data_2FQ6
# 
_entry.id   2FQ6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FQ6         
RCSB  RCSB036177   
WWPDB D_1000036177 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FQ6 
_pdbx_database_status.recvd_initial_deposition_date   2006-01-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Junop, M.S.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Inhibitors of bacterial cystathionine beta-lyase: leads for new antimicrobial agents and probes of enzyme structure and function.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            50 
_citation.page_first                755 
_citation.page_last                 764 
_citation.year                      2007 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17300162 
_citation.pdbx_database_id_DOI      10.1021/jm061132r 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ejim, L.J.'      1 
primary 'Blanchard, J.E.' 2 
primary 'Koteva, K.P.'    3 
primary 'Sumerfield, R.'  4 
primary 'Elowe, N.H.'     5 
primary 'Chechetto, J.D.' 6 
primary 'Brown, E.D.'     7 
primary 'Junop, M.S.'     8 
primary 'Wright, G.D.'    9 
# 
_cell.entry_id           2FQ6 
_cell.length_a           59.830 
_cell.length_b           153.470 
_cell.length_c           151.450 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2FQ6 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cystathionine beta-lyase' 45432.629 2   4.4.1.8 ? ? ? 
2 non-polymer syn 
'PHOSPHORIC ACID MONO-(5-HYDROXY-6-METHYL-4-{[2-(2-TRIFLUOROMETHYL-BENZOYLAMINO)-ACETYL]-HYDRAZONOMETHYL}-PYRIDIN-3-YLMETHYL)ESTER' 
490.327   2   ?       ? ? ? 
3 water       nat water 18.015    918 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CBL, Beta-cystathionase, Cysteine lyase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRRG
TLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADI
VKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMI
GTAVCNARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFW
KRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGTLIRLHIGLEDV
DDLIADLDAGFARIV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRRG
TLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADI
VKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMI
GTAVCNARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFW
KRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGTLIRLHIGLEDV
DDLIADLDAGFARIV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  ALA n 
1 23  ASP n 
1 24  LYS n 
1 25  LYS n 
1 26  LEU n 
1 27  ASP n 
1 28  THR n 
1 29  GLN n 
1 30  LEU n 
1 31  VAL n 
1 32  ASN n 
1 33  ALA n 
1 34  GLY n 
1 35  ARG n 
1 36  SER n 
1 37  LYS n 
1 38  LYS n 
1 39  TYR n 
1 40  THR n 
1 41  LEU n 
1 42  GLY n 
1 43  ALA n 
1 44  VAL n 
1 45  ASN n 
1 46  SER n 
1 47  VAL n 
1 48  ILE n 
1 49  GLN n 
1 50  ARG n 
1 51  ALA n 
1 52  SER n 
1 53  SER n 
1 54  LEU n 
1 55  VAL n 
1 56  PHE n 
1 57  ASP n 
1 58  SER n 
1 59  VAL n 
1 60  GLU n 
1 61  ALA n 
1 62  LYS n 
1 63  LYS n 
1 64  HIS n 
1 65  ALA n 
1 66  THR n 
1 67  ARG n 
1 68  ASN n 
1 69  ARG n 
1 70  ALA n 
1 71  ASN n 
1 72  GLY n 
1 73  GLU n 
1 74  LEU n 
1 75  PHE n 
1 76  TYR n 
1 77  GLY n 
1 78  ARG n 
1 79  ARG n 
1 80  GLY n 
1 81  THR n 
1 82  LEU n 
1 83  THR n 
1 84  HIS n 
1 85  PHE n 
1 86  SER n 
1 87  LEU n 
1 88  GLN n 
1 89  GLN n 
1 90  ALA n 
1 91  MET n 
1 92  CYS n 
1 93  GLU n 
1 94  LEU n 
1 95  GLU n 
1 96  GLY n 
1 97  GLY n 
1 98  ALA n 
1 99  GLY n 
1 100 CYS n 
1 101 VAL n 
1 102 LEU n 
1 103 PHE n 
1 104 PRO n 
1 105 CYS n 
1 106 GLY n 
1 107 ALA n 
1 108 ALA n 
1 109 ALA n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 SER n 
1 114 ILE n 
1 115 LEU n 
1 116 ALA n 
1 117 PHE n 
1 118 ILE n 
1 119 GLU n 
1 120 GLN n 
1 121 GLY n 
1 122 ASP n 
1 123 HIS n 
1 124 VAL n 
1 125 LEU n 
1 126 MET n 
1 127 THR n 
1 128 ASN n 
1 129 THR n 
1 130 ALA n 
1 131 TYR n 
1 132 GLU n 
1 133 PRO n 
1 134 SER n 
1 135 GLN n 
1 136 ASP n 
1 137 PHE n 
1 138 CYS n 
1 139 SER n 
1 140 LYS n 
1 141 ILE n 
1 142 LEU n 
1 143 SER n 
1 144 LYS n 
1 145 LEU n 
1 146 GLY n 
1 147 VAL n 
1 148 THR n 
1 149 THR n 
1 150 SER n 
1 151 TRP n 
1 152 PHE n 
1 153 ASP n 
1 154 PRO n 
1 155 LEU n 
1 156 ILE n 
1 157 GLY n 
1 158 ALA n 
1 159 ASP n 
1 160 ILE n 
1 161 VAL n 
1 162 LYS n 
1 163 HIS n 
1 164 LEU n 
1 165 GLN n 
1 166 PRO n 
1 167 ASN n 
1 168 THR n 
1 169 LYS n 
1 170 ILE n 
1 171 VAL n 
1 172 PHE n 
1 173 LEU n 
1 174 GLU n 
1 175 SER n 
1 176 PRO n 
1 177 GLY n 
1 178 SER n 
1 179 ILE n 
1 180 THR n 
1 181 MET n 
1 182 GLU n 
1 183 VAL n 
1 184 HIS n 
1 185 ASP n 
1 186 VAL n 
1 187 PRO n 
1 188 ALA n 
1 189 ILE n 
1 190 VAL n 
1 191 ALA n 
1 192 ALA n 
1 193 VAL n 
1 194 ARG n 
1 195 SER n 
1 196 VAL n 
1 197 VAL n 
1 198 PRO n 
1 199 ASP n 
1 200 ALA n 
1 201 ILE n 
1 202 ILE n 
1 203 MET n 
1 204 ILE n 
1 205 ASP n 
1 206 ASN n 
1 207 THR n 
1 208 TRP n 
1 209 ALA n 
1 210 ALA n 
1 211 GLY n 
1 212 VAL n 
1 213 LEU n 
1 214 PHE n 
1 215 LYS n 
1 216 ALA n 
1 217 LEU n 
1 218 ASP n 
1 219 PHE n 
1 220 GLY n 
1 221 ILE n 
1 222 ASP n 
1 223 VAL n 
1 224 SER n 
1 225 ILE n 
1 226 GLN n 
1 227 ALA n 
1 228 ALA n 
1 229 THR n 
1 230 LYS n 
1 231 TYR n 
1 232 LEU n 
1 233 VAL n 
1 234 GLY n 
1 235 HIS n 
1 236 SER n 
1 237 ASP n 
1 238 ALA n 
1 239 MET n 
1 240 ILE n 
1 241 GLY n 
1 242 THR n 
1 243 ALA n 
1 244 VAL n 
1 245 CYS n 
1 246 ASN n 
1 247 ALA n 
1 248 ARG n 
1 249 CYS n 
1 250 TRP n 
1 251 GLU n 
1 252 GLN n 
1 253 LEU n 
1 254 ARG n 
1 255 GLU n 
1 256 ASN n 
1 257 ALA n 
1 258 TYR n 
1 259 LEU n 
1 260 MET n 
1 261 GLY n 
1 262 GLN n 
1 263 MET n 
1 264 VAL n 
1 265 ASP n 
1 266 ALA n 
1 267 ASP n 
1 268 THR n 
1 269 ALA n 
1 270 TYR n 
1 271 ILE n 
1 272 THR n 
1 273 SER n 
1 274 ARG n 
1 275 GLY n 
1 276 LEU n 
1 277 ARG n 
1 278 THR n 
1 279 LEU n 
1 280 GLY n 
1 281 VAL n 
1 282 ARG n 
1 283 LEU n 
1 284 ARG n 
1 285 GLN n 
1 286 HIS n 
1 287 HIS n 
1 288 GLU n 
1 289 SER n 
1 290 SER n 
1 291 LEU n 
1 292 LYS n 
1 293 VAL n 
1 294 ALA n 
1 295 GLU n 
1 296 TRP n 
1 297 LEU n 
1 298 ALA n 
1 299 GLU n 
1 300 HIS n 
1 301 PRO n 
1 302 GLN n 
1 303 VAL n 
1 304 ALA n 
1 305 ARG n 
1 306 VAL n 
1 307 ASN n 
1 308 HIS n 
1 309 PRO n 
1 310 ALA n 
1 311 LEU n 
1 312 PRO n 
1 313 GLY n 
1 314 SER n 
1 315 LYS n 
1 316 GLY n 
1 317 HIS n 
1 318 GLU n 
1 319 PHE n 
1 320 TRP n 
1 321 LYS n 
1 322 ARG n 
1 323 ASP n 
1 324 PHE n 
1 325 THR n 
1 326 GLY n 
1 327 SER n 
1 328 SER n 
1 329 GLY n 
1 330 LEU n 
1 331 PHE n 
1 332 SER n 
1 333 PHE n 
1 334 VAL n 
1 335 LEU n 
1 336 LYS n 
1 337 LYS n 
1 338 LYS n 
1 339 LEU n 
1 340 ASN n 
1 341 ASN n 
1 342 GLU n 
1 343 GLU n 
1 344 LEU n 
1 345 ALA n 
1 346 ASN n 
1 347 TYR n 
1 348 LEU n 
1 349 ASP n 
1 350 ASN n 
1 351 PHE n 
1 352 SER n 
1 353 LEU n 
1 354 PHE n 
1 355 SER n 
1 356 MET n 
1 357 ALA n 
1 358 TYR n 
1 359 SER n 
1 360 TRP n 
1 361 GLY n 
1 362 GLY n 
1 363 TYR n 
1 364 GLU n 
1 365 SER n 
1 366 LEU n 
1 367 ILE n 
1 368 LEU n 
1 369 ALA n 
1 370 ASN n 
1 371 GLN n 
1 372 PRO n 
1 373 GLU n 
1 374 HIS n 
1 375 ILE n 
1 376 ALA n 
1 377 ALA n 
1 378 ILE n 
1 379 ARG n 
1 380 PRO n 
1 381 GLN n 
1 382 GLY n 
1 383 GLU n 
1 384 ILE n 
1 385 ASP n 
1 386 PHE n 
1 387 SER n 
1 388 GLY n 
1 389 THR n 
1 390 LEU n 
1 391 ILE n 
1 392 ARG n 
1 393 LEU n 
1 394 HIS n 
1 395 ILE n 
1 396 GLY n 
1 397 LEU n 
1 398 GLU n 
1 399 ASP n 
1 400 VAL n 
1 401 ASP n 
1 402 ASP n 
1 403 LEU n 
1 404 ILE n 
1 405 ALA n 
1 406 ASP n 
1 407 LEU n 
1 408 ASP n 
1 409 ALA n 
1 410 GLY n 
1 411 PHE n 
1 412 ALA n 
1 413 ARG n 
1 414 ILE n 
1 415 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 metC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    METC_ECOLI 
_struct_ref.pdbx_db_accession          P06721 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGC
VLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSIT
MEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLM
GQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSSGLFSFVLKKKLN
NEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGTLIRLHIGLEDVDDLIADLDAGFARIV
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2FQ6 A 21 ? 415 ? P06721 1 ? 395 ? 1 395 
2 1 2FQ6 B 21 ? 415 ? P06721 1 ? 395 ? 1 395 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2FQ6 MET A 1  ? UNP P06721 ? ? 'cloning artifact' -19 1  
1 2FQ6 GLY A 2  ? UNP P06721 ? ? 'cloning artifact' -18 2  
1 2FQ6 SER A 3  ? UNP P06721 ? ? 'cloning artifact' -17 3  
1 2FQ6 SER A 4  ? UNP P06721 ? ? 'cloning artifact' -16 4  
1 2FQ6 HIS A 5  ? UNP P06721 ? ? 'EXPRESSION TAG'   -15 5  
1 2FQ6 HIS A 6  ? UNP P06721 ? ? 'EXPRESSION TAG'   -14 6  
1 2FQ6 HIS A 7  ? UNP P06721 ? ? 'EXPRESSION TAG'   -13 7  
1 2FQ6 HIS A 8  ? UNP P06721 ? ? 'EXPRESSION TAG'   -12 8  
1 2FQ6 HIS A 9  ? UNP P06721 ? ? 'EXPRESSION TAG'   -11 9  
1 2FQ6 HIS A 10 ? UNP P06721 ? ? 'EXPRESSION TAG'   -10 10 
1 2FQ6 SER A 11 ? UNP P06721 ? ? 'cloning artifact' -9  11 
1 2FQ6 SER A 12 ? UNP P06721 ? ? 'cloning artifact' -8  12 
1 2FQ6 GLY A 13 ? UNP P06721 ? ? 'cloning artifact' -7  13 
1 2FQ6 LEU A 14 ? UNP P06721 ? ? 'cloning artifact' -6  14 
1 2FQ6 VAL A 15 ? UNP P06721 ? ? 'cloning artifact' -5  15 
1 2FQ6 PRO A 16 ? UNP P06721 ? ? 'cloning artifact' -4  16 
1 2FQ6 ARG A 17 ? UNP P06721 ? ? 'cloning artifact' -3  17 
1 2FQ6 GLY A 18 ? UNP P06721 ? ? 'cloning artifact' -2  18 
1 2FQ6 SER A 19 ? UNP P06721 ? ? 'cloning artifact' -1  19 
1 2FQ6 HIS A 20 ? UNP P06721 ? ? 'cloning artifact' 0   20 
2 2FQ6 MET B 1  ? UNP P06721 ? ? 'cloning artifact' -19 21 
2 2FQ6 GLY B 2  ? UNP P06721 ? ? 'cloning artifact' -18 22 
2 2FQ6 SER B 3  ? UNP P06721 ? ? 'cloning artifact' -17 23 
2 2FQ6 SER B 4  ? UNP P06721 ? ? 'cloning artifact' -16 24 
2 2FQ6 HIS B 5  ? UNP P06721 ? ? 'EXPRESSION TAG'   -15 25 
2 2FQ6 HIS B 6  ? UNP P06721 ? ? 'EXPRESSION TAG'   -14 26 
2 2FQ6 HIS B 7  ? UNP P06721 ? ? 'EXPRESSION TAG'   -13 27 
2 2FQ6 HIS B 8  ? UNP P06721 ? ? 'EXPRESSION TAG'   -12 28 
2 2FQ6 HIS B 9  ? UNP P06721 ? ? 'EXPRESSION TAG'   -11 29 
2 2FQ6 HIS B 10 ? UNP P06721 ? ? 'EXPRESSION TAG'   -10 30 
2 2FQ6 SER B 11 ? UNP P06721 ? ? 'cloning artifact' -9  31 
2 2FQ6 SER B 12 ? UNP P06721 ? ? 'cloning artifact' -8  32 
2 2FQ6 GLY B 13 ? UNP P06721 ? ? 'cloning artifact' -7  33 
2 2FQ6 LEU B 14 ? UNP P06721 ? ? 'cloning artifact' -6  34 
2 2FQ6 VAL B 15 ? UNP P06721 ? ? 'cloning artifact' -5  35 
2 2FQ6 PRO B 16 ? UNP P06721 ? ? 'cloning artifact' -4  36 
2 2FQ6 ARG B 17 ? UNP P06721 ? ? 'cloning artifact' -3  37 
2 2FQ6 GLY B 18 ? UNP P06721 ? ? 'cloning artifact' -2  38 
2 2FQ6 SER B 19 ? UNP P06721 ? ? 'cloning artifact' -1  39 
2 2FQ6 HIS B 20 ? UNP P06721 ? ? 'cloning artifact' 0   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ? 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'      149.211 
P3F non-polymer         . 
'PHOSPHORIC ACID MONO-(5-HYDROXY-6-METHYL-4-{[2-(2-TRIFLUOROMETHYL-BENZOYLAMINO)-ACETYL]-HYDRAZONOMETHYL}-PYRIDIN-3-YLMETHYL)ESTER' 
? 'C18 H18 F3 N4 O7 P' 490.327 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          2FQ6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.97 
_exptl_crystal.density_percent_sol   37.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_details    
'0.1M Hepes, 0.15M calcium chloride, 26% PEG 400, pH 7.3, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2005-09-05 
_diffrn_detector.details                'Blue Confocal Max-Flux' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Ni FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     2FQ6 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             76.7 
_reflns.d_resolution_high            1.75 
_reflns.number_obs                   70456 
_reflns.number_all                   70456 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.87 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.81 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.308 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.19 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2FQ6 
_refine.ls_number_reflns_obs                     63627 
_refine.ls_number_reflns_all                     63627 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             76.70 
_refine.ls_d_res_high                            1.78 
_refine.ls_percent_reflns_obs                    99.81 
_refine.ls_R_factor_obs                          0.17154 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16872 
_refine.ls_R_factor_R_free                       0.22477 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3391 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.969 
_refine.correlation_coeff_Fo_to_Fc_free          0.947 
_refine.B_iso_mean                               24.038 
_refine.aniso_B[1][1]                            2.85 
_refine.aniso_B[2][2]                            -1.34 
_refine.aniso_B[3][3]                            -1.51 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1CL1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.136 
_refine.pdbx_overall_ESU_R_Free                  0.135 
_refine.overall_SU_ML                            0.108 
_refine.overall_SU_B                             6.864 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2FQ6 
_refine_analyze.Luzzati_coordinate_error_obs    0.134 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.133 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6033 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             918 
_refine_hist.number_atoms_total               7017 
_refine_hist.d_res_high                       1.78 
_refine_hist.d_res_low                        76.70 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.022  ? 6227 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.682  1.957  ? 8451 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.186  5.000  ? 781  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.564 23.971 ? 272  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.519 15.000 ? 1020 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       24.008 15.000 ? 36   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.105  0.200  ? 949  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 4720 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.216  0.200  ? 3306 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.308  0.200  ? 4282 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.153  0.200  ? 725  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.234  0.200  ? 220  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.182  0.200  ? 84   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.183  1.500  ? 3984 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.364  2.000  ? 6214 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.663  3.000  ? 2549 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.789  4.500  ? 2237 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.780 
_refine_ls_shell.d_res_low                        1.826 
_refine_ls_shell.number_reflns_R_work             4665 
_refine_ls_shell.R_factor_R_work                  0.287 
_refine_ls_shell.percent_reflns_obs               99.90 
_refine_ls_shell.R_factor_R_free                  0.343 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             281 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2FQ6 
_struct.title                     
'Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide' 
_struct.pdbx_descriptor           'Cystathionine beta-lyase (E.C.4.4.1.8)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FQ6 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'PROTEIN-INHIBITOR COMPLEX, PLP COFACTOR COVALENTLY BOUND TO P3F INHIBITOR, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a tetramer, generated by the two fold axis: X,-Y,-Z.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 25  ? ALA A 33  ? LYS A 5   ALA A 13  1 ? 9  
HELX_P HELX_P2  2  SER A 36  ? LEU A 41  ? SER A 16  LEU A 21  1 ? 6  
HELX_P HELX_P3  3  SER A 58  ? ASN A 68  ? SER A 38  ASN A 48  1 ? 11 
HELX_P HELX_P4  4  THR A 81  ? GLY A 96  ? THR A 61  GLY A 76  1 ? 16 
HELX_P HELX_P5  5  CYS A 105 ? ALA A 116 ? CYS A 85  ALA A 96  1 ? 12 
HELX_P HELX_P6  6  TYR A 131 ? ILE A 141 ? TYR A 111 ILE A 121 1 ? 11 
HELX_P HELX_P7  7  LEU A 142 ? GLY A 146 ? LEU A 122 GLY A 126 5 ? 5  
HELX_P HELX_P8  8  ILE A 156 ? LEU A 164 ? ILE A 136 LEU A 144 5 ? 9  
HELX_P HELX_P9  9  ASP A 185 ? VAL A 197 ? ASP A 165 VAL A 177 1 ? 13 
HELX_P HELX_P10 10 LYS A 215 ? GLY A 220 ? LYS A 195 GLY A 200 5 ? 6  
HELX_P HELX_P11 11 CYS A 249 ? MET A 260 ? CYS A 229 MET A 240 1 ? 12 
HELX_P HELX_P12 12 ASP A 265 ? GLU A 299 ? ASP A 245 GLU A 279 1 ? 35 
HELX_P HELX_P13 13 GLY A 316 ? PHE A 324 ? GLY A 296 PHE A 304 1 ? 9  
HELX_P HELX_P14 14 ASN A 340 ? ASP A 349 ? ASN A 320 ASP A 329 1 ? 10 
HELX_P HELX_P15 15 GLN A 371 ? ALA A 377 ? GLN A 351 ALA A 357 1 ? 7  
HELX_P HELX_P16 16 ASP A 399 ? ARG A 413 ? ASP A 379 ARG A 393 1 ? 15 
HELX_P HELX_P17 17 LYS B 25  ? ALA B 33  ? LYS B 5   ALA B 13  1 ? 9  
HELX_P HELX_P18 18 SER B 36  ? LEU B 41  ? SER B 16  LEU B 21  1 ? 6  
HELX_P HELX_P19 19 SER B 58  ? ASN B 68  ? SER B 38  ASN B 48  1 ? 11 
HELX_P HELX_P20 20 THR B 81  ? GLY B 96  ? THR B 61  GLY B 76  1 ? 16 
HELX_P HELX_P21 21 CYS B 105 ? ILE B 118 ? CYS B 85  ILE B 98  1 ? 14 
HELX_P HELX_P22 22 TYR B 131 ? ILE B 141 ? TYR B 111 ILE B 121 1 ? 11 
HELX_P HELX_P23 23 LEU B 142 ? GLY B 146 ? LEU B 122 GLY B 126 5 ? 5  
HELX_P HELX_P24 24 ILE B 156 ? LEU B 164 ? ILE B 136 LEU B 144 5 ? 9  
HELX_P HELX_P25 25 ASP B 185 ? VAL B 197 ? ASP B 165 VAL B 177 1 ? 13 
HELX_P HELX_P26 26 LYS B 215 ? GLY B 220 ? LYS B 195 GLY B 200 5 ? 6  
HELX_P HELX_P27 27 ASN B 246 ? MET B 260 ? ASN B 226 MET B 240 1 ? 15 
HELX_P HELX_P28 28 ASP B 265 ? ARG B 277 ? ASP B 245 ARG B 257 1 ? 13 
HELX_P HELX_P29 29 THR B 278 ? GLU B 299 ? THR B 258 GLU B 279 1 ? 22 
HELX_P HELX_P30 30 GLY B 316 ? PHE B 324 ? GLY B 296 PHE B 304 1 ? 9  
HELX_P HELX_P31 31 ASN B 340 ? ASN B 350 ? ASN B 320 ASN B 330 1 ? 11 
HELX_P HELX_P32 32 GLN B 371 ? ALA B 377 ? GLN B 351 ALA B 357 1 ? 7  
HELX_P HELX_P33 33 ASP B 399 ? ILE B 414 ? ASP B 379 ILE B 394 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 175 A . ? SER 155 A PRO 176 A ? PRO 156 A 1 -6.95 
2 SER 175 B . ? SER 155 B PRO 176 B ? PRO 156 B 1 -9.54 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 5 ? 
C ? 7 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 99  ? PHE A 103 ? GLY A 79  PHE A 83  
A 2 GLY A 241 ? CYS A 245 ? GLY A 221 CYS A 225 
A 3 VAL A 223 ? ALA A 227 ? VAL A 203 ALA A 207 
A 4 ILE A 201 ? ASP A 205 ? ILE A 181 ASP A 185 
A 5 THR A 168 ? GLU A 174 ? THR A 148 GLU A 154 
A 6 HIS A 123 ? THR A 127 ? HIS A 103 THR A 107 
A 7 THR A 148 ? PHE A 152 ? THR A 128 PHE A 132 
B 1 VAL A 303 ? ASN A 307 ? VAL A 283 ASN A 287 
B 2 LEU A 330 ? LEU A 335 ? LEU A 310 LEU A 315 
B 3 LEU A 390 ? HIS A 394 ? LEU A 370 HIS A 374 
B 4 LEU A 366 ? ASN A 370 ? LEU A 346 ASN A 350 
B 5 SER A 355 ? MET A 356 ? SER A 335 MET A 336 
C 1 GLY B 99  ? PHE B 103 ? GLY B 79  PHE B 83  
C 2 GLY B 241 ? CYS B 245 ? GLY B 221 CYS B 225 
C 3 VAL B 223 ? ALA B 227 ? VAL B 203 ALA B 207 
C 4 ILE B 201 ? ASP B 205 ? ILE B 181 ASP B 185 
C 5 THR B 168 ? GLU B 174 ? THR B 148 GLU B 154 
C 6 HIS B 123 ? THR B 127 ? HIS B 103 THR B 107 
C 7 THR B 148 ? PHE B 152 ? THR B 128 PHE B 132 
D 1 VAL B 303 ? ASN B 307 ? VAL B 283 ASN B 287 
D 2 LEU B 330 ? LEU B 335 ? LEU B 310 LEU B 315 
D 3 LEU B 390 ? HIS B 394 ? LEU B 370 HIS B 374 
D 4 LEU B 366 ? ASN B 370 ? LEU B 346 ASN B 350 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 101 ? N VAL A 81  O ALA A 243 ? O ALA A 223 
A 2 3 O VAL A 244 ? O VAL A 224 N SER A 224 ? N SER A 204 
A 3 4 O ILE A 225 ? O ILE A 205 N ILE A 204 ? N ILE A 184 
A 4 5 O MET A 203 ? O MET A 183 N LEU A 173 ? N LEU A 153 
A 5 6 O PHE A 172 ? O PHE A 152 N LEU A 125 ? N LEU A 105 
A 6 7 N VAL A 124 ? N VAL A 104 O THR A 148 ? O THR A 128 
B 1 2 N ASN A 307 ? N ASN A 287 O SER A 332 ? O SER A 312 
B 2 3 N PHE A 333 ? N PHE A 313 O ILE A 391 ? O ILE A 371 
B 3 4 O ARG A 392 ? O ARG A 372 N LEU A 368 ? N LEU A 348 
B 4 5 O ILE A 367 ? O ILE A 347 N SER A 355 ? N SER A 335 
C 1 2 N VAL B 101 ? N VAL B 81  O ALA B 243 ? O ALA B 223 
C 2 3 O VAL B 244 ? O VAL B 224 N SER B 224 ? N SER B 204 
C 3 4 O ILE B 225 ? O ILE B 205 N ILE B 204 ? N ILE B 184 
C 4 5 O ILE B 201 ? O ILE B 181 N LYS B 169 ? N LYS B 149 
C 5 6 O PHE B 172 ? O PHE B 152 N LEU B 125 ? N LEU B 105 
C 6 7 N VAL B 124 ? N VAL B 104 O THR B 148 ? O THR B 128 
D 1 2 N ASN B 307 ? N ASN B 287 O SER B 332 ? O SER B 312 
D 2 3 N PHE B 333 ? N PHE B 313 O ILE B 391 ? O ILE B 371 
D 3 4 O LEU B 390 ? O LEU B 370 N ASN B 370 ? N ASN B 350 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE P3F A 700' 
AC2 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE P3F B 700' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 PHE A 75  ? PHE A 55   . ? 3_555 ? 
2  AC1 23 TYR A 76  ? TYR A 56   . ? 3_555 ? 
3  AC1 23 ARG A 78  ? ARG A 58   . ? 3_555 ? 
4  AC1 23 CYS A 105 ? CYS A 85   . ? 1_555 ? 
5  AC1 23 GLY A 106 ? GLY A 86   . ? 1_555 ? 
6  AC1 23 ALA A 107 ? ALA A 87   . ? 1_555 ? 
7  AC1 23 TYR A 131 ? TYR A 111  . ? 1_555 ? 
8  AC1 23 PRO A 133 ? PRO A 113  . ? 1_555 ? 
9  AC1 23 GLU A 174 ? GLU A 154  . ? 1_555 ? 
10 AC1 23 ASP A 205 ? ASP A 185  . ? 1_555 ? 
11 AC1 23 ALA A 227 ? ALA A 207  . ? 1_555 ? 
12 AC1 23 THR A 229 ? THR A 209  . ? 1_555 ? 
13 AC1 23 LYS A 230 ? LYS A 210  . ? 1_555 ? 
14 AC1 23 MET A 239 ? MET A 219  . ? 1_555 ? 
15 AC1 23 TYR A 258 ? TYR A 238  . ? 3_555 ? 
16 AC1 23 TYR A 358 ? TYR A 338  . ? 1_555 ? 
17 AC1 23 SER A 359 ? SER A 339  . ? 1_555 ? 
18 AC1 23 TRP A 360 ? TRP A 340  . ? 1_555 ? 
19 AC1 23 ARG A 392 ? ARG A 372  . ? 1_555 ? 
20 AC1 23 HOH E .   ? HOH A 984  . ? 1_555 ? 
21 AC1 23 HOH E .   ? HOH A 986  . ? 1_555 ? 
22 AC1 23 HOH E .   ? HOH A 1085 . ? 1_555 ? 
23 AC1 23 HOH E .   ? HOH A 1126 . ? 1_555 ? 
24 AC2 24 PHE B 75  ? PHE B 55   . ? 3_555 ? 
25 AC2 24 TYR B 76  ? TYR B 56   . ? 3_555 ? 
26 AC2 24 ARG B 78  ? ARG B 58   . ? 3_555 ? 
27 AC2 24 CYS B 105 ? CYS B 85   . ? 1_555 ? 
28 AC2 24 GLY B 106 ? GLY B 86   . ? 1_555 ? 
29 AC2 24 ALA B 107 ? ALA B 87   . ? 1_555 ? 
30 AC2 24 TYR B 131 ? TYR B 111  . ? 1_555 ? 
31 AC2 24 PRO B 133 ? PRO B 113  . ? 1_555 ? 
32 AC2 24 GLU B 174 ? GLU B 154  . ? 1_555 ? 
33 AC2 24 ASP B 205 ? ASP B 185  . ? 1_555 ? 
34 AC2 24 ALA B 227 ? ALA B 207  . ? 1_555 ? 
35 AC2 24 THR B 229 ? THR B 209  . ? 1_555 ? 
36 AC2 24 LYS B 230 ? LYS B 210  . ? 1_555 ? 
37 AC2 24 MET B 239 ? MET B 219  . ? 1_555 ? 
38 AC2 24 TYR B 258 ? TYR B 238  . ? 3_555 ? 
39 AC2 24 TYR B 358 ? TYR B 338  . ? 1_555 ? 
40 AC2 24 SER B 359 ? SER B 339  . ? 1_555 ? 
41 AC2 24 TRP B 360 ? TRP B 340  . ? 1_555 ? 
42 AC2 24 ARG B 392 ? ARG B 372  . ? 1_555 ? 
43 AC2 24 HOH F .   ? HOH B 743  . ? 1_555 ? 
44 AC2 24 HOH F .   ? HOH B 818  . ? 1_555 ? 
45 AC2 24 HOH F .   ? HOH B 875  . ? 1_555 ? 
46 AC2 24 HOH F .   ? HOH B 992  . ? 1_555 ? 
47 AC2 24 HOH F .   ? HOH B 1165 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FQ6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FQ6 
_atom_sites.fract_transf_matrix[1][1]   0.016714 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006516 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006603 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 25  ? 14.546  22.057  66.303 1.00 31.34 ? 5    LYS A N   1 
ATOM   2    C CA  . LYS A 1 25  ? 15.162  22.429  65.006 1.00 29.57 ? 5    LYS A CA  1 
ATOM   3    C C   . LYS A 1 25  ? 14.297  22.085  63.801 1.00 28.83 ? 5    LYS A C   1 
ATOM   4    O O   . LYS A 1 25  ? 14.628  22.505  62.684 1.00 27.96 ? 5    LYS A O   1 
ATOM   5    C CB  . LYS A 1 25  ? 16.574  21.812  64.838 1.00 30.87 ? 5    LYS A CB  1 
ATOM   6    C CG  . LYS A 1 25  ? 17.640  22.868  64.508 1.00 30.76 ? 5    LYS A CG  1 
ATOM   7    C CD  . LYS A 1 25  ? 18.566  22.432  63.415 1.00 34.15 ? 5    LYS A CD  1 
ATOM   8    C CE  . LYS A 1 25  ? 18.975  23.624  62.572 1.00 36.80 ? 5    LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 25  ? 19.973  23.274  61.479 1.00 38.43 ? 5    LYS A NZ  1 
ATOM   10   N N   . LEU A 1 26  ? 13.207  21.334  64.017 1.00 27.27 ? 6    LEU A N   1 
ATOM   11   C CA  . LEU A 1 26  ? 12.279  21.032  62.937 1.00 26.34 ? 6    LEU A CA  1 
ATOM   12   C C   . LEU A 1 26  ? 11.789  22.313  62.233 1.00 24.94 ? 6    LEU A C   1 
ATOM   13   O O   . LEU A 1 26  ? 11.680  22.323  61.025 1.00 23.03 ? 6    LEU A O   1 
ATOM   14   C CB  . LEU A 1 26  ? 11.078  20.210  63.415 1.00 26.46 ? 6    LEU A CB  1 
ATOM   15   C CG  . LEU A 1 26  ? 10.048  19.819  62.330 1.00 27.77 ? 6    LEU A CG  1 
ATOM   16   C CD1 . LEU A 1 26  ? 10.552  18.832  61.307 1.00 30.74 ? 6    LEU A CD1 1 
ATOM   17   C CD2 . LEU A 1 26  ? 8.764   19.267  62.935 1.00 31.29 ? 6    LEU A CD2 1 
ATOM   18   N N   . ASP A 1 27  ? 11.503  23.383  62.990 1.00 24.53 ? 7    ASP A N   1 
ATOM   19   C CA  . ASP A 1 27  ? 11.008  24.631  62.360 1.00 22.97 ? 7    ASP A CA  1 
ATOM   20   C C   . ASP A 1 27  ? 12.027  25.223  61.421 1.00 22.33 ? 7    ASP A C   1 
ATOM   21   O O   . ASP A 1 27  ? 11.669  25.723  60.349 1.00 20.67 ? 7    ASP A O   1 
ATOM   22   C CB  . ASP A 1 27  ? 10.611  25.648  63.407 1.00 24.09 ? 7    ASP A CB  1 
ATOM   23   C CG  . ASP A 1 27  ? 9.324   25.248  64.148 1.00 23.52 ? 7    ASP A CG  1 
ATOM   24   O OD1 . ASP A 1 27  ? 8.428   24.616  63.568 1.00 24.67 ? 7    ASP A OD1 1 
ATOM   25   O OD2 . ASP A 1 27  ? 9.225   25.563  65.331 1.00 32.74 ? 7    ASP A OD2 1 
ATOM   26   N N   . THR A 1 28  ? 13.294  25.139  61.814 1.00 20.29 ? 8    THR A N   1 
ATOM   27   C CA  . THR A 1 28  ? 14.369  25.632  60.979 1.00 21.01 ? 8    THR A CA  1 
ATOM   28   C C   . THR A 1 28  ? 14.568  24.763  59.731 1.00 20.65 ? 8    THR A C   1 
ATOM   29   O O   . THR A 1 28  ? 14.791  25.282  58.639 1.00 20.38 ? 8    THR A O   1 
ATOM   30   C CB  . THR A 1 28  ? 15.684  25.689  61.769 1.00 21.14 ? 8    THR A CB  1 
ATOM   31   O OG1 . THR A 1 28  ? 15.511  26.544  62.900 1.00 18.70 ? 8    THR A OG1 1 
ATOM   32   C CG2 . THR A 1 28  ? 16.819  26.191  60.909 1.00 22.69 ? 8    THR A CG2 1 
ATOM   33   N N   . GLN A 1 29  ? 14.501  23.452  59.913 1.00 21.70 ? 9    GLN A N   1 
ATOM   34   C CA  . GLN A 1 29  ? 14.643  22.488  58.821 1.00 22.68 ? 9    GLN A CA  1 
ATOM   35   C C   . GLN A 1 29  ? 13.501  22.716  57.833 1.00 21.22 ? 9    GLN A C   1 
ATOM   36   O O   . GLN A 1 29  ? 13.694  22.731  56.631 1.00 20.09 ? 9    GLN A O   1 
ATOM   37   C CB  . GLN A 1 29  ? 14.496  21.067  59.384 1.00 23.98 ? 9    GLN A CB  1 
ATOM   38   C CG  . GLN A 1 29  ? 15.752  20.284  59.693 1.00 31.21 ? 9    GLN A CG  1 
ATOM   39   C CD  . GLN A 1 29  ? 15.536  18.773  59.415 1.00 38.56 ? 9    GLN A CD  1 
ATOM   40   O OE1 . GLN A 1 29  ? 16.386  18.112  58.781 1.00 42.61 ? 9    GLN A OE1 1 
ATOM   41   N NE2 . GLN A 1 29  ? 14.374  18.243  59.832 1.00 38.57 ? 9    GLN A NE2 1 
ATOM   42   N N   . LEU A 1 30  ? 12.290  22.907  58.344 1.00 19.42 ? 10   LEU A N   1 
ATOM   43   C CA  . LEU A 1 30  ? 11.173  23.103  57.454 1.00 19.69 ? 10   LEU A CA  1 
ATOM   44   C C   . LEU A 1 30  ? 11.340  24.333  56.562 1.00 18.77 ? 10   LEU A C   1 
ATOM   45   O O   . LEU A 1 30  ? 11.101  24.280  55.340 1.00 18.70 ? 10   LEU A O   1 
ATOM   46   C CB  . LEU A 1 30  ? 9.881   23.217  58.256 1.00 18.74 ? 10   LEU A CB  1 
ATOM   47   C CG  . LEU A 1 30  ? 9.339   21.878  58.767 1.00 22.83 ? 10   LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 30  ? 8.200   22.160  59.790 1.00 25.19 ? 10   LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 30  ? 8.838   20.950  57.630 1.00 18.03 ? 10   LEU A CD2 1 
ATOM   50   N N   . VAL A 1 31  ? 11.702  25.449  57.192 1.00 19.04 ? 11   VAL A N   1 
ATOM   51   C CA  . VAL A 1 31  ? 12.003  26.690  56.461 1.00 19.31 ? 11   VAL A CA  1 
ATOM   52   C C   . VAL A 1 31  ? 13.073  26.517  55.332 1.00 19.56 ? 11   VAL A C   1 
ATOM   53   O O   . VAL A 1 31  ? 12.934  27.077  54.230 1.00 19.70 ? 11   VAL A O   1 
ATOM   54   C CB  . VAL A 1 31  ? 12.351  27.844  57.450 1.00 19.22 ? 11   VAL A CB  1 
ATOM   55   C CG1 . VAL A 1 31  ? 12.934  29.031  56.707 1.00 18.38 ? 11   VAL A CG1 1 
ATOM   56   C CG2 . VAL A 1 31  ? 11.074  28.263  58.247 1.00 19.62 ? 11   VAL A CG2 1 
ATOM   57   N N   . ASN A 1 32  ? 14.097  25.708  55.587 1.00 19.48 ? 12   ASN A N   1 
ATOM   58   C CA  . ASN A 1 32  ? 15.230  25.613  54.679 1.00 20.52 ? 12   ASN A CA  1 
ATOM   59   C C   . ASN A 1 32  ? 15.280  24.422  53.733 1.00 20.33 ? 12   ASN A C   1 
ATOM   60   O O   . ASN A 1 32  ? 15.941  24.486  52.714 1.00 20.52 ? 12   ASN A O   1 
ATOM   61   C CB  . ASN A 1 32  ? 16.538  25.820  55.466 1.00 20.07 ? 12   ASN A CB  1 
ATOM   62   C CG  . ASN A 1 32  ? 16.669  27.288  55.981 1.00 22.89 ? 12   ASN A CG  1 
ATOM   63   O OD1 . ASN A 1 32  ? 16.712  28.227  55.182 1.00 25.07 ? 12   ASN A OD1 1 
ATOM   64   N ND2 . ASN A 1 32  ? 16.685  27.473  57.306 1.00 23.84 ? 12   ASN A ND2 1 
ATOM   65   N N   . ALA A 1 33  ? 14.552  23.368  54.081 1.00 19.56 ? 13   ALA A N   1 
ATOM   66   C CA  . ALA A 1 33  ? 14.501  22.103  53.340 1.00 20.79 ? 13   ALA A CA  1 
ATOM   67   C C   . ALA A 1 33  ? 14.332  22.310  51.842 1.00 21.18 ? 13   ALA A C   1 
ATOM   68   O O   . ALA A 1 33  ? 13.329  22.901  51.383 1.00 20.31 ? 13   ALA A O   1 
ATOM   69   C CB  . ALA A 1 33  ? 13.352  21.239  53.866 1.00 20.77 ? 13   ALA A CB  1 
ATOM   70   N N   . GLY A 1 34  ? 15.334  21.838  51.103 1.00 20.41 ? 14   GLY A N   1 
ATOM   71   C CA  . GLY A 1 34  ? 15.344  21.884  49.636 1.00 21.28 ? 14   GLY A CA  1 
ATOM   72   C C   . GLY A 1 34  ? 15.759  23.210  49.002 1.00 20.78 ? 14   GLY A C   1 
ATOM   73   O O   . GLY A 1 34  ? 15.869  23.290  47.776 1.00 20.95 ? 14   GLY A O   1 
ATOM   74   N N   . ARG A 1 35  ? 16.022  24.232  49.823 1.00 21.78 ? 15   ARG A N   1 
ATOM   75   C CA  . ARG A 1 35  ? 16.281  25.589  49.326 1.00 23.30 ? 15   ARG A CA  1 
ATOM   76   C C   . ARG A 1 35  ? 17.759  25.865  49.085 1.00 25.78 ? 15   ARG A C   1 
ATOM   77   O O   . ARG A 1 35  ? 18.272  26.889  49.523 1.00 27.67 ? 15   ARG A O   1 
ATOM   78   C CB  . ARG A 1 35  ? 15.643  26.651  50.249 1.00 23.59 ? 15   ARG A CB  1 
ATOM   79   C CG  . ARG A 1 35  ? 14.117  26.588  50.208 1.00 23.13 ? 15   ARG A CG  1 
ATOM   80   C CD  . ARG A 1 35  ? 13.399  27.872  50.552 1.00 25.22 ? 15   ARG A CD  1 
ATOM   81   N NE  . ARG A 1 35  ? 13.775  28.308  51.876 1.00 27.65 ? 15   ARG A NE  1 
ATOM   82   C CZ  . ARG A 1 35  ? 14.532  29.363  52.178 1.00 24.83 ? 15   ARG A CZ  1 
ATOM   83   N NH1 . ARG A 1 35  ? 14.949  30.217  51.261 1.00 27.24 ? 15   ARG A NH1 1 
ATOM   84   N NH2 . ARG A 1 35  ? 14.823  29.586  53.431 1.00 23.97 ? 15   ARG A NH2 1 
ATOM   85   N N   . SER A 1 36  ? 18.432  24.956  48.386 1.00 26.05 ? 16   SER A N   1 
ATOM   86   C CA  . SER A 1 36  ? 19.812  25.174  47.943 1.00 27.03 ? 16   SER A CA  1 
ATOM   87   C C   . SER A 1 36  ? 19.808  26.224  46.852 1.00 26.48 ? 16   SER A C   1 
ATOM   88   O O   . SER A 1 36  ? 18.870  26.300  46.066 1.00 25.37 ? 16   SER A O   1 
ATOM   89   C CB  . SER A 1 36  ? 20.415  23.884  47.362 1.00 26.84 ? 16   SER A CB  1 
ATOM   90   O OG  . SER A 1 36  ? 20.409  22.845  48.336 1.00 32.12 ? 16   SER A OG  1 
ATOM   91   N N   . LYS A 1 37  ? 20.889  26.999  46.767 1.00 26.74 ? 17   LYS A N   1 
ATOM   92   C CA  . LYS A 1 37  ? 21.033  28.006  45.719 1.00 25.97 ? 17   LYS A CA  1 
ATOM   93   C C   . LYS A 1 37  ? 20.808  27.453  44.312 1.00 24.33 ? 17   LYS A C   1 
ATOM   94   O O   . LYS A 1 37  ? 20.344  28.181  43.442 1.00 24.08 ? 17   LYS A O   1 
ATOM   95   C CB  . LYS A 1 37  ? 22.404  28.720  45.776 1.00 27.17 ? 17   LYS A CB  1 
ATOM   96   C CG  . LYS A 1 37  ? 22.422  29.985  44.879 1.00 30.24 ? 17   LYS A CG  1 
ATOM   97   C CD  . LYS A 1 37  ? 23.735  30.750  44.924 1.00 38.32 ? 17   LYS A CD  1 
ATOM   98   C CE  . LYS A 1 37  ? 23.517  32.174  44.394 1.00 41.20 ? 17   LYS A CE  1 
ATOM   99   N NZ  . LYS A 1 37  ? 24.818  32.914  44.290 1.00 44.68 ? 17   LYS A NZ  1 
ATOM   100  N N   . LYS A 1 38  ? 21.158  26.194  44.066 1.00 23.21 ? 18   LYS A N   1 
ATOM   101  C CA  . LYS A 1 38  ? 21.031  25.652  42.702 1.00 23.10 ? 18   LYS A CA  1 
ATOM   102  C C   . LYS A 1 38  ? 19.574  25.508  42.302 1.00 21.83 ? 18   LYS A C   1 
ATOM   103  O O   . LYS A 1 38  ? 19.264  25.399  41.121 1.00 21.85 ? 18   LYS A O   1 
ATOM   104  C CB  . LYS A 1 38  ? 21.747  24.302  42.531 1.00 23.99 ? 18   LYS A CB  1 
ATOM   105  C CG  . LYS A 1 38  ? 21.197  23.188  43.415 1.00 26.39 ? 18   LYS A CG  1 
ATOM   106  C CD  . LYS A 1 38  ? 22.020  21.909  43.207 1.00 33.97 ? 18   LYS A CD  1 
ATOM   107  C CE  . LYS A 1 38  ? 21.906  21.000  44.436 1.00 39.35 ? 18   LYS A CE  1 
ATOM   108  N NZ  . LYS A 1 38  ? 23.112  20.095  44.581 1.00 41.46 ? 18   LYS A NZ  1 
ATOM   109  N N   . TYR A 1 39  ? 18.692  25.550  43.295 1.00 20.85 ? 19   TYR A N   1 
ATOM   110  C CA  . TYR A 1 39  ? 17.247  25.423  43.069 1.00 21.50 ? 19   TYR A CA  1 
ATOM   111  C C   . TYR A 1 39  ? 16.446  26.747  43.107 1.00 20.97 ? 19   TYR A C   1 
ATOM   112  O O   . TYR A 1 39  ? 15.425  26.924  42.357 1.00 22.51 ? 19   TYR A O   1 
ATOM   113  C CB  . TYR A 1 39  ? 16.725  24.453  44.119 1.00 21.41 ? 19   TYR A CB  1 
ATOM   114  C CG  . TYR A 1 39  ? 17.293  23.054  43.954 1.00 21.74 ? 19   TYR A CG  1 
ATOM   115  C CD1 . TYR A 1 39  ? 17.549  22.536  42.672 1.00 20.97 ? 19   TYR A CD1 1 
ATOM   116  C CD2 . TYR A 1 39  ? 17.571  22.259  45.062 1.00 21.25 ? 19   TYR A CD2 1 
ATOM   117  C CE1 . TYR A 1 39  ? 18.048  21.262  42.499 1.00 23.11 ? 19   TYR A CE1 1 
ATOM   118  C CE2 . TYR A 1 39  ? 18.071  20.964  44.901 1.00 24.00 ? 19   TYR A CE2 1 
ATOM   119  C CZ  . TYR A 1 39  ? 18.316  20.487  43.623 1.00 23.52 ? 19   TYR A CZ  1 
ATOM   120  O OH  . TYR A 1 39  ? 18.799  19.218  43.442 1.00 27.29 ? 19   TYR A OH  1 
ATOM   121  N N   . THR A 1 40  ? 16.876  27.644  43.994 1.00 20.83 ? 20   THR A N   1 
ATOM   122  C CA  . THR A 1 40  ? 16.242  28.959  44.177 1.00 20.73 ? 20   THR A CA  1 
ATOM   123  C C   . THR A 1 40  ? 16.797  30.057  43.259 1.00 21.98 ? 20   THR A C   1 
ATOM   124  O O   . THR A 1 40  ? 16.076  30.997  42.898 1.00 22.12 ? 20   THR A O   1 
ATOM   125  C CB  . THR A 1 40  ? 16.390  29.417  45.625 1.00 21.11 ? 20   THR A CB  1 
ATOM   126  O OG1 . THR A 1 40  ? 17.796  29.611  45.895 1.00 20.61 ? 20   THR A OG1 1 
ATOM   127  C CG2 . THR A 1 40  ? 15.762  28.384  46.617 1.00 17.56 ? 20   THR A CG2 1 
ATOM   128  N N   . LEU A 1 41  ? 18.076  29.958  42.891 1.00 22.03 ? 21   LEU A N   1 
ATOM   129  C CA  . LEU A 1 41  ? 18.668  30.850  41.856 1.00 22.50 ? 21   LEU A CA  1 
ATOM   130  C C   . LEU A 1 41  ? 18.529  32.357  42.122 1.00 21.57 ? 21   LEU A C   1 
ATOM   131  O O   . LEU A 1 41  ? 18.391  33.157  41.212 1.00 21.50 ? 21   LEU A O   1 
ATOM   132  C CB  . LEU A 1 41  ? 18.141  30.476  40.465 1.00 23.49 ? 21   LEU A CB  1 
ATOM   133  C CG  . LEU A 1 41  ? 18.450  29.001  40.155 1.00 24.94 ? 21   LEU A CG  1 
ATOM   134  C CD1 . LEU A 1 41  ? 17.645  28.511  38.953 1.00 27.31 ? 21   LEU A CD1 1 
ATOM   135  C CD2 . LEU A 1 41  ? 19.939  28.744  39.969 1.00 25.54 ? 21   LEU A CD2 1 
ATOM   136  N N   . GLY A 1 42  ? 18.538  32.719  43.384 1.00 21.77 ? 22   GLY A N   1 
ATOM   137  C CA  . GLY A 1 42  ? 18.528  34.125  43.796 1.00 23.40 ? 22   GLY A CA  1 
ATOM   138  C C   . GLY A 1 42  ? 17.254  34.466  44.534 1.00 23.25 ? 22   GLY A C   1 
ATOM   139  O O   . GLY A 1 42  ? 17.184  35.459  45.261 1.00 25.13 ? 22   GLY A O   1 
ATOM   140  N N   . ALA A 1 43  ? 16.240  33.644  44.351 1.00 22.06 ? 23   ALA A N   1 
ATOM   141  C CA  . ALA A 1 43  ? 14.958  33.861  44.990 1.00 21.32 ? 23   ALA A CA  1 
ATOM   142  C C   . ALA A 1 43  ? 14.957  33.158  46.340 1.00 21.41 ? 23   ALA A C   1 
ATOM   143  O O   . ALA A 1 43  ? 15.914  32.465  46.700 1.00 21.91 ? 23   ALA A O   1 
ATOM   144  C CB  . ALA A 1 43  ? 13.860  33.316  44.130 1.00 21.43 ? 23   ALA A CB  1 
ATOM   145  N N   . VAL A 1 44  ? 13.899  33.377  47.098 1.00 21.52 ? 24   VAL A N   1 
ATOM   146  C CA  . VAL A 1 44  ? 13.687  32.697  48.353 1.00 20.21 ? 24   VAL A CA  1 
ATOM   147  C C   . VAL A 1 44  ? 13.166  31.272  48.081 1.00 19.86 ? 24   VAL A C   1 
ATOM   148  O O   . VAL A 1 44  ? 13.703  30.309  48.614 1.00 21.10 ? 24   VAL A O   1 
ATOM   149  C CB  . VAL A 1 44  ? 12.731  33.532  49.283 1.00 20.95 ? 24   VAL A CB  1 
ATOM   150  C CG1 . VAL A 1 44  ? 12.256  32.714  50.484 1.00 17.41 ? 24   VAL A CG1 1 
ATOM   151  C CG2 . VAL A 1 44  ? 13.435  34.834  49.768 1.00 16.02 ? 24   VAL A CG2 1 
ATOM   152  N N   . ASN A 1 45  ? 12.170  31.132  47.203 1.00 19.82 ? 25   ASN A N   1 
ATOM   153  C CA  . ASN A 1 45  ? 11.598  29.811  46.902 1.00 19.90 ? 25   ASN A CA  1 
ATOM   154  C C   . ASN A 1 45  ? 12.291  29.193  45.694 1.00 20.18 ? 25   ASN A C   1 
ATOM   155  O O   . ASN A 1 45  ? 13.003  29.889  44.954 1.00 21.52 ? 25   ASN A O   1 
ATOM   156  C CB  . ASN A 1 45  ? 10.093  29.921  46.677 1.00 19.42 ? 25   ASN A CB  1 
ATOM   157  C CG  . ASN A 1 45  ? 9.370   30.534  47.869 1.00 20.85 ? 25   ASN A CG  1 
ATOM   158  O OD1 . ASN A 1 45  ? 9.062   29.847  48.850 1.00 21.72 ? 25   ASN A OD1 1 
ATOM   159  N ND2 . ASN A 1 45  ? 9.090   31.818  47.784 1.00 17.97 ? 25   ASN A ND2 1 
ATOM   160  N N   . SER A 1 46  ? 12.140  27.883  45.494 1.00 19.53 ? 26   SER A N   1 
ATOM   161  C CA  . SER A 1 46  ? 12.706  27.287  44.276 1.00 18.92 ? 26   SER A CA  1 
ATOM   162  C C   . SER A 1 46  ? 12.061  27.894  43.042 1.00 19.40 ? 26   SER A C   1 
ATOM   163  O O   . SER A 1 46  ? 10.919  28.357  43.088 1.00 20.46 ? 26   SER A O   1 
ATOM   164  C CB  . SER A 1 46  ? 12.553  25.736  44.252 1.00 19.63 ? 26   SER A CB  1 
ATOM   165  O OG  . SER A 1 46  ? 11.168  25.368  44.178 1.00 21.41 ? 26   SER A OG  1 
ATOM   166  N N   . VAL A 1 47  ? 12.791  27.924  41.932 1.00 19.83 ? 27   VAL A N   1 
ATOM   167  C CA  . VAL A 1 47  ? 12.196  28.302  40.668 1.00 20.01 ? 27   VAL A CA  1 
ATOM   168  C C   . VAL A 1 47  ? 11.174  27.243  40.323 1.00 19.90 ? 27   VAL A C   1 
ATOM   169  O O   . VAL A 1 47  ? 11.174  26.121  40.900 1.00 18.90 ? 27   VAL A O   1 
ATOM   170  C CB  . VAL A 1 47  ? 13.204  28.364  39.546 1.00 19.87 ? 27   VAL A CB  1 
ATOM   171  C CG1 . VAL A 1 47  ? 14.204  29.491  39.830 1.00 24.81 ? 27   VAL A CG1 1 
ATOM   172  C CG2 . VAL A 1 47  ? 13.886  26.989  39.353 1.00 21.38 ? 27   VAL A CG2 1 
ATOM   173  N N   . ILE A 1 48  ? 10.279  27.638  39.423 1.00 19.59 ? 28   ILE A N   1 
ATOM   174  C CA  . ILE A 1 48  ? 9.348   26.740  38.769 1.00 20.18 ? 28   ILE A CA  1 
ATOM   175  C C   . ILE A 1 48  ? 9.810   26.586  37.331 1.00 20.31 ? 28   ILE A C   1 
ATOM   176  O O   . ILE A 1 48  ? 9.765   27.559  36.523 1.00 18.99 ? 28   ILE A O   1 
ATOM   177  C CB  . ILE A 1 48  ? 7.939   27.307  38.807 1.00 19.40 ? 28   ILE A CB  1 
ATOM   178  C CG1 . ILE A 1 48  ? 7.522   27.481  40.259 1.00 21.87 ? 28   ILE A CG1 1 
ATOM   179  C CG2 . ILE A 1 48  ? 6.927   26.432  37.992 1.00 20.75 ? 28   ILE A CG2 1 
ATOM   180  C CD1 . ILE A 1 48  ? 6.512   28.484  40.405 1.00 25.52 ? 28   ILE A CD1 1 
ATOM   181  N N   . GLN A 1 49  ? 10.331  25.381  37.042 1.00 19.55 ? 29   GLN A N   1 
ATOM   182  C CA  . GLN A 1 49  ? 10.778  25.034  35.728 1.00 19.14 ? 29   GLN A CA  1 
ATOM   183  C C   . GLN A 1 49  ? 9.746   24.108  35.124 1.00 20.35 ? 29   GLN A C   1 
ATOM   184  O O   . GLN A 1 49  ? 9.637   22.941  35.538 1.00 20.41 ? 29   GLN A O   1 
ATOM   185  C CB  . GLN A 1 49  ? 12.161  24.410  35.804 1.00 18.75 ? 29   GLN A CB  1 
ATOM   186  C CG  . GLN A 1 49  ? 12.757  23.983  34.490 1.00 19.92 ? 29   GLN A CG  1 
ATOM   187  C CD  . GLN A 1 49  ? 14.258  23.731  34.639 1.00 21.32 ? 29   GLN A CD  1 
ATOM   188  O OE1 . GLN A 1 49  ? 14.679  22.922  35.477 1.00 23.26 ? 29   GLN A OE1 1 
ATOM   189  N NE2 . GLN A 1 49  ? 15.072  24.458  33.873 1.00 23.67 ? 29   GLN A NE2 1 
ATOM   190  N N   . ARG A 1 50  ? 8.913   24.635  34.223 1.00 20.13 ? 30   ARG A N   1 
ATOM   191  C CA  . ARG A 1 50  ? 7.940   23.799  33.527 1.00 20.05 ? 30   ARG A CA  1 
ATOM   192  C C   . ARG A 1 50  ? 8.644   23.236  32.313 1.00 19.14 ? 30   ARG A C   1 
ATOM   193  O O   . ARG A 1 50  ? 9.217   23.995  31.556 1.00 19.21 ? 30   ARG A O   1 
ATOM   194  C CB  . ARG A 1 50  ? 6.713   24.600  33.086 1.00 19.94 ? 30   ARG A CB  1 
ATOM   195  C CG  . ARG A 1 50  ? 5.991   25.286  34.238 1.00 21.09 ? 30   ARG A CG  1 
ATOM   196  C CD  . ARG A 1 50  ? 4.725   25.985  33.788 1.00 22.06 ? 30   ARG A CD  1 
ATOM   197  N NE  . ARG A 1 50  ? 4.120   26.632  34.944 1.00 21.95 ? 30   ARG A NE  1 
ATOM   198  C CZ  . ARG A 1 50  ? 3.431   27.776  34.917 1.00 28.95 ? 30   ARG A CZ  1 
ATOM   199  N NH1 . ARG A 1 50  ? 3.254   28.460  33.779 1.00 25.51 ? 30   ARG A NH1 1 
ATOM   200  N NH2 . ARG A 1 50  ? 2.930   28.256  36.063 1.00 27.86 ? 30   ARG A NH2 1 
ATOM   201  N N   . ALA A 1 51  ? 8.623   21.919  32.134 1.00 18.71 ? 31   ALA A N   1 
ATOM   202  C CA  . ALA A 1 51  ? 9.298   21.342  30.970 1.00 19.36 ? 31   ALA A CA  1 
ATOM   203  C C   . ALA A 1 51  ? 8.880   19.893  30.743 1.00 19.30 ? 31   ALA A C   1 
ATOM   204  O O   . ALA A 1 51  ? 8.697   19.150  31.701 1.00 18.28 ? 31   ALA A O   1 
ATOM   205  C CB  . ALA A 1 51  ? 10.825  21.424  31.149 1.00 18.25 ? 31   ALA A CB  1 
ATOM   206  N N   . SER A 1 52  ? 8.734   19.526  29.472 1.00 19.63 ? 32   SER A N   1 
ATOM   207  C CA  . SER A 1 52  ? 8.892   18.157  29.047 1.00 20.11 ? 32   SER A CA  1 
ATOM   208  C C   . SER A 1 52  ? 10.323  18.017  28.499 1.00 21.13 ? 32   SER A C   1 
ATOM   209  O O   . SER A 1 52  ? 11.218  17.520  29.192 1.00 20.62 ? 32   SER A O   1 
ATOM   210  C CB  . SER A 1 52  ? 7.818   17.759  28.029 1.00 19.65 ? 32   SER A CB  1 
ATOM   211  O OG  . SER A 1 52  ? 7.661   18.708  26.979 1.00 21.02 ? 32   SER A OG  1 
ATOM   212  N N   . SER A 1 53  ? 10.561  18.495  27.277 1.00 22.16 ? 33   SER A N   1 
ATOM   213  C CA  . SER A 1 53  ? 11.921  18.502  26.733 1.00 21.87 ? 33   SER A CA  1 
ATOM   214  C C   . SER A 1 53  ? 12.904  19.269  27.630 1.00 21.87 ? 33   SER A C   1 
ATOM   215  O O   . SER A 1 53  ? 12.629  20.384  28.124 1.00 21.88 ? 33   SER A O   1 
ATOM   216  C CB  . SER A 1 53  ? 11.959  19.105  25.316 1.00 22.49 ? 33   SER A CB  1 
ATOM   217  O OG  . SER A 1 53  ? 10.982  18.523  24.456 1.00 23.39 ? 33   SER A OG  1 
ATOM   218  N N   . LEU A 1 54  ? 14.063  18.659  27.815 1.00 21.79 ? 34   LEU A N   1 
ATOM   219  C CA  . LEU A 1 54  ? 15.195  19.319  28.429 1.00 21.04 ? 34   LEU A CA  1 
ATOM   220  C C   . LEU A 1 54  ? 16.385  19.276  27.438 1.00 21.88 ? 34   LEU A C   1 
ATOM   221  O O   . LEU A 1 54  ? 16.702  18.238  26.864 1.00 20.46 ? 34   LEU A O   1 
ATOM   222  C CB  . LEU A 1 54  ? 15.468  18.741  29.830 1.00 20.39 ? 34   LEU A CB  1 
ATOM   223  C CG  . LEU A 1 54  ? 14.292  19.068  30.826 1.00 20.02 ? 34   LEU A CG  1 
ATOM   224  C CD1 . LEU A 1 54  ? 14.245  18.109  32.017 1.00 20.92 ? 34   LEU A CD1 1 
ATOM   225  C CD2 . LEU A 1 54  ? 14.300  20.547  31.291 1.00 19.26 ? 34   LEU A CD2 1 
ATOM   226  N N   . VAL A 1 55  ? 16.944  20.448  27.149 1.00 22.68 ? 35   VAL A N   1 
ATOM   227  C CA  . VAL A 1 55  ? 17.924  20.591  26.042 1.00 22.86 ? 35   VAL A CA  1 
ATOM   228  C C   . VAL A 1 55  ? 19.348  20.256  26.450 1.00 24.83 ? 35   VAL A C   1 
ATOM   229  O O   . VAL A 1 55  ? 19.827  20.710  27.498 1.00 24.77 ? 35   VAL A O   1 
ATOM   230  C CB  . VAL A 1 55  ? 17.872  21.993  25.400 1.00 23.16 ? 35   VAL A CB  1 
ATOM   231  C CG1 . VAL A 1 55  ? 18.986  22.182  24.365 1.00 20.02 ? 35   VAL A CG1 1 
ATOM   232  C CG2 . VAL A 1 55  ? 16.552  22.175  24.715 1.00 22.02 ? 35   VAL A CG2 1 
ATOM   233  N N   . PHE A 1 56  ? 20.005  19.466  25.600 1.00 24.65 ? 36   PHE A N   1 
ATOM   234  C CA  . PHE A 1 56  ? 21.380  19.079  25.759 1.00 25.82 ? 36   PHE A CA  1 
ATOM   235  C C   . PHE A 1 56  ? 22.192  19.949  24.821 1.00 26.36 ? 36   PHE A C   1 
ATOM   236  O O   . PHE A 1 56  ? 21.949  19.961  23.605 1.00 25.95 ? 36   PHE A O   1 
ATOM   237  C CB  . PHE A 1 56  ? 21.544  17.600  25.387 1.00 25.46 ? 36   PHE A CB  1 
ATOM   238  C CG  . PHE A 1 56  ? 20.567  16.707  26.078 1.00 25.53 ? 36   PHE A CG  1 
ATOM   239  C CD1 . PHE A 1 56  ? 20.569  16.602  27.480 1.00 25.26 ? 36   PHE A CD1 1 
ATOM   240  C CD2 . PHE A 1 56  ? 19.622  15.991  25.338 1.00 24.88 ? 36   PHE A CD2 1 
ATOM   241  C CE1 . PHE A 1 56  ? 19.604  15.790  28.145 1.00 27.27 ? 36   PHE A CE1 1 
ATOM   242  C CE2 . PHE A 1 56  ? 18.688  15.150  25.978 1.00 25.28 ? 36   PHE A CE2 1 
ATOM   243  C CZ  . PHE A 1 56  ? 18.677  15.047  27.378 1.00 25.05 ? 36   PHE A CZ  1 
ATOM   244  N N   . ASP A 1 57  ? 23.132  20.701  25.370 1.00 27.16 ? 37   ASP A N   1 
ATOM   245  C CA  . ASP A 1 57  ? 23.926  21.599  24.540 1.00 28.65 ? 37   ASP A CA  1 
ATOM   246  C C   . ASP A 1 57  ? 24.899  20.852  23.617 1.00 28.29 ? 37   ASP A C   1 
ATOM   247  O O   . ASP A 1 57  ? 25.346  21.409  22.621 1.00 28.96 ? 37   ASP A O   1 
ATOM   248  C CB  . ASP A 1 57  ? 24.692  22.623  25.397 1.00 29.76 ? 37   ASP A CB  1 
ATOM   249  C CG  . ASP A 1 57  ? 23.795  23.741  25.957 1.00 35.49 ? 37   ASP A CG  1 
ATOM   250  O OD1 . ASP A 1 57  ? 22.684  23.999  25.417 1.00 38.97 ? 37   ASP A OD1 1 
ATOM   251  O OD2 . ASP A 1 57  ? 24.215  24.366  26.956 1.00 41.47 ? 37   ASP A OD2 1 
ATOM   252  N N   . SER A 1 58  ? 25.254  19.615  23.967 1.00 26.92 ? 38   SER A N   1 
ATOM   253  C CA  . SER A 1 58  ? 26.179  18.807  23.171 1.00 26.14 ? 38   SER A CA  1 
ATOM   254  C C   . SER A 1 58  ? 25.884  17.327  23.360 1.00 25.87 ? 38   SER A C   1 
ATOM   255  O O   . SER A 1 58  ? 25.105  16.963  24.234 1.00 25.30 ? 38   SER A O   1 
ATOM   256  C CB  . SER A 1 58  ? 27.658  19.095  23.540 1.00 25.86 ? 38   SER A CB  1 
ATOM   257  O OG  . SER A 1 58  ? 27.955  18.650  24.851 1.00 23.59 ? 38   SER A OG  1 
ATOM   258  N N   . VAL A 1 59  ? 26.516  16.492  22.528 1.00 25.90 ? 39   VAL A N   1 
ATOM   259  C CA  . VAL A 1 59  ? 26.417  15.038  22.664 1.00 25.93 ? 39   VAL A CA  1 
ATOM   260  C C   . VAL A 1 59  ? 27.079  14.568  23.982 1.00 26.67 ? 39   VAL A C   1 
ATOM   261  O O   . VAL A 1 59  ? 26.546  13.698  24.678 1.00 25.98 ? 39   VAL A O   1 
ATOM   262  C CB  . VAL A 1 59  ? 27.014  14.295  21.427 1.00 26.73 ? 39   VAL A CB  1 
ATOM   263  C CG1 . VAL A 1 59  ? 27.171  12.791  21.709 1.00 25.81 ? 39   VAL A CG1 1 
ATOM   264  C CG2 . VAL A 1 59  ? 26.133  14.501  20.207 1.00 22.77 ? 39   VAL A CG2 1 
ATOM   265  N N   . GLU A 1 60  ? 28.207  15.174  24.341 1.00 27.22 ? 40   GLU A N   1 
ATOM   266  C CA  . GLU A 1 60  ? 28.820  14.884  25.629 1.00 28.81 ? 40   GLU A CA  1 
ATOM   267  C C   . GLU A 1 60  ? 27.825  15.166  26.752 1.00 28.63 ? 40   GLU A C   1 
ATOM   268  O O   . GLU A 1 60  ? 27.586  14.302  27.609 1.00 27.77 ? 40   GLU A O   1 
ATOM   269  C CB  . GLU A 1 60  ? 30.121  15.676  25.853 1.00 29.87 ? 40   GLU A CB  1 
ATOM   270  C CG  . GLU A 1 60  ? 31.012  15.076  26.997 1.00 35.99 ? 40   GLU A CG  1 
ATOM   271  C CD  . GLU A 1 60  ? 30.452  15.297  28.445 1.00 45.61 ? 40   GLU A CD  1 
ATOM   272  O OE1 . GLU A 1 60  ? 30.497  14.335  29.292 1.00 47.53 ? 40   GLU A OE1 1 
ATOM   273  O OE2 . GLU A 1 60  ? 29.954  16.431  28.736 1.00 49.53 ? 40   GLU A OE2 1 
ATOM   274  N N   . ALA A 1 61  ? 27.232  16.365  26.722 1.00 27.48 ? 41   ALA A N   1 
ATOM   275  C CA  . ALA A 1 61  ? 26.320  16.809  27.771 1.00 26.79 ? 41   ALA A CA  1 
ATOM   276  C C   . ALA A 1 61  ? 25.147  15.824  27.886 1.00 26.64 ? 41   ALA A C   1 
ATOM   277  O O   . ALA A 1 61  ? 24.791  15.409  28.997 1.00 25.21 ? 41   ALA A O   1 
