CG    . LYS C 3 251 ? 12.857 78.078 -5.846  1.00 55.11 ? 274 LYS A CG    1 
ATOM   2342 C CD    . LYS C 3 251 ? 12.877 78.957 -4.603  1.00 56.52 ? 274 LYS A CD    1 
ATOM   2343 C CE    . LYS C 3 251 ? 11.830 80.057 -4.672  1.00 57.99 ? 274 LYS A CE    1 
ATOM   2344 N NZ    . LYS C 3 251 ? 11.827 80.885 -3.431  1.00 58.47 ? 274 LYS A NZ    1 
ATOM   2345 N N     . GLU C 3 252 ? 13.070 76.946 -8.994  1.00 56.68 ? 275 GLU A N     1 
ATOM   2346 C CA    . GLU C 3 252 ? 13.081 77.690 -10.248 1.00 58.30 ? 275 GLU A CA    1 
ATOM   2347 C C     . GLU C 3 252 ? 14.177 77.179 -11.181 1.00 58.32 ? 275 GLU A C     1 
ATOM   2348 O O     . GLU C 3 252 ? 14.721 77.931 -11.991 1.00 57.98 ? 275 GLU A O     1 
ATOM   2349 C CB    . GLU C 3 252 ? 13.284 79.182 -9.961  1.00 59.80 ? 275 GLU A CB    1 
ATOM   2350 C CG    . GLU C 3 252 ? 12.250 79.764 -9.001  1.00 61.97 ? 275 GLU A CG    1 
ATOM   2351 C CD    . GLU C 3 252 ? 12.529 81.209 -8.627  1.00 63.36 ? 275 GLU A CD    1 
ATOM   2352 O OE1   . GLU C 3 252 ? 11.786 81.757 -7.784  1.00 63.84 ? 275 GLU A OE1   1 
ATOM   2353 O OE2   . GLU C 3 252 ? 13.486 81.799 -9.174  1.00 64.71 ? 275 GLU A OE2   1 
ATOM   2354 N N     . GLY C 3 253 ? 14.497 75.895 -11.060 1.00 57.99 ? 276 GLY A N     1 
ATOM   2355 C CA    . GLY C 3 253 ? 15.522 75.306 -11.902 1.00 58.34 ? 276 GLY A CA    1 
ATOM   2356 C C     . GLY C 3 253 ? 16.930 75.758 -11.564 1.00 58.58 ? 276 GLY A C     1 
ATOM   2357 O O     . GLY C 3 253 ? 17.874 75.458 -12.294 1.00 58.19 ? 276 GLY A O     1 
ATOM   2358 N N     . GLN C 3 254 ? 17.080 76.483 -10.460 1.00 58.95 ? 277 GLN A N     1 
ATOM   2359 C CA    . GLN C 3 254 ? 18.394 76.961 -10.049 1.00 60.05 ? 277 GLN A CA    1 
ATOM   2360 C C     . GLN C 3 254 ? 19.162 75.907 -9.264  1.00 60.49 ? 277 GLN A C     1 
ATOM   2361 O O     . GLN C 3 254 ? 18.651 75.347 -8.292  1.00 59.36 ? 277 GLN A O     1 
ATOM   2362 C CB    . GLN C 3 254 ? 18.263 78.237 -9.213  1.00 60.82 ? 277 GLN A CB    1 
ATOM   2363 C CG    . GLN C 3 254 ? 17.859 79.460 -10.021 1.00 62.20 ? 277 GLN A CG    1 
ATOM   2364 C CD    . GLN C 3 254 ? 18.893 79.844 -11.067 1.00 63.59 ? 277 GLN A CD    1 
ATOM   2365 O OE1   . GLN C 3 254 ? 18.701 80.798 -11.821 1.00 65.87 ? 277 GLN A OE1   1 
ATOM   2366 N NE2   . GLN C 3 254 ? 19.996 79.105 -11.116 1.00 63.83 ? 277 GLN A NE2   1 
ATOM   2367 N N     . ARG C 3 255 ? 20.391 75.653 -9.710  1.00 61.16 ? 278 ARG A N     1 
ATOM   2368 C CA    . ARG C 3 255 ? 21.300 74.677 -9.109  1.00 61.80 ? 278 ARG A CA    1 
ATOM   2369 C C     . ARG C 3 255 ? 21.177 73.293 -9.734  1.00 62.33 ? 278 ARG A C     1 
ATOM   2370 O O     . ARG C 3 255 ? 20.359 73.127 -10.666 1.00 63.29 ? 278 ARG A O     1 
ATOM   2371 C CB    . ARG C 3 255 ? 21.077 74.584 -7.599  1.00 60.68 ? 278 ARG A CB    1 
ATOM   2372 C CG    . ARG C 3 255 ? 21.474 75.837 -6.841  1.00 59.36 ? 278 ARG A CG    1 
ATOM   2373 C CD    . ARG C 3 255 ? 21.164 75.685 -5.371  1.00 58.91 ? 278 ARG A CD    1 
ATOM   2374 N NE    . ARG C 3 255 ? 21.875 76.665 -4.559  1.00 59.52 ? 278 ARG A NE    1 
ATOM   2375 C CZ    . ARG C 3 255 ? 21.881 76.663 -3.231  1.00 58.23 ? 278 ARG A CZ    1 
ATOM   2376 N NH1   . ARG C 3 255 ? 21.208 75.735 -2.566  1.00 57.95 ? 278 ARG A NH1   1 
ATOM   2377 N NH2   . ARG C 3 255 ? 22.573 77.579 -2.567  1.00 58.08 ? 278 ARG A NH2   1 
ATOM   2378 O OXT   . ARG C 3 255 ? 21.912 72.391 -9.286  1.00 63.28 ? 278 ARG A OXT   1 
HETATM 2379 N N1    . HXL D 4 .   ? 42.386 64.421 7.915   1.00 82.25 ? 301 HXL B N1    1 
HETATM 2380 N N2    . HXL D 4 .   ? 40.123 64.113 8.060   1.00 81.89 ? 301 HXL B N2    1 
HETATM 2381 C C1    . HXL D 4 .   ? 41.177 64.923 8.195   1.00 82.18 ? 301 HXL B C1    1 
HETATM 2382 C C2    . HXL D 4 .   ? 40.973 66.373 8.658   1.00 82.00 ? 301 HXL B C2    1 
HETATM 2383 C C3    . HXL D 4 .   ? 41.719 66.886 9.912   1.00 81.61 ? 301 HXL B C3    1 
HETATM 2384 C C4    . HXL D 4 .   ? 41.526 68.334 10.386  1.00 81.71 ? 301 HXL B C4    1 
HETATM 2385 N N3    . HXL D 4 .   ? 42.066 68.941 11.412  1.00 81.32 ? 301 HXL B N3    1 
HETATM 2386 C C5    . HXL D 4 .   ? 41.608 70.243 11.458  1.00 80.92 ? 301 HXL B C5    1 
HETATM 2387 N N4    . HXL D 4 .   ? 40.731 70.502 10.420  1.00 81.24 ? 301 HXL B N4    1 
HETATM 2388 C C6    . HXL D 4 .   ? 40.625 69.305 9.675   1.00 81.64 ? 301 HXL B C6    1 
HETATM 2389 C C7    . HXL D 4 .   ? 39.852 68.837 8.408   1.00 81.85 ? 301 HXL B C7    1 
HETATM 2390 C C8    . HXL D 4 .   ? 40.030 67.370 7.904   1.00 81.90 ? 301 HXL B C8    1 
HETATM 2391 C C9    . HXL D 4 .   ? 42.052 71.285 12.577  1.00 80.43 ? 301 HXL B C9    1 
HETATM 2392 C C10   . HXL D 4 .   ? 43.016 70.794 13.614  1.00 80.21 ? 301 HXL B C10   1 
HETATM 2393 C C11   . HXL D 4 .   ? 43.520 71.672 14.730  1.00 79.85 ? 301 HXL B C11   1 
HETATM 2394 C C12   . HXL D 4 .   ? 43.060 73.150 14.866  1.00 79.60 ? 301 HXL B C12   1 
HETATM 2395 C C13   . HXL D 4 .   ? 42.052 73.672 13.786  1.00 80.03 ? 301 HXL B C13   1 
HETATM 2396 C C14   . HXL D 4 .   ? 41.546 72.735 12.636  1.00 80.11 ? 301 HXL B C14   1 
HETATM 2397 O O1    . HXL D 4 .   ? 43.532 74.057 15.959  1.00 79.03 ? 301 HXL B O1    1 
HETATM 2398 C C15   . HXL D 4 .   ? 44.569 74.074 17.035  1.00 78.24 ? 301 HXL B C15   1 
HETATM 2399 C C16   . HXL D 4 .   ? 45.988 73.523 16.898  1.00 77.57 ? 301 HXL B C16   1 
HETATM 2400 C C17   . HXL D 4 .   ? 47.000 73.566 18.016  1.00 77.42 ? 301 HXL B C17   1 
HETATM 2401 C C18   . HXL D 4 .   ? 46.676 74.169 19.376  1.00 77.66 ? 301 HXL B C18   1 
HETATM 2402 C C19   . HXL D 4 .   ? 45.222 74.752 19.568  1.00 77.82 ? 301 HXL B C19   1 
HETATM 2403 C C20   . HXL D 4 .   ? 44.177 74.703 18.400  1.00 78.11 ? 301 HXL B C20   1 
HETATM 2404 C C21   . HXL D 4 .   ? 47.761 74.183 20.481  1.00 77.60 ? 301 HXL B C21   1 
HETATM 2405 N N5    . HXL D 4 .   ? 48.956 73.574 20.317  1.00 77.31 ? 301 HXL B N5    1 
HETATM 2406 N N6    . HXL D 4 .   ? 47.531 74.811 21.632  1.00 77.84 ? 301 HXL B N6    1 
HETATM 2407 O O     . HOH E 5 .   ? 35.945 60.535 20.554  1.00 46.94 ? 129 HOH B O     1 
HETATM 2408 O O     . HOH E 5 .   ? 43.921 53.501 9.930   1.00 43.23 ? 179 HOH B O     1 