ATOM   278  C CB  . ALA A 1 61  ? 25.831  18.232  27.508 1.00 26.97 ? 41   ALA A CB  1 
ATOM   279  N N   . LYS A 1 62  ? 24.623  15.404  26.730 1.00 26.47 ? 42   LYS A N   1 
ATOM   280  C CA  . LYS A 1 62  ? 23.551  14.390  26.661 1.00 27.12 ? 42   LYS A CA  1 
ATOM   281  C C   . LYS A 1 62  ? 24.014  13.051  27.283 1.00 26.75 ? 42   LYS A C   1 
ATOM   282  O O   . LYS A 1 62  ? 23.291  12.483  28.053 1.00 25.24 ? 42   LYS A O   1 
ATOM   283  C CB  . LYS A 1 62  ? 23.052  14.248  25.207 1.00 27.63 ? 42   LYS A CB  1 
ATOM   284  C CG  . LYS A 1 62  ? 21.947  13.243  24.954 1.00 28.68 ? 42   LYS A CG  1 
ATOM   285  C CD  . LYS A 1 62  ? 21.634  13.226  23.459 1.00 33.79 ? 42   LYS A CD  1 
ATOM   286  C CE  . LYS A 1 62  ? 21.366  11.819  22.960 1.00 39.17 ? 42   LYS A CE  1 
ATOM   287  N NZ  . LYS A 1 62  ? 20.200  11.181  23.626 1.00 40.97 ? 42   LYS A NZ  1 
ATOM   288  N N   . LYS A 1 63  ? 25.231  12.581  26.992 1.00 27.81 ? 43   LYS A N   1 
ATOM   289  C CA  . LYS A 1 63  ? 25.789  11.397  27.718 1.00 28.74 ? 43   LYS A CA  1 
ATOM   290  C C   . LYS A 1 63  ? 25.770  11.593  29.233 1.00 28.67 ? 43   LYS A C   1 
ATOM   291  O O   . LYS A 1 63  ? 25.321  10.716  29.984 1.00 28.11 ? 43   LYS A O   1 
ATOM   292  C CB  . LYS A 1 63  ? 27.238  11.073  27.271 1.00 29.30 ? 43   LYS A CB  1 
ATOM   293  C CG  . LYS A 1 63  ? 27.753  9.586   27.573 1.00 31.87 ? 43   LYS A CG  1 
ATOM   294  C CD  . LYS A 1 63  ? 28.089  9.288   29.075 1.00 36.83 ? 43   LYS A CD  1 
ATOM   295  C CE  . LYS A 1 63  ? 29.388  9.940   29.529 1.00 39.45 ? 43   LYS A CE  1 
ATOM   296  N NZ  . LYS A 1 63  ? 29.224  10.843  30.711 1.00 38.38 ? 43   LYS A NZ  1 
ATOM   297  N N   . HIS A 1 64  ? 26.264  12.740  29.683 1.00 29.05 ? 44   HIS A N   1 
ATOM   298  C CA  . HIS A 1 64  ? 26.366  13.003  31.121 1.00 29.78 ? 44   HIS A CA  1 
ATOM   299  C C   . HIS A 1 64  ? 24.993  12.995  31.811 1.00 29.08 ? 44   HIS A C   1 
ATOM   300  O O   . HIS A 1 64  ? 24.831  12.352  32.858 1.00 27.86 ? 44   HIS A O   1 
ATOM   301  C CB  . HIS A 1 64  ? 27.077  14.321  31.367 1.00 29.85 ? 44   HIS A CB  1 
ATOM   302  C CG  . HIS A 1 64  ? 27.593  14.475  32.759 1.00 32.83 ? 44   HIS A CG  1 
ATOM   303  N ND1 . HIS A 1 64  ? 26.814  14.946  33.793 1.00 34.45 ? 44   HIS A ND1 1 
ATOM   304  C CD2 . HIS A 1 64  ? 28.819  14.233  33.290 1.00 33.59 ? 44   HIS A CD2 1 
ATOM   305  C CE1 . HIS A 1 64  ? 27.534  14.988  34.902 1.00 34.61 ? 44   HIS A CE1 1 
ATOM   306  N NE2 . HIS A 1 64  ? 28.754  14.562  34.624 1.00 33.93 ? 44   HIS A NE2 1 
ATOM   307  N N   . ALA A 1 65  ? 24.007  13.686  31.212 1.00 28.96 ? 45   ALA A N   1 
ATOM   308  C CA  . ALA A 1 65  ? 22.656  13.710  31.733 1.00 28.69 ? 45   ALA A CA  1 
ATOM   309  C C   . ALA A 1 65  ? 22.063  12.301  31.756 1.00 28.34 ? 45   ALA A C   1 
ATOM   310  O O   . ALA A 1 65  ? 21.398  11.932  32.723 1.00 28.54 ? 45   ALA A O   1 
ATOM   311  C CB  . ALA A 1 65  ? 21.758  14.672  30.922 1.00 27.90 ? 45   ALA A CB  1 
ATOM   312  N N   . THR A 1 66  ? 22.303  11.534  30.696 1.00 27.55 ? 46   THR A N   1 
ATOM   313  C CA  . THR A 1 66  ? 21.773  10.174  30.607 1.00 26.97 ? 46   THR A CA  1 
ATOM   314  C C   . THR A 1 66  ? 22.272  9.324   31.753 1.00 27.38 ? 46   THR A C   1 
ATOM   315  O O   . THR A 1 66  ? 21.475  8.702   32.434 1.00 27.01 ? 46   THR A O   1 
ATOM   316  C CB  . THR A 1 66  ? 22.188  9.478   29.315 1.00 26.33 ? 46   THR A CB  1 
ATOM   317  O OG1 . THR A 1 66  ? 21.735  10.243  28.202 1.00 25.89 ? 46   THR A OG1 1 
ATOM   318  C CG2 . THR A 1 66  ? 21.587  8.074   29.256 1.00 26.65 ? 46   THR A CG2 1 
ATOM   319  N N   . ARG A 1 67  ? 23.591  9.304   31.972 1.00 27.68 ? 47   ARG A N   1 
ATOM   320  C CA  . ARG A 1 67  ? 24.121  8.565   33.116 1.00 28.56 ? 47   ARG A CA  1 
ATOM   321  C C   . ARG A 1 67  ? 23.633  9.053   34.496 1.00 27.93 ? 47   ARG A C   1 
ATOM   322  O O   . ARG A 1 67  ? 23.530  8.274   35.430 1.00 27.04 ? 47   ARG A O   1 
ATOM   323  C CB  . ARG A 1 67  ? 25.645  8.330   33.018 1.00 29.52 ? 47   ARG A CB  1 
ATOM   324  C CG  . ARG A 1 67  ? 26.568  9.424   33.465 1.00 34.63 ? 47   ARG A CG  1 
ATOM   325  C CD  . ARG A 1 67  ? 28.041  8.941   33.318 1.00 41.22 ? 47   ARG A CD  1 
ATOM   326  N NE  . ARG A 1 67  ? 28.989  10.058  33.226 1.00 46.72 ? 47   ARG A NE  1 
ATOM   327  C CZ  . ARG A 1 67  ? 30.317  9.931   33.076 1.00 51.94 ? 47   ARG A CZ  1 
ATOM   328  N NH1 . ARG A 1 67  ? 31.086  11.024  32.995 1.00 53.77 ? 47   ARG A NH1 1 
ATOM   329  N NH2 . ARG A 1 67  ? 30.891  8.723   32.999 1.00 52.96 ? 47   ARG A NH2 1 
ATOM   330  N N   . ASN A 1 68  ? 23.248  10.325  34.584 1.00 27.84 ? 48   ASN A N   1 
ATOM   331  C CA  . ASN A 1 68  ? 22.745  10.896  35.818 1.00 27.89 ? 48   ASN A CA  1 
ATOM   332  C C   . ASN A 1 68  ? 21.234  11.191  35.821 1.00 28.27 ? 48   ASN A C   1 
ATOM   333  O O   . ASN A 1 68  ? 20.790  12.044  36.576 1.00 28.36 ? 48   ASN A O   1 
ATOM   334  C CB  . ASN A 1 68  ? 23.505  12.179  36.131 1.00 28.06 ? 48   ASN A CB  1 
ATOM   335  C CG  . ASN A 1 68  ? 24.955  11.919  36.495 1.00 29.68 ? 48   ASN A CG  1 
ATOM   336  O OD1 . ASN A 1 68  ? 25.254  11.446  37.596 1.00 32.36 ? 48   ASN A OD1 1 
ATOM   337  N ND2 . ASN A 1 68  ? 25.861  12.204  35.570 1.00 32.31 ? 48   ASN A ND2 1 
ATOM   338  N N   . ARG A 1 69  ? 20.456  10.502  34.995 1.00 28.11 ? 49   ARG A N   1 
ATOM   339  C CA  . ARG A 1 69  ? 19.032  10.858  34.844 1.00 28.75 ? 49   ARG A CA  1 
ATOM   340  C C   . ARG A 1 69  ? 18.135  10.549  36.058 1.00 29.48 ? 49   ARG A C   1 
ATOM   341  O O   . ARG A 1 69  ? 16.997  11.062  36.158 1.00 28.83 ? 49   ARG A O   1 
ATOM   342  C CB  . ARG A 1 69  ? 18.453  10.209  33.596 1.00 29.46 ? 49   ARG A CB  1 
ATOM   343  C CG  . ARG A 1 69  ? 18.320  8.705   33.668 1.00 29.84 ? 49   ARG A CG  1 
ATOM   344  C CD  . ARG A 1 69  ? 18.120  8.156   32.280 1.00 32.10 ? 49   ARG A CD  1 
ATOM   345  N NE  . ARG A 1 69  ? 17.896  6.717   32.274 1.00 33.56 ? 49   ARG A NE  1 
ATOM   346  C CZ  . ARG A 1 69  ? 18.855  5.793   32.226 1.00 36.00 ? 49   ARG A CZ  1 
ATOM   347  N NH1 . ARG A 1 69  ? 20.151  6.133   32.193 1.00 35.12 ? 49   ARG A NH1 1 
ATOM   348  N NH2 . ARG A 1 69  ? 18.510  4.508   32.207 1.00 36.14 ? 49   ARG A NH2 1 
ATOM   349  N N   . ALA A 1 70  ? 18.628  9.704   36.966 1.00 30.43 ? 50   ALA A N   1 
ATOM   350  C CA  . ALA A 1 70  ? 17.902  9.388   38.200 1.00 31.18 ? 50   ALA A CA  1 
ATOM   351  C C   . ALA A 1 70  ? 18.584  10.011  39.434 1.00 31.92 ? 50   ALA A C   1 
ATOM   352  O O   . ALA A 1 70  ? 18.193  9.734   40.576 1.00 32.25 ? 50   ALA A O   1 
ATOM   353  C CB  . ALA A 1 70  ? 17.791  7.871   38.344 1.00 30.95 ? 50   ALA A CB  1 
ATOM   354  N N   . ASN A 1 71  ? 19.581  10.872  39.180 1.00 32.41 ? 51   ASN A N   1 
ATOM   355  C CA  . ASN A 1 71  ? 20.533  11.405  40.175 1.00 32.94 ? 51   ASN A CA  1 
ATOM   356  C C   . ASN A 1 71  ? 20.539  12.945  40.086 1.00 31.98 ? 51   ASN A C   1 
ATOM   357  O O   . ASN A 1 71  ? 21.540  13.599  40.340 1.00 32.23 ? 51   ASN A O   1 
ATOM   358  C CB  . ASN A 1 71  ? 21.941  10.773  39.912 1.00 34.07 ? 51   ASN A CB  1 
ATOM   359  C CG  . ASN A 1 71  ? 23.096  11.286  40.867 1.00 37.12 ? 51   ASN A CG  1 
ATOM   360  O OD1 . ASN A 1 71  ? 24.245  11.459  40.409 1.00 40.27 ? 51   ASN A OD1 1 
ATOM   361  N ND2 . ASN A 1 71  ? 22.808  11.471  42.169 1.00 38.56 ? 51   ASN A ND2 1 
ATOM   362  N N   . GLY A 1 72  ? 19.409  13.521  39.689 1.00 31.19 ? 52   GLY A N   1 
ATOM   363  C CA  . GLY A 1 72  ? 19.224  14.989  39.768 1.00 30.22 ? 52   GLY A CA  1 
ATOM   364  C C   . GLY A 1 72  ? 19.954  15.863  38.752 1.00 29.40 ? 52   GLY A C   1 
ATOM   365  O O   . GLY A 1 72  ? 20.191  17.050  38.997 1.00 28.91 ? 52   GLY A O   1 
ATOM   366  N N   . GLU A 1 73  ? 20.319  15.282  37.612 1.00 28.70 ? 53   GLU A N   1 
ATOM   367  C CA  . GLU A 1 73  ? 20.752  16.069  36.467 1.00 27.61 ? 53   GLU A CA  1 
ATOM   368  C C   . GLU A 1 73  ? 19.579  16.143  35.472 1.00 27.12 ? 53   GLU A C   1 
ATOM   369  O O   . GLU A 1 73  ? 18.911  15.119  35.211 1.00 26.40 ? 53   GLU A O   1 
ATOM   370  C CB  . GLU A 1 73  ? 22.015  15.457  35.813 1.00 28.92 ? 53   GLU A CB  1 
ATOM   371  C CG  . GLU A 1 73  ? 22.544  16.231  34.607 1.00 31.63 ? 53   GLU A CG  1 
ATOM   372  C CD  . GLU A 1 73  ? 24.026  16.002  34.372 1.00 38.39 ? 53   GLU A CD  1 
ATOM   373  O OE1 . GLU A 1 73  ? 24.516  16.386  33.285 1.00 38.78 ? 53   GLU A OE1 1 
ATOM   374  O OE2 . GLU A 1 73  ? 24.699  15.447  35.282 1.00 39.75 ? 53   GLU A OE2 1 
ATOM   375  N N   . LEU A 1 74  ? 19.322  17.342  34.940 1.00 24.16 ? 54   LEU A N   1 
ATOM   376  C CA  . LEU A 1 74  ? 18.251  17.543  33.983 1.00 24.17 ? 54   LEU A CA  1 
ATOM   377  C C   . LEU A 1 74  ? 18.365  16.591  32.783 1.00 23.47 ? 54   LEU A C   1 
ATOM   378  O O   . LEU A 1 74  ? 19.392  16.525  32.121 1.00 22.38 ? 54   LEU A O   1 
ATOM   379  C CB  . LEU A 1 74  ? 18.175  19.006  33.548 1.00 23.53 ? 54   LEU A CB  1 
ATOM   380  C CG  . LEU A 1 74  ? 17.833  20.015  34.653 1.00 24.91 ? 54   LEU A CG  1 
ATOM   381  C CD1 . LEU A 1 74  ? 18.105  21.429  34.209 1.00 24.92 ? 54   LEU A CD1 1 
ATOM   382  C CD2 . LEU A 1 74  ? 16.355  19.878  35.062 1.00 22.01 ? 54   LEU A CD2 1 
ATOM   383  N N   . PHE A 1 75  ? 17.293  15.853  32.526 1.00 22.21 ? 55   PHE A N   1 
ATOM   384  C CA  . PHE A 1 75  ? 17.265  14.854  31.463 1.00 22.94 ? 55   PHE A CA  1 
ATOM   385  C C   . PHE A 1 75  ? 15.941  14.800  30.674 1.00 22.37 ? 55   PHE A C   1 
ATOM   386  O O   . PHE A 1 75  ? 15.912  14.923  29.446 1.00 22.17 ? 55   PHE A O   1 
ATOM   387  C CB  . PHE A 1 75  ? 17.599  13.476  32.053 1.00 23.77 ? 55   PHE A CB  1 
ATOM   388  C CG  . PHE A 1 75  ? 17.564  12.372  31.026 1.00 24.82 ? 55   PHE A CG  1 
ATOM   389  C CD1 . PHE A 1 75  ? 18.651  12.151  30.196 1.00 26.68 ? 55   PHE A CD1 1 
ATOM   390  C CD2 . PHE A 1 75  ? 16.427  11.591  30.878 1.00 25.94 ? 55   PHE A CD2 1 
ATOM   391  C CE1 . PHE A 1 75  ? 18.613  11.138  29.235 1.00 28.92 ? 55   PHE A CE1 1 
ATOM   392  C CE2 . PHE A 1 75  ? 16.383  10.587  29.904 1.00 28.92 ? 55   PHE A CE2 1 
ATOM   393  C CZ  . PHE A 1 75  ? 17.478  10.364  29.090 1.00 27.52 ? 55   PHE A CZ  1 
ATOM   394  N N   . TYR A 1 76  ? 14.837  14.605  31.377 1.00 22.23 ? 56   TYR A N   1 
ATOM   395  C CA  . TYR A 1 76  ? 13.550  14.629  30.721 1.00 22.67 ? 56   TYR A CA  1 
ATOM   396  C C   . TYR A 1 76  ? 12.539  14.985  31.781 1.00 21.27 ? 56   TYR A C   1 
ATOM   397  O O   . TYR A 1 76  ? 12.730  14.593  32.916 1.00 22.71 ? 56   TYR A O   1 
ATOM   398  C CB  . TYR A 1 76  ? 13.186  13.304  30.033 1.00 22.38 ? 56   TYR A CB  1 
ATOM   399  C CG  . TYR A 1 76  ? 11.851  13.396  29.290 1.00 22.98 ? 56   TYR A CG  1 
ATOM   400  C CD1 . TYR A 1 76  ? 11.655  14.368  28.299 1.00 25.15 ? 56   TYR A CD1 1 
ATOM   401  C CD2 . TYR A 1 76  ? 10.775  12.542  29.615 1.00 23.29 ? 56   TYR A CD2 1 
ATOM   402  C CE1 . TYR A 1 76  ? 10.420  14.483  27.641 1.00 27.35 ? 56   TYR A CE1 1 
ATOM   403  C CE2 . TYR A 1 76  ? 9.549   12.627  28.948 1.00 20.72 ? 56   TYR A CE2 1 
ATOM   404  C CZ  . TYR A 1 76  ? 9.370   13.608  27.964 1.00 25.12 ? 56   TYR A CZ  1 
ATOM   405  O OH  . TYR A 1 76  ? 8.140   13.762  27.303 1.00 26.52 ? 56   TYR A OH  1 
ATOM   406  N N   . GLY A 1 77  ? 11.518  15.775  31.426 1.00 20.90 ? 57   GLY A N   1 
ATOM   407  C CA  . GLY A 1 77  ? 10.547  16.264  32.403 1.00 19.78 ? 57   GLY A CA  1 
ATOM   408  C C   . GLY A 1 77  ? 9.862   15.180  33.222 1.00 20.41 ? 57   GLY A C   1 
ATOM   409  O O   . GLY A 1 77  ? 9.474   15.409  34.391 1.00 19.46 ? 57   GLY A O   1 
ATOM   410  N N   . ARG A 1 78  ? 9.687   14.000  32.608 1.00 20.84 ? 58   ARG A N   1 
ATOM   411  C CA  . ARG A 1 78  ? 9.063   12.864  33.290 1.00 20.86 ? 58   ARG A CA  1 
ATOM   412  C C   . ARG A 1 78  ? 9.853   12.456  34.516 1.00 21.27 ? 58   ARG A C   1 
ATOM   413  O O   . ARG A 1 78  ? 9.275   12.043  35.500 1.00 21.02 ? 58   ARG A O   1 
ATOM   414  C CB  . ARG A 1 78  ? 8.773   11.658  32.371 1.00 21.54 ? 58   ARG A CB  1 
ATOM   415  C CG  . ARG A 1 78  ? 7.699   10.660  32.968 1.00 19.15 ? 58   ARG A CG  1 
ATOM   416  C CD  . ARG A 1 78  ? 7.357   9.403   32.035 1.00 19.01 ? 58   ARG A CD  1 
ATOM   417  N NE  . ARG A 1 78  ? 7.410   9.718   30.601 1.00 17.42 ? 58   ARG A NE  1 
ATOM   418  C CZ  . ARG A 1 78  ? 8.307   9.160   29.755 1.00 24.53 ? 58   ARG A CZ  1 
ATOM   419  N NH1 . ARG A 1 78  ? 9.103   8.205   30.199 1.00 23.78 ? 58   ARG A NH1 1 
ATOM   420  N NH2 . ARG A 1 78  ? 8.391   9.495   28.459 1.00 20.74 ? 58   ARG A NH2 1 
ATOM   421  N N   . ARG A 1 79  ? 11.180  12.589  34.457 1.00 21.26 ? 59   ARG A N   1 
ATOM   422  C CA  . ARG A 1 79  ? 12.032  12.392  35.645 1.00 23.27 ? 59   ARG A CA  1 
ATOM   423  C C   . ARG A 1 79  ? 12.087  13.637  36.563 1.00 24.39 ? 59   ARG A C   1 
ATOM   424  O O   . ARG A 1 79  ? 12.530  13.527  37.706 1.00 25.61 ? 59   ARG A O   1 
ATOM   425  C CB  . ARG A 1 79  ? 13.478  12.118  35.214 1.00 22.63 ? 59   ARG A CB  1 
ATOM   426  C CG  . ARG A 1 79  ? 13.696  10.816  34.434 1.00 24.01 ? 59   ARG A CG  1 
ATOM   427  C CD  . ARG A 1 79  ? 14.178  9.726   35.367 1.00 23.80 ? 59   ARG A CD  1 
ATOM   428  N NE  . ARG A 1 79  ? 14.394  8.443   34.684 1.00 26.96 ? 59   ARG A NE  1 
ATOM   429  C CZ  . ARG A 1 79  ? 14.530  7.282   35.331 1.00 26.93 ? 59   ARG A CZ  1 
ATOM   430  N NH1 . ARG A 1 79  ? 14.417  7.242   36.667 1.00 27.84 ? 59   ARG A NH1 1 
ATOM   431  N NH2 . ARG A 1 79  ? 14.748  6.158   34.653 1.00 25.77 ? 59   ARG A NH2 1 
ATOM   432  N N   . GLY A 1 80  ? 11.683  14.805  36.057 1.00 23.51 ? 60   GLY A N   1 
ATOM   433  C CA  . GLY A 1 80  ? 11.632  16.007  36.895 1.00 22.11 ? 60   GLY A CA  1 
ATOM   434  C C   . GLY A 1 80  ? 12.545  17.117  36.426 1.00 20.85 ? 60   GLY A C   1 
ATOM   435  O O   . GLY A 1 80  ? 13.454  16.894  35.602 1.00 20.50 ? 60   GLY A O   1 
ATOM   436  N N   . THR A 1 81  ? 12.252  18.325  36.914 1.00 19.51 ? 61   THR A N   1 
ATOM   437  C CA  . THR A 1 81  ? 13.065  19.513  36.693 1.00 18.66 ? 61   THR A CA  1 
ATOM   438  C C   . THR A 1 81  ? 13.698  19.970  38.037 1.00 17.91 ? 61   THR A C   1 
ATOM   439  O O   . THR A 1 81  ? 13.584  19.282  39.065 1.00 17.08 ? 61   THR A O   1 
ATOM   440  C CB  . THR A 1 81  ? 12.218  20.638  36.100 1.00 19.18 ? 61   THR A CB  1 
ATOM   441  O OG1 . THR A 1 81  ? 11.279  21.097  37.080 1.00 20.62 ? 61   THR A OG1 1 
ATOM   442  C CG2 . THR A 1 81  ? 11.381  20.102  34.876 1.00 20.26 ? 61   THR A CG2 1 
ATOM   443  N N   . LEU A 1 82  ? 14.307  21.146  38.043 1.00 16.24 ? 62   LEU A N   1 
ATOM   444  C CA  . LEU A 1 82  ? 14.819  21.735  39.275 1.00 16.82 ? 62   LEU A CA  1 
ATOM   445  C C   . LEU A 1 82  ? 13.798  21.810  40.368 1.00 16.11 ? 62   LEU A C   1 
ATOM   446  O O   . LEU A 1 82  ? 14.102  21.604  41.519 1.00 14.98 ? 62   LEU A O   1 
ATOM   447  C CB  . LEU A 1 82  ? 15.343  23.147  39.005 1.00 17.44 ? 62   LEU A CB  1 
ATOM   448  C CG  . LEU A 1 82  ? 16.584  23.223  38.086 1.00 17.78 ? 62   LEU A CG  1 
ATOM   449  C CD1 . LEU A 1 82  ? 16.862  24.705  37.870 1.00 17.30 ? 62   LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1 82  ? 17.835  22.502  38.586 1.00 22.65 ? 62   LEU A CD2 1 
ATOM   451  N N   . THR A 1 83  ? 12.548  22.060  39.993 1.00 16.72 ? 63   THR A N   1 
ATOM   452  C CA  . THR A 1 83  ? 11.526  22.198  40.978 1.00 17.10 ? 63   THR A CA  1 
ATOM   453  C C   . THR A 1 83  ? 11.229  20.868  41.707 1.00 17.12 ? 63   THR A C   1 
ATOM   454  O O   . THR A 1 83  ? 10.978  20.827  42.929 1.00 17.38 ? 63   THR A O   1 
ATOM   455  C CB  . THR A 1 83  ? 10.270  22.705  40.296 1.00 15.72 ? 63   THR A CB  1 
ATOM   456  O OG1 . THR A 1 83  ? 10.599  23.878  39.524 1.00 18.09 ? 63   THR A OG1 1 
ATOM   457  C CG2 . THR A 1 83  ? 9.303   23.070  41.345 1.00 18.02 ? 63   THR A CG2 1 
ATOM   458  N N   . HIS A 1 84  ? 11.215  19.785  40.936 1.00 17.60 ? 64   HIS A N   1 
ATOM   459  C CA  . HIS A 1 84  ? 10.994  18.452  41.510 1.00 17.10 ? 64   HIS A CA  1 
ATOM   460  C C   . HIS A 1 84  ? 12.207  18.088  42.361 1.00 17.40 ? 64   HIS A C   1 
ATOM   461  O O   . HIS A 1 84  ? 12.032  17.579  43.468 1.00 15.55 ? 64   HIS A O   1 
ATOM   462  C CB  . HIS A 1 84  ? 10.797  17.399  40.419 1.00 17.84 ? 64   HIS A CB  1 
ATOM   463  C CG  . HIS A 1 84  ? 9.715   17.718  39.434 1.00 16.40 ? 64   HIS A CG  1 
ATOM   464  N ND1 . HIS A 1 84  ? 8.400   17.302  39.575 1.00 21.16 ? 64   HIS A ND1 1 
ATOM   465  C CD2 . HIS A 1 84  ? 9.765   18.411  38.278 1.00 15.27 ? 64   HIS A CD2 1 
ATOM   466  C CE1 . HIS A 1 84  ? 7.706   17.698  38.520 1.00 11.88 ? 64   HIS A CE1 1 
ATOM   467  N NE2 . HIS A 1 84  ? 8.507   18.390  37.733 1.00 18.94 ? 64   HIS A NE2 1 
ATOM   468  N N   . PHE A 1 85  ? 13.418  18.319  41.840 1.00 17.34 ? 65   PHE A N   1 
ATOM   469  C CA  . PHE A 1 85  ? 14.640  17.946  42.574 1.00 16.49 ? 65   PHE A CA  1 
ATOM   470  C C   . PHE A 1 85  ? 14.674  18.646  43.948 1.00 16.51 ? 65   PHE A C   1 
ATOM   471  O O   . PHE A 1 85  ? 15.087  18.049  44.958 1.00 14.32 ? 65   PHE A O   1 
ATOM   472  C CB  . PHE A 1 85  ? 15.950  18.283  41.808 1.00 18.58 ? 65   PHE A CB  1 
ATOM   473  C CG  . PHE A 1 85  ? 16.037  17.705  40.407 1.00 19.65 ? 65   PHE A CG  1 
ATOM   474  C CD1 . PHE A 1 85  ? 15.268  16.595  40.025 1.00 16.23 ? 65   PHE A CD1 1 
ATOM   475  C CD2 . PHE A 1 85  ? 16.892  18.286  39.472 1.00 23.36 ? 65   PHE A CD2 1 
ATOM   476  C CE1 . PHE A 1 85  ? 15.368  16.081  38.731 1.00 20.56 ? 65   PHE A CE1 1 
ATOM   477  C CE2 . PHE A 1 85  ? 16.995  17.787  38.163 1.00 24.26 ? 65   PHE A CE2 1 
ATOM   478  C CZ  . PHE A 1 85  ? 16.216  16.696  37.794 1.00 20.85 ? 65   PHE A CZ  1 
ATOM   479  N N   . SER A 1 86  ? 14.277  19.920  43.960 1.00 15.76 ? 66   SER A N   1 
ATOM   480  C CA  . SER A 1 86  ? 14.115  20.664  45.218 1.00 14.92 ? 66   SER A CA  1 
ATOM   481  C C   . SER A 1 86  ? 13.161  20.030  46.235 1.00 15.26 ? 66   SER A C   1 
ATOM   482  O O   . SER A 1 86  ? 13.506  19.893  47.418 1.00 14.21 ? 66   SER A O   1 
ATOM   483  C CB  . SER A 1 86  ? 13.782  22.139  44.947 1.00 12.63 ? 66   SER A CB  1 
ATOM   484  O OG  . SER A 1 86  ? 13.850  22.940  46.136 1.00 15.23 ? 66   SER A OG  1 
ATOM   485  N N   . LEU A 1 87  ? 11.932  19.709  45.810 1.00 16.12 ? 67   LEU A N   1 
ATOM   486  C CA  . LEU A 1 87  ? 11.023  18.992  46.681 1.00 16.75 ? 67   LEU A CA  1 
ATOM   487  C C   . LEU A 1 87  ? 11.547  17.606  47.155 1.00 16.72 ? 67   LEU A C   1 
ATOM   488  O O   . LEU A 1 87  ? 11.468  17.265  48.342 1.00 15.95 ? 67   LEU A O   1 
ATOM   489  C CB  . LEU A 1 87  ? 9.616   18.877  46.035 1.00 16.48 ? 67   LEU A CB  1 
ATOM   490  C CG  . LEU A 1 87  ? 8.626   18.039  46.878 1.00 18.73 ? 67   LEU A CG  1 
ATOM   491  C CD1 . LEU A 1 87  ? 8.181   18.773  48.152 1.00 13.93 ? 67   LEU A CD1 1 
ATOM   492  C CD2 . LEU A 1 87  ? 7.431   17.703  46.038 1.00 20.82 ? 67   LEU A CD2 1 
ATOM   493  N N   . GLN A 1 88  ? 12.133  16.843  46.230 1.00 17.83 ? 68   GLN A N   1 
ATOM   494  C CA  . GLN A 1 88  ? 12.748  15.554  46.565 1.00 17.94 ? 68   GLN A CA  1 
ATOM   495  C C   . GLN A 1 88  ? 13.882  15.653  47.610 1.00 18.72 ? 68   GLN A C   1 
ATOM   496  O O   . GLN A 1 88  ? 13.946  14.837  48.535 1.00 18.90 ? 68   GLN A O   1 
ATOM   497  C CB  . GLN A 1 88  ? 13.237  14.900  45.270 1.00 17.55 ? 68   GLN A CB  1 
ATOM   498  C CG  . GLN A 1 88  ? 12.082  14.438  44.372 1.00 17.43 ? 68   GLN A CG  1 
ATOM   499  C CD  . GLN A 1 88  ? 12.583  13.855  43.076 1.00 17.91 ? 68   GLN A CD  1 
ATOM   500  O OE1 . GLN A 1 88  ? 12.327  12.678  42.776 1.00 22.29 ? 68   GLN A OE1 1 
ATOM   501  N NE2 . GLN A 1 88  ? 13.365  14.640  42.325 1.00 17.40 ? 68   GLN A NE2 1 
ATOM   502  N N   . GLN A 1 89  ? 14.809  16.597  47.435 1.00 19.26 ? 69   GLN A N   1 
ATOM   503  C CA  . GLN A 1 89  ? 15.796  16.872  48.481 1.00 19.56 ? 69   GLN A CA  1 
ATOM   504  C C   . GLN A 1 89  ? 15.125  17.198  49.848 1.00 19.40 ? 69   GLN A C   1 
ATOM   505  O O   . GLN A 1 89  ? 15.532  16.682  50.879 1.00 19.29 ? 69   GLN A O   1 
ATOM   506  C CB  . GLN A 1 89  ? 16.738  18.005  48.038 1.00 19.42 ? 69   GLN A CB  1 
ATOM   507  C CG  . GLN A 1 89  ? 17.786  18.392  49.068 1.00 23.52 ? 69   GLN A CG  1 
ATOM   508  C CD  . GLN A 1 89  ? 18.632  19.577  48.608 1.00 28.76 ? 69   GLN A CD  1 
ATOM   509  O OE1 . GLN A 1 89  ? 19.279  19.512  47.555 1.00 33.16 ? 69   GLN A OE1 1 
ATOM   510  N NE2 . GLN A 1 89  ? 18.635  20.659  49.389 1.00 30.06 ? 69   GLN A NE2 1 
ATOM   511  N N   . ALA A 1 90  ? 14.087  18.043  49.827 1.00 18.57 ? 70   ALA A N   1 
ATOM   512  C CA  . ALA A 1 90  ? 13.380  18.443  51.039 1.00 18.34 ? 70   ALA A CA  1 
ATOM   513  C C   . ALA A 1 90  ? 12.684  17.268  51.761 1.00 18.13 ? 70   ALA A C   1 
ATOM   514  O O   . ALA A 1 90  ? 12.836  17.077  52.976 1.00 17.01 ? 70   ALA A O   1 
ATOM   515  C CB  . ALA A 1 90  ? 12.396  19.603  50.733 1.00 17.14 ? 70   ALA A CB  1 
ATOM   516  N N   . MET A 1 91  ? 11.992  16.431  51.001 1.00 18.13 ? 71   MET A N   1 
ATOM   517  C CA  . MET A 1 91  ? 11.352  15.258  51.587 1.00 18.46 ? 71   MET A CA  1 
ATOM   518  C C   . MET A 1 91  ? 12.356  14.283  52.183 1.00 18.36 ? 71   MET A C   1 
ATOM   519  O O   . MET A 1 91  ? 12.120  13.684  53.234 1.00 17.61 ? 71   MET A O   1 
ATOM   520  C CB  . MET A 1 91  ? 10.484  14.573  50.528 1.00 18.28 ? 71   MET A CB  1 
ATOM   521  C CG  . MET A 1 91  ? 9.288   15.433  50.092 1.00 19.86 ? 71   MET A CG  1 
ATOM   522  S SD  . MET A 1 91  ? 8.319   16.069  51.487 1.00 23.02 ? 71   MET A SD  1 
ATOM   523  C CE  . MET A 1 91  ? 7.825   14.504  52.202 1.00 24.81 ? 71   MET A CE  1 
ATOM   524  N N   . CYS A 1 92  ? 13.476  14.102  51.480 1.00 19.36 ? 72   CYS A N   1 
ATOM   525  C CA  . CYS A 1 92  ? 14.550  13.245  51.934 1.00 20.69 ? 72   CYS A CA  1 
ATOM   526  C C   . CYS A 1 92  ? 15.209  13.744  53.240 1.00 21.64 ? 72   CYS A C   1 
ATOM   527  O O   . CYS A 1 92  ? 15.501  12.955  54.156 1.00 21.06 ? 72   CYS A O   1 
ATOM   528  C CB  . CYS A 1 92  ? 15.594  13.145  50.847 1.00 20.55 ? 72   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 92  ? 15.193  11.989  49.552 1.00 24.12 ? 72   CYS A SG  1 
ATOM   530  N N   . GLU A 1 93  ? 15.456  15.041  53.336 1.00 21.69 ? 73   GLU A N   1 
ATOM   531  C CA  . GLU A 1 93  ? 15.945  15.509  54.609 1.00 23.71 ? 73   GLU A CA  1 
ATOM   532  C C   . GLU A 1 93  ? 14.925  15.466  55.730 1.00 23.04 ? 73   GLU A C   1 
ATOM   533  O O   . GLU A 1 93  ? 15.276  15.111  56.835 1.00 24.73 ? 73   GLU A O   1 
ATOM   534  C CB  . GLU A 1 93  ? 16.649  16.854  54.538 1.00 24.75 ? 73   GLU A CB  1 
ATOM   535  C CG  . GLU A 1 93  ? 15.977  17.975  53.870 1.00 29.86 ? 73   GLU A CG  1 
ATOM   536  C CD  . GLU A 1 93  ? 16.937  19.170  53.822 1.00 37.72 ? 73   GLU A CD  1 
ATOM   537  O OE1 . GLU A 1 93  ? 17.281  19.673  54.930 1.00 41.76 ? 73   GLU A OE1 1 
ATOM   538  O OE2 . GLU A 1 93  ? 17.371  19.567  52.711 1.00 38.44 ? 73   GLU A OE2 1 
ATOM   539  N N   . LEU A 1 94  ? 13.678  15.790  55.443 1.00 22.94 ? 74   LEU A N   1 
ATOM   540  C CA  . LEU A 1 94  ? 12.626  15.769  56.477 1.00 22.45 ? 74   LEU A CA  1 
ATOM   541  C C   . LEU A 1 94  ? 12.283  14.371  56.972 1.00 22.21 ? 74   LEU A C   1 
ATOM   542  O O   . LEU A 1 94  ? 12.120  14.174  58.170 1.00 22.36 ? 74   LEU A O   1 
ATOM   543  C CB  . LEU A 1 94  ? 11.384  16.504  56.043 1.00 23.58 ? 74   LEU A CB  1 
ATOM   544  C CG  . LEU A 1 94  ? 11.679  17.981  55.783 1.00 23.46 ? 74   LEU A CG  1 
ATOM   545  C CD1 . LEU A 1 94  ? 10.438  18.566  55.103 1.00 23.71 ? 74   LEU A CD1 1 
ATOM   546  C CD2 . LEU A 1 94  ? 12.113  18.757  57.043 1.00 24.96 ? 74   LEU A CD2 1 
ATOM   547  N N   . GLU A 1 95  ? 12.239  13.388  56.082 1.00 21.59 ? 75   GLU A N   1 
ATOM   548  C CA  . GLU A 1 95  ? 11.960  12.026  56.525 1.00 21.55 ? 75   GLU A CA  1 
ATOM   549  C C   . GLU A 1 95  ? 13.188  11.118  56.631 1.00 22.05 ? 75   GLU A C   1 
ATOM   550  O O   . GLU A 1 95  ? 13.059  9.944   56.955 1.00 23.32 ? 75   GLU A O   1 
ATOM   551  C CB  . GLU A 1 95  ? 10.824  11.400  55.686 1.00 22.21 ? 75   GLU A CB  1 
ATOM   552  C CG  . GLU A 1 95  ? 9.567   12.255  55.654 1.00 20.48 ? 75   GLU A CG  1 
ATOM   553  C CD  . GLU A 1 95  ? 8.370   11.452  55.128 1.00 23.49 ? 75   GLU A CD  1 
ATOM   554  O OE1 . GLU A 1 95  ? 8.122   10.345  55.676 1.00 23.50 ? 75   GLU A OE1 1 
ATOM   555  O OE2 . GLU A 1 95  ? 7.713   11.918  54.168 1.00 21.46 ? 75   GLU A OE2 1 
ATOM   556  N N   . GLY A 1 96  ? 14.386  11.649  56.421 1.00 22.22 ? 76   GLY A N   1 
ATOM   557  C CA  . GLY A 1 96  ? 15.614  10.858  56.605 1.00 21.28 ? 76   GLY A CA  1 
ATOM   558  C C   . GLY A 1 96  ? 15.702  9.671   55.647 1.00 20.95 ? 76   GLY A C   1 
ATOM   559  O O   . GLY A 1 96  ? 15.859  8.535   56.080 1.00 20.47 ? 76   GLY A O   1 
ATOM   560  N N   . GLY A 1 97  ? 15.562  9.940   54.349 1.00 20.47 ? 77   GLY A N   1 
ATOM   561  C CA  . GLY A 1 97  ? 15.567  8.890   53.336 1.00 21.38 ? 77   GLY A CA  1 
ATOM   562  C C   . GLY A 1 97  ? 16.664  9.037   52.300 1.00 21.55 ? 77   GLY A C   1 
ATOM   563  O O   . GLY A 1 97  ? 17.308  10.081  52.201 1.00 21.27 ? 77   GLY A O   1 
ATOM   564  N N   . ALA A 1 98  ? 16.854  7.982   51.526 1.00 20.88 ? 78   ALA A N   1 
ATOM   565  C CA  . ALA A 1 98  ? 17.759  7.981   50.393 1.00 21.21 ? 78   ALA A CA  1 
ATOM   566  C C   . ALA A 1 98  ? 17.123  8.612   49.155 1.00 21.12 ? 78   ALA A C   1 
ATOM   567  O O   . ALA A 1 98  ? 17.802  9.236   48.374 1.00 22.08 ? 78   ALA A O   1 
ATOM   568  C CB  . ALA A 1 98  ? 18.219  6.559   50.092 1.00 21.85 ? 78   ALA A CB  1 
ATOM   569  N N   . GLY A 1 99  ? 15.815  8.471   48.973 1.00 19.84 ? 79   GLY A N   1 
ATOM   570  C CA  . GLY A 1 99  ? 15.178  9.049   47.792 1.00 19.21 ? 79   GLY A CA  1 
ATOM   571  C C   . GLY A 1 99  ? 13.721  9.313   48.059 1.00 18.57 ? 79   GLY A C   1 
ATOM   572  O O   . GLY A 1 99  ? 13.193  8.791   49.041 1.00 18.33 ? 79   GLY A O   1 
ATOM   573  N N   . CYS A 1 100 ? 13.104  10.111  47.184 1.00 17.20 ? 80   CYS A N   1 
ATOM   574  C CA  . CYS A 1 100 ? 11.694  10.479  47.321 1.00 17.02 ? 80   CYS A CA  1 
ATOM   575  C C   . CYS A 1 100 ? 11.109  10.342  45.951 1.00 17.19 ? 80   CYS A C   1 
ATOM   576  O O   . CYS A 1 100 ? 11.514  11.038  45.016 1.00 17.39 ? 80   CYS A O   1 
ATOM   577  C CB  . CYS A 1 100 ? 11.546  11.915  47.841 1.00 16.14 ? 80   CYS A CB  1 
ATOM   578  S SG  . CYS A 1 100 ? 9.786   12.421  47.891 1.00 20.43 ? 80   CYS A SG  1 
ATOM   579  N N   . VAL A 1 101 ? 10.131  9.445   45.830 1.00 17.73 ? 81   VAL A N   1 
ATOM   580  C CA  . VAL A 1 101 ? 9.441   9.234   44.579 1.00 18.05 ? 81   VAL A CA  1 
ATOM   581  C C   . VAL A 1 101 ? 8.115   10.020  44.614 1.00 18.78 ? 81   VAL A C   1 
ATOM   582  O O   . VAL A 1 101 ? 7.459   10.062  45.639 1.00 18.34 ? 81   VAL A O   1 
ATOM   583  C CB  . VAL A 1 101 ? 9.248   7.718   44.299 1.00 17.15 ? 81   VAL A CB  1 
ATOM   584  C CG1 . VAL A 1 101 ? 8.730   7.548   42.872 1.00 19.48 ? 81   VAL A CG1 1 
ATOM   585  C CG2 . VAL A 1 101 ? 10.629  6.951   44.487 1.00 19.26 ? 81   VAL A CG2 1 
ATOM   586  N N   . LEU A 1 102 ? 7.787   10.676  43.498 1.00 19.98 ? 82   LEU A N   1 
ATOM   587  C CA  . LEU A 1 102 ? 6.619   11.541  43.403 1.00 18.70 ? 82   LEU A CA  1 
ATOM   588  C C   . LEU A 1 102 ? 5.491   10.955  42.544 1.00 19.62 ? 82   LEU A C   1 
ATOM   589  O O   . LEU A 1 102 ? 5.743   10.248  41.541 1.00 19.45 ? 82   LEU A O   1 
ATOM   590  C CB  . LEU A 1 102 ? 7.036   12.916  42.833 1.00 19.23 ? 82   LEU A CB  1 
ATOM   591  C CG  . LEU A 1 102 ? 8.135   13.688  43.597 1.00 17.79 ? 82   LEU A CG  1 
ATOM   592  C CD1 . LEU A 1 102 ? 8.340   15.048  42.966 1.00 14.65 ? 82   LEU A CD1 1 
ATOM   593  C CD2 . LEU A 1 102 ? 7.829   13.851  45.074 1.00 17.88 ? 82   LEU A CD2 1 
ATOM   594  N N   . PHE A 1 103 ? 4.249   11.262  42.932 1.00 18.53 ? 83   PHE A N   1 
ATOM   595  C CA  . PHE A 1 103 ? 3.077   10.680  42.286 1.00 18.58 ? 83   PHE A CA  1 
ATOM   596  C C   . PHE A 1 103 ? 2.006   11.752  42.217 1.00 18.98 ? 83   PHE A C   1 
ATOM   597  O O   . PHE A 1 103 ? 2.054   12.717  42.981 1.00 20.13 ? 83   PHE A O   1 
ATOM   598  C CB  . PHE A 1 103 ? 2.521   9.510   43.104 1.00 19.02 ? 83   PHE A CB  1 
ATOM   599  C CG  . PHE A 1 103 ? 3.509   8.409   43.323 1.00 17.07 ? 83   PHE A CG  1 
ATOM   600  C CD1 . PHE A 1 103 ? 4.390   8.488   44.388 1.00 15.44 ? 83   PHE A CD1 1 
ATOM   601  C CD2 . PHE A 1 103 ? 3.522   7.285   42.492 1.00 15.62 ? 83   PHE A CD2 1 
ATOM   602  C CE1 . PHE A 1 103 ? 5.327   7.491   44.599 1.00 14.25 ? 83   PHE A CE1 1 
ATOM   603  C CE2 . PHE A 1 103 ? 4.490   6.260   42.677 1.00 14.68 ? 83   PHE A CE2 1 
ATOM   604  C CZ  . PHE A 1 103 ? 5.359   6.353   43.747 1.00 15.15 ? 83   PHE A CZ  1 
ATOM   605  N N   . PRO A 1 104 ? 1.042   11.593  41.309 1.00 18.32 ? 84   PRO A N   1 
ATOM   606  C CA  . PRO A 1 104 ? -0.029  12.589  41.162 1.00 18.67 ? 84   PRO A CA  1 
ATOM   607  C C   . PRO A 1 104 ? -1.008  12.761  42.335 1.00 18.94 ? 84   PRO A C   1 
ATOM   608  O O   . PRO A 1 104 ? -1.628  13.795  42.406 1.00 18.26 ? 84   PRO A O   1 
ATOM   609  C CB  . PRO A 1 104 ? -0.788  12.121  39.902 1.00 18.42 ? 84   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 104 ? -0.568  10.681  39.848 1.00 18.81 ? 84   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 104 ? 0.926   10.540  40.283 1.00 18.70 ? 84   PRO A CD  1 
ATOM   612  N N   . CYS A 1 105 ? -1.101  11.780  43.234 1.00 18.80 ? 85   CYS A N   1 
ATOM   613  C CA  . CYS A 1 105 ? -1.893  11.913  44.455 1.00 18.93 ? 85   CYS A CA  1 
ATOM   614  C C   . CYS A 1 105 ? -1.451  10.815  45.433 1.00 18.81 ? 85   CYS A C   1 
ATOM   615  O O   . CYS A 1 105 ? -0.656  9.935   45.078 1.00 19.82 ? 85   CYS A O   1 
ATOM   616  C CB  . CYS A 1 105 ? -3.389  11.851  44.175 1.00 18.08 ? 85   CYS A CB  1 
ATOM   617  S SG  . CYS A 1 105 ? -3.901  10.256  43.533 1.00 18.30 ? 85   CYS A SG  1 
ATOM   618  N N   . GLY A 1 106 ? -1.950  10.872  46.657 1.00 19.63 ? 86   GLY A N   1 
ATOM   619  C CA  . GLY A 1 106 ? -1.634  9.831   47.661 1.00 18.39 ? 86   GLY A CA  1 
ATOM   620  C C   . GLY A 1 106 ? -2.045  8.443   47.181 1.00 18.33 ? 86   GLY A C   1 
ATOM   621  O O   . GLY A 1 106 ? -1.316  7.494   47.357 1.00 16.77 ? 86   GLY A O   1 
ATOM   622  N N   . ALA A 1 107 ? -3.246  8.312   46.616 1.00 17.96 ? 87   ALA A N   1 
ATOM   623  C CA  . ALA A 1 107 ? -3.725  6.984   46.198 1.00 18.69 ? 87   ALA A CA  1 
ATOM   624  C C   . ALA A 1 107 ? -2.823  6.397   45.113 1.00 18.13 ? 87   ALA A C   1 
ATOM   625  O O   . ALA A 1 107 ? -2.535  5.199   45.110 1.00 18.35 ? 87   ALA A O   1 
ATOM   626  C CB  . ALA A 1 107 ? -5.193  7.056   45.734 1.00 18.67 ? 87   ALA A CB  1 
ATOM   627  N N   . ALA A 1 108 ? -2.337  7.245   44.206 1.00 18.09 ? 88   ALA A N   1 
ATOM   628  C CA  . ALA A 1 108 ? -1.299  6.798   43.247 1.00 16.62 ? 88   ALA A CA  1 
ATOM   629  C C   . ALA A 1 108 ? -0.023  6.344   43.949 1.00 17.20 ? 88   ALA A C   1 
ATOM   630  O O   . ALA A 1 108 ? 0.599   5.352   43.490 1.00 18.29 ? 88   ALA A O   1 
ATOM   631  C CB  . ALA A 1 108 ? -0.979  7.892   42.193 1.00 14.98 ? 88   ALA A CB  1 
ATOM   632  N N   . ALA A 1 109 ? 0.392   7.024   45.018 1.00 16.26 ? 89   ALA A N   1 
ATOM   633  C CA  . ALA A 1 109 ? 1.677   6.637   45.672 1.00 17.16 ? 89   ALA A CA  1 
ATOM   634  C C   . ALA A 1 109 ? 1.508   5.270   46.364 1.00 17.19 ? 89   ALA A C   1 
ATOM   635  O O   . ALA A 1 109 ? 2.379   4.414   46.331 1.00 18.09 ? 89   ALA A O   1 
ATOM   636  C CB  . ALA A 1 109 ? 2.158   7.702   46.677 1.00 17.12 ? 89   ALA A CB  1 
ATOM   637  N N   . VAL A 1 110 ? 0.355   5.071   46.978 1.00 17.25 ? 90   VAL A N   1 
ATOM   638  C CA  . VAL A 1 110 ? 0.081   3.787   47.621 1.00 16.90 ? 90   VAL A CA  1 
ATOM   639  C C   . VAL A 1 110 ? 0.000   2.644   46.588 1.00 18.19 ? 90   VAL A C   1 
ATOM   640  O O   . VAL A 1 110 ? 0.741   1.663   46.708 1.00 16.98 ? 90   VAL A O   1 
ATOM   641  C CB  . VAL A 1 110 ? -1.226  3.830   48.415 1.00 16.37 ? 90   VAL A CB  1 
ATOM   642  C CG1 . VAL A 1 110 ? -1.614  2.427   48.851 1.00 16.46 ? 90   VAL A CG1 1 
ATOM   643  C CG2 . VAL A 1 110 ? -1.028  4.732   49.649 1.00 15.46 ? 90   VAL A CG2 1 
ATOM   644  N N   . ALA A 1 111 ? -0.891  2.771   45.580 1.00 16.88 ? 91   ALA A N   1 
ATOM   645  C CA  . ALA A 1 111 ? -1.054  1.691   44.595 1.00 16.96 ? 91   ALA A CA  1 
ATOM   646  C C   . ALA A 1 111 ? 0.266   1.343   43.933 1.00 16.67 ? 91   ALA A C   1 
ATOM   647  O O   . ALA A 1 111 ? 0.563   0.172   43.728 1.00 15.21 ? 91   ALA A O   1 
ATOM   648  C CB  . ALA A 1 111 ? -2.047  2.072   43.530 1.00 17.99 ? 91   ALA A CB  1 
ATOM   649  N N   . ASN A 1 112 ? 0.982   2.380   43.502 1.00 16.46 ? 92   ASN A N   1 
ATOM   650  C CA  . ASN A 1 112 ? 2.255   2.206   42.760 1.00 16.30 ? 92   ASN A CA  1 
ATOM   651  C C   . ASN A 1 112 ? 3.476   1.795   43.561 1.00 16.72 ? 92   ASN A C   1 
ATOM   652  O O   . ASN A 1 112 ? 4.311   1.026   43.041 1.00 16.33 ? 92   ASN A O   1 
ATOM   653  C CB  . ASN A 1 112 ? 2.559   3.447   41.920 1.00 16.55 ? 92   ASN A CB  1 
ATOM   654  C CG  . ASN A 1 112 ? 1.748   3.474   40.664 1.00 16.33 ? 92   ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 112 ? 2.060   2.751   39.715 1.00 15.88 ? 92   ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 112 ? 0.632   4.222   40.674 1.00 17.20 ? 92   ASN A ND2 1 
ATOM   657  N N   . SER A 1 113 ? 3.585   2.286   44.798 1.00 17.04 ? 93   SER A N   1 
ATOM   658  C CA  . SER A 1 113 ? 4.584   1.748   45.740 1.00 16.04 ? 93   SER A CA  1 
ATOM   659  C C   . SER A 1 113 ? 4.401   0.238   45.974 1.00 17.34 ? 93   SER A C   1 
ATOM   660  O O   . SER A 1 113 ? 5.345   -0.527  45.913 1.00 17.27 ? 93   SER A O   1 
ATOM   661  C CB  . SER A 1 113 ? 4.589   2.492   47.072 1.00 15.86 ? 93   SER A CB  1 
ATOM   662  O OG  . SER A 1 113 ? 4.866   3.880   46.931 1.00 18.87 ? 93   SER A OG  1 
ATOM   663  N N   . ILE A 1 114 ? 3.179   -0.220  46.244 1.00 16.58 ? 94   ILE A N   1 
ATOM   664  C CA  . ILE A 1 114 ? 2.959   -1.655  46.364 1.00 17.49 ? 94   ILE A CA  1 
ATOM   665  C C   . ILE A 1 114 ? 3.274   -2.440  45.062 1.00 18.35 ? 94   ILE A C   1 
ATOM   666  O O   . ILE A 1 114 ? 4.012   -3.460  45.079 1.00 18.91 ? 94   ILE A O   1 
ATOM   667  C CB  . ILE A 1 114 ? 1.512   -1.934  46.790 1.00 15.85 ? 94   ILE A CB  1 
ATOM   668  C CG1 . ILE A 1 114 ? 1.303   -1.430  48.217 1.00 16.79 ? 94   ILE A CG1 1 
ATOM   669  C CG2 . ILE A 1 114 ? 1.192   -3.431  46.750 1.00 17.96 ? 94   ILE A CG2 1 
ATOM   670  C CD1 . ILE A 1 114 ? -0.232  -1.308  48.547 1.00 14.81 ? 94   ILE A CD1 1 
ATOM   671  N N   . LEU A 1 115 ? 2.712   -1.986  43.944 1.00 18.93 ? 95   LEU A N   1 
ATOM   672  C CA  . LEU A 1 115 ? 2.981   -2.627  42.652 1.00 18.46 ? 95   LEU A CA  1 
ATOM   673  C C   . LEU A 1 115 ? 4.461   -2.792  42.384 1.00 19.46 ? 95   LEU A C   1 
ATOM   674  O O   . LEU A 1 115 ? 4.872   -3.806  41.846 1.00 19.56 ? 95   LEU A O   1 
ATOM   675  C CB  . LEU A 1 115 ? 2.400   -1.797  41.495 1.00 19.26 ? 95   LEU A CB  1 
ATOM   676  C CG  . LEU A 1 115 ? 2.303   -2.486  40.107 1.00 18.69 ? 95   LEU A CG  1 
ATOM   677  C CD1 . LEU A 1 115 ? 1.463   -3.714  40.138 1.00 16.63 ? 95   LEU A CD1 1 
ATOM   678  C CD2 . LEU A 1 115 ? 1.757   -1.525  39.065 1.00 22.27 ? 95   LEU A CD2 1 
ATOM   679  N N   . ALA A 1 116 ? 5.241   -1.767  42.721 1.00 20.12 ? 96   ALA A N   1 
ATOM   680  C CA  . ALA A 1 116 ? 6.670   -1.717  42.376 1.00 19.44 ? 96   ALA A CA  1 
ATOM   681  C C   . ALA A 1 116 ? 7.458   -2.886  43.003 1.00 20.61 ? 96   ALA A C   1 
ATOM   682  O O   . ALA A 1 116 ? 8.608   -3.189  42.571 1.00 19.34 ? 96   ALA A O   1 
ATOM   683  C CB  . ALA A 1 116 ? 7.268   -0.377  42.809 1.00 21.28 ? 96   ALA A CB  1 
ATOM   684  N N   . PHE A 1 117 ? 6.875   -3.516  44.033 1.00 19.46 ? 97   PHE A N   1 
ATOM   685  C CA  . PHE A 1 117 ? 7.584   -4.550  44.783 1.00 21.46 ? 97   PHE A CA  1 
ATOM   686  C C   . PHE A 1 117 ? 6.974   -5.941  44.711 1.00 21.88 ? 97   PHE A C   1 
ATOM   687  O O   . PHE A 1 117 ? 7.541   -6.896  45.245 1.00 22.62 ? 97   PHE A O   1 
ATOM   688  C CB  . PHE A 1 117 ? 7.773   -4.124  46.242 1.00 20.85 ? 97   PHE A CB  1 
ATOM   689  C CG  . PHE A 1 117 ? 8.780   -3.028  46.414 1.00 20.92 ? 97   PHE A CG  1 
ATOM   690  C CD1 . PHE A 1 117 ? 10.147  -3.310  46.443 1.00 21.58 ? 97   PHE A CD1 1 
ATOM   691  C CD2 . PHE A 1 117 ? 8.371   -1.697  46.511 1.00 23.18 ? 97   PHE A CD2 1 
ATOM   692  C CE1 . PHE A 1 117 ? 11.066  -2.271  46.578 1.00 16.14 ? 97   PHE A CE1 1 
ATOM   693  C CE2 . PHE A 1 117 ? 9.314   -0.657  46.647 1.00 19.81 ? 97   PHE A CE2 1 
ATOM   694  C CZ  . PHE A 1 117 ? 10.662  -0.960  46.682 1.00 19.54 ? 97   PHE A CZ  1 
ATOM   695  N N   . ILE A 1 118 ? 5.833   -6.072  44.043 1.00 22.29 ? 98   ILE A N   1 
ATOM   696  C CA  . ILE A 1 118 ? 5.257   -7.383  43.944 1.00 22.72 ? 98   ILE A CA  1 
ATOM   697  C C   . ILE A 1 118 ? 5.499   -8.070  42.587 1.00 21.72 ? 98   ILE A C   1 
ATOM   698  O O   . ILE A 1 118 ? 5.927   -7.472  41.567 1.00 21.23 ? 98   ILE A O   1 
ATOM   699  C CB  . ILE A 1 118 ? 3.700   -7.459  44.352 1.00 22.59 ? 98   ILE A CB  1 
ATOM   700  C CG1 . ILE A 1 118 ? 2.881   -6.390  43.642 1.00 23.95 ? 98   ILE A CG1 1 
ATOM   701  C CG2 . ILE A 1 118 ? 3.479   -7.412  45.871 1.00 25.47 ? 98   ILE A CG2 1 
ATOM   702  C CD1 . ILE A 1 118 ? 2.621   -6.713  42.219 1.00 22.32 ? 98   ILE A CD1 1 
ATOM   703  N N   . GLU A 1 119 ? 5.230   -9.359  42.629 1.00 21.30 ? 99   GLU A N   1 
ATOM   704  C CA  . GLU A 1 119 ? 5.074   -10.167 41.446 1.00 22.50 ? 99   GLU A CA  1 
ATOM   705  C C   . GLU A 1 119 ? 4.026   -11.252 41.721 1.00 21.17 ? 99   GLU A C   1 
ATOM   706  O O   . GLU A 1 119 ? 3.609   -11.479 42.870 1.00 19.82 ? 99   GLU A O   1 
ATOM   707  C CB  . GLU A 1 119 ? 6.401   -10.777 41.025 1.00 23.21 ? 99   GLU A CB  1 
ATOM   708  C CG  . GLU A 1 119 ? 7.309   -11.217 42.129 1.00 27.71 ? 99   GLU A CG  1 
ATOM   709  C CD  . GLU A 1 119 ? 8.547   -11.867 41.555 1.00 32.97 ? 99   GLU A CD  1 
ATOM   710  O OE1 . GLU A 1 119 ? 8.705   -13.088 41.727 1.00 37.16 ? 99   GLU A OE1 1 
ATOM   711  O OE2 . GLU A 1 119 ? 9.334   -11.161 40.896 1.00 36.50 ? 99   GLU A OE2 1 
ATOM   712  N N   . GLN A 1 120 ? 3.604   -11.904 40.656 1.00 20.79 ? 100  GLN A N   1 
ATOM   713  C CA  . GLN A 1 120 ? 2.614   -12.959 40.766 1.00 20.68 ? 100  GLN A CA  1 
ATOM   714  C C   . GLN A 1 120 ? 3.131   -14.032 41.753 1.00 20.34 ? 100  GLN A C   1 
ATOM   715  O O   . GLN A 1 120 ? 4.341   -14.383 41.755 1.00 18.98 ? 100  GLN A O   1 
ATOM   716  C CB  . GLN A 1 120 ? 2.319   -13.473 39.371 1.00 21.75 ? 100  GLN A CB  1 
ATOM   717  C CG  . GLN A 1 120 ? 2.090   -14.907 39.207 1.00 24.87 ? 100  GLN A CG  1 
ATOM   718  C CD  . GLN A 1 120 ? 2.131   -15.318 37.741 1.00 26.25 ? 100  GLN A CD  1 
ATOM   719  O OE1 . GLN A 1 120 ? 3.193   -15.446 37.121 1.00 25.21 ? 100  GLN A OE1 1 
ATOM   720  N NE2 . GLN A 1 120 ? 0.966   -15.542 37.193 1.00 28.27 ? 100  GLN A NE2 1 
ATOM   721  N N   . GLY A 1 121 ? 2.230   -14.469 42.633 1.00 20.06 ? 101  GLY A N   1 
ATOM   722  C CA  . GLY A 1 121 ? 2.521   -15.434 43.691 1.00 19.73 ? 101  GLY A CA  1 
ATOM   723  C C   . GLY A 1 121 ? 2.895   -14.816 45.032 1.00 20.55 ? 101  GLY A C   1 
ATOM   724  O O   . GLY A 1 121 ? 3.031   -15.544 46.045 1.00 20.02 ? 101  GLY A O   1 
ATOM   725  N N   . ASP A 1 122 ? 3.077   -13.487 45.066 1.00 20.53 ? 102  ASP A N   1 
ATOM   726  C CA  . ASP A 1 122 ? 3.383   -12.778 46.327 1.00 20.83 ? 102  ASP A CA  1 
ATOM   727  C C   . ASP A 1 122 ? 2.148   -12.666 47.228 1.00 20.74 ? 102  ASP A C   1 
ATOM   728  O O   . ASP A 1 122 ? 1.016   -12.808 46.767 1.00 20.67 ? 102  ASP A O   1 
ATOM   729  C CB  . ASP A 1 122 ? 3.970   -11.388 46.054 1.00 21.03 ? 102  ASP A CB  1 
ATOM   730  C CG  . ASP A 1 122 ? 5.413   -11.448 45.613 1.00 22.67 ? 102  ASP A CG  1 
ATOM   731  O OD1 . ASP A 1 122 ? 6.010   -12.537 45.644 1.00 25.78 ? 102  ASP A OD1 1 
ATOM   732  O OD2 . ASP A 1 122 ? 5.955   -10.410 45.218 1.00 22.80 ? 102  ASP A OD2 1 
ATOM   733  N N   . HIS A 1 123 ? 2.377   -12.373 48.506 1.00 19.98 ? 103  HIS A N   1 
ATOM   734  C CA  . HIS A 1 123 ? 1.296   -12.128 49.455 1.00 18.45 ? 103  HIS A CA  1 
ATOM   735  C C   . HIS A 1 123 ? 1.462   -10.716 50.031 1.00 17.64 ? 103  HIS A C   1 
ATOM   736  O O   . HIS A 1 123 ? 2.581   -10.270 50.282 1.00 18.51 ? 103  HIS A O   1 
ATOM   737  C CB  . HIS A 1 123 ? 1.320   -13.209 50.579 1.00 17.39 ? 103  HIS A CB  1 
ATOM   738  C CG  . HIS A 1 123 ? 0.419   -12.908 51.732 1.00 18.01 ? 103  HIS A CG  1 
ATOM   739  N ND1 . HIS A 1 123 ? 0.895   -12.621 52.988 1.00 17.34 ? 103  HIS A ND1 1 
ATOM   740  C CD2 . HIS A 1 123 ? -0.934  -12.860 51.824 1.00 18.36 ? 103  HIS A CD2 1 
ATOM   741  C CE1 . HIS A 1 123 ? -0.116  -12.415 53.814 1.00 20.00 ? 103  HIS A CE1 1 
ATOM   742  N NE2 . HIS A 1 123 ? -1.237  -12.564 53.135 1.00 16.91 ? 103  HIS A NE2 1 
ATOM   743  N N   . VAL A 1 124 ? 0.364   -10.006 50.225 1.00 16.03 ? 104  VAL A N   1 
ATOM   744  C CA  . VAL A 1 124 ? 0.429   -8.686  50.867 1.00 16.27 ? 104  VAL A CA  1 
ATOM   745  C C   . VAL A 1 124 ? -0.293  -8.743  52.187 1.00 17.06 ? 104  VAL A C   1 
ATOM   746  O O   . VAL A 1 124 ? -1.419  -9.248  52.256 1.00 17.83 ? 104  VAL A O   1 
ATOM   747  C CB  . VAL A 1 124 ? -0.121  -7.553  49.947 1.00 16.47 ? 104  VAL A CB  1 
ATOM   748  C CG1 . VAL A 1 124 ? -0.207  -6.123  50.696 1.00 14.08 ? 104  VAL A CG1 1 
ATOM   749  C CG2 . VAL A 1 124 ? 0.729   -7.470  48.664 1.00 15.22 ? 104  VAL A CG2 1 
ATOM   750  N N   . LEU A 1 125 ? 0.344   -8.214  53.228 1.00 17.82 ? 105  LEU A N   1 
ATOM   751  C CA  . LEU A 1 125 ? -0.276  -8.170  54.550 1.00 17.64 ? 105  LEU A CA  1 
ATOM   752  C C   . LEU A 1 125 ? -0.509  -6.719  54.944 1.00 18.08 ? 105  LEU A C   1 
ATOM   753  O O   . LEU A 1 125 ? 0.424   -5.954  55.132 1.00 18.81 ? 105  LEU A O   1 
ATOM   754  C CB  . LEU A 1 125 ? 0.552   -8.889  55.604 1.00 18.25 ? 105  LEU A CB  1 
ATOM   755  C CG  . LEU A 1 125 ? -0.062  -9.012  57.012 1.00 18.68 ? 105  LEU A CG  1 
ATOM   756  C CD1 . LEU A 1 125 ? -1.420  -9.744  57.046 1.00 17.11 ? 105  LEU A CD1 1 
ATOM   757  C CD2 . LEU A 1 125 ? 0.905   -9.667  58.011 1.00 18.35 ? 105  LEU A CD2 1 
ATOM   758  N N   . MET A 1 126 ? -1.775  -6.350  55.055 1.00 16.28 ? 106  MET A N   1 
ATOM   759  C CA  . MET A 1 126 ? -2.155  -4.929  55.204 1.00 17.70 ? 106  MET A CA  1 
ATOM   760  C C   . MET A 1 126 ? -3.039  -4.712  56.452 1.00 16.72 ? 106  MET A C   1 
ATOM   761  O O   . MET A 1 126 ? -3.895  -5.538  56.728 1.00 17.65 ? 106  MET A O   1 
ATOM   762  C CB  . MET A 1 126 ? -2.920  -4.502  53.954 1.00 17.23 ? 106  MET A CB  1 
ATOM   763  C CG  . MET A 1 126 ? -3.452  -3.059  54.051 1.00 18.16 ? 106  MET A CG  1 
ATOM   764  S SD  . MET A 1 126 ? -4.182  -2.377  52.546 1.00 18.35 ? 106  MET A SD  1 
ATOM   765  C CE  . MET A 1 126 ? -2.671  -2.138  51.582 1.00 17.09 ? 106  MET A CE  1 
ATOM   766  N N   . THR A 1 127 ? -2.851  -3.619  57.189 1.00 16.76 ? 107  THR A N   1 
ATOM   767  C CA  . THR A 1 127 ? -3.700  -3.350  58.354 1.00 16.83 ? 107  THR A CA  1 
ATOM   768  C C   . THR A 1 127 ? -5.168  -3.262  57.909 1.00 16.87 ? 107  THR A C   1 
ATOM   769  O O   . THR A 1 127 ? -5.460  -2.709  56.844 1.00 18.35 ? 107  THR A O   1 
ATOM   770  C CB  . THR A 1 127 ? -3.310  -2.073  59.172 1.00 16.82 ? 107  THR A CB  1 
ATOM   771  O OG1 . THR A 1 127 ? -4.256  -1.922  60.272 1.00 15.51 ? 107  THR A OG1 1 
ATOM   772  C CG2 . THR A 1 127 ? -3.216  -0.779  58.288 1.00 13.82 ? 107  THR A CG2 1 
ATOM   773  N N   . ASN A 1 128 ? -6.091  -3.834  58.671 1.00 17.13 ? 108  ASN A N   1 
ATOM   774  C CA  . ASN A 1 128 ? -7.489  -3.718  58.250 1.00 16.91 ? 108  ASN A CA  1 
ATOM   775  C C   . ASN A 1 128 ? -8.037  -2.310  58.437 1.00 17.09 ? 108  ASN A C   1 
ATOM   776  O O   . ASN A 1 128 ? -9.197  -2.056  58.068 1.00 18.17 ? 108  ASN A O   1 
ATOM   777  C CB  . ASN A 1 128 ? -8.413  -4.794  58.900 1.00 16.58 ? 108  ASN A CB  1 
ATOM   778  C CG  . ASN A 1 128 ? -8.442  -4.724  60.430 1.00 18.19 ? 108  ASN A CG  1 
ATOM   779  O OD1 . ASN A 1 128 ? -8.259  -3.664  61.020 1.00 16.25 ? 108  ASN A OD1 1 
ATOM   780  N ND2 . ASN A 1 128 ? -8.738  -5.860  61.071 1.00 20.37 ? 108  ASN A ND2 1 
ATOM   781  N N   . THR A 1 129 ? -7.232  -1.430  59.049 1.00 16.02 ? 109  THR A N   1 
ATOM   782  C CA  . THR A 1 129 ? -7.591  -0.027  59.227 1.00 16.41 ? 109  THR A CA  1 
ATOM   783  C C   . THR A 1 129 ? -7.057  0.893   58.120 1.00 16.10 ? 109  THR A C   1 
ATOM   784  O O   . THR A 1 129 ? -7.166  2.131   58.215 1.00 16.36 ? 109  THR A O   1 
ATOM   785  C CB  . THR A 1 129 ? -7.165  0.533   60.563 1.00 16.67 ? 109  THR A CB  1 
ATOM   786  O OG1 . THR A 1 129 ? -5.753  0.372   60.725 1.00 16.70 ? 109  THR A OG1 1 
ATOM   787  C CG2 . THR A 1 129 ? -7.861  -0.156  61.714 1.00 16.11 ? 109  THR A CG2 1 
ATOM   788  N N   . ALA A 1 130 ? -6.505  0.291   57.077 1.00 16.62 ? 110  ALA A N   1 
ATOM   789  C CA  . ALA A 1 130 ? -5.980  1.042   55.940 1.00 17.13 ? 110  ALA A CA  1 
ATOM   790  C C   . ALA A 1 130 ? -7.076  1.855   55.234 1.00 17.24 ? 110  ALA A C   1 
ATOM   791  O O   . ALA A 1 130 ? -8.196  1.422   55.143 1.00 18.01 ? 110  ALA A O   1 
ATOM   792  C CB  . ALA A 1 130 ? -5.301  0.075   54.951 1.00 16.78 ? 110  ALA A CB  1 
ATOM   793  N N   . TYR A 1 131 ? -6.746  3.048   54.758 1.00 17.09 ? 111  TYR A N   1 
ATOM   794  C CA  . TYR A 1 131 ? -7.634  3.808   53.861 1.00 17.94 ? 111  TYR A CA  1 
ATOM   795  C C   . TYR A 1 131 ? -8.292  2.880   52.823 1.00 17.28 ? 111  TYR A C   1 
ATOM   796  O O   . TYR A 1 131 ? -7.635  2.061   52.190 1.00 16.65 ? 111  TYR A O   1 
ATOM   797  C CB  . TYR A 1 131 ? -6.803  4.920   53.205 1.00 18.18 ? 111  TYR A CB  1 
ATOM   798  C CG  . TYR A 1 131 ? -7.523  5.901   52.267 1.00 20.34 ? 111  TYR A CG  1 
ATOM   799  C CD1 . TYR A 1 131 ? -8.639  6.639   52.681 1.00 23.25 ? 111  TYR A CD1 1 
ATOM   800  C CD2 . TYR A 1 131 ? -7.024  6.118   50.981 1.00 22.90 ? 111  TYR A CD2 1 
ATOM   801  C CE1 . TYR A 1 131 ? -9.256  7.542   51.809 1.00 19.85 ? 111  TYR A CE1 1 
ATOM   802  C CE2 . TYR A 1 131 ? -7.611  6.999   50.119 1.00 21.38 ? 111  TYR A CE2 1 
ATOM   803  C CZ  . TYR A 1 131 ? -8.724  7.718   50.516 1.00 22.08 ? 111  TYR A CZ  1 
ATOM   804  O OH  . TYR A 1 131 ? -9.266  8.603   49.605 1.00 24.91 ? 111  TYR A OH  1 
ATOM   805  N N   . GLU A 1 132 ? -9.606  2.970   52.702 1.00 17.93 ? 112  GLU A N   1 
ATOM   806  C CA  . GLU A 1 132 ? -10.376 2.062   51.833 1.00 17.37 ? 112  GLU A CA  1 
ATOM   807  C C   . GLU A 1 132 ? -9.845  1.859   50.400 1.00 17.29 ? 112  GLU A C   1 
ATOM   808  O O   . GLU A 1 132 ? -9.727  0.725   49.926 1.00 17.95 ? 112  GLU A O   1 
ATOM   809  C CB  . GLU A 1 132 ? -11.857 2.441   51.834 1.00 18.29 ? 112  GLU A CB  1 
ATOM   810  C CG  . GLU A 1 132 ? -12.743 1.480   50.994 1.00 22.63 ? 112  GLU A CG  1 
ATOM   811  C CD  . GLU A 1 132 ? -14.239 1.866   50.970 1.00 22.62 ? 112  GLU A CD  1 
ATOM   812  O OE1 . GLU A 1 132 ? -14.591 2.974   51.412 1.00 23.89 ? 112  GLU A OE1 1 
ATOM   813  O OE2 . GLU A 1 132 ? -15.067 1.048   50.509 1.00 24.62 ? 112  GLU A OE2 1 
ATOM   814  N N   . PRO A 1 133 ? -9.526  2.941   49.695 1.00 16.55 ? 113  PRO A N   1 
ATOM   815  C CA  . PRO A 1 133 ? -8.906  2.765   48.358 1.00 16.50 ? 113  PRO A CA  1 
ATOM   816  C C   . PRO A 1 133 ? -7.624  1.959   48.369 1.00 16.47 ? 113  PRO A C   1 
ATOM   817  O O   . PRO A 1 133 ? -7.370  1.269   47.378 1.00 14.76 ? 113  PRO A O   1 
ATOM   818  C CB  . PRO A 1 133 ? -8.607  4.181   47.908 1.00 17.27 ? 113  PRO A CB  1 
ATOM   819  C CG  . PRO A 1 133 ? -9.620  4.996   48.601 1.00 17.63 ? 113  PRO A CG  1 
ATOM   820  C CD  . PRO A 1 133 ? -9.808  4.358   49.983 1.00 17.72 ? 113  PRO A CD  1 
ATOM   821  N N   . SER A 1 134 ? -6.884  2.010   49.488 1.00 16.50 ? 114  SER A N   1 
ATOM   822  C CA  . SER A 1 134 ? -5.680  1.175   49.639 1.00 16.77 ? 114  SER A CA  1 
ATOM   823  C C   . SER A 1 134 ? -6.095  -0.285  49.659 1.00 17.55 ? 114  SER A C   1 
ATOM   824  O O   . SER A 1 134 ? -5.532  -1.096  48.913 1.00 17.41 ? 114  SER A O   1 
ATOM   825  C CB  . SER A 1 134 ? -4.812  1.544   50.864 1.00 16.64 ? 114  SER A CB  1 
ATOM   826  O OG  . SER A 1 134 ? -4.375  2.885   50.802 1.00 16.54 ? 114  SER A OG  1 
ATOM   827  N N   . GLN A 1 135 ? -7.124  -0.608  50.458 1.00 17.18 ? 115  GLN A N   1 
ATOM   828  C CA  . GLN A 1 135 ? -7.670  -1.968  50.500 1.00 17.25 ? 115  GLN A CA  1 
ATOM   829  C C   . GLN A 1 135 ? -8.213  -2.421  49.142 1.00 17.27 ? 115  GLN A C   1 
ATOM   830  O O   . GLN A 1 135 ? -7.928  -3.549  48.701 1.00 17.86 ? 115  GLN A O   1 
ATOM   831  C CB  . GLN A 1 135 ? -8.804  -2.057  51.510 1.00 16.38 ? 115  GLN A CB  1 
ATOM   832  C CG  . GLN A 1 135 ? -8.454  -1.598  52.965 1.00 16.59 ? 115  GLN A CG  1 
ATOM   833  C CD  . GLN A 1 135 ? -9.610  -1.912  53.966 1.00 17.20 ? 115  GLN A CD  1 
ATOM   834  O OE1 . GLN A 1 135 ? -10.386 -2.827  53.745 1.00 20.07 ? 115  GLN A OE1 1 
ATOM   835  N NE2 . GLN A 1 135 ? -9.694  -1.161  55.042 1.00 15.95 ? 115  GLN A NE2 1 
ATOM   836  N N   . ASP A 1 136 ? -9.006  -1.557  48.511 1.00 18.35 ? 116  ASP A N   1 
ATOM   837  C CA  . ASP A 1 136 ? -9.598  -1.828  47.197 1.00 18.88 ? 116  ASP A CA  1 
ATOM   838  C C   . ASP A 1 136 ? -8.531  -2.102  46.126 1.00 18.89 ? 116  ASP A C   1 
ATOM   839  O O   . ASP A 1 136 ? -8.663  -3.013  45.331 1.00 18.49 ? 116  ASP A O   1 
ATOM   840  C CB  . ASP A 1 136 ? -10.511 -0.684  46.757 1.00 18.99 ? 116  ASP A CB  1 
ATOM   841  C CG  . ASP A 1 136 ? -11.791 -0.628  47.563 1.00 20.52 ? 116  ASP A CG  1 
ATOM   842  O OD1 . ASP A 1 136 ? -12.065 -1.568  48.352 1.00 21.89 ? 116  ASP A OD1 1 
ATOM   843  O OD2 . ASP A 1 136 ? -12.525 0.373   47.419 1.00 25.42 ? 116  ASP A OD2 1 
ATOM   844  N N   . PHE A 1 137 ? -7.477  -1.301  46.115 1.00 18.21 ? 117  PHE A N   1 
ATOM   845  C CA  . PHE A 1 137 ? -6.389  -1.554  45.168 1.00 18.25 ? 117  PHE A CA  1 
ATOM   846  C C   . PHE A 1 137 ? -5.934  -3.021  45.310 1.00 18.18 ? 117  PHE A C   1 
ATOM   847  O O   . PHE A 1 137 ? -5.740  -3.724  44.317 1.00 17.03 ? 117  PHE A O   1 
ATOM   848  C CB  . PHE A 1 137 ? -5.214  -0.600  45.404 1.00 18.60 ? 117  PHE A CB  1 
ATOM   849  C CG  . PHE A 1 137 ? -3.944  -1.101  44.797 1.00 19.26 ? 117  PHE A CG  1 
ATOM   850  C CD1 . PHE A 1 137 ? -3.760  -1.067  43.408 1.00 19.00 ? 117  PHE A CD1 1 
ATOM   851  C CD2 . PHE A 1 137 ? -2.970  -1.683  45.605 1.00 21.05 ? 117  PHE A CD2 1 
ATOM   852  C CE1 . PHE A 1 137 ? -2.601  -1.583  42.839 1.00 16.68 ? 117  PHE A CE1 1 
ATOM   853  C CE2 . PHE A 1 137 ? -1.815  -2.187  45.063 1.00 19.80 ? 117  PHE A CE2 1 
ATOM   854  C CZ  . PHE A 1 137 ? -1.600  -2.126  43.686 1.00 19.88 ? 117  PHE A CZ  1 
ATOM   855  N N   . CYS A 1 138 ? -5.762  -3.473  46.551 1.00 17.73 ? 118  CYS A N   1 
ATOM   856  C CA  . CYS A 1 138 ? -5.358  -4.868  46.794 1.00 18.88 ? 118  CYS A CA  1 
ATOM   857  C C   . CYS A 1 138 ? -6.395  -5.901  46.333 1.00 19.70 ? 118  CYS A C   1 
ATOM   858  O O   . CYS A 1 138 ? -6.082  -6.861  45.612 1.00 18.78 ? 118  CYS A O   1 
ATOM   859  C CB  . CYS A 1 138 ? -5.027  -5.058  48.270 1.00 18.97 ? 118  CYS A CB  1 
ATOM   860  S SG  . CYS A 1 138 ? -3.552  -4.098  48.811 1.00 20.43 ? 118  CYS A SG  1 
ATOM   861  N N   . SER A 1 139 ? -7.645  -5.691  46.745 1.00 19.99 ? 119  SER A N   1 
ATOM   862  C CA  . SER A 1 139 ? -8.676  -6.686  46.497 1.00 21.27 ? 119  SER A CA  1 
ATOM   863  C C   . SER A 1 139 ? -9.163  -6.737  45.043 1.00 21.18 ? 119  SER A C   1 
ATOM   864  O O   . SER A 1 139 ? -9.530  -7.816  44.565 1.00 21.49 ? 119  SER A O   1 
ATOM   865  C CB  . SER A 1 139 ? -9.839  -6.499  47.471 1.00 20.65 ? 119  SER A CB  1 
ATOM   866  O OG  . SER A 1 139 ? -10.449 -5.263  47.232 1.00 27.02 ? 119  SER A OG  1 
ATOM   867  N N   . LYS A 1 140 ? -9.103  -5.604  44.349 1.00 20.67 ? 120  LYS A N   1 
ATOM   868  C CA  . LYS A 1 140 ? -9.597  -5.471  42.965 1.00 21.85 ? 120  LYS A CA  1 
ATOM   869  C C   . LYS A 1 140 ? -8.509  -5.439  41.872 1.00 22.30 ? 120  LYS A C   1 
ATOM   870  O O   . LYS A 1 140 ? -8.752  -5.811  40.719 1.00 23.99 ? 120  LYS A O   1 
ATOM   871  C CB  . LYS A 1 140 ? -10.424 -4.184  42.832 1.00 22.29 ? 120  LYS A CB  1 
ATOM   872  C CG  . LYS A 1 140 ? -11.713 -4.155  43.665 1.00 25.14 ? 120  LYS A CG  1 
ATOM   873  C CD  . LYS A 1 140 ? -12.422 -2.803  43.589 1.00 28.04 ? 120  LYS A CD  1 
ATOM   874  C CE  . LYS A 1 140 ? -13.643 -2.767  44.492 1.00 32.98 ? 120  LYS A CE  1 
ATOM   875  N NZ  . LYS A 1 140 ? -14.703 -1.890  43.861 1.00 34.06 ? 120  LYS A NZ  1 
ATOM   876  N N   . ILE A 1 141 ? -7.337  -4.922  42.194 1.00 20.78 ? 121  ILE A N   1 
ATOM   877  C CA  . ILE A 1 141 ? -6.320  -4.889  41.170 1.00 19.80 ? 121  ILE A CA  1 
ATOM   878  C C   . ILE A 1 141 ? -5.311  -6.024  41.388 1.00 19.66 ? 121  ILE A C   1 
ATOM   879  O O   . ILE A 1 141 ? -5.111  -6.847  40.489 1.00 18.06 ? 121  ILE A O   1 
ATOM   880  C CB  . ILE A 1 141 ? -5.590  -3.530  41.124 1.00 20.69 ? 121  ILE A CB  1 
ATOM   881  C CG1 . ILE A 1 141 ? -6.574  -2.363  40.883 1.00 19.32 ? 121  ILE A CG1 1 
ATOM   882  C CG2 . ILE A 1 141 ? -4.420  -3.588  40.125 1.00 17.14 ? 121  ILE A CG2 1 
ATOM   883  C CD1 . ILE A 1 141 ? -7.289  -2.386  39.523 1.00 23.15 ? 121  ILE A CD1 1 
ATOM   884  N N   . LEU A 1 142 ? -4.663  -6.065  42.557 1.00 19.27 ? 122  LEU A N   1 
ATOM   885  C CA  . LEU A 1 142 ? -3.649  -7.113  42.802 1.00 19.24 ? 122  LEU A CA  1 
ATOM   886  C C   . LEU A 1 142 ? -4.176  -8.550  42.613 1.00 19.38 ? 122  LEU A C   1 
ATOM   887  O O   . LEU A 1 142 ? -3.478  -9.420  42.084 1.00 19.30 ? 122  LEU A O   1 
ATOM   888  C CB  . LEU A 1 142 ? -3.076  -6.970  44.217 1.00 18.72 ? 122  LEU A CB  1 
ATOM   889  C CG  . LEU A 1 142 ? -2.167  -5.738  44.406 1.00 18.45 ? 122  LEU A CG  1 
ATOM   890  C CD1 . LEU A 1 142 ? -1.574  -5.722  45.840 1.00 21.24 ? 122  LEU A CD1 1 
ATOM   891  C CD2 . LEU A 1 142 ? -1.059  -5.687  43.316 1.00 22.24 ? 122  LEU A CD2 1 
ATOM   892  N N   . SER A 1 143 ? -5.411  -8.795  43.053 1.00 19.38 ? 123  SER A N   1 
ATOM   893  C CA  . SER A 1 143 ? -5.973  -10.152 43.045 1.00 21.03 ? 123  SER A CA  1 
ATOM   894  C C   . SER A 1 143 ? -6.031  -10.759 41.638 1.00 21.42 ? 123  SER A C   1 
ATOM   895  O O   . SER A 1 143 ? -5.875  -11.980 41.459 1.00 22.70 ? 123  SER A O   1 
ATOM   896  C CB  . SER A 1 143 ? -7.373  -10.129 43.631 1.00 21.36 ? 123  SER A CB  1 
ATOM   897  O OG  . SER A 1 143 ? -8.201  -9.301  42.831 1.00 22.86 ? 123  SER A OG  1 
ATOM   898  N N   . LYS A 1 144 ? -6.222  -9.931  40.625 1.00 20.86 ? 124  LYS A N   1 
ATOM   899  C CA  . LYS A 1 144 ? -6.310  -10.478 39.284 1.00 21.89 ? 124  LYS A CA  1 
ATOM   900  C C   . LYS A 1 144 ? -4.920  -10.615 38.669 1.00 22.08 ? 124  LYS A C   1 
ATOM   901  O O   . LYS A 1 144 ? -4.770  -11.102 37.540 1.00 23.19 ? 124  LYS A O   1 
ATOM   902  C CB  . LYS A 1 144 ? -7.232  -9.656  38.396 1.00 22.36 ? 124  LYS A CB  1 
ATOM   903  C CG  . LYS A 1 144 ? -6.756  -8.304  38.131 1.00 24.24 ? 124  LYS A CG  1 
ATOM   904  C CD  . LYS A 1 144 ? -7.826  -7.451  37.434 1.00 27.49 ? 124  LYS A CD  1 
ATOM   905  C CE  . LYS A 1 144 ? -7.156  -6.144  37.016 1.00 28.01 ? 124  LYS A CE  1 
ATOM   906  N NZ  . LYS A 1 144 ? -8.164  -5.138  36.574 1.00 28.57 ? 124  LYS A NZ  1 
ATOM   907  N N   . LEU A 1 145 ? -3.910  -10.233 39.441 1.00 21.56 ? 125  LEU A N   1 
ATOM   908  C CA  . LEU A 1 145 ? -2.540  -10.339 39.010 1.00 21.11 ? 125  LEU A CA  1 
ATOM   909  C C   . LEU A 1 145 ? -1.807  -11.476 39.744 1.00 20.71 ? 125  LEU A C   1 
ATOM   910  O O   . LEU A 1 145 ? -0.587  -11.536 39.733 1.00 20.38 ? 125  LEU A O   1 
ATOM   911  C CB  . LEU A 1 145 ? -1.826  -8.980  39.219 1.00 21.82 ? 125  LEU A CB  1 
ATOM   912  C CG  . LEU A 1 145 ? -2.399  -7.716  38.529 1.00 22.57 ? 125  LEU A CG  1 
ATOM   913  C CD1 . LEU A 1 145 ? -1.620  -6.445  38.931 1.00 22.35 ? 125  LEU A CD1 1 
ATOM   914  C CD2 . LEU A 1 145 ? -2.404  -7.837  37.002 1.00 22.72 ? 125  LEU A CD2 1 
ATOM   915  N N   . GLY A 1 146 ? -2.549  -12.362 40.387 1.00 21.05 ? 126  GLY A N   1 
ATOM   916  C CA  . GLY A 1 146 ? -1.967  -13.478 41.122 1.00 22.04 ? 126  GLY A CA  1 
ATOM   917  C C   . GLY A 1 146 ? -1.281  -13.096 42.420 1.00 22.67 ? 126  GLY A C   1 
ATOM   918  O O   . GLY A 1 146 ? -0.375  -13.812 42.901 1.00 22.65 ? 126  GLY A O   1 
ATOM   919  N N   . VAL A 1 147 ? -1.698  -11.970 42.990 1.00 21.97 ? 127  VAL A N   1 
ATOM   920  C CA  . VAL A 1 147 ? -1.138  -11.523 44.259 1.00 22.78 ? 127  VAL A CA  1 
ATOM   921  C C   . VAL A 1 147 ? -2.258  -11.624 45.323 1.00 23.03 ? 127  VAL A C   1 
ATOM   922  O O   . VAL A 1 147 ? -3.359  -11.117 45.107 1.00 24.29 ? 127  VAL A O   1 
ATOM   923  C CB  . VAL A 1 147 ? -0.547  -10.076 44.136 1.00 23.06 ? 127  VAL A CB  1 
ATOM   924  C CG1 . VAL A 1 147 ? -0.071  -9.545  45.477 1.00 22.40 ? 127  VAL A CG1 1 
ATOM   925  C CG2 . VAL A 1 147 ? 0.595   -10.033 43.157 1.00 22.67 ? 127  VAL A CG2 1 
ATOM   926  N N   . THR A 1 148 ? -1.997  -12.276 46.452 1.00 22.03 ? 128  THR A N   1 
ATOM   927  C CA  . THR A 1 148 ? -3.039  -12.380 47.478 1.00 22.62 ? 128  THR A CA  1 
ATOM   928  C C   . THR A 1 148 ? -2.799  -11.350 48.587 1.00 22.00 ? 128  THR A C   1 
ATOM   929  O O   . THR A 1 148 ? -1.669  -10.919 48.817 1.00 21.64 ? 128  THR A O   1 
ATOM   930  C CB  . THR A 1 148 ? -3.093  -13.751 48.123 1.00 22.17 ? 128  THR A CB  1 
ATOM   931  O OG1 . THR A 1 148 ? -1.792  -14.027 48.653 1.00 24.86 ? 128  THR A OG1 1 
ATOM   932  C CG2 . THR A 1 148 ? -3.514  -14.846 47.112 1.00 24.44 ? 128  THR A CG2 1 
ATOM   933  N N   . THR A 1 149 ? -3.873  -10.943 49.248 1.00 20.37 ? 129  THR A N   1 
ATOM   934  C CA  . THR A 1 149 ? -3.793  -10.002 50.333 1.00 19.49 ? 129  THR A CA  1 
ATOM   935  C C   . THR A 1 149 ? -4.591  -10.545 51.477 1.00 20.67 ? 129  THR A C   1 
ATOM   936  O O   . THR A 1 149 ? -5.684  -11.079 51.277 1.00 20.82 ? 129  THR A O   1 
ATOM   937  C CB  . THR A 1 149 ? -4.401  -8.644  49.950 1.00 19.16 ? 129  THR A CB  1 
ATOM   938  O OG1 . THR A 1 149 ? -3.756  -8.161  48.774 1.00 20.10 ? 129  THR A OG1 1 
ATOM   939  C CG2 . THR A 1 149 ? -4.305  -7.621  51.107 1.00 15.92 ? 129  THR A CG2 1 
ATOM   940  N N   . SER A 1 150 ? -4.058  -10.392 52.681 1.00 20.31 ? 130  SER A N   1 
ATOM   941  C CA  . SER A 1 150 ? -4.875  -10.611 53.861 1.00 20.78 ? 130  SER A CA  1 
ATOM   942  C C   . SER A 1 150 ? -4.574  -9.453  54.816 1.00 20.49 ? 130  SER A C   1 
ATOM   943  O O   . SER A 1 150 ? -3.715  -8.609  54.532 1.00 18.62 ? 130  SER A O   1 
ATOM   944  C CB  . SER A 1 150 ? -4.602  -11.989 54.477 1.00 20.35 ? 130  SER A CB  1 
ATOM   945  O OG  . SER A 1 150 ? -3.351  -11.959 55.111 1.00 22.25 ? 130  SER A OG  1 
ATOM   946  N N   . TRP A 1 151 ? -5.276  -9.426  55.945 1.00 20.71 ? 131  TRP A N   1 
ATOM   947  C CA  . TRP A 1 151 ? -5.369  -8.232  56.778 1.00 22.00 ? 131  TRP A CA  1 
ATOM   948  C C   . TRP A 1 151 ? -5.205  -8.536  58.255 1.00 21.46 ? 131  TRP A C   1 
ATOM   949  O O   . TRP A 1 151 ? -5.482  -9.645  58.700 1.00 22.23 ? 131  TRP A O   1 
ATOM   950  C CB  . TRP A 1 151 ? -6.738  -7.570  56.581 1.00 22.04 ? 131  TRP A CB  1 
ATOM   951  C CG  . TRP A 1 151 ? -7.190  -7.648  55.177 1.00 26.82 ? 131  TRP A CG  1 
ATOM   952  C CD1 . TRP A 1 151 ? -7.775  -8.728  54.552 1.00 27.49 ? 131  TRP A CD1 1 
ATOM   953  C CD2 . TRP A 1 151 ? -7.059  -6.641  54.198 1.00 27.41 ? 131  TRP A CD2 1 
ATOM   954  N NE1 . TRP A 1 151 ? -8.030  -8.430  53.244 1.00 28.56 ? 131  TRP A NE1 1 
ATOM   955  C CE2 . TRP A 1 151 ? -7.607  -7.151  53.000 1.00 29.66 ? 131  TRP A CE2 1 
ATOM   956  C CE3 . TRP A 1 151 ? -6.560  -5.338  54.218 1.00 26.08 ? 131  TRP A CE3 1 
ATOM   957  C CZ2 . TRP A 1 151 ? -7.644  -6.415  51.822 1.00 27.70 ? 131  TRP A CZ2 1 
ATOM   958  C CZ3 . TRP A 1 151 ? -6.601  -4.621  53.068 1.00 27.75 ? 131  TRP A CZ3 1 
ATOM   959  C CH2 . TRP A 1 151 ? -7.148  -5.153  51.883 1.00 31.90 ? 131  TRP A CH2 1 
ATOM   960  N N   . PHE A 1 152 ? -4.780  -7.528  59.008 1.00 20.53 ? 132  PHE A N   1 
ATOM   961  C CA  . PHE A 1 152 ? -4.553  -7.694  60.449 1.00 20.32 ? 132  PHE A CA  1 
ATOM   962  C C   . PHE A 1 152 ? -5.155  -6.545  61.278 1.00 19.65 ? 132  PHE A C   1 
ATOM   963  O O   . PHE A 1 152 ? -5.305  -5.414  60.804 1.00 19.03 ? 132  PHE A O   1 
ATOM   964  C CB  . PHE A 1 152 ? -3.041  -7.891  60.768 1.00 18.96 ? 132  PHE A CB  1 
ATOM   965  C CG  . PHE A 1 152 ? -2.150  -6.691  60.447 1.00 20.63 ? 132  PHE A CG  1 
ATOM   966  C CD1 . PHE A 1 152 ? -1.766  -5.790  61.458 1.00 19.06 ? 132  PHE A CD1 1 
ATOM   967  C CD2 . PHE A 1 152 ? -1.669  -6.483  59.151 1.00 17.38 ? 132  PHE A CD2 1 
ATOM   968  C CE1 . PHE A 1 152 ? -0.965  -4.671  61.169 1.00 19.91 ? 132  PHE A CE1 1 
ATOM   969  C CE2 . PHE A 1 152 ? -0.824  -5.372  58.839 1.00 21.57 ? 132  PHE A CE2 1 
ATOM   970  C CZ  . PHE A 1 152 ? -0.473  -4.457  59.855 1.00 17.73 ? 132  PHE A CZ  1 
ATOM   971  N N   . ASP A 1 153 ? -5.470  -6.863  62.532 1.00 20.66 ? 133  ASP A N   1 
ATOM   972  C CA  . ASP A 1 153 ? -5.879  -5.880  63.524 1.00 22.02 ? 133  ASP A CA  1 
ATOM   973  C C   . ASP A 1 153 ? -4.708  -4.942  63.833 1.00 21.04 ? 133  ASP A C   1 
ATOM   974  O O   . ASP A 1 153 ? -3.572  -5.411  64.001 1.00 21.37 ? 133  ASP A O   1 
ATOM   975  C CB  . ASP A 1 153 ? -6.313  -6.583  64.808 1.00 22.79 ? 133  ASP A CB  1 
ATOM   976  C CG  . ASP A 1 153 ? -6.885  -5.610  65.838 1.00 27.78 ? 133  ASP A CG  1 
ATOM   977  O OD1 . ASP A 1 153 ? -6.121  -4.976  66.620 1.00 30.15 ? 133  ASP A OD1 1 
ATOM   978  O OD2 . ASP A 1 153 ? -8.124  -5.447  65.843 1.00 34.27 ? 133  ASP A OD2 1 
ATOM   979  N N   . PRO A 1 154 ? -4.969  -3.612  63.904 1.00 20.48 ? 134  PRO A N   1 
ATOM   980  C CA  . PRO A 1 154 ? -3.851  -2.659  64.070 1.00 19.93 ? 134  PRO A CA  1 
ATOM   981  C C   . PRO A 1 154 ? -3.066  -2.749  65.408 1.00 19.78 ? 134  PRO A C   1 
ATOM   982  O O   . PRO A 1 154 ? -1.892  -2.305  65.498 1.00 19.56 ? 134  PRO A O   1 
ATOM   983  C CB  . PRO A 1 154 ? -4.542  -1.300  63.925 1.00 20.42 ? 134  PRO A CB  1 
ATOM   984  C CG  . PRO A 1 154 ? -5.986  -1.574  64.442 1.00 19.54 ? 134  PRO A CG  1 
ATOM   985  C CD  . PRO A 1 154 ? -6.268  -2.919  63.820 1.00 20.06 ? 134  PRO A CD  1 
ATOM   986  N N   . LEU A 1 155 ? -3.705  -3.310  66.427 1.00 18.84 ? 135  LEU A N   1 
ATOM   987  C CA  . LEU A 1 155 ? -3.127  -3.485  67.762 1.00 19.19 ? 135  LEU A CA  1 
ATOM   988  C C   . LEU A 1 155 ? -2.463  -4.871  67.956 1.00 19.33 ? 135  LEU A C   1 
ATOM   989  O O   . LEU A 1 155 ? -2.180  -5.267  69.077 1.00 19.52 ? 135  LEU A O   1 
ATOM   990  C CB  . LEU A 1 155 ? -4.180  -3.233  68.852 1.00 19.29 ? 135  LEU A CB  1 
ATOM   991  C CG  . LEU A 1 155 ? -4.774  -1.820  68.967 1.00 21.91 ? 135  LEU A CG  1 
ATOM   992  C CD1 . LEU A 1 155 ? -5.489  -1.691  70.283 1.00 22.68 ? 135  LEU A CD1 1 
ATOM   993  C CD2 . LEU A 1 155 ? -3.670  -0.808  68.902 1.00 22.42 ? 135  LEU A CD2 1 
ATOM   994  N N   . ILE A 1 156 ? -2.205  -5.583  66.863 1.00 19.72 ? 136  ILE A N   1 
ATOM   995  C CA  . ILE A 1 156 ? -1.661  -6.963  66.901 1.00 19.88 ? 136  ILE A CA  1 
ATOM   996  C C   . ILE A 1 156 ? -0.229  -7.011  67.432 1.00 20.17 ? 136  ILE A C   1 
ATOM   997  O O   . ILE A 1 156 ? 0.141   -7.981  68.131 1.00 19.62 ? 136  ILE A O   1 
ATOM   998  C CB  . ILE A 1 156 ? -1.754  -7.668  65.523 1.00 20.55 ? 136  ILE A CB  1 
ATOM   999  C CG1 . ILE A 1 156 ? -1.425  -9.157  65.618 1.00 23.45 ? 136  ILE A CG1 1 
ATOM   1000 C CG2 . ILE A 1 156 ? -0.914  -6.992  64.479 1.00 20.49 ? 136  ILE A CG2 1 
ATOM   1001 C CD1 . ILE A 1 156 ? -2.589  -9.991  66.108 1.00 26.66 ? 136  ILE A CD1 1 
ATOM   1002 N N   . GLY A 1 157 ? 0.555   -5.963  67.155 1.00 19.33 ? 137  GLY A N   1 
ATOM   1003 C CA  . GLY A 1 157 ? 1.954   -5.898  67.614 1.00 19.73 ? 137  GLY A CA  1 
ATOM   1004 C C   . GLY A 1 157 ? 2.757   -7.133  67.185 1.00 20.33 ? 137  GLY A C   1 
ATOM   1005 O O   . GLY A 1 157 ? 2.725   -7.549  66.014 1.00 18.58 ? 137  GLY A O   1 
ATOM   1006 N N   . ALA A 1 158 ? 3.467   -7.733  68.142 1.00 21.17 ? 138  ALA A N   1 
ATOM   1007 C CA  . ALA A 1 158 ? 4.354   -8.870  67.858 1.00 21.62 ? 138  ALA A CA  1 
ATOM   1008 C C   . ALA A 1 158 ? 3.574   -10.117 67.475 1.00 21.98 ? 138  ALA A C   1 
ATOM   1009 O O   . ALA A 1 158 ? 4.132   -11.054 66.935 1.00 23.04 ? 138  ALA A O   1 
ATOM   1010 C CB  . ALA A 1 158 ? 5.246   -9.160  69.060 1.00 22.46 ? 138  ALA A CB  1 
ATOM   1011 N N   . ASP A 1 159 ? 2.278   -10.154 67.752 1.00 21.82 ? 139  ASP A N   1 
ATOM   1012 C CA  . ASP A 1 159 ? 1.494   -11.307 67.323 1.00 22.86 ? 139  ASP A CA  1 
ATOM   1013 C C   . ASP A 1 159 ? 1.195   -11.328 65.812 1.00 21.70 ? 139  ASP A C   1 
ATOM   1014 O O   . ASP A 1 159 ? 0.508   -12.215 65.301 1.00 22.65 ? 139  ASP A O   1 
ATOM   1015 C CB  . ASP A 1 159 ? 0.201   -11.383 68.144 1.00 24.20 ? 139  ASP A CB  1 
ATOM   1016 C CG  . ASP A 1 159 ? 0.456   -11.730 69.606 1.00 28.13 ? 139  ASP A CG  1 
ATOM   1017 O OD1 . ASP A 1 159 ? 1.343   -12.579 69.899 1.00 34.25 ? 139  ASP A OD1 1 
ATOM   1018 O OD2 . ASP A 1 159 ? -0.235  -11.154 70.463 1.00 35.14 ? 139  ASP A OD2 1 
ATOM   1019 N N   . ILE A 1 160 ? 1.712   -10.356 65.089 1.00 20.68 ? 140  ILE A N   1 
ATOM   1020 C CA  . ILE A 1 160 ? 1.530   -10.319 63.635 1.00 20.53 ? 140  ILE A CA  1 
ATOM   1021 C C   . ILE A 1 160 ? 2.200   -11.541 62.955 1.00 20.23 ? 140  ILE A C   1 
ATOM   1022 O O   . ILE A 1 160 ? 1.911   -11.844 61.812 1.00 20.07 ? 140  ILE A O   1 
ATOM   1023 C CB  . ILE A 1 160 ? 2.065   -8.983  63.029 1.00 19.83 ? 140  ILE A CB  1 
ATOM   1024 C CG1 . ILE A 1 160 ? 1.615   -8.802  61.576 1.00 19.04 ? 140  ILE A CG1 1 
ATOM   1025 C CG2 . ILE A 1 160 ? 3.590   -8.907  63.109 1.00 18.19 ? 140  ILE A CG2 1 
ATOM   1026 C CD1 . ILE A 1 160 ? 2.123   -7.475  60.941 1.00 19.65 ? 140  ILE A CD1 1 
ATOM   1027 N N   . VAL A 1 161 ? 3.105   -12.218 63.669 1.00 21.20 ? 141  VAL A N   1 
ATOM   1028 C CA  . VAL A 1 161 ? 3.793   -13.411 63.125 1.00 22.49 ? 141  VAL A CA  1 
ATOM   1029 C C   . VAL A 1 161 ? 2.798   -14.479 62.650 1.00 22.75 ? 141  VAL A C   1 
ATOM   1030 O O   . VAL A 1 161 ? 3.034   -15.147 61.648 1.00 22.23 ? 141  VAL A O   1 
ATOM   1031 C CB  . VAL A 1 161 ? 4.818   -14.007 64.119 1.00 22.54 ? 141  VAL A CB  1 
ATOM   1032 C CG1 . VAL A 1 161 ? 5.886   -12.992 64.453 1.00 24.46 ? 141  VAL A CG1 1 
ATOM   1033 C CG2 . VAL A 1 161 ? 4.140   -14.419 65.382 1.00 25.23 ? 141  VAL A CG2 1 
ATOM   1034 N N   . LYS A 1 162 ? 1.699   -14.612 63.388 1.00 23.48 ? 142  LYS A N   1 
ATOM   1035 C CA  . LYS A 1 162 ? 0.481   -15.374 63.018 1.00 24.76 ? 142  LYS A CA  1 
ATOM   1036 C C   . LYS A 1 162 ? 0.131   -15.250 61.530 1.00 24.33 ? 142  LYS A C   1 
ATOM   1037 O O   . LYS A 1 162 ? -0.337  -16.212 60.916 1.00 22.40 ? 142  LYS A O   1 
ATOM   1038 C CB  . LYS A 1 162 ? -0.723  -14.703 63.710 1.00 25.63 ? 142  LYS A CB  1 
ATOM   1039 C CG  . LYS A 1 162 ? -1.347  -15.324 64.900 1.00 29.27 ? 142  LYS A CG  1 
ATOM   1040 C CD  . LYS A 1 162 ? -2.583  -14.438 65.253 1.00 31.68 ? 142  LYS A CD  1 
ATOM   1041 C CE  . LYS A 1 162 ? -3.549  -15.097 66.243 1.00 36.25 ? 142  LYS A CE  1 
ATOM   1042 N NZ  . LYS A 1 162 ? -3.073  -15.130 67.695 1.00 37.51 ? 142  LYS A NZ  1 
ATOM   1043 N N   . HIS A 1 163 ? 0.288   -14.038 60.989 1.00 23.73 ? 143  HIS A N   1 
ATOM   1044 C CA  . HIS A 1 163 ? -0.289  -13.701 59.674 1.00 24.03 ? 143  HIS A CA  1 
ATOM   1045 C C   . HIS A 1 163 ? 0.754   -13.699 58.562 1.00 23.66 ? 143  HIS A C   1 
ATOM   1046 O O   . HIS A 1 163 ? 0.417   -13.525 57.389 1.00 24.32 ? 143  HIS A O   1 
ATOM   1047 C CB  . HIS A 1 163 ? -0.973  -12.322 59.700 1.00 23.42 ? 143  HIS A CB  1 
ATOM   1048 C CG  . HIS A 1 163 ? -2.169  -12.250 60.579 1.00 24.92 ? 143  HIS A CG  1 
ATOM   1049 N ND1 . HIS A 1 163 ? -2.214  -11.465 61.712 1.00 27.55 ? 143  HIS A ND1 1 
ATOM   1050 C CD2 . HIS A 1 163 ? -3.384  -12.843 60.481 1.00 28.70 ? 143  HIS A CD2 1 
ATOM   1051 C CE1 . HIS A 1 163 ? -3.395  -11.595 62.288 1.00 28.77 ? 143  HIS A CE1 1 
ATOM   1052 N NE2 . HIS A 1 163 ? -4.129  -12.413 61.554 1.00 30.32 ? 143  HIS A NE2 1 
ATOM   1053 N N   . LEU A 1 164 ? 2.016   -13.894 58.931 1.00 23.86 ? 144  LEU A N   1 
ATOM   1054 C CA  . LEU A 1 164 ? 3.125   -13.830 57.995 1.00 24.15 ? 144  LEU A CA  1 
ATOM   1055 C C   . LEU A 1 164 ? 3.285   -15.169 57.254 1.00 25.25 ? 144  LEU A C   1 
ATOM   1056 O O   . LEU A 1 164 ? 3.416   -16.220 57.881 1.00 26.27 ? 144  LEU A O   1 
ATOM   1057 C CB  . LEU A 1 164 ? 4.416   -13.455 58.747 1.00 23.76 ? 144  LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 164 ? 4.498   -12.051 59.355 1.00 22.95 ? 144  LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 164 ? 5.808   -11.848 60.129 1.00 21.33 ? 144  LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 164 ? 4.413   -10.995 58.260 1.00 22.02 ? 144  LEU A CD2 1 
ATOM   1061 N N   . GLN A 1 165 ? 3.252   -15.126 55.925 1.00 25.27 ? 145  GLN A N   1 
ATOM   1062 C CA  . GLN A 1 165 ? 3.418   -16.292 55.069 1.00 24.62 ? 145  GLN A CA  1 
ATOM   1063 C C   . GLN A 1 165 ? 4.849   -16.299 54.511 1.00 24.11 ? 145  GLN A C   1 
ATOM   1064 O O   . GLN A 1 165 ? 5.485   -15.258 54.444 1.00 23.59 ? 145  GLN A O   1 
ATOM   1065 C CB  . GLN A 1 165 ? 2.383   -16.243 53.948 1.00 24.11 ? 145  GLN A CB  1 
ATOM   1066 C CG  . GLN A 1 165 ? 1.012   -16.592 54.451 1.00 26.18 ? 145  GLN A CG  1 
ATOM   1067 C CD  . GLN A 1 165 ? -0.127  -16.267 53.498 1.00 27.38 ? 145  GLN A CD  1 
ATOM   1068 O OE1 . GLN A 1 165 ? -1.229  -15.919 53.953 1.00 29.26 ? 145  GLN A OE1 1 
ATOM   1069 N NE2 . GLN A 1 165 ? 0.104   -16.403 52.192 1.00 25.96 ? 145  GLN A NE2 1 
ATOM   1070 N N   . PRO A 1 166 ? 5.359   -17.473 54.106 1.00 24.20 ? 146  PRO A N   1 
ATOM   1071 C CA  . PRO A 1 166 ? 6.700   -17.481 53.516 1.00 23.34 ? 146  PRO A CA  1 
ATOM   1072 C C   . PRO A 1 166 ? 6.760   -16.613 52.251 1.00 23.38 ? 146  PRO A C   1 
ATOM   1073 O O   . PRO A 1 166 ? 7.825   -16.140 51.907 1.00 22.97 ? 146  PRO A O   1 
ATOM   1074 C CB  . PRO A 1 166 ? 6.943   -18.949 53.168 1.00 23.71 ? 146  PRO A CB  1 
ATOM   1075 C CG  . PRO A 1 166 ? 5.911   -19.724 54.002 1.00 25.36 ? 146  PRO A CG  1 
ATOM   1076 C CD  . PRO A 1 166 ? 4.743   -18.812 54.144 1.00 24.64 ? 146  PRO A CD  1 
ATOM   1077 N N   . ASN A 1 167 ? 5.621   -16.384 51.586 1.00 21.90 ? 147  ASN A N   1 
ATOM   1078 C CA  . ASN A 1 167 ? 5.592   -15.518 50.403 1.00 21.33 ? 147  ASN A CA  1 
ATOM   1079 C C   . ASN A 1 167 ? 5.140   -14.082 50.689 1.00 20.80 ? 147  ASN A C   1 
ATOM   1080 O O   . ASN A 1 167 ? 4.732   -13.360 49.783 1.00 20.46 ? 147  ASN A O   1 
ATOM   1081 C CB  . ASN A 1 167 ? 4.726   -16.123 49.293 1.00 21.19 ? 147  ASN A CB  1 
ATOM   1082 C CG  . ASN A 1 167 ? 3.277   -16.268 49.705 1.00 22.78 ? 147  ASN A CG  1 
ATOM   1083 O OD1 . ASN A 1 167 ? 2.989   -16.469 50.879 1.00 21.75 ? 147  ASN A OD1 1 
ATOM   1084 N ND2 . ASN A 1 167 ? 2.356   -16.154 48.740 1.00 22.68 ? 147  ASN A ND2 1 
ATOM   1085 N N   . THR A 1 168 ? 5.198   -13.668 51.950 1.00 20.75 ? 148  THR A N   1 
ATOM   1086 C CA  . THR A 1 168 ? 4.799   -12.300 52.283 1.00 20.06 ? 148  THR A CA  1 
ATOM   1087 C C   . THR A 1 168 ? 5.875   -11.348 51.822 1.00 20.65 ? 148  THR A C   1 
ATOM   1088 O O   . THR A 1 168 ? 7.020   -11.382 52.329 1.00 19.85 ? 148  THR A O   1 
ATOM   1089 C CB  . THR A 1 168 ? 4.477   -12.098 53.790 1.00 20.47 ? 148  THR A CB  1 
ATOM   1090 O OG1 . THR A 1 168 ? 3.422   -12.996 54.170 1.00 20.02 ? 148  THR A OG1 1 
ATOM   1091 C CG2 . THR A 1 168 ? 4.030   -10.631 54.077 1.00 20.92 ? 148  THR A CG2 1 
ATOM   1092 N N   . LYS A 1 169 ? 5.485   -10.498 50.869 1.00 20.17 ? 149  LYS A N   1 
ATOM   1093 C CA  . LYS A 1 169 ? 6.404   -9.585  50.238 1.00 19.57 ? 149  LYS A CA  1 
ATOM   1094 C C   . LYS A 1 169 ? 6.268   -8.179  50.795 1.00 18.75 ? 149  LYS A C   1 
ATOM   1095 O O   . LYS A 1 169 ? 7.242   -7.432  50.838 1.00 19.25 ? 149  LYS A O   1 
ATOM   1096 C CB  . LYS A 1 169 ? 6.172   -9.600  48.709 1.00 20.77 ? 149  LYS A CB  1 
ATOM   1097 C CG  . LYS A 1 169 ? 7.069   -8.642  47.930 1.00 23.11 ? 149  LYS A CG  1 
ATOM   1098 C CD  . LYS A 1 169 ? 8.493   -9.161  47.796 1.00 27.96 ? 149  LYS A CD  1 
ATOM   1099 C CE  . LYS A 1 169 ? 9.043   -8.876  46.383 1.00 32.91 ? 149  LYS A CE  1 
ATOM   1100 N NZ  . LYS A 1 169 ? 8.455   -9.736  45.204 1.00 30.45 ? 149  LYS A NZ  1 
ATOM   1101 N N   . ILE A 1 170 ? 5.048   -7.788  51.137 1.00 18.16 ? 150  ILE A N   1 
ATOM   1102 C CA  . ILE A 1 170 ? 4.771   -6.454  51.647 1.00 18.46 ? 150  ILE A CA  1 
ATOM   1103 C C   . ILE A 1 170 ? 4.038   -6.565  52.949 1.00 17.78 ? 150  ILE A C   1 
ATOM   1104 O O   . ILE A 1 170 ? 3.053   -7.317  53.042 1.00 19.39 ? 150  ILE A O   1 
ATOM   1105 C CB  . ILE A 1 170 ? 3.797   -5.664  50.690 1.00 18.26 ? 150  ILE A CB  1 
ATOM   1106 C CG1 . ILE A 1 170 ? 4.224   -5.701  49.207 1.00 19.95 ? 150  ILE A CG1 1 
ATOM   1107 C CG2 . ILE A 1 170 ? 3.481   -4.243  51.286 1.00 17.45 ? 150  ILE A CG2 1 
ATOM   1108 C CD1 . ILE A 1 170 ? 4.969   -4.463  48.744 1.00 20.22 ? 150  ILE A CD1 1 
ATOM   1109 N N   . VAL A 1 171 ? 4.465   -5.769  53.930 1.00 17.33 ? 151  VAL A N   1 
ATOM   1110 C CA  . VAL A 1 171 ? 3.659   -5.504  55.131 1.00 18.04 ? 151  VAL A CA  1 
ATOM   1111 C C   . VAL A 1 171 ? 3.278   -4.019  55.140 1.00 17.78 ? 151  VAL A C   1 
ATOM   1112 O O   . VAL A 1 171 ? 4.138   -3.157  55.133 1.00 17.79 ? 151  VAL A O   1 
ATOM   1113 C CB  . VAL A 1 171 ? 4.358   -5.959  56.453 1.00 18.06 ? 151  VAL A CB  1 
ATOM   1114 C CG1 . VAL A 1 171 ? 3.442   -5.655  57.674 1.00 18.93 ? 151  VAL A CG1 1 
ATOM   1115 C CG2 . VAL A 1 171 ? 4.722   -7.465  56.393 1.00 18.43 ? 151  VAL A CG2 1 
ATOM   1116 N N   . PHE A 1 172 ? 1.984   -3.719  55.112 1.00 17.99 ? 152  PHE A N   1 
ATOM   1117 C CA  . PHE A 1 172 ? 1.564   -2.351  54.846 1.00 18.72 ? 152  PHE A CA  1 
ATOM   1118 C C   . PHE A 1 172 ? 0.900   -1.770  56.093 1.00 18.34 ? 152  PHE A C   1 
ATOM   1119 O O   . PHE A 1 172 ? -0.144  -2.253  56.513 1.00 18.33 ? 152  PHE A O   1 
ATOM   1120 C CB  . PHE A 1 172 ? 0.580   -2.281  53.647 1.00 18.60 ? 152  PHE A CB  1 
ATOM   1121 C CG  . PHE A 1 172 ? 0.273   -0.860  53.215 1.00 18.26 ? 152  PHE A CG  1 
ATOM   1122 C CD1 . PHE A 1 172 ? -0.698  -0.087  53.893 1.00 16.90 ? 152  PHE A CD1 1 
ATOM   1123 C CD2 . PHE A 1 172 ? 0.993   -0.278  52.122 1.00 20.41 ? 152  PHE A CD2 1 
ATOM   1124 C CE1 . PHE A 1 172 ? -0.954  1.278   53.490 1.00 16.59 ? 152  PHE A CE1 1 
ATOM   1125 C CE2 . PHE A 1 172 ? 0.743   1.045   51.723 1.00 18.88 ? 152  PHE A CE2 1 
ATOM   1126 C CZ  . PHE A 1 172 ? -0.245  1.808   52.388 1.00 17.17 ? 152  PHE A CZ  1 
ATOM   1127 N N   . LEU A 1 173 ? 1.517   -0.761  56.696 1.00 18.53 ? 153  LEU A N   1 
ATOM   1128 C CA  . LEU A 1 173 ? 0.966   -0.181  57.926 1.00 18.96 ? 153  LEU A CA  1 
ATOM   1129 C C   . LEU A 1 173 ? 0.282   1.156   57.653 1.00 18.81 ? 153  LEU A C   1 
ATOM   1130 O O   . LEU A 1 173 ? 0.530   1.782   56.620 1.00 18.41 ? 153  LEU A O   1 
ATOM   1131 C CB  . LEU A 1 173 ? 2.079   0.031   58.947 1.00 19.12 ? 153  LEU A CB  1 
ATOM   1132 C CG  . LEU A 1 173 ? 3.113   -1.112  59.117 1.00 21.26 ? 153  LEU A CG  1 
ATOM   1133 C CD1 . LEU A 1 173 ? 4.221   -0.664  60.042 1.00 24.23 ? 153  LEU A CD1 1 
ATOM   1134 C CD2 . LEU A 1 173 ? 2.451   -2.306  59.679 1.00 21.89 ? 153  LEU A CD2 1 
ATOM   1135 N N   . GLU A 1 174 ? -0.581  1.588   58.574 1.00 17.59 ? 154  GLU A N   1 
ATOM   1136 C CA  . GLU A 1 174 ? -1.148  2.945   58.560 1.00 17.76 ? 154  GLU A CA  1 
ATOM   1137 C C   . GLU A 1 174 ? -1.371  3.291   60.031 1.00 17.98 ? 154  GLU A C   1 
ATOM   1138 O O   . GLU A 1 174 ? -2.227  2.689   60.690 1.00 18.40 ? 154  GLU A O   1 
ATOM   1139 C CB  . GLU A 1 174 ? -2.510  3.021   57.819 1.00 17.41 ? 154  GLU A CB  1 
ATOM   1140 C CG  . GLU A 1 174 ? -2.982  4.464   57.578 1.00 16.31 ? 154  GLU A CG  1 
ATOM   1141 C CD  . GLU A 1 174 ? -4.183  4.533   56.631 1.00 20.76 ? 154  GLU A CD  1 
ATOM   1142 O OE1 . GLU A 1 174 ? -4.233  3.732   55.658 1.00 16.56 ? 154  GLU A OE1 1 
ATOM   1143 O OE2 . GLU A 1 174 ? -5.084  5.381   56.868 1.00 17.81 ? 154  GLU A OE2 1 
ATOM   1144 N N   . SER A 1 175 ? -0.619  4.245   60.551 1.00 17.23 ? 155  SER A N   1 
ATOM   1145 C CA  . SER A 1 175 ? -0.685  4.558   61.973 1.00 17.08 ? 155  SER A CA  1 
ATOM   1146 C C   . SER A 1 175 ? -0.691  6.079   62.119 1.00 18.23 ? 155  SER A C   1 
ATOM   1147 O O   . SER A 1 175 ? 0.235   6.725   61.622 1.00 18.20 ? 155  SER A O   1 
ATOM   1148 C CB  . SER A 1 175 ? 0.522   3.986   62.714 1.00 18.02 ? 155  SER A CB  1 
ATOM   1149 O OG  . SER A 1 175 ? 0.390   4.165   64.118 1.00 18.04 ? 155  SER A OG  1 
ATOM   1150 N N   . PRO A 1 176 ? -1.747  6.665   62.734 1.00 16.81 ? 156  PRO A N   1 
ATOM   1151 C CA  . PRO A 1 176 ? -2.998  6.063   63.185 1.00 17.75 ? 156  PRO A CA  1 
ATOM   1152 C C   . PRO A 1 176 ? -3.783  5.582   61.994 1.00 17.02 ? 156  PRO A C   1 
ATOM   1153 O O   . PRO A 1 176 ? -3.533  6.030   60.879 1.00 16.71 ? 156  PRO A O   1 
ATOM   1154 C CB  . PRO A 1 176 ? -3.750  7.228   63.840 1.00 17.58 ? 156  PRO A CB  1 
ATOM   1155 C CG  . PRO A 1 176 ? -2.758  8.288   64.060 1.00 20.20 ? 156  PRO A CG  1 
ATOM   1156 C CD  . PRO A 1 176 ? -1.746  8.120   62.959 1.00 17.58 ? 156  PRO A CD  1 
ATOM   1157 N N   . GLY A 1 177 ? -4.741  4.685   62.239 1.00 17.22 ? 157  GLY A N   1 
ATOM   1158 C CA  . GLY A 1 177 ? -5.568  4.125   61.170 1.00 18.28 ? 157  GLY A CA  1 
ATOM   1159 C C   . GLY A 1 177 ? -6.605  5.079   60.584 1.00 18.47 ? 157  GLY A C   1 
ATOM   1160 O O   . GLY A 1 177 ? -7.067  6.022   61.239 1.00 18.31 ? 157  GLY A O   1 
ATOM   1161 N N   . SER A 1 178 ? -6.988  4.823   59.341 1.00 18.02 ? 158  SER A N   1 
ATOM   1162 C CA  . SER A 1 178 ? -8.059  5.613   58.739 1.00 17.90 ? 158  SER A CA  1 
ATOM   1163 C C   . SER A 1 178 ? -9.334  5.533   59.556 1.00 17.92 ? 158  SER A C   1 
ATOM   1164 O O   . SER A 1 178 ? -9.804  4.442   59.921 1.00 18.54 ? 158  SER A O   1 
ATOM   1165 C CB  . SER A 1 178 ? -8.371  5.181   57.304 1.00 18.55 ? 158  SER A CB  1 
ATOM   1166 O OG  . SER A 1 178 ? -7.419  5.731   56.371 1.00 19.16 ? 158  SER A OG  1 
ATOM   1167 N N   . ILE A 1 179 ? -9.882  6.705   59.842 1.00 17.52 ? 159  ILE A N   1 
ATOM   1168 C CA  . ILE A 1 179 ? -11.232 6.809   60.451 1.00 17.46 ? 159  ILE A CA  1 
ATOM   1169 C C   . ILE A 1 179 ? -11.287 6.520   61.962 1.00 16.82 ? 159  ILE A C   1 
ATOM   1170 O O   . ILE A 1 179 ? -11.615 7.406   62.761 1.00 17.50 ? 159  ILE A O   1 
ATOM   1171 C CB  . ILE A 1 179 ? -12.282 5.974   59.673 1.00 18.23 ? 159  ILE A CB  1 
ATOM   1172 C CG1 . ILE A 1 179 ? -12.345 6.394   58.195 1.00 19.44 ? 159  ILE A CG1 1 
ATOM   1173 C CG2 . ILE A 1 179 ? -13.639 6.215   60.260 1.00 19.28 ? 159  ILE A CG2 1 
ATOM   1174 C CD1 . ILE A 1 179 ? -13.422 5.627   57.408 1.00 21.19 ? 159  ILE A CD1 1 
ATOM   1175 N N   . THR A 1 180 ? -10.907 5.315   62.354 1.00 17.11 ? 160  THR A N   1 
ATOM   1176 C CA  . THR A 1 180 ? -10.969 4.877   63.741 1.00 17.74 ? 160  THR A CA  1 
ATOM   1177 C C   . THR A 1 180 ? -9.723  5.214   64.556 1.00 17.55 ? 160  THR A C   1 
ATOM   1178 O O   . THR A 1 180 ? -9.727  5.113   65.777 1.00 19.40 ? 160  THR A O   1 
ATOM   1179 C CB  . THR A 1 180 ? -11.259 3.365   63.810 1.00 18.45 ? 160  THR A CB  1 
ATOM   1180 O OG1 . THR A 1 180 ? -10.451 2.678   62.848 1.00 15.94 ? 160  THR A OG1 1 
ATOM   1181 C CG2 . THR A 1 180 ? -12.682 3.138   63.427 1.00 17.78 ? 160  THR A CG2 1 
ATOM   1182 N N   . MET A 1 181 ? -8.661  5.581   63.867 1.00 17.25 ? 161  MET A N   1 
ATOM   1183 C CA  . MET A 1 181 ? -7.518  6.248   64.503 1.00 16.65 ? 161  MET A CA  1 
ATOM   1184 C C   . MET A 1 181 ? -6.653  5.353   65.427 1.00 17.32 ? 161  MET A C   1 
ATOM   1185 O O   . MET A 1 181 ? -5.881  5.906   66.212 1.00 17.93 ? 161  MET A O   1 
ATOM   1186 C CB  . MET A 1 181 ? -7.968  7.521   65.305 1.00 17.41 ? 161  MET A CB  1 
ATOM   1187 C CG  . MET A 1 181 ? -8.971  8.516   64.611 1.00 15.48 ? 161  MET A CG  1 
ATOM   1188 S SD  . MET A 1 181 ? -8.501  9.000   62.926 1.00 18.74 ? 161  MET A SD  1 
ATOM   1189 C CE  . MET A 1 181 ? -6.826  9.594   63.230 1.00 14.05 ? 161  MET A CE  1 
ATOM   1190 N N   . GLU A 1 182 ? -6.737  4.012   65.322 1.00 17.71 ? 162  GLU A N   1 
ATOM   1191 C CA  . GLU A 1 182 ? -5.917  3.120   66.172 1.00 18.84 ? 162  GLU A CA  1 
ATOM   1192 C C   . GLU A 1 182 ? -4.453  3.293   65.807 1.00 18.48 ? 162  GLU A C   1 
ATOM   1193 O O   . GLU A 1 182 ? -4.143  3.321   64.611 1.00 19.41 ? 162  GLU A O   1 
ATOM   1194 C CB  . GLU A 1 182 ? -6.251  1.637   65.956 1.00 18.82 ? 162  GLU A CB  1 
ATOM   1195 C CG  . GLU A 1 182 ? -7.708  1.223   66.324 1.00 18.61 ? 162  GLU A CG  1 
ATOM   1196 C CD  . GLU A 1 182 ? -8.673  1.361   65.164 1.00 18.80 ? 162  GLU A CD  1 
ATOM   1197 O OE1 . GLU A 1 182 ? -8.429  2.196   64.261 1.00 19.81 ? 162  GLU A OE1 1 
ATOM   1198 O OE2 . GLU A 1 182 ? -9.695  0.632   65.181 1.00 19.75 ? 162  GLU A OE2 1 
ATOM   1199 N N   . VAL A 1 183 ? -3.563  3.362   66.817 1.00 18.28 ? 163  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 183 ? -2.126  3.525   66.580 1.00 18.21 ? 163  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 183 ? -1.411  2.177   66.721 1.00 18.08 ? 163  VAL A C   1 
ATOM   1202 O O   . VAL A 1 183 ? -1.542  1.496   67.750 1.00 18.46 ? 163  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 183 ? -1.506  4.611   67.541 1.00 19.68 ? 163  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 183 ? 0.018   4.809   67.324 1.00 18.21 ? 163  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 183 ? -2.235  5.961   67.405 1.00 19.31 ? 163  VAL A CG2 1 
ATOM   1206 N N   . HIS A 1 184 ? -0.630  1.816   65.704 1.00 17.90 ? 164  HIS A N   1 
ATOM   1207 C CA  . HIS A 1 184 ? 0.203   0.619   65.734 1.00 17.92 ? 164  HIS A CA  1 
ATOM   1208 C C   . HIS A 1 184 ? 1.334   0.699   66.801 1.00 18.32 ? 164  HIS A C   1 
ATOM   1209 O O   . HIS A 1 184 ? 1.851   1.782   67.111 1.00 20.15 ? 164  HIS A O   1 
ATOM   1210 C CB  . HIS A 1 184 ? 0.926   0.432   64.371 1.00 17.05 ? 164  HIS A CB  1 
ATOM   1211 C CG  . HIS A 1 184 ? 0.057   0.133   63.184 1.00 16.12 ? 164  HIS A CG  1 
ATOM   1212 N ND1 . HIS A 1 184 ? -0.989  -0.771  63.211 1.00 18.34 ? 164  HIS A ND1 1 
ATOM   1213 C CD2 . HIS A 1 184 ? 0.182   0.520   61.890 1.00 16.27 ? 164  HIS A CD2 1 
ATOM   1214 C CE1 . HIS A 1 184 ? -1.518  -0.863  62.002 1.00 16.95 ? 164  HIS A CE1 1 
ATOM   1215 N NE2 . HIS A 1 184 ? -0.813  -0.103  61.176 1.00 17.86 ? 164  HIS A NE2 1 
ATOM   1216 N N   . ASP A 1 185 ? 1.740   -0.457  67.319 1.00 18.49 ? 165  ASP A N   1 
ATOM   1217 C CA  . ASP A 1 185 ? 3.055   -0.631  67.954 1.00 18.70 ? 165  ASP A CA  1 
ATOM   1218 C C   . ASP A 1 185 ? 4.087   -0.979  66.868 1.00 18.46 ? 165  ASP A C   1 
ATOM   1219 O O   . ASP A 1 185 ? 4.413   -2.172  66.625 1.00 16.67 ? 165  ASP A O   1 
ATOM   1220 C CB  . ASP A 1 185 ? 2.958   -1.720  69.020 1.00 18.21 ? 165  ASP A CB  1 
ATOM   1221 C CG  . ASP A 1 185 ? 4.249   -1.881  69.851 1.00 19.56 ? 165  ASP A CG  1 
ATOM   1222 O OD1 . ASP A 1 185 ? 5.317   -1.296  69.497 1.00 18.47 ? 165  ASP A OD1 1 
ATOM   1223 O OD2 . ASP A 1 185 ? 4.181   -2.642  70.847 1.00 18.04 ? 165  ASP A OD2 1 
ATOM   1224 N N   . VAL A 1 186 ? 4.638   0.068   66.232 1.00 18.96 ? 166  VAL A N   1 
ATOM   1225 C CA  . VAL A 1 186 ? 5.487   -0.115  65.056 1.00 18.95 ? 166  VAL A CA  1 
ATOM   1226 C C   . VAL A 1 186 ? 6.775   -0.915  65.389 1.00 19.55 ? 166  VAL A C   1 
ATOM   1227 O O   . VAL A 1 186 ? 7.053   -1.933  64.736 1.00 20.40 ? 166  VAL A O   1 
ATOM   1228 C CB  . VAL A 1 186 ? 5.785   1.207   64.306 1.00 19.02 ? 166  VAL A CB  1 
ATOM   1229 C CG1 . VAL A 1 186 ? 6.987   1.020   63.369 1.00 20.64 ? 166  VAL A CG1 1 
ATOM   1230 C CG2 . VAL A 1 186 ? 4.571   1.588   63.497 1.00 17.63 ? 166  VAL A CG2 1 
ATOM   1231 N N   . PRO A 1 187 ? 7.499   -0.520  66.455 1.00 19.66 ? 167  PRO A N   1 
ATOM   1232 C CA  . PRO A 1 187 ? 8.685   -1.320  66.846 1.00 19.97 ? 167  PRO A CA  1 
ATOM   1233 C C   . PRO A 1 187 ? 8.407   -2.819  67.014 1.00 19.43 ? 167  PRO A C   1 
ATOM   1234 O O   . PRO A 1 187 ? 9.174   -3.641  66.503 1.00 20.20 ? 167  PRO A O   1 
ATOM   1235 C CB  . PRO A 1 187 ? 9.119   -0.666  68.170 1.00 19.72 ? 167  PRO A CB  1 
ATOM   1236 C CG  . PRO A 1 187 ? 8.627   0.738   68.034 1.00 21.11 ? 167  PRO A CG  1 
ATOM   1237 C CD  . PRO A 1 187 ? 7.302   0.622   67.368 1.00 19.60 ? 167  PRO A CD  1 
ATOM   1238 N N   . ALA A 1 188 ? 7.282   -3.182  67.640 1.00 19.79 ? 168  ALA A N   1 
ATOM   1239 C CA  . ALA A 1 188 ? 6.980   -4.606  67.825 1.00 19.42 ? 168  ALA A CA  1 
ATOM   1240 C C   . ALA A 1 188 ? 6.668   -5.304  66.506 1.00 18.43 ? 168  ALA A C   1 
ATOM   1241 O O   . ALA A 1 188 ? 7.081   -6.444  66.283 1.00 17.78 ? 168  ALA A O   1 
ATOM   1242 C CB  . ALA A 1 188 ? 5.833   -4.801  68.835 1.00 18.56 ? 168  ALA A CB  1 
ATOM   1243 N N   . ILE A 1 189 ? 5.936   -4.627  65.635 1.00 17.51 ? 169  ILE A N   1 
ATOM   1244 C CA  . ILE A 1 189 ? 5.592   -5.199  64.334 1.00 17.30 ? 169  ILE A CA  1 
ATOM   1245 C C   . ILE A 1 189 ? 6.822   -5.389  63.471 1.00 18.09 ? 169  ILE A C   1 
ATOM   1246 O O   . ILE A 1 189 ? 7.001   -6.446  62.901 1.00 18.39 ? 169  ILE A O   1 
ATOM   1247 C CB  . ILE A 1 189 ? 4.617   -4.281  63.576 1.00 17.97 ? 169  ILE A CB  1 
ATOM   1248 C CG1 . ILE A 1 189 ? 3.283   -4.248  64.353 1.00 18.88 ? 169  ILE A CG1 1 
ATOM   1249 C CG2 . ILE A 1 189 ? 4.536   -4.726  62.073 1.00 15.45 ? 169  ILE A CG2 1 
ATOM   1250 C CD1 . ILE A 1 189 ? 2.067   -3.645  63.625 1.00 18.80 ? 169  ILE A CD1 1 
ATOM   1251 N N   . VAL A 1 190 ? 7.654   -4.346  63.376 1.00 19.24 ? 170  VAL A N   1 
ATOM   1252 C CA  . VAL A 1 190 ? 8.898   -4.373  62.585 1.00 19.25 ? 170  VAL A CA  1 
ATOM   1253 C C   . VAL A 1 190 ? 9.816   -5.499  63.064 1.00 20.19 ? 170  VAL A C   1 
ATOM   1254 O O   . VAL A 1 190 ? 10.358  -6.245  62.239 1.00 19.82 ? 170  VAL A O   1 
ATOM   1255 C CB  . VAL A 1 190 ? 9.660   -3.014  62.610 1.00 19.58 ? 170  VAL A CB  1 
ATOM   1256 C CG1 . VAL A 1 190 ? 11.132  -3.161  62.102 1.00 20.64 ? 170  VAL A CG1 1 
ATOM   1257 C CG2 . VAL A 1 190 ? 8.841   -1.952  61.799 1.00 18.35 ? 170  VAL A CG2 1 
ATOM   1258 N N   . ALA A 1 191 ? 9.974   -5.647  64.384 1.00 20.21 ? 171  ALA A N   1 
ATOM   1259 C CA  . ALA A 1 191 ? 10.870  -6.699  64.884 1.00 20.66 ? 171  ALA A CA  1 
ATOM   1260 C C   . ALA A 1 191 ? 10.354  -8.077  64.464 1.00 21.17 ? 171  ALA A C   1 
ATOM   1261 O O   . ALA A 1 191 ? 11.147  -8.965  64.095 1.00 22.07 ? 171  ALA A O   1 
ATOM   1262 C CB  . ALA A 1 191 ? 11.040  -6.613  66.391 1.00 20.00 ? 171  ALA A CB  1 
ATOM   1263 N N   . ALA A 1 192 ? 9.029   -8.258  64.546 1.00 21.38 ? 172  ALA A N   1 
ATOM   1264 C CA  . ALA A 1 192 ? 8.440   -9.539  64.223 1.00 21.63 ? 172  ALA A CA  1 
ATOM   1265 C C   . ALA A 1 192 ? 8.654   -9.809  62.737 1.00 21.74 ? 172  ALA A C   1 
ATOM   1266 O O   . ALA A 1 192 ? 9.216   -10.858 62.382 1.00 21.85 ? 172  ALA A O   1 
ATOM   1267 C CB  . ALA A 1 192 ? 6.942   -9.600  64.621 1.00 21.37 ? 172  ALA A CB  1 
ATOM   1268 N N   . VAL A 1 193 ? 8.245   -8.865  61.880 1.00 20.97 ? 173  VAL A N   1 
ATOM   1269 C CA  . VAL A 1 193 ? 8.451   -9.014  60.441 1.00 21.27 ? 173  VAL A CA  1 
ATOM   1270 C C   . VAL A 1 193 ? 9.891   -9.378  60.090 1.00 21.22 ? 173  VAL A C   1 
ATOM   1271 O O   . VAL A 1 193 ? 10.091  -10.350 59.365 1.00 21.05 ? 173  VAL A O   1 
ATOM   1272 C CB  . VAL A 1 193 ? 8.015   -7.767  59.628 1.00 21.46 ? 173  VAL A CB  1 
ATOM   1273 C CG1 . VAL A 1 193 ? 8.383   -7.941  58.138 1.00 18.81 ? 173  VAL A CG1 1 
ATOM   1274 C CG2 . VAL A 1 193 ? 6.566   -7.498  59.821 1.00 22.06 ? 173  VAL A CG2 1 
ATOM   1275 N N   . ARG A 1 194 ? 10.885  -8.614  60.573 1.00 21.60 ? 174  ARG A N   1 
ATOM   1276 C CA  . ARG A 1 194 ? 12.290  -8.908  60.255 1.00 24.04 ? 174  ARG A CA  1 
ATOM   1277 C C   . ARG A 1 194 ? 12.712  -10.296 60.704 1.00 24.83 ? 174  ARG A C   1 
ATOM   1278 O O   . ARG A 1 194 ? 13.540  -10.905 60.075 1.00 26.02 ? 174  ARG A O   1 
ATOM   1279 C CB  . ARG A 1 194 ? 13.265  -7.881  60.858 1.00 23.17 ? 174  ARG A CB  1 
ATOM   1280 C CG  . ARG A 1 194 ? 13.064  -6.456  60.407 1.00 25.80 ? 174  ARG A CG  1 
ATOM   1281 C CD  . ARG A 1 194 ? 13.201  -6.358  58.938 1.00 28.79 ? 174  ARG A CD  1 
ATOM   1282 N NE  . ARG A 1 194 ? 12.911  -5.017  58.439 1.00 30.93 ? 174  ARG A NE  1 
ATOM   1283 C CZ  . ARG A 1 194 ? 12.481  -4.783  57.206 1.00 31.53 ? 174  ARG A CZ  1 
ATOM   1284 N NH1 . ARG A 1 194 ? 12.291  -5.827  56.392 1.00 30.25 ? 174  ARG A NH1 1 
ATOM   1285 N NH2 . ARG A 1 194 ? 12.220  -3.525  56.811 1.00 29.82 ? 174  ARG A NH2 1 
ATOM   1286 N N   . SER A 1 195 ? 12.151  -10.798 61.792 1.00 26.07 ? 175  SER A N   1 
ATOM   1287 C CA  . SER A 1 195 ? 12.590  -12.092 62.307 1.00 27.10 ? 175  SER A CA  1 
ATOM   1288 C C   . SER A 1 195 ? 12.058  -13.242 61.468 1.00 27.10 ? 175  SER A C   1 
ATOM   1289 O O   . SER A 1 195 ? 12.624  -14.327 61.495 1.00 28.57 ? 175  SER A O   1 
ATOM   1290 C CB  . SER A 1 195 ? 12.131  -12.280 63.749 1.00 27.51 ? 175  SER A CB  1 
ATOM   1291 O OG  . SER A 1 195 ? 10.745  -12.603 63.788 1.00 26.36 ? 175  SER A OG  1 
ATOM   1292 N N   . VAL A 1 196 ? 10.974  -13.020 60.732 1.00 26.79 ? 176  VAL A N   1 
ATOM   1293 C CA  . VAL A 1 196 ? 10.290  -14.106 60.035 1.00 26.31 ? 176  VAL A CA  1 
ATOM   1294 C C   . VAL A 1 196 ? 10.415  -13.976 58.523 1.00 26.47 ? 176  VAL A C   1 
ATOM   1295 O O   . VAL A 1 196 ? 10.747  -14.959 57.840 1.00 26.09 ? 176  VAL A O   1 
ATOM   1296 C CB  . VAL A 1 196 ? 8.808   -14.192 60.456 1.00 27.15 ? 176  VAL A CB  1 
ATOM   1297 C CG1 . VAL A 1 196 ? 8.027   -15.156 59.567 1.00 27.23 ? 176  VAL A CG1 1 
ATOM   1298 C CG2 . VAL A 1 196 ? 8.679   -14.559 61.959 1.00 26.79 ? 176  VAL A CG2 1 
ATOM   1299 N N   . VAL A 1 197 ? 10.152  -12.779 57.992 1.00 24.69 ? 177  VAL A N   1 
ATOM   1300 C CA  . VAL A 1 197 ? 10.318  -12.535 56.569 1.00 25.53 ? 177  VAL A CA  1 
ATOM   1301 C C   . VAL A 1 197 ? 11.244  -11.346 56.328 1.00 25.13 ? 177  VAL A C   1 
ATOM   1302 O O   . VAL A 1 197 ? 10.781  -10.252 55.987 1.00 24.59 ? 177  VAL A O   1 
ATOM   1303 C CB  . VAL A 1 197 ? 8.961   -12.318 55.865 1.00 25.77 ? 177  VAL A CB  1 
ATOM   1304 C CG1 . VAL A 1 197 ? 8.229   -13.664 55.686 1.00 25.74 ? 177  VAL A CG1 1 
ATOM   1305 C CG2 . VAL A 1 197 ? 8.095   -11.318 56.662 1.00 25.68 ? 177  VAL A CG2 1 
ATOM   1306 N N   . PRO A 1 198 ? 12.568  -11.562 56.484 1.00 25.69 ? 178  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 198 ? 13.468  -10.424 56.358 1.00 25.62 ? 178  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 198 ? 13.413  -9.761  54.964 1.00 24.46 ? 178  PRO A C   1 
ATOM   1309 O O   . PRO A 1 198 ? 13.685  -8.586  54.857 1.00 25.40 ? 178  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 198 ? 14.849  -11.032 56.668 1.00 25.54 ? 178  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 198 ? 14.728  -12.470 56.369 1.00 26.06 ? 178  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 198 ? 13.305  -12.809 56.762 1.00 25.94 ? 178  PRO A CD  1 
ATOM   1313 N N   . ASP A 1 199 ? 13.041  -10.499 53.923 1.00 24.12 ? 179  ASP A N   1 
ATOM   1314 C CA  . ASP A 1 199 ? 12.945  -9.925  52.571 1.00 23.49 ? 179  ASP A CA  1 
ATOM   1315 C C   . ASP A 1 199 ? 11.724  -9.023  52.335 1.00 22.77 ? 179  ASP A C   1 
ATOM   1316 O O   . ASP A 1 199 ? 11.666  -8.337  51.296 1.00 22.32 ? 179  ASP A O   1 
ATOM   1317 C CB  . ASP A 1 199 ? 12.974  -11.020 51.505 1.00 23.88 ? 179  ASP A CB  1 
ATOM   1318 C CG  . ASP A 1 199 ? 14.319  -11.748 51.440 1.00 26.20 ? 179  ASP A CG  1 
ATOM   1319 O OD1 . ASP A 1 199 ? 15.372  -11.082 51.550 1.00 26.57 ? 179  ASP A OD1 1 
ATOM   1320 O OD2 . ASP A 1 199 ? 14.303  -12.977 51.279 1.00 26.68 ? 179  ASP A OD2 1 
ATOM   1321 N N   . ALA A 1 200 ? 10.759  -9.022  53.272 1.00 21.89 ? 180  ALA A N   1 
ATOM   1322 C CA  . ALA A 1 200 ? 9.580   -8.198  53.122 1.00 20.41 ? 180  ALA A CA  1 
ATOM   1323 C C   . ALA A 1 200 ? 9.891   -6.691  53.089 1.00 19.73 ? 180  ALA A C   1 
ATOM   1324 O O   . ALA A 1 200 ? 10.780  -6.205  53.766 1.00 18.85 ? 180  ALA A O   1 
ATOM   1325 C CB  . ALA A 1 200 ? 8.486   -8.509  54.168 1.00 20.91 ? 180  ALA A CB  1 
ATOM   1326 N N   . ILE A 1 201 ? 9.092   -5.970  52.317 1.00 19.18 ? 181  ILE A N   1 
ATOM   1327 C CA  . ILE A 1 201 ? 9.158   -4.521  52.304 1.00 19.39 ? 181  ILE A CA  1 
ATOM   1328 C C   . ILE A 1 201 ? 8.093   -4.007  53.261 1.00 19.16 ? 181  ILE A C   1 
ATOM   1329 O O   . ILE A 1 201 ? 6.922   -4.298  53.088 1.00 19.80 ? 181  ILE A O   1 
ATOM   1330 C CB  . ILE A 1 201 ? 8.893   -3.960  50.883 1.00 19.83 ? 181  ILE A CB  1 
ATOM   1331 C CG1 . ILE A 1 201 ? 9.709   -4.740  49.825 1.00 19.68 ? 181  ILE A CG1 1 
ATOM   1332 C CG2 . ILE A 1 201 ? 9.018   -2.402  50.857 1.00 18.80 ? 181  ILE A CG2 1 
ATOM   1333 C CD1 . ILE A 1 201 ? 11.228  -4.742  50.075 1.00 22.01 ? 181  ILE A CD1 1 
ATOM   1334 N N   . ILE A 1 202 ? 8.501   -3.251  54.274 1.00 19.16 ? 182  ILE A N   1 
ATOM   1335 C CA  . ILE A 1 202 ? 7.531   -2.689  55.213 1.00 18.15 ? 182  ILE A CA  1 
ATOM   1336 C C   . ILE A 1 202 ? 7.257   -1.253  54.787 1.00 18.40 ? 182  ILE A C   1 
ATOM   1337 O O   . ILE A 1 202 ? 8.200   -0.449  54.652 1.00 18.97 ? 182  ILE A O   1 
ATOM   1338 C CB  . ILE A 1 202 ? 8.023   -2.694  56.651 1.00 18.20 ? 182  ILE A CB  1 
ATOM   1339 C CG1 . ILE A 1 202 ? 8.564   -4.092  57.027 1.00 17.94 ? 182  ILE A CG1 1 
ATOM   1340 C CG2 . ILE A 1 202 ? 6.876   -2.236  57.610 1.00 17.60 ? 182  ILE A CG2 1 
ATOM   1341 C CD1 . ILE A 1 202 ? 9.101   -4.208  58.482 1.00 18.11 ? 182  ILE A CD1 1 
ATOM   1342 N N   . MET A 1 203 ? 5.969   -0.944  54.613 1.00 17.65 ? 183  MET A N   1 
ATOM   1343 C CA  . MET A 1 203 ? 5.527   0.348   54.092 1.00 18.31 ? 183  MET A CA  1 
ATOM   1344 C C   . MET A 1 203 ? 4.584   0.937   55.089 1.00 17.23 ? 183  MET A C   1 
ATOM   1345 O O   . MET A 1 203 ? 3.942   0.198   55.821 1.00 18.21 ? 183  MET A O   1 
ATOM   1346 C CB  . MET A 1 203 ? 4.768   0.194   52.777 1.00 17.26 ? 183  MET A CB  1 
ATOM   1347 C CG  . MET A 1 203 ? 5.570   -0.534  51.729 1.00 20.24 ? 183  MET A CG  1 
ATOM   1348 S SD  . MET A 1 203 ? 4.828   -0.347  50.099 1.00 20.88 ? 183  MET A SD  1 
ATOM   1349 C CE  . MET A 1 203 ? 6.081   -1.166  49.100 1.00 22.18 ? 183  MET A CE  1 
ATOM   1350 N N   . ILE A 1 204 ? 4.513   2.262   55.137 1.00 16.98 ? 184  ILE A N   1 
ATOM   1351 C CA  . ILE A 1 204 ? 3.505   2.900   55.966 1.00 17.71 ? 184  ILE A CA  1 
ATOM   1352 C C   . ILE A 1 204 ? 2.842   4.058   55.226 1.00 17.36 ? 184  ILE A C   1 
ATOM   1353 O O   . ILE A 1 204 ? 3.510   4.812   54.553 1.00 18.27 ? 184  ILE A O   1 
ATOM   1354 C CB  . ILE A 1 204 ? 4.082   3.339   57.350 1.00 17.40 ? 184  ILE A CB  1 
ATOM   1355 C CG1 . ILE A 1 204 ? 2.953   3.903   58.234 1.00 18.67 ? 184  ILE A CG1 1 
ATOM   1356 C CG2 . ILE A 1 204 ? 5.185   4.417   57.201 1.00 17.82 ? 184  ILE A CG2 1 
ATOM   1357 C CD1 . ILE A 1 204 ? 3.259   3.967   59.744 1.00 19.93 ? 184  ILE A CD1 1 
ATOM   1358 N N   . ASP A 1 205 ? 1.522   4.181   55.337 1.00 16.30 ? 185  ASP A N   1 