HETATM 2409 O O     . HOH E 5 .   ? 50.428 66.004 10.807  1.00 43.06 ? 184 HOH B O     1 
HETATM 2410 O O     . HOH F 5 .   ? 33.117 54.601 5.928   1.00 33.87 ? 48  HOH G O     1 
HETATM 2411 O O     . HOH F 5 .   ? 39.964 61.785 9.979   1.00 43.58 ? 114 HOH G O     1 
HETATM 2412 O O     . HOH F 5 .   ? 46.022 62.984 18.844  1.00 43.63 ? 127 HOH G O     1 
HETATM 2413 O O     . HOH F 5 .   ? 30.689 54.699 10.456  1.00 27.39 ? 147 HOH G O     1 
HETATM 2414 O O     . HOH F 5 .   ? 31.073 55.253 7.897   1.00 41.42 ? 169 HOH G O     1 
HETATM 2415 O O     . HOH F 5 .   ? 33.214 59.357 16.964  1.00 44.03 ? 170 HOH G O     1 
HETATM 2416 O O     . HOH F 5 .   ? 31.656 56.995 11.191  1.00 44.90 ? 182 HOH G O     1 
HETATM 2417 O O     . HOH G 5 .   ? 37.109 44.129 -3.006  1.00 17.77 ? 279 HOH A O     1 
HETATM 2418 O O     . HOH G 5 .   ? 36.103 42.555 11.529  1.00 15.85 ? 280 HOH A O     1 
HETATM 2419 O O     . HOH G 5 .   ? 20.493 41.237 -1.489  1.00 17.42 ? 281 HOH A O     1 
HETATM 2420 O O     . HOH G 5 .   ? 26.786 46.097 -5.988  1.00 18.39 ? 282 HOH A O     1 
HETATM 2421 O O     . HOH G 5 .   ? 28.649 46.351 -8.174  1.00 19.30 ? 283 HOH A O     1 
HETATM 2422 O O     . HOH G 5 .   ? 40.185 48.454 12.293  1.00 16.44 ? 284 HOH A O     1 
HETATM 2423 O O     . HOH G 5 .   ? 29.709 48.159 10.861  1.00 17.98 ? 285 HOH A O     1 
HETATM 2424 O O     . HOH G 5 .   ? 35.185 43.805 18.761  1.00 19.91 ? 286 HOH A O     1 
HETATM 2425 O O     . HOH G 5 .   ? 24.773 57.462 -9.209  1.00 19.38 ? 287 HOH A O     1 
HETATM 2426 O O     . HOH G 5 .   ? 27.609 53.745 -9.301  1.00 20.01 ? 288 HOH A O     1 
HETATM 2427 O O     . HOH G 5 .   ? 39.081 37.260 -1.503  1.00 22.56 ? 289 HOH A O     1 
HETATM 2428 O O     . HOH G 5 .   ? 25.516 52.047 33.496  1.00 18.44 ? 290 HOH A O     1 
HETATM 2429 O O     . HOH G 5 .   ? 29.430 50.573 12.192  1.00 18.95 ? 291 HOH A O     1 
HETATM 2430 O O     . HOH G 5 .   ? 26.941 48.250 10.051  1.00 18.29 ? 292 HOH A O     1 
HETATM 2431 O O     . HOH G 5 .   ? 35.290 37.604 0.977   1.00 23.99 ? 293 HOH A O     1 
HETATM 2432 O O     . HOH G 5 .   ? 20.537 54.554 4.366   1.00 23.30 ? 294 HOH A O     1 
HETATM 2433 O O     . HOH G 5 .   ? 37.891 50.703 -2.820  1.00 22.24 ? 295 HOH A O     1 
HETATM 2434 O O     . HOH G 5 .   ? 43.777 50.304 -0.461  1.00 28.45 ? 296 HOH A O     1 
HETATM 2435 O O     . HOH G 5 .   ? 34.586 45.106 -2.231  1.00 15.83 ? 297 HOH A O     1 
HETATM 2436 O O     . HOH G 5 .   ? 43.786 37.036 -0.955  1.00 23.97 ? 298 HOH A O     1 
HETATM 2437 O O     . HOH G 5 .   ? 47.116 41.012 5.945   1.00 24.01 ? 299 HOH A O     1 
HETATM 2438 O O     . HOH G 5 .   ? 26.246 35.696 -4.475  1.00 22.60 ? 300 HOH A O     1 
HETATM 2439 O O     . HOH G 5 .   ? 31.151 50.453 33.825  1.00 22.77 ? 301 HOH A O     1 
HETATM 2440 O O     . HOH G 5 .   ? 16.304 43.949 -5.451  1.00 18.39 ? 302 HOH A O     1 
HETATM 2441 O O     . HOH G 5 .   ? 12.419 42.469 0.681   1.00 26.68 ? 303 HOH A O     1 
HETATM 2442 O O     . HOH G 5 .   ? 23.287 41.676 -2.296  1.00 21.95 ? 304 HOH A O     1 
HETATM 2443 O O     . HOH G 5 .   ? 32.393 53.638 -1.744  1.00 21.04 ? 305 HOH A O     1 
HETATM 2444 O O     . HOH G 5 .   ? 22.954 52.634 4.640   1.00 23.75 ? 306 HOH A O     1 
HETATM 2445 O O     . HOH G 5 .   ? 21.852 59.038 -11.335 1.00 21.20 ? 307 HOH A O     1 
HETATM 2446 O O     . HOH G 5 .   ? 16.281 46.985 -13.800 1.00 24.68 ? 308 HOH A O     1 
HETATM 2447 O O     . HOH G 5 .   ? 32.397 47.647 -8.167  1.00 22.23 ? 309 HOH A O     1 
HETATM 2448 O O     . HOH G 5 .   ? 16.230 50.948 1.576   1.00 22.69 ? 310 HOH A O     1 
HETATM 2449 O O     . HOH G 5 .   ? 31.517 52.141 11.090  1.00 21.81 ? 311 HOH A O     1 
HETATM 2450 O O     . HOH G 5 .   ? 15.525 36.772 -3.851  1.00 24.73 ? 312 HOH A O     1 
HETATM 2451 O O     . HOH G 5 .   ? 29.301 52.828 33.274  1.00 21.86 ? 313 HOH A O     1 
HETATM 2452 O O     . HOH G 5 .   ? 33.385 50.048 -8.966  1.00 23.94 ? 314 HOH A O     1 
HETATM 2453 O O     . HOH G 5 .   ? 13.510 49.129 -12.367 1.00 26.43 ? 315 HOH A O     1 
HETATM 2454 O O     . HOH G 5 .   ? 22.451 37.721 3.950   1.00 23.83 ? 316 HOH A O     1 
HETATM 2455 O O     . HOH G 5 .   ? 15.222 42.040 8.661   1.00 30.61 ? 317 HOH A O     1 
HETATM 2456 O O     . HOH G 5 .   ? 18.389 52.033 -18.042 1.00 30.50 ? 318 HOH A O     1 
HETATM 2457 O O     . HOH G 5 .   ? 29.484 39.747 -5.506  1.00 28.94 ? 319 HOH A O     1 
HETATM 2458 O O     . HOH G 5 .   ? 29.362 53.929 6.280   1.00 29.05 ? 320 HOH A O     1 
HETATM 2459 O O     . HOH G 5 .   ? 33.131 52.864 27.326  1.00 35.65 ? 321 HOH A O     1 
HETATM 2460 O O     . HOH G 5 .   ? 20.129 52.841 -13.628 1.00 27.83 ? 322 HOH A O     1 
HETATM 2461 O O     . HOH G 5 .   ? 22.014 54.935 -5.985  1.00 26.78 ? 323 HOH A O     1 
HETATM 2462 O O     . HOH G 5 .   ? 45.750 42.631 -4.541  1.00 28.87 ? 324 HOH A O     1 
HETATM 2463 O O     . HOH G 5 .   ? 38.457 45.521 -7.729  1.00 25.34 ? 325 HOH A O     1 
HETATM 2464 O O     . HOH G 5 .   ? 23.299 35.988 2.107   1.00 29.63 ? 326 HOH A O     1 
HETATM 2465 O O     . HOH G 5 .   ? 35.232 32.942 4.366   1.00 29.27 ? 327 HOH A O     1 
HETATM 2466 O O     . HOH G 5 .   ? 45.568 39.720 14.222  1.00 37.19 ? 328 HOH A O     1 
HETATM 2467 O O     . HOH G 5 .   ? 21.591 51.919 8.736   1.00 31.71 ? 329 HOH A O     1 
HETATM 2468 O O     . HOH G 5 .   ? 22.384 42.736 -10.265 1.00 35.17 ? 330 HOH A O     1 
HETATM 2469 O O     . HOH G 5 .   ? 19.377 45.640 29.765  1.00 34.80 ? 331 HOH A O     1 
HETATM 2470 O O     . HOH G 5 .   ? 41.653 50.618 13.516  1.00 30.64 ? 332 HOH A O     1 
HETATM 2471 O O     . HOH G 5 .   ? 43.520 51.515 11.653  1.00 31.80 ? 333 HOH A O     1 
HETATM 2472 O O     . HOH G 5 .   ? 46.893 43.072 2.168   1.00 29.04 ? 334 HOH A O     1 
HETATM 2473 O O     . HOH G 5 .   ? 27.621 32.764 11.126  1.00 35.11 ? 335 HOH A O     1 
HETATM 2474 O O     . HOH G 5 .   ? 24.739 33.944 8.023   1.00 28.52 ? 336 HOH A O     1 
HETATM 2475 O O     . HOH G 5 .   ? 20.173 38.297 5.730   1.00 36.45 ? 337 HOH A O     1 
HETATM 2476 O O     . HOH G 5 .   ? 29.576 32.799 7.321   1.00 23.46 ? 338 HOH A O     1 