ATOM   1359 C CA  . ASP A 1 205 ? 0.873   5.425   54.980 1.00 16.36 ? 185  ASP A CA  1 
ATOM   1360 C C   . ASP A 1 205 ? 0.959   6.363   56.194 1.00 15.71 ? 185  ASP A C   1 
ATOM   1361 O O   . ASP A 1 205 ? 0.196   6.252   57.181 1.00 17.04 ? 185  ASP A O   1 
ATOM   1362 C CB  . ASP A 1 205 ? -0.600  5.183   54.608 1.00 15.65 ? 185  ASP A CB  1 
ATOM   1363 C CG  . ASP A 1 205 ? -1.258  6.442   54.069 1.00 16.46 ? 185  ASP A CG  1 
ATOM   1364 O OD1 . ASP A 1 205 ? -0.905  7.577   54.524 1.00 13.17 ? 185  ASP A OD1 1 
ATOM   1365 O OD2 . ASP A 1 205 ? -2.088  6.294   53.134 1.00 19.34 ? 185  ASP A OD2 1 
ATOM   1366 N N   . ASN A 1 206 ? 1.890   7.300   56.103 1.00 13.69 ? 186  ASN A N   1 
ATOM   1367 C CA  . ASN A 1 206 ? 2.282   8.155   57.215 1.00 13.52 ? 186  ASN A CA  1 
ATOM   1368 C C   . ASN A 1 206 ? 1.736   9.574   57.054 1.00 14.76 ? 186  ASN A C   1 
ATOM   1369 O O   . ASN A 1 206 ? 2.317   10.553  57.505 1.00 13.05 ? 186  ASN A O   1 
ATOM   1370 C CB  . ASN A 1 206 ? 3.815   8.211   57.193 1.00 13.59 ? 186  ASN A CB  1 
ATOM   1371 C CG  . ASN A 1 206 ? 4.455   8.622   58.542 1.00 17.29 ? 186  ASN A CG  1 
ATOM   1372 O OD1 . ASN A 1 206 ? 5.692   8.914   58.567 1.00 17.29 ? 186  ASN A OD1 1 
ATOM   1373 N ND2 . ASN A 1 206 ? 3.709   8.601   59.636 1.00 11.44 ? 186  ASN A ND2 1 
ATOM   1374 N N   . THR A 1 207 ? 0.572   9.691   56.404 1.00 11.69 ? 187  THR A N   1 
ATOM   1375 C CA  . THR A 1 207 ? 0.027   10.988  56.050 1.00 15.17 ? 187  THR A CA  1 
ATOM   1376 C C   . THR A 1 207 ? -0.435  11.771  57.311 1.00 16.10 ? 187  THR A C   1 
ATOM   1377 O O   . THR A 1 207 ? -0.176  12.987  57.457 1.00 16.36 ? 187  THR A O   1 
ATOM   1378 C CB  . THR A 1 207 ? -1.219  10.773  55.127 1.00 12.91 ? 187  THR A CB  1 
ATOM   1379 O OG1 . THR A 1 207 ? -0.841  10.119  53.902 1.00 13.75 ? 187  THR A OG1 1 
ATOM   1380 C CG2 . THR A 1 207 ? -1.895  12.107  54.753 1.00 16.40 ? 187  THR A CG2 1 
ATOM   1381 N N   . TRP A 1 208 ? -1.104  11.074  58.242 1.00 17.02 ? 188  TRP A N   1 
ATOM   1382 C CA  . TRP A 1 208 ? -1.630  11.733  59.442 1.00 17.44 ? 188  TRP A CA  1 
ATOM   1383 C C   . TRP A 1 208 ? -0.513  12.471  60.182 1.00 17.52 ? 188  TRP A C   1 
ATOM   1384 O O   . TRP A 1 208 ? -0.700  13.586  60.655 1.00 17.95 ? 188  TRP A O   1 
ATOM   1385 C CB  . TRP A 1 208 ? -2.336  10.715  60.352 1.00 18.51 ? 188  TRP A CB  1 
ATOM   1386 C CG  . TRP A 1 208 ? -3.036  11.311  61.592 1.00 16.78 ? 188  TRP A CG  1 
ATOM   1387 C CD1 . TRP A 1 208 ? -4.377  11.670  61.705 1.00 19.26 ? 188  TRP A CD1 1 
ATOM   1388 C CD2 . TRP A 1 208 ? -2.447  11.552  62.877 1.00 18.88 ? 188  TRP A CD2 1 
ATOM   1389 N NE1 . TRP A 1 208 ? -4.629  12.125  62.986 1.00 17.38 ? 188  TRP A NE1 1 
ATOM   1390 C CE2 . TRP A 1 208 ? -3.463  12.055  63.722 1.00 17.24 ? 188  TRP A CE2 1 
ATOM   1391 C CE3 . TRP A 1 208 ? -1.140  11.380  63.407 1.00 17.74 ? 188  TRP A CE3 1 
ATOM   1392 C CZ2 . TRP A 1 208 ? -3.225  12.398  65.058 1.00 16.93 ? 188  TRP A CZ2 1 
ATOM   1393 C CZ3 . TRP A 1 208 ? -0.908  11.701  64.732 1.00 18.96 ? 188  TRP A CZ3 1 
ATOM   1394 C CH2 . TRP A 1 208 ? -1.934  12.229  65.548 1.00 17.60 ? 188  TRP A CH2 1 
ATOM   1395 N N   . ALA A 1 209 ? 0.661   11.851  60.219 1.00 17.78 ? 189  ALA A N   1 
ATOM   1396 C CA  . ALA A 1 209 ? 1.828   12.442  60.852 1.00 17.34 ? 189  ALA A CA  1 
ATOM   1397 C C   . ALA A 1 209 ? 2.599   13.497  59.994 1.00 18.22 ? 189  ALA A C   1 
ATOM   1398 O O   . ALA A 1 209 ? 3.616   14.071  60.458 1.00 17.41 ? 189  ALA A O   1 
ATOM   1399 C CB  . ALA A 1 209 ? 2.802   11.304  61.381 1.00 18.26 ? 189  ALA A CB  1 
ATOM   1400 N N   . ALA A 1 210 ? 2.135   13.724  58.766 1.00 17.84 ? 190  ALA A N   1 
ATOM   1401 C CA  . ALA A 1 210 ? 2.756   14.627  57.789 1.00 18.52 ? 190  ALA A CA  1 
ATOM   1402 C C   . ALA A 1 210 ? 4.209   14.214  57.578 1.00 18.85 ? 190  ALA A C   1 
ATOM   1403 O O   . ALA A 1 210 ? 5.040   15.050  57.283 1.00 18.58 ? 190  ALA A O   1 
ATOM   1404 C CB  . ALA A 1 210 ? 2.670   16.108  58.214 1.00 17.03 ? 190  ALA A CB  1 
ATOM   1405 N N   . GLY A 1 211 ? 4.482   12.928  57.770 1.00 19.69 ? 191  GLY A N   1 
ATOM   1406 C CA  . GLY A 1 211 ? 5.860   12.410  57.706 1.00 19.03 ? 191  GLY A CA  1 
ATOM   1407 C C   . GLY A 1 211 ? 6.795   12.871  58.824 1.00 20.78 ? 191  GLY A C   1 
ATOM   1408 O O   . GLY A 1 211 ? 7.790   12.232  59.071 1.00 21.43 ? 191  GLY A O   1 
ATOM   1409 N N   . VAL A 1 212 ? 6.508   13.971  59.506 1.00 19.97 ? 192  VAL A N   1 
ATOM   1410 C CA  . VAL A 1 212 ? 7.493   14.507  60.458 1.00 20.21 ? 192  VAL A CA  1 
ATOM   1411 C C   . VAL A 1 212 ? 7.146   14.257  61.922 1.00 19.48 ? 192  VAL A C   1 
ATOM   1412 O O   . VAL A 1 212 ? 8.030   14.287  62.768 1.00 21.46 ? 192  VAL A O   1 
ATOM   1413 C CB  . VAL A 1 212 ? 7.799   16.025  60.226 1.00 20.42 ? 192  VAL A CB  1 
ATOM   1414 C CG1 . VAL A 1 212 ? 8.392   16.278  58.819 1.00 20.29 ? 192  VAL A CG1 1 
ATOM   1415 C CG2 . VAL A 1 212 ? 6.517   16.841  60.481 1.00 20.09 ? 192  VAL A CG2 1 
ATOM   1416 N N   . LEU A 1 213 ? 5.873   14.010  62.248 1.00 19.15 ? 193  LEU A N   1 
ATOM   1417 C CA  . LEU A 1 213 ? 5.548   13.678  63.649 1.00 18.13 ? 193  LEU A CA  1 
ATOM   1418 C C   . LEU A 1 213 ? 5.879   12.210  63.998 1.00 18.34 ? 193  LEU A C   1 
ATOM   1419 O O   . LEU A 1 213 ? 5.861   11.816  65.145 1.00 18.63 ? 193  LEU A O   1 
ATOM   1420 C CB  . LEU A 1 213 ? 4.073   13.987  63.960 1.00 16.94 ? 193  LEU A CB  1 
ATOM   1421 C CG  . LEU A 1 213 ? 3.662   15.409  63.613 1.00 17.55 ? 193  LEU A CG  1 
ATOM   1422 C CD1 . LEU A 1 213 ? 2.140   15.573  63.886 1.00 19.61 ? 193  LEU A CD1 1 
ATOM   1423 C CD2 . LEU A 1 213 ? 4.513   16.454  64.324 1.00 18.98 ? 193  LEU A CD2 1 
ATOM   1424 N N   . PHE A 1 214 ? 6.172   11.401  62.995 1.00 19.33 ? 194  PHE A N   1 
ATOM   1425 C CA  . PHE A 1 214 ? 6.548   10.003  63.224 1.00 18.88 ? 194  PHE A CA  1 
ATOM   1426 C C   . PHE A 1 214 ? 7.606   9.640   62.204 1.00 19.86 ? 194  PHE A C   1 
ATOM   1427 O O   . PHE A 1 214 ? 7.320   9.551   60.988 1.00 18.93 ? 194  PHE A O   1 
ATOM   1428 C CB  . PHE A 1 214 ? 5.348   9.075   63.078 1.00 19.42 ? 194  PHE A CB  1 
ATOM   1429 C CG  . PHE A 1 214 ? 5.708   7.597   63.183 1.00 17.68 ? 194  PHE A CG  1 
ATOM   1430 C CD1 . PHE A 1 214 ? 6.109   7.033   64.412 1.00 16.62 ? 194  PHE A CD1 1 
ATOM   1431 C CD2 . PHE A 1 214 ? 5.674   6.786   62.047 1.00 16.82 ? 194  PHE A CD2 1 
ATOM   1432 C CE1 . PHE A 1 214 ? 6.459   5.652   64.542 1.00 17.48 ? 194  PHE A CE1 1 
ATOM   1433 C CE2 . PHE A 1 214 ? 5.996   5.381   62.128 1.00 17.75 ? 194  PHE A CE2 1 
ATOM   1434 C CZ  . PHE A 1 214 ? 6.405   4.800   63.387 1.00 16.73 ? 194  PHE A CZ  1 
ATOM   1435 N N   . LYS A 1 215 ? 8.837   9.469   62.683 1.00 20.48 ? 195  LYS A N   1 
ATOM   1436 C CA  . LYS A 1 215 ? 9.995   9.300   61.782 1.00 21.05 ? 195  LYS A CA  1 
ATOM   1437 C C   . LYS A 1 215 ? 10.139  7.838   61.347 1.00 19.38 ? 195  LYS A C   1 
ATOM   1438 O O   . LYS A 1 215 ? 11.053  7.135   61.784 1.00 18.65 ? 195  LYS A O   1 
ATOM   1439 C CB  . LYS A 1 215 ? 11.286  9.807   62.458 1.00 21.82 ? 195  LYS A CB  1 
ATOM   1440 C CG  . LYS A 1 215 ? 11.393  11.341  62.502 1.00 26.94 ? 195  LYS A CG  1 
ATOM   1441 C CD  . LYS A 1 215 ? 11.524  11.973  61.106 1.00 32.85 ? 195  LYS A CD  1 
ATOM   1442 C CE  . LYS A 1 215 ? 12.975  12.459  60.811 1.00 37.02 ? 195  LYS A CE  1 
ATOM   1443 N NZ  . LYS A 1 215 ? 14.121  11.465  60.964 1.00 37.94 ? 195  LYS A NZ  1 
ATOM   1444 N N   . ALA A 1 216 ? 9.213   7.419   60.481 1.00 17.04 ? 196  ALA A N   1 
ATOM   1445 C CA  . ALA A 1 216 ? 8.971   6.022   60.110 1.00 16.90 ? 196  ALA A CA  1 
ATOM   1446 C C   . ALA A 1 216 ? 10.268  5.294   59.735 1.00 16.62 ? 196  ALA A C   1 
ATOM   1447 O O   . ALA A 1 216 ? 10.478  4.136   60.120 1.00 17.18 ? 196  ALA A O   1 
ATOM   1448 C CB  . ALA A 1 216 ? 8.042   5.996   58.914 1.00 18.15 ? 196  ALA A CB  1 
ATOM   1449 N N   . LEU A 1 217 ? 11.083  5.931   58.916 1.00 18.06 ? 197  LEU A N   1 
ATOM   1450 C CA  . LEU A 1 217 ? 12.364  5.246   58.479 1.00 19.16 ? 197  LEU A CA  1 
ATOM   1451 C C   . LEU A 1 217 ? 13.331  4.995   59.618 1.00 21.08 ? 197  LEU A C   1 
ATOM   1452 O O   . LEU A 1 217 ? 14.195  4.077   59.540 1.00 20.49 ? 197  LEU A O   1 
ATOM   1453 C CB  . LEU A 1 217 ? 13.031  5.978   57.298 1.00 20.15 ? 197  LEU A CB  1 
ATOM   1454 C CG  . LEU A 1 217 ? 12.506  5.721   55.869 1.00 22.08 ? 197  LEU A CG  1 
ATOM   1455 C CD1 . LEU A 1 217 ? 11.022  5.506   55.751 1.00 23.13 ? 197  LEU A CD1 1 
ATOM   1456 C CD2 . LEU A 1 217 ? 12.933  6.840   54.915 1.00 23.63 ? 197  LEU A CD2 1 
ATOM   1457 N N   . ASP A 1 218 ? 13.213  5.783   60.686 1.00 21.52 ? 198  ASP A N   1 
ATOM   1458 C CA  . ASP A 1 218 ? 14.051  5.547   61.881 1.00 22.02 ? 198  ASP A CA  1 
ATOM   1459 C C   . ASP A 1 218 ? 13.555  4.356   62.662 1.00 22.12 ? 198  ASP A C   1 
ATOM   1460 O O   . ASP A 1 218 ? 14.250  3.849   63.522 1.00 23.62 ? 198  ASP A O   1 
ATOM   1461 C CB  . ASP A 1 218 ? 14.102  6.773   62.804 1.00 23.20 ? 198  ASP A CB  1 
ATOM   1462 C CG  . ASP A 1 218 ? 14.842  7.970   62.182 1.00 26.12 ? 198  ASP A CG  1 
ATOM   1463 O OD1 . ASP A 1 218 ? 15.333  7.865   61.038 1.00 27.87 ? 198  ASP A OD1 1 
ATOM   1464 O OD2 . ASP A 1 218 ? 14.907  9.033   62.845 1.00 28.00 ? 198  ASP A OD2 1 
ATOM   1465 N N   . PHE A 1 219 ? 12.333  3.902   62.393 1.00 21.86 ? 199  PHE A N   1 
ATOM   1466 C CA  . PHE A 1 219 ? 11.792  2.724   63.096 1.00 21.46 ? 199  PHE A CA  1 
ATOM   1467 C C   . PHE A 1 219 ? 12.021  1.432   62.320 1.00 21.56 ? 199  PHE A C   1 
ATOM   1468 O O   . PHE A 1 219 ? 11.532  0.387   62.725 1.00 22.62 ? 199  PHE A O   1 
ATOM   1469 C CB  . PHE A 1 219 ? 10.299  2.918   63.431 1.00 21.16 ? 199  PHE A CB  1 
ATOM   1470 C CG  . PHE A 1 219 ? 10.062  3.903   64.540 1.00 21.14 ? 199  PHE A CG  1 
ATOM   1471 C CD1 . PHE A 1 219 ? 10.150  5.265   64.308 1.00 24.80 ? 199  PHE A CD1 1 
ATOM   1472 C CD2 . PHE A 1 219 ? 9.825   3.458   65.833 1.00 24.20 ? 199  PHE A CD2 1 
ATOM   1473 C CE1 . PHE A 1 219 ? 9.976   6.182   65.335 1.00 25.29 ? 199  PHE A CE1 1 
ATOM   1474 C CE2 . PHE A 1 219 ? 9.637   4.349   66.872 1.00 25.25 ? 199  PHE A CE2 1 
ATOM   1475 C CZ  . PHE A 1 219 ? 9.713   5.726   66.625 1.00 26.93 ? 199  PHE A CZ  1 
ATOM   1476 N N   . GLY A 1 220 ? 12.801  1.483   61.239 1.00 20.93 ? 200  GLY A N   1 
ATOM   1477 C CA  . GLY A 1 220 ? 13.032  0.292   60.428 1.00 21.38 ? 200  GLY A CA  1 
ATOM   1478 C C   . GLY A 1 220 ? 11.990  0.033   59.325 1.00 20.60 ? 200  GLY A C   1 
ATOM   1479 O O   . GLY A 1 220 ? 11.993  -1.028  58.713 1.00 21.17 ? 200  GLY A O   1 
ATOM   1480 N N   . ILE A 1 221 ? 11.136  1.008   59.037 1.00 20.73 ? 201  ILE A N   1 
ATOM   1481 C CA  . ILE A 1 221 ? 10.149  0.896   57.924 1.00 19.43 ? 201  ILE A CA  1 
ATOM   1482 C C   . ILE A 1 221 ? 10.907  1.229   56.661 1.00 19.70 ? 201  ILE A C   1 
ATOM   1483 O O   . ILE A 1 221 ? 11.828  2.061   56.720 1.00 19.51 ? 201  ILE A O   1 
ATOM   1484 C CB  . ILE A 1 221 ? 8.912   1.825   58.172 1.00 20.15 ? 201  ILE A CB  1 
ATOM   1485 C CG1 . ILE A 1 221 ? 8.056   1.244   59.308 1.00 18.77 ? 201  ILE A CG1 1 
ATOM   1486 C CG2 . ILE A 1 221 ? 8.030   1.982   56.905 1.00 19.30 ? 201  ILE A CG2 1 
ATOM   1487 C CD1 . ILE A 1 221 ? 7.035   2.221   59.897 1.00 20.21 ? 201  ILE A CD1 1 
ATOM   1488 N N   . ASP A 1 222 ? 10.602  0.533   55.556 1.00 18.20 ? 202  ASP A N   1 
ATOM   1489 C CA  . ASP A 1 222 ? 11.318  0.767   54.295 1.00 18.12 ? 202  ASP A CA  1 
ATOM   1490 C C   . ASP A 1 222 ? 10.832  1.974   53.505 1.00 17.98 ? 202  ASP A C   1 
ATOM   1491 O O   . ASP A 1 222 ? 11.654  2.687   52.930 1.00 17.73 ? 202  ASP A O   1 
ATOM   1492 C CB  . ASP A 1 222 ? 11.367  -0.467  53.387 1.00 18.23 ? 202  ASP A CB  1 
ATOM   1493 C CG  . ASP A 1 222 ? 12.017  -1.656  54.060 1.00 18.15 ? 202  ASP A CG  1 
ATOM   1494 O OD1 . ASP A 1 222 ? 13.268  -1.669  54.146 1.00 22.28 ? 202  ASP A OD1 1 
ATOM   1495 O OD2 . ASP A 1 222 ? 11.277  -2.589  54.470 1.00 17.16 ? 202  ASP A OD2 1 
ATOM   1496 N N   . VAL A 1 223 ? 9.512   2.220   53.473 1.00 17.58 ? 203  VAL A N   1 
ATOM   1497 C CA  . VAL A 1 223 ? 8.989   3.251   52.605 1.00 17.85 ? 203  VAL A CA  1 
ATOM   1498 C C   . VAL A 1 223 ? 7.931   3.995   53.409 1.00 17.51 ? 203  VAL A C   1 
ATOM   1499 O O   . VAL A 1 223 ? 7.066   3.370   53.979 1.00 17.26 ? 203  VAL A O   1 
ATOM   1500 C CB  . VAL A 1 223 ? 8.292   2.660   51.350 1.00 18.52 ? 203  VAL A CB  1 
ATOM   1501 C CG1 . VAL A 1 223 ? 7.713   3.780   50.503 1.00 18.58 ? 203  VAL A CG1 1 
ATOM   1502 C CG2 . VAL A 1 223 ? 9.212   1.719   50.533 1.00 18.38 ? 203  VAL A CG2 1 
ATOM   1503 N N   . SER A 1 224 ? 8.068   5.308   53.491 1.00 17.15 ? 204  SER A N   1 
ATOM   1504 C CA  . SER A 1 224 ? 7.101   6.160   54.142 1.00 16.28 ? 204  SER A CA  1 
ATOM   1505 C C   . SER A 1 224 ? 6.312   6.914   53.064 1.00 16.73 ? 204  SER A C   1 
ATOM   1506 O O   . SER A 1 224 ? 6.825   7.781   52.374 1.00 15.24 ? 204  SER A O   1 
ATOM   1507 C CB  . SER A 1 224 ? 7.780   7.122   55.118 1.00 16.99 ? 204  SER A CB  1 
ATOM   1508 O OG  . SER A 1 224 ? 6.821   8.043   55.643 1.00 18.58 ? 204  SER A OG  1 
ATOM   1509 N N   . ILE A 1 225 ? 5.016   6.602   52.952 1.00 15.25 ? 205  ILE A N   1 
ATOM   1510 C CA  . ILE A 1 225 ? 4.154   7.183   51.925 1.00 18.02 ? 205  ILE A CA  1 
ATOM   1511 C C   . ILE A 1 225 ? 3.232   8.281   52.517 1.00 17.52 ? 205  ILE A C   1 
ATOM   1512 O O   . ILE A 1 225 ? 2.790   8.183   53.659 1.00 17.72 ? 205  ILE A O   1 
ATOM   1513 C CB  . ILE A 1 225 ? 3.235   6.053   51.297 1.00 17.47 ? 205  ILE A CB  1 
ATOM   1514 C CG1 . ILE A 1 225 ? 4.078   4.884   50.762 1.00 17.46 ? 205  ILE A CG1 1 
ATOM   1515 C CG2 . ILE A 1 225 ? 2.199   6.606   50.240 1.00 18.40 ? 205  ILE A CG2 1 
ATOM   1516 C CD1 . ILE A 1 225 ? 3.311   3.600   50.562 1.00 15.01 ? 205  ILE A CD1 1 
ATOM   1517 N N   . GLN A 1 226 ? 3.009   9.348   51.751 1.00 17.76 ? 206  GLN A N   1 
ATOM   1518 C CA  . GLN A 1 226 ? 2.104   10.412  52.143 1.00 17.82 ? 206  GLN A CA  1 
ATOM   1519 C C   . GLN A 1 226 ? 1.187   10.815  50.983 1.00 17.94 ? 206  GLN A C   1 
ATOM   1520 O O   . GLN A 1 226 ? 1.590   10.886  49.807 1.00 16.36 ? 206  GLN A O   1 
ATOM   1521 C CB  . GLN A 1 226 ? 2.873   11.650  52.621 1.00 17.80 ? 206  GLN A CB  1 
ATOM   1522 C CG  . GLN A 1 226 ? 3.609   11.534  53.960 1.00 18.67 ? 206  GLN A CG  1 
ATOM   1523 C CD  . GLN A 1 226 ? 3.962   12.929  54.467 1.00 20.67 ? 206  GLN A CD  1 
ATOM   1524 O OE1 . GLN A 1 226 ? 3.082   13.761  54.605 1.00 18.98 ? 206  GLN A OE1 1 
ATOM   1525 N NE2 . GLN A 1 226 ? 5.248   13.206  54.663 1.00 19.00 ? 206  GLN A NE2 1 
ATOM   1526 N N   . ALA A 1 227 ? -0.090  11.013  51.321 1.00 17.82 ? 207  ALA A N   1 
ATOM   1527 C CA  . ALA A 1 227 ? -0.896  11.888  50.533 1.00 17.34 ? 207  ALA A CA  1 
ATOM   1528 C C   . ALA A 1 227 ? -0.457  13.299  50.904 1.00 15.81 ? 207  ALA A C   1 
ATOM   1529 O O   . ALA A 1 227 ? -0.890  13.863  51.906 1.00 16.26 ? 207  ALA A O   1 
ATOM   1530 C CB  . ALA A 1 227 ? -2.391  11.650  50.797 1.00 16.06 ? 207  ALA A CB  1 
ATOM   1531 N N   . ALA A 1 228 ? 0.513   13.829  50.158 1.00 16.69 ? 208  ALA A N   1 
ATOM   1532 C CA  . ALA A 1 228 ? 1.001   15.204  50.369 1.00 16.76 ? 208  ALA A CA  1 
ATOM   1533 C C   . ALA A 1 228 ? -0.076  16.226  50.159 1.00 16.82 ? 208  ALA A C   1 
ATOM   1534 O O   . ALA A 1 228 ? 0.003   17.345  50.685 1.00 18.60 ? 208  ALA A O   1 
ATOM   1535 C CB  . ALA A 1 228 ? 2.286   15.513  49.498 1.00 15.73 ? 208  ALA A CB  1 
ATOM   1536 N N   . THR A 1 229 ? -1.081  15.834  49.392 1.00 16.10 ? 209  THR A N   1 
ATOM   1537 C CA  . THR A 1 229 ? -2.391  16.490  49.387 1.00 16.19 ? 209  THR A CA  1 
ATOM   1538 C C   . THR A 1 229 ? -2.893  17.041  50.733 1.00 16.50 ? 209  THR A C   1 
ATOM   1539 O O   . THR A 1 229 ? -3.565  18.076  50.754 1.00 18.57 ? 209  THR A O   1 
ATOM   1540 C CB  . THR A 1 229 ? -3.417  15.475  48.873 1.00 15.93 ? 209  THR A CB  1 
ATOM   1541 O OG1 . THR A 1 229 ? -2.975  14.898  47.623 1.00 16.43 ? 209  THR A OG1 1 
ATOM   1542 C CG2 . THR A 1 229 ? -4.816  16.113  48.709 1.00 16.49 ? 209  THR A CG2 1 
ATOM   1543 N N   . LYS A 1 230 ? -2.625  16.330  51.819 1.00 16.09 ? 210  LYS A N   1 
ATOM   1544 C CA  . LYS A 1 230 ? -3.057  16.654  53.176 1.00 15.86 ? 210  LYS A CA  1 
ATOM   1545 C C   . LYS A 1 230 ? -2.245  17.770  53.799 1.00 15.92 ? 210  LYS A C   1 
ATOM   1546 O O   . LYS A 1 230 ? -2.279  18.877  53.274 1.00 16.66 ? 210  LYS A O   1 
ATOM   1547 C CB  . LYS A 1 230 ? -3.105  15.388  54.065 1.00 15.11 ? 210  LYS A CB  1 
ATOM   1548 C CG  . LYS A 1 230 ? -4.393  14.518  53.871 1.00 17.74 ? 210  LYS A CG  1 
ATOM   1549 C CD  . LYS A 1 230 ? -4.803  14.382  52.411 1.00 20.54 ? 210  LYS A CD  1 
ATOM   1550 C CE  . LYS A 1 230 ? -5.954  13.368  52.253 1.00 26.50 ? 210  LYS A CE  1 
ATOM   1551 N NZ  . LYS A 1 230 ? -6.469  13.423  50.835 1.00 27.12 ? 210  LYS A NZ  1 
ATOM   1552 N N   . TYR A 1 231 ? -1.496  17.500  54.885 1.00 16.09 ? 211  TYR A N   1 
ATOM   1553 C CA  . TYR A 1 231 ? -0.805  18.560  55.589 1.00 16.38 ? 211  TYR A CA  1 
ATOM   1554 C C   . TYR A 1 231 ? 0.362   19.214  54.885 1.00 16.34 ? 211  TYR A C   1 
ATOM   1555 O O   . TYR A 1 231 ? 0.615   20.369  55.157 1.00 15.38 ? 211  TYR A O   1 
ATOM   1556 C CB  . TYR A 1 231 ? -0.328  18.122  56.983 1.00 17.23 ? 211  TYR A CB  1 
ATOM   1557 C CG  . TYR A 1 231 ? -1.461  17.988  57.943 1.00 20.65 ? 211  TYR A CG  1 
ATOM   1558 C CD1 . TYR A 1 231 ? -2.089  19.113  58.454 1.00 21.36 ? 211  TYR A CD1 1 
ATOM   1559 C CD2 . TYR A 1 231 ? -1.928  16.721  58.312 1.00 22.92 ? 211  TYR A CD2 1 
ATOM   1560 C CE1 . TYR A 1 231 ? -3.170  18.995  59.323 1.00 20.23 ? 211  TYR A CE1 1 
ATOM   1561 C CE2 . TYR A 1 231 ? -2.989  16.585  59.185 1.00 20.23 ? 211  TYR A CE2 1 
ATOM   1562 C CZ  . TYR A 1 231 ? -3.602  17.712  59.685 1.00 22.99 ? 211  TYR A CZ  1 
ATOM   1563 O OH  . TYR A 1 231 ? -4.647  17.562  60.539 1.00 22.28 ? 211  TYR A OH  1 
ATOM   1564 N N   . LEU A 1 232 ? 1.065   18.487  54.009 1.00 16.80 ? 212  LEU A N   1 
ATOM   1565 C CA  . LEU A 1 232 ? 2.189   19.094  53.309 1.00 17.42 ? 212  LEU A CA  1 
ATOM   1566 C C   . LEU A 1 232 ? 1.745   20.305  52.460 1.00 17.28 ? 212  LEU A C   1 
ATOM   1567 O O   . LEU A 1 232 ? 2.240   21.399  52.705 1.00 17.91 ? 212  LEU A O   1 
ATOM   1568 C CB  . LEU A 1 232 ? 3.037   18.094  52.510 1.00 17.84 ? 212  LEU A CB  1 
ATOM   1569 C CG  . LEU A 1 232 ? 3.666   16.960  53.343 1.00 21.28 ? 212  LEU A CG  1 
ATOM   1570 C CD1 . LEU A 1 232 ? 4.579   16.090  52.500 1.00 20.29 ? 212  LEU A CD1 1 
ATOM   1571 C CD2 . LEU A 1 232 ? 4.486   17.518  54.579 1.00 17.23 ? 212  LEU A CD2 1 
ATOM   1572 N N   . VAL A 1 233 ? 0.809   20.117  51.525 1.00 17.47 ? 213  VAL A N   1 
ATOM   1573 C CA  . VAL A 1 233 ? 0.142   21.214  50.810 1.00 18.41 ? 213  VAL A CA  1 
ATOM   1574 C C   . VAL A 1 233 ? -0.582  22.171  51.789 1.00 18.30 ? 213  VAL A C   1 
ATOM   1575 O O   . VAL A 1 233 ? -0.350  23.396  51.736 1.00 18.02 ? 213  VAL A O   1 
ATOM   1576 C CB  . VAL A 1 233 ? -0.849  20.650  49.745 1.00 19.56 ? 213  VAL A CB  1 
ATOM   1577 C CG1 . VAL A 1 233 ? -1.789  21.775  49.164 1.00 17.87 ? 213  VAL A CG1 1 
ATOM   1578 C CG2 . VAL A 1 233 ? -0.074  19.898  48.618 1.00 18.94 ? 213  VAL A CG2 1 
ATOM   1579 N N   . GLY A 1 234 ? -1.513  21.640  52.611 1.00 18.94 ? 214  GLY A N   1 
ATOM   1580 C CA  . GLY A 1 234 ? -2.046  22.334  53.796 1.00 18.35 ? 214  GLY A CA  1 
ATOM   1581 C C   . GLY A 1 234 ? -3.233  23.261  53.505 1.00 18.99 ? 214  GLY A C   1 
ATOM   1582 O O   . GLY A 1 234 ? -3.746  23.941  54.418 1.00 19.06 ? 214  GLY A O   1 
ATOM   1583 N N   . HIS A 1 235 ? -3.644  23.306  52.233 1.00 17.98 ? 215  HIS A N   1 
ATOM   1584 C CA  . HIS A 1 235 ? -4.653  24.262  51.795 1.00 18.21 ? 215  HIS A CA  1 
ATOM   1585 C C   . HIS A 1 235 ? -5.753  23.684  50.914 1.00 18.41 ? 215  HIS A C   1 
ATOM   1586 O O   . HIS A 1 235 ? -6.536  24.458  50.374 1.00 17.93 ? 215  HIS A O   1 
ATOM   1587 C CB  . HIS A 1 235 ? -3.990  25.448  51.065 1.00 17.16 ? 215  HIS A CB  1 
ATOM   1588 C CG  . HIS A 1 235 ? -3.070  26.250  51.919 1.00 15.51 ? 215  HIS A CG  1 
ATOM   1589 N ND1 . HIS A 1 235 ? -1.791  25.831  52.246 1.00 14.94 ? 215  HIS A ND1 1 
ATOM   1590 C CD2 . HIS A 1 235 ? -3.221  27.480  52.473 1.00 15.88 ? 215  HIS A CD2 1 
ATOM   1591 C CE1 . HIS A 1 235 ? -1.213  26.772  52.978 1.00 14.13 ? 215  HIS A CE1 1 
ATOM   1592 N NE2 . HIS A 1 235 ? -2.045  27.796  53.102 1.00 16.13 ? 215  HIS A NE2 1 
ATOM   1593 N N   . SER A 1 236 ? -5.801  22.355  50.778 1.00 18.84 ? 216  SER A N   1 
ATOM   1594 C CA  . SER A 1 236 ? -6.871  21.677  50.036 1.00 20.73 ? 216  SER A CA  1 
ATOM   1595 C C   . SER A 1 236 ? -7.004  22.024  48.546 1.00 20.60 ? 216  SER A C   1 
ATOM   1596 O O   . SER A 1 236 ? -8.125  22.010  48.036 1.00 21.32 ? 216  SER A O   1 
ATOM   1597 C CB  . SER A 1 236 ? -8.220  21.976  50.703 1.00 20.70 ? 216  SER A CB  1 
ATOM   1598 O OG  . SER A 1 236 ? -8.112  21.775  52.106 1.00 27.37 ? 216  SER A OG  1 
ATOM   1599 N N   . ASP A 1 237 ? -5.915  22.365  47.866 1.00 19.78 ? 217  ASP A N   1 
ATOM   1600 C CA  . ASP A 1 237 ? -5.971  22.804  46.454 1.00 20.71 ? 217  ASP A CA  1 
ATOM   1601 C C   . ASP A 1 237 ? -4.887  22.232  45.522 1.00 22.20 ? 217  ASP A C   1 
ATOM   1602 O O   . ASP A 1 237 ? -4.712  22.728  44.364 1.00 25.35 ? 217  ASP A O   1 
ATOM   1603 C CB  . ASP A 1 237 ? -5.892  24.334  46.387 1.00 19.16 ? 217  ASP A CB  1 
ATOM   1604 C CG  . ASP A 1 237 ? -4.560  24.895  46.884 1.00 20.14 ? 217  ASP A CG  1 
ATOM   1605 O OD1 . ASP A 1 237 ? -3.775  24.177  47.526 1.00 17.99 ? 217  ASP A OD1 1 
ATOM   1606 O OD2 . ASP A 1 237 ? -4.317  26.083  46.604 1.00 22.54 ? 217  ASP A OD2 1 
ATOM   1607 N N   . ALA A 1 238 ? -4.063  21.334  46.030 1.00 22.17 ? 218  ALA A N   1 
ATOM   1608 C CA  . ALA A 1 238 ? -3.108  20.602  45.171 1.00 21.18 ? 218  ALA A CA  1 
ATOM   1609 C C   . ALA A 1 238 ? -3.101  19.132  45.582 1.00 19.94 ? 218  ALA A C   1 
ATOM   1610 O O   . ALA A 1 238 ? -3.298  18.821  46.752 1.00 20.09 ? 218  ALA A O   1 
ATOM   1611 C CB  . ALA A 1 238 ? -1.698  21.187  45.207 1.00 20.71 ? 218  ALA A CB  1 
ATOM   1612 N N   . MET A 1 239 ? -2.926  18.244  44.614 1.00 18.20 ? 219  MET A N   1 
ATOM   1613 C CA  . MET A 1 239 ? -2.929  16.803  44.909 1.00 17.46 ? 219  MET A CA  1 
ATOM   1614 C C   . MET A 1 239 ? -1.556  16.283  44.495 1.00 16.85 ? 219  MET A C   1 
ATOM   1615 O O   . MET A 1 239 ? -0.998  16.707  43.457 1.00 15.87 ? 219  MET A O   1 
ATOM   1616 C CB  . MET A 1 239 ? -4.132  16.075  44.243 1.00 18.28 ? 219  MET A CB  1 
ATOM   1617 C CG  . MET A 1 239 ? -5.408  16.677  44.689 1.00 18.92 ? 219  MET A CG  1 
ATOM   1618 S SD  . MET A 1 239 ? -6.785  15.668  44.205 1.00 20.25 ? 219  MET A SD  1 
ATOM   1619 C CE  . MET A 1 239 ? -6.515  14.177  45.234 1.00 15.26 ? 219  MET A CE  1 
ATOM   1620 N N   . ILE A 1 240 ? -1.022  15.395  45.330 1.00 15.80 ? 220  ILE A N   1 
ATOM   1621 C CA  . ILE A 1 240 ? 0.337   14.873  45.145 1.00 16.20 ? 220  ILE A CA  1 
ATOM   1622 C C   . ILE A 1 240 ? 0.549   13.748  46.161 1.00 16.69 ? 220  ILE A C   1 
ATOM   1623 O O   . ILE A 1 240 ? 0.039   13.843  47.328 1.00 16.88 ? 220  ILE A O   1 
ATOM   1624 C CB  . ILE A 1 240 ? 1.323   16.000  45.353 1.00 15.78 ? 220  ILE A CB  1 
ATOM   1625 C CG1 . ILE A 1 240 ? 2.783   15.448  45.381 1.00 14.23 ? 220  ILE A CG1 1 
ATOM   1626 C CG2 . ILE A 1 240 ? 0.881   16.951  46.524 1.00 14.87 ? 220  ILE A CG2 1 
ATOM   1627 C CD1 . ILE A 1 240 ? 3.950   16.574  45.321 1.00 20.96 ? 220  ILE A CD1 1 
ATOM   1628 N N   . GLY A 1 241 ? 1.299   12.712  45.747 1.00 15.73 ? 221  GLY A N   1 
ATOM   1629 C CA  . GLY A 1 241 ? 1.705   11.653  46.680 1.00 15.31 ? 221  GLY A CA  1 
ATOM   1630 C C   . GLY A 1 241 ? 3.222   11.671  46.705 1.00 15.67 ? 221  GLY A C   1 
ATOM   1631 O O   . GLY A 1 241 ? 3.853   12.057  45.705 1.00 14.93 ? 221  GLY A O   1 
ATOM   1632 N N   . THR A 1 242 ? 3.783   11.250  47.835 1.00 15.42 ? 222  THR A N   1 
ATOM   1633 C CA  . THR A 1 242 ? 5.229   11.093  47.977 1.00 15.92 ? 222  THR A CA  1 
ATOM   1634 C C   . THR A 1 242 ? 5.537   9.722   48.585 1.00 16.13 ? 222  THR A C   1 
ATOM   1635 O O   . THR A 1 242 ? 4.749   9.166   49.329 1.00 17.48 ? 222  THR A O   1 
ATOM   1636 C CB  . THR A 1 242 ? 5.796   12.157  48.862 1.00 14.88 ? 222  THR A CB  1 
ATOM   1637 O OG1 . THR A 1 242 ? 5.236   12.095  50.175 1.00 15.30 ? 222  THR A OG1 1 
ATOM   1638 C CG2 . THR A 1 242 ? 5.650   13.509  48.252 1.00 13.79 ? 222  THR A CG2 1 
ATOM   1639 N N   . ALA A 1 243 ? 6.699   9.156   48.269 1.00 17.78 ? 223  ALA A N   1 
ATOM   1640 C CA  . ALA A 1 243 ? 7.091   7.905   48.893 1.00 17.14 ? 223  ALA A CA  1 
ATOM   1641 C C   . ALA A 1 243 ? 8.574   8.086   49.198 1.00 18.04 ? 223  ALA A C   1 
ATOM   1642 O O   . ALA A 1 243 ? 9.366   8.153   48.271 1.00 18.34 ? 223  ALA A O   1 
ATOM   1643 C CB  . ALA A 1 243 ? 6.849   6.740   47.935 1.00 18.55 ? 223  ALA A CB  1 
ATOM   1644 N N   . VAL A 1 244 ? 8.915   8.299   50.471 1.00 17.95 ? 224  VAL A N   1 
ATOM   1645 C CA  . VAL A 1 244 ? 10.333  8.442   50.866 1.00 18.79 ? 224  VAL A CA  1 
ATOM   1646 C C   . VAL A 1 244 ? 10.879  7.061   51.247 1.00 18.86 ? 224  VAL A C   1 
ATOM   1647 O O   . VAL A 1 244 ? 10.313  6.374   52.097 1.00 19.84 ? 224  VAL A O   1 
ATOM   1648 C CB  . VAL A 1 244 ? 10.561  9.444   52.023 1.00 18.31 ? 224  VAL A CB  1 
ATOM   1649 C CG1 . VAL A 1 244 ? 12.057  9.505   52.380 1.00 18.77 ? 224  VAL A CG1 1 
ATOM   1650 C CG2 . VAL A 1 244 ? 10.059  10.864  51.625 1.00 22.37 ? 224  VAL A CG2 1 
ATOM   1651 N N   . CYS A 1 245 ? 11.958  6.651   50.585 1.00 19.13 ? 225  CYS A N   1 
ATOM   1652 C CA  . CYS A 1 245 ? 12.488  5.285   50.682 1.00 20.09 ? 225  CYS A CA  1 
ATOM   1653 C C   . CYS A 1 245 ? 13.842  5.295   51.353 1.00 19.44 ? 225  CYS A C   1 
ATOM   1654 O O   . CYS A 1 245 ? 14.616  6.244   51.189 1.00 19.26 ? 225  CYS A O   1 
ATOM   1655 C CB  . CYS A 1 245 ? 12.689  4.672   49.276 1.00 20.57 ? 225  CYS A CB  1 
ATOM   1656 S SG  . CYS A 1 245 ? 11.168  4.752   48.245 1.00 25.58 ? 225  CYS A SG  1 
ATOM   1657 N N   . ASN A 1 246 ? 14.151  4.224   52.083 1.00 20.32 ? 226  ASN A N   1 
ATOM   1658 C CA  . ASN A 1 246 ? 15.548  3.971   52.458 1.00 19.23 ? 226  ASN A CA  1 
ATOM   1659 C C   . ASN A 1 246 ? 16.401  3.569   51.246 1.00 20.36 ? 226  ASN A C   1 
ATOM   1660 O O   . ASN A 1 246 ? 15.875  3.403   50.125 1.00 20.84 ? 226  ASN A O   1 
ATOM   1661 C CB  . ASN A 1 246 ? 15.652  2.952   53.604 1.00 19.32 ? 226  ASN A CB  1 
ATOM   1662 C CG  . ASN A 1 246 ? 15.067  1.549   53.257 1.00 18.95 ? 226  ASN A CG  1 
ATOM   1663 O OD1 . ASN A 1 246 ? 14.841  1.179   52.081 1.00 19.55 ? 226  ASN A OD1 1 
ATOM   1664 N ND2 . ASN A 1 246 ? 14.827  0.761   54.316 1.00 18.36 ? 226  ASN A ND2 1 
ATOM   1665 N N   . ALA A 1 247 ? 17.712  3.411   51.455 1.00 19.82 ? 227  ALA A N   1 
ATOM   1666 C CA  . ALA A 1 247 ? 18.595  3.025   50.378 1.00 19.27 ? 227  ALA A CA  1 
ATOM   1667 C C   . ALA A 1 247 ? 18.318  1.603   49.838 1.00 18.84 ? 227  ALA A C   1 
ATOM   1668 O O   . ALA A 1 247 ? 18.480  1.353   48.641 1.00 18.46 ? 227  ALA A O   1 
ATOM   1669 C CB  . ALA A 1 247 ? 20.070  3.159   50.830 1.00 19.19 ? 227  ALA A CB  1 
ATOM   1670 N N   . ARG A 1 248 ? 17.917  0.684   50.713 1.00 18.52 ? 228  ARG A N   1 
ATOM   1671 C CA  . ARG A 1 248 ? 17.549  -0.678  50.304 1.00 19.52 ? 228  ARG A CA  1 
ATOM   1672 C C   . ARG A 1 248 ? 16.483  -0.685  49.182 1.00 19.26 ? 228  ARG A C   1 
ATOM   1673 O O   . ARG A 1 248 ? 16.587  -1.454  48.231 1.00 18.15 ? 228  ARG A O   1 
ATOM   1674 C CB  . ARG A 1 248 ? 17.096  -1.482  51.532 1.00 20.17 ? 228  ARG A CB  1 
ATOM   1675 C CG  . ARG A 1 248 ? 16.589  -2.905  51.267 1.00 23.41 ? 228  ARG A CG  1 
ATOM   1676 C CD  . ARG A 1 248 ? 15.915  -3.514  52.492 1.00 26.48 ? 228  ARG A CD  1 
ATOM   1677 N NE  . ARG A 1 248 ? 15.362  -4.823  52.141 1.00 31.05 ? 228  ARG A NE  1 
ATOM   1678 C CZ  . ARG A 1 248 ? 14.174  -5.294  52.522 1.00 29.76 ? 228  ARG A CZ  1 
ATOM   1679 N NH1 . ARG A 1 248 ? 13.342  -4.568  53.263 1.00 25.31 ? 228  ARG A NH1 1 
ATOM   1680 N NH2 . ARG A 1 248 ? 13.798  -6.495  52.114 1.00 31.08 ? 228  ARG A NH2 1 
ATOM   1681 N N   . CYS A 1 249 ? 15.503  0.212   49.264 1.00 19.97 ? 229  CYS A N   1 
ATOM   1682 C CA  . CYS A 1 249 ? 14.307  0.102   48.403 1.00 20.65 ? 229  CYS A CA  1 
ATOM   1683 C C   . CYS A 1 249 ? 14.147  1.204   47.354 1.00 20.26 ? 229  CYS A C   1 
ATOM   1684 O O   . CYS A 1 249 ? 13.314  1.097   46.440 1.00 20.26 ? 229  CYS A O   1 
ATOM   1685 C CB  . CYS A 1 249 ? 13.040  0.018   49.290 1.00 21.43 ? 229  CYS A CB  1 
ATOM   1686 S SG  . CYS A 1 249 ? 13.054  -1.447  50.335 1.00 25.83 ? 229  CYS A SG  1 
ATOM   1687 N N   . TRP A 1 250 ? 14.924  2.268   47.477 1.00 20.06 ? 230  TRP A N   1 
ATOM   1688 C CA  . TRP A 1 250 ? 14.724  3.442   46.628 1.00 20.78 ? 230  TRP A CA  1 
ATOM   1689 C C   . TRP A 1 250 ? 14.750  3.137   45.124 1.00 21.10 ? 230  TRP A C   1 
ATOM   1690 O O   . TRP A 1 250 ? 13.817  3.497   44.416 1.00 19.14 ? 230  TRP A O   1 
ATOM   1691 C CB  . TRP A 1 250 ? 15.735  4.532   46.960 1.00 21.20 ? 230  TRP A CB  1 
ATOM   1692 C CG  . TRP A 1 250 ? 15.642  5.763   46.069 1.00 22.67 ? 230  TRP A CG  1 
ATOM   1693 C CD1 . TRP A 1 250 ? 14.507  6.388   45.602 1.00 22.45 ? 230  TRP A CD1 1 
ATOM   1694 C CD2 . TRP A 1 250 ? 16.753  6.526   45.573 1.00 24.97 ? 230  TRP A CD2 1 
ATOM   1695 N NE1 . TRP A 1 250 ? 14.857  7.491   44.824 1.00 20.83 ? 230  TRP A NE1 1 
ATOM   1696 C CE2 . TRP A 1 250 ? 16.226  7.599   44.806 1.00 25.82 ? 230  TRP A CE2 1 
ATOM   1697 C CE3 . TRP A 1 250 ? 18.147  6.415   45.723 1.00 25.81 ? 230  TRP A CE3 1 
ATOM   1698 C CZ2 . TRP A 1 250 ? 17.046  8.546   44.179 1.00 27.72 ? 230  TRP A CZ2 1 
ATOM   1699 C CZ3 . TRP A 1 250 ? 18.967  7.367   45.100 1.00 28.40 ? 230  TRP A CZ3 1 
ATOM   1700 C CH2 . TRP A 1 250 ? 18.419  8.409   44.334 1.00 29.72 ? 230  TRP A CH2 1 
ATOM   1701 N N   . GLU A 1 251 ? 15.796  2.462   44.669 1.00 20.45 ? 231  GLU A N   1 
ATOM   1702 C CA  . GLU A 1 251 ? 15.982  2.234   43.239 1.00 22.67 ? 231  GLU A CA  1 
ATOM   1703 C C   . GLU A 1 251 ? 14.814  1.478   42.611 1.00 22.09 ? 231  GLU A C   1 
ATOM   1704 O O   . GLU A 1 251 ? 14.327  1.878   41.530 1.00 23.51 ? 231  GLU A O   1 
ATOM   1705 C CB  . GLU A 1 251 ? 17.284  1.499   42.949 1.00 22.94 ? 231  GLU A CB  1 
ATOM   1706 C CG  . GLU A 1 251 ? 17.416  1.115   41.449 1.00 27.76 ? 231  GLU A CG  1 
ATOM   1707 C CD  . GLU A 1 251 ? 18.825  0.670   41.044 1.00 33.26 ? 231  GLU A CD  1 
ATOM   1708 O OE1 . GLU A 1 251 ? 19.302  1.094   39.965 1.00 37.36 ? 231  GLU A OE1 1 
ATOM   1709 O OE2 . GLU A 1 251 ? 19.444  -0.114  41.781 1.00 35.83 ? 231  GLU A OE2 1 
ATOM   1710 N N   . GLN A 1 252 ? 14.358  0.409   43.283 1.00 20.51 ? 232  GLN A N   1 
ATOM   1711 C CA  . GLN A 1 252 ? 13.274  -0.404  42.764 1.00 20.47 ? 232  GLN A CA  1 
ATOM   1712 C C   . GLN A 1 252 ? 12.005  0.412   42.683 1.00 19.55 ? 232  GLN A C   1 
ATOM   1713 O O   . GLN A 1 252 ? 11.309  0.381   41.669 1.00 19.10 ? 232  GLN A O   1 
ATOM   1714 C CB  . GLN A 1 252 ? 13.008  -1.641  43.626 1.00 20.14 ? 232  GLN A CB  1 
ATOM   1715 C CG  . GLN A 1 252 ? 11.988  -2.554  43.006 1.00 21.63 ? 232  GLN A CG  1 
ATOM   1716 C CD  . GLN A 1 252 ? 11.987  -3.971  43.573 1.00 25.70 ? 232  GLN A CD  1 
ATOM   1717 O OE1 . GLN A 1 252 ? 12.862  -4.347  44.346 1.00 23.67 ? 232  GLN A OE1 1 
ATOM   1718 N NE2 . GLN A 1 252 ? 10.969  -4.749  43.201 1.00 23.75 ? 232  GLN A NE2 1 
ATOM   1719 N N   . LEU A 1 253 ? 11.670  1.115   43.756 1.00 20.38 ? 233  LEU A N   1 
ATOM   1720 C CA  . LEU A 1 253 ? 10.410  1.867   43.757 1.00 20.37 ? 233  LEU A CA  1 
ATOM   1721 C C   . LEU A 1 253 ? 10.483  2.950   42.669 1.00 20.11 ? 233  LEU A C   1 
ATOM   1722 O O   . LEU A 1 253 ? 9.564   3.108   41.866 1.00 18.38 ? 233  LEU A O   1 
ATOM   1723 C CB  . LEU A 1 253 ? 10.169  2.478   45.137 1.00 21.88 ? 233  LEU A CB  1 
ATOM   1724 C CG  . LEU A 1 253 ? 8.920   3.245   45.556 1.00 25.03 ? 233  LEU A CG  1 
ATOM   1725 C CD1 . LEU A 1 253 ? 7.759   3.174   44.601 1.00 23.84 ? 233  LEU A CD1 1 
ATOM   1726 C CD2 . LEU A 1 253 ? 8.474   2.836   46.963 1.00 27.87 ? 233  LEU A CD2 1 
ATOM   1727 N N   . ARG A 1 254 ? 11.612  3.643   42.629 1.00 19.27 ? 234  ARG A N   1 
ATOM   1728 C CA  . ARG A 1 254 ? 11.840  4.736   41.688 1.00 19.56 ? 234  ARG A CA  1 
ATOM   1729 C C   . ARG A 1 254 ? 11.728  4.266   40.249 1.00 19.81 ? 234  ARG A C   1 
ATOM   1730 O O   . ARG A 1 254 ? 10.951  4.816   39.490 1.00 19.05 ? 234  ARG A O   1 
ATOM   1731 C CB  . ARG A 1 254 ? 13.221  5.354   41.898 1.00 19.50 ? 234  ARG A CB  1 
ATOM   1732 C CG  . ARG A 1 254 ? 13.460  6.561   41.003 1.00 20.26 ? 234  ARG A CG  1 
ATOM   1733 C CD  . ARG A 1 254 ? 14.930  7.005   41.031 1.00 23.76 ? 234  ARG A CD  1 
ATOM   1734 N NE  . ARG A 1 254 ? 15.816  6.035   40.393 1.00 25.30 ? 234  ARG A NE  1 
ATOM   1735 C CZ  . ARG A 1 254 ? 16.916  5.511   40.937 1.00 25.09 ? 234  ARG A CZ  1 
ATOM   1736 N NH1 . ARG A 1 254 ? 17.296  5.832   42.170 1.00 25.70 ? 234  ARG A NH1 1 
ATOM   1737 N NH2 . ARG A 1 254 ? 17.635  4.653   40.241 1.00 24.72 ? 234  ARG A NH2 1 
ATOM   1738 N N   . GLU A 1 255 ? 12.520  3.257   39.877 1.00 19.12 ? 235  GLU A N   1 
ATOM   1739 C CA  . GLU A 1 255 ? 12.485  2.742   38.513 1.00 19.28 ? 235  GLU A CA  1 
ATOM   1740 C C   . GLU A 1 255 ? 11.148  2.082   38.110 1.00 19.06 ? 235  GLU A C   1 
ATOM   1741 O O   . GLU A 1 255 ? 10.707  2.232   36.980 1.00 20.01 ? 235  GLU A O   1 
ATOM   1742 C CB  . GLU A 1 255 ? 13.658  1.808   38.277 1.00 20.22 ? 235  GLU A CB  1 
ATOM   1743 C CG  . GLU A 1 255 ? 15.004  2.563   38.363 1.00 19.11 ? 235  GLU A CG  1 
ATOM   1744 C CD  . GLU A 1 255 ? 15.042  3.827   37.477 1.00 23.18 ? 235  GLU A CD  1 
ATOM   1745 O OE1 . GLU A 1 255 ? 14.761  3.729   36.261 1.00 23.60 ? 235  GLU A OE1 1 
ATOM   1746 O OE2 . GLU A 1 255 ? 15.331  4.931   38.005 1.00 23.84 ? 235  GLU A OE2 1 
ATOM   1747 N N   . ASN A 1 256 ? 10.529  1.343   39.013 1.00 18.62 ? 236  ASN A N   1 
ATOM   1748 C CA  . ASN A 1 256 ? 9.244   0.688   38.688 1.00 18.38 ? 236  ASN A CA  1 
ATOM   1749 C C   . ASN A 1 256 ? 8.084   1.671   38.609 1.00 19.83 ? 236  ASN A C   1 
ATOM   1750 O O   . ASN A 1 256 ? 7.259   1.591   37.688 1.00 19.48 ? 236  ASN A O   1 
ATOM   1751 C CB  . ASN A 1 256 ? 8.978   -0.542  39.589 1.00 18.27 ? 236  ASN A CB  1 
ATOM   1752 C CG  . ASN A 1 256 ? 9.951   -1.710  39.279 1.00 18.05 ? 236  ASN A CG  1 
ATOM   1753 O OD1 . ASN A 1 256 ? 10.681  -1.666  38.300 1.00 22.11 ? 236  ASN A OD1 1 
ATOM   1754 N ND2 . ASN A 1 256 ? 9.968   -2.735  40.124 1.00 16.88 ? 236  ASN A ND2 1 
ATOM   1755 N N   . ALA A 1 257 ? 8.083   2.646   39.504 1.00 19.40 ? 237  ALA A N   1 
ATOM   1756 C CA  . ALA A 1 257 ? 7.149   3.763   39.391 1.00 19.47 ? 237  ALA A CA  1 
ATOM   1757 C C   . ALA A 1 257 ? 7.330   4.523   38.077 1.00 19.55 ? 237  ALA A C   1 
ATOM   1758 O O   . ALA A 1 257 ? 6.344   4.921   37.425 1.00 20.02 ? 237  ALA A O   1 
ATOM   1759 C CB  . ALA A 1 257 ? 7.276   4.735   40.603 1.00 18.12 ? 237  ALA A CB  1 
ATOM   1760 N N   . TYR A 1 258 ? 8.584   4.723   37.663 1.00 19.33 ? 238  TYR A N   1 
ATOM   1761 C CA  . TYR A 1 258 ? 8.826   5.401   36.393 1.00 19.98 ? 238  TYR A CA  1 
ATOM   1762 C C   . TYR A 1 258 ? 8.238   4.626   35.184 1.00 19.75 ? 238  TYR A C   1 
ATOM   1763 O O   . TYR A 1 258 ? 7.643   5.237   34.270 1.00 20.79 ? 238  TYR A O   1 
ATOM   1764 C CB  . TYR A 1 258 ? 10.313  5.623   36.201 1.00 18.26 ? 238  TYR A CB  1 
ATOM   1765 C CG  . TYR A 1 258 ? 10.623  6.609   35.121 1.00 18.61 ? 238  TYR A CG  1 
ATOM   1766 C CD1 . TYR A 1 258 ? 10.388  7.976   35.317 1.00 19.87 ? 238  TYR A CD1 1 
ATOM   1767 C CD2 . TYR A 1 258 ? 11.150  6.182   33.894 1.00 17.79 ? 238  TYR A CD2 1 
ATOM   1768 C CE1 . TYR A 1 258 ? 10.683  8.905   34.323 1.00 20.15 ? 238  TYR A CE1 1 
ATOM   1769 C CE2 . TYR A 1 258 ? 11.442  7.113   32.871 1.00 19.96 ? 238  TYR A CE2 1 
ATOM   1770 C CZ  . TYR A 1 258 ? 11.220  8.466   33.105 1.00 20.06 ? 238  TYR A CZ  1 
ATOM   1771 O OH  . TYR A 1 258 ? 11.488  9.400   32.138 1.00 19.11 ? 238  TYR A OH  1 
ATOM   1772 N N   . LEU A 1 259 ? 8.336   3.296   35.219 1.00 18.48 ? 239  LEU A N   1 
ATOM   1773 C CA  . LEU A 1 259 ? 7.808   2.452   34.119 1.00 18.64 ? 239  LEU A CA  1 
ATOM   1774 C C   . LEU A 1 259 ? 6.295   2.555   34.036 1.00 18.44 ? 239  LEU A C   1 
ATOM   1775 O O   . LEU A 1 259 ? 5.703   2.302   32.979 1.00 18.64 ? 239  LEU A O   1 
ATOM   1776 C CB  . LEU A 1 259 ? 8.260   0.992   34.270 1.00 17.90 ? 239  LEU A CB  1 
ATOM   1777 C CG  . LEU A 1 259 ? 9.705   0.777   33.773 1.00 15.73 ? 239  LEU A CG  1 
ATOM   1778 C CD1 . LEU A 1 259 ? 10.268  -0.513  34.334 1.00 16.07 ? 239  LEU A CD1 1 
ATOM   1779 C CD2 . LEU A 1 259 ? 9.722   0.740   32.242 1.00 15.85 ? 239  LEU A CD2 1 
ATOM   1780 N N   . MET A 1 260 ? 5.709   2.971   35.160 1.00 16.83 ? 240  MET A N   1 
ATOM   1781 C CA  . MET A 1 260 ? 4.246   3.256   35.235 1.00 16.37 ? 240  MET A CA  1 
ATOM   1782 C C   . MET A 1 260 ? 3.963   4.728   34.890 1.00 17.17 ? 240  MET A C   1 
ATOM   1783 O O   . MET A 1 260 ? 2.812   5.171   34.938 1.00 17.48 ? 240  MET A O   1 
ATOM   1784 C CB  . MET A 1 260 ? 3.718   2.897   36.642 1.00 15.78 ? 240  MET A CB  1 
ATOM   1785 C CG  . MET A 1 260 ? 3.736   1.362   36.950 1.00 14.08 ? 240  MET A CG  1 
ATOM   1786 S SD  . MET A 1 260 ? 3.058   0.347   35.635 1.00 19.80 ? 240  MET A SD  1 
ATOM   1787 C CE  . MET A 1 260 ? 1.311   0.736   35.802 1.00 16.10 ? 240  MET A CE  1 
ATOM   1788 N N   . GLY A 1 261 ? 5.009   5.492   34.539 1.00 15.51 ? 241  GLY A N   1 
ATOM   1789 C CA  . GLY A 1 261 ? 4.864   6.904   34.150 1.00 15.67 ? 241  GLY A CA  1 
ATOM   1790 C C   . GLY A 1 261 ? 4.465   7.860   35.268 1.00 16.62 ? 241  GLY A C   1 
ATOM   1791 O O   . GLY A 1 261 ? 3.860   8.926   35.016 1.00 15.80 ? 241  GLY A O   1 
ATOM   1792 N N   . GLN A 1 262 ? 4.782   7.504   36.516 1.00 16.42 ? 242  GLN A N   1 
ATOM   1793 C CA  . GLN A 1 262 ? 4.370   8.299   37.665 1.00 16.21 ? 242  GLN A CA  1 
ATOM   1794 C C   . GLN A 1 262 ? 5.243   9.503   37.866 1.00 16.79 ? 242  GLN A C   1 
ATOM   1795 O O   . GLN A 1 262 ? 6.476   9.421   37.892 1.00 15.86 ? 242  GLN A O   1 
ATOM   1796 C CB  . GLN A 1 262 ? 4.301   7.442   38.936 1.00 16.78 ? 242  GLN A CB  1 
ATOM   1797 C CG  . GLN A 1 262 ? 3.273   6.274   38.808 1.00 16.08 ? 242  GLN A CG  1 
ATOM   1798 C CD  . GLN A 1 262 ? 1.887   6.780   38.395 1.00 18.14 ? 242  GLN A CD  1 
ATOM   1799 O OE1 . GLN A 1 262 ? 1.458   6.585   37.240 1.00 18.57 ? 242  GLN A OE1 1 
ATOM   1800 N NE2 . GLN A 1 262 ? 1.205   7.455   39.305 1.00 15.62 ? 242  GLN A NE2 1 
ATOM   1801 N N   . MET A 1 263 ? 4.578   10.637  37.999 1.00 16.68 ? 243  MET A N   1 
ATOM   1802 C CA  . MET A 1 263 ? 5.205   11.909  38.215 1.00 18.07 ? 243  MET A CA  1 
ATOM   1803 C C   . MET A 1 263 ? 4.141   12.864  38.702 1.00 17.97 ? 243  MET A C   1 
ATOM   1804 O O   . MET A 1 263 ? 2.926   12.557  38.678 1.00 15.99 ? 243  MET A O   1 
ATOM   1805 C CB  . MET A 1 263 ? 5.807   12.443  36.901 1.00 17.30 ? 243  MET A CB  1 
ATOM   1806 C CG  . MET A 1 263 ? 4.759   12.719  35.775 1.00 18.47 ? 243  MET A CG  1 
ATOM   1807 S SD  . MET A 1 263 ? 5.438   13.623  34.370 1.00 19.58 ? 243  MET A SD  1 
ATOM   1808 C CE  . MET A 1 263 ? 5.898   15.234  35.083 1.00 21.59 ? 243  MET A CE  1 
ATOM   1809 N N   . VAL A 1 264 ? 4.585   14.053  39.069 1.00 18.48 ? 244  VAL A N   1 
ATOM   1810 C CA  . VAL A 1 264 ? 3.652   15.105  39.454 1.00 19.04 ? 244  VAL A CA  1 
ATOM   1811 C C   . VAL A 1 264 ? 4.146   16.368  38.734 1.00 19.00 ? 244  VAL A C   1 
ATOM   1812 O O   . VAL A 1 264 ? 5.328   16.468  38.348 1.00 17.56 ? 244  VAL A O   1 
ATOM   1813 C CB  . VAL A 1 264 ? 3.623   15.263  40.962 1.00 19.72 ? 244  VAL A CB  1 
ATOM   1814 C CG1 . VAL A 1 264 ? 4.954   15.879  41.496 1.00 21.36 ? 244  VAL A CG1 1 
ATOM   1815 C CG2 . VAL A 1 264 ? 2.355   16.104  41.415 1.00 20.17 ? 244  VAL A CG2 1 
ATOM   1816 N N   . ASP A 1 265 ? 3.264   17.309  38.497 1.00 17.78 ? 245  ASP A N   1 
ATOM   1817 C CA  . ASP A 1 265 ? 3.639   18.503  37.729 1.00 19.28 ? 245  ASP A CA  1 
ATOM   1818 C C   . ASP A 1 265 ? 4.521   19.436  38.542 1.00 18.63 ? 245  ASP A C   1 
ATOM   1819 O O   . ASP A 1 265 ? 4.452   19.460  39.791 1.00 19.54 ? 245  ASP A O   1 
ATOM   1820 C CB  . ASP A 1 265 ? 2.371   19.239  37.254 1.00 19.26 ? 245  ASP A CB  1 
ATOM   1821 C CG  . ASP A 1 265 ? 1.605   19.859  38.400 1.00 22.32 ? 245  ASP A CG  1 
ATOM   1822 O OD1 . ASP A 1 265 ? 0.860   19.105  39.095 1.00 24.54 ? 245  ASP A OD1 1 
ATOM   1823 O OD2 . ASP A 1 265 ? 1.705   21.108  38.562 1.00 21.22 ? 245  ASP A OD2 1 
ATOM   1824 N N   . ALA A 1 266 ? 5.337   20.226  37.849 1.00 18.92 ? 246  ALA A N   1 
ATOM   1825 C CA  . ALA A 1 266 ? 6.285   21.136  38.493 1.00 17.91 ? 246  ALA A CA  1 
ATOM   1826 C C   . ALA A 1 266 ? 5.618   22.137  39.449 1.00 18.37 ? 246  ALA A C   1 
ATOM   1827 O O   . ALA A 1 266 ? 6.113   22.388  40.541 1.00 17.81 ? 246  ALA A O   1 
ATOM   1828 C CB  . ALA A 1 266 ? 7.137   21.869  37.411 1.00 17.77 ? 246  ALA A CB  1 
ATOM   1829 N N   . ASP A 1 267 ? 4.456   22.696  39.071 1.00 15.97 ? 247  ASP A N   1 
ATOM   1830 C CA  . ASP A 1 267 ? 3.842   23.715  39.909 1.00 17.46 ? 247  ASP A CA  1 
ATOM   1831 C C   . ASP A 1 267 ? 3.320   23.141  41.252 1.00 17.55 ? 247  ASP A C   1 
ATOM   1832 O O   . ASP A 1 267 ? 3.416   23.797  42.296 1.00 17.52 ? 247  ASP A O   1 
ATOM   1833 C CB  . ASP A 1 267 ? 2.674   24.367  39.147 1.00 17.89 ? 247  ASP A CB  1 
ATOM   1834 C CG  . ASP A 1 267 ? 3.144   25.372  38.110 1.00 16.93 ? 247  ASP A CG  1 
ATOM   1835 O OD1 . ASP A 1 267 ? 3.564   24.963  37.012 1.00 22.78 ? 247  ASP A OD1 1 
ATOM   1836 O OD2 . ASP A 1 267 ? 3.102   26.581  38.390 1.00 22.99 ? 247  ASP A OD2 1 
ATOM   1837 N N   . THR A 1 268 ? 2.735   21.940  41.196 1.00 17.76 ? 248  THR A N   1 
ATOM   1838 C CA  . THR A 1 268 ? 2.339   21.189  42.407 1.00 17.33 ? 248  THR A CA  1 
ATOM   1839 C C   . THR A 1 268 ? 3.532   20.847  43.294 1.00 17.76 ? 248  THR A C   1 
ATOM   1840 O O   . THR A 1 268 ? 3.470   20.984  44.520 1.00 18.63 ? 248  THR A O   1 
ATOM   1841 C CB  . THR A 1 268 ? 1.563   19.914  42.034 1.00 17.16 ? 248  THR A CB  1 
ATOM   1842 O OG1 . THR A 1 268 ? 0.355   20.318  41.358 1.00 19.69 ? 248  THR A OG1 1 
ATOM   1843 C CG2 . THR A 1 268 ? 1.215   19.093  43.331 1.00 15.82 ? 248  THR A CG2 1 
ATOM   1844 N N   . ALA A 1 269 ? 4.625   20.430  42.678 1.00 16.77 ? 249  ALA A N   1 
ATOM   1845 C CA  . ALA A 1 269 ? 5.875   20.299  43.431 1.00 16.31 ? 249  ALA A CA  1 
ATOM   1846 C C   . ALA A 1 269 ? 6.274   21.599  44.156 1.00 15.09 ? 249  ALA A C   1 
ATOM   1847 O O   . ALA A 1 269 ? 6.565   21.587  45.377 1.00 15.61 ? 249  ALA A O   1 
ATOM   1848 C CB  . ALA A 1 269 ? 6.934   19.817  42.535 1.00 16.65 ? 249  ALA A CB  1 
ATOM   1849 N N   . TYR A 1 270 ? 6.285   22.706  43.419 1.00 15.16 ? 250  TYR A N   1 
ATOM   1850 C CA  . TYR A 1 270 ? 6.504   24.019  44.036 1.00 15.68 ? 250  TYR A CA  1 
ATOM   1851 C C   . TYR A 1 270 ? 5.565   24.303  45.238 1.00 15.93 ? 250  TYR A C   1 
ATOM   1852 O O   . TYR A 1 270 ? 6.026   24.618  46.322 1.00 15.12 ? 250  TYR A O   1 
ATOM   1853 C CB  . TYR A 1 270 ? 6.522   25.129  42.969 1.00 16.08 ? 250  TYR A CB  1 
ATOM   1854 C CG  . TYR A 1 270 ? 6.661   26.534  43.537 1.00 14.75 ? 250  TYR A CG  1 
ATOM   1855 C CD1 . TYR A 1 270 ? 7.894   27.160  43.606 1.00 18.28 ? 250  TYR A CD1 1 
ATOM   1856 C CD2 . TYR A 1 270 ? 5.516   27.234  44.000 1.00 17.62 ? 250  TYR A CD2 1 
ATOM   1857 C CE1 . TYR A 1 270 ? 8.029   28.488  44.113 1.00 14.22 ? 250  TYR A CE1 1 
ATOM   1858 C CE2 . TYR A 1 270 ? 5.625   28.523  44.514 1.00 17.00 ? 250  TYR A CE2 1 
ATOM   1859 C CZ  . TYR A 1 270 ? 6.879   29.154  44.572 1.00 20.33 ? 250  TYR A CZ  1 
ATOM   1860 O OH  . TYR A 1 270 ? 6.975   30.442  45.091 1.00 18.51 ? 250  TYR A OH  1 
ATOM   1861 N N   . ILE A 1 271 ? 4.264   24.129  45.056 1.00 17.70 ? 251  ILE A N   1 
ATOM   1862 C CA  . ILE A 1 271 ? 3.317   24.419  46.094 1.00 19.24 ? 251  ILE A CA  1 
ATOM   1863 C C   . ILE A 1 271 ? 3.501   23.498  47.304 1.00 18.11 ? 251  ILE A C   1 
ATOM   1864 O O   . ILE A 1 271 ? 3.238   23.910  48.427 1.00 16.56 ? 251  ILE A O   1 
ATOM   1865 C CB  . ILE A 1 271 ? 1.828   24.420  45.503 1.00 20.01 ? 251  ILE A CB  1 
ATOM   1866 C CG1 . ILE A 1 271 ? 1.062   25.725  45.827 1.00 27.07 ? 251  ILE A CG1 1 
ATOM   1867 C CG2 . ILE A 1 271 ? 1.027   23.217  45.869 1.00 24.96 ? 251  ILE A CG2 1 
ATOM   1868 C CD1 . ILE A 1 271 ? 1.457   26.417  47.075 1.00 32.64 ? 251  ILE A CD1 1 
ATOM   1869 N N   . THR A 1 272 ? 3.980   22.261  47.068 1.00 17.72 ? 252  THR A N   1 
ATOM   1870 C CA  . THR A 1 272 ? 4.156   21.318  48.182 1.00 17.21 ? 252  THR A CA  1 
ATOM   1871 C C   . THR A 1 272 ? 5.381   21.785  48.998 1.00 15.91 ? 252  THR A C   1 
ATOM   1872 O O   . THR A 1 272 ? 5.296   21.906  50.211 1.00 14.94 ? 252  THR A O   1 
ATOM   1873 C CB  . THR A 1 272 ? 4.335   19.861  47.699 1.00 16.49 ? 252  THR A CB  1 
ATOM   1874 O OG1 . THR A 1 272 ? 3.235   19.513  46.868 1.00 19.23 ? 252  THR A OG1 1 
ATOM   1875 C CG2 . THR A 1 272 ? 4.402   18.904  48.903 1.00 16.65 ? 252  THR A CG2 1 
ATOM   1876 N N   . SER A 1 273 ? 6.491   22.080  48.324 1.00 15.75 ? 253  SER A N   1 
ATOM   1877 C CA  . SER A 1 273 ? 7.660   22.704  49.000 1.00 16.35 ? 253  SER A CA  1 
ATOM   1878 C C   . SER A 1 273 ? 7.245   23.923  49.841 1.00 16.41 ? 253  SER A C   1 
ATOM   1879 O O   . SER A 1 273 ? 7.569   24.029  51.016 1.00 18.09 ? 253  SER A O   1 
ATOM   1880 C CB  . SER A 1 273 ? 8.767   23.134  47.984 1.00 15.55 ? 253  SER A CB  1 
ATOM   1881 O OG  . SER A 1 273 ? 9.620   22.069  47.511 1.00 16.26 ? 253  SER A OG  1 
ATOM   1882 N N   . ARG A 1 274 ? 6.525   24.846  49.219 1.00 17.30 ? 254  ARG A N   1 
ATOM   1883 C CA  . ARG A 1 274 ? 5.922   26.009  49.896 1.00 16.98 ? 254  ARG A CA  1 
ATOM   1884 C C   . ARG A 1 274 ? 5.089   25.688  51.163 1.00 17.76 ? 254  ARG A C   1 
ATOM   1885 O O   . ARG A 1 274 ? 5.187   26.413  52.163 1.00 17.85 ? 254  ARG A O   1 
ATOM   1886 C CB  . ARG A 1 274 ? 5.097   26.808  48.884 1.00 15.34 ? 254  ARG A CB  1 
ATOM   1887 C CG  . ARG A 1 274 ? 4.868   28.321  49.232 1.00 16.76 ? 254  ARG A CG  1 
ATOM   1888 C CD  . ARG A 1 274 ? 4.053   28.876  48.084 1.00 16.93 ? 254  ARG A CD  1 
ATOM   1889 N NE  . ARG A 1 274 ? 3.725   30.300  48.124 1.00 18.01 ? 254  ARG A NE  1 
ATOM   1890 C CZ  . ARG A 1 274 ? 2.668   30.792  48.775 1.00 18.12 ? 254  ARG A CZ  1 
ATOM   1891 N NH1 . ARG A 1 274 ? 1.888   29.987  49.503 1.00 15.46 ? 254  ARG A NH1 1 
ATOM   1892 N NH2 . ARG A 1 274 ? 2.405   32.089  48.735 1.00 19.01 ? 254  ARG A NH2 1 
ATOM   1893 N N   . GLY A 1 275 ? 4.281   24.623  51.105 1.00 16.98 ? 255  GLY A N   1 
ATOM   1894 C CA  . GLY A 1 275 ? 3.525   24.137  52.263 1.00 16.83 ? 255  GLY A CA  1 
ATOM   1895 C C   . GLY A 1 275 ? 4.393   23.803  53.486 1.00 16.71 ? 255  GLY A C   1 
ATOM   1896 O O   . GLY A 1 275 ? 4.063   24.111  54.638 1.00 16.51 ? 255  GLY A O   1 
ATOM   1897 N N   . LEU A 1 276 ? 5.535   23.192  53.220 1.00 16.08 ? 256  LEU A N   1 
ATOM   1898 C CA  . LEU A 1 276 ? 6.447   22.768  54.250 1.00 17.57 ? 256  LEU A CA  1 
ATOM   1899 C C   . LEU A 1 276 ? 6.775   23.950  55.149 1.00 18.10 ? 256  LEU A C   1 
ATOM   1900 O O   . LEU A 1 276 ? 6.979   23.800  56.361 1.00 18.07 ? 256  LEU A O   1 