HETATM 2477 O O     . HOH G 5 .   ? 29.999 67.912 -5.546  1.00 30.12 ? 339 HOH A O     1 
HETATM 2478 O O     . HOH G 5 .   ? 24.818 41.623 -6.252  1.00 26.77 ? 340 HOH A O     1 
HETATM 2479 O O     . HOH G 5 .   ? 41.924 50.956 1.826   1.00 31.13 ? 341 HOH A O     1 
HETATM 2480 O O     . HOH G 5 .   ? 22.941 59.746 1.811   1.00 32.39 ? 342 HOH A O     1 
HETATM 2481 O O     . HOH G 5 .   ? 36.533 48.492 -10.211 1.00 25.88 ? 343 HOH A O     1 
HETATM 2482 O O     . HOH G 5 .   ? 15.517 49.200 18.824  1.00 50.85 ? 344 HOH A O     1 
HETATM 2483 O O     . HOH G 5 .   ? 12.113 42.940 3.377   1.00 28.49 ? 345 HOH A O     1 
HETATM 2484 O O     . HOH G 5 .   ? 28.468 34.386 9.340   1.00 33.12 ? 346 HOH A O     1 
HETATM 2485 O O     . HOH G 5 .   ? 28.318 45.778 33.927  1.00 38.35 ? 347 HOH A O     1 
HETATM 2486 O O     . HOH G 5 .   ? 20.171 36.962 13.961  1.00 28.67 ? 348 HOH A O     1 
HETATM 2487 O O     . HOH G 5 .   ? 30.779 47.899 -11.555 1.00 35.65 ? 349 HOH A O     1 
HETATM 2488 O O     . HOH G 5 .   ? 39.303 52.948 6.143   1.00 28.18 ? 350 HOH A O     1 
HETATM 2489 O O     . HOH G 5 .   ? 13.149 63.743 0.956   1.00 39.56 ? 351 HOH A O     1 
HETATM 2490 O O     . HOH G 5 .   ? 17.436 39.075 -10.086 1.00 34.10 ? 352 HOH A O     1 
HETATM 2491 O O     . HOH G 5 .   ? 43.350 46.971 -4.229  1.00 32.80 ? 353 HOH A O     1 
HETATM 2492 O O     . HOH G 5 .   ? 20.063 36.245 9.146   1.00 39.64 ? 354 HOH A O     1 
HETATM 2493 O O     . HOH G 5 .   ? 39.590 52.896 -5.402  1.00 34.00 ? 355 HOH A O     1 
HETATM 2494 O O     . HOH G 5 .   ? 17.427 60.311 -15.581 1.00 37.52 ? 356 HOH A O     1 
HETATM 2495 O O     . HOH G 5 .   ? 45.861 36.126 10.697  1.00 40.60 ? 357 HOH A O     1 
HETATM 2496 O O     . HOH G 5 .   ? 26.209 55.925 33.975  1.00 44.16 ? 358 HOH A O     1 
HETATM 2497 O O     . HOH G 5 .   ? 30.849 30.994 12.650  1.00 49.58 ? 359 HOH A O     1 
HETATM 2498 O O     . HOH G 5 .   ? 39.199 36.524 16.238  1.00 28.95 ? 360 HOH A O     1 
HETATM 2499 O O     . HOH G 5 .   ? 19.993 45.697 -14.624 1.00 27.80 ? 361 HOH A O     1 
HETATM 2500 O O     . HOH G 5 .   ? 49.292 38.751 5.011   1.00 43.96 ? 362 HOH A O     1 
HETATM 2501 O O     . HOH G 5 .   ? 15.245 42.185 5.928   1.00 24.76 ? 363 HOH A O     1 
HETATM 2502 O O     . HOH G 5 .   ? 21.102 60.008 -13.818 1.00 39.17 ? 364 HOH A O     1 
HETATM 2503 O O     . HOH G 5 .   ? 42.977 35.516 13.485  1.00 30.89 ? 365 HOH A O     1 
HETATM 2504 O O     . HOH G 5 .   ? 22.386 77.047 -10.300 1.00 41.92 ? 366 HOH A O     1 
HETATM 2505 O O     . HOH G 5 .   ? 17.530 66.415 1.171   1.00 46.83 ? 367 HOH A O     1 
HETATM 2506 O O     . HOH G 5 .   ? 28.691 34.702 19.402  1.00 39.16 ? 368 HOH A O     1 
HETATM 2507 O O     . HOH G 5 .   ? 11.788 56.709 8.143   1.00 40.38 ? 369 HOH A O     1 
HETATM 2508 O O     . HOH G 5 .   ? 27.245 51.995 12.635  1.00 31.91 ? 370 HOH A O     1 
HETATM 2509 O O     . HOH G 5 .   ? 16.788 43.912 -11.125 1.00 35.73 ? 371 HOH A O     1 
HETATM 2510 O O     . HOH G 5 .   ? 23.370 34.629 5.091   1.00 37.59 ? 372 HOH A O     1 
HETATM 2511 O O     . HOH G 5 .   ? 19.292 55.161 6.846   1.00 32.61 ? 373 HOH A O     1 
HETATM 2512 O O     . HOH G 5 .   ? 28.223 69.682 -4.567  1.00 39.91 ? 374 HOH A O     1 
HETATM 2513 O O     . HOH G 5 .   ? 32.885 56.854 23.961  1.00 46.41 ? 375 HOH A O     1 
HETATM 2514 O O     . HOH G 5 .   ? 15.363 49.332 5.019   1.00 33.07 ? 376 HOH A O     1 
HETATM 2515 O O     . HOH G 5 .   ? 23.945 63.592 -14.208 1.00 39.38 ? 377 HOH A O     1 
HETATM 2516 O O     . HOH G 5 .   ? 30.190 61.955 19.044  1.00 48.90 ? 378 HOH A O     1 
HETATM 2517 O O     . HOH G 5 .   ? 23.171 40.645 -8.448  1.00 31.40 ? 379 HOH A O     1 
HETATM 2518 O O     . HOH G 5 .   ? 19.650 67.973 1.647   1.00 39.35 ? 380 HOH A O     1 
HETATM 2519 O O     . HOH G 5 .   ? 32.294 55.926 -5.841  1.00 28.62 ? 381 HOH A O     1 
HETATM 2520 O O     . HOH G 5 .   ? 33.856 45.268 26.685  1.00 43.62 ? 382 HOH A O     1 
HETATM 2521 O O     . HOH G 5 .   ? 30.628 62.499 -3.893  1.00 40.12 ? 383 HOH A O     1 
HETATM 2522 O O     . HOH G 5 .   ? 18.562 57.632 3.911   1.00 46.17 ? 384 HOH A O     1 
HETATM 2523 O O     . HOH G 5 .   ? 15.880 46.068 21.151  1.00 36.40 ? 385 HOH A O     1 
HETATM 2524 O O     . HOH G 5 .   ? 34.919 33.894 18.742  1.00 44.72 ? 386 HOH A O     1 
HETATM 2525 O O     . HOH G 5 .   ? 33.110 39.134 -5.812  1.00 43.87 ? 387 HOH A O     1 
HETATM 2526 O O     . HOH G 5 .   ? 19.303 64.930 -0.034  1.00 42.86 ? 388 HOH A O     1 
HETATM 2527 O O     . HOH G 5 .   ? 46.231 35.675 -3.691  1.00 38.03 ? 389 HOH A O     1 
HETATM 2528 O O     . HOH G 5 .   ? 41.714 51.852 6.314   1.00 31.38 ? 390 HOH A O     1 
HETATM 2529 O O     . HOH G 5 .   ? 23.518 53.621 29.508  1.00 36.21 ? 391 HOH A O     1 
HETATM 2530 O O     . HOH G 5 .   ? 47.794 47.588 -0.595  1.00 44.52 ? 392 HOH A O     1 
HETATM 2531 O O     . HOH G 5 .   ? 20.740 54.963 21.727  1.00 43.60 ? 393 HOH A O     1 
HETATM 2532 O O     . HOH G 5 .   ? 5.859  48.570 -3.373  1.00 34.22 ? 394 HOH A O     1 
HETATM 2533 O O     . HOH G 5 .   ? 31.912 53.781 3.790   1.00 36.51 ? 395 HOH A O     1 
HETATM 2534 O O     . HOH G 5 .   ? 31.242 63.116 -10.994 1.00 35.38 ? 396 HOH A O     1 
HETATM 2535 O O     . HOH G 5 .   ? 29.876 69.357 -14.190 1.00 50.74 ? 397 HOH A O     1 
HETATM 2536 O O     . HOH G 5 .   ? 34.381 54.903 1.495   1.00 41.85 ? 398 HOH A O     1 
HETATM 2537 O O     . HOH G 5 .   ? 34.775 35.384 21.094  1.00 53.08 ? 399 HOH A O     1 
HETATM 2538 O O     . HOH G 5 .   ? 19.491 49.486 27.620  1.00 37.10 ? 400 HOH A O     1 
HETATM 2539 O O     . HOH G 5 .   ? 14.019 57.736 -16.842 1.00 42.85 ? 401 HOH A O     1 
HETATM 2540 O O     . HOH G 5 .   ? 10.711 42.612 -1.952  1.00 35.42 ? 402 HOH A O     1 
HETATM 2541 O O     . HOH G 5 .   ? 30.846 42.787 -4.150  1.00 37.72 ? 403 HOH A O     1 
HETATM 2542 O O     . HOH G 5 .   ? 2.015  55.703 -11.979 1.00 48.44 ? 404 HOH A O     1 
HETATM 2543 O O     . HOH G 5 .   ? 39.888 51.470 17.116  1.00 35.40 ? 405 HOH A O     1 
HETATM 2544 O O     . HOH G 5 .   ? 37.226 43.744 -5.785  1.00 20.66 ? 406 HOH A O     1 
HETATM 2545 O O     . HOH G 5 .   ? 24.631 58.260 -11.804 1.00 25.57 ? 407 HOH A O     1 
HETATM 2546 O O     . HOH G 5 .   ? 33.022 43.931 -4.046  1.00 24.34 ? 408 HOH A O     1 
HETATM 2547 O O     . HOH G 5 .   ? 15.232 37.075 -1.073  1.00 21.35 ? 409 HOH A O     1 
HETATM 2548 O O     . HOH G 5 .   ? 27.230 53.672 34.815  1.00 24.15 ? 410 HOH A O     1 
HETATM 2549 O O     . HOH G 5 .   ? 39.914 35.278 0.394   1.00 21.50 ? 411 HOH A O     1 
HETATM 2550 O O     . HOH G 5 .   ? 23.764 53.880 32.149  1.00 23.13 ? 412 HOH A O     1 
HETATM 2551 O O     . HOH G 5 .   ? 17.660 48.248 12.788  1.00 30.97 ? 413 HOH A O     1 
HETATM 2552 O O     . HOH G 5 .   ? 12.841 37.112 -4.915  1.00 23.45 ? 414 HOH A O     1 
HETATM 2553 O O     . HOH G 5 .   ? 11.890 39.820 1.085   1.00 25.82 ? 415 HOH A O     1 
HETATM 2554 O O     . HOH G 5 .   ? 22.216 50.538 6.437   1.00 28.57 ? 416 HOH A O     1 
HETATM 2555 O O     . HOH G 5 .   ? 34.367 49.309 -11.390 1.00 27.42 ? 417 HOH A O     1 
HETATM 2556 O O     . HOH G 5 .   ? 12.436 60.127 1.988   1.00 30.73 ? 418 HOH A O     1 
HETATM 2557 O O     . HOH G 5 .   ? 25.653 50.108 11.766  1.00 31.08 ? 419 HOH A O     1 
HETATM 2558 O O     . HOH G 5 .   ? 20.521 52.513 -16.225 1.00 28.15 ? 420 HOH A O     1 
HETATM 2559 O O     . HOH G 5 .   ? 32.527 56.234 -0.910  1.00 30.99 ? 421 HOH A O     1 
HETATM 2560 O O     . HOH G 5 .   ? 36.032 35.862 -0.906  1.00 32.77 ? 422 HOH A O     1 
HETATM 2561 O O     . HOH G 5 .   ? 33.835 50.869 33.471  1.00 34.63 ? 423 HOH A O     1 
HETATM 2562 O O     . HOH G 5 .   ? 36.482 45.882 -9.297  1.00 33.72 ? 424 HOH A O     1 
HETATM 2563 O O     . HOH G 5 .   ? 37.165 32.641 2.354   1.00 32.66 ? 425 HOH A O     1 
HETATM 2564 O O     . HOH G 5 .   ? 9.928  43.668 0.130   1.00 39.63 ? 426 HOH A O     1 
HETATM 2565 O O     . HOH G 5 .   ? 33.556 45.267 -8.298  1.00 32.20 ? 427 HOH A O     1 
HETATM 2566 O O     . HOH G 5 .   ? 15.809 62.872 1.767   1.00 35.30 ? 428 HOH A O     1 
HETATM 2567 O O     . HOH G 5 .   ? 24.467 32.509 10.259  1.00 34.11 ? 429 HOH A O     1 
HETATM 2568 O O     . HOH G 5 .   ? 9.396  42.347 3.772   1.00 44.24 ? 430 HOH A O     1 
HETATM 2569 O O     . HOH G 5 .   ? 34.942 37.339 -6.270  1.00 37.09 ? 431 HOH A O     1 
HETATM 2570 O O     . HOH G 5 .   ? 10.849 43.628 6.628   1.00 42.51 ? 432 HOH A O     1 
HETATM 2571 O O     . HOH G 5 .   ? 19.224 35.021 11.982  1.00 41.93 ? 433 HOH A O     1 
HETATM 2572 O O     . HOH G 5 .   ? 20.243 53.389 23.673  1.00 46.60 ? 434 HOH A O     1 
HETATM 2573 O O     . HOH G 5 .   ? 34.000 41.149 -7.634  1.00 33.93 ? 435 HOH A O     1 
HETATM 2574 O O     . HOH G 5 .   ? 35.522 53.310 -4.061  1.00 48.01 ? 436 HOH A O     1 
HETATM 2575 O O     . HOH G 5 .   ? 30.705 55.302 32.892  1.00 31.72 ? 437 HOH A O     1 
HETATM 2576 O O     . HOH G 5 .   ? 12.925 41.008 5.108   1.00 39.96 ? 438 HOH A O     1 
HETATM 2577 O O     . HOH G 5 .   ? 14.759 45.582 -12.015 1.00 35.74 ? 439 HOH A O     1 
HETATM 2578 O O     . HOH G 5 .   ? 36.317 43.725 25.885  1.00 47.98 ? 440 HOH A O     1 
HETATM 2579 O O     . HOH G 5 .   ? 16.956 57.886 -16.904 1.00 39.23 ? 441 HOH A O     1 
HETATM 2580 O O     . HOH G 5 .   ? 17.502 62.423 -0.196  1.00 41.31 ? 442 HOH A O     1 
HETATM 2581 O O     . HOH G 5 .   ? 35.380 53.634 5.184   1.00 42.89 ? 443 HOH A O     1 
HETATM 2582 O O     . HOH G 5 .   ? 36.155 55.254 3.379   1.00 41.24 ? 444 HOH A O     1 
HETATM 2583 O O     . HOH G 5 .   ? 14.120 50.475 6.855   1.00 43.51 ? 445 HOH A O     1 
HETATM 2584 O O     . HOH G 5 .   ? 43.071 53.768 7.464   1.00 40.88 ? 446 HOH A O     1 
HETATM 2585 O O     . HOH G 5 .   ? 36.786 36.908 3.199   1.00 34.54 ? 447 HOH A O     1 
HETATM 2586 O O     . HOH G 5 .   ? 11.069 41.644 -6.989  1.00 45.91 ? 448 HOH A O     1 
HETATM 2587 O O     . HOH G 5 .   ? 17.081 37.188 18.030  1.00 41.72 ? 449 HOH A O     1 
HETATM 2588 O O     . HOH G 5 .   ? 31.981 60.508 -5.261  1.00 47.44 ? 450 HOH A O     1 
HETATM 2589 O O     . HOH G 5 .   ? 48.246 42.688 -1.895  1.00 45.55 ? 451 HOH A O     1 
HETATM 2590 O O     . HOH G 5 .   ? 40.506 43.988 -8.795  1.00 46.02 ? 452 HOH A O     1 
HETATM 2591 O O     . HOH G 5 .   ? 31.881 45.170 21.549  1.00 39.55 ? 453 HOH A O     1 
HETATM 2592 O O     . HOH G 5 .   ? 23.095 41.829 24.461  1.00 38.63 ? 454 HOH A O     1 
HETATM 2593 O O     . HOH G 5 .   ? 46.781 40.486 9.264   1.00 37.59 ? 455 HOH A O     1 
HETATM 2594 O O     . HOH G 5 .   ? 8.296  58.993 -19.255 1.00 43.10 ? 456 HOH A O     1 
HETATM 2595 O O     . HOH G 5 .   ? 27.284 41.628 -7.410  1.00 44.60 ? 457 HOH A O     1 
HETATM 2596 O O     . HOH G 5 .   ? 12.823 42.306 9.621   1.00 44.61 ? 458 HOH A O     1 
HETATM 2597 O O     . HOH G 5 .   ? 17.400 53.990 -19.584 1.00 46.63 ? 459 HOH A O     1 
HETATM 2598 O O     . HOH G 5 .   ? 46.573 49.850 2.212   1.00 42.98 ? 460 HOH A O     1 
HETATM 2599 O O     . HOH G 5 .   ? 17.384 38.739 7.944   1.00 41.55 ? 461 HOH A O     1 
HETATM 2600 O O     . HOH G 5 .   ? 11.020 48.337 -13.276 1.00 42.81 ? 462 HOH A O     1 
HETATM 2601 O O     . HOH G 5 .   ? 36.684 36.687 -3.312  1.00 44.18 ? 463 HOH A O     1 
HETATM 2602 O O     . HOH G 5 .   ? 6.438  43.471 1.138   1.00 40.23 ? 464 HOH A O     1 
HETATM 2603 O O     . HOH G 5 .   ? 42.230 47.001 -7.592  1.00 46.02 ? 465 HOH A O     1 
HETATM 2604 O O     . HOH G 5 .   ? 20.759 35.088 16.193  1.00 48.83 ? 466 HOH A O     1 
HETATM 2605 O O     . HOH G 5 .   ? 15.237 41.758 -12.402 1.00 50.18 ? 467 HOH A O     1 
HETATM 2606 O O     . HOH G 5 .   ? 43.963 36.275 -4.928  1.00 48.31 ? 468 HOH A O     1 
HETATM 2607 O O     . HOH G 5 .   ? 37.196 33.489 16.963  1.00 49.25 ? 469 HOH A O     1 
HETATM 2608 O O     . HOH G 5 .   ? 46.976 42.141 -6.819  1.00 43.73 ? 470 HOH A O     1 
HETATM 2609 O O     . HOH G 5 .   ? 32.090 33.669 18.976  1.00 42.30 ? 471 HOH A O     1 
HETATM 2610 O O     . HOH G 5 .   ? 37.904 36.812 18.772  1.00 46.30 ? 472 HOH A O     1 
HETATM 2611 O O     . HOH G 5 .   ? 38.713 39.599 20.546  1.00 64.44 ? 473 HOH A O     1 
HETATM 2612 O O     . HOH G 5 .   ? 11.757 46.484 -11.621 1.00 40.58 ? 474 HOH A O     1 