ATOM   1901 C CB  . LEU A 1 276 ? 7.743   22.293  53.598 1.00 16.76 ? 256  LEU A CB  1 
ATOM   1902 C CG  . LEU A 1 276 ? 7.721   21.077  52.648 1.00 17.58 ? 256  LEU A CG  1 
ATOM   1903 C CD1 . LEU A 1 276 ? 9.181   20.772  52.226 1.00 16.55 ? 256  LEU A CD1 1 
ATOM   1904 C CD2 . LEU A 1 276 ? 7.062   19.846  53.288 1.00 21.68 ? 256  LEU A CD2 1 
ATOM   1905 N N   . ARG A 1 277 ? 6.871   25.129  54.527 1.00 19.37 ? 257  ARG A N   1 
ATOM   1906 C CA  . ARG A 1 277 ? 7.367   26.330  55.239 1.00 19.12 ? 257  ARG A CA  1 
ATOM   1907 C C   . ARG A 1 277 ? 6.498   26.691  56.435 1.00 19.50 ? 257  ARG A C   1 
ATOM   1908 O O   . ARG A 1 277 ? 6.997   27.220  57.420 1.00 19.28 ? 257  ARG A O   1 
ATOM   1909 C CB  . ARG A 1 277 ? 7.474   27.508  54.286 1.00 18.16 ? 257  ARG A CB  1 
ATOM   1910 C CG  . ARG A 1 277 ? 8.187   27.212  52.973 1.00 18.67 ? 257  ARG A CG  1 
ATOM   1911 C CD  . ARG A 1 277 ? 9.562   26.587  53.154 1.00 15.00 ? 257  ARG A CD  1 
ATOM   1912 N NE  . ARG A 1 277 ? 10.089  26.215  51.841 1.00 13.67 ? 257  ARG A NE  1 
ATOM   1913 C CZ  . ARG A 1 277 ? 10.973  25.241  51.623 1.00 17.13 ? 257  ARG A CZ  1 
ATOM   1914 N NH1 . ARG A 1 277 ? 11.509  24.523  52.628 1.00 15.50 ? 257  ARG A NH1 1 
ATOM   1915 N NH2 . ARG A 1 277 ? 11.319  24.995  50.381 1.00 19.02 ? 257  ARG A NH2 1 
ATOM   1916 N N   . THR A 1 278 ? 5.204   26.393  56.368 1.00 19.64 ? 258  THR A N   1 
ATOM   1917 C CA  . THR A 1 278 ? 4.292   26.716  57.491 1.00 18.87 ? 258  THR A CA  1 
ATOM   1918 C C   . THR A 1 278 ? 3.829   25.457  58.231 1.00 18.98 ? 258  THR A C   1 
ATOM   1919 O O   . THR A 1 278 ? 2.956   25.531  59.110 1.00 19.44 ? 258  THR A O   1 
ATOM   1920 C CB  . THR A 1 278 ? 3.038   27.492  56.994 1.00 18.87 ? 258  THR A CB  1 
ATOM   1921 O OG1 . THR A 1 278 ? 2.382   26.722  55.968 1.00 20.61 ? 258  THR A OG1 1 
ATOM   1922 C CG2 . THR A 1 278 ? 3.481   28.870  56.369 1.00 16.64 ? 258  THR A CG2 1 
ATOM   1923 N N   . LEU A 1 279 ? 4.387   24.316  57.834 1.00 18.72 ? 259  LEU A N   1 
ATOM   1924 C CA  . LEU A 1 279 ? 3.963   23.041  58.383 1.00 18.00 ? 259  LEU A CA  1 
ATOM   1925 C C   . LEU A 1 279 ? 4.061   22.995  59.934 1.00 18.88 ? 259  LEU A C   1 
ATOM   1926 O O   . LEU A 1 279 ? 3.168   22.466  60.598 1.00 18.41 ? 259  LEU A O   1 
ATOM   1927 C CB  . LEU A 1 279 ? 4.690   21.872  57.712 1.00 17.86 ? 259  LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 279 ? 4.269   20.492  58.222 1.00 16.39 ? 259  LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 279 ? 2.776   20.232  57.858 1.00 13.56 ? 259  LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 279 ? 5.144   19.430  57.662 1.00 17.31 ? 259  LEU A CD2 1 
ATOM   1931 N N   . GLY A 1 280 ? 5.102   23.602  60.496 1.00 19.28 ? 260  GLY A N   1 
ATOM   1932 C CA  . GLY A 1 280 ? 5.330   23.577  61.955 1.00 20.27 ? 260  GLY A CA  1 
ATOM   1933 C C   . GLY A 1 280 ? 4.296   24.404  62.673 1.00 20.50 ? 260  GLY A C   1 
ATOM   1934 O O   . GLY A 1 280 ? 3.670   23.924  63.611 1.00 20.87 ? 260  GLY A O   1 
ATOM   1935 N N   . VAL A 1 281 ? 4.087   25.645  62.224 1.00 20.08 ? 261  VAL A N   1 
ATOM   1936 C CA  . VAL A 1 281 ? 3.134   26.520  62.896 1.00 20.11 ? 261  VAL A CA  1 
ATOM   1937 C C   . VAL A 1 281 ? 1.723   25.973  62.712 1.00 19.79 ? 261  VAL A C   1 
ATOM   1938 O O   . VAL A 1 281 ? 0.896   26.095  63.626 1.00 20.12 ? 261  VAL A O   1 
ATOM   1939 C CB  . VAL A 1 281 ? 3.147   27.997  62.428 1.00 19.08 ? 261  VAL A CB  1 
ATOM   1940 C CG1 . VAL A 1 281 ? 4.474   28.687  62.861 1.00 21.97 ? 261  VAL A CG1 1 
ATOM   1941 C CG2 . VAL A 1 281 ? 2.921   28.112  60.946 1.00 20.14 ? 261  VAL A CG2 1 
ATOM   1942 N N   . ARG A 1 282 ? 1.450   25.384  61.536 1.00 18.84 ? 262  ARG A N   1 
ATOM   1943 C CA  . ARG A 1 282 ? 0.177   24.722  61.324 1.00 16.77 ? 262  ARG A CA  1 
ATOM   1944 C C   . ARG A 1 282 ? -0.034  23.519  62.256 1.00 17.38 ? 262  ARG A C   1 
ATOM   1945 O O   . ARG A 1 282 ? -1.003  23.503  63.022 1.00 16.12 ? 262  ARG A O   1 
ATOM   1946 C CB  . ARG A 1 282 ? -0.063  24.327  59.858 1.00 16.37 ? 262  ARG A CB  1 
ATOM   1947 C CG  . ARG A 1 282 ? -0.353  25.551  58.990 1.00 17.26 ? 262  ARG A CG  1 
ATOM   1948 C CD  . ARG A 1 282 ? -0.680  25.198  57.530 1.00 16.06 ? 262  ARG A CD  1 
ATOM   1949 N NE  . ARG A 1 282 ? 0.518   24.720  56.791 1.00 18.16 ? 262  ARG A NE  1 
ATOM   1950 C CZ  . ARG A 1 282 ? 0.701   23.443  56.413 1.00 20.36 ? 262  ARG A CZ  1 
ATOM   1951 N NH1 . ARG A 1 282 ? -0.220  22.508  56.718 1.00 19.38 ? 262  ARG A NH1 1 
ATOM   1952 N NH2 . ARG A 1 282 ? 1.797   23.092  55.721 1.00 17.83 ? 262  ARG A NH2 1 
ATOM   1953 N N   . LEU A 1 283 ? 0.840   22.514  62.178 1.00 17.25 ? 263  LEU A N   1 
ATOM   1954 C CA  . LEU A 1 283 ? 0.647   21.290  62.972 1.00 17.78 ? 263  LEU A CA  1 
ATOM   1955 C C   . LEU A 1 283 ? 0.472   21.630  64.457 1.00 18.51 ? 263  LEU A C   1 
ATOM   1956 O O   . LEU A 1 283 ? -0.338  20.996  65.126 1.00 19.49 ? 263  LEU A O   1 
ATOM   1957 C CB  . LEU A 1 283 ? 1.829   20.328  62.795 1.00 18.19 ? 263  LEU A CB  1 
ATOM   1958 C CG  . LEU A 1 283 ? 1.868   19.588  61.452 1.00 15.92 ? 263  LEU A CG  1 
ATOM   1959 C CD1 . LEU A 1 283 ? 3.107   18.720  61.350 1.00 18.37 ? 263  LEU A CD1 1 
ATOM   1960 C CD2 . LEU A 1 283 ? 0.572   18.721  61.265 1.00 19.48 ? 263  LEU A CD2 1 
ATOM   1961 N N   . ARG A 1 284 ? 1.209   22.628  64.969 1.00 19.24 ? 264  ARG A N   1 
ATOM   1962 C CA  . ARG A 1 284 ? 1.091   22.958  66.407 1.00 19.67 ? 264  ARG A CA  1 
ATOM   1963 C C   . ARG A 1 284 ? -0.322  23.447  66.742 1.00 19.68 ? 264  ARG A C   1 
ATOM   1964 O O   . ARG A 1 284 ? -0.903  23.076  67.769 1.00 19.62 ? 264  ARG A O   1 
ATOM   1965 C CB  . ARG A 1 284 ? 2.164   23.943  66.857 1.00 20.29 ? 264  ARG A CB  1 
ATOM   1966 C CG  . ARG A 1 284 ? 3.517   23.257  67.044 1.00 21.78 ? 264  ARG A CG  1 
ATOM   1967 C CD  . ARG A 1 284 ? 4.564   24.089  67.754 1.00 25.97 ? 264  ARG A CD  1 
ATOM   1968 N NE  . ARG A 1 284 ? 4.904   25.283  66.983 1.00 29.35 ? 264  ARG A NE  1 
ATOM   1969 C CZ  . ARG A 1 284 ? 5.826   25.329  66.020 1.00 31.07 ? 264  ARG A CZ  1 
ATOM   1970 N NH1 . ARG A 1 284 ? 6.542   24.247  65.698 1.00 30.70 ? 264  ARG A NH1 1 
ATOM   1971 N NH2 . ARG A 1 284 ? 6.042   26.476  65.387 1.00 29.49 ? 264  ARG A NH2 1 
ATOM   1972 N N   . GLN A 1 285 ? -0.891  24.261  65.867 1.00 18.24 ? 265  GLN A N   1 
ATOM   1973 C CA  . GLN A 1 285 ? -2.249  24.705  66.073 1.00 18.38 ? 265  GLN A CA  1 
ATOM   1974 C C   . GLN A 1 285 ? -3.281  23.560  65.918 1.00 18.52 ? 265  GLN A C   1 
ATOM   1975 O O   . GLN A 1 285 ? -4.260  23.493  66.703 1.00 17.72 ? 265  GLN A O   1 
ATOM   1976 C CB  . GLN A 1 285 ? -2.557  25.849  65.132 1.00 19.82 ? 265  GLN A CB  1 
ATOM   1977 C CG  . GLN A 1 285 ? -3.976  26.345  65.197 1.00 21.15 ? 265  GLN A CG  1 
ATOM   1978 C CD  . GLN A 1 285 ? -4.140  27.597  66.016 1.00 28.92 ? 265  GLN A CD  1 
ATOM   1979 O OE1 . GLN A 1 285 ? -3.256  27.970  66.778 1.00 31.04 ? 265  GLN A OE1 1 
ATOM   1980 N NE2 . GLN A 1 285 ? -5.307  28.253  65.880 1.00 33.92 ? 265  GLN A NE2 1 
ATOM   1981 N N   . HIS A 1 286 ? -3.094  22.693  64.919 1.00 17.37 ? 266  HIS A N   1 
ATOM   1982 C CA  . HIS A 1 286 ? -3.995  21.544  64.754 1.00 17.42 ? 266  HIS A CA  1 
ATOM   1983 C C   . HIS A 1 286 ? -3.931  20.637  66.010 1.00 18.17 ? 266  HIS A C   1 
ATOM   1984 O O   . HIS A 1 286 ? -4.966  20.153  66.466 1.00 18.52 ? 266  HIS A O   1 
ATOM   1985 C CB  . HIS A 1 286 ? -3.649  20.705  63.516 1.00 16.52 ? 266  HIS A CB  1 
ATOM   1986 C CG  . HIS A 1 286 ? -3.833  21.411  62.204 1.00 13.79 ? 266  HIS A CG  1 
ATOM   1987 N ND1 . HIS A 1 286 ? -5.070  21.815  61.737 1.00 14.92 ? 266  HIS A ND1 1 
ATOM   1988 C CD2 . HIS A 1 286 ? -2.949  21.726  61.225 1.00 16.77 ? 266  HIS A CD2 1 
ATOM   1989 C CE1 . HIS A 1 286 ? -4.932  22.371  60.535 1.00 15.74 ? 266  HIS A CE1 1 
ATOM   1990 N NE2 . HIS A 1 286 ? -3.652  22.320  60.199 1.00 16.67 ? 266  HIS A NE2 1 
ATOM   1991 N N   . HIS A 1 287 ? -2.727  20.414  66.538 1.00 18.11 ? 267  HIS A N   1 
ATOM   1992 C CA  . HIS A 1 287 ? -2.526  19.647  67.767 1.00 18.50 ? 267  HIS A CA  1 
ATOM   1993 C C   . HIS A 1 287 ? -3.290  20.274  68.948 1.00 18.52 ? 267  HIS A C   1 
ATOM   1994 O O   . HIS A 1 287 ? -4.137  19.628  69.596 1.00 19.05 ? 267  HIS A O   1 
ATOM   1995 C CB  . HIS A 1 287 ? -1.026  19.610  68.082 1.00 18.04 ? 267  HIS A CB  1 
ATOM   1996 C CG  . HIS A 1 287 ? -0.643  18.711  69.226 1.00 21.37 ? 267  HIS A CG  1 
ATOM   1997 N ND1 . HIS A 1 287 ? -1.494  18.403  70.273 1.00 23.44 ? 267  HIS A ND1 1 
ATOM   1998 C CD2 . HIS A 1 287 ? 0.528   18.088  69.505 1.00 17.34 ? 267  HIS A CD2 1 
ATOM   1999 C CE1 . HIS A 1 287 ? -0.864  17.627  71.139 1.00 22.22 ? 267  HIS A CE1 1 
ATOM   2000 N NE2 . HIS A 1 287 ? 0.359   17.408  70.685 1.00 23.98 ? 267  HIS A NE2 1 
ATOM   2001 N N   . GLU A 1 288 ? -3.006  21.542  69.215 1.00 18.61 ? 268  GLU A N   1 
ATOM   2002 C CA  . GLU A 1 288 ? -3.539  22.207  70.396 1.00 19.49 ? 268  GLU A CA  1 
ATOM   2003 C C   . GLU A 1 288 ? -5.078  22.238  70.335 1.00 18.26 ? 268  GLU A C   1 
ATOM   2004 O O   . GLU A 1 288 ? -5.733  21.860  71.276 1.00 17.78 ? 268  GLU A O   1 
ATOM   2005 C CB  . GLU A 1 288 ? -2.951  23.604  70.434 1.00 20.24 ? 268  GLU A CB  1 
ATOM   2006 C CG  . GLU A 1 288 ? -3.419  24.535  71.529 1.00 24.58 ? 268  GLU A CG  1 
ATOM   2007 C CD  . GLU A 1 288 ? -2.878  25.954  71.242 1.00 32.73 ? 268  GLU A CD  1 
ATOM   2008 O OE1 . GLU A 1 288 ? -1.699  26.200  71.622 1.00 34.51 ? 268  GLU A OE1 1 
ATOM   2009 O OE2 . GLU A 1 288 ? -3.589  26.774  70.565 1.00 32.10 ? 268  GLU A OE2 1 
ATOM   2010 N N   . SER A 1 289 ? -5.610  22.659  69.192 1.00 18.44 ? 269  SER A N   1 
ATOM   2011 C CA  . SER A 1 289 ? -7.069  22.754  68.999 1.00 17.70 ? 269  SER A CA  1 
ATOM   2012 C C   . SER A 1 289 ? -7.791  21.405  69.031 1.00 18.19 ? 269  SER A C   1 
ATOM   2013 O O   . SER A 1 289 ? -8.819  21.291  69.705 1.00 17.30 ? 269  SER A O   1 
ATOM   2014 C CB  . SER A 1 289 ? -7.406  23.520  67.710 1.00 17.70 ? 269  SER A CB  1 
ATOM   2015 O OG  . SER A 1 289 ? -6.943  24.872  67.786 1.00 18.06 ? 269  SER A OG  1 
ATOM   2016 N N   . SER A 1 290 ? -7.269  20.397  68.310 1.00 17.91 ? 270  SER A N   1 
ATOM   2017 C CA  . SER A 1 290 ? -7.939  19.097  68.217 1.00 17.90 ? 270  SER A CA  1 
ATOM   2018 C C   . SER A 1 290 ? -7.996  18.424  69.557 1.00 18.33 ? 270  SER A C   1 
ATOM   2019 O O   . SER A 1 290 ? -8.998  17.806  69.893 1.00 18.42 ? 270  SER A O   1 
ATOM   2020 C CB  . SER A 1 290 ? -7.322  18.139  67.171 1.00 17.83 ? 270  SER A CB  1 
ATOM   2021 O OG  . SER A 1 290 ? -5.981  17.761  67.489 1.00 18.12 ? 270  SER A OG  1 
ATOM   2022 N N   . LEU A 1 291 ? -6.926  18.564  70.338 1.00 18.98 ? 271  LEU A N   1 
ATOM   2023 C CA  . LEU A 1 291 ? -6.884  17.904  71.626 1.00 19.16 ? 271  LEU A CA  1 
ATOM   2024 C C   . LEU A 1 291 ? -7.879  18.551  72.591 1.00 19.28 ? 271  LEU A C   1 
ATOM   2025 O O   . LEU A 1 291 ? -8.533  17.852  73.347 1.00 18.72 ? 271  LEU A O   1 
ATOM   2026 C CB  . LEU A 1 291 ? -5.450  17.883  72.197 1.00 19.23 ? 271  LEU A CB  1 
ATOM   2027 C CG  . LEU A 1 291 ? -5.328  17.204  73.590 1.00 22.11 ? 271  LEU A CG  1 
ATOM   2028 C CD1 . LEU A 1 291 ? -5.768  15.757  73.544 1.00 18.28 ? 271  LEU A CD1 1 
ATOM   2029 C CD2 . LEU A 1 291 ? -3.905  17.337  74.124 1.00 24.45 ? 271  LEU A CD2 1 
ATOM   2030 N N   . LYS A 1 292 ? -8.018  19.877  72.541 1.00 19.46 ? 272  LYS A N   1 
ATOM   2031 C CA  . LYS A 1 292 ? -8.995  20.577  73.364 1.00 20.31 ? 272  LYS A CA  1 
ATOM   2032 C C   . LYS A 1 292 ? -10.411 20.132  73.018 1.00 20.06 ? 272  LYS A C   1 
ATOM   2033 O O   . LYS A 1 292 ? -11.189 19.846  73.928 1.00 21.37 ? 272  LYS A O   1 
ATOM   2034 C CB  . LYS A 1 292 ? -8.878  22.080  73.201 1.00 20.54 ? 272  LYS A CB  1 
ATOM   2035 C CG  . LYS A 1 292 ? -9.798  22.882  74.085 1.00 24.36 ? 272  LYS A CG  1 
ATOM   2036 C CD  . LYS A 1 292 ? -9.606  24.362  73.810 1.00 26.85 ? 272  LYS A CD  1 
ATOM   2037 C CE  . LYS A 1 292 ? -10.693 25.213  74.438 1.00 27.48 ? 272  LYS A CE  1 
ATOM   2038 N NZ  . LYS A 1 292 ? -10.301 25.715  75.786 1.00 29.59 ? 272  LYS A NZ  1 
ATOM   2039 N N   . VAL A 1 293 ? -10.740 20.064  71.724 1.00 19.11 ? 273  VAL A N   1 
ATOM   2040 C CA  . VAL A 1 293 ? -12.049 19.527  71.284 1.00 18.84 ? 273  VAL A CA  1 
ATOM   2041 C C   . VAL A 1 293 ? -12.240 18.098  71.778 1.00 18.57 ? 273  VAL A C   1 
ATOM   2042 O O   . VAL A 1 293 ? -13.284 17.772  72.340 1.00 18.04 ? 273  VAL A O   1 
ATOM   2043 C CB  . VAL A 1 293 ? -12.194 19.554  69.748 1.00 18.97 ? 273  VAL A CB  1 
ATOM   2044 C CG1 . VAL A 1 293 ? -13.587 19.060  69.330 1.00 17.15 ? 273  VAL A CG1 1 
ATOM   2045 C CG2 . VAL A 1 293 ? -11.907 20.957  69.211 1.00 18.54 ? 273  VAL A CG2 1 
ATOM   2046 N N   . ALA A 1 294 ? -11.221 17.257  71.579 1.00 17.95 ? 274  ALA A N   1 
ATOM   2047 C CA  . ALA A 1 294 ? -11.286 15.857  71.994 1.00 18.52 ? 274  ALA A CA  1 
ATOM   2048 C C   . ALA A 1 294 ? -11.589 15.725  73.496 1.00 18.05 ? 274  ALA A C   1 
ATOM   2049 O O   . ALA A 1 294 ? -12.396 14.897  73.918 1.00 18.73 ? 274  ALA A O   1 
ATOM   2050 C CB  . ALA A 1 294 ? -9.980  15.097  71.628 1.00 17.85 ? 274  ALA A CB  1 
ATOM   2051 N N   . GLU A 1 295 ? -10.931 16.544  74.294 1.00 18.41 ? 275  GLU A N   1 
ATOM   2052 C CA  . GLU A 1 295 ? -11.069 16.480  75.742 1.00 18.65 ? 275  GLU A CA  1 
ATOM   2053 C C   . GLU A 1 295 ? -12.482 16.857  76.195 1.00 18.61 ? 275  GLU A C   1 
ATOM   2054 O O   . GLU A 1 295 ? -13.057 16.207  77.065 1.00 17.99 ? 275  GLU A O   1 
ATOM   2055 C CB  . GLU A 1 295 ? -10.064 17.410  76.396 1.00 19.57 ? 275  GLU A CB  1 
ATOM   2056 C CG  . GLU A 1 295 ? -8.630  16.874  76.382 1.00 21.37 ? 275  GLU A CG  1 
ATOM   2057 C CD  . GLU A 1 295 ? -7.598  17.936  76.763 1.00 25.04 ? 275  GLU A CD  1 
ATOM   2058 O OE1 . GLU A 1 295 ? -7.908  19.145  76.686 1.00 25.53 ? 275  GLU A OE1 1 
ATOM   2059 O OE2 . GLU A 1 295 ? -6.468  17.546  77.133 1.00 24.72 ? 275  GLU A OE2 1 
ATOM   2060 N N   . TRP A 1 296 ? -13.005 17.909  75.583 1.00 17.46 ? 276  TRP A N   1 
ATOM   2061 C CA  . TRP A 1 296 ? -14.383 18.365  75.757 1.00 17.25 ? 276  TRP A CA  1 
ATOM   2062 C C   . TRP A 1 296 ? -15.395 17.277  75.309 1.00 17.46 ? 276  TRP A C   1 
ATOM   2063 O O   . TRP A 1 296 ? -16.340 16.955  76.032 1.00 17.03 ? 276  TRP A O   1 
ATOM   2064 C CB  . TRP A 1 296 ? -14.584 19.708  75.010 1.00 17.46 ? 276  TRP A CB  1 
ATOM   2065 C CG  . TRP A 1 296 ? -16.043 20.162  74.937 1.00 18.10 ? 276  TRP A CG  1 
ATOM   2066 C CD1 . TRP A 1 296 ? -16.760 20.696  75.950 1.00 21.39 ? 276  TRP A CD1 1 
ATOM   2067 C CD2 . TRP A 1 296 ? -16.935 20.094  73.803 1.00 18.78 ? 276  TRP A CD2 1 
ATOM   2068 N NE1 . TRP A 1 296 ? -18.064 20.938  75.548 1.00 22.50 ? 276  TRP A NE1 1 
ATOM   2069 C CE2 . TRP A 1 296 ? -18.194 20.592  74.232 1.00 18.70 ? 276  TRP A CE2 1 
ATOM   2070 C CE3 . TRP A 1 296 ? -16.806 19.636  72.495 1.00 17.81 ? 276  TRP A CE3 1 
ATOM   2071 C CZ2 . TRP A 1 296 ? -19.308 20.687  73.382 1.00 19.01 ? 276  TRP A CZ2 1 
ATOM   2072 C CZ3 . TRP A 1 296 ? -17.908 19.720  71.639 1.00 20.97 ? 276  TRP A CZ3 1 
ATOM   2073 C CH2 . TRP A 1 296 ? -19.156 20.248  72.097 1.00 16.87 ? 276  TRP A CH2 1 
ATOM   2074 N N   . LEU A 1 297 ? -15.189 16.686  74.135 1.00 17.51 ? 277  LEU A N   1 
ATOM   2075 C CA  . LEU A 1 297 ? -16.084 15.634  73.648 1.00 18.51 ? 277  LEU A CA  1 
ATOM   2076 C C   . LEU A 1 297 ? -16.100 14.402  74.562 1.00 18.89 ? 277  LEU A C   1 
ATOM   2077 O O   . LEU A 1 297 ? -17.126 13.766  74.731 1.00 20.12 ? 277  LEU A O   1 
ATOM   2078 C CB  . LEU A 1 297 ? -15.665 15.195  72.244 1.00 17.79 ? 277  LEU A CB  1 
ATOM   2079 C CG  . LEU A 1 297 ? -15.974 16.140  71.076 1.00 17.84 ? 277  LEU A CG  1 
ATOM   2080 C CD1 . LEU A 1 297 ? -15.204 15.720  69.796 1.00 17.67 ? 277  LEU A CD1 1 
ATOM   2081 C CD2 . LEU A 1 297 ? -17.461 16.190  70.798 1.00 18.19 ? 277  LEU A CD2 1 
ATOM   2082 N N   . ALA A 1 298 ? -14.955 14.060  75.127 1.00 19.98 ? 278  ALA A N   1 
ATOM   2083 C CA  . ALA A 1 298 ? -14.821 12.851  75.962 1.00 21.16 ? 278  ALA A CA  1 
ATOM   2084 C C   . ALA A 1 298 ? -15.685 12.944  77.237 1.00 21.82 ? 278  ALA A C   1 
ATOM   2085 O O   . ALA A 1 298 ? -16.018 11.941  77.858 1.00 20.95 ? 278  ALA A O   1 
ATOM   2086 C CB  . ALA A 1 298 ? -13.351 12.629  76.317 1.00 21.46 ? 278  ALA A CB  1 
ATOM   2087 N N   . GLU A 1 299 ? -16.003 14.171  77.602 1.00 21.40 ? 279  GLU A N   1 
ATOM   2088 C CA  . GLU A 1 299 ? -16.690 14.495  78.827 1.00 23.55 ? 279  GLU A CA  1 
ATOM   2089 C C   . GLU A 1 299 ? -18.176 14.789  78.489 1.00 23.24 ? 279  GLU A C   1 
ATOM   2090 O O   . GLU A 1 299 ? -18.993 15.003  79.374 1.00 22.85 ? 279  GLU A O   1 
ATOM   2091 C CB  . GLU A 1 299 ? -15.962 15.726  79.359 1.00 23.91 ? 279  GLU A CB  1 
ATOM   2092 C CG  . GLU A 1 299 ? -15.743 15.837  80.811 1.00 29.39 ? 279  GLU A CG  1 
ATOM   2093 C CD  . GLU A 1 299 ? -15.142 14.626  81.447 1.00 31.42 ? 279  GLU A CD  1 
ATOM   2094 O OE1 . GLU A 1 299 ? -14.150 14.093  80.926 1.00 34.53 ? 279  GLU A OE1 1 
ATOM   2095 O OE2 . GLU A 1 299 ? -15.662 14.236  82.491 1.00 31.02 ? 279  GLU A OE2 1 
ATOM   2096 N N   . HIS A 1 300 ? -18.529 14.791  77.207 1.00 22.40 ? 280  HIS A N   1 
ATOM   2097 C CA  . HIS A 1 300 ? -19.884 15.159  76.782 1.00 22.14 ? 280  HIS A CA  1 
ATOM   2098 C C   . HIS A 1 300 ? -20.927 14.039  76.967 1.00 22.80 ? 280  HIS A C   1 
ATOM   2099 O O   . HIS A 1 300 ? -20.721 12.901  76.520 1.00 22.47 ? 280  HIS A O   1 
ATOM   2100 C CB  . HIS A 1 300 ? -19.892 15.657  75.322 1.00 21.35 ? 280  HIS A CB  1 
ATOM   2101 C CG  . HIS A 1 300 ? -21.127 16.427  74.963 1.00 20.01 ? 280  HIS A CG  1 
ATOM   2102 N ND1 . HIS A 1 300 ? -21.185 17.805  74.981 1.00 19.68 ? 280  HIS A ND1 1 
ATOM   2103 C CD2 . HIS A 1 300 ? -22.376 16.005  74.648 1.00 21.02 ? 280  HIS A CD2 1 
ATOM   2104 C CE1 . HIS A 1 300 ? -22.407 18.203  74.681 1.00 20.50 ? 280  HIS A CE1 1 
ATOM   2105 N NE2 . HIS A 1 300 ? -23.151 17.128  74.477 1.00 21.82 ? 280  HIS A NE2 1 
ATOM   2106 N N   . PRO A 1 301 ? -22.084 14.366  77.582 1.00 23.24 ? 281  PRO A N   1 
ATOM   2107 C CA  . PRO A 1 301 ? -23.117 13.346  77.808 1.00 23.36 ? 281  PRO A CA  1 
ATOM   2108 C C   . PRO A 1 301 ? -23.628 12.604  76.562 1.00 22.72 ? 281  PRO A C   1 
ATOM   2109 O O   . PRO A 1 301 ? -24.105 11.478  76.706 1.00 23.55 ? 281  PRO A O   1 
ATOM   2110 C CB  . PRO A 1 301 ? -24.273 14.156  78.405 1.00 23.62 ? 281  PRO A CB  1 
ATOM   2111 C CG  . PRO A 1 301 ? -23.628 15.316  79.049 1.00 23.59 ? 281  PRO A CG  1 
ATOM   2112 C CD  . PRO A 1 301 ? -22.501 15.676  78.126 1.00 23.11 ? 281  PRO A CD  1 
ATOM   2113 N N   . GLN A 1 302 ? -23.527 13.212  75.379 1.00 22.50 ? 282  GLN A N   1 
ATOM   2114 C CA  . GLN A 1 302 ? -24.047 12.626  74.129 1.00 21.84 ? 282  GLN A CA  1 
ATOM   2115 C C   . GLN A 1 302 ? -22.999 11.820  73.352 1.00 21.78 ? 282  GLN A C   1 
ATOM   2116 O O   . GLN A 1 302 ? -23.259 11.297  72.249 1.00 23.19 ? 282  GLN A O   1 
ATOM   2117 C CB  . GLN A 1 302 ? -24.651 13.713  73.253 1.00 22.28 ? 282  GLN A CB  1 
ATOM   2118 C CG  . GLN A 1 302 ? -25.963 14.282  73.804 1.00 20.79 ? 282  GLN A CG  1 
ATOM   2119 C CD  . GLN A 1 302 ? -26.503 15.464  73.014 1.00 20.33 ? 282  GLN A CD  1 
ATOM   2120 O OE1 . GLN A 1 302 ? -26.989 15.325  71.876 1.00 22.93 ? 282  GLN A OE1 1 
ATOM   2121 N NE2 . GLN A 1 302 ? -26.459 16.622  73.628 1.00 16.92 ? 282  GLN A NE2 1 
ATOM   2122 N N   . VAL A 1 303 ? -21.819 11.695  73.947 1.00 21.07 ? 283  VAL A N   1 
ATOM   2123 C CA  . VAL A 1 303 ? -20.669 11.083  73.292 1.00 20.33 ? 283  VAL A CA  1 
ATOM   2124 C C   . VAL A 1 303 ? -20.281 9.762   73.998 1.00 20.62 ? 283  VAL A C   1 
ATOM   2125 O O   . VAL A 1 303 ? -20.084 9.746   75.212 1.00 19.81 ? 283  VAL A O   1 
ATOM   2126 C CB  . VAL A 1 303 ? -19.460 12.085  73.261 1.00 20.48 ? 283  VAL A CB  1 
ATOM   2127 C CG1 . VAL A 1 303 ? -18.161 11.411  72.735 1.00 18.99 ? 283  VAL A CG1 1 
ATOM   2128 C CG2 . VAL A 1 303 ? -19.818 13.331  72.443 1.00 19.76 ? 283  VAL A CG2 1 
ATOM   2129 N N   . ALA A 1 304 ? -20.151 8.680   73.220 1.00 20.70 ? 284  ALA A N   1 
ATOM   2130 C CA  . ALA A 1 304 ? -19.800 7.350   73.745 1.00 21.23 ? 284  ALA A CA  1 
ATOM   2131 C C   . ALA A 1 304 ? -18.294 7.210   73.989 1.00 22.14 ? 284  ALA A C   1 
ATOM   2132 O O   . ALA A 1 304 ? -17.871 6.736   75.064 1.00 22.73 ? 284  ALA A O   1 
ATOM   2133 C CB  . ALA A 1 304 ? -20.290 6.257   72.791 1.00 21.84 ? 284  ALA A CB  1 
ATOM   2134 N N   . ARG A 1 305 ? -17.507 7.625   72.984 1.00 21.50 ? 285  ARG A N   1 
ATOM   2135 C CA  . ARG A 1 305 ? -16.032 7.452   72.960 1.00 21.37 ? 285  ARG A CA  1 
ATOM   2136 C C   . ARG A 1 305 ? -15.406 8.462   72.013 1.00 20.24 ? 285  ARG A C   1 
ATOM   2137 O O   . ARG A 1 305 ? -16.032 8.876   71.042 1.00 19.14 ? 285  ARG A O   1 
ATOM   2138 C CB  . ARG A 1 305 ? -15.681 6.041   72.462 1.00 22.58 ? 285  ARG A CB  1 
ATOM   2139 C CG  . ARG A 1 305 ? -14.212 5.707   72.494 1.00 26.93 ? 285  ARG A CG  1 
ATOM   2140 C CD  . ARG A 1 305 ? -14.040 4.213   72.320 1.00 34.71 ? 285  ARG A CD  1 
ATOM   2141 N NE  . ARG A 1 305 ? -13.982 3.740   70.935 1.00 36.46 ? 285  ARG A NE  1 
ATOM   2142 C CZ  . ARG A 1 305 ? -14.570 2.610   70.524 1.00 40.63 ? 285  ARG A CZ  1 
ATOM   2143 N NH1 . ARG A 1 305 ? -15.309 1.896   71.361 1.00 40.20 ? 285  ARG A NH1 1 
ATOM   2144 N NH2 . ARG A 1 305 ? -14.455 2.204   69.265 1.00 43.46 ? 285  ARG A NH2 1 
ATOM   2145 N N   . VAL A 1 306 ? -14.145 8.798   72.275 1.00 19.53 ? 286  VAL A N   1 
ATOM   2146 C CA  . VAL A 1 306 ? -13.356 9.658   71.404 1.00 18.89 ? 286  VAL A CA  1 
ATOM   2147 C C   . VAL A 1 306 ? -12.090 8.920   70.973 1.00 18.65 ? 286  VAL A C   1 
ATOM   2148 O O   . VAL A 1 306 ? -11.413 8.327   71.831 1.00 17.80 ? 286  VAL A O   1 
ATOM   2149 C CB  . VAL A 1 306 ? -13.001 10.984  72.112 1.00 18.39 ? 286  VAL A CB  1 
ATOM   2150 C CG1 . VAL A 1 306 ? -12.178 11.901  71.190 1.00 18.30 ? 286  VAL A CG1 1 
ATOM   2151 C CG2 . VAL A 1 306 ? -14.315 11.696  72.523 1.00 17.31 ? 286  VAL A CG2 1 
ATOM   2152 N N   . ASN A 1 307 ? -11.824 8.935   69.660 1.00 18.11 ? 287  ASN A N   1 
ATOM   2153 C CA  . ASN A 1 307 ? -10.673 8.270   69.044 1.00 18.00 ? 287  ASN A CA  1 
ATOM   2154 C C   . ASN A 1 307 ? -9.690  9.352   68.643 1.00 18.24 ? 287  ASN A C   1 
ATOM   2155 O O   . ASN A 1 307 ? -9.721  9.840   67.514 1.00 17.07 ? 287  ASN A O   1 
ATOM   2156 C CB  . ASN A 1 307 ? -11.115 7.487   67.794 1.00 19.10 ? 287  ASN A CB  1 
ATOM   2157 C CG  . ASN A 1 307 ? -12.261 6.523   68.070 1.00 18.20 ? 287  ASN A CG  1 
ATOM   2158 O OD1 . ASN A 1 307 ? -13.239 6.452   67.304 1.00 22.60 ? 287  ASN A OD1 1 
ATOM   2159 N ND2 . ASN A 1 307 ? -12.146 5.769   69.147 1.00 14.68 ? 287  ASN A ND2 1 
ATOM   2160 N N   . HIS A 1 308 ? -8.832  9.739   69.572 1.00 19.45 ? 288  HIS A N   1 
ATOM   2161 C CA  . HIS A 1 308 ? -7.775  10.712  69.286 1.00 20.17 ? 288  HIS A CA  1 
ATOM   2162 C C   . HIS A 1 308 ? -6.434  10.211  69.822 1.00 20.47 ? 288  HIS A C   1 
ATOM   2163 O O   . HIS A 1 308 ? -6.253  10.106  71.023 1.00 20.93 ? 288  HIS A O   1 
ATOM   2164 C CB  . HIS A 1 308 ? -8.099  12.093  69.866 1.00 20.12 ? 288  HIS A CB  1 
ATOM   2165 C CG  . HIS A 1 308 ? -7.159  13.163  69.398 1.00 19.84 ? 288  HIS A CG  1 
ATOM   2166 N ND1 . HIS A 1 308 ? -7.600  14.357  68.860 1.00 21.22 ? 288  HIS A ND1 1 
ATOM   2167 C CD2 . HIS A 1 308 ? -5.809  13.198  69.338 1.00 16.64 ? 288  HIS A CD2 1 
ATOM   2168 C CE1 . HIS A 1 308 ? -6.555  15.086  68.505 1.00 19.72 ? 288  HIS A CE1 1 
ATOM   2169 N NE2 . HIS A 1 308 ? -5.460  14.397  68.767 1.00 22.03 ? 288  HIS A NE2 1 
ATOM   2170 N N   . PRO A 1 309 ? -5.486  9.933   68.915 1.00 20.24 ? 289  PRO A N   1 
ATOM   2171 C CA  . PRO A 1 309 ? -4.182  9.364   69.309 1.00 19.79 ? 289  PRO A CA  1 
ATOM   2172 C C   . PRO A 1 309 ? -3.539  10.053  70.529 1.00 20.37 ? 289  PRO A C   1 
ATOM   2173 O O   . PRO A 1 309 ? -2.861  9.385   71.325 1.00 20.88 ? 289  PRO A O   1 
ATOM   2174 C CB  . PRO A 1 309 ? -3.344  9.580   68.061 1.00 20.50 ? 289  PRO A CB  1 
ATOM   2175 C CG  . PRO A 1 309 ? -4.373  9.435   66.913 1.00 20.08 ? 289  PRO A CG  1 
ATOM   2176 C CD  . PRO A 1 309 ? -5.551  10.198  67.466 1.00 19.70 ? 289  PRO A CD  1 
ATOM   2177 N N   . ALA A 1 310 ? -3.759  11.357  70.677 1.00 19.48 ? 290  ALA A N   1 
ATOM   2178 C CA  . ALA A 1 310 ? -3.138  12.139  71.777 1.00 19.78 ? 290  ALA A CA  1 
ATOM   2179 C C   . ALA A 1 310 ? -3.886  12.081  73.095 1.00 19.72 ? 290  ALA A C   1 
ATOM   2180 O O   . ALA A 1 310 ? -3.396  12.534  74.126 1.00 19.88 ? 290  ALA A O   1 
ATOM   2181 C CB  . ALA A 1 310 ? -2.915  13.609  71.352 1.00 18.91 ? 290  ALA A CB  1 
ATOM   2182 N N   . LEU A 1 311 ? -5.093  11.535  73.053 1.00 20.49 ? 291  LEU A N   1 
ATOM   2183 C CA  . LEU A 1 311 ? -5.909  11.492  74.240 1.00 20.85 ? 291  LEU A CA  1 
ATOM   2184 C C   . LEU A 1 311 ? -5.677  10.205  75.010 1.00 21.10 ? 291  LEU A C   1 
ATOM   2185 O O   . LEU A 1 311 ? -5.884  9.091   74.460 1.00 20.56 ? 291  LEU A O   1 
ATOM   2186 C CB  . LEU A 1 311 ? -7.392  11.649  73.889 1.00 20.94 ? 291  LEU A CB  1 
ATOM   2187 C CG  . LEU A 1 311 ? -8.445  11.776  74.996 1.00 20.58 ? 291  LEU A CG  1 
ATOM   2188 C CD1 . LEU A 1 311 ? -8.489  13.188  75.595 1.00 21.55 ? 291  LEU A CD1 1 
ATOM   2189 C CD2 . LEU A 1 311 ? -9.787  11.415  74.399 1.00 19.07 ? 291  LEU A CD2 1 
ATOM   2190 N N   . PRO A 1 312 ? -5.287  10.341  76.294 1.00 21.33 ? 292  PRO A N   1 
ATOM   2191 C CA  . PRO A 1 312 ? -5.160  9.164   77.182 1.00 22.37 ? 292  PRO A CA  1 
ATOM   2192 C C   . PRO A 1 312 ? -6.373  8.222   77.079 1.00 22.71 ? 292  PRO A C   1 
ATOM   2193 O O   . PRO A 1 312 ? -7.528  8.682   77.107 1.00 24.27 ? 292  PRO A O   1 
ATOM   2194 C CB  . PRO A 1 312 ? -5.081  9.788   78.579 1.00 22.57 ? 292  PRO A CB  1 
ATOM   2195 C CG  . PRO A 1 312 ? -4.466  11.156  78.333 1.00 22.86 ? 292  PRO A CG  1 
ATOM   2196 C CD  . PRO A 1 312 ? -4.965  11.611  76.992 1.00 21.28 ? 292  PRO A CD  1 
ATOM   2197 N N   . GLY A 1 313 ? -6.136  6.925   76.924 1.00 22.55 ? 293  GLY A N   1 
ATOM   2198 C CA  . GLY A 1 313 ? -7.239  5.971   76.776 1.00 22.99 ? 293  GLY A CA  1 
ATOM   2199 C C   . GLY A 1 313 ? -7.620  5.598   75.343 1.00 23.08 ? 293  GLY A C   1 
ATOM   2200 O O   . GLY A 1 313 ? -8.259  4.563   75.114 1.00 22.67 ? 293  GLY A O   1 
ATOM   2201 N N   . SER A 1 314 ? -7.243  6.426   74.374 1.00 22.57 ? 294  SER A N   1 
ATOM   2202 C CA  . SER A 1 314 ? -7.457  6.082   72.970 1.00 23.01 ? 294  SER A CA  1 
ATOM   2203 C C   . SER A 1 314 ? -6.602  4.863   72.527 1.00 23.25 ? 294  SER A C   1 
ATOM   2204 O O   . SER A 1 314 ? -5.507  4.610   73.069 1.00 24.17 ? 294  SER A O   1 
ATOM   2205 C CB  . SER A 1 314 ? -7.260  7.305   72.068 1.00 22.58 ? 294  SER A CB  1 
ATOM   2206 O OG  . SER A 1 314 ? -7.916  7.160   70.822 1.00 21.41 ? 294  SER A OG  1 
ATOM   2207 N N   . LYS A 1 315 ? -7.113  4.110   71.548 1.00 23.29 ? 295  LYS A N   1 
ATOM   2208 C CA  . LYS A 1 315 ? -6.482  2.850   71.159 1.00 22.39 ? 295  LYS A CA  1 
ATOM   2209 C C   . LYS A 1 315 ? -5.108  3.126   70.603 1.00 22.11 ? 295  LYS A C   1 
ATOM   2210 O O   . LYS A 1 315 ? -4.973  3.813   69.597 1.00 21.98 ? 295  LYS A O   1 
ATOM   2211 C CB  . LYS A 1 315 ? -7.335  2.064   70.155 1.00 22.35 ? 295  LYS A CB  1 
ATOM   2212 C CG  . LYS A 1 315 ? -8.558  1.440   70.805 1.00 22.71 ? 295  LYS A CG  1 
ATOM   2213 C CD  . LYS A 1 315 ? -9.252  0.449   69.906 1.00 24.29 ? 295  LYS A CD  1 
ATOM   2214 C CE  . LYS A 1 315 ? -10.697 0.297   70.290 1.00 25.86 ? 295  LYS A CE  1 
ATOM   2215 N NZ  . LYS A 1 315 ? -11.282 -0.808  69.486 1.00 27.16 ? 295  LYS A NZ  1 
ATOM   2216 N N   . GLY A 1 316 ? -4.087  2.611   71.288 1.00 22.44 ? 296  GLY A N   1 
ATOM   2217 C CA  . GLY A 1 316 ? -2.695  2.837   70.900 1.00 21.52 ? 296  GLY A CA  1 
ATOM   2218 C C   . GLY A 1 316 ? -2.093  4.153   71.384 1.00 21.68 ? 296  GLY A C   1 
ATOM   2219 O O   . GLY A 1 316 ? -0.987  4.531   70.968 1.00 21.45 ? 296  GLY A O   1 
ATOM   2220 N N   . HIS A 1 317 ? -2.786  4.870   72.272 1.00 21.18 ? 297  HIS A N   1 
ATOM   2221 C CA  . HIS A 1 317 ? -2.254  6.150   72.747 1.00 21.40 ? 297  HIS A CA  1 
ATOM   2222 C C   . HIS A 1 317 ? -0.855  5.995   73.372 1.00 21.40 ? 297  HIS A C   1 
ATOM   2223 O O   . HIS A 1 317 ? 0.027   6.899   73.238 1.00 22.77 ? 297  HIS A O   1 
ATOM   2224 C CB  . HIS A 1 317 ? -3.210  6.822   73.750 1.00 21.65 ? 297  HIS A CB  1 
ATOM   2225 C CG  . HIS A 1 317 ? -2.584  7.974   74.488 1.00 22.10 ? 297  HIS A CG  1 
ATOM   2226 N ND1 . HIS A 1 317 ? -2.169  7.887   75.806 1.00 22.11 ? 297  HIS A ND1 1 
ATOM   2227 C CD2 . HIS A 1 317 ? -2.274  9.229   74.077 1.00 20.45 ? 297  HIS A CD2 1 
ATOM   2228 C CE1 . HIS A 1 317 ? -1.669  9.049   76.185 1.00 17.39 ? 297  HIS A CE1 1 
ATOM   2229 N NE2 . HIS A 1 317 ? -1.701  9.874   75.150 1.00 23.53 ? 297  HIS A NE2 1 
ATOM   2230 N N   . GLU A 1 318 ? -0.633  4.865   74.048 1.00 20.36 ? 298  GLU A N   1 
ATOM   2231 C CA  . GLU A 1 318 ? 0.690   4.595   74.624 1.00 21.51 ? 298  GLU A CA  1 
ATOM   2232 C C   . GLU A 1 318 ? 1.811   4.601   73.568 1.00 20.91 ? 298  GLU A C   1 
ATOM   2233 O O   . GLU A 1 318 ? 2.927   5.117   73.827 1.00 21.26 ? 298  GLU A O   1 
ATOM   2234 C CB  . GLU A 1 318 ? 0.703   3.268   75.395 1.00 21.54 ? 298  GLU A CB  1 
ATOM   2235 C CG  . GLU A 1 318 ? -0.067  3.315   76.723 1.00 25.78 ? 298  GLU A CG  1 
ATOM   2236 C CD  . GLU A 1 318 ? 0.363   4.458   77.633 1.00 26.55 ? 298  GLU A CD  1 
ATOM   2237 O OE1 . GLU A 1 318 ? 1.566   4.630   77.837 1.00 27.79 ? 298  GLU A OE1 1 
ATOM   2238 O OE2 . GLU A 1 318 ? -0.510  5.177   78.159 1.00 32.01 ? 298  GLU A OE2 1 
ATOM   2239 N N   . PHE A 1 319 ? 1.511   4.061   72.386 1.00 20.08 ? 299  PHE A N   1 
ATOM   2240 C CA  . PHE A 1 319 ? 2.461   4.057   71.260 1.00 20.79 ? 299  PHE A CA  1 
ATOM   2241 C C   . PHE A 1 319 ? 2.621   5.454   70.651 1.00 21.04 ? 299  PHE A C   1 
ATOM   2242 O O   . PHE A 1 319 ? 3.752   5.862   70.340 1.00 20.79 ? 299  PHE A O   1 
ATOM   2243 C CB  . PHE A 1 319 ? 2.067   2.991   70.211 1.00 20.68 ? 299  PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 319 ? 1.747   1.663   70.830 1.00 21.99 ? 299  PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 319 ? 2.684   1.029   71.655 1.00 21.01 ? 299  PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 319 ? 0.487   1.080   70.684 1.00 21.26 ? 299  PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 319 ? 2.383   -0.190  72.301 1.00 21.35 ? 299  PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 319 ? 0.189   -0.140  71.326 1.00 22.95 ? 299  PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 319 ? 1.134   -0.774  72.115 1.00 21.66 ? 299  PHE A CZ  1 
ATOM   2250 N N   . TRP A 1 320 ? 1.509   6.196   70.517 1.00 19.96 ? 300  TRP A N   1 
ATOM   2251 C CA  . TRP A 1 320 ? 1.582   7.598   70.078 1.00 20.13 ? 300  TRP A CA  1 
ATOM   2252 C C   . TRP A 1 320 ? 2.533   8.408   70.995 1.00 20.20 ? 300  TRP A C   1 
ATOM   2253 O O   . TRP A 1 320 ? 3.465   9.101   70.520 1.00 18.78 ? 300  TRP A O   1 
ATOM   2254 C CB  . TRP A 1 320 ? 0.175   8.262   69.973 1.00 19.47 ? 300  TRP A CB  1 
ATOM   2255 C CG  . TRP A 1 320 ? 0.306   9.731   69.677 1.00 20.68 ? 300  TRP A CG  1 
ATOM   2256 C CD1 . TRP A 1 320 ? 0.418   10.323  68.436 1.00 21.59 ? 300  TRP A CD1 1 
ATOM   2257 C CD2 . TRP A 1 320 ? 0.468   10.799  70.640 1.00 19.91 ? 300  TRP A CD2 1 
ATOM   2258 N NE1 . TRP A 1 320 ? 0.592   11.684  68.574 1.00 22.68 ? 300  TRP A NE1 1 
ATOM   2259 C CE2 . TRP A 1 320 ? 0.645   11.999  69.907 1.00 21.24 ? 300  TRP A CE2 1 
ATOM   2260 C CE3 . TRP A 1 320 ? 0.463   10.853  72.040 1.00 20.94 ? 300  TRP A CE3 1 
ATOM   2261 C CZ2 . TRP A 1 320 ? 0.801   13.245  70.529 1.00 21.24 ? 300  TRP A CZ2 1 
ATOM   2262 C CZ3 . TRP A 1 320 ? 0.625   12.091  72.665 1.00 23.43 ? 300  TRP A CZ3 1 
ATOM   2263 C CH2 . TRP A 1 320 ? 0.796   13.270  71.903 1.00 22.35 ? 300  TRP A CH2 1 
ATOM   2264 N N   . LYS A 1 321 ? 2.316   8.283   72.301 1.00 19.83 ? 301  LYS A N   1 
ATOM   2265 C CA  . LYS A 1 321 ? 3.079   9.040   73.311 1.00 21.15 ? 301  LYS A CA  1 
ATOM   2266 C C   . LYS A 1 321 ? 4.577   8.693   73.257 1.00 20.72 ? 301  LYS A C   1 
ATOM   2267 O O   . LYS A 1 321 ? 5.431   9.575   73.427 1.00 21.10 ? 301  LYS A O   1 
ATOM   2268 C CB  . LYS A 1 321 ? 2.486   8.787   74.709 1.00 21.62 ? 301  LYS A CB  1 
ATOM   2269 C CG  . LYS A 1 321 ? 2.997   9.708   75.807 1.00 24.06 ? 301  LYS A CG  1 
ATOM   2270 C CD  . LYS A 1 321 ? 2.539   9.228   77.195 1.00 28.88 ? 301  LYS A CD  1 
ATOM   2271 C CE  . LYS A 1 321 ? 2.420   10.401  78.173 1.00 34.40 ? 301  LYS A CE  1 
ATOM   2272 N NZ  . LYS A 1 321 ? 3.341   10.422  79.385 1.00 38.51 ? 301  LYS A NZ  1 
ATOM   2273 N N   . ARG A 1 322 ? 4.876   7.423   72.997 1.00 20.21 ? 302  ARG A N   1 
ATOM   2274 C CA  . ARG A 1 322 ? 6.255   6.923   72.933 1.00 20.89 ? 302  ARG A CA  1 
ATOM   2275 C C   . ARG A 1 322 ? 6.968   7.253   71.605 1.00 20.95 ? 302  ARG A C   1 
ATOM   2276 O O   . ARG A 1 322 ? 8.137   7.655   71.608 1.00 20.78 ? 302  ARG A O   1 
ATOM   2277 C CB  . ARG A 1 322 ? 6.259   5.405   73.151 1.00 21.32 ? 302  ARG A CB  1 
ATOM   2278 C CG  . ARG A 1 322 ? 7.670   4.779   73.330 1.00 21.62 ? 302  ARG A CG  1 
ATOM   2279 C CD  . ARG A 1 322 ? 7.610   3.279   73.308 1.00 22.43 ? 302  ARG A CD  1 
ATOM   2280 N NE  . ARG A 1 322 ? 7.110   2.787   72.007 1.00 21.08 ? 302  ARG A NE  1 
ATOM   2281 C CZ  . ARG A 1 322 ? 6.672   1.552   71.784 1.00 22.65 ? 302  ARG A CZ  1 
ATOM   2282 N NH1 . ARG A 1 322 ? 6.649   0.641   72.763 1.00 23.72 ? 302  ARG A NH1 1 
ATOM   2283 N NH2 . ARG A 1 322 ? 6.235   1.222   70.575 1.00 21.17 ? 302  ARG A NH2 1 
ATOM   2284 N N   . ASP A 1 323 ? 6.273   7.081   70.487 1.00 19.96 ? 303  ASP A N   1 
ATOM   2285 C CA  . ASP A 1 323 ? 6.910   7.090   69.162 1.00 20.08 ? 303  ASP A CA  1 
ATOM   2286 C C   . ASP A 1 323 ? 6.704   8.368   68.339 1.00 20.73 ? 303  ASP A C   1 
ATOM   2287 O O   . ASP A 1 323 ? 7.386   8.570   67.333 1.00 21.86 ? 303  ASP A O   1 
ATOM   2288 C CB  . ASP A 1 323 ? 6.452   5.864   68.333 1.00 19.04 ? 303  ASP A CB  1 
ATOM   2289 C CG  . ASP A 1 323 ? 6.719   4.547   69.041 1.00 21.08 ? 303  ASP A CG  1 
ATOM   2290 O OD1 . ASP A 1 323 ? 7.619   4.488   69.924 1.00 19.04 ? 303  ASP A OD1 1 
ATOM   2291 O OD2 . ASP A 1 323 ? 6.058   3.561   68.711 1.00 18.99 ? 303  ASP A OD2 1 
ATOM   2292 N N   . PHE A 1 324 ? 5.741   9.202   68.717 1.00 21.27 ? 304  PHE A N   1 
ATOM   2293 C CA  . PHE A 1 324 ? 5.455   10.414  67.953 1.00 21.60 ? 304  PHE A CA  1 
ATOM   2294 C C   . PHE A 1 324 ? 6.015   11.657  68.686 1.00 22.80 ? 304  PHE A C   1 
ATOM   2295 O O   . PHE A 1 324 ? 6.186   11.653  69.905 1.00 23.34 ? 304  PHE A O   1 
ATOM   2296 C CB  . PHE A 1 324 ? 3.928   10.602  67.729 1.00 20.82 ? 304  PHE A CB  1 
ATOM   2297 C CG  . PHE A 1 324 ? 3.284   9.642   66.724 1.00 20.59 ? 304  PHE A CG  1 
ATOM   2298 C CD1 . PHE A 1 324 ? 3.310   8.258   66.915 1.00 18.60 ? 304  PHE A CD1 1 
ATOM   2299 C CD2 . PHE A 1 324 ? 2.540   10.155  65.654 1.00 21.95 ? 304  PHE A CD2 1 
ATOM   2300 C CE1 . PHE A 1 324 ? 2.664   7.392   66.004 1.00 20.72 ? 304  PHE A CE1 1 
ATOM   2301 C CE2 . PHE A 1 324 ? 1.857   9.307   64.727 1.00 21.51 ? 304  PHE A CE2 1 
ATOM   2302 C CZ  . PHE A 1 324 ? 1.928   7.910   64.905 1.00 21.89 ? 304  PHE A CZ  1 
ATOM   2303 N N   . THR A 1 325 ? 6.284   12.721  67.940 1.00 23.83 ? 305  THR A N   1 
ATOM   2304 C CA  . THR A 1 325 ? 6.724   13.983  68.515 1.00 23.79 ? 305  THR A CA  1 
ATOM   2305 C C   . THR A 1 325 ? 5.628   15.060  68.466 1.00 23.45 ? 305  THR A C   1 
ATOM   2306 O O   . THR A 1 325 ? 5.832   16.226  68.852 1.00 24.75 ? 305  THR A O   1 
ATOM   2307 C CB  . THR A 1 325 ? 8.011   14.449  67.816 1.00 24.75 ? 305  THR A CB  1 
ATOM   2308 O OG1 . THR A 1 325 ? 7.828   14.365  66.393 1.00 25.48 ? 305  THR A OG1 1 
ATOM   2309 C CG2 . THR A 1 325 ? 9.112   13.532  68.199 1.00 25.14 ? 305  THR A CG2 1 
ATOM   2310 N N   . GLY A 1 326 ? 4.437   14.655  68.052 1.00 22.81 ? 306  GLY A N   1 
ATOM   2311 C CA  . GLY A 1 326 ? 3.349   15.590  67.988 1.00 20.76 ? 306  GLY A CA  1 
ATOM   2312 C C   . GLY A 1 326 ? 2.094   14.915  67.481 1.00 20.48 ? 306  GLY A C   1 
ATOM   2313 O O   . GLY A 1 326 ? 2.089   13.718  67.207 1.00 20.16 ? 306  GLY A O   1 
ATOM   2314 N N   . SER A 1 327 ? 1.049   15.724  67.348 1.00 19.90 ? 307  SER A N   1 
ATOM   2315 C CA  . SER A 1 327 ? -0.237  15.273  66.828 1.00 19.16 ? 307  SER A CA  1 
ATOM   2316 C C   . SER A 1 327 ? -0.680  16.213  65.697 1.00 19.82 ? 307  SER A C   1 
ATOM   2317 O O   . SER A 1 327 ? -0.226  17.375  65.644 1.00 20.58 ? 307  SER A O   1 
ATOM   2318 C CB  . SER A 1 327 ? -1.284  15.262  67.954 1.00 19.57 ? 307  SER A CB  1 
ATOM   2319 O OG  . SER A 1 327 ? -2.590  15.082  67.386 1.00 17.20 ? 307  SER A OG  1 
ATOM   2320 N N   . SER A 1 328 ? -1.514  15.721  64.788 1.00 18.31 ? 308  SER A N   1 
ATOM   2321 C CA  . SER A 1 328 ? -2.168  16.606  63.835 1.00 18.38 ? 308  SER A CA  1 
ATOM   2322 C C   . SER A 1 328 ? -3.617  16.852  64.313 1.00 19.02 ? 308  SER A C   1 
ATOM   2323 O O   . SER A 1 328 ? -3.908  16.695  65.528 1.00 19.57 ? 308  SER A O   1 
ATOM   2324 C CB  . SER A 1 328 ? -2.073  16.078  62.385 1.00 18.17 ? 308  SER A CB  1 
ATOM   2325 O OG  . SER A 1 328 ? -2.730  14.831  62.216 1.00 19.94 ? 308  SER A OG  1 
ATOM   2326 N N   . GLY A 1 329 ? -4.518  17.213  63.393 1.00 17.99 ? 309  GLY A N   1 
ATOM   2327 C CA  . GLY A 1 329 ? -5.865  17.666  63.790 1.00 17.78 ? 309  GLY A CA  1 
ATOM   2328 C C   . GLY A 1 329 ? -7.025  16.796  63.380 1.00 18.37 ? 309  GLY A C   1 
ATOM   2329 O O   . GLY A 1 329 ? -8.187  17.187  63.568 1.00 19.29 ? 309  GLY A O   1 
ATOM   2330 N N   . LEU A 1 330 ? -6.712  15.627  62.821 1.00 17.82 ? 310  LEU A N   1 
ATOM   2331 C CA  . LEU A 1 330 ? -7.740  14.683  62.395 1.00 17.40 ? 310  LEU A CA  1 
ATOM   2332 C C   . LEU A 1 330 ? -8.028  13.621  63.472 1.00 17.81 ? 310  LEU A C   1 
ATOM   2333 O O   . LEU A 1 330 ? -7.127  12.939  63.925 1.00 16.20 ? 310  LEU A O   1 
ATOM   2334 C CB  . LEU A 1 330 ? -7.327  13.979  61.097 1.00 17.85 ? 310  LEU A CB  1 
ATOM   2335 C CG  . LEU A 1 330 ? -8.413  13.116  60.436 1.00 17.53 ? 310  LEU A CG  1 
ATOM   2336 C CD1 . LEU A 1 330 ? -9.350  14.044  59.649 1.00 17.27 ? 310  LEU A CD1 1 
ATOM   2337 C CD2 . LEU A 1 330 ? -7.797  12.028  59.491 1.00 16.91 ? 310  LEU A CD2 1 
ATOM   2338 N N   . PHE A 1 331 ? -9.292  13.454  63.868 1.00 17.39 ? 311  PHE A N   1 
ATOM   2339 C CA  . PHE A 1 331 ? -9.630  12.385  64.815 1.00 18.17 ? 311  PHE A CA  1 
ATOM   2340 C C   . PHE A 1 331 ? -11.113 12.044  64.639 1.00 18.08 ? 311  PHE A C   1 
ATOM   2341 O O   . PHE A 1 331 ? -11.767 12.580  63.727 1.00 18.79 ? 311  PHE A O   1 
ATOM   2342 C CB  . PHE A 1 331 ? -9.277  12.796  66.265 1.00 18.44 ? 311  PHE A CB  1 
ATOM   2343 C CG  . PHE A 1 331 ? -10.226 13.822  66.888 1.00 18.70 ? 311  PHE A CG  1 
ATOM   2344 C CD1 . PHE A 1 331 ? -10.120 15.189  66.573 1.00 19.68 ? 311  PHE A CD1 1 
ATOM   2345 C CD2 . PHE A 1 331 ? -11.197 13.416  67.826 1.00 20.16 ? 311  PHE A CD2 1 
ATOM   2346 C CE1 . PHE A 1 331 ? -10.936 16.140  67.154 1.00 20.10 ? 311  PHE A CE1 1 
ATOM   2347 C CE2 . PHE A 1 331 ? -12.047 14.378  68.423 1.00 18.87 ? 311  PHE A CE2 1 
ATOM   2348 C CZ  . PHE A 1 331 ? -11.911 15.747  68.074 1.00 18.92 ? 311  PHE A CZ  1 
ATOM   2349 N N   . SER A 1 332 ? -11.657 11.173  65.483 1.00 17.63 ? 312  SER A N   1 
ATOM   2350 C CA  . SER A 1 332 ? -13.084 10.838  65.389 1.00 17.76 ? 312  SER A CA  1 
ATOM   2351 C C   . SER A 1 332 ? -13.677 10.561  66.763 1.00 17.81 ? 312  SER A C   1 
ATOM   2352 O O   . SER A 1 332 ? -12.951 10.457  67.740 1.00 18.11 ? 312  SER A O   1 
ATOM   2353 C CB  . SER A 1 332 ? -13.363 9.661   64.439 1.00 17.68 ? 312  SER A CB  1 
ATOM   2354 O OG  . SER A 1 332 ? -12.954 8.412   64.979 1.00 17.77 ? 312  SER A OG  1 
ATOM   2355 N N   . PHE A 1 333 ? -15.006 10.509  66.835 1.00 16.94 ? 313  PHE A N   1 
ATOM   2356 C CA  . PHE A 1 333 ? -15.667 10.141  68.071 1.00 18.09 ? 313  PHE A CA  1 
ATOM   2357 C C   . PHE A 1 333 ? -16.947 9.397   67.704 1.00 17.93 ? 313  PHE A C   1 
ATOM   2358 O O   . PHE A 1 333 ? -17.434 9.506   66.558 1.00 18.11 ? 313  PHE A O   1 
ATOM   2359 C CB  . PHE A 1 333 ? -15.956 11.394  68.963 1.00 18.21 ? 313  PHE A CB  1 
ATOM   2360 C CG  . PHE A 1 333 ? -16.964 12.368  68.378 1.00 18.45 ? 313  PHE A CG  1 
ATOM   2361 C CD1 . PHE A 1 333 ? -16.568 13.394  67.535 1.00 21.02 ? 313  PHE A CD1 1 
ATOM   2362 C CD2 . PHE A 1 333 ? -18.318 12.264  68.700 1.00 23.13 ? 313  PHE A CD2 1 
ATOM   2363 C CE1 . PHE A 1 333 ? -17.485 14.316  67.020 1.00 21.37 ? 313  PHE A CE1 1 
ATOM   2364 C CE2 . PHE A 1 333 ? -19.235 13.153  68.185 1.00 19.55 ? 313  PHE A CE2 1 
ATOM   2365 C CZ  . PHE A 1 333 ? -18.830 14.193  67.362 1.00 18.63 ? 313  PHE A CZ  1 
ATOM   2366 N N   . VAL A 1 334 ? -17.452 8.655   68.671 1.00 18.49 ? 314  VAL A N   1 
ATOM   2367 C CA  . VAL A 1 334 ? -18.691 7.863   68.541 1.00 18.78 ? 314  VAL A CA  1 
ATOM   2368 C C   . VAL A 1 334 ? -19.821 8.483   69.376 1.00 19.43 ? 314  VAL A C   1 
ATOM   2369 O O   . VAL A 1 334 ? -19.680 8.684   70.587 1.00 19.07 ? 314  VAL A O   1 
ATOM   2370 C CB  . VAL A 1 334 ? -18.444 6.360   68.927 1.00 19.09 ? 314  VAL A CB  1 
ATOM   2371 C CG1 . VAL A 1 334 ? -19.670 5.512   68.690 1.00 19.19 ? 314  VAL A CG1 1 
ATOM   2372 C CG2 . VAL A 1 334 ? -17.241 5.772   68.100 1.00 17.32 ? 314  VAL A CG2 1 
ATOM   2373 N N   . LEU A 1 335 ? -20.931 8.788   68.700 1.00 19.70 ? 315  LEU A N   1 
ATOM   2374 C CA  . LEU A 1 335 ? -22.139 9.266   69.362 1.00 20.14 ? 315  LEU A CA  1 
ATOM   2375 C C   . LEU A 1 335 ? -22.717 8.117   70.154 1.00 21.58 ? 315  LEU A C   1 
ATOM   2376 O O   . LEU A 1 335 ? -22.545 6.942   69.764 1.00 19.72 ? 315  LEU A O   1 
ATOM   2377 C CB  . LEU A 1 335 ? -23.170 9.742   68.328 1.00 20.39 ? 315  LEU A CB  1 
ATOM   2378 C CG  . LEU A 1 335 ? -22.803 11.048  67.608 1.00 19.42 ? 315  LEU A CG  1 
ATOM   2379 C CD1 . LEU A 1 335 ? -23.593 11.305  66.327 1.00 16.78 ? 315  LEU A CD1 1 
ATOM   2380 C CD2 . LEU A 1 335 ? -22.923 12.255  68.576 1.00 19.71 ? 315  LEU A CD2 1 
ATOM   2381 N N   . LYS A 1 336 ? -23.429 8.448   71.247 1.00 22.33 ? 316  LYS A N   1 
ATOM   2382 C CA  . LYS A 1 336 ? -24.114 7.442   72.038 1.00 24.06 ? 316  LYS A CA  1 
ATOM   2383 C C   . LYS A 1 336 ? -25.206 6.823   71.204 1.00 24.75 ? 316  LYS A C   1 
ATOM   2384 O O   . LYS A 1 336 ? -25.381 5.619   71.239 1.00 24.92 ? 316  LYS A O   1 
ATOM   2385 C CB  . LYS A 1 336 ? -24.692 8.021   73.337 1.00 23.76 ? 316  LYS A CB  1 
ATOM   2386 C CG  . LYS A 1 336 ? -23.645 8.121   74.431 1.00 24.71 ? 316  LYS A CG  1 
ATOM   2387 C CD  . LYS A 1 336 ? -24.218 8.468   75.811 1.00 27.20 ? 316  LYS A CD  1 
ATOM   2388 C CE  . LYS A 1 336 ? -23.075 8.501   76.830 1.00 28.46 ? 316  LYS A CE  1 
ATOM   2389 N NZ  . LYS A 1 336 ? -23.520 9.075   78.144 1.00 28.22 ? 316  LYS A NZ  1 
ATOM   2390 N N   . LYS A 1 337 ? -25.923 7.627   70.430 1.00 25.34 ? 317  LYS A N   1 
ATOM   2391 C CA  . LYS A 1 337 ? -26.841 7.031   69.480 1.00 27.28 ? 317  LYS A CA  1 
ATOM   2392 C C   . LYS A 1 337 ? -26.312 6.769   68.059 1.00 27.02 ? 317  LYS A C   1 
ATOM   2393 O O   . LYS A 1 337 ? -25.300 7.347   67.601 1.00 28.50 ? 317  LYS A O   1 
ATOM   2394 C CB  . LYS A 1 337 ? -28.167 7.781   69.427 1.00 27.74 ? 317  LYS A CB  1 
ATOM   2395 C CG  . LYS A 1 337 ? -28.069 9.212   68.990 1.00 29.96 ? 317  LYS A CG  1 
ATOM   2396 C CD  . LYS A 1 337 ? -29.485 9.794   68.768 1.00 32.31 ? 317  LYS A CD  1 
ATOM   2397 C CE  . LYS A 1 337 ? -30.193 10.147  70.065 1.00 35.50 ? 317  LYS A CE  1 
ATOM   2398 N NZ  . LYS A 1 337 ? -31.539 10.786  69.796 1.00 33.80 ? 317  LYS A NZ  1 
ATOM   2399 N N   . LYS A 1 338 ? -27.002 5.840   67.408 1.00 27.20 ? 318  LYS A N   1 
ATOM   2400 C CA  . LYS A 1 338 ? -26.904 5.583   65.985 1.00 27.94 ? 318  LYS A CA  1 
ATOM   2401 C C   . LYS A 1 338 ? -27.980 6.448   65.342 1.00 28.02 ? 318  LYS A C   1 
ATOM   2402 O O   . LYS A 1 338 ? -29.178 6.201   65.517 1.00 27.16 ? 318  LYS A O   1 
ATOM   2403 C CB  . LYS A 1 338 ? -27.200 4.091   65.703 1.00 28.60 ? 318  LYS A CB  1 
ATOM   2404 C CG  . LYS A 1 338 ? -26.885 3.625   64.278 1.00 31.42 ? 318  LYS A CG  1 
ATOM   2405 C CD  . LYS A 1 338 ? -27.059 2.114   64.179 1.00 35.94 ? 318  LYS A CD  1 
ATOM   2406 C CE  . LYS A 1 338 ? -27.016 1.643   62.750 1.00 37.05 ? 318  LYS A CE  1 
ATOM   2407 N NZ  . LYS A 1 338 ? -27.798 2.585   61.897 1.00 38.16 ? 318  LYS A NZ  1 
ATOM   2408 N N   . LEU A 1 339 ? -27.552 7.479   64.619 1.00 27.25 ? 319  LEU A N   1 
ATOM   2409 C CA  . LEU A 1 339 ? -28.504 8.441   64.086 1.00 26.34 ? 319  LEU A CA  1 
ATOM   2410 C C   . LEU A 1 339 ? -29.263 7.797   62.947 1.00 26.11 ? 319  LEU A C   1 
ATOM   2411 O O   . LEU A 1 339 ? -28.701 7.004   62.207 1.00 25.30 ? 319  LEU A O   1 
ATOM   2412 C CB  . LEU A 1 339 ? -27.788 9.702   63.594 1.00 26.52 ? 319  LEU A CB  1 
ATOM   2413 C CG  . LEU A 1 339 ? -26.977 10.518  64.612 1.00 23.79 ? 319  LEU A CG  1 
ATOM   2414 C CD1 . LEU A 1 339 ? -26.279 11.672  63.911 1.00 24.56 ? 319  LEU A CD1 1 
ATOM   2415 C CD2 . LEU A 1 339 ? -27.862 11.013  65.754 1.00 23.66 ? 319  LEU A CD2 1 
ATOM   2416 N N   . ASN A 1 340 ? -30.548 8.112   62.818 1.00 26.30 ? 320  ASN A N   1 
ATOM   2417 C CA  . ASN A 1 340 ? -31.280 7.667   61.651 1.00 26.90 ? 320  ASN A CA  1 
ATOM   2418 C C   . ASN A 1 340 ? -31.078 8.753   60.612 1.00 27.43 ? 320  ASN A C   1 
ATOM   2419 O O   . ASN A 1 340 ? -30.388 9.738   60.890 1.00 27.25 ? 320  ASN A O   1 
ATOM   2420 C CB  . ASN A 1 340 ? -32.765 7.387   61.964 1.00 26.90 ? 320  ASN A CB  1 
ATOM   2421 C CG  . ASN A 1 340 ? -33.509 8.621   62.475 1.00 28.11 ? 320  ASN A CG  1 
ATOM   2422 O OD1 . ASN A 1 340 ? -33.327 9.740   61.972 1.00 29.52 ? 320  ASN A OD1 1 
ATOM   2423 N ND2 . ASN A 1 340 ? -34.366 8.417   63.470 1.00 28.36 ? 320  ASN A ND2 1 
ATOM   2424 N N   . ASN A 1 341 ? -31.636 8.575   59.420 1.00 28.80 ? 321  ASN A N   1 
ATOM   2425 C CA  . ASN A 1 341 ? -31.337 9.478   58.296 1.00 30.04 ? 321  ASN A CA  1 
ATOM   2426 C C   . ASN A 1 341 ? -31.862 10.906  58.479 1.00 29.92 ? 321  ASN A C   1 
ATOM   2427 O O   . ASN A 1 341 ? -31.240 11.869  58.019 1.00 29.63 ? 321  ASN A O   1 
ATOM   2428 C CB  . ASN A 1 341 ? -31.800 8.874   56.967 1.00 30.62 ? 321  ASN A CB  1 
ATOM   2429 C CG  . ASN A 1 341 ? -30.854 7.795   56.466 1.00 34.33 ? 321  ASN A CG  1 
ATOM   2430 O OD1 . ASN A 1 341 ? -29.640 8.022   56.308 1.00 39.15 ? 321  ASN A OD1 1 
ATOM   2431 N ND2 . ASN A 1 341 ? -31.399 6.615   56.201 1.00 37.12 ? 321  ASN A ND2 1 
ATOM   2432 N N   . GLU A 1 342 ? -33.005 11.044  59.149 1.00 30.25 ? 322  GLU A N   1 
ATOM   2433 C CA  . GLU A 1 342 ? -33.532 12.371  59.463 1.00 30.80 ? 322  GLU A CA  1 
ATOM   2434 C C   . GLU A 1 342 ? -32.588 13.094  60.428 1.00 30.04 ? 322  GLU A C   1 
ATOM   2435 O O   . GLU A 1 342 ? -32.235 14.263  60.202 1.00 29.12 ? 322  GLU A O   1 
ATOM   2436 C CB  . GLU A 1 342 ? -34.932 12.262  60.064 1.00 32.06 ? 322  GLU A CB  1 
ATOM   2437 C CG  . GLU A 1 342 ? -35.467 13.553  60.638 1.00 36.80 ? 322  GLU A CG  1 
ATOM   2438 C CD  . GLU A 1 342 ? -36.861 13.381  61.157 1.00 43.15 ? 322  GLU A CD  1 
ATOM   2439 O OE1 . GLU A 1 342 ? -37.382 14.309  61.827 1.00 46.33 ? 322  GLU A OE1 1 
ATOM   2440 O OE2 . GLU A 1 342 ? -37.436 12.296  60.893 1.00 46.32 ? 322  GLU A OE2 1 
ATOM   2441 N N   . GLU A 1 343 ? -32.189 12.395  61.489 1.00 29.38 ? 323  GLU A N   1 