HETATM 2613 O O     . HOH G 5 .   ? 38.038 31.722 14.322  1.00 46.55 ? 475 HOH A O     1 
HETATM 2614 O O     . HOH G 5 .   ? 30.645 58.260 -2.034  1.00 49.06 ? 476 HOH A O     1 
HETATM 2615 O O     . HOH G 5 .   ? 27.006 56.949 1.649   1.00 35.68 ? 477 HOH A O     1 
HETATM 2616 O O     . HOH G 5 .   ? 11.798 38.811 -6.779  1.00 32.97 ? 478 HOH A O     1 
HETATM 2617 O O     . HOH G 5 .   ? 11.179 37.707 -2.769  1.00 27.49 ? 479 HOH A O     1 
HETATM 2618 O O     . HOH G 5 .   ? 12.216 39.006 3.562   1.00 35.22 ? 480 HOH A O     1 
HETATM 2619 O O     . HOH G 5 .   ? 9.307  39.464 0.255   1.00 31.90 ? 481 HOH A O     1 
HETATM 2620 O O     . HOH G 5 .   ? 15.013 71.680 -13.229 1.00 43.25 ? 482 HOH A O     1 
HETATM 2621 O O     . HOH G 5 .   ? 9.480  69.760 -0.363  1.00 52.46 ? 483 HOH A O     1 
HETATM 2622 O O     . HOH G 5 .   ? 10.793 74.233 -9.549  1.00 52.43 ? 484 HOH A O     1 
HETATM 2623 O O     . HOH G 5 .   ? 21.768 32.544 14.466  1.00 45.48 ? 485 HOH A O     1 
HETATM 2624 O O     . HOH G 5 .   ? 15.270 37.403 11.571  1.00 49.46 ? 486 HOH A O     1 
HETATM 2625 O O     . HOH G 5 .   ? 34.210 43.424 -6.370  1.00 26.84 ? 487 HOH A O     1 
HETATM 2626 O O     . HOH G 5 .   ? 38.463 41.785 -7.317  1.00 32.38 ? 488 HOH A O     1 
HETATM 2627 O O     . HOH G 5 .   ? 42.051 40.566 -5.267  1.00 44.70 ? 489 HOH A O     1 
HETATM 2628 O O     . HOH G 5 .   ? 30.036 44.333 -8.204  1.00 51.84 ? 490 HOH A O     1 
HETATM 2629 O O     . HOH G 5 .   ? 23.759 40.772 -10.906 1.00 59.04 ? 491 HOH A O     1 
HETATM 2630 O O     . HOH G 5 .   ? 32.207 43.811 23.761  1.00 36.73 ? 492 HOH A O     1 
HETATM 2631 O O     . HOH G 5 .   ? 30.324 44.994 25.187  1.00 53.24 ? 493 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  CYT B . n 
A 1 2   DT  2   2   2   DT  THY B . n 
A 1 3   DT  3   3   3   DT  THY B . n 
A 1 4   DG  4   4   4   DG  GUA B . n 
A 1 5   DA  5   5   5   DA  ADE B . n 
A 1 6   DA  6   6   6   DA  ADE B . n 
A 1 7   DT  7   7   7   DT  THY B . n 
A 1 8   DG  8   8   8   DG  GUA B . n 
B 2 1   DC  1   9   9   DC  CYT G . n 
B 2 2   DA  2   10  10  DA  ADE G . n 
B 2 3   DT  3   11  11  DT  THY G . n 
B 2 4   DT  4   12  12  DT  THY G . n 
B 2 5   DC  5   13  13  DC  CYT G . n 
B 2 6   DA  6   14  14  DA  ADE G . n 
B 2 7   DA  7   15  15  DA  ADE G . n 
B 2 8   DG  8   16  16  DG  GUA G . n 
C 3 1   THR 1   24  24  THR THR A . n 
C 3 2   TRP 2   25  25  TRP TRP A . n 
C 3 3   LEU 3   26  26  LEU LEU A . n 
C 3 4   SER 4   27  27  SER SER A . n 
C 3 5   ASP 5   28  28  ASP ASP A . n 
C 3 6   PHE 6   29  29  PHE PHE A . n 
C 3 7   PRO 7   30  30  PRO PRO A . n 
C 3 8   GLN 8   31  31  GLN GLN A . n 
C 3 9   ALA 9   32  32  ALA ALA A . n 
C 3 10  TRP 10  33  33  TRP TRP A . n 
C 3 11  ALA 11  34  34  ALA ALA A . n 
C 3 12  GLU 12  35  35  GLU GLU A . n 
C 3 13  THR 13  36  36  THR THR A . n 
C 3 14  GLY 14  37  37  GLY GLY A . n 
C 3 15  GLY 15  38  38  GLY GLY A . n 
C 3 16  MET 16  39  39  MET MET A . n 
C 3 17  GLY 17  40  40  GLY GLY A . n 
C 3 18  LEU 18  41  41  LEU LEU A . n 
C 3 19  ALA 19  42  42  ALA ALA A . n 
C 3 20  VAL 20  43  43  VAL VAL A . n 
C 3 21  ARG 21  44  44  ARG ARG A . n 
C 3 22  GLN 22  45  45  GLN GLN A . n 
C 3 23  ALA 23  46  46  ALA ALA A . n 
C 3 24  PRO 24  47  47  PRO PRO A . n 
C 3 25  LEU 25  48  48  LEU LEU A . n 
C 3 26  ILE 26  49  49  ILE ILE A . n 
C 3 27  ILE 27  50  50  ILE ILE A . n 
C 3 28  PRO 28  51  51  PRO PRO A . n 
C 3 29  LEU 29  52  52  LEU LEU A . n 
C 3 30  LYS 30  53  53  LYS LYS A . n 
C 3 31  ALA 31  54  54  ALA ALA A . n 
C 3 32  THR 32  55  55  THR THR A . n 
C 3 33  SER 33  56  56  SER SER A . n 
C 3 34  THR 34  57  57  THR THR A . n 
C 3 35  PRO 35  58  58  PRO PRO A . n 
C 3 36  VAL 36  59  59  VAL VAL A . n 
C 3 37  SER 37  60  60  SER SER A . n 
C 3 38  ILE 38  61  61  ILE ILE A . n 
C 3 39  LYS 39  62  62  LYS LYS A . n 
C 3 40  GLN 40  63  63  GLN GLN A . n 
C 3 41  TYR 41  64  64  TYR TYR A . n 
C 3 42  PRO 42  65  65  PRO PRO A . n 
C 3 43  MET 43  66  66  MET MET A . n 
C 3 44  SER 44  67  67  SER SER A . n 
C 3 45  GLN 45  68  68  GLN GLN A . n 
C 3 46  GLU 46  69  69  GLU GLU A . n 
C 3 47  ALA 47  70  70  ALA ALA A . n 
C 3 48  ARG 48  71  71  ARG ARG A . n 
C 3 49  LEU 49  72  72  LEU LEU A . n 
C 3 50  GLY 50  73  73  GLY GLY A . n 
C 3 51  ILE 51  74  74  ILE ILE A . n 
C 3 52  LYS 52  75  75  LYS LYS A . n 
C 3 53  PRO 53  76  76  PRO PRO A . n 
C 3 54  HIS 54  77  77  HIS HIS A . n 
C 3 55  ILE 55  78  78  ILE ILE A . n 
C 3 56  GLN 56  79  79  GLN GLN A . n 
C 3 57  ARG 57  80  80  ARG ARG A . n 
C 3 58  LEU 58  81  81  LEU LEU A . n 
C 3 59  LEU 59  82  82  LEU LEU A . n 
C 3 60  ASP 60  83  83  ASP ASP A . n 
C 3 61  GLN 61  84  84  GLN GLN A . n 
C 3 62  GLY 62  85  85  GLY GLY A . n 
C 3 63  ILE 63  86  86  ILE ILE A . n 
C 3 64  LEU 64  87  87  LEU LEU A . n 
C 3 65  VAL 65  88  88  VAL VAL A . n 
C 3 66  PRO 66  89  89  PRO PRO A . n 
C 3 67  CYS 67  90  90  CYS CYS A . n 
C 3 68  GLN 68  91  91  GLN GLN A . n 
C 3 69  SER 69  92  92  SER SER A . n 
C 3 70  PRO 70  93  93  PRO PRO A . n 
C 3 71  TRP 71  94  94  TRP TRP A . n 
C 3 72  ASN 72  95  95  ASN ASN A . n 
C 3 73  THR 73  96  96  THR THR A . n 
C 3 74  PRO 74  97  97  PRO PRO A . n 
C 3 75  LEU 75  98  98  LEU LEU A . n 
C 3 76  LEU 76  99  99  LEU LEU A . n 
C 3 77  PRO 77  100 100 PRO PRO A . n 
C 3 78  VAL 78  101 101 VAL VAL A . n 
C 3 79  LYS 79  102 102 LYS LYS A . n 
C 3 80  LYS 80  103 103 LYS LYS A . n 
C 3 81  PRO 81  104 104 PRO PRO A . n 
C 3 82  GLY 82  105 105 GLY GLY A . n 
C 3 83  THR 83  106 106 THR THR A . n 
C 3 84  ASN 84  107 107 ASN ASN A . n 
C 3 85  ASP 85  108 108 ASP ASP A . n 
C 3 86  TYR 86  109 109 TYR TYR A . n 
C 3 87  ARG 87  110 110 ARG ARG A . n 
C 3 88  PRO 88  111 111 PRO PRO A . n 
C 3 89  VAL 89  112 112 VAL VAL A . n 
C 3 90  GLN 90  113 113 GLN GLN A . n 
C 3 91  ASP 91  114 114 ASP ASP A . n 
C 3 92  LEU 92  115 115 LEU LEU A . n 
C 3 93  ARG 93  116 116 ARG ARG A . n 
C 3 94  GLU 94  117 117 GLU GLU A . n 
C 3 95  VAL 95  118 118 VAL VAL A . n 
C 3 96  ASN 96  119 119 ASN ASN A . n 
C 3 97  LYS 97  120 120 LYS LYS A . n 
C 3 98  ARG 98  121 121 ARG ARG A . n 
C 3 99  VAL 99  122 122 VAL VAL A . n 
C 3 100 GLU 100 123 123 GLU GLU A . n 
C 3 101 ASP 101 124 124 ASP ASP A . n 
C 3 102 ILE 102 125 125 ILE ILE A . n 
C 3 103 HIS 103 126 126 HIS HIS A . n 
C 3 104 PRO 104 127 127 PRO PRO A . n 
C 3 105 THR 105 128 128 THR THR A . n 
C 3 106 VAL 106 129 129 VAL VAL A . n 
C 3 107 PRO 107 130 130 PRO PRO A . n 
C 3 108 ASN 108 131 131 ASN ASN A . n 
C 3 109 PRO 109 132 132 PRO PRO A . n 
C 3 110 TYR 110 133 133 TYR TYR A . n 
C 3 111 ASN 111 134 134 ASN ASN A . n 
C 3 112 LEU 112 135 135 LEU LEU A . n 
C 3 113 LEU 113 136 136 LEU LEU A . n 
C 3 114 SER 114 137 137 SER SER A . n 
C 3 115 GLY 115 138 138 GLY GLY A . n 
C 3 116 LEU 116 139 139 LEU LEU A . n 
C 3 117 PRO 117 140 140 PRO PRO A . n 
C 3 118 PRO 118 141 141 PRO PRO A . n 
C 3 119 SER 119 142 142 SER SER A . n 
C 3 120 HIS 120 143 143 HIS HIS A . n 
C 3 121 GLN 121 144 144 GLN GLN A . n 
C 3 122 TRP 122 145 145 TRP TRP A . n 
C 3 123 TYR 123 146 146 TYR TYR A . n 
C 3 124 THR 124 147 147 THR THR A . n 
C 3 125 VAL 125 148 148 VAL VAL A . n 
C 3 126 LEU 126 149 149 LEU LEU A . n 
C 3 127 ASP 127 150 150 ASP ASP A . n 
C 3 128 LEU 128 151 151 LEU LEU A . n 
C 3 129 LYS 129 152 152 LYS LYS A . n 
C 3 130 ASP 130 153 153 ASP ASP A . n 
C 3 131 ALA 131 154 154 ALA ALA A . n 
C 3 132 PHE 132 155 155 PHE PHE A . n 
C 3 133 PHE 133 156 156 PHE PHE A . n 
C 3 134 CYS 134 157 157 CYS CYS A . n 
C 3 135 LEU 135 158 158 LEU LEU A . n 
C 3 136 ARG 136 159 159 ARG ARG A . n 
C 3 137 LEU 137 160 160 LEU LEU A . n 
C 3 138 HIS 138 161 161 HIS HIS A . n 
C 3 139 PRO 139 162 162 PRO PRO A . n 
C 3 140 THR 140 163 163 THR THR A . n 
C 3 141 SER 141 164 164 SER SER A . n 
C 3 142 GLN 142 165 165 GLN GLN A . n 
C 3 143 PRO 143 166 166 PRO PRO A . n 
C 3 144 LEU 144 167 167 LEU LEU A . n 
C 3 145 PHE 145 168 168 PHE PHE A . n 
C 3 146 ALA 146 169 169 ALA ALA A . n 
C 3 147 PHE 147 170 170 PHE PHE A . n 
C 3 148 GLU 148 171 171 GLU GLU A . n 
C 3 149 TRP 149 172 172 TRP TRP A . n 
C 3 150 ARG 150 173 173 ARG ARG A . n 
C 3 151 ASP 151 174 174 ASP ASP A . n 
C 3 152 PRO 152 175 175 PRO PRO A . n 
C 3 153 GLU 153 176 176 GLU GLU A . n 
C 3 154 MET 154 177 177 MET MET A . n 
C 3 155 GLY 155 178 178 GLY GLY A . n 
C 3 156 ILE 156 179 179 ILE ILE A . n 
C 3 157 SER 157 180 180 SER SER A . n 
C 3 158 GLY 158 181 181 GLY GLY A . n 
C 3 159 GLN 159 182 182 GLN GLN A . n 
C 3 160 LEU 160 183 183 LEU LEU A . n 
C 3 161 THR 161 184 184 THR THR A . n 
C 3 162 TRP 162 185 185 TRP TRP A . n 
C 3 163 THR 163 186 186 THR THR A . n 
C 3 164 ARG 164 187 187 ARG ARG A . n 
C 3 165 LEU 165 188 188 LEU LEU A . n 
C 3 166 PRO 166 189 189 PRO PRO A . n 
C 3 167 GLN 167 190 190 GLN GLN A . n 
C 3 168 GLY 168 191 191 GLY GLY A . n 
C 3 169 PHE 169 192 192 PHE PHE A . n 
C 3 170 LYS 170 193 193 LYS LYS A . n 
C 3 171 ASN 171 194 194 ASN ASN A . n 
C 3 172 SER 172 195 195 SER SER A . n 
C 3 173 PRO 173 196 196 PRO PRO A . n 
C 3 174 THR 174 197 197 THR THR A . n 
C 3 175 LEU 175 198 198 LEU LEU A . n 
C 3 176 PHE 176 199 199 PHE PHE A . n 
C 3 177 ASP 177 200 200 ASP ASP A . n 
C 3 178 GLU 178 201 201 GLU GLU A . n 
C 3 179 ALA 179 202 202 ALA ALA A . n 
C 3 180 LEU 180 203 203 LEU LEU A . n 
C 3 181 HIS 181 204 204 HIS HIS A . n 
C 3 182 ARG 182 205 205 ARG ARG A . n 
C 3 183 ASP 183 206 206 ASP ASP A . n 
C 3 184 LEU 184 207 207 LEU LEU A . n 
C 3 185 ALA 185 208 208 ALA ALA A . n 
C 3 186 ASP 186 209 209 ASP ASP A . n 
C 3 187 PHE 187 210 210 PHE PHE A . n 
C 3 188 ARG 188 211 211 ARG ARG A . n 
C 3 189 ILE 189 212 212 ILE ILE A . n 
C 3 190 GLN 190 213 213 GLN GLN A . n 
C 3 191 HIS 191 214 214 HIS HIS A . n 
C 3 192 PRO 192 215 215 PRO PRO A . n 
C 3 193 ASP 193 216 216 ASP ASP A . n 
C 3 194 LEU 194 217 217 LEU LEU A . n 
C 3 195 ILE 195 218 218 ILE ILE A . n 
C 3 196 LEU 196 219 219 LEU LEU A . n 
C 3 197 LEU 197 220 220 LEU LEU A . n 
C 3 198 GLN 198 221 221 GLN GLN A . n 
C 3 199 TYR 199 222 222 TYR TYR A . n 
C 3 200 VAL 200 223 223 VAL VAL A . n 
C 3 201 ASP 201 224 224 ASP ASP A . n 
C 3 202 ASP 202 225 225 ASP ASP A . n 
C 3 203 LEU 203 226 226 LEU LEU A . n 
C 3 204 LEU 204 227 227 LEU LEU A . n 
C 3 205 LEU 205 228 228 LEU LEU A . n 
C 3 206 ALA 206 229 229 ALA ALA A . n 
C 3 207 ALA 207 230 230 ALA ALA A . n 
C 3 208 THR 208 231 231 THR THR A . n 
C 3 209 SER 209 232 232 SER SER A . n 
C 3 210 GLU 210 233 233 GLU GLU A . n 
C 3 211 LEU 211 234 234 LEU LEU A . n 
C 3 212 ASP 212 235 235 ASP ASP A . n 
C 3 213 CYS 213 236 236 CYS CYS A . n 
C 3 214 GLN 214 237 237 GLN GLN A . n 
C 3 215 GLN 215 238 238 GLN GLN A . n 
C 3 216 GLY 216 239 239 GLY GLY A . n 
C 3 217 THR 217 240 240 THR THR A . n 
C 3 218 ARG 218 241 241 ARG ARG A . n 
C 3 219 ALA 219 242 242 ALA ALA A . n 
C 3 220 LEU 220 243 243 LEU LEU A . n 
C 3 221 LEU 221 244 244 LEU LEU A . n 
C 3 222 GLN 222 245 245 GLN GLN A . n 
C 3 223 THR 223 246 246 THR THR A . n 
C 3 224 LEU 224 247 247 LEU LEU A . n 
C 3 225 GLY 225 248 248 GLY GLY A . n 
C 3 226 ASN 226 249 249 ASN ASN A . n 
C 3 227 LEU 227 250 250 LEU LEU A . n 
C 3 228 GLY 228 251 251 GLY GLY A . n 
C 3 229 TYR 229 252 252 TYR TYR A . n 
C 3 230 ARG 230 253 253 ARG ARG A . n 
C 3 231 ALA 231 254 254 ALA ALA A . n 
C 3 232 SER 232 255 255 SER SER A . n 
C 3 233 ALA 233 256 256 ALA ALA A . n 
C 3 234 LYS 234 257 257 LYS LYS A . n 
C 3 235 LYS 235 258 258 LYS LYS A . n 
C 3 236 ALA 236 259 259 ALA ALA A . n 
C 3 237 GLN 237 260 260 GLN GLN A . n 
C 3 238 ILE 238 261 261 ILE ILE A . n 
C 3 239 CYS 239 262 262 CYS CYS A . n 
C 3 240 GLN 240 263 263 GLN GLN A . n 
C 3 241 LYS 241 264 264 LYS LYS A . n 
C 3 242 GLN 242 265 265 GLN GLN A . n 
C 3 243 VAL 243 266 266 VAL VAL A . n 
C 3 244 LYS 244 267 267 LYS LYS A . n 
C 3 245 TYR 245 268 268 TYR TYR A . n 
C 3 246 LEU 246 269 269 LEU LEU A . n 
C 3 247 GLY 247 270 270 GLY GLY A . n 
C 3 248 TYR 248 271 271 TYR TYR A . n 
C 3 249 LEU 249 272 272 LEU LEU A . n 
C 3 250 LEU 250 273 273 LEU LEU A . n 
C 3 251 LYS 251 274 274 LYS LYS A . n 
C 3 252 GLU 252 275 275 GLU GLU A . n 
C 3 253 GLY 253 276 276 GLY GLY A . n 