ATOM   2442 C CA  . GLU A 1 343 ? -31.241 12.938  62.483 1.00 30.00 ? 323  GLU A CA  1 
ATOM   2443 C C   . GLU A 1 343 ? -29.900 13.280  61.876 1.00 29.84 ? 323  GLU A C   1 
ATOM   2444 O O   . GLU A 1 343 ? -29.365 14.355  62.126 1.00 29.64 ? 323  GLU A O   1 
ATOM   2445 C CB  . GLU A 1 343 ? -31.043 11.972  63.651 1.00 29.84 ? 323  GLU A CB  1 
ATOM   2446 C CG  . GLU A 1 343 ? -32.318 11.789  64.488 1.00 30.64 ? 323  GLU A CG  1 
ATOM   2447 C CD  . GLU A 1 343 ? -32.206 10.658  65.501 1.00 33.11 ? 323  GLU A CD  1 
ATOM   2448 O OE1 . GLU A 1 343 ? -31.668 9.569   65.154 1.00 30.96 ? 323  GLU A OE1 1 
ATOM   2449 O OE2 . GLU A 1 343 ? -32.663 10.873  66.650 1.00 32.42 ? 323  GLU A OE2 1 
ATOM   2450 N N   . LEU A 1 344 ? -29.361 12.356  61.082 1.00 29.64 ? 324  LEU A N   1 
ATOM   2451 C CA  . LEU A 1 344 ? -28.133 12.596  60.331 1.00 29.35 ? 324  LEU A CA  1 
ATOM   2452 C C   . LEU A 1 344 ? -28.170 13.910  59.557 1.00 28.40 ? 324  LEU A C   1 
ATOM   2453 O O   . LEU A 1 344 ? -27.226 14.697  59.604 1.00 27.29 ? 324  LEU A O   1 
ATOM   2454 C CB  . LEU A 1 344 ? -27.900 11.455  59.344 1.00 29.93 ? 324  LEU A CB  1 
ATOM   2455 C CG  . LEU A 1 344 ? -26.802 10.427  59.570 1.00 32.86 ? 324  LEU A CG  1 
ATOM   2456 C CD1 . LEU A 1 344 ? -26.566 9.714   58.257 1.00 36.44 ? 324  LEU A CD1 1 
ATOM   2457 C CD2 . LEU A 1 344 ? -25.519 11.069  60.040 1.00 32.98 ? 324  LEU A CD2 1 
ATOM   2458 N N   . ALA A 1 345 ? -29.270 14.137  58.840 1.00 28.26 ? 325  ALA A N   1 
ATOM   2459 C CA  . ALA A 1 345 ? -29.419 15.344  58.032 1.00 28.20 ? 325  ALA A CA  1 
ATOM   2460 C C   . ALA A 1 345 ? -29.544 16.591  58.926 1.00 27.90 ? 325  ALA A C   1 
ATOM   2461 O O   . ALA A 1 345 ? -28.933 17.629  58.669 1.00 26.47 ? 325  ALA A O   1 
ATOM   2462 C CB  . ALA A 1 345 ? -30.640 15.214  57.106 1.00 28.69 ? 325  ALA A CB  1 
ATOM   2463 N N   . ASN A 1 346 ? -30.353 16.481  59.978 1.00 28.40 ? 326  ASN A N   1 
ATOM   2464 C CA  . ASN A 1 346 ? -30.518 17.601  60.909 1.00 28.82 ? 326  ASN A CA  1 
ATOM   2465 C C   . ASN A 1 346 ? -29.182 17.990  61.561 1.00 27.37 ? 326  ASN A C   1 
ATOM   2466 O O   . ASN A 1 346 ? -28.892 19.177  61.763 1.00 28.17 ? 326  ASN A O   1 
ATOM   2467 C CB  . ASN A 1 346 ? -31.559 17.260  61.983 1.00 29.58 ? 326  ASN A CB  1 
ATOM   2468 C CG  . ASN A 1 346 ? -32.095 18.502  62.700 1.00 33.69 ? 326  ASN A CG  1 
ATOM   2469 O OD1 . ASN A 1 346 ? -32.111 19.619  62.146 1.00 36.21 ? 326  ASN A OD1 1 
ATOM   2470 N ND2 . ASN A 1 346 ? -32.557 18.311  63.939 1.00 36.84 ? 326  ASN A ND2 1 
ATOM   2471 N N   . TYR A 1 347 ? -28.383 16.981  61.903 1.00 26.04 ? 327  TYR A N   1 
ATOM   2472 C CA  . TYR A 1 347 ? -27.059 17.193  62.508 1.00 24.23 ? 327  TYR A CA  1 
ATOM   2473 C C   . TYR A 1 347 ? -26.085 17.821  61.485 1.00 25.18 ? 327  TYR A C   1 
ATOM   2474 O O   . TYR A 1 347 ? -25.593 18.953  61.653 1.00 24.14 ? 327  TYR A O   1 
ATOM   2475 C CB  . TYR A 1 347 ? -26.536 15.856  63.063 1.00 23.53 ? 327  TYR A CB  1 
ATOM   2476 C CG  . TYR A 1 347 ? -25.199 15.932  63.783 1.00 22.28 ? 327  TYR A CG  1 
ATOM   2477 C CD1 . TYR A 1 347 ? -25.055 16.688  64.953 1.00 20.15 ? 327  TYR A CD1 1 
ATOM   2478 C CD2 . TYR A 1 347 ? -24.084 15.239  63.304 1.00 20.85 ? 327  TYR A CD2 1 
ATOM   2479 C CE1 . TYR A 1 347 ? -23.840 16.777  65.605 1.00 20.27 ? 327  TYR A CE1 1 
ATOM   2480 C CE2 . TYR A 1 347 ? -22.859 15.304  63.975 1.00 18.24 ? 327  TYR A CE2 1 
ATOM   2481 C CZ  . TYR A 1 347 ? -22.744 16.078  65.123 1.00 18.84 ? 327  TYR A CZ  1 
ATOM   2482 O OH  . TYR A 1 347 ? -21.532 16.167  65.797 1.00 21.22 ? 327  TYR A OH  1 
ATOM   2483 N N   . LEU A 1 348 ? -25.847 17.098  60.398 1.00 25.05 ? 328  LEU A N   1 
ATOM   2484 C CA  . LEU A 1 348 ? -24.838 17.508  59.408 1.00 25.59 ? 328  LEU A CA  1 
ATOM   2485 C C   . LEU A 1 348 ? -25.193 18.702  58.503 1.00 25.90 ? 328  LEU A C   1 
ATOM   2486 O O   . LEU A 1 348 ? -24.309 19.486  58.170 1.00 27.40 ? 328  LEU A O   1 
ATOM   2487 C CB  . LEU A 1 348 ? -24.409 16.316  58.546 1.00 25.24 ? 328  LEU A CB  1 
ATOM   2488 C CG  . LEU A 1 348 ? -23.652 15.153  59.203 1.00 24.96 ? 328  LEU A CG  1 
ATOM   2489 C CD1 . LEU A 1 348 ? -23.512 14.028  58.199 1.00 26.57 ? 328  LEU A CD1 1 
ATOM   2490 C CD2 . LEU A 1 348 ? -22.319 15.540  59.781 1.00 25.83 ? 328  LEU A CD2 1 
ATOM   2491 N N   . ASP A 1 349 ? -26.451 18.840  58.079 1.00 26.08 ? 329  ASP A N   1 
ATOM   2492 C CA  . ASP A 1 349 ? -26.813 19.960  57.196 1.00 26.23 ? 329  ASP A CA  1 
ATOM   2493 C C   . ASP A 1 349 ? -26.748 21.338  57.859 1.00 26.00 ? 329  ASP A C   1 
ATOM   2494 O O   . ASP A 1 349 ? -26.683 22.336  57.160 1.00 26.85 ? 329  ASP A O   1 
ATOM   2495 C CB  . ASP A 1 349 ? -28.216 19.770  56.575 1.00 26.20 ? 329  ASP A CB  1 
ATOM   2496 C CG  . ASP A 1 349 ? -28.328 18.489  55.840 1.00 27.15 ? 329  ASP A CG  1 
ATOM   2497 O OD1 . ASP A 1 349 ? -27.268 17.849  55.616 1.00 27.30 ? 329  ASP A OD1 1 
ATOM   2498 O OD2 . ASP A 1 349 ? -29.450 18.083  55.496 1.00 28.01 ? 329  ASP A OD2 1 
ATOM   2499 N N   . ASN A 1 350 ? -26.757 21.398  59.185 1.00 24.50 ? 330  ASN A N   1 
ATOM   2500 C CA  . ASN A 1 350 ? -26.929 22.673  59.855 1.00 23.89 ? 330  ASN A CA  1 
ATOM   2501 C C   . ASN A 1 350 ? -25.730 23.305  60.560 1.00 23.61 ? 330  ASN A C   1 
ATOM   2502 O O   . ASN A 1 350 ? -25.900 24.266  61.319 1.00 23.69 ? 330  ASN A O   1 
ATOM   2503 C CB  . ASN A 1 350 ? -28.148 22.588  60.767 1.00 23.81 ? 330  ASN A CB  1 
ATOM   2504 C CG  . ASN A 1 350 ? -29.424 22.367  59.972 1.00 26.07 ? 330  ASN A CG  1 
ATOM   2505 O OD1 . ASN A 1 350 ? -29.796 23.200  59.145 1.00 28.80 ? 330  ASN A OD1 1 
ATOM   2506 N ND2 . ASN A 1 350 ? -30.075 21.228  60.183 1.00 25.36 ? 330  ASN A ND2 1 
ATOM   2507 N N   . PHE A 1 351 ? -24.526 22.794  60.281 1.00 23.39 ? 331  PHE A N   1 
ATOM   2508 C CA  . PHE A 1 351 ? -23.278 23.354  60.825 1.00 23.77 ? 331  PHE A CA  1 
ATOM   2509 C C   . PHE A 1 351 ? -22.944 24.695  60.181 1.00 23.64 ? 331  PHE A C   1 
ATOM   2510 O O   . PHE A 1 351 ? -23.227 24.901  59.003 1.00 23.17 ? 331  PHE A O   1 
ATOM   2511 C CB  . PHE A 1 351 ? -22.085 22.368  60.648 1.00 22.17 ? 331  PHE A CB  1 
ATOM   2512 C CG  . PHE A 1 351 ? -22.020 21.306  61.705 1.00 22.28 ? 331  PHE A CG  1 
ATOM   2513 C CD1 . PHE A 1 351 ? -22.692 20.101  61.541 1.00 22.91 ? 331  PHE A CD1 1 
ATOM   2514 C CD2 . PHE A 1 351 ? -21.330 21.529  62.903 1.00 19.13 ? 331  PHE A CD2 1 
ATOM   2515 C CE1 . PHE A 1 351 ? -22.646 19.103  62.554 1.00 20.75 ? 331  PHE A CE1 1 
ATOM   2516 C CE2 . PHE A 1 351 ? -21.291 20.559  63.915 1.00 19.51 ? 331  PHE A CE2 1 
ATOM   2517 C CZ  . PHE A 1 351 ? -21.943 19.334  63.742 1.00 18.64 ? 331  PHE A CZ  1 
ATOM   2518 N N   . SER A 1 352 ? -22.336 25.593  60.956 1.00 24.42 ? 332  SER A N   1 
ATOM   2519 C CA  . SER A 1 352 ? -21.981 26.939  60.469 1.00 23.62 ? 332  SER A CA  1 
ATOM   2520 C C   . SER A 1 352 ? -20.531 27.061  60.055 1.00 23.37 ? 332  SER A C   1 
ATOM   2521 O O   . SER A 1 352 ? -20.183 27.968  59.309 1.00 22.93 ? 332  SER A O   1 
ATOM   2522 C CB  . SER A 1 352 ? -22.203 27.974  61.551 1.00 23.91 ? 332  SER A CB  1 
ATOM   2523 O OG  . SER A 1 352 ? -23.535 27.977  61.947 1.00 27.64 ? 332  SER A OG  1 
ATOM   2524 N N   . LEU A 1 353 ? -19.690 26.192  60.595 1.00 23.15 ? 333  LEU A N   1 
ATOM   2525 C CA  . LEU A 1 353 ? -18.255 26.330  60.408 1.00 23.79 ? 333  LEU A CA  1 
ATOM   2526 C C   . LEU A 1 353 ? -17.617 25.071  59.849 1.00 23.28 ? 333  LEU A C   1 
ATOM   2527 O O   . LEU A 1 353 ? -16.688 25.166  59.047 1.00 24.55 ? 333  LEU A O   1 
ATOM   2528 C CB  . LEU A 1 353 ? -17.568 26.733  61.722 1.00 23.39 ? 333  LEU A CB  1 
ATOM   2529 C CG  . LEU A 1 353 ? -17.733 28.168  62.241 1.00 26.78 ? 333  LEU A CG  1 
ATOM   2530 C CD1 . LEU A 1 353 ? -16.934 28.337  63.555 1.00 23.63 ? 333  LEU A CD1 1 
ATOM   2531 C CD2 . LEU A 1 353 ? -17.300 29.220  61.200 1.00 24.40 ? 333  LEU A CD2 1 
ATOM   2532 N N   . PHE A 1 354 ? -18.046 23.910  60.337 1.00 21.86 ? 334  PHE A N   1 
ATOM   2533 C CA  . PHE A 1 354 ? -17.600 22.633  59.801 1.00 21.90 ? 334  PHE A CA  1 
ATOM   2534 C C   . PHE A 1 354 ? -18.313 22.415  58.472 1.00 22.35 ? 334  PHE A C   1 
ATOM   2535 O O   . PHE A 1 354 ? -19.529 22.626  58.397 1.00 24.27 ? 334  PHE A O   1 
ATOM   2536 C CB  . PHE A 1 354 ? -17.945 21.479  60.753 1.00 21.02 ? 334  PHE A CB  1 
ATOM   2537 C CG  . PHE A 1 354 ? -17.076 21.405  61.974 1.00 19.75 ? 334  PHE A CG  1 
ATOM   2538 C CD1 . PHE A 1 354 ? -17.406 22.108  63.133 1.00 19.45 ? 334  PHE A CD1 1 
ATOM   2539 C CD2 . PHE A 1 354 ? -15.932 20.612  61.974 1.00 18.36 ? 334  PHE A CD2 1 
ATOM   2540 C CE1 . PHE A 1 354 ? -16.613 22.038  64.280 1.00 20.85 ? 334  PHE A CE1 1 
ATOM   2541 C CE2 . PHE A 1 354 ? -15.133 20.536  63.122 1.00 19.40 ? 334  PHE A CE2 1 
ATOM   2542 C CZ  . PHE A 1 354 ? -15.476 21.246  64.270 1.00 20.10 ? 334  PHE A CZ  1 
ATOM   2543 N N   . SER A 1 355 ? -17.586 21.989  57.451 1.00 22.30 ? 335  SER A N   1 
ATOM   2544 C CA  . SER A 1 355 ? -18.140 21.645  56.134 1.00 22.64 ? 335  SER A CA  1 
ATOM   2545 C C   . SER A 1 355 ? -18.025 20.140  55.893 1.00 21.81 ? 335  SER A C   1 
ATOM   2546 O O   . SER A 1 355 ? -17.084 19.488  56.371 1.00 21.09 ? 335  SER A O   1 
ATOM   2547 C CB  . SER A 1 355 ? -17.324 22.342  55.041 1.00 22.82 ? 335  SER A CB  1 
ATOM   2548 O OG  . SER A 1 355 ? -17.255 23.737  55.275 1.00 28.11 ? 335  SER A OG  1 
ATOM   2549 N N   . MET A 1 356 ? -18.941 19.589  55.108 1.00 21.27 ? 336  MET A N   1 
ATOM   2550 C CA  . MET A 1 356 ? -18.824 18.209  54.641 1.00 22.39 ? 336  MET A CA  1 
ATOM   2551 C C   . MET A 1 356 ? -17.943 18.101  53.377 1.00 21.95 ? 336  MET A C   1 
ATOM   2552 O O   . MET A 1 356 ? -18.251 18.750  52.371 1.00 21.15 ? 336  MET A O   1 
ATOM   2553 C CB  . MET A 1 356 ? -20.200 17.631  54.328 1.00 22.43 ? 336  MET A CB  1 
ATOM   2554 C CG  . MET A 1 356 ? -20.985 17.239  55.568 1.00 26.20 ? 336  MET A CG  1 
ATOM   2555 S SD  . MET A 1 356 ? -22.546 16.468  55.106 1.00 30.74 ? 336  MET A SD  1 
ATOM   2556 C CE  . MET A 1 356 ? -23.447 17.945  54.695 1.00 30.52 ? 336  MET A CE  1 
ATOM   2557 N N   . ALA A 1 357 ? -16.896 17.266  53.432 1.00 21.18 ? 337  ALA A N   1 
ATOM   2558 C CA  . ALA A 1 357 ? -16.024 16.980  52.295 1.00 21.20 ? 337  ALA A CA  1 
ATOM   2559 C C   . ALA A 1 357 ? -15.054 15.844  52.618 1.00 22.12 ? 337  ALA A C   1 
ATOM   2560 O O   . ALA A 1 357 ? -14.814 15.565  53.777 1.00 21.28 ? 337  ALA A O   1 
ATOM   2561 C CB  . ALA A 1 357 ? -15.210 18.247  51.902 1.00 21.03 ? 337  ALA A CB  1 
ATOM   2562 N N   . TYR A 1 358 ? -14.480 15.232  51.587 1.00 22.74 ? 338  TYR A N   1 
ATOM   2563 C CA  . TYR A 1 358 ? -13.470 14.207  51.749 1.00 24.83 ? 338  TYR A CA  1 
ATOM   2564 C C   . TYR A 1 358 ? -12.129 14.909  51.807 1.00 24.93 ? 338  TYR A C   1 
ATOM   2565 O O   . TYR A 1 358 ? -12.069 16.113  51.568 1.00 25.63 ? 338  TYR A O   1 
ATOM   2566 C CB  . TYR A 1 358 ? -13.539 13.239  50.576 1.00 26.01 ? 338  TYR A CB  1 
ATOM   2567 C CG  . TYR A 1 358 ? -14.769 12.392  50.673 1.00 27.25 ? 338  TYR A CG  1 
ATOM   2568 C CD1 . TYR A 1 358 ? -14.880 11.449  51.680 1.00 29.70 ? 338  TYR A CD1 1 
ATOM   2569 C CD2 . TYR A 1 358 ? -15.841 12.581  49.815 1.00 28.80 ? 338  TYR A CD2 1 
ATOM   2570 C CE1 . TYR A 1 358 ? -15.978 10.687  51.821 1.00 30.52 ? 338  TYR A CE1 1 
ATOM   2571 C CE2 . TYR A 1 358 ? -16.981 11.810  49.943 1.00 28.23 ? 338  TYR A CE2 1 
ATOM   2572 C CZ  . TYR A 1 358 ? -17.031 10.862  50.957 1.00 30.70 ? 338  TYR A CZ  1 
ATOM   2573 O OH  . TYR A 1 358 ? -18.122 10.058  51.132 1.00 34.12 ? 338  TYR A OH  1 
ATOM   2574 N N   . SER A 1 359 ? -11.073 14.170  52.129 1.00 24.89 ? 339  SER A N   1 
ATOM   2575 C CA  . SER A 1 359 ? -9.737  14.746  52.404 1.00 24.89 ? 339  SER A CA  1 
ATOM   2576 C C   . SER A 1 359 ? -9.768  15.523  53.732 1.00 23.28 ? 339  SER A C   1 
ATOM   2577 O O   . SER A 1 359 ? -10.765 15.527  54.421 1.00 21.53 ? 339  SER A O   1 
ATOM   2578 C CB  . SER A 1 359 ? -9.197  15.623  51.254 1.00 25.67 ? 339  SER A CB  1 
ATOM   2579 O OG  . SER A 1 359 ? -7.762  15.738  51.359 1.00 28.38 ? 339  SER A OG  1 
ATOM   2580 N N   . TRP A 1 360 ? -8.651  16.140  54.078 1.00 21.85 ? 340  TRP A N   1 
ATOM   2581 C CA  . TRP A 1 360 ? -8.421  16.760  55.379 1.00 20.40 ? 340  TRP A CA  1 
ATOM   2582 C C   . TRP A 1 360 ? -7.014  17.310  55.287 1.00 20.44 ? 340  TRP A C   1 
ATOM   2583 O O   . TRP A 1 360 ? -6.406  17.179  54.236 1.00 20.23 ? 340  TRP A O   1 
ATOM   2584 C CB  . TRP A 1 360 ? -8.514  15.750  56.532 1.00 18.17 ? 340  TRP A CB  1 
ATOM   2585 C CG  . TRP A 1 360 ? -7.924  14.390  56.252 1.00 20.49 ? 340  TRP A CG  1 
ATOM   2586 C CD1 . TRP A 1 360 ? -8.508  13.362  55.551 1.00 21.32 ? 340  TRP A CD1 1 
ATOM   2587 C CD2 . TRP A 1 360 ? -6.645  13.896  56.695 1.00 20.75 ? 340  TRP A CD2 1 
ATOM   2588 N NE1 . TRP A 1 360 ? -7.659  12.271  55.489 1.00 21.49 ? 340  TRP A NE1 1 
ATOM   2589 C CE2 . TRP A 1 360 ? -6.513  12.562  56.194 1.00 22.00 ? 340  TRP A CE2 1 
ATOM   2590 C CE3 . TRP A 1 360 ? -5.606  14.440  57.456 1.00 21.10 ? 340  TRP A CE3 1 
ATOM   2591 C CZ2 . TRP A 1 360 ? -5.368  11.774  56.428 1.00 19.97 ? 340  TRP A CZ2 1 
ATOM   2592 C CZ3 . TRP A 1 360 ? -4.460  13.661  57.688 1.00 19.80 ? 340  TRP A CZ3 1 
ATOM   2593 C CH2 . TRP A 1 360 ? -4.357  12.336  57.179 1.00 18.51 ? 340  TRP A CH2 1 
ATOM   2594 N N   . GLY A 1 361 ? -6.525  17.909  56.379 1.00 20.02 ? 341  GLY A N   1 
ATOM   2595 C CA  . GLY A 1 361 ? -5.186  18.475  56.456 1.00 20.94 ? 341  GLY A CA  1 
ATOM   2596 C C   . GLY A 1 361 ? -5.040  19.880  55.891 1.00 21.11 ? 341  GLY A C   1 
ATOM   2597 O O   . GLY A 1 361 ? -3.921  20.357  55.732 1.00 21.66 ? 341  GLY A O   1 
ATOM   2598 N N   . GLY A 1 362 ? -6.173  20.535  55.624 1.00 20.17 ? 342  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 362 ? -6.198  21.948  55.224 1.00 19.31 ? 342  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 362 ? -6.440  22.898  56.404 1.00 18.20 ? 342  GLY A C   1 
ATOM   2601 O O   . GLY A 1 362 ? -6.301  22.534  57.578 1.00 16.99 ? 342  GLY A O   1 
ATOM   2602 N N   . TYR A 1 363 ? -6.776  24.150  56.093 1.00 19.40 ? 343  TYR A N   1 
ATOM   2603 C CA  . TYR A 1 363 ? -6.816  25.178  57.127 1.00 18.83 ? 343  TYR A CA  1 
ATOM   2604 C C   . TYR A 1 363 ? -8.211  25.208  57.717 1.00 19.25 ? 343  TYR A C   1 
ATOM   2605 O O   . TYR A 1 363 ? -8.438  25.843  58.714 1.00 18.84 ? 343  TYR A O   1 
ATOM   2606 C CB  . TYR A 1 363 ? -6.454  26.551  56.550 1.00 19.05 ? 343  TYR A CB  1 
ATOM   2607 C CG  . TYR A 1 363 ? -7.200  26.925  55.275 1.00 17.33 ? 343  TYR A CG  1 
ATOM   2608 C CD1 . TYR A 1 363 ? -8.479  27.424  55.326 1.00 20.91 ? 343  TYR A CD1 1 
ATOM   2609 C CD2 . TYR A 1 363 ? -6.605  26.764  54.022 1.00 19.74 ? 343  TYR A CD2 1 
ATOM   2610 C CE1 . TYR A 1 363 ? -9.168  27.758  54.155 1.00 17.88 ? 343  TYR A CE1 1 
ATOM   2611 C CE2 . TYR A 1 363 ? -7.282  27.079  52.843 1.00 16.91 ? 343  TYR A CE2 1 
ATOM   2612 C CZ  . TYR A 1 363 ? -8.571  27.574  52.936 1.00 17.40 ? 343  TYR A CZ  1 
ATOM   2613 O OH  . TYR A 1 363 ? -9.243  27.947  51.825 1.00 20.91 ? 343  TYR A OH  1 
ATOM   2614 N N   . GLU A 1 364 ? -9.138  24.546  57.051 1.00 19.21 ? 344  GLU A N   1 
ATOM   2615 C CA  . GLU A 1 364 ? -10.519 24.609  57.481 1.00 19.25 ? 344  GLU A CA  1 
ATOM   2616 C C   . GLU A 1 364 ? -10.937 23.304  58.139 1.00 19.50 ? 344  GLU A C   1 
ATOM   2617 O O   . GLU A 1 364 ? -10.325 22.246  57.893 1.00 18.33 ? 344  GLU A O   1 
ATOM   2618 C CB  . GLU A 1 364 ? -11.431 24.955  56.302 1.00 19.77 ? 344  GLU A CB  1 
ATOM   2619 C CG  . GLU A 1 364 ? -12.067 23.771  55.549 1.00 22.73 ? 344  GLU A CG  1 
ATOM   2620 C CD  . GLU A 1 364 ? -11.097 22.995  54.672 1.00 26.30 ? 344  GLU A CD  1 
ATOM   2621 O OE1 . GLU A 1 364 ? -9.875  23.265  54.654 1.00 25.76 ? 344  GLU A OE1 1 
ATOM   2622 O OE2 . GLU A 1 364 ? -11.563 22.072  53.994 1.00 26.05 ? 344  GLU A OE2 1 
ATOM   2623 N N   . SER A 1 365 ? -12.020 23.353  58.913 1.00 17.62 ? 345  SER A N   1 
ATOM   2624 C CA  . SER A 1 365 ? -12.463 22.190  59.682 1.00 17.87 ? 345  SER A CA  1 
ATOM   2625 C C   . SER A 1 365 ? -13.538 21.453  58.909 1.00 18.59 ? 345  SER A C   1 
ATOM   2626 O O   . SER A 1 365 ? -14.319 22.084  58.220 1.00 18.73 ? 345  SER A O   1 
ATOM   2627 C CB  . SER A 1 365 ? -13.072 22.614  61.024 1.00 18.27 ? 345  SER A CB  1 
ATOM   2628 O OG  . SER A 1 365 ? -12.123 23.215  61.864 1.00 19.13 ? 345  SER A OG  1 
ATOM   2629 N N   . LEU A 1 366 ? -13.516 20.128  58.980 1.00 18.39 ? 346  LEU A N   1 
ATOM   2630 C CA  . LEU A 1 366 ? -14.408 19.270  58.196 1.00 18.99 ? 346  LEU A CA  1 
ATOM   2631 C C   . LEU A 1 366 ? -15.082 18.246  59.095 1.00 18.89 ? 346  LEU A C   1 
ATOM   2632 O O   . LEU A 1 366 ? -14.548 17.885  60.141 1.00 17.79 ? 346  LEU A O   1 
ATOM   2633 C CB  . LEU A 1 366 ? -13.632 18.546  57.072 1.00 18.49 ? 346  LEU A CB  1 
ATOM   2634 C CG  . LEU A 1 366 ? -12.931 19.399  55.996 1.00 17.56 ? 346  LEU A CG  1 
ATOM   2635 C CD1 . LEU A 1 366 ? -12.080 18.515  55.057 1.00 19.47 ? 346  LEU A CD1 1 
ATOM   2636 C CD2 . LEU A 1 366 ? -13.920 20.206  55.166 1.00 17.13 ? 346  LEU A CD2 1 
ATOM   2637 N N   . ILE A 1 367 ? -16.243 17.750  58.644 1.00 18.76 ? 347  ILE A N   1 
ATOM   2638 C CA  . ILE A 1 367 ? -16.968 16.720  59.354 1.00 19.81 ? 347  ILE A CA  1 
ATOM   2639 C C   . ILE A 1 367 ? -17.525 15.699  58.360 1.00 20.72 ? 347  ILE A C   1 
ATOM   2640 O O   . ILE A 1 367 ? -17.966 16.061  57.254 1.00 21.62 ? 347  ILE A O   1 
ATOM   2641 C CB  . ILE A 1 367 ? -18.104 17.331  60.238 1.00 19.52 ? 347  ILE A CB  1 
ATOM   2642 C CG1 . ILE A 1 367 ? -18.685 16.304  61.215 1.00 18.01 ? 347  ILE A CG1 1 
ATOM   2643 C CG2 . ILE A 1 367 ? -19.150 18.148  59.411 1.00 19.56 ? 347  ILE A CG2 1 
ATOM   2644 C CD1 . ILE A 1 367 ? -19.624 17.001  62.292 1.00 15.25 ? 347  ILE A CD1 1 
ATOM   2645 N N   . LEU A 1 368 ? -17.488 14.430  58.754 1.00 21.35 ? 348  LEU A N   1 
ATOM   2646 C CA  . LEU A 1 368 ? -18.044 13.344  57.967 1.00 22.77 ? 348  LEU A CA  1 
ATOM   2647 C C   . LEU A 1 368 ? -18.614 12.339  58.950 1.00 23.49 ? 348  LEU A C   1 
ATOM   2648 O O   . LEU A 1 368 ? -18.100 12.172  60.043 1.00 23.80 ? 348  LEU A O   1 
ATOM   2649 C CB  . LEU A 1 368 ? -16.987 12.631  57.114 1.00 24.49 ? 348  LEU A CB  1 
ATOM   2650 C CG  . LEU A 1 368 ? -16.589 13.334  55.818 1.00 26.72 ? 348  LEU A CG  1 
ATOM   2651 C CD1 . LEU A 1 368 ? -15.586 12.483  55.021 1.00 29.95 ? 348  LEU A CD1 1 
ATOM   2652 C CD2 . LEU A 1 368 ? -17.863 13.702  54.952 1.00 27.77 ? 348  LEU A CD2 1 
ATOM   2653 N N   . ALA A 1 369 ? -19.658 11.649  58.540 1.00 22.59 ? 349  ALA A N   1 
ATOM   2654 C CA  . ALA A 1 369 ? -20.194 10.606  59.381 1.00 22.10 ? 349  ALA A CA  1 
ATOM   2655 C C   . ALA A 1 369 ? -20.025 9.264   58.700 1.00 22.92 ? 349  ALA A C   1 
ATOM   2656 O O   . ALA A 1 369 ? -20.078 9.159   57.455 1.00 23.98 ? 349  ALA A O   1 
ATOM   2657 C CB  . ALA A 1 369 ? -21.657 10.866  59.641 1.00 21.90 ? 349  ALA A CB  1 
ATOM   2658 N N   . ASN A 1 370 ? -19.836 8.239   59.525 1.00 22.30 ? 350  ASN A N   1 
ATOM   2659 C CA  . ASN A 1 370 ? -19.859 6.858   59.097 1.00 23.05 ? 350  ASN A CA  1 
ATOM   2660 C C   . ASN A 1 370 ? -20.713 6.049   60.070 1.00 22.34 ? 350  ASN A C   1 
ATOM   2661 O O   . ASN A 1 370 ? -20.493 6.065   61.293 1.00 21.77 ? 350  ASN A O   1 
ATOM   2662 C CB  . ASN A 1 370 ? -18.447 6.303   59.092 1.00 24.27 ? 350  ASN A CB  1 
ATOM   2663 C CG  . ASN A 1 370 ? -17.623 6.856   57.963 1.00 24.82 ? 350  ASN A CG  1 
ATOM   2664 O OD1 . ASN A 1 370 ? -17.877 6.562   56.793 1.00 30.12 ? 350  ASN A OD1 1 
ATOM   2665 N ND2 . ASN A 1 370 ? -16.657 7.679   58.296 1.00 28.79 ? 350  ASN A ND2 1 
ATOM   2666 N N   . GLN A 1 371 ? -21.673 5.320   59.529 1.00 23.11 ? 351  GLN A N   1 
ATOM   2667 C CA  . GLN A 1 371 ? -22.454 4.379   60.337 1.00 23.52 ? 351  GLN A CA  1 
ATOM   2668 C C   . GLN A 1 371 ? -21.663 3.106   60.587 1.00 23.28 ? 351  GLN A C   1 
ATOM   2669 O O   . GLN A 1 371 ? -20.818 2.727   59.761 1.00 23.55 ? 351  GLN A O   1 
ATOM   2670 C CB  . GLN A 1 371 ? -23.780 4.029   59.649 1.00 24.04 ? 351  GLN A CB  1 
ATOM   2671 C CG  . GLN A 1 371 ? -24.681 5.222   59.343 1.00 25.00 ? 351  GLN A CG  1 
ATOM   2672 C CD  . GLN A 1 371 ? -25.375 5.812   60.565 1.00 28.48 ? 351  GLN A CD  1 
ATOM   2673 O OE1 . GLN A 1 371 ? -24.835 5.822   61.660 1.00 29.69 ? 351  GLN A OE1 1 
ATOM   2674 N NE2 . GLN A 1 371 ? -26.590 6.318   60.365 1.00 27.68 ? 351  GLN A NE2 1 
ATOM   2675 N N   . PRO A 1 372 ? -21.905 2.453   61.729 1.00 24.27 ? 352  PRO A N   1 
ATOM   2676 C CA  . PRO A 1 372 ? -21.127 1.252   62.087 1.00 24.67 ? 352  PRO A CA  1 
ATOM   2677 C C   . PRO A 1 372 ? -21.112 0.187   60.976 1.00 25.12 ? 352  PRO A C   1 
ATOM   2678 O O   . PRO A 1 372 ? -20.071 -0.405  60.725 1.00 24.81 ? 352  PRO A O   1 
ATOM   2679 C CB  . PRO A 1 372 ? -21.796 0.726   63.362 1.00 24.88 ? 352  PRO A CB  1 
ATOM   2680 C CG  . PRO A 1 372 ? -22.773 1.797   63.816 1.00 25.22 ? 352  PRO A CG  1 
ATOM   2681 C CD  . PRO A 1 372 ? -22.905 2.838   62.753 1.00 23.98 ? 352  PRO A CD  1 
ATOM   2682 N N   . GLU A 1 373 ? -22.246 0.003   60.288 1.00 25.68 ? 353  GLU A N   1 
ATOM   2683 C CA  . GLU A 1 373 ? -22.345 -0.914  59.130 1.00 26.95 ? 353  GLU A CA  1 
ATOM   2684 C C   . GLU A 1 373 ? -21.333 -0.601  58.045 1.00 26.33 ? 353  GLU A C   1 
ATOM   2685 O O   . GLU A 1 373 ? -20.739 -1.529  57.507 1.00 26.45 ? 353  GLU A O   1 
ATOM   2686 C CB  . GLU A 1 373 ? -23.734 -0.902  58.475 1.00 27.35 ? 353  GLU A CB  1 
ATOM   2687 C CG  . GLU A 1 373 ? -24.894 -0.845  59.445 1.00 32.48 ? 353  GLU A CG  1 
ATOM   2688 C CD  . GLU A 1 373 ? -25.357 0.584   59.717 1.00 35.76 ? 353  GLU A CD  1 
ATOM   2689 O OE1 . GLU A 1 373 ? -26.121 1.166   58.884 1.00 39.63 ? 353  GLU A OE1 1 
ATOM   2690 O OE2 . GLU A 1 373 ? -24.946 1.118   60.767 1.00 32.55 ? 353  GLU A OE2 1 
ATOM   2691 N N   . HIS A 1 374 ? -21.195 0.690   57.705 1.00 25.86 ? 354  HIS A N   1 
ATOM   2692 C CA  . HIS A 1 374 ? -20.229 1.185   56.724 1.00 25.86 ? 354  HIS A CA  1 
ATOM   2693 C C   . HIS A 1 374 ? -18.839 0.736   57.173 1.00 24.92 ? 354  HIS A C   1 
ATOM   2694 O O   . HIS A 1 374 ? -18.094 0.151   56.390 1.00 25.43 ? 354  HIS A O   1 
ATOM   2695 C CB  . HIS A 1 374 ? -20.198 2.728   56.626 1.00 27.35 ? 354  HIS A CB  1 
ATOM   2696 C CG  . HIS A 1 374 ? -21.520 3.384   56.307 1.00 32.34 ? 354  HIS A CG  1 
ATOM   2697 N ND1 . HIS A 1 374 ? -21.746 4.740   56.517 1.00 34.49 ? 354  HIS A ND1 1 
ATOM   2698 C CD2 . HIS A 1 374 ? -22.670 2.886   55.774 1.00 34.48 ? 354  HIS A CD2 1 
ATOM   2699 C CE1 . HIS A 1 374 ? -22.979 5.037   56.142 1.00 36.76 ? 354  HIS A CE1 1 
ATOM   2700 N NE2 . HIS A 1 374 ? -23.562 3.930   55.691 1.00 36.96 ? 354  HIS A NE2 1 
ATOM   2701 N N   . ILE A 1 375 ? -18.498 1.003   58.439 1.00 22.69 ? 355  ILE A N   1 
ATOM   2702 C CA  . ILE A 1 375 ? -17.162 0.649   58.935 1.00 21.33 ? 355  ILE A CA  1 
ATOM   2703 C C   . ILE A 1 375 ? -16.939 -0.873  58.953 1.00 20.50 ? 355  ILE A C   1 
ATOM   2704 O O   . ILE A 1 375 ? -15.885 -1.358  58.546 1.00 19.69 ? 355  ILE A O   1 
ATOM   2705 C CB  . ILE A 1 375 ? -16.836 1.288   60.322 1.00 21.64 ? 355  ILE A CB  1 
ATOM   2706 C CG1 . ILE A 1 375 ? -17.064 2.809   60.273 1.00 22.01 ? 355  ILE A CG1 1 
ATOM   2707 C CG2 . ILE A 1 375 ? -15.338 1.040   60.682 1.00 21.09 ? 355  ILE A CG2 1 
ATOM   2708 C CD1 . ILE A 1 375 ? -16.158 3.501   59.232 1.00 26.47 ? 355  ILE A CD1 1 
ATOM   2709 N N   . ALA A 1 376 ? -17.948 -1.619  59.399 1.00 20.28 ? 356  ALA A N   1 
ATOM   2710 C CA  . ALA A 1 376 ? -17.850 -3.083  59.413 1.00 20.51 ? 356  ALA A CA  1 
ATOM   2711 C C   . ALA A 1 376 ? -17.466 -3.674  58.010 1.00 20.94 ? 356  ALA A C   1 
ATOM   2712 O O   . ALA A 1 376 ? -16.809 -4.711  57.905 1.00 22.25 ? 356  ALA A O   1 
ATOM   2713 C CB  . ALA A 1 376 ? -19.131 -3.679  59.964 1.00 20.38 ? 356  ALA A CB  1 
ATOM   2714 N N   . ALA A 1 377 ? -17.801 -2.971  56.942 1.00 20.79 ? 357  ALA A N   1 
ATOM   2715 C CA  . ALA A 1 377 ? -17.610 -3.497  55.605 1.00 21.48 ? 357  ALA A CA  1 
ATOM   2716 C C   . ALA A 1 377 ? -16.223 -3.229  55.100 1.00 21.06 ? 357  ALA A C   1 
ATOM   2717 O O   . ALA A 1 377 ? -15.805 -3.832  54.095 1.00 22.20 ? 357  ALA A O   1 
ATOM   2718 C CB  . ALA A 1 377 ? -18.684 -2.933  54.625 1.00 22.26 ? 357  ALA A CB  1 
ATOM   2719 N N   . ILE A 1 378 ? -15.499 -2.353  55.802 1.00 19.63 ? 358  ILE A N   1 
ATOM   2720 C CA  . ILE A 1 378 ? -14.102 -2.021  55.439 1.00 19.08 ? 358  ILE A CA  1 
ATOM   2721 C C   . ILE A 1 378 ? -13.110 -2.364  56.585 1.00 19.20 ? 358  ILE A C   1 
ATOM   2722 O O   . ILE A 1 378 ? -12.043 -1.747  56.724 1.00 18.23 ? 358  ILE A O   1 
ATOM   2723 C CB  . ILE A 1 378 ? -13.970 -0.561  54.935 1.00 19.53 ? 358  ILE A CB  1 
ATOM   2724 C CG1 . ILE A 1 378 ? -14.380 0.437   56.031 1.00 19.62 ? 358  ILE A CG1 1 
ATOM   2725 C CG2 . ILE A 1 378 ? -14.819 -0.355  53.631 1.00 19.35 ? 358  ILE A CG2 1 
ATOM   2726 C CD1 . ILE A 1 378 ? -13.964 1.899   55.782 1.00 21.42 ? 358  ILE A CD1 1 
ATOM   2727 N N   . ARG A 1 379 ? -13.449 -3.364  57.390 1.00 18.97 ? 359  ARG A N   1 
ATOM   2728 C CA  . ARG A 1 379 ? -12.494 -3.881  58.377 1.00 20.66 ? 359  ARG A CA  1 
ATOM   2729 C C   . ARG A 1 379 ? -12.318 -5.372  58.128 1.00 21.30 ? 359  ARG A C   1 
ATOM   2730 O O   . ARG A 1 379 ? -12.712 -6.187  58.964 1.00 21.25 ? 359  ARG A O   1 
ATOM   2731 C CB  . ARG A 1 379 ? -12.948 -3.588  59.823 1.00 19.99 ? 359  ARG A CB  1 
ATOM   2732 C CG  . ARG A 1 379 ? -13.017 -2.114  60.171 1.00 18.63 ? 359  ARG A CG  1 
ATOM   2733 C CD  . ARG A 1 379 ? -11.632 -1.517  60.102 1.00 18.50 ? 359  ARG A CD  1 
ATOM   2734 N NE  . ARG A 1 379 ? -11.514 -0.099  60.443 1.00 16.93 ? 359  ARG A NE  1 
ATOM   2735 C CZ  . ARG A 1 379 ? -11.285 0.870   59.549 1.00 17.76 ? 359  ARG A CZ  1 
ATOM   2736 N NH1 . ARG A 1 379 ? -11.235 0.628   58.245 1.00 16.26 ? 359  ARG A NH1 1 
ATOM   2737 N NH2 . ARG A 1 379 ? -11.138 2.103   59.951 1.00 19.91 ? 359  ARG A NH2 1 
ATOM   2738 N N   . PRO A 1 380 ? -11.675 -5.743  56.987 1.00 22.23 ? 360  PRO A N   1 
ATOM   2739 C CA  . PRO A 1 380 ? -11.551 -7.176  56.671 1.00 22.61 ? 360  PRO A CA  1 
ATOM   2740 C C   . PRO A 1 380 ? -10.845 -7.951  57.768 1.00 22.61 ? 360  PRO A C   1 
ATOM   2741 O O   . PRO A 1 380 ? -9.852  -7.483  58.316 1.00 22.66 ? 360  PRO A O   1 
ATOM   2742 C CB  . PRO A 1 380 ? -10.721 -7.208  55.381 1.00 21.80 ? 360  PRO A CB  1 
ATOM   2743 C CG  . PRO A 1 380 ? -10.279 -5.821  55.132 1.00 22.01 ? 360  PRO A CG  1 
ATOM   2744 C CD  . PRO A 1 380 ? -11.029 -4.877  55.984 1.00 21.20 ? 360  PRO A CD  1 
ATOM   2745 N N   . GLN A 1 381 ? -11.400 -9.105  58.113 1.00 24.47 ? 361  GLN A N   1 
ATOM   2746 C CA  . GLN A 1 381 ? -10.879 -9.970  59.160 1.00 26.07 ? 361  GLN A CA  1 
ATOM   2747 C C   . GLN A 1 381 ? -10.878 -9.306  60.501 1.00 26.89 ? 361  GLN A C   1 
ATOM   2748 O O   . GLN A 1 381 ? -10.180 -9.749  61.393 1.00 29.45 ? 361  GLN A O   1 
ATOM   2749 C CB  . GLN A 1 381 ? -9.443  -10.416 58.835 1.00 26.28 ? 361  GLN A CB  1 
ATOM   2750 C CG  . GLN A 1 381 ? -9.309  -11.199 57.538 1.00 27.66 ? 361  GLN A CG  1 
ATOM   2751 C CD  . GLN A 1 381 ? -7.886  -11.598 57.268 1.00 30.10 ? 361  GLN A CD  1 
ATOM   2752 O OE1 . GLN A 1 381 ? -7.163  -12.064 58.161 1.00 33.79 ? 361  GLN A OE1 1 
ATOM   2753 N NE2 . GLN A 1 381 ? -7.462  -11.396 56.054 1.00 25.74 ? 361  GLN A NE2 1 
ATOM   2754 N N   . GLY A 1 382 ? -11.614 -8.222  60.639 1.00 27.86 ? 362  GLY A N   1 
ATOM   2755 C CA  . GLY A 1 382 ? -11.767 -7.555  61.913 1.00 28.18 ? 362  GLY A CA  1 
ATOM   2756 C C   . GLY A 1 382 ? -13.214 -7.539  62.333 1.00 29.13 ? 362  GLY A C   1 
ATOM   2757 O O   . GLY A 1 382 ? -14.109 -7.928  61.579 1.00 28.15 ? 362  GLY A O   1 
ATOM   2758 N N   . GLU A 1 383 ? -13.436 -7.046  63.547 1.00 30.18 ? 363  GLU A N   1 
ATOM   2759 C CA  . GLU A 1 383 ? -14.764 -6.882  64.125 1.00 32.02 ? 363  GLU A CA  1 
ATOM   2760 C C   . GLU A 1 383 ? -14.873 -5.454  64.711 1.00 32.44 ? 363  GLU A C   1 
ATOM   2761 O O   . GLU A 1 383 ? -14.028 -5.044  65.501 1.00 33.91 ? 363  GLU A O   1 
ATOM   2762 C CB  . GLU A 1 383 ? -14.978 -7.948  65.212 1.00 32.74 ? 363  GLU A CB  1 
ATOM   2763 C CG  . GLU A 1 383 ? -13.982 -7.921  66.457 1.00 39.27 ? 363  GLU A CG  1 
ATOM   2764 C CD  . GLU A 1 383 ? -12.518 -8.451  66.186 1.00 46.66 ? 363  GLU A CD  1 
ATOM   2765 O OE1 . GLU A 1 383 ? -12.211 -9.625  66.583 1.00 48.18 ? 363  GLU A OE1 1 
ATOM   2766 O OE2 . GLU A 1 383 ? -11.670 -7.691  65.616 1.00 47.29 ? 363  GLU A OE2 1 
ATOM   2767 N N   . ILE A 1 384 ? -15.888 -4.694  64.309 1.00 32.34 ? 364  ILE A N   1 
ATOM   2768 C CA  . ILE A 1 384 ? -16.135 -3.335  64.856 1.00 31.72 ? 364  ILE A CA  1 
ATOM   2769 C C   . ILE A 1 384 ? -16.475 -3.441  66.356 1.00 30.99 ? 364  ILE A C   1 
ATOM   2770 O O   . ILE A 1 384 ? -16.951 -4.478  66.795 1.00 30.97 ? 364  ILE A O   1 
ATOM   2771 C CB  . ILE A 1 384 ? -17.221 -2.617  63.966 1.00 31.73 ? 364  ILE A CB  1 
ATOM   2772 C CG1 . ILE A 1 384 ? -16.571 -1.543  63.097 1.00 32.18 ? 364  ILE A CG1 1 
ATOM   2773 C CG2 . ILE A 1 384 ? -18.402 -2.082  64.700 1.00 31.54 ? 364  ILE A CG2 1 
ATOM   2774 C CD1 . ILE A 1 384 ? -15.695 -2.142  62.053 1.00 35.58 ? 364  ILE A CD1 1 
ATOM   2775 N N   . ASP A 1 385 ? -16.213 -2.413  67.152 1.00 30.55 ? 365  ASP A N   1 
ATOM   2776 C CA  . ASP A 1 385 ? -16.591 -2.524  68.569 1.00 30.32 ? 365  ASP A CA  1 
ATOM   2777 C C   . ASP A 1 385 ? -17.378 -1.341  69.129 1.00 29.21 ? 365  ASP A C   1 
ATOM   2778 O O   . ASP A 1 385 ? -17.328 -1.052  70.335 1.00 29.05 ? 365  ASP A O   1 
ATOM   2779 C CB  . ASP A 1 385 ? -15.374 -2.856  69.446 1.00 30.76 ? 365  ASP A CB  1 
ATOM   2780 C CG  . ASP A 1 385 ? -14.402 -1.700  69.561 1.00 32.91 ? 365  ASP A CG  1 
ATOM   2781 O OD1 . ASP A 1 385 ? -14.559 -0.669  68.852 1.00 35.67 ? 365  ASP A OD1 1 
ATOM   2782 O OD2 . ASP A 1 385 ? -13.469 -1.838  70.385 1.00 35.36 ? 365  ASP A OD2 1 
ATOM   2783 N N   . PHE A 1 386 ? -18.103 -0.665  68.248 1.00 27.66 ? 366  PHE A N   1 
ATOM   2784 C CA  . PHE A 1 386 ? -18.950 0.451   68.648 1.00 26.55 ? 366  PHE A CA  1 
ATOM   2785 C C   . PHE A 1 386 ? -20.305 0.273   67.959 1.00 26.00 ? 366  PHE A C   1 
ATOM   2786 O O   . PHE A 1 386 ? -20.411 -0.445  66.940 1.00 25.17 ? 366  PHE A O   1 
ATOM   2787 C CB  . PHE A 1 386 ? -18.265 1.803   68.309 1.00 25.73 ? 366  PHE A CB  1 
ATOM   2788 C CG  . PHE A 1 386 ? -18.029 2.020   66.832 1.00 25.57 ? 366  PHE A CG  1 
ATOM   2789 C CD1 . PHE A 1 386 ? -16.864 1.551   66.215 1.00 26.01 ? 366  PHE A CD1 1 
ATOM   2790 C CD2 . PHE A 1 386 ? -18.989 2.683   66.049 1.00 23.76 ? 366  PHE A CD2 1 
ATOM   2791 C CE1 . PHE A 1 386 ? -16.648 1.744   64.831 1.00 26.66 ? 366  PHE A CE1 1 
ATOM   2792 C CE2 . PHE A 1 386 ? -18.807 2.872   64.685 1.00 23.75 ? 366  PHE A CE2 1 
ATOM   2793 C CZ  . PHE A 1 386 ? -17.627 2.412   64.059 1.00 27.30 ? 366  PHE A CZ  1 
ATOM   2794 N N   . SER A 1 387 ? -21.338 0.919   68.488 1.00 26.00 ? 367  SER A N   1 
ATOM   2795 C CA  . SER A 1 387 ? -22.650 0.850   67.824 1.00 26.44 ? 367  SER A CA  1 
ATOM   2796 C C   . SER A 1 387 ? -23.324 2.186   67.470 1.00 25.20 ? 367  SER A C   1 
ATOM   2797 O O   . SER A 1 387 ? -24.321 2.202   66.767 1.00 24.91 ? 367  SER A O   1 
ATOM   2798 C CB  . SER A 1 387 ? -23.601 -0.055  68.599 1.00 26.74 ? 367  SER A CB  1 
ATOM   2799 O OG  . SER A 1 387 ? -23.504 0.211   69.980 1.00 31.44 ? 367  SER A OG  1 
ATOM   2800 N N   . GLY A 1 388 ? -22.755 3.298   67.925 1.00 24.17 ? 368  GLY A N   1 
ATOM   2801 C CA  . GLY A 1 388 ? -23.258 4.614   67.568 1.00 22.84 ? 368  GLY A CA  1 
ATOM   2802 C C   . GLY A 1 388 ? -22.674 5.155   66.269 1.00 22.68 ? 368  GLY A C   1 
ATOM   2803 O O   . GLY A 1 388 ? -21.723 4.554   65.676 1.00 22.42 ? 368  GLY A O   1 
ATOM   2804 N N   . THR A 1 389 ? -23.197 6.298   65.814 1.00 21.39 ? 369  THR A N   1 
ATOM   2805 C CA  . THR A 1 389 ? -22.711 6.869   64.569 1.00 20.82 ? 369  THR A CA  1 
ATOM   2806 C C   . THR A 1 389 ? -21.297 7.395   64.815 1.00 20.17 ? 369  THR A C   1 
ATOM   2807 O O   . THR A 1 389 ? -21.043 7.980   65.859 1.00 18.41 ? 369  THR A O   1 
ATOM   2808 C CB  . THR A 1 389 ? -23.615 7.981   64.048 1.00 21.13 ? 369  THR A CB  1 
ATOM   2809 O OG1 . THR A 1 389 ? -24.883 7.406   63.739 1.00 23.24 ? 369  THR A OG1 1 
ATOM   2810 C CG2 . THR A 1 389 ? -23.041 8.578   62.764 1.00 19.39 ? 369  THR A CG2 1 
ATOM   2811 N N   . LEU A 1 390 ? -20.374 7.118   63.905 1.00 19.53 ? 370  LEU A N   1 
ATOM   2812 C CA  . LEU A 1 390 ? -19.022 7.632   64.095 1.00 19.09 ? 370  LEU A CA  1 
ATOM   2813 C C   . LEU A 1 390 ? -18.862 8.948   63.320 1.00 19.24 ? 370  LEU A C   1 
ATOM   2814 O O   . LEU A 1 390 ? -19.192 9.024   62.110 1.00 18.91 ? 370  LEU A O   1 
ATOM   2815 C CB  . LEU A 1 390 ? -17.956 6.606   63.646 1.00 20.01 ? 370  LEU A CB  1 
ATOM   2816 C CG  . LEU A 1 390 ? -16.515 7.112   63.791 1.00 21.36 ? 370  LEU A CG  1 
ATOM   2817 C CD1 . LEU A 1 390 ? -15.560 6.029   64.171 1.00 24.28 ? 370  LEU A CD1 1 
ATOM   2818 C CD2 . LEU A 1 390 ? -16.024 7.792   62.514 1.00 25.98 ? 370  LEU A CD2 1 
ATOM   2819 N N   . ILE A 1 391 ? -18.298 9.949   64.003 1.00 17.60 ? 371  ILE A N   1 
ATOM   2820 C CA  . ILE A 1 391 ? -18.135 11.276  63.418 1.00 17.48 ? 371  ILE A CA  1 
ATOM   2821 C C   . ILE A 1 391 ? -16.652 11.533  63.281 1.00 17.88 ? 371  ILE A C   1 
ATOM   2822 O O   . ILE A 1 391 ? -15.936 11.489  64.268 1.00 17.92 ? 371  ILE A O   1 
ATOM   2823 C CB  . ILE A 1 391 ? -18.815 12.374  64.282 1.00 18.14 ? 371  ILE A CB  1 
ATOM   2824 C CG1 . ILE A 1 391 ? -20.335 12.138  64.377 1.00 18.71 ? 371  ILE A CG1 1 
ATOM   2825 C CG2 . ILE A 1 391 ? -18.528 13.802  63.758 1.00 16.95 ? 371  ILE A CG2 1 
ATOM   2826 C CD1 . ILE A 1 391 ? -21.071 12.030  62.977 1.00 19.90 ? 371  ILE A CD1 1 
ATOM   2827 N N   . ARG A 1 392 ? -16.179 11.762  62.050 1.00 18.44 ? 372  ARG A N   1 
ATOM   2828 C CA  . ARG A 1 392 ? -14.770 12.112  61.889 1.00 17.95 ? 372  ARG A CA  1 
ATOM   2829 C C   . ARG A 1 392 ? -14.661 13.611  61.750 1.00 17.51 ? 372  ARG A C   1 
ATOM   2830 O O   . ARG A 1 392 ? -15.325 14.197  60.900 1.00 17.70 ? 372  ARG A O   1 
ATOM   2831 C CB  . ARG A 1 392 ? -14.093 11.412  60.679 1.00 17.88 ? 372  ARG A CB  1 
ATOM   2832 C CG  . ARG A 1 392 ? -12.534 11.511  60.746 1.00 20.03 ? 372  ARG A CG  1 
ATOM   2833 C CD  . ARG A 1 392 ? -11.913 10.990  59.473 1.00 23.65 ? 372  ARG A CD  1 
ATOM   2834 N NE  . ARG A 1 392 ? -12.223 11.801  58.285 1.00 24.54 ? 372  ARG A NE  1 
ATOM   2835 C CZ  . ARG A 1 392 ? -11.740 11.542  57.062 1.00 25.32 ? 372  ARG A CZ  1 
ATOM   2836 N NH1 . ARG A 1 392 ? -10.941 10.499  56.896 1.00 21.74 ? 372  ARG A NH1 1 
ATOM   2837 N NH2 . ARG A 1 392 ? -12.043 12.315  56.010 1.00 21.10 ? 372  ARG A NH2 1 
ATOM   2838 N N   . LEU A 1 393 ? -13.767 14.213  62.542 1.00 17.61 ? 373  LEU A N   1 
ATOM   2839 C CA  . LEU A 1 393 ? -13.502 15.632  62.470 1.00 16.78 ? 373  LEU A CA  1 
ATOM   2840 C C   . LEU A 1 393 ? -12.085 15.931  61.998 1.00 17.28 ? 373  LEU A C   1 
ATOM   2841 O O   . LEU A 1 393 ? -11.122 15.309  62.458 1.00 17.93 ? 373  LEU A O   1 
ATOM   2842 C CB  . LEU A 1 393 ? -13.640 16.236  63.859 1.00 18.21 ? 373  LEU A CB  1 
ATOM   2843 C CG  . LEU A 1 393 ? -14.985 16.096  64.584 1.00 18.16 ? 373  LEU A CG  1 
ATOM   2844 C CD1 . LEU A 1 393 ? -14.944 16.781  65.974 1.00 17.83 ? 373  LEU A CD1 1 
ATOM   2845 C CD2 . LEU A 1 393 ? -16.070 16.698  63.696 1.00 16.90 ? 373  LEU A CD2 1 
ATOM   2846 N N   . HIS A 1 394 ? -11.973 16.905  61.104 1.00 15.55 ? 374  HIS A N   1 
ATOM   2847 C CA  . HIS A 1 394 ? -10.698 17.579  60.899 1.00 16.51 ? 374  HIS A CA  1 
ATOM   2848 C C   . HIS A 1 394 ? -10.789 18.961  61.518 1.00 16.85 ? 374  HIS A C   1 
ATOM   2849 O O   . HIS A 1 394 ? -11.667 19.773  61.166 1.00 17.12 ? 374  HIS A O   1 
ATOM   2850 C CB  . HIS A 1 394 ? -10.313 17.728  59.432 1.00 15.80 ? 374  HIS A CB  1 
ATOM   2851 C CG  . HIS A 1 394 ? -8.991  18.409  59.294 1.00 17.77 ? 374  HIS A CG  1 
ATOM   2852 N ND1 . HIS A 1 394 ? -8.871  19.733  58.941 1.00 17.64 ? 374  HIS A ND1 1 
ATOM   2853 C CD2 . HIS A 1 394 ? -7.761  18.004  59.674 1.00 20.46 ? 374  HIS A CD2 1 
ATOM   2854 C CE1 . HIS A 1 394 ? -7.597  20.081  59.002 1.00 22.13 ? 374  HIS A CE1 1 
ATOM   2855 N NE2 . HIS A 1 394 ? -6.904  19.051  59.449 1.00 18.45 ? 374  HIS A NE2 1 
ATOM   2856 N N   . ILE A 1 395 ? -9.963  19.190  62.511 1.00 16.28 ? 375  ILE A N   1 
ATOM   2857 C CA  . ILE A 1 395 ? -9.914  20.463  63.191 1.00 15.77 ? 375  ILE A CA  1 
ATOM   2858 C C   . ILE A 1 395 ? -8.892  21.373  62.454 1.00 16.50 ? 375  ILE A C   1 
ATOM   2859 O O   . ILE A 1 395 ? -7.662  21.100  62.414 1.00 16.93 ? 375  ILE A O   1 
ATOM   2860 C CB  . ILE A 1 395 ? -9.537  20.271  64.695 1.00 15.23 ? 375  ILE A CB  1 
ATOM   2861 C CG1 . ILE A 1 395 ? -10.532 19.359  65.422 1.00 15.24 ? 375  ILE A CG1 1 
ATOM   2862 C CG2 . ILE A 1 395 ? -9.381  21.650  65.388 1.00 15.00 ? 375  ILE A CG2 1 
ATOM   2863 C CD1 . ILE A 1 395 ? -12.032 19.823  65.363 1.00 14.28 ? 375  ILE A CD1 1 
ATOM   2864 N N   . GLY A 1 396 ? -9.391  22.443  61.856 1.00 16.28 ? 376  GLY A N   1 
ATOM   2865 C CA  . GLY A 1 396 ? -8.568  23.355  61.038 1.00 16.45 ? 376  GLY A CA  1 
ATOM   2866 C C   . GLY A 1 396 ? -7.993  24.453  61.925 1.00 17.19 ? 376  GLY A C   1 
ATOM   2867 O O   . GLY A 1 396 ? -7.794  24.259  63.129 1.00 17.52 ? 376  GLY A O   1 
ATOM   2868 N N   . LEU A 1 397 ? -7.793  25.624  61.334 1.00 18.14 ? 377  LEU A N   1 
ATOM   2869 C CA  . LEU A 1 397 ? -7.186  26.750  62.004 1.00 18.75 ? 377  LEU A CA  1 
ATOM   2870 C C   . LEU A 1 397 ? -8.122  27.821  62.590 1.00 18.54 ? 377  LEU A C   1 
ATOM   2871 O O   . LEU A 1 397 ? -7.662  28.841  63.133 1.00 18.88 ? 377  LEU A O   1 
ATOM   2872 C CB  . LEU A 1 397 ? -6.130  27.362  61.053 1.00 18.43 ? 377  LEU A CB  1 
ATOM   2873 C CG  . LEU A 1 397 ? -4.996  26.427  60.565 1.00 20.73 ? 377  LEU A CG  1 
ATOM   2874 C CD1 . LEU A 1 397 ? -4.037  27.211  59.678 1.00 21.90 ? 377  LEU A CD1 1 
ATOM   2875 C CD2 . LEU A 1 397 ? -4.226  25.784  61.707 1.00 18.23 ? 377  LEU A CD2 1 
ATOM   2876 N N   . GLU A 1 398 ? -9.440  27.584  62.527 1.00 17.64 ? 378  GLU A N   1 
ATOM   2877 C CA  . GLU A 1 398 ? -10.418 28.463  63.123 1.00 18.41 ? 378  GLU A CA  1 
ATOM   2878 C C   . GLU A 1 398 ? -10.259 28.571  64.613 1.00 18.32 ? 378  GLU A C   1 
ATOM   2879 O O   . GLU A 1 398 ? -9.593  27.749  65.220 1.00 19.71 ? 378  GLU A O   1 
ATOM   2880 C CB  . GLU A 1 398 ? -11.829 27.948  62.800 1.00 16.10 ? 378  GLU A CB  1 
ATOM   2881 C CG  . GLU A 1 398 ? -12.056 27.829  61.284 1.00 16.46 ? 378  GLU A CG  1 
ATOM   2882 C CD  . GLU A 1 398 ? -11.973 26.407  60.771 1.00 15.70 ? 378  GLU A CD  1 
ATOM   2883 O OE1 . GLU A 1 398 ? -11.263 25.586  61.370 1.00 18.46 ? 378  GLU A OE1 1 
ATOM   2884 O OE2 . GLU A 1 398 ? -12.644 26.099  59.755 1.00 20.23 ? 378  GLU A OE2 1 
ATOM   2885 N N   . ASP A 1 399 ? -10.855 29.586  65.220 1.00 19.64 ? 379  ASP A N   1 
ATOM   2886 C CA  . ASP A 1 399 ? -10.786 29.673  66.677 1.00 19.99 ? 379  ASP A CA  1 
ATOM   2887 C C   . ASP A 1 399 ? -11.404 28.410  67.300 1.00 19.41 ? 379  ASP A C   1 
ATOM   2888 O O   . ASP A 1 399 ? -12.535 28.024  66.943 1.00 18.04 ? 379  ASP A O   1 
ATOM   2889 C CB  . ASP A 1 399 ? -11.492 30.925  67.193 1.00 20.54 ? 379  ASP A CB  1 
ATOM   2890 C CG  . ASP A 1 399 ? -11.418 31.043  68.714 1.00 22.36 ? 379  ASP A CG  1 
ATOM   2891 O OD1 . ASP A 1 399 ? -12.271 30.451  69.389 1.00 26.61 ? 379  ASP A OD1 1 
ATOM   2892 O OD2 . ASP A 1 399 ? -10.529 31.748  69.220 1.00 27.30 ? 379  ASP A OD2 1 
ATOM   2893 N N   . VAL A 1 400 ? -10.672 27.754  68.205 1.00 18.88 ? 380  VAL A N   1 
ATOM   2894 C CA  . VAL A 1 400 ? -11.175 26.458  68.773 1.00 19.59 ? 380  VAL A CA  1 
ATOM   2895 C C   . VAL A 1 400 ? -12.516 26.597  69.524 1.00 19.62 ? 380  VAL A C   1 
ATOM   2896 O O   . VAL A 1 400 ? -13.383 25.713  69.455 1.00 18.62 ? 380  VAL A O   1 
ATOM   2897 C CB  . VAL A 1 400 ? -10.080 25.685  69.597 1.00 19.73 ? 380  VAL A CB  1 
ATOM   2898 C CG1 . VAL A 1 400 ? -9.667  26.442  70.904 1.00 19.01 ? 380  VAL A CG1 1 
ATOM   2899 C CG2 . VAL A 1 400 ? -10.581 24.226  69.878 1.00 20.49 ? 380  VAL A CG2 1 
ATOM   2900 N N   . ASP A 1 401 ? -12.722 27.722  70.184 1.00 19.81 ? 381  ASP A N   1 
ATOM   2901 C CA  . ASP A 1 401 ? -14.004 27.920  70.909 1.00 21.51 ? 381  ASP A CA  1 
ATOM   2902 C C   . ASP A 1 401 ? -15.180 28.126  69.935 1.00 21.46 ? 381  ASP A C   1 
ATOM   2903 O O   . ASP A 1 401 ? -16.315 27.707  70.213 1.00 21.40 ? 381  ASP A O   1 
ATOM   2904 C CB  . ASP A 1 401 ? -13.894 29.056  71.926 1.00 22.23 ? 381  ASP A CB  1 
ATOM   2905 C CG  . ASP A 1 401 ? -12.793 28.797  72.980 1.00 25.15 ? 381  ASP A CG  1 
ATOM   2906 O OD1 . ASP A 1 401 ? -12.765 27.685  73.553 1.00 29.09 ? 381  ASP A OD1 1 
ATOM   2907 O OD2 . ASP A 1 401 ? -11.950 29.689  73.210 1.00 25.16 ? 381  ASP A OD2 1 
ATOM   2908 N N   . ASP A 1 402 ? -14.909 28.741  68.785 1.00 21.09 ? 382  ASP A N   1 
ATOM   2909 C CA  . ASP A 1 402 ? -15.947 28.840  67.733 1.00 21.10 ? 382  ASP A CA  1 
ATOM   2910 C C   . ASP A 1 402 ? -16.370 27.445  67.248 1.00 21.24 ? 382  ASP A C   1 
ATOM   2911 O O   . ASP A 1 402 ? -17.564 27.156  67.003 1.00 20.45 ? 382  ASP A O   1 
ATOM   2912 C CB  . ASP A 1 402 ? -15.426 29.686  66.563 1.00 21.76 ? 382  ASP A CB  1 
ATOM   2913 C CG  . ASP A 1 402 ? -15.422 31.176  66.864 1.00 22.17 ? 382  ASP A CG  1 
ATOM   2914 O OD1 . ASP A 1 402 ? -16.113 31.612  67.819 1.00 20.89 ? 382  ASP A OD1 1 
ATOM   2915 O OD2 . ASP A 1 402 ? -14.720 31.923  66.135 1.00 23.61 ? 382  ASP A OD2 1 
ATOM   2916 N N   . LEU A 1 403 ? -15.368 26.582  67.101 1.00 20.44 ? 383  LEU A N   1 
ATOM   2917 C CA  . LEU A 1 403 ? -15.568 25.226  66.631 1.00 19.93 ? 383  LEU A CA  1 
ATOM   2918 C C   . LEU A 1 403 ? -16.335 24.418  67.696 1.00 20.81 ? 383  LEU A C   1 
ATOM   2919 O O   . LEU A 1 403 ? -17.342 23.746  67.379 1.00 21.46 ? 383  LEU A O   1 
ATOM   2920 C CB  . LEU A 1 403 ? -14.208 24.583  66.272 1.00 19.85 ? 383  LEU A CB  1 
ATOM   2921 C CG  . LEU A 1 403 ? -13.471 25.213  65.084 1.00 17.70 ? 383  LEU A CG  1 
ATOM   2922 C CD1 . LEU A 1 403 ? -12.074 24.566  64.988 1.00 19.11 ? 383  LEU A CD1 1 
ATOM   2923 C CD2 . LEU A 1 403 ? -14.216 25.020  63.761 1.00 20.81 ? 383  LEU A CD2 1 
ATOM   2924 N N   . ILE A 1 404 ? -15.924 24.531  68.956 1.00 20.08 ? 384  ILE A N   1 
ATOM   2925 C CA  . ILE A 1 404 ? -16.674 23.859  70.046 1.00 20.85 ? 384  ILE A CA  1 
ATOM   2926 C C   . ILE A 1 404 ? -18.107 24.358  70.088 1.00 20.82 ? 384  ILE A C   1 
ATOM   2927 O O   . ILE A 1 404 ? -19.046 23.538  70.143 1.00 19.92 ? 384  ILE A O   1 
ATOM   2928 C CB  . ILE A 1 404 ? -16.001 24.042  71.441 1.00 20.86 ? 384  ILE A CB  1 
ATOM   2929 C CG1 . ILE A 1 404 ? -14.738 23.156  71.482 1.00 21.42 ? 384  ILE A CG1 1 
ATOM   2930 C CG2 . ILE A 1 404 ? -16.992 23.686  72.531 1.00 21.24 ? 384  ILE A CG2 1 
ATOM   2931 C CD1 . ILE A 1 404 ? -13.840 23.311  72.720 1.00 20.49 ? 384  ILE A CD1 1 
ATOM   2932 N N   . ALA A 1 405 ? -18.287 25.678  69.999 1.00 20.48 ? 385  ALA A N   1 
ATOM   2933 C CA  . ALA A 1 405 ? -19.652 26.222  69.884 1.00 20.86 ? 385  ALA A CA  1 
ATOM   2934 C C   . ALA A 1 405 ? -20.479 25.615  68.743 1.00 21.53 ? 385  ALA A C   1 
ATOM   2935 O O   . ALA A 1 405 ? -21.691 25.374  68.919 1.00 20.90 ? 385  ALA A O   1 
ATOM   2936 C CB  . ALA A 1 405 ? -19.649 27.753  69.815 1.00 22.00 ? 385  ALA A CB  1 
ATOM   2937 N N   . ASP A 1 406 ? -19.852 25.335  67.594 1.00 20.91 ? 386  ASP A N   1 
ATOM   2938 C CA  . ASP A 1 406 ? -20.571 24.788  66.429 1.00 21.75 ? 386  ASP A CA  1 
ATOM   2939 C C   . ASP A 1 406 ? -20.996 23.325  66.704 1.00 21.57 ? 386  ASP A C   1 
ATOM   2940 O O   . ASP A 1 406 ? -22.111 22.899  66.370 1.00 21.23 ? 386  ASP A O   1 
ATOM   2941 C CB  . ASP A 1 406 ? -19.665 24.891  65.194 1.00 20.40 ? 386  ASP A CB  1 
ATOM   2942 C CG  . ASP A 1 406 ? -20.427 24.913  63.876 1.00 23.46 ? 386  ASP A CG  1 
ATOM   2943 O OD1 . ASP A 1 406 ? -21.613 25.310  63.822 1.00 23.52 ? 386  ASP A OD1 1 
ATOM   2944 O OD2 . ASP A 1 406 ? -19.807 24.534  62.862 1.00 27.67 ? 386  ASP A OD2 1 
ATOM   2945 N N   . LEU A 1 407 ? -20.089 22.562  67.316 1.00 22.41 ? 387  LEU A N   1 
ATOM   2946 C CA  . LEU A 1 407 ? -20.388 21.195  67.727 1.00 23.23 ? 387  LEU A CA  1 
ATOM   2947 C C   . LEU A 1 407 ? -21.453 21.141  68.820 1.00 23.65 ? 387  LEU A C   1 
ATOM   2948 O O   . LEU A 1 407 ? -22.324 20.270  68.788 1.00 23.67 ? 387  LEU A O   1 
ATOM   2949 C CB  . LEU A 1 407 ? -19.122 20.526  68.222 1.00 23.30 ? 387  LEU A CB  1 
ATOM   2950 C CG  . LEU A 1 407 ? -18.184 20.141  67.079 1.00 23.47 ? 387  LEU A CG  1 
ATOM   2951 C CD1 . LEU A 1 407 ? -16.783 19.950  67.602 1.00 21.20 ? 387  LEU A CD1 1 
ATOM   2952 C CD2 . LEU A 1 407 ? -18.720 18.858  66.398 1.00 24.70 ? 387  LEU A CD2 1 
ATOM   2953 N N   . ASP A 1 408 ? -21.358 22.058  69.794 1.00 23.53 ? 388  ASP A N   1 
ATOM   2954 C CA  . ASP A 1 408 ? -22.372 22.187  70.861 1.00 24.71 ? 388  ASP A CA  1 
ATOM   2955 C C   . ASP A 1 408 ? -23.756 22.393  70.256 1.00 24.46 ? 388  ASP A C   1 
ATOM   2956 O O   . ASP A 1 408 ? -24.710 21.736  70.675 1.00 23.64 ? 388  ASP A O   1 
ATOM   2957 C CB  . ASP A 1 408 ? -22.029 23.355  71.797 1.00 25.64 ? 388  ASP A CB  1 
ATOM   2958 C CG  . ASP A 1 408 ? -23.017 23.511  72.939 1.00 30.71 ? 388  ASP A CG  1 
ATOM   2959 O OD1 . ASP A 1 408 ? -22.874 22.724  73.923 1.00 34.20 ? 388  ASP A OD1 1 
ATOM   2960 O OD2 . ASP A 1 408 ? -23.900 24.429  72.851 1.00 32.65 ? 388  ASP A OD2 1 
ATOM   2961 N N   . ALA A 1 409 ? -23.865 23.271  69.259 1.00 24.02 ? 389  ALA A N   1 
ATOM   2962 C CA  . ALA A 1 409 ? -25.158 23.494  68.593 1.00 22.95 ? 389  ALA A CA  1 
ATOM   2963 C C   . ALA A 1 409 ? -25.635 22.246  67.837 1.00 23.04 ? 389  ALA A C   1 
ATOM   2964 O O   . ALA A 1 409 ? -26.854 21.949  67.800 1.00 21.54 ? 389  ALA A O   1 
ATOM   2965 C CB  . ALA A 1 409 ? -25.113 24.682  67.662 1.00 23.88 ? 389  ALA A CB  1 
ATOM   2966 N N   . GLY A 1 410 ? -24.685 21.523  67.248 1.00 21.53 ? 390  GLY A N   1 
ATOM   2967 C CA  . GLY A 1 410 ? -25.002 20.249  66.589 1.00 21.79 ? 390  GLY A CA  1 
ATOM   2968 C C   . GLY A 1 410 ? -25.544 19.233  67.572 1.00 21.24 ? 390  GLY A C   1 
ATOM   2969 O O   . GLY A 1 410 ? -26.472 18.482  67.245 1.00 22.05 ? 390  GLY A O   1 
ATOM   2970 N N   . PHE A 1 411 ? -25.000 19.199  68.788 1.00 21.08 ? 391  PHE A N   1 
ATOM   2971 C CA  . PHE A 1 411 ? -25.509 18.262  69.812 1.00 21.89 ? 391  PHE A CA  1 
ATOM   2972 C C   . PHE A 1 411 ? -26.963 18.568  70.164 1.00 22.21 ? 391  PHE A C   1 
ATOM   2973 O O   . PHE A 1 411 ? -27.776 17.659  70.280 1.00 21.37 ? 391  PHE A O   1 
ATOM   2974 C CB  . PHE A 1 411 ? -24.638 18.246  71.084 1.00 21.87 ? 391  PHE A CB  1 
ATOM   2975 C CG  . PHE A 1 411 ? -23.367 17.436  70.953 1.00 21.70 ? 391  PHE A CG  1 
ATOM   2976 C CD1 . PHE A 1 411 ? -23.390 16.127  70.479 1.00 21.10 ? 391  PHE A CD1 1 
ATOM   2977 C CD2 . PHE A 1 411 ? -22.146 17.982  71.335 1.00 21.78 ? 391  PHE A CD2 1 
ATOM   2978 C CE1 . PHE A 1 411 ? -22.220 15.384  70.383 1.00 20.07 ? 391  PHE A CE1 1 
ATOM   2979 C CE2 . PHE A 1 411 ? -20.961 17.247  71.226 1.00 21.42 ? 391  PHE A CE2 1 
ATOM   2980 C CZ  . PHE A 1 411 ? -21.012 15.938  70.749 1.00 19.20 ? 391  PHE A CZ  1 
ATOM   2981 N N   . ALA A 1 412 ? -27.290 19.849  70.300 1.00 22.15 ? 392  ALA A N   1 
ATOM   2982 C CA  . ALA A 1 412 ? -28.662 20.249  70.540 1.00 23.40 ? 392  ALA A CA  1 
ATOM   2983 C C   . ALA A 1 412 ? -29.631 19.739  69.459 1.00 24.00 ? 392  ALA A C   1 
ATOM   2984 O O   . ALA A 1 412 ? -30.778 19.433  69.773 1.00 24.80 ? 392  ALA A O   1 
ATOM   2985 C CB  . ALA A 1 412 ? -28.770 21.789  70.721 1.00 22.77 ? 392  ALA A CB  1 
ATOM   2986 N N   . ARG A 1 413 ? -29.171 19.616  68.206 1.00 24.08 ? 393  ARG A N   1 
ATOM   2987 C CA  . ARG A 1 413 ? -30.055 19.193  67.112 1.00 24.37 ? 393  ARG A CA  1 
ATOM   2988 C C   . ARG A 1 413 ? -30.428 17.689  67.183 1.00 24.85 ? 393  ARG A C   1 
ATOM   2989 O O   . ARG A 1 413 ? -31.359 17.253  66.513 1.00 25.84 ? 393  ARG A O   1 
ATOM   2990 C CB  . ARG A 1 413 ? -29.452 19.546  65.741 1.00 24.27 ? 393  ARG A CB  1 
ATOM   2991 C CG  . ARG A 1 413 ? -29.321 21.052  65.497 1.00 22.92 ? 393  ARG A CG  1 
ATOM   2992 C CD  . ARG A 1 413 ? -29.111 21.405  64.032 1.00 23.09 ? 393  ARG A CD  1 
ATOM   2993 N NE  . ARG A 1 413 ? -27.754 21.034  63.591 1.00 24.49 ? 393  ARG A NE  1 
ATOM   2994 C CZ  . ARG A 1 413 ? -26.620 21.694  63.876 1.00 26.40 ? 393  ARG A CZ  1 
ATOM   2995 N NH1 . ARG A 1 413 ? -26.615 22.799  64.614 1.00 25.74 ? 393  ARG A NH1 1 
ATOM   2996 N NH2 . ARG A 1 413 ? -25.460 21.234  63.407 1.00 20.21 ? 393  ARG A NH2 1 
ATOM   2997 N N   . ILE A 1 414 ? -29.710 16.910  67.993 1.00 24.32 ? 394  ILE A N   1 
ATOM   2998 C CA  . ILE A 1 414 ? -29.876 15.449  68.002 1.00 24.91 ? 394  ILE A CA  1 
ATOM   2999 C C   . ILE A 1 414 ? -30.170 14.847  69.391 1.00 25.71 ? 394  ILE A C   1 
ATOM   3000 O O   . ILE A 1 414 ? -30.178 13.627  69.537 1.00 25.95 ? 394  ILE A O   1 
ATOM   3001 C CB  . ILE A 1 414 ? -28.662 14.708  67.344 1.00 24.53 ? 394  ILE A CB  1 
ATOM   3002 C CG1 . ILE A 1 414 ? -27.325 15.169  67.953 1.00 25.49 ? 394  ILE A CG1 1 
ATOM   3003 C CG2 . ILE A 1 414 ? -28.656 14.913  65.835 1.00 23.99 ? 394  ILE A CG2 1 
ATOM   3004 C CD1 . ILE A 1 414 ? -26.190 14.125  67.800 1.00 23.32 ? 394  ILE A CD1 1 
ATOM   3005 N N   . VAL A 1 415 ? -30.412 15.684  70.403 1.00 26.53 ? 395  VAL A N   1 
ATOM   3006 C CA  . VAL A 1 415 ? -30.655 15.181  71.774 1.00 28.02 ? 395  VAL A CA  1 
ATOM   3007 C C   . VAL A 1 415 ? -31.987 14.434  71.780 1.00 28.60 ? 395  VAL A C   1 
ATOM   3008 O O   . VAL A 1 415 ? -32.230 13.568  72.638 1.00 29.14 ? 395  VAL A O   1 
ATOM   3009 C CB  . VAL A 1 415 ? -30.728 16.307  72.877 1.00 28.13 ? 395  VAL A CB  1 
ATOM   3010 C CG1 . VAL A 1 415 ? -30.436 15.739  74.275 1.00 29.29 ? 395  VAL A CG1 1 
ATOM   3011 C CG2 . VAL A 1 415 ? -29.796 17.423  72.595 1.00 29.42 ? 395  VAL A CG2 1 
ATOM   3012 O OXT . VAL A 1 415 ? -32.838 14.710  70.909 1.00 28.91 ? 395  VAL A OXT 1 
ATOM   3013 N N   . LYS B 1 24  ? 16.295  34.173  10.834 1.00 42.06 ? 4    LYS B N   1 
ATOM   3014 C CA  . LYS B 1 24  ? 16.228  35.655  10.670 1.00 42.06 ? 4    LYS B CA  1 
ATOM   3015 C C   . LYS B 1 24  ? 14.821  36.130  10.254 1.00 40.46 ? 4    LYS B C   1 
ATOM   3016 O O   . LYS B 1 24  ? 14.458  37.306  10.434 1.00 40.65 ? 4    LYS B O   1 
ATOM   3017 C CB  . LYS B 1 24  ? 17.295  36.145  9.669  1.00 42.92 ? 4    LYS B CB  1 
ATOM   3018 C CG  . LYS B 1 24  ? 18.760  36.120  10.170 1.00 46.61 ? 4    LYS B CG  1 
ATOM   3019 C CD  . LYS B 1 24  ? 19.367  34.692  10.194 1.00 51.28 ? 4    LYS B CD  1 
ATOM   3020 C CE  . LYS B 1 24  ? 19.361  34.088  11.619 1.00 53.88 ? 4    LYS B CE  1 
ATOM   3021 N NZ  . LYS B 1 24  ? 18.792  32.682  11.703 1.00 55.13 ? 4    LYS B NZ  1 
ATOM   3022 N N   . LYS B 1 25  ? 14.030  35.211  9.703  1.00 38.03 ? 5    LYS B N   1 
ATOM   3023 C CA  . LYS B 1 25  ? 12.659  35.526  9.346  1.00 34.89 ? 5    LYS B CA  1 
ATOM   3024 C C   . LYS B 1 25  ? 11.845  35.690  10.644 1.00 32.37 ? 5    LYS B C   1 
ATOM   3025 O O   . LYS B 1 25  ? 12.257  35.201  11.715 1.00 30.55 ? 5    LYS B O   1 
ATOM   3026 C CB  . LYS B 1 25  ? 12.088  34.439  8.432  1.00 35.72 ? 5    LYS B CB  1 
ATOM   3027 C CG  . LYS B 1 25  ? 13.132  33.785  7.451  1.00 37.74 ? 5    LYS B CG  1 
ATOM   3028 C CD  . LYS B 1 25  ? 13.603  34.694  6.333  1.00 39.13 ? 5    LYS B CD  1 
ATOM   3029 C CE  . LYS B 1 25  ? 13.708  33.938  4.968  1.00 39.54 ? 5    LYS B CE  1 
ATOM   3030 N NZ  . LYS B 1 25  ? 14.604  32.756  4.900  1.00 40.10 ? 5    LYS B NZ  1 
ATOM   3031 N N   . LEU B 1 26  ? 10.707  36.378  10.557 1.00 29.65 ? 6    LEU B N   1 
ATOM   3032 C CA  . LEU B 1 26  ? 9.920   36.653  11.752 1.00 27.62 ? 6    LEU B CA  1 
ATOM   3033 C C   . LEU B 1 26  ? 9.541   35.375  12.534 1.00 25.47 ? 6    LEU B C   1 
ATOM   3034 O O   . LEU B 1 26  ? 9.636   35.348  13.758 1.00 25.19 ? 6    LEU B O   1 
ATOM   3035 C CB  . LEU B 1 26  ? 8.696   37.499  11.424 1.00 27.84 ? 6    LEU B CB  1 
ATOM   3036 C CG  . LEU B 1 26  ? 7.683   37.843  12.528 1.00 28.33 ? 6    LEU B CG  1 
ATOM   3037 C CD1 . LEU B 1 26  ? 8.250   38.664  13.679 1.00 27.99 ? 6    LEU B CD1 1 
ATOM   3038 C CD2 . LEU B 1 26  ? 6.528   38.586  11.892 1.00 30.80 ? 6    LEU B CD2 1 
ATOM   3039 N N   . ASP B 1 27  ? 9.122   34.325  11.835 1.00 23.66 ? 7    ASP B N   1 
ATOM   3040 C CA  . ASP B 1 27  ? 8.726   33.088  12.522 1.00 22.01 ? 7    ASP B CA  1 
ATOM   3041 C C   . ASP B 1 27  ? 9.882   32.504  13.332 1.00 20.99 ? 7    ASP B C   1 
ATOM   3042 O O   . ASP B 1 27  ? 9.664   31.969  14.425 1.00 20.31 ? 7    ASP B O   1 
ATOM   3043 C CB  . ASP B 1 27  ? 8.276   32.036  11.526 1.00 23.08 ? 7    ASP B CB  1 
ATOM   3044 C CG  . ASP B 1 27  ? 7.022   32.410  10.820 1.00 22.97 ? 7    ASP B CG  1 
ATOM   3045 O OD1 . ASP B 1 27  ? 6.217   33.170  11.406 1.00 26.12 ? 7    ASP B OD1 1 
ATOM   3046 O OD2 . ASP B 1 27  ? 6.843   31.915  9.690  1.00 29.75 ? 7    ASP B OD2 1 
ATOM   3047 N N   . THR B 1 28  ? 11.093  32.597  12.800 1.00 20.09 ? 8    THR B N   1 
ATOM   3048 C CA  . THR B 1 28  ? 12.255  32.120  13.546 1.00 20.15 ? 8    THR B CA  1 
ATOM   3049 C C   . THR B 1 28  ? 12.523  33.017  14.755 1.00 20.17 ? 8    THR B C   1 
ATOM   3050 O O   . THR B 1 28  ? 12.825  32.531  15.850 1.00 19.62 ? 8    THR B O   1 
ATOM   3051 C CB  . THR B 1 28  ? 13.496  32.046  12.660 1.00 20.24 ? 8    THR B CB  1 
ATOM   3052 O OG1 . THR B 1 28  ? 13.198  31.193  11.559 1.00 21.00 ? 8    THR B OG1 1 
ATOM   3053 C CG2 . THR B 1 28  ? 14.700  31.458  13.439 1.00 21.85 ? 8    THR B CG2 1 
ATOM   3054 N N   . GLN B 1 29  ? 12.423  34.326  14.538 1.00 20.88 ? 9    GLN B N   1 
ATOM   3055 C CA  . GLN B 1 29  ? 12.583  35.292  15.607 1.00 21.49 ? 9    GLN B CA  1 
ATOM   3056 C C   . GLN B 1 29  ? 11.607  34.999  16.730 1.00 20.29 ? 9    GLN B C   1 
ATOM   3057 O O   . GLN B 1 29  ? 11.995  34.929  17.873 1.00 19.55 ? 9    GLN B O   1 
ATOM   3058 C CB  . GLN B 1 29  ? 12.283  36.669  15.088 1.00 22.61 ? 9    GLN B CB  1 
ATOM   3059 C CG  . GLN B 1 29  ? 13.490  37.468  14.757 1.00 29.42 ? 9    GLN B CG  1 
ATOM   3060 C CD  . GLN B 1 29  ? 13.212  38.954  15.062 1.00 36.49 ? 9    GLN B CD  1 
ATOM   3061 O OE1 . GLN B 1 29  ? 12.141  39.477  14.730 1.00 37.22 ? 9    GLN B OE1 1 
ATOM   3062 N NE2 . GLN B 1 29  ? 14.147  39.608  15.745 1.00 40.23 ? 9    GLN B NE2 1 
ATOM   3063 N N   . LEU B 1 30  ? 10.330  34.852  16.373 1.00 18.88 ? 10   LEU B N   1 
ATOM   3064 C CA  . LEU B 1 30  ? 9.292   34.597  17.352 1.00 19.68 ? 10   LEU B CA  1 
ATOM   3065 C C   . LEU B 1 30  ? 9.526   33.347  18.213 1.00 20.18 ? 10   LEU B C   1 
ATOM   3066 O O   . LEU B 1 30  ? 9.291   33.358  19.437 1.00 19.89 ? 10   LEU B O   1 
ATOM   3067 C CB  . LEU B 1 30  ? 7.916   34.521  16.649 1.00 19.62 ? 10   LEU B CB  1 
ATOM   3068 C CG  . LEU B 1 30  ? 7.349   35.862  16.142 1.00 21.81 ? 10   LEU B CG  1 
ATOM   3069 C CD1 . LEU B 1 30  ? 6.054   35.635  15.363 1.00 22.49 ? 10   LEU B CD1 1 
ATOM   3070 C CD2 . LEU B 1 30  ? 7.050   36.872  17.253 1.00 24.37 ? 10   LEU B CD2 1 
ATOM   3071 N N   . VAL B 1 31  ? 9.958   32.270  17.577 1.00 19.55 ? 11   VAL B N   1 
ATOM   3072 C CA  . VAL B 1 31  ? 10.230  31.048  18.310 1.00 19.89 ? 11   VAL B CA  1 
ATOM   3073 C C   . VAL B 1 31  ? 11.349  31.273  19.336 1.00 20.33 ? 11   VAL B C   1 
ATOM   3074 O O   . VAL B 1 31  ? 11.274  30.769  20.477 1.00 20.47 ? 11   VAL B O   1 
ATOM   3075 C CB  . VAL B 1 31  ? 10.581  29.877  17.331 1.00 19.85 ? 11   VAL B CB  1 
ATOM   3076 C CG1 . VAL B 1 31  ? 11.248  28.689  18.049 1.00 17.49 ? 11   VAL B CG1 1 
ATOM   3077 C CG2 . VAL B 1 31  ? 9.291   29.413  16.594 1.00 18.80 ? 11   VAL B CG2 1 
ATOM   3078 N N   . ASN B 1 32  ? 12.392  31.993  18.920 1.00 19.58 ? 12   ASN B N   1 
ATOM   3079 C CA  . ASN B 1 32  ? 13.581  32.134  19.721 1.00 20.15 ? 12   ASN B CA  1 
ATOM   3080 C C   . ASN B 1 32  ? 13.713  33.345  20.621 1.00 20.02 ? 12   ASN B C   1 
ATOM   3081 O O   . ASN B 1 32  ? 14.493  33.318  21.543 1.00 20.59 ? 12   ASN B O   1 
ATOM   3082 C CB  . ASN B 1 32  ? 14.823  31.970  18.836 1.00 19.71 ? 12   ASN B CB  1 
ATOM   3083 C CG  . ASN B 1 32  ? 14.961  30.546  18.297 1.00 21.38 ? 12   ASN B CG  1 
ATOM   3084 O OD1 . ASN B 1 32  ? 14.957  29.587  19.074 1.00 26.30 ? 12   ASN B OD1 1 
ATOM   3085 N ND2 . ASN B 1 32  ? 15.090  30.404  16.988 1.00 23.75 ? 12   ASN B ND2 1 
ATOM   3086 N N   . ALA B 1 33  ? 12.934  34.388  20.360 1.00 20.44 ? 13   ALA B N   1 
ATOM   3087 C CA  . ALA B 1 33  ? 13.007  35.638  21.109 1.00 20.86 ? 13   ALA B CA  1 
ATOM   3088 C C   . ALA B 1 33  ? 12.946  35.445  22.640 1.00 21.60 ? 13   ALA B C   1 
ATOM   3089 O O   . ALA B 1 33  ? 11.966  34.922  23.213 1.00 22.06 ? 13   ALA B O   1 
ATOM   3090 C CB  . ALA B 1 33  ? 11.961  36.623  20.608 1.00 21.25 ? 13   ALA B CB  1 
ATOM   3091 N N   . GLY B 1 34  ? 14.019  35.868  23.290 1.00 22.01 ? 14   GLY B N   1 
ATOM   3092 C CA  . GLY B 1 34  ? 14.131  35.834  24.737 1.00 22.42 ? 14   GLY B CA  1 
ATOM   3093 C C   . GLY B 1 34  ? 14.661  34.513  25.275 1.00 22.53 ? 14   GLY B C   1 
ATOM   3094 O O   . GLY B 1 34  ? 14.842  34.384  26.472 1.00 22.65 ? 14   GLY B O   1 
ATOM   3095 N N   . ARG B 1 35  ? 14.917  33.524  24.414 1.00 23.27 ? 15   ARG B N   1 
ATOM   3096 C CA  . ARG B 1 35  ? 15.253  32.181  24.916 1.00 24.16 ? 15   ARG B CA  1 
ATOM   3097 C C   . ARG B 1 35  ? 16.744  31.890  25.080 1.00 25.15 ? 15   ARG B C   1 
ATOM   3098 O O   . ARG B 1 35  ? 17.229  30.859  24.634 1.00 25.75 ? 15   ARG B O   1 
ATOM   3099 C CB  . ARG B 1 35  ? 14.579  31.104  24.076 1.00 24.50 ? 15   ARG B CB  1 
ATOM   3100 C CG  . ARG B 1 35  ? 13.076  30.997  24.417 1.00 25.79 ? 15   ARG B CG  1 
ATOM   3101 C CD  . ARG B 1 35  ? 12.259  30.055  23.544 1.00 25.88 ? 15   ARG B CD  1 
ATOM   3102 N NE  . ARG B 1 35  ? 12.889  28.758  23.581 1.00 29.50 ? 15   ARG B NE  1 
ATOM   3103 C CZ  . ARG B 1 35  ? 13.351  28.097  22.539 1.00 28.01 ? 15   ARG B CZ  1 
ATOM   3104 N NH1 . ARG B 1 35  ? 13.170  28.556  21.322 1.00 30.09 ? 15   ARG B NH1 1 
ATOM   3105 N NH2 . ARG B 1 35  ? 13.951  26.936  22.735 1.00 28.68 ? 15   ARG B NH2 1 
ATOM   3106 N N   . SER B 1 36  ? 17.457  32.788  25.741 1.00 25.57 ? 16   SER B N   1 
ATOM   3107 C CA  . SER B 1 36  ? 18.846  32.526  26.088 1.00 26.86 ? 16   SER B CA  1 
ATOM   3108 C C   . SER B 1 36  ? 18.861  31.512  27.210 1.00 26.42 ? 16   SER B C   1 
ATOM   3109 O O   . SER B 1 36  ? 17.917  31.436  28.023 1.00 25.92 ? 16   SER B O   1 
ATOM   3110 C CB  . SER B 1 36  ? 19.581  33.807  26.492 1.00 27.16 ? 16   SER B CB  1 
ATOM   3111 O OG  . SER B 1 36  ? 18.684  34.902  26.596 1.00 32.87 ? 16   SER B OG  1 
ATOM   3112 N N   . LYS B 1 37  ? 19.944  30.743  27.248 1.00 26.58 ? 17   LYS B N   1 
ATOM   3113 C CA  . LYS B 1 37  ? 20.143  29.713  28.241 1.00 26.34 ? 17   LYS B CA  1 
ATOM   3114 C C   . LYS B 1 37  ? 20.104  30.248  29.660 1.00 25.21 ? 17   LYS B C   1 
ATOM   3115 O O   . LYS B 1 37  ? 19.770  29.529  30.585 1.00 25.35 ? 17   LYS B O   1 
ATOM   3116 C CB  . LYS B 1 37  ? 21.485  29.015  27.997 1.00 27.24 ? 17   LYS B CB  1 
ATOM   3117 C CG  . LYS B 1 37  ? 21.628  27.738  28.827 1.00 30.45 ? 17   LYS B CG  1 
ATOM   3118 C CD  . LYS B 1 37  ? 22.868  26.945  28.458 1.00 36.93 ? 17   LYS B CD  1 
ATOM   3119 C CE  . LYS B 1 37  ? 22.958  25.711  29.312 1.00 38.91 ? 17   LYS B CE  1 
ATOM   3120 N NZ  . LYS B 1 37  ? 21.624  25.094  29.402 1.00 41.03 ? 17   LYS B NZ  1 
ATOM   3121 N N   . LYS B 1 38  ? 20.461  31.514  29.839 1.00 24.88 ? 18   LYS B N   1 
ATOM   3122 C CA  . LYS B 1 38  ? 20.487  32.077  31.173 1.00 25.06 ? 18   LYS B CA  1 
ATOM   3123 C C   . LYS B 1 38  ? 19.071  32.272  31.692 1.00 23.36 ? 18   LYS B C   1 
ATOM   3124 O O   . LYS B 1 38  ? 18.878  32.456  32.888 1.00 23.16 ? 18   LYS B O   1 
ATOM   3125 C CB  . LYS B 1 38  ? 21.236  33.401  31.222 1.00 25.79 ? 18   LYS B CB  1 
ATOM   3126 C CG  . LYS B 1 38  ? 20.702  34.472  30.281 1.00 28.93 ? 18   LYS B CG  1 
ATOM   3127 C CD  . LYS B 1 38  ? 20.740  35.782  31.038 1.00 36.33 ? 18   LYS B CD  1 
ATOM   3128 C CE  . LYS B 1 38  ? 21.555  36.813  30.330 1.00 39.36 ? 18   LYS B CE  1 
ATOM   3129 N NZ  . LYS B 1 38  ? 22.053  37.799  31.350 1.00 43.54 ? 18   LYS B NZ  1 
ATOM   3130 N N   . TYR B 1 39  ? 18.098  32.211  30.790 1.00 21.96 ? 19   TYR B N   1 
ATOM   3131 C CA  . TYR B 1 39  ? 16.692  32.336  31.183 1.00 21.51 ? 19   TYR B CA  1 
ATOM   3132 C C   . TYR B 1 39  ? 15.912  31.027  31.154 1.00 21.37 ? 19   TYR B C   1 
ATOM   3133 O O   . TYR B 1 39  ? 14.919  30.880  31.880 1.00 22.14 ? 19   TYR B O   1 
ATOM   3134 C CB  . TYR B 1 39  ? 15.989  33.357  30.310 1.00 22.28 ? 19   TYR B CB  1 
ATOM   3135 C CG  . TYR B 1 39  ? 16.577  34.734  30.378 1.00 22.17 ? 19   TYR B CG  1 
ATOM   3136 C CD1 . TYR B 1 39  ? 16.893  35.326  31.604 1.00 22.51 ? 19   TYR B CD1 1 
ATOM   3137 C CD2 . TYR B 1 39  ? 16.833  35.448  29.204 1.00 21.15 ? 19   TYR B CD2 1 
ATOM   3138 C CE1 . TYR B 1 39  ? 17.427  36.647  31.657 1.00 24.48 ? 19   TYR B CE1 1 
ATOM   3139 C CE2 . TYR B 1 39  ? 17.339  36.732  29.251 1.00 21.19 ? 19   TYR B CE2 1 
ATOM   3140 C CZ  . TYR B 1 39  ? 17.647  37.316  30.463 1.00 21.63 ? 19   TYR B CZ  1 
ATOM   3141 O OH  . TYR B 1 39  ? 18.149  38.599  30.474 1.00 22.24 ? 19   TYR B OH  1 
ATOM   3142 N N   . THR B 1 40  ? 16.344  30.104  30.295 1.00 20.61 ? 20   THR B N   1 
ATOM   3143 C CA  . THR B 1 40  ? 15.735  28.791  30.140 1.00 22.01 ? 20   THR B CA  1 
ATOM   3144 C C   . THR B 1 40  ? 16.297  27.690  31.070 1.00 22.38 ? 20   THR B C   1 
ATOM   3145 O O   . THR B 1 40  ? 15.573  26.752  31.448 1.00 22.15 ? 20   THR B O   1 
ATOM   3146 C CB  . THR B 1 40  ? 15.788  28.332  28.669 1.00 21.50 ? 20   THR B CB  1 
ATOM   3147 O OG1 . THR B 1 40  ? 17.145  28.138  28.292 1.00 24.23 ? 20   THR B OG1 1 
ATOM   3148 C CG2 . THR B 1 40  ? 15.177  29.396  27.754 1.00 22.92 ? 20   THR B CG2 1 
ATOM   3149 N N   . LEU B 1 41  ? 17.589  27.788  31.400 1.00 23.09 ? 21   LEU B N   1 
ATOM   3150 C CA  . LEU B 1 41  ? 18.225  26.908  32.378 1.00 23.44 ? 21   LEU B CA  1 
ATOM   3151 C C   . LEU B 1 41  ? 18.044  25.415  32.046 1.00 23.46 ? 21   LEU B C   1 
ATOM   3152 O O   . LEU B 1 41  ? 17.926  24.559  32.935 1.00 22.94 ? 21   LEU B O   1 
ATOM   3153 C CB  . LEU B 1 41  ? 17.739  27.257  33.795 1.00 24.65 ? 21   LEU B CB  1 
ATOM   3154 C CG  . LEU B 1 41  ? 17.859  28.763  34.121 1.00 25.93 ? 21   LEU B CG  1 
ATOM   3155 C CD1 . LEU B 1 41  ? 17.329  29.104  35.466 1.00 27.87 ? 21   LEU B CD1 1 
ATOM   3156 C CD2 . LEU B 1 41  ? 19.292  29.213  34.056 1.00 27.36 ? 21   LEU B CD2 1 
ATOM   3157 N N   . GLY B 1 42  ? 18.077  25.104  30.749 1.00 23.57 ? 22   GLY B N   1 
ATOM   3158 C CA  . GLY B 1 42  ? 17.934  23.717  30.289 1.00 24.05 ? 22   GLY B CA  1 
ATOM   3159 C C   . GLY B 1 42  ? 16.576  23.371  29.694 1.00 24.41 ? 22   GLY B C   1 
ATOM   3160 O O   . GLY B 1 42  ? 16.425  22.357  28.977 1.00 25.28 ? 22   GLY B O   1 
ATOM   3161 N N   . ALA B 1 43  ? 15.584  24.195  29.975 1.00 23.57 ? 23   ALA B N   1 
ATOM   3162 C CA  . ALA B 1 43  ? 14.224  23.917  29.503 1.00 22.21 ? 23   ALA B CA  1 
ATOM   3163 C C   . ALA B 1 43  ? 14.035  24.606  28.141 1.00 21.86 ? 23   ALA B C   1 
ATOM   3164 O O   . ALA B 1 43  ? 14.942  25.286  27.658 1.00 21.71 ? 23   ALA B O   1 
ATOM   3165 C CB  . ALA B 1 43  ? 13.238  24.417  30.487 1.00 23.53 ? 23   ALA B CB  1 
ATOM   3166 N N   . VAL B 1 44  ? 12.892  24.405  27.495 1.00 21.51 ? 24   VAL B N   1 
ATOM   3167 C CA  . VAL B 1 44  ? 12.631  25.110  26.233 1.00 20.30 ? 24   VAL B CA  1 
ATOM   3168 C C   . VAL B 1 44  ? 12.183  26.557  26.510 1.00 20.01 ? 24   VAL B C   1 
ATOM   3169 O O   . VAL B 1 44  ? 12.673  27.527  25.876 1.00 20.82 ? 24   VAL B O   1 
ATOM   3170 C CB  . VAL B 1 44  ? 11.631  24.335  25.336 1.00 20.25 ? 24   VAL B CB  1 
ATOM   3171 C CG1 . VAL B 1 44  ? 11.292  25.152  24.100 1.00 18.62 ? 24   VAL B CG1 1 
ATOM   3172 C CG2 . VAL B 1 44  ? 12.266  22.961  24.923 1.00 19.60 ? 24   VAL B CG2 1 
ATOM   3173 N N   . ASN B 1 45  ? 11.236  26.707  27.441 1.00 19.24 ? 25   ASN B N   1 
ATOM   3174 C CA  . ASN B 1 45  ? 10.749  28.032  27.825 1.00 19.39 ? 25   ASN B CA  1 
ATOM   3175 C C   . ASN B 1 45  ? 11.567  28.664  28.962 1.00 18.80 ? 25   ASN B C   1 
ATOM   3176 O O   . ASN B 1 45  ? 12.261  27.947  29.695 1.00 19.20 ? 25   ASN B O   1 
ATOM   3177 C CB  . ASN B 1 45  ? 9.285   27.853  28.237 1.00 18.22 ? 25   ASN B CB  1 
ATOM   3178 C CG  . ASN B 1 45  ? 8.466   27.211  27.129 1.00 21.20 ? 25   ASN B CG  1 
ATOM   3179 O OD1 . ASN B 1 45  ? 8.092   27.868  26.149 1.00 21.00 ? 25   ASN B OD1 1 
ATOM   3180 N ND2 . ASN B 1 45  ? 8.221   25.925  27.254 1.00 18.97 ? 25   ASN B ND2 1 
ATOM   3181 N N   . SER B 1 46  ? 11.464  29.981  29.163 1.00 18.88 ? 26   SER B N   1 
ATOM   3182 C CA  . SER B 1 46  ? 12.105  30.597  30.367 1.00 19.11 ? 26   SER B CA  1 
ATOM   3183 C C   . SER B 1 46  ? 11.566  29.925  31.620 1.00 18.85 ? 26   SER B C   1 
ATOM   3184 O O   . SER B 1 46  ? 10.400  29.474  31.615 1.00 16.78 ? 26   SER B O   1 
ATOM   3185 C CB  . SER B 1 46  ? 11.809  32.120  30.443 1.00 19.44 ? 26   SER B CB  1 
ATOM   3186 O OG  . SER B 1 46  ? 10.402  32.382  30.518 1.00 21.85 ? 26   SER B OG  1 
ATOM   3187 N N   . VAL B 1 47  ? 12.360  29.875  32.691 1.00 18.15 ? 27   VAL B N   1 
ATOM   3188 C CA  . VAL B 1 47  ? 11.849  29.460  34.008 1.00 19.57 ? 27   VAL B CA  1 
ATOM   3189 C C   . VAL B 1 47  ? 10.863  30.493  34.503 1.00 18.90 ? 27   VAL B C   1 
ATOM   3190 O O   . VAL B 1 47  ? 10.858  31.663  34.054 1.00 18.29 ? 27   VAL B O   1 
ATOM   3191 C CB  . VAL B 1 47  ? 12.931  29.389  35.099 1.00 19.88 ? 27   VAL B CB  1 
ATOM   3192 C CG1 . VAL B 1 47  ? 13.751  28.126  34.919 1.00 22.43 ? 27   VAL B CG1 1 
ATOM   3193 C CG2 . VAL B 1 47  ? 13.753  30.690  35.126 1.00 22.73 ? 27   VAL B CG2 1 
ATOM   3194 N N   . ILE B 1 48  ? 9.992   30.053  35.398 1.00 18.95 ? 28   ILE B N   1 
ATOM   3195 C CA  . ILE B 1 48  ? 9.147   30.972  36.118 1.00 19.84 ? 28   ILE B CA  1 
ATOM   3196 C C   . ILE B 1 48  ? 9.727   31.220  37.501 1.00 20.01 ? 28   ILE B C   1 
ATOM   3197 O O   . ILE B 1 48  ? 9.636   30.352  38.362 1.00 19.36 ? 28   ILE B O   1 
ATOM   3198 C CB  . ILE B 1 48  ? 7.714   30.453  36.237 1.00 19.63 ? 28   ILE B CB  1 
ATOM   3199 C CG1 . ILE B 1 48  ? 7.176   30.274  34.828 1.00 22.74 ? 28   ILE B CG1 1 
ATOM   3200 C CG2 . ILE B 1 48  ? 6.897   31.405  37.083 1.00 21.20 ? 28   ILE B CG2 1 
ATOM   3201 C CD1 . ILE B 1 48  ? 5.847   29.629  34.794 1.00 25.82 ? 28   ILE B CD1 1 
ATOM   3202 N N   . GLN B 1 49  ? 10.340  32.394  37.683 1.00 20.21 ? 29   GLN B N   1 
ATOM   3203 C CA  . GLN B 1 49  ? 10.928  32.791  38.968 1.00 20.17 ? 29   GLN B CA  1 
ATOM   3204 C C   . GLN B 1 49  ? 9.959   33.721  39.726 1.00 21.57 ? 29   GLN B C   1 
ATOM   3205 O O   . GLN B 1 49  ? 9.811   34.930  39.387 1.00 20.61 ? 29   GLN B O   1 
ATOM   3206 C CB  . GLN B 1 49  ? 12.281  33.458  38.764 1.00 20.26 ? 29   GLN B CB  1 
ATOM   3207 C CG  . GLN B 1 49  ? 13.019  33.687  40.059 1.00 21.09 ? 29   GLN B CG  1 
ATOM   3208 C CD  . GLN B 1 49  ? 14.474  34.045  39.848 1.00 21.67 ? 29   GLN B CD  1 
ATOM   3209 O OE1 . GLN B 1 49  ? 14.797  34.911  39.040 1.00 23.21 ? 29   GLN B OE1 1 
ATOM   3210 N NE2 . GLN B 1 49  ? 15.342  33.410  40.582 1.00 21.78 ? 29   GLN B NE2 1 
ATOM   3211 N N   . ARG B 1 50  ? 9.261   33.145  40.705 1.00 20.82 ? 30   ARG B N   1 
ATOM   3212 C CA  . ARG B 1 50  ? 8.297   33.909  41.510 1.00 21.51 ? 30   ARG B CA  1 
ATOM   3213 C C   . ARG B 1 50  ? 9.104   34.471  42.682 1.00 22.19 ? 30   ARG B C   1 
ATOM   3214 O O   . ARG B 1 50  ? 9.796   33.701  43.387 1.00 22.22 ? 30   ARG B O   1 
ATOM   3215 C CB  . ARG B 1 50  ? 7.187   33.018  42.036 1.00 21.13 ? 30   ARG B CB  1 
ATOM   3216 C CG  . ARG B 1 50  ? 6.247   32.538  40.951 1.00 19.97 ? 30   ARG B CG  1 
ATOM   3217 C CD  . ARG B 1 50  ? 4.984   31.938  41.486 1.00 22.17 ? 30   ARG B CD  1 
ATOM   3218 N NE  . ARG B 1 50  ? 4.312   31.294  40.378 1.00 22.17 ? 30   ARG B NE  1 
ATOM   3219 C CZ  . ARG B 1 50  ? 3.723   30.103  40.456 1.00 28.61 ? 30   ARG B CZ  1 
ATOM   3220 N NH1 . ARG B 1 50  ? 3.714   29.440  41.626 1.00 27.35 ? 30   ARG B NH1 1 
ATOM   3221 N NH2 . ARG B 1 50  ? 3.163   29.565  39.366 1.00 28.27 ? 30   ARG B NH2 1 
ATOM   3222 N N   . ALA B 1 51  ? 9.059   35.790  42.863 1.00 21.60 ? 31   ALA B N   1 
ATOM   3223 C CA  . ALA B 1 51  ? 9.832   36.401  43.941 1.00 21.79 ? 31   ALA B CA  1 
ATOM   3224 C C   . ALA B 1 51  ? 9.500   37.848  44.186 1.00 21.52 ? 31   ALA B C   1 
ATOM   3225 O O   . ALA B 1 51  ? 9.293   38.616  43.253 1.00 21.94 ? 31   ALA B O   1 
ATOM   3226 C CB  . ALA B 1 51  ? 11.340  36.301  43.655 1.00 20.17 ? 31   ALA B CB  1 
ATOM   3227 N N   . SER B 1 52  ? 9.520   38.216  45.457 1.00 21.58 ? 32   SER B N   1 
ATOM   3228 C CA  . SER B 1 52  ? 9.609   39.609  45.811 1.00 22.07 ? 32   SER B CA  1 
ATOM   3229 C C   . SER B 1 52  ? 11.059  39.765  46.246 1.00 22.73 ? 32   SER B C   1 
ATOM   3230 O O   . SER B 1 52  ? 11.826  40.338  45.508 1.00 23.62 ? 32   SER B O   1 
ATOM   3231 C CB  . SER B 1 52  ? 8.601   39.982  46.904 1.00 22.38 ? 32   SER B CB  1 
ATOM   3232 O OG  . SER B 1 52  ? 8.738   39.153  48.057 1.00 21.49 ? 32   SER B OG  1 
ATOM   3233 N N   . SER B 1 53  ? 11.430  39.226  47.412 1.00 23.05 ? 33   SER B N   1 
ATOM   3234 C CA  . SER B 1 53  ? 12.829  39.255  47.884 1.00 23.42 ? 33   SER B CA  1 
ATOM   3235 C C   . SER B 1 53  ? 13.777  38.560  46.867 1.00 23.48 ? 33   SER B C   1 
ATOM   3236 O O   . SER B 1 53  ? 13.510  37.449  46.387 1.00 23.72 ? 33   SER B O   1 
ATOM   3237 C CB  . SER B 1 53  ? 12.930  38.551  49.263 1.00 23.54 ? 33   SER B CB  1 
ATOM   3238 O OG  . SER B 1 53  ? 12.263  39.255  50.311 1.00 22.66 ? 33   SER B OG  1 
ATOM   3239 N N   . LEU B 1 54  ? 14.880  39.210  46.541 1.00 24.28 ? 34   LEU B N   1 
ATOM   3240 C CA  . LEU B 1 54  ? 15.997  38.519  45.893 1.00 24.40 ? 34   LEU B CA  1 
ATOM   3241 C C   . LEU B 1 54  ? 17.220  38.603  46.807 1.00 24.19 ? 34   LEU B C   1 
ATOM   3242 O O   . LEU B 1 54  ? 17.511  39.657  47.379 1.00 23.87 ? 34   LEU B O   1 
ATOM   3243 C CB  . LEU B 1 54  ? 16.249  39.046  44.470 1.00 24.38 ? 34   LEU B CB  1 
ATOM   3244 C CG  . LEU B 1 54  ? 15.030  38.771  43.552 1.00 25.17 ? 34   LEU B CG  1 
ATOM   3245 C CD1 . LEU B 1 54  ? 14.913  39.806  42.420 1.00 23.82 ? 34   LEU B CD1 1 
ATOM   3246 C CD2 . LEU B 1 54  ? 15.005  37.328  43.001 1.00 24.63 ? 34   LEU B CD2 1 
ATOM   3247 N N   . VAL B 1 55  ? 17.857  37.454  47.009 1.00 24.05 ? 35   VAL B N   1 
ATOM   3248 C CA  . VAL B 1 55  ? 18.852  37.286  48.054 1.00 24.09 ? 35   VAL B CA  1 
ATOM   3249 C C   . VAL B 1 55  ? 20.233  37.634  47.517 1.00 25.13 ? 35   VAL B C   1 
ATOM   3250 O O   . VAL B 1 55  ? 20.608  37.270  46.385 1.00 25.57 ? 35   VAL B O   1 
ATOM   3251 C CB  . VAL B 1 55  ? 18.842  35.856  48.616 1.00 23.65 ? 35   VAL B CB  1 
ATOM   3252 C CG1 . VAL B 1 55  ? 19.707  35.759  49.845 1.00 25.52 ? 35   VAL B CG1 1 
ATOM   3253 C CG2 . VAL B 1 55  ? 17.403  35.443  48.984 1.00 24.63 ? 35   VAL B CG2 1 
ATOM   3254 N N   . PHE B 1 56  ? 20.963  38.387  48.327 1.00 24.84 ? 36   PHE B N   1 
ATOM   3255 C CA  . PHE B 1 56  ? 22.329  38.758  48.033 1.00 25.79 ? 36   PHE B CA  1 
ATOM   3256 C C   . PHE B 1 56  ? 23.216  37.924  48.926 1.00 26.80 ? 36   PHE B C   1 
ATOM   3257 O O   . PHE B 1 56  ? 23.040  37.902  50.141 1.00 27.48 ? 36   PHE B O   1 
ATOM   3258 C CB  . PHE B 1 56  ? 22.551  40.238  48.325 1.00 24.74 ? 36   PHE B CB  1 
ATOM   3259 C CG  . PHE B 1 56  ? 21.524  41.134  47.726 1.00 25.15 ? 36   PHE B CG  1 
ATOM   3260 C CD1 . PHE B 1 56  ? 21.366  41.222  46.343 1.00 23.21 ? 36   PHE B CD1 1 
ATOM   3261 C CD2 . PHE B 1 56  ? 20.705  41.907  48.550 1.00 24.03 ? 36   PHE B CD2 1 
ATOM   3262 C CE1 . PHE B 1 56  ? 20.357  42.059  45.795 1.00 23.98 ? 36   PHE B CE1 1 
ATOM   3263 C CE2 . PHE B 1 56  ? 19.762  42.759  48.017 1.00 20.79 ? 36   PHE B CE2 1 
ATOM   3264 C CZ  . PHE B 1 56  ? 19.586  42.826  46.630 1.00 22.43 ? 36   PHE B CZ  1 
ATOM   3265 N N   . ASP B 1 57  ? 24.190  37.247  48.336 1.00 27.81 ? 37   ASP B N   1 
ATOM   3266 C CA  . ASP B 1 57  ? 25.030  36.349  49.106 1.00 28.14 ? 37   ASP B CA  1 
ATOM   3267 C C   . ASP B 1 57  ? 26.151  37.058  49.862 1.00 28.16 ? 37   ASP B C   1 
ATOM   3268 O O   . ASP B 1 57  ? 26.776  36.459  50.739 1.00 27.17 ? 37   ASP B O   1 
ATOM   3269 C CB  . ASP B 1 57  ? 25.605  35.269  48.196 1.00 29.77 ? 37   ASP B CB  1 
ATOM   3270 C CG  . ASP B 1 57  ? 24.566  34.257  47.764 1.00 33.42 ? 37   ASP B CG  1 
ATOM   3271 O OD1 . ASP B 1 57  ? 23.368  34.330  48.183 1.00 38.16 ? 37   ASP B OD1 1 
ATOM   3272 O OD2 . ASP B 1 57  ? 24.954  33.360  46.989 1.00 40.01 ? 37   ASP B OD2 1 
ATOM   3273 N N   . SER B 1 58  ? 26.378  38.328  49.533 1.00 26.94 ? 38   SER B N   1 
ATOM   3274 C CA  . SER B 1 58  ? 27.397  39.124  50.197 1.00 27.84 ? 38   SER B CA  1 
ATOM   3275 C C   . SER B 1 58  ? 27.148  40.611  49.971 1.00 27.73 ? 38   SER B C   1 
ATOM   3276 O O   . SER B 1 58  ? 26.446  40.991  49.025 1.00 26.97 ? 38   SER B O   1 
ATOM   3277 C CB  . SER B 1 58  ? 28.795  38.764  49.650 1.00 27.45 ? 38   SER B CB  1 
ATOM   3278 O OG  . SER B 1 58  ? 28.981  39.347  48.366 1.00 27.13 ? 38   SER B OG  1 
ATOM   3279 N N   . VAL B 1 59  ? 27.778  41.439  50.811 1.00 27.70 ? 39   VAL B N   1 
ATOM   3280 C CA  . VAL B 1 59  ? 27.718  42.877  50.661 1.00 28.61 ? 39   VAL B CA  1 
ATOM   3281 C C   . VAL B 1 59  ? 28.179  43.263  49.251 1.00 28.76 ? 39   VAL B C   1 
ATOM   3282 O O   . VAL B 1 59  ? 27.584  44.127  48.593 1.00 27.87 ? 39   VAL B O   1 
ATOM   3283 C CB  . VAL B 1 59  ? 28.566  43.598  51.759 1.00 28.75 ? 39   VAL B CB  1 
ATOM   3284 C CG1 . VAL B 1 59  ? 28.735  45.090  51.438 1.00 30.09 ? 39   VAL B CG1 1 
ATOM   3285 C CG2 . VAL B 1 59  ? 27.920  43.404  53.130 1.00 28.92 ? 39   VAL B CG2 1 
ATOM   3286 N N   . GLU B 1 60  ? 29.213  42.584  48.780 1.00 29.57 ? 40   GLU B N   1 
ATOM   3287 C CA  . GLU B 1 60  ? 29.775  42.849  47.455 1.00 31.13 ? 40   GLU B CA  1 
ATOM   3288 C C   . GLU B 1 60  ? 28.773  42.564  46.338 1.00 30.89 ? 40   GLU B C   1 
ATOM   3289 O O   . GLU B 1 60  ? 28.605  43.388  45.437 1.00 31.52 ? 40   GLU B O   1 
ATOM   3290 C CB  . GLU B 1 60  ? 31.073  42.046  47.254 1.00 32.29 ? 40   GLU B CB  1 
ATOM   3291 C CG  . GLU B 1 60  ? 31.693  42.101  45.847 1.00 37.71 ? 40   GLU B CG  1 
ATOM   3292 C CD  . GLU B 1 60  ? 31.871  43.523  45.312 1.00 44.78 ? 40   GLU B CD  1 
ATOM   3293 O OE1 . GLU B 1 60  ? 31.198  43.874  44.293 1.00 47.14 ? 40   GLU B OE1 1 
ATOM   3294 O OE2 . GLU B 1 60  ? 32.687  44.283  45.901 1.00 47.44 ? 40   GLU B OE2 1 
ATOM   3295 N N   . ALA B 1 61  ? 28.101  41.412  46.414 1.00 29.41 ? 41   ALA B N   1 
ATOM   3296 C CA  . ALA B 1 61  ? 27.034  41.044  45.458 1.00 28.76 ? 41   ALA B CA  1 
ATOM   3297 C C   . ALA B 1 61  ? 25.850  42.019  45.520 1.00 27.96 ? 41   ALA B C   1 
ATOM   3298 O O   . ALA B 1 61  ? 25.295  42.388  44.485 1.00 27.31 ? 41   ALA B O   1 
ATOM   3299 C CB  . ALA B 1 61  ? 26.565  39.632  45.718 1.00 28.17 ? 41   ALA B CB  1 
ATOM   3300 N N   . LYS B 1 62  ? 25.484  42.432  46.733 1.00 27.87 ? 42   LYS B N   1 
ATOM   3301 C CA  . LYS B 1 62  ? 24.373  43.377  46.950 1.00 29.07 ? 42   LYS B CA  1 
ATOM   3302 C C   . LYS B 1 62  ? 24.685  44.729  46.297 1.00 29.32 ? 42   LYS B C   1 
ATOM   3303 O O   . LYS B 1 62  ? 23.800  45.382  45.730 1.00 28.49 ? 42   LYS B O   1 
ATOM   3304 C CB  . LYS B 1 62  ? 24.098  43.550  48.461 1.00 29.52 ? 42   LYS B CB  1 
ATOM   3305 C CG  . LYS B 1 62  ? 23.157  44.677  48.806 1.00 30.78 ? 42   LYS B CG  1 
ATOM   3306 C CD  . LYS B 1 62  ? 22.635  44.492  50.206 1.00 36.69 ? 42   LYS B CD  1 
ATOM   3307 C CE  . LYS B 1 62  ? 22.626  45.806  50.957 1.00 40.98 ? 42   LYS B CE  1 
ATOM   3308 N NZ  . LYS B 1 62  ? 21.431  46.651  50.645 1.00 42.34 ? 42   LYS B NZ  1 
ATOM   3309 N N   . LYS B 1 63  ? 25.948  45.137  46.389 1.00 28.63 ? 43   LYS B N   1 
ATOM   3310 C CA  . LYS B 1 63  ? 26.368  46.408  45.833 1.00 29.54 ? 43   LYS B CA  1 
ATOM   3311 C C   . LYS B 1 63  ? 26.414  46.330  44.299 1.00 29.48 ? 43   LYS B C   1 
ATOM   3312 O O   . LYS B 1 63  ? 25.933  47.229  43.602 1.00 28.66 ? 43   LYS B O   1 
ATOM   3313 C CB  . LYS B 1 63  ? 27.686  46.861  46.495 1.00 29.93 ? 43   LYS B CB  1 
ATOM   3314 C CG  . LYS B 1 63  ? 27.426  47.169  47.974 1.00 32.64 ? 43   LYS B CG  1 
ATOM   3315 C CD  . LYS B 1 63  ? 28.585  47.751  48.773 1.00 40.78 ? 43   LYS B CD  1 
ATOM   3316 C CE  . LYS B 1 63  ? 28.024  48.397  50.067 1.00 43.20 ? 43   LYS B CE  1 
ATOM   3317 N NZ  . LYS B 1 63  ? 28.953  48.430  51.242 1.00 45.04 ? 43   LYS B NZ  1 
ATOM   3318 N N   . HIS B 1 64  ? 26.915  45.205  43.785 1.00 29.74 ? 44   HIS B N   1 
ATOM   3319 C CA  . HIS B 1 64  ? 26.897  44.916  42.345 1.00 29.56 ? 44   HIS B CA  1 
ATOM   3320 C C   . HIS B 1 64  ? 25.458  44.850  41.761 1.00 29.47 ? 44   HIS B C   1 
ATOM   3321 O O   . HIS B 1 64  ? 25.209  45.321  40.636 1.00 29.69 ? 44   HIS B O   1 
ATOM   3322 C CB  . HIS B 1 64  ? 27.663  43.612  42.078 1.00 29.96 ? 44   HIS B CB  1 
ATOM   3323 C CG  . HIS B 1 64  ? 27.951  43.371  40.629 1.00 31.73 ? 44   HIS B CG  1 
ATOM   3324 N ND1 . HIS B 1 64  ? 26.994  42.916  39.745 1.00 33.99 ? 44   HIS B ND1 1 
ATOM   3325 C CD2 . HIS B 1 64  ? 29.088  43.521  39.906 1.00 33.30 ? 44   HIS B CD2 1 
ATOM   3326 C CE1 . HIS B 1 64  ? 27.529  42.793  38.542 1.00 33.45 ? 44   HIS B CE1 1 
ATOM   3327 N NE2 . HIS B 1 64  ? 28.797  43.151  38.615 1.00 35.03 ? 44   HIS B NE2 1 
ATOM   3328 N N   . ALA B 1 65  ? 24.523  44.269  42.519 1.00 28.25 ? 45   ALA B N   1 
ATOM   3329 C CA  . ALA B 1 65  ? 23.115  44.188  42.073 1.00 27.83 ? 45   ALA B CA  1 
ATOM   3330 C C   . ALA B 1 65  ? 22.441  45.560  42.080 1.00 28.05 ? 45   ALA B C   1 
ATOM   3331 O O   . ALA B 1 65  ? 21.595  45.865  41.223 1.00 28.26 ? 45   ALA B O   1 
ATOM   3332 C CB  . ALA B 1 65  ? 22.336  43.222  42.952 1.00 27.80 ? 45   ALA B CB  1 
ATOM   3333 N N   . THR B 1 66  ? 22.794  46.369  43.073 1.00 28.61 ? 46   THR B N   1 
ATOM   3334 C CA  . THR B 1 66  ? 22.243  47.713  43.204 1.00 29.43 ? 46   THR B CA  1 
ATOM   3335 C C   . THR B 1 66  ? 22.637  48.520  41.966 1.00 29.88 ? 46   THR B C   1 
ATOM   3336 O O   . THR B 1 66  ? 21.785  49.116  41.307 1.00 29.18 ? 46   THR B O   1 
ATOM   3337 C CB  . THR B 1 66  ? 22.735  48.344  44.526 1.00 29.52 ? 46   THR B CB  1 
ATOM   3338 O OG1 . THR B 1 66  ? 22.197  47.573  45.615 1.00 30.62 ? 46   THR B OG1 1 
ATOM   3339 C CG2 . THR B 1 66  ? 22.282  49.786  44.676 1.00 30.54 ? 46   THR B CG2 1 
ATOM   3340 N N   . ARG B 1 67  ? 23.928  48.503  41.637 1.00 30.72 ? 47   ARG B N   1 
ATOM   3341 C CA  . ARG B 1 67  ? 24.432  49.201  40.452 1.00 32.80 ? 47   ARG B CA  1 
ATOM   3342 C C   . ARG B 1 67  ? 23.717  48.790  39.129 1.00 32.54 ? 47   ARG B C   1 
ATOM   3343 O O   . ARG B 1 67  ? 23.492  49.628  38.232 1.00 31.94 ? 47   ARG B O   1 
ATOM   3344 C CB  . ARG B 1 67  ? 25.964  49.026  40.368 1.00 33.85 ? 47   ARG B CB  1 
ATOM   3345 C CG  . ARG B 1 67  ? 26.687  49.735  39.197 1.00 38.46 ? 47   ARG B CG  1 
ATOM   3346 C CD  . ARG B 1 67  ? 25.992  51.030  38.710 1.00 45.95 ? 47   ARG B CD  1 
ATOM   3347 N NE  . ARG B 1 67  ? 25.761  51.981  39.798 1.00 50.82 ? 47   ARG B NE  1 
ATOM   3348 C CZ  . ARG B 1 67  ? 26.543  53.024  40.069 1.00 53.05 ? 47   ARG B CZ  1 
ATOM   3349 N NH1 . ARG B 1 67  ? 27.618  53.283  39.321 1.00 53.77 ? 47   ARG B NH1 1 
ATOM   3350 N NH2 . ARG B 1 67  ? 26.233  53.818  41.086 1.00 54.65 ? 47   ARG B NH2 1 
ATOM   3351 N N   . ASN B 1 68  ? 23.347  47.515  39.043 1.00 32.08 ? 48   ASN B N   1 
ATOM   3352 C CA  . ASN B 1 68  ? 22.771  46.925  37.830 1.00 31.68 ? 48   ASN B CA  1 
ATOM   3353 C C   . ASN B 1 68  ? 21.271  46.596  37.930 1.00 31.94 ? 48   ASN B C   1 
ATOM   3354 O O   . ASN B 1 68  ? 20.749  45.777  37.153 1.00 31.67 ? 48   ASN B O   1 
ATOM   3355 C CB  . ASN B 1 68  ? 23.558  45.658  37.507 1.00 32.01 ? 48   ASN B CB  1 
ATOM   3356 C CG  . ASN B 1 68  ? 24.959  45.965  37.052 1.00 31.72 ? 48   ASN B CG  1 
ATOM   3357 O OD1 . ASN B 1 68  ? 25.155  46.421  35.928 1.00 33.95 ? 48   ASN B OD1 1 
ATOM   3358 N ND2 . ASN B 1 68  ? 25.945  45.731  37.920 1.00 31.14 ? 48   ASN B ND2 1 
ATOM   3359 N N   . ARG B 1 69  ? 20.594  47.259  38.869 1.00 31.78 ? 49   ARG B N   1 
ATOM   3360 C CA  . ARG B 1 69  ? 19.200  46.972  39.230 1.00 32.16 ? 49   ARG B CA  1 
ATOM   3361 C C   . ARG B 1 69  ? 18.174  47.297  38.129 1.00 32.90 ? 49   ARG B C   1 
ATOM   3362 O O   . ARG B 1 69  ? 17.077  46.740  38.127 1.00 31.99 ? 49   ARG B O   1 
ATOM   3363 C CB  . ARG B 1 69  ? 18.831  47.643  40.574 1.00 32.37 ? 49   ARG B CB  1 
ATOM   3364 C CG  . ARG B 1 69  ? 18.347  49.101  40.505 1.00 34.68 ? 49   ARG B CG  1 
ATOM   3365 C CD  . ARG B 1 69  ? 18.378  49.832  41.859 1.00 37.77 ? 49   ARG B CD  1 
ATOM   3366 N NE  . ARG B 1 69  ? 19.521  50.761  41.876 1.00 45.92 ? 49   ARG B NE  1 
ATOM   3367 C CZ  . ARG B 1 69  ? 19.448  52.087  41.921 1.00 46.19 ? 49   ARG B CZ  1 
ATOM   3368 N NH1 . ARG B 1 69  ? 18.287  52.709  42.012 1.00 48.74 ? 49   ARG B NH1 1 
ATOM   3369 N NH2 . ARG B 1 69  ? 20.556  52.799  41.899 1.00 50.31 ? 49   ARG B NH2 1 
ATOM   3370 N N   . ALA B 1 70  ? 18.533  48.201  37.211 1.00 33.67 ? 50   ALA B N   1 
ATOM   3371 C CA  . ALA B 1 70  ? 17.679  48.508  36.060 1.00 34.01 ? 50   ALA B CA  1 
ATOM   3372 C C   . ALA B 1 70  ? 18.259  47.900  34.784 1.00 34.88 ? 50   ALA B C   1 
ATOM   3373 O O   . ALA B 1 70  ? 17.842  48.239  33.668 1.00 36.42 ? 50   ALA B O   1 
ATOM   3374 C CB  . ALA B 1 70  ? 17.539  50.003  35.911 1.00 34.00 ? 50   ALA B CB  1 
ATOM   3375 N N   . ASN B 1 71  ? 19.201  46.982  34.966 1.00 34.81 ? 51   ASN B N   1 
ATOM   3376 C CA  . ASN B 1 71  ? 20.087  46.508  33.899 1.00 34.77 ? 51   ASN B CA  1 
ATOM   3377 C C   . ASN B 1 71  ? 20.146  44.970  33.817 1.00 33.68 ? 51   ASN B C   1 
ATOM   3378 O O   . ASN B 1 71  ? 21.130  44.378  33.368 1.00 32.83 ? 51   ASN B O   1 
ATOM   3379 C CB  . ASN B 1 71  ? 21.476  47.110  34.129 1.00 35.82 ? 51   ASN B CB  1 
ATOM   3380 C CG  . ASN B 1 71  ? 22.433  46.863  32.980 1.00 38.30 ? 51   ASN B CG  1 
ATOM   3381 O OD1 . ASN B 1 71  ? 23.632  46.640  33.207 1.00 43.94 ? 51   ASN B OD1 1 
ATOM   3382 N ND2 . ASN B 1 71  ? 21.919  46.894  31.739 1.00 41.48 ? 51   ASN B ND2 1 
ATOM   3383 N N   . GLY B 1 72  ? 19.065  44.322  34.245 1.00 32.97 ? 52   GLY B N   1 
ATOM   3384 C CA  . GLY B 1 72  ? 18.941  42.872  34.077 1.00 31.17 ? 52   GLY B CA  1 
ATOM   3385 C C   . GLY B 1 72  ? 19.630  42.006  35.121 1.00 30.66 ? 52   GLY B C   1 
ATOM   3386 O O   . GLY B 1 72  ? 19.756  40.794  34.915 1.00 31.31 ? 52   GLY B O   1 
ATOM   3387 N N   . GLU B 1 73  ? 20.077  42.600  36.233 1.00 29.09 ? 53   GLU B N   1 
ATOM   3388 C CA  . GLU B 1 73  ? 20.548  41.817  37.384 1.00 27.93 ? 53   GLU B CA  1 
ATOM   3389 C C   . GLU B 1 73  ? 19.470  41.672  38.471 1.00 26.64 ? 53   GLU B C   1 
ATOM   3390 O O   . GLU B 1 73  ? 18.776  42.647  38.802 1.00 25.57 ? 53   GLU B O   1 
ATOM   3391 C CB  . GLU B 1 73  ? 21.815  42.441  37.988 1.00 28.94 ? 53   GLU B CB  1 
ATOM   3392 C CG  . GLU B 1 73  ? 22.537  41.523  38.975 1.00 31.65 ? 53   GLU B CG  1 
ATOM   3393 C CD  . GLU B 1 73  ? 23.958  41.973  39.273 1.00 38.19 ? 53   GLU B CD  1 
ATOM   3394 O OE1 . GLU B 1 73  ? 24.566  42.614  38.374 1.00 39.57 ? 53   GLU B OE1 1 
ATOM   3395 O OE2 . GLU B 1 73  ? 24.473  41.668  40.385 1.00 38.52 ? 53   GLU B OE2 1 
ATOM   3396 N N   . LEU B 1 74  ? 19.338  40.468  39.027 1.00 24.35 ? 54   LEU B N   1 
ATOM   3397 C CA  . LEU B 1 74  ? 18.386  40.241  40.108 1.00 23.90 ? 54   LEU B CA  1 
ATOM   3398 C C   . LEU B 1 74  ? 18.668  41.160  41.285 1.00 24.08 ? 54   LEU B C   1 
ATOM   3399 O O   . LEU B 1 74  ? 19.779  41.179  41.826 1.00 24.06 ? 54   LEU B O   1 
ATOM   3400 C CB  . LEU B 1 74  ? 18.379  38.775  40.550 1.00 23.81 ? 54   LEU B CB  1 
ATOM   3401 C CG  . LEU B 1 74  ? 18.008  37.728  39.483 1.00 21.77 ? 54   LEU B CG  1 
ATOM   3402 C CD1 . LEU B 1 74  ? 18.394  36.312  40.012 1.00 21.74 ? 54   LEU B CD1 1 
ATOM   3403 C CD2 . LEU B 1 74  ? 16.512  37.764  39.065 1.00 21.39 ? 54   LEU B CD2 1 
ATOM   3404 N N   . PHE B 1 75  ? 17.672  41.959  41.647 1.00 23.77 ? 55   PHE B N   1 
ATOM   3405 C CA  . PHE B 1 75  ? 17.815  42.914  42.750 1.00 23.42 ? 55   PHE B CA  1 
ATOM   3406 C C   . PHE B 1 75  ? 16.566  42.962  43.651 1.00 23.47 ? 55   PHE B C   1 
ATOM   3407 O O   . PHE B 1 75  ? 16.652  42.786  44.867 1.00 23.11 ? 55   PHE B O   1 
ATOM   3408 C CB  . PHE B 1 75  ? 18.164  44.300  42.177 1.00 24.50 ? 55   PHE B CB  1 
ATOM   3409 C CG  . PHE B 1 75  ? 18.107  45.418  43.195 1.00 25.27 ? 55   PHE B CG  1 
ATOM   3410 C CD1 . PHE B 1 75  ? 19.167  45.630  44.073 1.00 25.22 ? 55   PHE B CD1 1 
ATOM   3411 C CD2 . PHE B 1 75  ? 16.989  46.267  43.270 1.00 27.32 ? 55   PHE B CD2 1 
ATOM   3412 C CE1 . PHE B 1 75  ? 19.118  46.664  45.012 1.00 25.03 ? 55   PHE B CE1 1 
ATOM   3413 C CE2 . PHE B 1 75  ? 16.958  47.313  44.207 1.00 27.56 ? 55   PHE B CE2 1 
ATOM   3414 C CZ  . PHE B 1 75  ? 18.004  47.498  45.075 1.00 27.84 ? 55   PHE B CZ  1 
ATOM   3415 N N   . TYR B 1 76  ? 15.401  43.187  43.052 1.00 22.68 ? 56   TYR B N   1 
ATOM   3416 C CA  . TYR B 1 76  ? 14.157  43.174  43.808 1.00 23.40 ? 56   TYR B CA  1 
ATOM   3417 C C   . TYR B 1 76  ? 13.031  42.791  42.818 1.00 23.55 ? 56   TYR B C   1 
ATOM   3418 O O   . TYR B 1 76  ? 13.077  43.170  41.633 1.00 23.18 ? 56   TYR B O   1 
ATOM   3419 C CB  . TYR B 1 76  ? 13.901  44.516  44.584 1.00 23.77 ? 56   TYR B CB  1 
ATOM   3420 C CG  . TYR B 1 76  ? 12.651  44.419  45.440 1.00 24.57 ? 56   TYR B CG  1 
ATOM   3421 C CD1 . TYR B 1 76  ? 12.516  43.398  46.401 1.00 22.31 ? 56   TYR B CD1 1 
ATOM   3422 C CD2 . TYR B 1 76  ? 11.586  45.290  45.252 1.00 23.27 ? 56   TYR B CD2 1 
ATOM   3423 C CE1 . TYR B 1 76  ? 11.330  43.244  47.141 1.00 24.26 ? 56   TYR B CE1 1 
ATOM   3424 C CE2 . TYR B 1 76  ? 10.433  45.171  46.008 1.00 24.64 ? 56   TYR B CE2 1 
ATOM   3425 C CZ  . TYR B 1 76  ? 10.297  44.139  46.948 1.00 24.42 ? 56   TYR B CZ  1 
ATOM   3426 O OH  . TYR B 1 76  ? 9.108   43.998  47.673 1.00 19.01 ? 56   TYR B OH  1 
ATOM   3427 N N   . GLY B 1 77  ? 12.075  41.985  43.289 1.00 23.06 ? 57   GLY B N   1 
ATOM   3428 C CA  . GLY B 1 77  ? 10.947  41.517  42.467 1.00 23.90 ? 57   GLY B CA  1 
ATOM   3429 C C   . GLY B 1 77  ? 10.225  42.607  41.688 1.00 23.61 ? 57   GLY B C   1 
ATOM   3430 O O   . GLY B 1 77  ? 9.668   42.342  40.586 1.00 22.59 ? 57   GLY B O   1 
ATOM   3431 N N   . ARG B 1 78  ? 10.244  43.831  42.239 1.00 23.67 ? 58   ARG B N   1 
ATOM   3432 C CA  . ARG B 1 78  ? 9.499   44.962  41.641 1.00 22.21 ? 58   ARG B CA  1 
ATOM   3433 C C   . ARG B 1 78  ? 10.179  45.399  40.356 1.00 22.23 ? 58   ARG B C   1 
ATOM   3434 O O   . ARG B 1 78  ? 9.548   45.867  39.411 1.00 20.36 ? 58   ARG B O   1 
ATOM   3435 C CB  . ARG B 1 78  ? 9.305   46.151  42.591 1.00 22.71 ? 58   ARG B CB  1 
ATOM   3436 C CG  . ARG B 1 78  ? 8.206   47.146  42.095 1.00 21.00 ? 58   ARG B CG  1 
ATOM   3437 C CD  . ARG B 1 78  ? 8.124   48.456  42.920 1.00 15.13 ? 58   ARG B CD  1 
ATOM   3438 N NE  . ARG B 1 78  ? 8.223   48.139  44.355 1.00 18.28 ? 58   ARG B NE  1 
ATOM   3439 C CZ  . ARG B 1 78  ? 9.073   48.732  45.207 1.00 18.16 ? 58   ARG B CZ  1 
ATOM   3440 N NH1 . ARG B 1 78  ? 9.771   49.768  44.813 1.00 12.07 ? 58   ARG B NH1 1 
ATOM   3441 N NH2 . ARG B 1 78  ? 9.103   48.375  46.497 1.00 22.62 ? 58   ARG B NH2 1 
ATOM   3442 N N   . ARG B 1 79  ? 11.495  45.253  40.333 1.00 22.81 ? 59   ARG B N   1 
ATOM   3443 C CA  . ARG B 1 79  ? 12.262  45.438  39.110 1.00 23.75 ? 59   ARG B CA  1 
ATOM   3444 C C   . ARG B 1 79  ? 12.156  44.240  38.149 1.00 23.83 ? 59   ARG B C   1 
ATOM   3445 O O   . ARG B 1 79  ? 12.464  44.373  36.959 1.00 25.18 ? 59   ARG B O   1 
ATOM   3446 C CB  . ARG B 1 79  ? 13.751  45.646  39.469 1.00 22.51 ? 59   ARG B CB  1 
ATOM   3447 C CG  . ARG B 1 79  ? 14.040  46.948  40.207 1.00 24.27 ? 59   ARG B CG  1 
ATOM   3448 C CD  . ARG B 1 79  ? 14.195  48.098  39.214 1.00 27.30 ? 59   ARG B CD  1 
ATOM   3449 N NE  . ARG B 1 79  ? 14.670  49.321  39.856 1.00 25.74 ? 59   ARG B NE  1 
ATOM   3450 C CZ  . ARG B 1 79  ? 14.802  50.486  39.231 1.00 28.71 ? 59   ARG B CZ  1 
ATOM   3451 N NH1 . ARG B 1 79  ? 14.499  50.582  37.926 1.00 28.59 ? 59   ARG B NH1 1 
ATOM   3452 N NH2 . ARG B 1 79  ? 15.228  51.554  39.908 1.00 27.00 ? 59   ARG B NH2 1 
ATOM   3453 N N   . GLY B 1 80  ? 11.801  43.066  38.674 1.00 23.28 ? 60   GLY B N   1 
ATOM   3454 C CA  . GLY B 1 80  ? 11.694  41.869  37.828 1.00 22.64 ? 60   GLY B CA  1 
ATOM   3455 C C   . GLY B 1 80  ? 12.626  40.724  38.182 1.00 22.68 ? 60   GLY B C   1 
ATOM   3456 O O   . GLY B 1 80  ? 13.641  40.890  38.902 1.00 22.42 ? 60   GLY B O   1 
ATOM   3457 N N   . THR B 1 81  ? 12.276  39.547  37.657 1.00 21.38 ? 61   THR B N   1 
ATOM   3458 C CA  . THR B 1 81  ? 13.093  38.342  37.833 1.00 19.35 ? 61   THR B CA  1 
ATOM   3459 C C   . THR B 1 81  ? 13.598  37.833  36.474 1.00 19.26 ? 61   THR B C   1 
ATOM   3460 O O   . THR B 1 81  ? 13.485  38.516  35.440 1.00 17.47 ? 61   THR B O   1 
ATOM   3461 C CB  . THR B 1 81  ? 12.264  37.232  38.533 1.00 19.37 ? 61   THR B CB  1 
ATOM   3462 O OG1 . THR B 1 81  ? 11.335  36.708  37.587 1.00 15.81 ? 61   THR B OG1 1 
ATOM   3463 C CG2 . THR B 1 81  ? 11.516  37.801  39.766 1.00 20.02 ? 61   THR B CG2 1 
ATOM   3464 N N   . LEU B 1 82  ? 14.158  36.633  36.443 1.00 19.38 ? 62   LEU B N   1 
ATOM   3465 C CA  . LEU B 1 82  ? 14.652  36.114  35.161 1.00 19.13 ? 62   LEU B CA  1 
ATOM   3466 C C   . LEU B 1 82  ? 13.552  36.032  34.124 1.00 18.06 ? 62   LEU B C   1 
ATOM   3467 O O   . LEU B 1 82  ? 13.782  36.257  32.958 1.00 17.89 ? 62   LEU B O   1 
ATOM   3468 C CB  . LEU B 1 82  ? 15.249  34.730  35.343 1.00 19.55 ? 62   LEU B CB  1 
ATOM   3469 C CG  . LEU B 1 82  ? 16.544  34.704  36.155 1.00 20.64 ? 62   LEU B CG  1 
ATOM   3470 C CD1 . LEU B 1 82  ? 16.858  33.279  36.588 1.00 21.46 ? 62   LEU B CD1 1 
ATOM   3471 C CD2 . LEU B 1 82  ? 17.635  35.277  35.303 1.00 22.89 ? 62   LEU B CD2 1 
ATOM   3472 N N   . THR B 1 83  ? 12.347  35.755  34.599 1.00 17.47 ? 63   THR B N   1 
ATOM   3473 C CA  . THR B 1 83  ? 11.189  35.574  33.748 1.00 17.62 ? 63   THR B CA  1 
ATOM   3474 C C   . THR B 1 83  ? 10.801  36.909  33.071 1.00 17.62 ? 63   THR B C   1 
ATOM   3475 O O   . THR B 1 83  ? 10.460  36.944  31.863 1.00 16.97 ? 63   THR B O   1 
ATOM   3476 C CB  . THR B 1 83  ? 10.037  35.070  34.611 1.00 17.46 ? 63   THR B CB  1 
ATOM   3477 O OG1 . THR B 1 83  ? 10.470  33.927  35.360 1.00 16.87 ? 63   THR B OG1 1 
ATOM   3478 C CG2 . THR B 1 83  ? 8.922   34.685  33.736 1.00 16.59 ? 63   THR B CG2 1 
ATOM   3479 N N   . HIS B 1 84  ? 10.882  38.011  33.833 1.00 17.04 ? 64   HIS B N   1 
ATOM   3480 C CA  . HIS B 1 84  ? 10.647  39.348  33.221 1.00 16.29 ? 64   HIS B CA  1 
ATOM   3481 C C   . HIS B 1 84  ? 11.752  39.676  32.248 1.00 17.22 ? 64   HIS B C   1 
ATOM   3482 O O   . HIS B 1 84  ? 11.475  40.121  31.129 1.00 15.96 ? 64   HIS B O   1 
ATOM   3483 C CB  . HIS B 1 84  ? 10.577  40.439  34.294 1.00 16.59 ? 64   HIS B CB  1 
ATOM   3484 C CG  . HIS B 1 84  ? 9.599   40.113  35.369 1.00 15.98 ? 64   HIS B CG  1 
ATOM   3485 N ND1 . HIS B 1 84  ? 8.259   40.440  35.265 1.00 17.81 ? 64   HIS B ND1 1 
ATOM   3486 C CD2 . HIS B 1 84  ? 9.742   39.451  36.537 1.00 13.71 ? 64   HIS B CD2 1 
ATOM   3487 C CE1 . HIS B 1 84  ? 7.631   40.028  36.349 1.00 14.03 ? 64   HIS B CE1 1 
ATOM   3488 N NE2 . HIS B 1 84  ? 8.491   39.396  37.120 1.00 21.02 ? 64   HIS B NE2 1 
ATOM   3489 N N   . PHE B 1 85  ? 12.999  39.445  32.667 1.00 17.50 ? 65   PHE B N   1 
ATOM   3490 C CA  . PHE B 1 85  ? 14.135  39.812  31.816 1.00 17.67 ? 65   PHE B CA  1 
ATOM   3491 C C   . PHE B 1 85  ? 14.032  39.139  30.445 1.00 17.37 ? 65   PHE B C   1 
ATOM   3492 O O   . PHE B 1 85  ? 14.367  39.757  29.436 1.00 17.80 ? 65   PHE B O   1 
ATOM   3493 C CB  . PHE B 1 85  ? 15.539  39.585  32.455 1.00 17.92 ? 65   PHE B CB  1 
ATOM   3494 C CG  . PHE B 1 85  ? 15.704  40.157  33.861 1.00 20.65 ? 65   PHE B CG  1 
ATOM   3495 C CD1 . PHE B 1 85  ? 14.941  41.246  34.301 1.00 20.18 ? 65   PHE B CD1 1 
ATOM   3496 C CD2 . PHE B 1 85  ? 16.639  39.588  34.745 1.00 23.39 ? 65   PHE B CD2 1 
ATOM   3497 C CE1 . PHE B 1 85  ? 15.097  41.746  35.590 1.00 20.46 ? 65   PHE B CE1 1 
ATOM   3498 C CE2 . PHE B 1 85  ? 16.796  40.079  36.025 1.00 24.09 ? 65   PHE B CE2 1 
ATOM   3499 C CZ  . PHE B 1 85  ? 16.008  41.166  36.447 1.00 20.04 ? 65   PHE B CZ  1 
ATOM   3500 N N   . SER B 1 86  ? 13.563  37.882  30.424 1.00 16.89 ? 66   SER B N   1 
ATOM   3501 C CA  . SER B 1 86  ? 13.384  37.122  29.201 1.00 15.88 ? 66   SER B CA  1 
ATOM   3502 C C   . SER B 1 86  ? 12.331  37.778  28.284 1.00 16.83 ? 66   SER B C   1 
ATOM   3503 O O   . SER B 1 86  ? 12.588  38.020  27.121 1.00 18.30 ? 66   SER B O   1 
ATOM   3504 C CB  . SER B 1 86  ? 13.086  35.645  29.533 1.00 15.46 ? 66   SER B CB  1 
ATOM   3505 O OG  . SER B 1 86  ? 13.068  34.815  28.367 1.00 15.74 ? 66   SER B OG  1 
ATOM   3506 N N   . LEU B 1 87  ? 11.162  38.093  28.828 1.00 16.25 ? 67   LEU B N   1 
ATOM   3507 C CA  . LEU B 1 87  ? 10.157  38.783  28.026 1.00 16.18 ? 67   LEU B CA  1 
ATOM   3508 C C   . LEU B 1 87  ? 10.651  40.140  27.500 1.00 15.83 ? 67   LEU B C   1 
ATOM   3509 O O   . LEU B 1 87  ? 10.451  40.503  26.321 1.00 15.72 ? 67   LEU B O   1 
ATOM   3510 C CB  . LEU B 1 87  ? 8.905   38.955  28.842 1.00 16.38 ? 67   LEU B CB  1 
ATOM   3511 C CG  . LEU B 1 87  ? 7.804   39.755  28.128 1.00 17.03 ? 67   LEU B CG  1 
ATOM   3512 C CD1 . LEU B 1 87  ? 7.276   39.094  26.876 1.00 16.02 ? 67   LEU B CD1 1 
ATOM   3513 C CD2 . LEU B 1 87  ? 6.661   39.998  29.104 1.00 19.25 ? 67   LEU B CD2 1 
ATOM   3514 N N   . GLN B 1 88  ? 11.274  40.894  28.384 1.00 15.56 ? 68   GLN B N   1 
ATOM   3515 C CA  . GLN B 1 88  ? 11.829  42.199  28.012 1.00 16.68 ? 68   GLN B CA  1 
ATOM   3516 C C   . GLN B 1 88  ? 12.794  42.096  26.841 1.00 18.00 ? 68   GLN B C   1 
ATOM   3517 O O   . GLN B 1 88  ? 12.714  42.901  25.903 1.00 17.30 ? 68   GLN B O   1 
ATOM   3518 C CB  . GLN B 1 88  ? 12.470  42.881  29.234 1.00 15.52 ? 68   GLN B CB  1 
ATOM   3519 C CG  . GLN B 1 88  ? 11.379  43.434  30.214 1.00 15.01 ? 68   GLN B CG  1 
ATOM   3520 C CD  . GLN B 1 88  ? 11.977  43.975  31.493 1.00 19.66 ? 68   GLN B CD  1 
ATOM   3521 O OE1 . GLN B 1 88  ? 11.770  45.141  31.852 1.00 25.14 ? 68   GLN B OE1 1 
ATOM   3522 N NE2 . GLN B 1 88  ? 12.752  43.159  32.165 1.00 17.83 ? 68   GLN B NE2 1 
ATOM   3523 N N   . GLN B 1 89  ? 13.722  41.138  26.916 1.00 18.18 ? 69   GLN B N   1 
ATOM   3524 C CA  . GLN B 1 89  ? 14.651  40.894  25.827 1.00 18.36 ? 69   GLN B CA  1 
ATOM   3525 C C   . GLN B 1 89  ? 13.903  40.553  24.544 1.00 17.96 ? 69   GLN B C   1 