C 3 254 GLN 254 277 277 GLN GLN A . n 
C 3 255 ARG 255 278 278 ARG ARG A . n 
# 
_struct_site_keywords.site_id   1 
_struct_site_keywords.text      'minor groove binder' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_765 -x+2,-y+1,z -1.0000000000 0.0000000000 0.0000000000 109.4980000000 0.0000000000 -1.0000000000 
0.0000000000 145.4500000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-27 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .   ? 1 
SCALEPACK 'data scaling'    .   ? 2 
AMoRE     phasing           .   ? 3 
CNS       refinement        1.0 ? 4 
HKL-2000  'data reduction'  .   ? 5 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    "O3'" 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    DG 
_pdbx_validate_symm_contact.auth_seq_id_1     8 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    P 
_pdbx_validate_symm_contact.auth_asym_id_2    G 
_pdbx_validate_symm_contact.auth_comp_id_2    DC 
_pdbx_validate_symm_contact.auth_seq_id_2     9 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_765 
_pdbx_validate_symm_contact.dist              1.61 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 41  ? ? -171.04 114.29  
2  1 LYS A 103 ? ? -135.78 -72.98  
3  1 PRO A 104 ? ? -56.72  -90.51  
4  1 THR A 106 ? ? -69.11  16.97   
5  1 ASN A 107 ? ? -109.06 -159.72 
6  1 ASP A 108 ? ? 36.92   83.39   
7  1 ARG A 110 ? ? -170.75 132.73  
8  1 PRO A 175 ? ? -48.50  8.26    
9  1 GLU A 176 ? ? -172.16 -37.78  
10 1 MET A 177 ? ? -170.08 105.64  
11 1 ILE A 179 ? ? -34.39  150.79  
12 1 VAL A 223 ? ? 59.02   -104.81 
13 1 CYS A 262 ? ? 32.81   72.58   
# 
_ndb_struct_conf_na.entry_id   2FJX 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 1 1_555 B DG 8 1_555 0.004  -0.069 0.137  -15.612 -0.415  -2.467 1 B_DC1:DG16_G B 1 ? G 16 ? 19 1 
1 A DT 2 1_555 B DA 7 1_555 -0.108 -0.134 0.285  -16.223 -8.430  2.669  2 B_DT2:DA15_G B 2 ? G 15 ? 20 1 
1 A DT 3 1_555 B DA 6 1_555 -0.058 -0.184 -0.300 5.090   -11.388 10.733 3 B_DT3:DA14_G B 3 ? G 14 ? 20 1 
1 A DG 4 1_555 B DC 5 1_555 0.267  -0.281 -0.413 6.563   -7.452  4.677  4 B_DG4:DC13_G B 4 ? G 13 ? 19 1 
1 A DA 5 1_555 B DT 4 1_555 -0.202 0.132  -0.111 0.454   -14.773 6.423  5 B_DA5:DT12_G B 5 ? G 12 ? 20 1 
1 A DA 6 1_555 B DT 3 1_555 0.381  0.027  0.057  -2.089  -16.683 4.326  6 B_DA6:DT11_G B 6 ? G 11 ? 20 1 
1 A DT 7 1_555 B DA 2 1_555 0.213  0.091  0.242  2.818   -6.892  4.902  7 B_DT7:DA10_G B 7 ? G 10 ? 20 1 
1 A DG 8 1_555 B DC 1 1_555 -0.846 -0.425 0.163  1.921   -1.831  0.580  8 B_DG8:DC9_G  B 8 ? G 9  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 1 1_555 B DG 8 1_555 A DT 2 1_555 B DA 7 1_555 0.327  0.099  3.351 0.440  4.989  34.857 -0.598 -0.474 3.337 8.275  -0.730 
35.204 1 BB_DC1DT2:DA15DG16_GG B 1 ? G 16 ? B 2 ? G 15 ? 
1 A DT 2 1_555 B DA 7 1_555 A DT 3 1_555 B DA 6 1_555 0.005  -0.287 2.749 4.794  3.146  30.832 -1.027 0.746  2.677 5.855  -8.920 
31.348 2 BB_DT2DT3:DA14DA15_GG B 2 ? G 15 ? B 3 ? G 14 ? 
1 A DT 3 1_555 B DA 6 1_555 A DG 4 1_555 B DC 5 1_555 -0.307 0.490  3.318 0.549  11.645 34.109 -0.932 0.579  3.299 19.171 -0.904 
35.990 3 BB_DT3DG4:DC13DA14_GG B 3 ? G 14 ? B 4 ? G 13 ? 
1 A DG 4 1_555 B DC 5 1_555 A DA 5 1_555 B DT 4 1_555 0.033  -0.116 3.310 -2.554 2.240  31.636 -0.625 -0.532 3.281 4.093  4.668  
31.814 4 BB_DG4DA5:DT12DC13_GG B 4 ? G 13 ? B 5 ? G 12 ? 
1 A DA 5 1_555 B DT 4 1_555 A DA 6 1_555 B DT 3 1_555 -0.172 -0.118 3.259 -0.900 0.825  38.924 -0.277 0.150  3.259 1.238  1.350  
38.943 5 BB_DA5DA6:DT11DT12_GG B 5 ? G 12 ? B 6 ? G 11 ? 
1 A DA 6 1_555 B DT 3 1_555 A DT 7 1_555 B DA 2 1_555 0.231  -1.001 3.178 -0.731 0.220  33.320 -1.781 -0.520 3.166 0.384  1.274  
33.329 6 BB_DA6DT7:DA10DT11_GG B 6 ? G 11 ? B 7 ? G 10 ? 
1 A DT 7 1_555 B DA 2 1_555 A DG 8 1_555 B DC 1 1_555 0.412  -0.200 3.265 2.338  -0.286 32.901 -0.303 -0.327 3.287 -0.503 -4.122 
32.983 7 BB_DT7DG8:DC9DA10_GG  B 7 ? G 10 ? B 8 ? G 9  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 '2-(4-(4-CARBAMIMIDOYLPHENOXY)PHENYL)-1H-BENZO[D]IMIDAZOLE-6-CARBOXIMIDAMIDE' HXL 
5 water                                                                         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HXL 1   301 1   HXL HXL B . 
E 5 HOH 1   129 129 HOH TIP B . 
E 5 HOH 2   179 179 HOH TIP B . 
E 5 HOH 3   184 184 HOH TIP B . 
F 5 HOH 1   48  48  HOH TIP G . 
F 5 HOH 2   114 114 HOH TIP G . 
F 5 HOH 3   127 127 HOH TIP G . 
F 5 HOH 4   147 147 HOH TIP G . 
F 5 HOH 5   169 169 HOH TIP G . 
F 5 HOH 6   170 170 HOH TIP G . 
F 5 HOH 7   182 182 HOH TIP G . 
G 5 HOH 1   279 1   HOH TIP A . 
G 5 HOH 2   280 2   HOH TIP A . 
G 5 HOH 3   281 3   HOH TIP A . 
G 5 HOH 4   282 4   HOH TIP A . 
G 5 HOH 5   283 5   HOH TIP A . 
G 5 HOH 6   284 6   HOH TIP A . 
G 5 HOH 7   285 7   HOH TIP A . 
G 5 HOH 8   286 8   HOH TIP A . 
G 5 HOH 9   287 9   HOH TIP A . 
G 5 HOH 10  288 10  HOH TIP A . 
G 5 HOH 11  289 11  HOH TIP A . 
G 5 HOH 12  290 12  HOH TIP A . 
G 5 HOH 13  291 13  HOH TIP A . 
G 5 HOH 14  292 14  HOH TIP A . 
G 5 HOH 15  293 15  HOH TIP A . 
G 5 HOH 16  294 16  HOH TIP A . 
G 5 HOH 17  295 17  HOH TIP A . 
G 5 HOH 18  296 18  HOH TIP A . 
G 5 HOH 19  297 19  HOH TIP A . 
G 5 HOH 20  298 20  HOH TIP A . 
G 5 HOH 21  299 21  HOH TIP A . 
G 5 HOH 22  300 22  HOH TIP A . 
G 5 HOH 23  301 23  HOH TIP A . 
G 5 HOH 24  302 24  HOH TIP A . 
G 5 HOH 25  303 25  HOH TIP A . 
G 5 HOH 26  304 26  HOH TIP A . 
G 5 HOH 27  305 27  HOH TIP A . 
G 5 HOH 28  306 28  HOH TIP A . 
G 5 HOH 29  307 29  HOH TIP A . 
G 5 HOH 30  308 30  HOH TIP A . 
G 5 HOH 31  309 31  HOH TIP A . 
G 5 HOH 32  310 32  HOH TIP A . 
G 5 HOH 33  311 33  HOH TIP A . 
G 5 HOH 34  312 34  HOH TIP A . 
G 5 HOH 35  313 35  HOH TIP A . 
G 5 HOH 36  314 36  HOH TIP A . 
G 5 HOH 37  315 37  HOH TIP A . 
G 5 HOH 38  316 38  HOH TIP A . 
G 5 HOH 39  317 39  HOH TIP A . 
G 5 HOH 40  318 40  HOH TIP A . 
G 5 HOH 41  319 41  HOH TIP A . 
G 5 HOH 42  320 42  HOH TIP A . 
G 5 HOH 43  321 43  HOH TIP A . 
G 5 HOH 44  322 44  HOH TIP A . 
G 5 HOH 45  323 45  HOH TIP A . 
G 5 HOH 46  324 46  HOH TIP A . 
G 5 HOH 47  325 47  HOH TIP A . 
G 5 HOH 48  326 49  HOH TIP A . 
G 5 HOH 49  327 50  HOH TIP A . 
G 5 HOH 50  328 51  HOH TIP A . 
G 5 HOH 51  329 52  HOH TIP A . 
G 5 HOH 52  330 53  HOH TIP A . 
G 5 HOH 53  331 54  HOH TIP A . 
G 5 HOH 54  332 55  HOH TIP A . 
G 5 HOH 55  333 56  HOH TIP A . 
G 5 HOH 56  334 57  HOH TIP A . 
G 5 HOH 57  335 58  HOH TIP A . 
G 5 HOH 58  336 59  HOH TIP A . 
G 5 HOH 59  337 60  HOH TIP A . 
G 5 HOH 60  338 61  HOH TIP A . 
G 5 HOH 61  339 62  HOH TIP A . 
G 5 HOH 62  340 63  HOH TIP A . 
G 5 HOH 63  341 64  HOH TIP A . 
G 5 HOH 64  342 65  HOH TIP A . 
G 5 HOH 65  343 66  HOH TIP A . 
G 5 HOH 66  344 67  HOH TIP A . 
G 5 HOH 67  345 68  HOH TIP A . 
G 5 HOH 68  346 69  HOH TIP A . 
G 5 HOH 69  347 70  HOH TIP A . 
G 5 HOH 70  348 71  HOH TIP A . 
G 5 HOH 71  349 72  HOH TIP A . 
G 5 HOH 72  350 73  HOH TIP A . 
G 5 HOH 73  351 74  HOH TIP A . 
G 5 HOH 74  352 75  HOH TIP A . 
G 5 HOH 75  353 76  HOH TIP A . 
G 5 HOH 76  354 77  HOH TIP A . 
G 5 HOH 77  355 78  HOH TIP A . 
G 5 HOH 78  356 79  HOH TIP A . 
G 5 HOH 79  357 80  HOH TIP A . 
G 5 HOH 80  358 81  HOH TIP A . 
G 5 HOH 81  359 82  HOH TIP A . 
G 5 HOH 82  360 83  HOH TIP A . 
G 5 HOH 83  361 84  HOH TIP A . 
G 5 HOH 84  362 85  HOH TIP A . 
G 5 HOH 85  363 86  HOH TIP A . 
G 5 HOH 86  364 87  HOH TIP A . 
G 5 HOH 87  365 88  HOH TIP A . 
G 5 HOH 88  366 89  HOH TIP A . 
G 5 HOH 89  367 90  HOH TIP A . 
G 5 HOH 90  368 91  HOH TIP A . 
G 5 HOH 91  369 92  HOH TIP A . 
G 5 HOH 92  370 93  HOH TIP A . 
G 5 HOH 93  371 94  HOH TIP A . 
G 5 HOH 94  372 95  HOH TIP A . 
G 5 HOH 95  373 96  HOH TIP A . 
G 5 HOH 96  374 97  HOH TIP A . 
G 5 HOH 97  375 98  HOH TIP A . 
G 5 HOH 98  376 99  HOH TIP A . 
G 5 HOH 99  377 100 HOH TIP A . 
G 5 HOH 100 378 101 HOH TIP A . 
G 5 HOH 101 379 102 HOH TIP A . 
G 5 HOH 102 380 103 HOH TIP A . 
G 5 HOH 103 381 104 HOH TIP A . 
G 5 HOH 104 382 105 HOH TIP A . 
G 5 HOH 105 383 106 HOH TIP A . 
G 5 HOH 106 384 107 HOH TIP A . 
G 5 HOH 107 385 108 HOH TIP A . 
G 5 HOH 108 386 109 HOH TIP A . 
G 5 HOH 109 387 110 HOH TIP A . 
G 5 HOH 110 388 111 HOH TIP A . 
G 5 HOH 111 389 112 HOH TIP A . 
G 5 HOH 112 390 113 HOH TIP A . 
G 5 HOH 113 391 115 HOH TIP A . 
G 5 HOH 114 392 116 HOH TIP A . 
G 5 HOH 115 393 117 HOH TIP A . 
G 5 HOH 116 394 118 HOH TIP A . 
G 5 HOH 117 395 119 HOH TIP A . 
G 5 HOH 118 396 120 HOH TIP A . 
G 5 HOH 119 397 121 HOH TIP A . 
G 5 HOH 120 398 122 HOH TIP A . 
G 5 HOH 121 399 123 HOH TIP A . 
G 5 HOH 122 400 124 HOH TIP A . 
G 5 HOH 123 401 125 HOH TIP A . 
G 5 HOH 124 402 126 HOH TIP A . 
G 5 HOH 125 403 128 HOH TIP A . 
G 5 HOH 126 404 130 HOH TIP A . 
G 5 HOH 127 405 131 HOH TIP A . 
G 5 HOH 128 406 132 HOH TIP A . 
G 5 HOH 129 407 133 HOH TIP A . 
G 5 HOH 130 408 134 HOH TIP A . 
G 5 HOH 131 409 135 HOH TIP A . 
G 5 HOH 132 410 136 HOH TIP A . 
G 5 HOH 133 411 137 HOH TIP A . 
G 5 HOH 134 412 138 HOH TIP A . 
G 5 HOH 135 413 139 HOH TIP A . 
G 5 HOH 136 414 140 HOH TIP A . 
G 5 HOH 137 415 141 HOH TIP A . 
G 5 HOH 138 416 142 HOH TIP A . 
G 5 HOH 139 417 143 HOH TIP A . 
G 5 HOH 140 418 144 HOH TIP A . 
G 5 HOH 141 419 145 HOH TIP A . 
G 5 HOH 142 420 146 HOH TIP A . 
G 5 HOH 143 421 148 HOH TIP A . 
G 5 HOH 144 422 149 HOH TIP A . 
G 5 HOH 145 423 150 HOH TIP A . 
G 5 HOH 146 424 151 HOH TIP A . 
G 5 HOH 147 425 152 HOH TIP A . 
G 5 HOH 148 426 153 HOH TIP A . 
G 5 HOH 149 427 154 HOH TIP A . 
G 5 HOH 150 428 155 HOH TIP A . 
G 5 HOH 151 429 156 HOH TIP A . 
G 5 HOH 152 430 157 HOH TIP A . 
G 5 HOH 153 431 158 HOH TIP A . 
G 5 HOH 154 432 159 HOH TIP A . 
G 5 HOH 155 433 160 HOH TIP A . 
G 5 HOH 156 434 161 HOH TIP A . 
G 5 HOH 157 435 162 HOH TIP A . 
G 5 HOH 158 436 163 HOH TIP A . 
G 5 HOH 159 437 164 HOH TIP A . 
G 5 HOH 160 438 165 HOH TIP A . 
G 5 HOH 161 439 166 HOH TIP A . 
G 5 HOH 162 440 167 HOH TIP A . 
G 5 HOH 163 441 168 HOH TIP A . 
G 5 HOH 164 442 171 HOH TIP A . 
G 5 HOH 165 443 172 HOH TIP A . 
G 5 HOH 166 444 173 HOH TIP A . 
G 5 HOH 167 445 174 HOH TIP A . 
G 5 HOH 168 446 175 HOH TIP A . 
G 5 HOH 169 447 176 HOH TIP A . 
G 5 HOH 170 448 177 HOH TIP A . 
G 5 HOH 171 449 178 HOH TIP A . 
G 5 HOH 172 450 180 HOH TIP A . 
G 5 HOH 173 451 181 HOH TIP A . 
G 5 HOH 174 452 183 HOH TIP A . 
G 5 HOH 175 453 185 HOH TIP A . 
G 5 HOH 176 454 186 HOH TIP A . 
G 5 HOH 177 455 187 HOH TIP A . 
G 5 HOH 178 456 188 HOH TIP A . 
G 5 HOH 179 457 189 HOH TIP A . 
G 5 HOH 180 458 190 HOH TIP A . 
G 5 HOH 181 459 191 HOH TIP A . 
G 5 HOH 182 460 193 HOH TIP A . 
G 5 HOH 183 461 194 HOH TIP A . 
G 5 HOH 184 462 195 HOH TIP A . 
G 5 HOH 185 463 196 HOH TIP A . 
G 5 HOH 186 464 197 HOH TIP A . 
G 5 HOH 187 465 198 HOH TIP A . 
G 5 HOH 188 466 199 HOH TIP A . 
G 5 HOH 189 467 200 HOH TIP A . 
G 5 HOH 190 468 201 HOH TIP A . 
G 5 HOH 191 469 202 HOH TIP A . 
G 5 HOH 192 470 203 HOH TIP A . 
G 5 HOH 193 471 204 HOH TIP A . 
G 5 HOH 194 472 205 HOH TIP A . 
G 5 HOH 195 473 206 HOH TIP A . 
G 5 HOH 196 474 207 HOH TIP A . 
G 5 HOH 197 475 208 HOH TIP A . 
G 5 HOH 198 476 209 HOH TIP A . 
G 5 HOH 199 477 210 HOH TIP A . 
G 5 HOH 200 478 211 HOH TIP A . 
G 5 HOH 201 479 212 HOH TIP A . 
G 5 HOH 202 480 213 HOH TIP A . 
G 5 HOH 203 481 214 HOH TIP A . 
G 5 HOH 204 482 215 HOH TIP A . 
G 5 HOH 205 483 216 HOH TIP A . 
G 5 HOH 206 484 217 HOH TIP A . 
G 5 HOH 207 485 218 HOH TIP A . 
G 5 HOH 208 486 219 HOH TIP A . 
G 5 HOH 209 487 220 HOH TIP A . 
G 5 HOH 210 488 221 HOH TIP A . 
G 5 HOH 211 489 222 HOH TIP A . 
G 5 HOH 212 490 223 HOH TIP A . 
G 5 HOH 213 491 224 HOH TIP A . 
G 5 HOH 214 492 225 HOH TIP A . 
G 5 HOH 215 493 226 HOH TIP A . 
#