ATOM   3526 O O   . GLN B 1 89  ? 14.223  41.059  23.473 1.00 16.62 ? 69   GLN B O   1 
ATOM   3527 C CB  . GLN B 1 89  ? 15.598  39.770  26.190 1.00 19.60 ? 69   GLN B CB  1 
ATOM   3528 C CG  . GLN B 1 89  ? 16.629  39.393  25.103 1.00 21.92 ? 69   GLN B CG  1 
ATOM   3529 C CD  . GLN B 1 89  ? 17.609  38.378  25.618 1.00 29.15 ? 69   GLN B CD  1 
ATOM   3530 O OE1 . GLN B 1 89  ? 18.374  38.658  26.544 1.00 32.13 ? 69   GLN B OE1 1 
ATOM   3531 N NE2 . GLN B 1 89  ? 17.598  37.183  25.031 1.00 31.44 ? 69   GLN B NE2 1 
ATOM   3532 N N   . ALA B 1 90  ? 12.891  39.704  24.662 1.00 17.24 ? 70   ALA B N   1 
ATOM   3533 C CA  . ALA B 1 90  ? 12.111  39.296  23.504 1.00 18.60 ? 70   ALA B CA  1 
ATOM   3534 C C   . ALA B 1 90  ? 11.375  40.489  22.843 1.00 20.07 ? 70   ALA B C   1 
ATOM   3535 O O   . ALA B 1 90  ? 11.368  40.607  21.601 1.00 18.48 ? 70   ALA B O   1 
ATOM   3536 C CB  . ALA B 1 90  ? 11.122  38.195  23.886 1.00 17.78 ? 70   ALA B CB  1 
ATOM   3537 N N   . MET B 1 91  ? 10.748  41.345  23.664 1.00 19.74 ? 71   MET B N   1 
ATOM   3538 C CA  . MET B 1 91  ? 10.076  42.535  23.166 1.00 20.15 ? 71   MET B CA  1 
ATOM   3539 C C   . MET B 1 91  ? 11.040  43.522  22.458 1.00 20.61 ? 71   MET B C   1 
ATOM   3540 O O   . MET B 1 91  ? 10.695  44.067  21.385 1.00 22.31 ? 71   MET B O   1 
ATOM   3541 C CB  . MET B 1 91  ? 9.255   43.240  24.289 1.00 19.77 ? 71   MET B CB  1 
ATOM   3542 C CG  . MET B 1 91  ? 8.077   42.416  24.876 1.00 21.45 ? 71   MET B CG  1 
ATOM   3543 S SD  . MET B 1 91  ? 6.943   41.813  23.614 1.00 21.92 ? 71   MET B SD  1 
ATOM   3544 C CE  . MET B 1 91  ? 6.387   43.363  22.847 1.00 23.32 ? 71   MET B CE  1 
ATOM   3545 N N   . CYS B 1 92  ? 12.239  43.738  23.037 1.00 20.30 ? 72   CYS B N   1 
ATOM   3546 C CA  . CYS B 1 92  ? 13.239  44.630  22.458 1.00 20.48 ? 72   CYS B CA  1 
ATOM   3547 C C   . CYS B 1 92  ? 13.708  44.116  21.105 1.00 19.88 ? 72   CYS B C   1 
ATOM   3548 O O   . CYS B 1 92  ? 13.907  44.897  20.192 1.00 18.59 ? 72   CYS B O   1 
ATOM   3549 C CB  . CYS B 1 92  ? 14.438  44.779  23.405 1.00 19.88 ? 72   CYS B CB  1 
ATOM   3550 S SG  . CYS B 1 92  ? 14.050  45.773  24.853 1.00 22.27 ? 72   CYS B SG  1 
ATOM   3551 N N   . GLU B 1 93  ? 13.880  42.794  20.999 1.00 21.38 ? 73   GLU B N   1 
ATOM   3552 C CA  . GLU B 1 93  ? 14.230  42.133  19.749 1.00 22.61 ? 73   GLU B CA  1 
ATOM   3553 C C   . GLU B 1 93  ? 13.104  42.289  18.744 1.00 22.15 ? 73   GLU B C   1 
ATOM   3554 O O   . GLU B 1 93  ? 13.344  42.697  17.616 1.00 23.61 ? 73   GLU B O   1 
ATOM   3555 C CB  . GLU B 1 93  ? 14.424  40.634  19.952 1.00 23.29 ? 73   GLU B CB  1 
ATOM   3556 C CG  . GLU B 1 93  ? 15.665  40.183  20.634 1.00 27.63 ? 73   GLU B CG  1 
ATOM   3557 C CD  . GLU B 1 93  ? 15.806  38.624  20.563 1.00 35.82 ? 73   GLU B CD  1 
ATOM   3558 O OE1 . GLU B 1 93  ? 16.159  37.989  21.601 1.00 38.53 ? 73   GLU B OE1 1 
ATOM   3559 O OE2 . GLU B 1 93  ? 15.538  38.047  19.452 1.00 37.43 ? 73   GLU B OE2 1 
ATOM   3560 N N   . LEU B 1 94  ? 11.878  41.939  19.115 1.00 21.53 ? 74   LEU B N   1 
ATOM   3561 C CA  . LEU B 1 94  ? 10.808  41.992  18.138 1.00 22.13 ? 74   LEU B CA  1 
ATOM   3562 C C   . LEU B 1 94  ? 10.460  43.389  17.633 1.00 21.87 ? 74   LEU B C   1 
ATOM   3563 O O   . LEU B 1 94  ? 10.183  43.555  16.447 1.00 23.20 ? 74   LEU B O   1 
ATOM   3564 C CB  . LEU B 1 94  ? 9.568   41.281  18.640 1.00 22.42 ? 74   LEU B CB  1 
ATOM   3565 C CG  . LEU B 1 94  ? 9.833   39.790  18.859 1.00 24.48 ? 74   LEU B CG  1 
ATOM   3566 C CD1 . LEU B 1 94  ? 8.672   39.225  19.642 1.00 26.09 ? 74   LEU B CD1 1 
ATOM   3567 C CD2 . LEU B 1 94  ? 10.097  39.025  17.527 1.00 27.54 ? 74   LEU B CD2 1 
ATOM   3568 N N   . GLU B 1 95  ? 10.491  44.391  18.505 1.00 21.40 ? 75   GLU B N   1 
ATOM   3569 C CA  . GLU B 1 95  ? 10.153  45.756  18.118 1.00 21.04 ? 75   GLU B CA  1 
ATOM   3570 C C   . GLU B 1 95  ? 11.363  46.625  17.831 1.00 21.36 ? 75   GLU B C   1 
ATOM   3571 O O   . GLU B 1 95  ? 11.190  47.776  17.410 1.00 22.46 ? 75   GLU B O   1 
ATOM   3572 C CB  . GLU B 1 95  ? 9.247   46.419  19.180 1.00 21.18 ? 75   GLU B CB  1 
ATOM   3573 C CG  . GLU B 1 95  ? 7.866   45.701  19.265 1.00 18.67 ? 75   GLU B CG  1 
ATOM   3574 C CD  . GLU B 1 95  ? 6.759   46.525  19.923 1.00 22.23 ? 75   GLU B CD  1 
ATOM   3575 O OE1 . GLU B 1 95  ? 6.465   47.634  19.440 1.00 20.86 ? 75   GLU B OE1 1 
ATOM   3576 O OE2 . GLU B 1 95  ? 6.165   46.044  20.903 1.00 22.52 ? 75   GLU B OE2 1 
ATOM   3577 N N   . GLY B 1 96  ? 12.567  46.101  18.049 1.00 21.26 ? 76   GLY B N   1 
ATOM   3578 C CA  . GLY B 1 96  ? 13.774  46.891  17.765 1.00 19.68 ? 76   GLY B CA  1 
ATOM   3579 C C   . GLY B 1 96  ? 13.992  48.053  18.738 1.00 20.54 ? 76   GLY B C   1 
ATOM   3580 O O   . GLY B 1 96  ? 14.422  49.155  18.334 1.00 18.94 ? 76   GLY B O   1 
ATOM   3581 N N   . GLY B 1 97  ? 13.665  47.812  20.009 1.00 19.79 ? 77   GLY B N   1 
ATOM   3582 C CA  . GLY B 1 97  ? 13.792  48.826  21.056 1.00 20.64 ? 77   GLY B CA  1 
ATOM   3583 C C   . GLY B 1 97  ? 15.070  48.721  21.904 1.00 20.56 ? 77   GLY B C   1 
ATOM   3584 O O   . GLY B 1 97  ? 15.785  47.694  21.894 1.00 20.86 ? 77   GLY B O   1 
ATOM   3585 N N   . ALA B 1 98  ? 15.335  49.782  22.661 1.00 19.43 ? 78   ALA B N   1 
ATOM   3586 C CA  . ALA B 1 98  ? 16.434  49.777  23.613 1.00 19.43 ? 78   ALA B CA  1 
ATOM   3587 C C   . ALA B 1 98  ? 15.964  49.198  24.941 1.00 19.36 ? 78   ALA B C   1 
ATOM   3588 O O   . ALA B 1 98  ? 16.793  48.697  25.695 1.00 20.07 ? 78   ALA B O   1 
ATOM   3589 C CB  . ALA B 1 98  ? 17.008  51.192  23.800 1.00 18.15 ? 78   ALA B CB  1 
ATOM   3590 N N   . GLY B 1 99  ? 14.643  49.255  25.223 1.00 18.35 ? 79   GLY B N   1 
ATOM   3591 C CA  . GLY B 1 99  ? 14.106  48.701  26.455 1.00 17.67 ? 79   GLY B CA  1 
ATOM   3592 C C   . GLY B 1 99  ? 12.609  48.453  26.362 1.00 18.87 ? 79   GLY B C   1 
ATOM   3593 O O   . GLY B 1 99  ? 11.961  49.008  25.491 1.00 18.20 ? 79   GLY B O   1 
ATOM   3594 N N   . CYS B 1 100 ? 12.113  47.597  27.254 1.00 18.05 ? 80   CYS B N   1 
ATOM   3595 C CA  . CYS B 1 100 ? 10.737  47.246  27.351 1.00 18.33 ? 80   CYS B CA  1 
ATOM   3596 C C   . CYS B 1 100 ? 10.287  47.496  28.804 1.00 18.86 ? 80   CYS B C   1 
ATOM   3597 O O   . CYS B 1 100 ? 10.841  46.928  29.759 1.00 18.59 ? 80   CYS B O   1 
ATOM   3598 C CB  . CYS B 1 100 ? 10.511  45.758  26.981 1.00 17.45 ? 80   CYS B CB  1 
ATOM   3599 S SG  . CYS B 1 100 ? 8.737   45.379  27.018 1.00 20.98 ? 80   CYS B SG  1 
ATOM   3600 N N   . VAL B 1 101 ? 9.228   48.290  28.987 1.00 18.57 ? 81   VAL B N   1 
ATOM   3601 C CA  . VAL B 1 101 ? 8.750   48.532  30.326 1.00 18.67 ? 81   VAL B CA  1 
ATOM   3602 C C   . VAL B 1 101 ? 7.414   47.798  30.414 1.00 19.10 ? 81   VAL B C   1 
ATOM   3603 O O   . VAL B 1 101 ? 6.685   47.770  29.432 1.00 18.29 ? 81   VAL B O   1 
ATOM   3604 C CB  . VAL B 1 101 ? 8.619   50.051  30.648 1.00 18.07 ? 81   VAL B CB  1 
ATOM   3605 C CG1 . VAL B 1 101 ? 8.125   50.260  32.106 1.00 19.14 ? 81   VAL B CG1 1 
ATOM   3606 C CG2 . VAL B 1 101 ? 9.949   50.792  30.416 1.00 21.75 ? 81   VAL B CG2 1 
ATOM   3607 N N   . LEU B 1 102 ? 7.160   47.143  31.550 1.00 19.18 ? 82   LEU B N   1 
ATOM   3608 C CA  . LEU B 1 102 ? 5.993   46.249  31.710 1.00 18.68 ? 82   LEU B CA  1 
ATOM   3609 C C   . LEU B 1 102 ? 4.959   46.814  32.676 1.00 18.63 ? 82   LEU B C   1 
ATOM   3610 O O   . LEU B 1 102 ? 5.286   47.508  33.623 1.00 19.42 ? 82   LEU B O   1 
ATOM   3611 C CB  . LEU B 1 102 ? 6.456   44.866  32.197 1.00 19.46 ? 82   LEU B CB  1 
ATOM   3612 C CG  . LEU B 1 102 ? 7.521   44.124  31.360 1.00 17.78 ? 82   LEU B CG  1 
ATOM   3613 C CD1 . LEU B 1 102 ? 7.915   42.852  32.127 1.00 16.47 ? 82   LEU B CD1 1 
ATOM   3614 C CD2 . LEU B 1 102 ? 7.014   43.756  29.917 1.00 19.34 ? 82   LEU B CD2 1 
ATOM   3615 N N   . PHE B 1 103 ? 3.691   46.488  32.429 1.00 18.75 ? 83   PHE B N   1 
ATOM   3616 C CA  . PHE B 1 103 ? 2.590   47.094  33.168 1.00 18.10 ? 83   PHE B CA  1 
ATOM   3617 C C   . PHE B 1 103 ? 1.544   46.004  33.327 1.00 18.77 ? 83   PHE B C   1 
ATOM   3618 O O   . PHE B 1 103 ? 1.595   45.020  32.582 1.00 18.39 ? 83   PHE B O   1 
ATOM   3619 C CB  . PHE B 1 103 ? 1.975   48.251  32.352 1.00 18.90 ? 83   PHE B CB  1 
ATOM   3620 C CG  . PHE B 1 103 ? 2.941   49.353  32.041 1.00 16.75 ? 83   PHE B CG  1 
ATOM   3621 C CD1 . PHE B 1 103 ? 3.072   50.464  32.896 1.00 15.90 ? 83   PHE B CD1 1 
ATOM   3622 C CD2 . PHE B 1 103 ? 3.700   49.307  30.887 1.00 17.93 ? 83   PHE B CD2 1 
ATOM   3623 C CE1 . PHE B 1 103 ? 4.028   51.521  32.587 1.00 15.82 ? 83   PHE B CE1 1 
ATOM   3624 C CE2 . PHE B 1 103 ? 4.640   50.325  30.571 1.00 15.52 ? 83   PHE B CE2 1 
ATOM   3625 C CZ  . PHE B 1 103 ? 4.771   51.468  31.422 1.00 15.74 ? 83   PHE B CZ  1 
ATOM   3626 N N   . PRO B 1 104 ? 0.625   46.165  34.312 1.00 18.77 ? 84   PRO B N   1 
ATOM   3627 C CA  . PRO B 1 104 ? -0.452  45.218  34.607 1.00 18.91 ? 84   PRO B CA  1 
ATOM   3628 C C   . PRO B 1 104 ? -1.461  45.008  33.491 1.00 18.39 ? 84   PRO B C   1 
ATOM   3629 O O   . PRO B 1 104 ? -2.097  43.969  33.470 1.00 17.92 ? 84   PRO B O   1 
ATOM   3630 C CB  . PRO B 1 104 ? -1.123  45.819  35.860 1.00 18.04 ? 84   PRO B CB  1 
ATOM   3631 C CG  . PRO B 1 104 ? -0.830  47.266  35.819 1.00 18.97 ? 84   PRO B CG  1 
ATOM   3632 C CD  . PRO B 1 104 ? 0.648   47.233  35.332 1.00 18.73 ? 84   PRO B CD  1 
ATOM   3633 N N   . CYS B 1 105 ? -1.587  45.979  32.574 1.00 16.47 ? 85   CYS B N   1 
ATOM   3634 C CA  . CYS B 1 105 ? -2.504  45.890  31.435 1.00 15.36 ? 85   CYS B CA  1 
ATOM   3635 C C   . CYS B 1 105 ? -2.160  47.013  30.446 1.00 14.43 ? 85   CYS B C   1 
ATOM   3636 O O   . CYS B 1 105 ? -1.290  47.911  30.719 1.00 16.47 ? 85   CYS B O   1 
ATOM   3637 C CB  . CYS B 1 105 ? -3.984  45.965  31.872 1.00 14.38 ? 85   CYS B CB  1 
ATOM   3638 S SG  . CYS B 1 105 ? -4.411  47.582  32.567 1.00 16.28 ? 85   CYS B SG  1 
ATOM   3639 N N   . GLY B 1 106 ? -2.782  46.938  29.284 1.00 14.43 ? 86   GLY B N   1 
ATOM   3640 C CA  . GLY B 1 106 ? -2.634  47.932  28.224 1.00 14.20 ? 86   GLY B CA  1 
ATOM   3641 C C   . GLY B 1 106 ? -2.943  49.325  28.748 1.00 16.30 ? 86   GLY B C   1 
ATOM   3642 O O   . GLY B 1 106 ? -2.225  50.261  28.484 1.00 13.91 ? 86   GLY B O   1 
ATOM   3643 N N   . ALA B 1 107 ? -4.097  49.490  29.397 1.00 14.88 ? 87   ALA B N   1 
ATOM   3644 C CA  . ALA B 1 107 ? -4.473  50.801  29.933 1.00 15.25 ? 87   ALA B CA  1 
ATOM   3645 C C   . ALA B 1 107 ? -3.476  51.402  30.910 1.00 16.90 ? 87   ALA B C   1 
ATOM   3646 O O   . ALA B 1 107 ? -3.243  52.627  30.868 1.00 17.88 ? 87   ALA B O   1 
ATOM   3647 C CB  . ALA B 1 107 ? -5.864  50.702  30.599 1.00 15.23 ? 87   ALA B CB  1 
ATOM   3648 N N   . ALA B 1 108 ? -2.885  50.547  31.768 1.00 17.17 ? 88   ALA B N   1 
ATOM   3649 C CA  . ALA B 1 108 ? -1.791  50.947  32.629 1.00 16.10 ? 88   ALA B CA  1 
ATOM   3650 C C   . ALA B 1 108 ? -0.565  51.373  31.818 1.00 15.98 ? 88   ALA B C   1 
ATOM   3651 O O   . ALA B 1 108 ? 0.035   52.403  32.150 1.00 16.46 ? 88   ALA B O   1 
ATOM   3652 C CB  . ALA B 1 108 ? -1.416  49.855  33.622 1.00 16.18 ? 88   ALA B CB  1 
ATOM   3653 N N   . ALA B 1 109 ? -0.243  50.672  30.730 1.00 15.62 ? 89   ALA B N   1 
ATOM   3654 C CA  . ALA B 1 109 ? 0.933   51.077  29.896 1.00 14.86 ? 89   ALA B CA  1 
ATOM   3655 C C   . ALA B 1 109 ? 0.658   52.434  29.246 1.00 15.31 ? 89   ALA B C   1 
ATOM   3656 O O   . ALA B 1 109 ? 1.531   53.288  29.205 1.00 14.11 ? 89   ALA B O   1 
ATOM   3657 C CB  . ALA B 1 109 ? 1.302   50.007  28.827 1.00 13.79 ? 89   ALA B CB  1 
ATOM   3658 N N   . VAL B 1 110 ? -0.584  52.642  28.773 1.00 15.60 ? 90   VAL B N   1 
ATOM   3659 C CA  . VAL B 1 110 ? -0.937  53.958  28.193 1.00 15.54 ? 90   VAL B CA  1 
ATOM   3660 C C   . VAL B 1 110 ? -0.856  55.128  29.189 1.00 16.56 ? 90   VAL B C   1 
ATOM   3661 O O   . VAL B 1 110 ? -0.120  56.099  28.933 1.00 16.40 ? 90   VAL B O   1 
ATOM   3662 C CB  . VAL B 1 110 ? -2.324  53.994  27.507 1.00 14.27 ? 90   VAL B CB  1 
ATOM   3663 C CG1 . VAL B 1 110 ? -2.616  55.442  27.032 1.00 16.41 ? 90   VAL B CG1 1 
ATOM   3664 C CG2 . VAL B 1 110 ? -2.378  53.044  26.283 1.00 15.02 ? 90   VAL B CG2 1 
ATOM   3665 N N   . ALA B 1 111 ? -1.607  55.052  30.288 1.00 15.76 ? 91   ALA B N   1 
ATOM   3666 C CA  . ALA B 1 111 ? -1.670  56.125  31.259 1.00 16.73 ? 91   ALA B CA  1 
ATOM   3667 C C   . ALA B 1 111 ? -0.272  56.406  31.802 1.00 16.86 ? 91   ALA B C   1 
ATOM   3668 O O   . ALA B 1 111 ? 0.161   57.559  31.887 1.00 16.93 ? 91   ALA B O   1 
ATOM   3669 C CB  . ALA B 1 111 ? -2.576  55.764  32.380 1.00 17.10 ? 91   ALA B CB  1 
ATOM   3670 N N   . ASN B 1 112 ? 0.437   55.341  32.153 1.00 16.61 ? 92   ASN B N   1 
ATOM   3671 C CA  . ASN B 1 112 ? 1.738   55.507  32.803 1.00 17.01 ? 92   ASN B CA  1 
ATOM   3672 C C   . ASN B 1 112 ? 2.839   55.926  31.846 1.00 17.58 ? 92   ASN B C   1 
ATOM   3673 O O   . ASN B 1 112 ? 3.697   56.731  32.226 1.00 17.12 ? 92   ASN B O   1 
ATOM   3674 C CB  . ASN B 1 112 ? 2.115   54.268  33.657 1.00 17.44 ? 92   ASN B CB  1 
ATOM   3675 C CG  . ASN B 1 112 ? 1.404   54.262  34.997 1.00 17.48 ? 92   ASN B CG  1 
ATOM   3676 O OD1 . ASN B 1 112 ? 1.867   54.923  35.947 1.00 15.59 ? 92   ASN B OD1 1 
ATOM   3677 N ND2 . ASN B 1 112 ? 0.240   53.562  35.086 1.00 14.36 ? 92   ASN B ND2 1 
ATOM   3678 N N   . SER B 1 113 ? 2.782   55.476  30.593 1.00 16.95 ? 93   SER B N   1 
ATOM   3679 C CA  . SER B 1 113 ? 3.761   55.998  29.588 1.00 15.85 ? 93   SER B CA  1 
ATOM   3680 C C   . SER B 1 113 ? 3.588   57.515  29.401 1.00 16.14 ? 93   SER B C   1 
ATOM   3681 O O   . SER B 1 113 ? 4.531   58.254  29.377 1.00 13.90 ? 93   SER B O   1 
ATOM   3682 C CB  . SER B 1 113 ? 3.638   55.250  28.238 1.00 15.37 ? 93   SER B CB  1 
ATOM   3683 O OG  . SER B 1 113 ? 4.104   53.895  28.350 1.00 18.12 ? 93   SER B OG  1 
ATOM   3684 N N   . ILE B 1 114 ? 2.350   57.998  29.274 1.00 14.67 ? 94   ILE B N   1 
ATOM   3685 C CA  . ILE B 1 114 ? 2.118   59.438  29.115 1.00 15.48 ? 94   ILE B CA  1 
ATOM   3686 C C   . ILE B 1 114 ? 2.500   60.226  30.362 1.00 15.60 ? 94   ILE B C   1 
ATOM   3687 O O   . ILE B 1 114 ? 3.196   61.248  30.246 1.00 15.94 ? 94   ILE B O   1 
ATOM   3688 C CB  . ILE B 1 114 ? 0.645   59.736  28.751 1.00 14.54 ? 94   ILE B CB  1 
ATOM   3689 C CG1 . ILE B 1 114 ? 0.337   59.267  27.325 1.00 17.47 ? 94   ILE B CG1 1 
ATOM   3690 C CG2 . ILE B 1 114 ? 0.378   61.257  28.870 1.00 15.83 ? 94   ILE B CG2 1 
ATOM   3691 C CD1 . ILE B 1 114 ? -1.162  59.024  27.135 1.00 13.81 ? 94   ILE B CD1 1 
ATOM   3692 N N   . LEU B 1 115 ? 2.105   59.733  31.549 1.00 15.18 ? 95   LEU B N   1 
ATOM   3693 C CA  . LEU B 1 115 ? 2.420   60.371  32.822 1.00 15.75 ? 95   LEU B CA  1 
ATOM   3694 C C   . LEU B 1 115 ? 3.933   60.518  32.993 1.00 16.21 ? 95   LEU B C   1 
ATOM   3695 O O   . LEU B 1 115 ? 4.410   61.547  33.486 1.00 18.01 ? 95   LEU B O   1 
ATOM   3696 C CB  . LEU B 1 115 ? 1.874   59.559  34.008 1.00 14.81 ? 95   LEU B CB  1 
ATOM   3697 C CG  . LEU B 1 115 ? 2.056   60.229  35.399 1.00 16.37 ? 95   LEU B CG  1 
ATOM   3698 C CD1 . LEU B 1 115 ? 1.190   61.529  35.530 1.00 20.60 ? 95   LEU B CD1 1 
ATOM   3699 C CD2 . LEU B 1 115 ? 1.818   59.294  36.613 1.00 14.29 ? 95   LEU B CD2 1 
ATOM   3700 N N   . ALA B 1 116 ? 4.668   59.487  32.583 1.00 17.28 ? 96   ALA B N   1 
ATOM   3701 C CA  . ALA B 1 116 ? 6.128   59.458  32.740 1.00 17.05 ? 96   ALA B CA  1 
ATOM   3702 C C   . ALA B 1 116 ? 6.845   60.647  32.065 1.00 18.92 ? 96   ALA B C   1 
ATOM   3703 O O   . ALA B 1 116 ? 7.959   61.013  32.479 1.00 18.67 ? 96   ALA B O   1 
ATOM   3704 C CB  . ALA B 1 116 ? 6.700   58.134  32.184 1.00 17.78 ? 96   ALA B CB  1 
ATOM   3705 N N   . PHE B 1 117 ? 6.247   61.221  31.023 1.00 19.36 ? 97   PHE B N   1 
ATOM   3706 C CA  . PHE B 1 117 ? 6.911   62.310  30.265 1.00 20.46 ? 97   PHE B CA  1 
ATOM   3707 C C   . PHE B 1 117 ? 6.314   63.708  30.456 1.00 20.46 ? 97   PHE B C   1 
ATOM   3708 O O   . PHE B 1 117 ? 6.840   64.682  29.922 1.00 21.94 ? 97   PHE B O   1 
ATOM   3709 C CB  . PHE B 1 117 ? 6.969   61.952  28.772 1.00 20.46 ? 97   PHE B CB  1 
ATOM   3710 C CG  . PHE B 1 117 ? 7.960   60.863  28.466 1.00 20.39 ? 97   PHE B CG  1 
ATOM   3711 C CD1 . PHE B 1 117 ? 9.294   61.184  28.260 1.00 19.80 ? 97   PHE B CD1 1 
ATOM   3712 C CD2 . PHE B 1 117 ? 7.557   59.530  28.404 1.00 21.40 ? 97   PHE B CD2 1 
ATOM   3713 C CE1 . PHE B 1 117 ? 10.226  60.166  28.003 1.00 20.83 ? 97   PHE B CE1 1 
ATOM   3714 C CE2 . PHE B 1 117 ? 8.484   58.494  28.142 1.00 21.29 ? 97   PHE B CE2 1 
ATOM   3715 C CZ  . PHE B 1 117 ? 9.839   58.831  27.930 1.00 22.83 ? 97   PHE B CZ  1 
ATOM   3716 N N   . ILE B 1 118 ? 5.226   63.827  31.209 1.00 20.71 ? 98   ILE B N   1 
ATOM   3717 C CA  . ILE B 1 118 ? 4.606   65.156  31.342 1.00 20.11 ? 98   ILE B CA  1 
ATOM   3718 C C   . ILE B 1 118 ? 4.920   65.883  32.667 1.00 20.26 ? 98   ILE B C   1 
ATOM   3719 O O   . ILE B 1 118 ? 5.396   65.294  33.675 1.00 18.55 ? 98   ILE B O   1 
ATOM   3720 C CB  . ILE B 1 118 ? 3.064   65.183  31.053 1.00 20.40 ? 98   ILE B CB  1 
ATOM   3721 C CG1 . ILE B 1 118 ? 2.342   64.120  31.872 1.00 21.66 ? 98   ILE B CG1 1 
ATOM   3722 C CG2 . ILE B 1 118 ? 2.750   65.104  29.545 1.00 20.88 ? 98   ILE B CG2 1 
ATOM   3723 C CD1 . ILE B 1 118 ? 2.327   64.406  33.347 1.00 20.31 ? 98   ILE B CD1 1 
ATOM   3724 N N   . GLU B 1 119 ? 4.598   67.177  32.641 1.00 19.98 ? 99   GLU B N   1 
ATOM   3725 C CA  . GLU B 1 119 ? 4.761   68.077  33.772 1.00 21.12 ? 99   GLU B CA  1 
ATOM   3726 C C   . GLU B 1 119 ? 3.655   69.083  33.673 1.00 19.85 ? 99   GLU B C   1 
ATOM   3727 O O   . GLU B 1 119 ? 3.144   69.313  32.573 1.00 19.91 ? 99   GLU B O   1 
ATOM   3728 C CB  . GLU B 1 119 ? 6.052   68.882  33.591 1.00 21.73 ? 99   GLU B CB  1 
ATOM   3729 C CG  . GLU B 1 119 ? 7.284   68.150  33.937 1.00 27.88 ? 99   GLU B CG  1 
ATOM   3730 C CD  . GLU B 1 119 ? 8.507   69.077  33.963 1.00 34.47 ? 99   GLU B CD  1 
ATOM   3731 O OE1 . GLU B 1 119 ? 8.426   70.198  33.401 1.00 35.48 ? 99   GLU B OE1 1 
ATOM   3732 O OE2 . GLU B 1 119 ? 9.539   68.671  34.562 1.00 37.93 ? 99   GLU B OE2 1 
ATOM   3733 N N   . GLN B 1 120 ? 3.322   69.741  34.785 1.00 20.11 ? 100  GLN B N   1 
ATOM   3734 C CA  . GLN B 1 120 ? 2.314   70.821  34.728 1.00 20.67 ? 100  GLN B CA  1 
ATOM   3735 C C   . GLN B 1 120 ? 2.703   71.846  33.659 1.00 20.40 ? 100  GLN B C   1 
ATOM   3736 O O   . GLN B 1 120 ? 3.878   72.193  33.502 1.00 19.21 ? 100  GLN B O   1 
ATOM   3737 C CB  . GLN B 1 120 ? 2.098   71.493  36.099 1.00 20.82 ? 100  GLN B CB  1 
ATOM   3738 C CG  . GLN B 1 120 ? 3.276   72.290  36.594 1.00 23.87 ? 100  GLN B CG  1 
ATOM   3739 C CD  . GLN B 1 120 ? 3.069   73.012  37.951 1.00 26.38 ? 100  GLN B CD  1 
ATOM   3740 O OE1 . GLN B 1 120 ? 4.041   73.212  38.662 1.00 30.79 ? 100  GLN B OE1 1 
ATOM   3741 N NE2 . GLN B 1 120 ? 1.834   73.372  38.301 1.00 23.58 ? 100  GLN B NE2 1 
ATOM   3742 N N   . GLY B 1 121 ? 1.709   72.316  32.919 1.00 20.63 ? 101  GLY B N   1 
ATOM   3743 C CA  . GLY B 1 121 ? 1.942   73.277  31.845 1.00 21.00 ? 101  GLY B CA  1 
ATOM   3744 C C   . GLY B 1 121 ? 2.224   72.668  30.469 1.00 21.86 ? 101  GLY B C   1 
ATOM   3745 O O   . GLY B 1 121 ? 2.394   73.403  29.494 1.00 22.24 ? 101  GLY B O   1 
ATOM   3746 N N   . ASP B 1 122 ? 2.276   71.333  30.380 1.00 21.19 ? 102  ASP B N   1 
ATOM   3747 C CA  . ASP B 1 122 ? 2.514   70.636  29.096 1.00 20.36 ? 102  ASP B CA  1 
ATOM   3748 C C   . ASP B 1 122 ? 1.235   70.460  28.281 1.00 19.83 ? 102  ASP B C   1 
ATOM   3749 O O   . ASP B 1 122 ? 0.144   70.546  28.829 1.00 18.94 ? 102  ASP B O   1 
ATOM   3750 C CB  . ASP B 1 122 ? 3.150   69.255  29.348 1.00 20.45 ? 102  ASP B CB  1 
ATOM   3751 C CG  . ASP B 1 122 ? 4.636   69.342  29.688 1.00 20.71 ? 102  ASP B CG  1 
ATOM   3752 O OD1 . ASP B 1 122 ? 5.230   70.425  29.522 1.00 22.06 ? 102  ASP B OD1 1 
ATOM   3753 O OD2 . ASP B 1 122 ? 5.213   68.314  30.129 1.00 22.98 ? 102  ASP B OD2 1 
ATOM   3754 N N   . HIS B 1 123 ? 1.379   70.158  26.993 1.00 18.62 ? 103  HIS B N   1 
ATOM   3755 C CA  . HIS B 1 123 ? 0.218   69.887  26.126 1.00 18.62 ? 103  HIS B CA  1 
ATOM   3756 C C   . HIS B 1 123 ? 0.409   68.517  25.532 1.00 18.50 ? 103  HIS B C   1 
ATOM   3757 O O   . HIS B 1 123 ? 1.533   68.140  25.169 1.00 18.94 ? 103  HIS B O   1 
ATOM   3758 C CB  . HIS B 1 123 ? 0.105   70.944  25.013 1.00 17.84 ? 103  HIS B CB  1 
ATOM   3759 C CG  . HIS B 1 123 ? -0.969  70.671  23.988 1.00 18.85 ? 103  HIS B CG  1 
ATOM   3760 N ND1 . HIS B 1 123 ? -0.693  70.451  22.655 1.00 16.36 ? 103  HIS B ND1 1 
ATOM   3761 C CD2 . HIS B 1 123 ? -2.322  70.603  24.102 1.00 21.34 ? 103  HIS B CD2 1 
ATOM   3762 C CE1 . HIS B 1 123 ? -1.822  70.263  21.989 1.00 22.37 ? 103  HIS B CE1 1 
ATOM   3763 N NE2 . HIS B 1 123 ? -2.830  70.375  22.840 1.00 17.02 ? 103  HIS B NE2 1 
ATOM   3764 N N   . VAL B 1 124 ? -0.678  67.765  25.490 1.00 17.89 ? 104  VAL B N   1 
ATOM   3765 C CA  . VAL B 1 124 ? -0.720  66.424  24.872 1.00 17.92 ? 104  VAL B CA  1 
ATOM   3766 C C   . VAL B 1 124 ? -1.613  66.503  23.644 1.00 18.20 ? 104  VAL B C   1 
ATOM   3767 O O   . VAL B 1 124 ? -2.709  66.993  23.738 1.00 17.80 ? 104  VAL B O   1 
ATOM   3768 C CB  . VAL B 1 124 ? -1.295  65.406  25.845 1.00 17.71 ? 104  VAL B CB  1 
ATOM   3769 C CG1 . VAL B 1 124 ? -1.586  64.046  25.169 1.00 16.49 ? 104  VAL B CG1 1 
ATOM   3770 C CG2 . VAL B 1 124 ? -0.289  65.216  27.027 1.00 17.84 ? 104  VAL B CG2 1 
ATOM   3771 N N   . LEU B 1 125 ? -1.123  66.016  22.506 1.00 18.27 ? 105  LEU B N   1 
ATOM   3772 C CA  . LEU B 1 125 ? -1.911  66.008  21.273 1.00 16.77 ? 105  LEU B CA  1 
ATOM   3773 C C   . LEU B 1 125 ? -2.207  64.565  20.887 1.00 16.88 ? 105  LEU B C   1 
ATOM   3774 O O   . LEU B 1 125 ? -1.298  63.795  20.603 1.00 18.26 ? 105  LEU B O   1 
ATOM   3775 C CB  . LEU B 1 125 ? -1.161  66.738  20.146 1.00 16.52 ? 105  LEU B CB  1 
ATOM   3776 C CG  . LEU B 1 125 ? -1.760  66.805  18.733 1.00 16.78 ? 105  LEU B CG  1 
ATOM   3777 C CD1 . LEU B 1 125 ? -3.185  67.413  18.763 1.00 11.53 ? 105  LEU B CD1 1 
ATOM   3778 C CD2 . LEU B 1 125 ? -0.902  67.577  17.767 1.00 14.70 ? 105  LEU B CD2 1 
ATOM   3779 N N   . MET B 1 126 ? -3.483  64.183  20.869 1.00 17.98 ? 106  MET B N   1 
ATOM   3780 C CA  . MET B 1 126 ? -3.825  62.757  20.731 1.00 17.14 ? 106  MET B CA  1 
ATOM   3781 C C   . MET B 1 126 ? -4.821  62.494  19.594 1.00 18.44 ? 106  MET B C   1 
ATOM   3782 O O   . MET B 1 126 ? -5.774  63.252  19.406 1.00 17.25 ? 106  MET B O   1 
ATOM   3783 C CB  . MET B 1 126 ? -4.401  62.238  22.056 1.00 16.28 ? 106  MET B CB  1 
ATOM   3784 C CG  . MET B 1 126 ? -4.911  60.789  22.038 1.00 13.59 ? 106  MET B CG  1 
ATOM   3785 S SD  . MET B 1 126 ? -5.455  60.146  23.628 1.00 16.63 ? 106  MET B SD  1 
ATOM   3786 C CE  . MET B 1 126 ? -3.795  59.928  24.383 1.00 9.97  ? 106  MET B CE  1 
ATOM   3787 N N   . THR B 1 127 ? -4.659  61.408  18.845 1.00 17.82 ? 107  THR B N   1 
ATOM   3788 C CA  . THR B 1 127 ? -5.643  61.153  17.765 1.00 17.35 ? 107  THR B CA  1 
ATOM   3789 C C   . THR B 1 127 ? -7.032  61.011  18.377 1.00 17.07 ? 107  THR B C   1 
ATOM   3790 O O   . THR B 1 127 ? -7.180  60.402  19.438 1.00 16.51 ? 107  THR B O   1 
ATOM   3791 C CB  . THR B 1 127 ? -5.357  59.867  16.911 1.00 16.79 ? 107  THR B CB  1 
ATOM   3792 O OG1 . THR B 1 127 ? -6.405  59.718  15.930 1.00 18.66 ? 107  THR B OG1 1 
ATOM   3793 C CG2 . THR B 1 127 ? -5.287  58.603  17.794 1.00 18.16 ? 107  THR B CG2 1 
ATOM   3794 N N   . ASN B 1 128 ? -8.049  61.561  17.721 1.00 17.45 ? 108  ASN B N   1 
ATOM   3795 C CA  . ASN B 1 128 ? -9.401  61.426  18.286 1.00 17.84 ? 108  ASN B CA  1 
ATOM   3796 C C   . ASN B 1 128 ? -9.995  60.019  18.098 1.00 17.87 ? 108  ASN B C   1 
ATOM   3797 O O   . ASN B 1 128 ? -11.102 59.765  18.534 1.00 18.32 ? 108  ASN B O   1 
ATOM   3798 C CB  . ASN B 1 128 ? -10.372 62.547  17.828 1.00 17.07 ? 108  ASN B CB  1 
ATOM   3799 C CG  . ASN B 1 128 ? -10.784 62.431  16.337 1.00 19.16 ? 108  ASN B CG  1 
ATOM   3800 O OD1 . ASN B 1 128 ? -10.648 61.359  15.687 1.00 18.41 ? 108  ASN B OD1 1 
ATOM   3801 N ND2 . ASN B 1 128 ? -11.285 63.540  15.792 1.00 19.28 ? 108  ASN B ND2 1 
ATOM   3802 N N   . THR B 1 129 ? -9.275  59.146  17.396 1.00 17.43 ? 109  THR B N   1 
ATOM   3803 C CA  . THR B 1 129 ? -9.640  57.726  17.276 1.00 16.97 ? 109  THR B CA  1 
ATOM   3804 C C   . THR B 1 129 ? -8.939  56.851  18.320 1.00 17.35 ? 109  THR B C   1 
ATOM   3805 O O   . THR B 1 129 ? -8.957  55.608  18.222 1.00 18.55 ? 109  THR B O   1 
ATOM   3806 C CB  . THR B 1 129 ? -9.308  57.158  15.905 1.00 17.33 ? 109  THR B CB  1 
ATOM   3807 O OG1 . THR B 1 129 ? -7.922  57.383  15.604 1.00 17.40 ? 109  THR B OG1 1 
ATOM   3808 C CG2 . THR B 1 129 ? -10.211 57.760  14.818 1.00 16.14 ? 109  THR B CG2 1 
ATOM   3809 N N   . ALA B 1 130 ? -8.343  57.486  19.319 1.00 17.40 ? 110  ALA B N   1 
ATOM   3810 C CA  . ALA B 1 130 ? -7.672  56.758  20.439 1.00 16.78 ? 110  ALA B CA  1 
ATOM   3811 C C   . ALA B 1 130 ? -8.680  55.997  21.273 1.00 17.32 ? 110  ALA B C   1 
ATOM   3812 O O   . ALA B 1 130 ? -9.818  56.433  21.440 1.00 16.34 ? 110  ALA B O   1 
ATOM   3813 C CB  . ALA B 1 130 ? -6.838  57.716  21.324 1.00 17.65 ? 110  ALA B CB  1 
ATOM   3814 N N   . TYR B 1 131 ? -8.303  54.796  21.707 1.00 16.89 ? 111  TYR B N   1 
ATOM   3815 C CA  . TYR B 1 131 ? -9.106  53.990  22.627 1.00 16.58 ? 111  TYR B CA  1 
ATOM   3816 C C   . TYR B 1 131 ? -9.698  54.873  23.739 1.00 16.15 ? 111  TYR B C   1 
ATOM   3817 O O   . TYR B 1 131 ? -8.994  55.736  24.269 1.00 17.68 ? 111  TYR B O   1 
ATOM   3818 C CB  . TYR B 1 131 ? -8.196  52.882  23.157 1.00 16.75 ? 111  TYR B CB  1 
ATOM   3819 C CG  . TYR B 1 131 ? -8.768  51.919  24.163 1.00 17.95 ? 111  TYR B CG  1 
ATOM   3820 C CD1 . TYR B 1 131 ? -9.933  51.182  23.888 1.00 17.69 ? 111  TYR B CD1 1 
ATOM   3821 C CD2 . TYR B 1 131 ? -8.135  51.756  25.391 1.00 19.49 ? 111  TYR B CD2 1 
ATOM   3822 C CE1 . TYR B 1 131 ? -10.419 50.297  24.829 1.00 18.55 ? 111  TYR B CE1 1 
ATOM   3823 C CE2 . TYR B 1 131 ? -8.565  50.889  26.297 1.00 18.22 ? 111  TYR B CE2 1 
ATOM   3824 C CZ  . TYR B 1 131 ? -9.728  50.169  26.034 1.00 20.04 ? 111  TYR B CZ  1 
ATOM   3825 O OH  . TYR B 1 131 ? -10.183 49.294  26.995 1.00 21.71 ? 111  TYR B OH  1 
ATOM   3826 N N   . GLU B 1 132 ? -10.982 54.694  24.062 1.00 17.13 ? 112  GLU B N   1 
ATOM   3827 C CA  . GLU B 1 132 ? -11.681 55.656  24.925 1.00 16.35 ? 112  GLU B CA  1 
ATOM   3828 C C   . GLU B 1 132 ? -10.980 55.889  26.301 1.00 17.91 ? 112  GLU B C   1 
ATOM   3829 O O   . GLU B 1 132 ? -10.817 57.053  26.730 1.00 18.66 ? 112  GLU B O   1 
ATOM   3830 C CB  . GLU B 1 132 ? -13.202 55.357  25.045 1.00 15.34 ? 112  GLU B CB  1 
ATOM   3831 C CG  . GLU B 1 132 ? -13.942 56.340  25.933 1.00 15.75 ? 112  GLU B CG  1 
ATOM   3832 C CD  . GLU B 1 132 ? -15.444 56.003  25.992 1.00 17.95 ? 112  GLU B CD  1 
ATOM   3833 O OE1 . GLU B 1 132 ? -15.807 54.953  25.439 1.00 19.11 ? 112  GLU B OE1 1 
ATOM   3834 O OE2 . GLU B 1 132 ? -16.201 56.786  26.579 1.00 23.01 ? 112  GLU B OE2 1 
ATOM   3835 N N   . PRO B 1 133 ? -10.552 54.805  26.991 1.00 17.13 ? 113  PRO B N   1 
ATOM   3836 C CA  . PRO B 1 133 ? -9.853  55.007  28.280 1.00 17.83 ? 113  PRO B CA  1 
ATOM   3837 C C   . PRO B 1 133 ? -8.568  55.811  28.153 1.00 18.79 ? 113  PRO B C   1 
ATOM   3838 O O   . PRO B 1 133 ? -8.177  56.495  29.117 1.00 20.26 ? 113  PRO B O   1 
ATOM   3839 C CB  . PRO B 1 133 ? -9.577  53.594  28.762 1.00 16.52 ? 113  PRO B CB  1 
ATOM   3840 C CG  . PRO B 1 133 ? -10.664 52.775  28.086 1.00 18.41 ? 113  PRO B CG  1 
ATOM   3841 C CD  . PRO B 1 133 ? -10.813 53.375  26.726 1.00 17.06 ? 113  PRO B CD  1 
ATOM   3842 N N   . SER B 1 134 ? -7.935  55.758  26.982 1.00 19.14 ? 114  SER B N   1 
ATOM   3843 C CA  . SER B 1 134 ? -6.775  56.575  26.712 1.00 18.83 ? 114  SER B CA  1 
ATOM   3844 C C   . SER B 1 134 ? -7.127  58.057  26.689 1.00 19.25 ? 114  SER B C   1 
ATOM   3845 O O   . SER B 1 134 ? -6.437  58.861  27.293 1.00 18.90 ? 114  SER B O   1 
ATOM   3846 C CB  . SER B 1 134 ? -6.128  56.193  25.387 1.00 19.28 ? 114  SER B CB  1 
ATOM   3847 O OG  . SER B 1 134 ? -5.720  54.840  25.400 1.00 18.85 ? 114  SER B OG  1 
ATOM   3848 N N   . GLN B 1 135 ? -8.221  58.406  26.011 1.00 18.32 ? 115  GLN B N   1 
ATOM   3849 C CA  . GLN B 1 135 ? -8.726  59.772  26.000 1.00 18.03 ? 115  GLN B CA  1 
ATOM   3850 C C   . GLN B 1 135 ? -9.159  60.202  27.406 1.00 17.90 ? 115  GLN B C   1 
ATOM   3851 O O   . GLN B 1 135 ? -8.792  61.301  27.844 1.00 17.35 ? 115  GLN B O   1 
ATOM   3852 C CB  . GLN B 1 135 ? -9.950  59.889  25.076 1.00 16.43 ? 115  GLN B CB  1 
ATOM   3853 C CG  . GLN B 1 135 ? -9.734  59.455  23.626 1.00 13.10 ? 115  GLN B CG  1 
ATOM   3854 C CD  . GLN B 1 135 ? -10.934 59.770  22.725 1.00 15.86 ? 115  GLN B CD  1 
ATOM   3855 O OE1 . GLN B 1 135 ? -11.659 60.675  23.003 1.00 18.40 ? 115  GLN B OE1 1 
ATOM   3856 N NE2 . GLN B 1 135 ? -11.084 59.046  21.639 1.00 14.30 ? 115  GLN B NE2 1 
ATOM   3857 N N   . ASP B 1 136 ? -9.956  59.345  28.082 1.00 18.25 ? 116  ASP B N   1 
ATOM   3858 C CA  . ASP B 1 136 ? -10.433 59.655  29.439 1.00 18.40 ? 116  ASP B CA  1 
ATOM   3859 C C   . ASP B 1 136 ? -9.316  59.846  30.423 1.00 18.00 ? 116  ASP B C   1 
ATOM   3860 O O   . ASP B 1 136 ? -9.465  60.653  31.324 1.00 17.82 ? 116  ASP B O   1 
ATOM   3861 C CB  . ASP B 1 136 ? -11.357 58.579  30.025 1.00 18.15 ? 116  ASP B CB  1 
ATOM   3862 C CG  . ASP B 1 136 ? -12.664 58.472  29.311 1.00 21.37 ? 116  ASP B CG  1 
ATOM   3863 O OD1 . ASP B 1 136 ? -13.015 59.395  28.511 1.00 22.17 ? 116  ASP B OD1 1 
ATOM   3864 O OD2 . ASP B 1 136 ? -13.331 57.447  29.570 1.00 24.59 ? 116  ASP B OD2 1 
ATOM   3865 N N   . PHE B 1 137 ? -8.204  59.129  30.275 1.00 18.59 ? 117  PHE B N   1 
ATOM   3866 C CA  . PHE B 1 137 ? -7.065  59.404  31.143 1.00 18.75 ? 117  PHE B CA  1 
ATOM   3867 C C   . PHE B 1 137 ? -6.635  60.887  30.976 1.00 19.65 ? 117  PHE B C   1 
ATOM   3868 O O   . PHE B 1 137 ? -6.376  61.594  31.969 1.00 19.45 ? 117  PHE B O   1 
ATOM   3869 C CB  . PHE B 1 137 ? -5.875  58.443  30.865 1.00 19.84 ? 117  PHE B CB  1 
ATOM   3870 C CG  . PHE B 1 137 ? -4.552  58.962  31.330 1.00 18.71 ? 117  PHE B CG  1 
ATOM   3871 C CD1 . PHE B 1 137 ? -4.219  58.920  32.678 1.00 18.50 ? 117  PHE B CD1 1 
ATOM   3872 C CD2 . PHE B 1 137 ? -3.620  59.493  30.416 1.00 18.40 ? 117  PHE B CD2 1 
ATOM   3873 C CE1 . PHE B 1 137 ? -2.974  59.407  33.132 1.00 17.53 ? 117  PHE B CE1 1 
ATOM   3874 C CE2 . PHE B 1 137 ? -2.359  59.989  30.878 1.00 21.22 ? 117  PHE B CE2 1 
ATOM   3875 C CZ  . PHE B 1 137 ? -2.050  59.932  32.237 1.00 18.69 ? 117  PHE B CZ  1 
ATOM   3876 N N   . CYS B 1 138 ? -6.531  61.343  29.730 1.00 18.47 ? 118  CYS B N   1 
ATOM   3877 C CA  . CYS B 1 138 ? -6.120  62.693  29.458 1.00 19.13 ? 118  CYS B CA  1 
ATOM   3878 C C   . CYS B 1 138 ? -7.131  63.709  29.984 1.00 20.18 ? 118  CYS B C   1 
ATOM   3879 O O   . CYS B 1 138 ? -6.761  64.700  30.633 1.00 19.04 ? 118  CYS B O   1 
ATOM   3880 C CB  . CYS B 1 138 ? -5.910  62.876  27.959 1.00 19.28 ? 118  CYS B CB  1 
ATOM   3881 S SG  . CYS B 1 138 ? -4.541  61.897  27.324 1.00 21.49 ? 118  CYS B SG  1 
ATOM   3882 N N   . SER B 1 139 ? -8.415  63.441  29.745 1.00 20.34 ? 119  SER B N   1 
ATOM   3883 C CA  . SER B 1 139 ? -9.413  64.436  30.047 1.00 21.58 ? 119  SER B CA  1 
ATOM   3884 C C   . SER B 1 139 ? -9.753  64.480  31.550 1.00 21.14 ? 119  SER B C   1 
ATOM   3885 O O   . SER B 1 139 ? -10.059 65.551  32.069 1.00 20.97 ? 119  SER B O   1 
ATOM   3886 C CB  . SER B 1 139 ? -10.658 64.262  29.168 1.00 21.80 ? 119  SER B CB  1 
ATOM   3887 O OG  . SER B 1 139 ? -11.412 63.199  29.662 1.00 24.80 ? 119  SER B OG  1 
ATOM   3888 N N   . LYS B 1 140 ? -9.689  63.343  32.236 1.00 20.87 ? 120  LYS B N   1 
ATOM   3889 C CA  . LYS B 1 140 ? -10.017 63.278  33.677 1.00 21.85 ? 120  LYS B CA  1 
ATOM   3890 C C   . LYS B 1 140 ? -8.810  63.273  34.623 1.00 21.50 ? 120  LYS B C   1 
ATOM   3891 O O   . LYS B 1 140 ? -8.913  63.737  35.756 1.00 23.28 ? 120  LYS B O   1 
ATOM   3892 C CB  . LYS B 1 140 ? -10.903 62.067  33.992 1.00 22.12 ? 120  LYS B CB  1 
ATOM   3893 C CG  . LYS B 1 140 ? -12.215 62.021  33.224 1.00 23.16 ? 120  LYS B CG  1 
ATOM   3894 C CD  . LYS B 1 140 ? -12.857 60.636  33.336 1.00 30.05 ? 120  LYS B CD  1 
ATOM   3895 C CE  . LYS B 1 140 ? -14.360 60.665  33.061 1.00 32.45 ? 120  LYS B CE  1 
ATOM   3896 N NZ  . LYS B 1 140 ? -14.734 61.764  32.116 1.00 36.14 ? 120  LYS B NZ  1 
ATOM   3897 N N   . ILE B 1 141 ? -7.669  62.752  34.199 1.00 20.60 ? 121  ILE B N   1 
ATOM   3898 C CA  . ILE B 1 141 ? -6.544  62.711  35.117 1.00 20.03 ? 121  ILE B CA  1 
ATOM   3899 C C   . ILE B 1 141 ? -5.570  63.832  34.825 1.00 20.01 ? 121  ILE B C   1 
ATOM   3900 O O   . ILE B 1 141 ? -5.299  64.646  35.707 1.00 18.90 ? 121  ILE B O   1 
ATOM   3901 C CB  . ILE B 1 141 ? -5.813  61.323  35.142 1.00 20.07 ? 121  ILE B CB  1 
ATOM   3902 C CG1 . ILE B 1 141 ? -6.797  60.161  35.492 1.00 19.65 ? 121  ILE B CG1 1 
ATOM   3903 C CG2 . ILE B 1 141 ? -4.594  61.339  36.123 1.00 20.70 ? 121  ILE B CG2 1 
ATOM   3904 C CD1 . ILE B 1 141 ? -7.592  60.280  36.831 1.00 18.45 ? 121  ILE B CD1 1 
ATOM   3905 N N   . LEU B 1 142 ? -5.059  63.889  33.592 1.00 19.53 ? 122  LEU B N   1 
ATOM   3906 C CA  . LEU B 1 142 ? -4.098  64.936  33.231 1.00 20.33 ? 122  LEU B CA  1 
ATOM   3907 C C   . LEU B 1 142 ? -4.603  66.369  33.455 1.00 20.79 ? 122  LEU B C   1 
ATOM   3908 O O   . LEU B 1 142 ? -3.834  67.237  33.857 1.00 20.21 ? 122  LEU B O   1 
ATOM   3909 C CB  . LEU B 1 142 ? -3.602  64.785  31.785 1.00 20.41 ? 122  LEU B CB  1 
ATOM   3910 C CG  . LEU B 1 142 ? -2.696  63.573  31.523 1.00 19.00 ? 122  LEU B CG  1 
ATOM   3911 C CD1 . LEU B 1 142 ? -2.357  63.483  30.037 1.00 20.57 ? 122  LEU B CD1 1 
ATOM   3912 C CD2 . LEU B 1 142 ? -1.426  63.594  32.393 1.00 22.39 ? 122  LEU B CD2 1 
ATOM   3913 N N   . SER B 1 143 ? -5.893  66.614  33.207 1.00 20.24 ? 123  SER B N   1 
ATOM   3914 C CA  . SER B 1 143 ? -6.380  67.969  33.225 1.00 21.12 ? 123  SER B CA  1 
ATOM   3915 C C   . SER B 1 143 ? -6.249  68.598  34.593 1.00 21.68 ? 123  SER B C   1 
ATOM   3916 O O   . SER B 1 143 ? -6.054  69.812  34.689 1.00 22.88 ? 123  SER B O   1 
ATOM   3917 C CB  . SER B 1 143 ? -7.846  68.028  32.805 1.00 20.65 ? 123  SER B CB  1 
ATOM   3918 O OG  . SER B 1 143 ? -8.555  67.081  33.561 1.00 22.97 ? 123  SER B OG  1 
ATOM   3919 N N   . LYS B 1 144 ? -6.381  67.798  35.652 1.00 21.23 ? 124  LYS B N   1 
ATOM   3920 C CA  . LYS B 1 144 ? -6.353  68.362  36.984 1.00 21.84 ? 124  LYS B CA  1 
ATOM   3921 C C   . LYS B 1 144 ? -4.907  68.475  37.478 1.00 21.19 ? 124  LYS B C   1 
ATOM   3922 O O   . LYS B 1 144 ? -4.663  68.978  38.563 1.00 22.13 ? 124  LYS B O   1 
ATOM   3923 C CB  . LYS B 1 144 ? -7.233  67.545  37.934 1.00 22.51 ? 124  LYS B CB  1 
ATOM   3924 C CG  . LYS B 1 144 ? -6.714  66.198  38.226 1.00 23.56 ? 124  LYS B CG  1 
ATOM   3925 C CD  . LYS B 1 144 ? -7.780  65.278  38.824 1.00 23.88 ? 124  LYS B CD  1 
ATOM   3926 C CE  . LYS B 1 144 ? -7.064  64.025  39.259 1.00 26.21 ? 124  LYS B CE  1 
ATOM   3927 N NZ  . LYS B 1 144 ? -7.895  63.064  40.050 1.00 26.03 ? 124  LYS B NZ  1 
ATOM   3928 N N   . LEU B 1 145 ? -3.964  68.012  36.671 1.00 21.15 ? 125  LEU B N   1 
ATOM   3929 C CA  . LEU B 1 145 ? -2.542  68.119  37.021 1.00 20.17 ? 125  LEU B CA  1 
ATOM   3930 C C   . LEU B 1 145 ? -1.892  69.222  36.172 1.00 21.00 ? 125  LEU B C   1 
ATOM   3931 O O   . LEU B 1 145 ? -0.658  69.333  36.101 1.00 19.56 ? 125  LEU B O   1 
ATOM   3932 C CB  . LEU B 1 145 ? -1.829  66.754  36.840 1.00 21.16 ? 125  LEU B CB  1 
ATOM   3933 C CG  . LEU B 1 145 ? -2.512  65.563  37.514 1.00 21.24 ? 125  LEU B CG  1 
ATOM   3934 C CD1 . LEU B 1 145 ? -1.880  64.248  37.033 1.00 21.65 ? 125  LEU B CD1 1 
ATOM   3935 C CD2 . LEU B 1 145 ? -2.446  65.698  39.050 1.00 19.27 ? 125  LEU B CD2 1 
ATOM   3936 N N   . GLY B 1 146 ? -2.724  70.058  35.554 1.00 20.91 ? 126  GLY B N   1 
ATOM   3937 C CA  . GLY B 1 146 ? -2.264  71.247  34.820 1.00 21.94 ? 126  GLY B CA  1 
ATOM   3938 C C   . GLY B 1 146 ? -1.740  70.931  33.438 1.00 21.97 ? 126  GLY B C   1 
ATOM   3939 O O   . GLY B 1 146 ? -0.917  71.665  32.871 1.00 22.40 ? 126  GLY B O   1 
ATOM   3940 N N   . VAL B 1 147 ? -2.208  69.821  32.904 1.00 21.09 ? 127  VAL B N   1 
ATOM   3941 C CA  . VAL B 1 147 ? -1.783  69.348  31.605 1.00 21.65 ? 127  VAL B CA  1 
ATOM   3942 C C   . VAL B 1 147 ? -3.002  69.335  30.683 1.00 21.76 ? 127  VAL B C   1 
ATOM   3943 O O   . VAL B 1 147 ? -4.015  68.709  31.004 1.00 23.77 ? 127  VAL B O   1 
ATOM   3944 C CB  . VAL B 1 147 ? -1.191  67.915  31.730 1.00 21.50 ? 127  VAL B CB  1 
ATOM   3945 C CG1 . VAL B 1 147 ? -0.900  67.329  30.365 1.00 21.36 ? 127  VAL B CG1 1 
ATOM   3946 C CG2 . VAL B 1 147 ? 0.065   67.947  32.603 1.00 20.25 ? 127  VAL B CG2 1 
ATOM   3947 N N   . THR B 1 148 ? -2.908  70.038  29.558 1.00 20.91 ? 128  THR B N   1 
ATOM   3948 C CA  . THR B 1 148 ? -4.023  70.109  28.613 1.00 20.25 ? 128  THR B CA  1 
ATOM   3949 C C   . THR B 1 148 ? -3.856  69.099  27.459 1.00 20.09 ? 128  THR B C   1 
ATOM   3950 O O   . THR B 1 148 ? -2.740  68.652  27.126 1.00 18.62 ? 128  THR B O   1 
ATOM   3951 C CB  . THR B 1 148 ? -4.157  71.502  27.996 1.00 20.92 ? 128  THR B CB  1 
ATOM   3952 O OG1 . THR B 1 148 ? -2.955  71.803  27.259 1.00 21.07 ? 128  THR B OG1 1 
ATOM   3953 C CG2 . THR B 1 148 ? -4.405  72.571  29.057 1.00 22.22 ? 128  THR B CG2 1 
ATOM   3954 N N   . THR B 1 149 ? -4.974  68.741  26.847 1.00 19.04 ? 129  THR B N   1 
ATOM   3955 C CA  . THR B 1 149 ? -4.989  67.797  25.759 1.00 19.37 ? 129  THR B CA  1 
ATOM   3956 C C   . THR B 1 149 ? -5.874  68.357  24.658 1.00 20.09 ? 129  THR B C   1 
ATOM   3957 O O   . THR B 1 149 ? -6.951  68.919  24.955 1.00 20.49 ? 129  THR B O   1 
ATOM   3958 C CB  . THR B 1 149 ? -5.647  66.499  26.214 1.00 19.38 ? 129  THR B CB  1 
ATOM   3959 O OG1 . THR B 1 149 ? -5.020  66.019  27.418 1.00 22.26 ? 129  THR B OG1 1 
ATOM   3960 C CG2 . THR B 1 149 ? -5.592  65.435  25.098 1.00 19.60 ? 129  THR B CG2 1 
ATOM   3961 N N   . SER B 1 150 ? -5.450  68.210  23.404 1.00 19.97 ? 130  SER B N   1 
ATOM   3962 C CA  . SER B 1 150 ? -6.361  68.415  22.291 1.00 20.59 ? 130  SER B CA  1 
ATOM   3963 C C   . SER B 1 150 ? -6.252  67.193  21.386 1.00 20.86 ? 130  SER B C   1 
ATOM   3964 O O   . SER B 1 150 ? -5.439  66.307  21.636 1.00 20.23 ? 130  SER B O   1 
ATOM   3965 C CB  . SER B 1 150 ? -6.072  69.719  21.539 1.00 21.11 ? 130  SER B CB  1 
ATOM   3966 O OG  . SER B 1 150 ? -4.714  69.732  21.106 1.00 22.43 ? 130  SER B OG  1 
ATOM   3967 N N   . TRP B 1 151 ? -7.104  67.151  20.365 1.00 20.72 ? 131  TRP B N   1 
ATOM   3968 C CA  . TRP B 1 151 ? -7.286  65.985  19.513 1.00 21.12 ? 131  TRP B CA  1 
ATOM   3969 C C   . TRP B 1 151 ? -7.204  66.349  18.042 1.00 21.48 ? 131  TRP B C   1 
ATOM   3970 O O   . TRP B 1 151 ? -7.458  67.499  17.665 1.00 22.21 ? 131  TRP B O   1 
ATOM   3971 C CB  . TRP B 1 151 ? -8.649  65.391  19.817 1.00 21.37 ? 131  TRP B CB  1 
ATOM   3972 C CG  . TRP B 1 151 ? -8.957  65.533  21.279 1.00 24.26 ? 131  TRP B CG  1 
ATOM   3973 C CD1 . TRP B 1 151 ? -9.494  66.636  21.934 1.00 25.96 ? 131  TRP B CD1 1 
ATOM   3974 C CD2 . TRP B 1 151 ? -8.698  64.570  22.266 1.00 22.86 ? 131  TRP B CD2 1 
ATOM   3975 N NE1 . TRP B 1 151 ? -9.581  66.375  23.290 1.00 26.37 ? 131  TRP B NE1 1 
ATOM   3976 C CE2 . TRP B 1 151 ? -9.119  65.106  23.511 1.00 25.88 ? 131  TRP B CE2 1 
ATOM   3977 C CE3 . TRP B 1 151 ? -8.162  63.279  22.229 1.00 22.80 ? 131  TRP B CE3 1 
ATOM   3978 C CZ2 . TRP B 1 151 ? -9.015  64.394  24.699 1.00 23.28 ? 131  TRP B CZ2 1 
ATOM   3979 C CZ3 . TRP B 1 151 ? -8.067  62.587  23.395 1.00 21.26 ? 131  TRP B CZ3 1 
ATOM   3980 C CH2 . TRP B 1 151 ? -8.503  63.137  24.616 1.00 25.36 ? 131  TRP B CH2 1 
ATOM   3981 N N   . PHE B 1 152 ? -6.867  65.351  17.216 1.00 21.64 ? 132  PHE B N   1 
ATOM   3982 C CA  . PHE B 1 152 ? -6.750  65.508  15.755 1.00 20.63 ? 132  PHE B CA  1 
ATOM   3983 C C   . PHE B 1 152 ? -7.388  64.351  14.967 1.00 19.81 ? 132  PHE B C   1 
ATOM   3984 O O   . PHE B 1 152 ? -7.528  63.223  15.459 1.00 17.47 ? 132  PHE B O   1 
ATOM   3985 C CB  . PHE B 1 152 ? -5.281  65.713  15.312 1.00 21.66 ? 132  PHE B CB  1 
ATOM   3986 C CG  . PHE B 1 152 ? -4.360  64.539  15.579 1.00 20.43 ? 132  PHE B CG  1 
ATOM   3987 C CD1 . PHE B 1 152 ? -4.146  63.559  14.612 1.00 20.80 ? 132  PHE B CD1 1 
ATOM   3988 C CD2 . PHE B 1 152 ? -3.707  64.408  16.805 1.00 22.66 ? 132  PHE B CD2 1 
ATOM   3989 C CE1 . PHE B 1 152 ? -3.283  62.429  14.865 1.00 21.44 ? 132  PHE B CE1 1 
ATOM   3990 C CE2 . PHE B 1 152 ? -2.819  63.327  17.050 1.00 22.53 ? 132  PHE B CE2 1 
ATOM   3991 C CZ  . PHE B 1 152 ? -2.630  62.337  16.072 1.00 22.68 ? 132  PHE B CZ  1 
ATOM   3992 N N   . ASP B 1 153 ? -7.737  64.641  13.721 1.00 19.05 ? 133  ASP B N   1 
ATOM   3993 C CA  . ASP B 1 153 ? -8.371  63.653  12.878 1.00 20.17 ? 133  ASP B CA  1 
ATOM   3994 C C   . ASP B 1 153 ? -7.261  62.737  12.426 1.00 19.80 ? 133  ASP B C   1 
ATOM   3995 O O   . ASP B 1 153 ? -6.147  63.194  12.117 1.00 19.75 ? 133  ASP B O   1 
ATOM   3996 C CB  . ASP B 1 153 ? -9.047  64.348  11.687 1.00 20.57 ? 133  ASP B CB  1 
ATOM   3997 C CG  . ASP B 1 153 ? -9.848  63.398  10.835 1.00 22.28 ? 133  ASP B CG  1 
ATOM   3998 O OD1 . ASP B 1 153 ? -11.082 63.340  11.028 1.00 27.05 ? 133  ASP B OD1 1 
ATOM   3999 O OD2 . ASP B 1 153 ? -9.273  62.730  9.968  1.00 22.29 ? 133  ASP B OD2 1 
ATOM   4000 N N   . PRO B 1 154 ? -7.527  61.431  12.418 1.00 20.17 ? 134  PRO B N   1 
ATOM   4001 C CA  . PRO B 1 154 ? -6.441  60.493  12.164 1.00 19.69 ? 134  PRO B CA  1 
ATOM   4002 C C   . PRO B 1 154 ? -5.834  60.637  10.764 1.00 19.73 ? 134  PRO B C   1 
ATOM   4003 O O   . PRO B 1 154 ? -4.668  60.260  10.568 1.00 20.31 ? 134  PRO B O   1 
ATOM   4004 C CB  . PRO B 1 154 ? -7.102  59.127  12.379 1.00 19.43 ? 134  PRO B CB  1 
ATOM   4005 C CG  . PRO B 1 154 ? -8.569  59.388  12.002 1.00 21.38 ? 134  PRO B CG  1 
ATOM   4006 C CD  . PRO B 1 154 ? -8.814  60.747  12.626 1.00 19.13 ? 134  PRO B CD  1 
ATOM   4007 N N   . LEU B 1 155 ? -6.570  61.195  9.804  1.00 18.78 ? 135  LEU B N   1 
ATOM   4008 C CA  . LEU B 1 155 ? -6.055  61.382  8.438  1.00 19.84 ? 135  LEU B CA  1 
ATOM   4009 C C   . LEU B 1 155 ? -5.466  62.781  8.190  1.00 20.75 ? 135  LEU B C   1 
ATOM   4010 O O   . LEU B 1 155 ? -5.281  63.177  7.042  1.00 20.48 ? 135  LEU B O   1 
ATOM   4011 C CB  . LEU B 1 155 ? -7.129  61.088  7.382  1.00 19.62 ? 135  LEU B CB  1 
ATOM   4012 C CG  . LEU B 1 155 ? -7.762  59.700  7.369  1.00 22.51 ? 135  LEU B CG  1 
ATOM   4013 C CD1 . LEU B 1 155 ? -8.587  59.427  6.079  1.00 23.74 ? 135  LEU B CD1 1 
ATOM   4014 C CD2 . LEU B 1 155 ? -6.727  58.604  7.592  1.00 23.40 ? 135  LEU B CD2 1 
ATOM   4015 N N   . ILE B 1 156 ? -5.153  63.507  9.267  1.00 20.96 ? 136  ILE B N   1 
ATOM   4016 C CA  . ILE B 1 156 ? -4.623  64.871  9.151  1.00 22.11 ? 136  ILE B CA  1 
ATOM   4017 C C   . ILE B 1 156 ? -3.243  64.896  8.469  1.00 22.26 ? 136  ILE B C   1 
ATOM   4018 O O   . ILE B 1 156 ? -2.871  65.876  7.817  1.00 22.13 ? 136  ILE B O   1 
ATOM   4019 C CB  . ILE B 1 156 ? -4.569  65.550  10.541 1.00 22.11 ? 136  ILE B CB  1 
ATOM   4020 C CG1 . ILE B 1 156 ? -4.458  67.080  10.435 1.00 24.22 ? 136  ILE B CG1 1 
ATOM   4021 C CG2 . ILE B 1 156 ? -3.433  64.951  11.409 1.00 24.68 ? 136  ILE B CG2 1 
ATOM   4022 C CD1 . ILE B 1 156 ? -5.612  67.762  9.681  1.00 26.58 ? 136  ILE B CD1 1 
ATOM   4023 N N   . GLY B 1 157 ? -2.491  63.812  8.610  1.00 22.37 ? 137  GLY B N   1 
ATOM   4024 C CA  . GLY B 1 157 ? -1.164  63.708  7.988  1.00 21.84 ? 137  GLY B CA  1 
ATOM   4025 C C   . GLY B 1 157 ? -0.305  64.927  8.272  1.00 21.84 ? 137  GLY B C   1 
ATOM   4026 O O   . GLY B 1 157 ? -0.186  65.341  9.433  1.00 22.03 ? 137  GLY B O   1 
ATOM   4027 N N   . ALA B 1 158 ? 0.272   65.522  7.227  1.00 21.61 ? 138  ALA B N   1 
ATOM   4028 C CA  . ALA B 1 158 ? 1.264   66.604  7.393  1.00 21.95 ? 138  ALA B CA  1 
ATOM   4029 C C   . ALA B 1 158 ? 0.646   67.873  7.967  1.00 22.62 ? 138  ALA B C   1 
ATOM   4030 O O   . ALA B 1 158 ? 1.339   68.714  8.546  1.00 22.78 ? 138  ALA B O   1 
ATOM   4031 C CB  . ALA B 1 158 ? 1.973   66.900  6.074  1.00 22.09 ? 138  ALA B CB  1 
ATOM   4032 N N   . ASP B 1 159 ? -0.673  67.995  7.847  1.00 22.07 ? 139  ASP B N   1 
ATOM   4033 C CA  . ASP B 1 159 ? -1.381  69.138  8.396  1.00 22.51 ? 139  ASP B CA  1 
ATOM   4034 C C   . ASP B 1 159 ? -1.490  69.114  9.906  1.00 22.15 ? 139  ASP B C   1 
ATOM   4035 O O   . ASP B 1 159 ? -2.087  70.042  10.457 1.00 22.66 ? 139  ASP B O   1 
ATOM   4036 C CB  . ASP B 1 159 ? -2.793  69.233  7.830  1.00 22.90 ? 139  ASP B CB  1 
ATOM   4037 C CG  . ASP B 1 159 ? -2.830  69.847  6.443  1.00 26.70 ? 139  ASP B CG  1 
ATOM   4038 O OD1 . ASP B 1 159 ? -1.975  70.716  6.134  1.00 29.83 ? 139  ASP B OD1 1 
ATOM   4039 O OD2 . ASP B 1 159 ? -3.711  69.437  5.670  1.00 27.33 ? 139  ASP B OD2 1 
ATOM   4040 N N   . ILE B 1 160 ? -0.964  68.067  10.567 1.00 21.02 ? 140  ILE B N   1 
ATOM   4041 C CA  . ILE B 1 160 ? -0.831  68.037  12.050 1.00 21.38 ? 140  ILE B CA  1 
ATOM   4042 C C   . ILE B 1 160 ? -0.125  69.291  12.640 1.00 21.98 ? 140  ILE B C   1 
ATOM   4043 O O   . ILE B 1 160 ? -0.347  69.650  13.814 1.00 21.73 ? 140  ILE B O   1 
ATOM   4044 C CB  . ILE B 1 160 ? -0.098  66.735  12.580 1.00 21.24 ? 140  ILE B CB  1 
ATOM   4045 C CG1 . ILE B 1 160 ? -0.391  66.506  14.082 1.00 19.36 ? 140  ILE B CG1 1 
ATOM   4046 C CG2 . ILE B 1 160 ? 1.428   66.773  12.322 1.00 21.52 ? 140  ILE B CG2 1 
ATOM   4047 C CD1 . ILE B 1 160 ? -0.159  65.104  14.548 1.00 19.36 ? 140  ILE B CD1 1 
ATOM   4048 N N   . VAL B 1 161 ? 0.734   69.924  11.836 1.00 22.65 ? 141  VAL B N   1 
ATOM   4049 C CA  . VAL B 1 161 ? 1.423   71.171  12.234 1.00 23.81 ? 141  VAL B CA  1 
ATOM   4050 C C   . VAL B 1 161 ? 0.438   72.188  12.799 1.00 24.38 ? 141  VAL B C   1 
ATOM   4051 O O   . VAL B 1 161 ? 0.751   72.908  13.755 1.00 25.33 ? 141  VAL B O   1 
ATOM   4052 C CB  . VAL B 1 161 ? 2.217   71.817  11.062 1.00 24.30 ? 141  VAL B CB  1 
ATOM   4053 C CG1 . VAL B 1 161 ? 3.491   71.032  10.788 1.00 25.73 ? 141  VAL B CG1 1 
ATOM   4054 C CG2 . VAL B 1 161 ? 1.395   71.891  9.794  1.00 25.17 ? 141  VAL B CG2 1 
ATOM   4055 N N   . LYS B 1 162 ? -0.766  72.215  12.223 1.00 24.97 ? 142  LYS B N   1 
ATOM   4056 C CA  . LYS B 1 162 ? -1.818  73.144  12.628 1.00 26.05 ? 142  LYS B CA  1 
ATOM   4057 C C   . LYS B 1 162 ? -2.246  72.971  14.089 1.00 25.90 ? 142  LYS B C   1 
ATOM   4058 O O   . LYS B 1 162 ? -2.739  73.924  14.695 1.00 24.92 ? 142  LYS B O   1 
ATOM   4059 C CB  . LYS B 1 162 ? -3.031  73.010  11.692 1.00 26.24 ? 142  LYS B CB  1 
ATOM   4060 C CG  . LYS B 1 162 ? -2.751  73.430  10.229 1.00 30.37 ? 142  LYS B CG  1 
ATOM   4061 C CD  . LYS B 1 162 ? -4.014  73.213  9.348  1.00 33.92 ? 142  LYS B CD  1 
ATOM   4062 C CE  . LYS B 1 162 ? -3.881  73.820  7.935  1.00 36.83 ? 142  LYS B CE  1 
ATOM   4063 N NZ  . LYS B 1 162 ? -4.954  73.315  7.016  1.00 37.03 ? 142  LYS B NZ  1 
ATOM   4064 N N   . HIS B 1 163 ? -2.013  71.777  14.655 1.00 25.84 ? 143  HIS B N   1 
ATOM   4065 C CA  . HIS B 1 163 ? -2.451  71.441  16.015 1.00 26.68 ? 143  HIS B CA  1 
ATOM   4066 C C   . HIS B 1 163 ? -1.334  71.463  17.058 1.00 26.14 ? 143  HIS B C   1 
ATOM   4067 O O   . HIS B 1 163 ? -1.582  71.206  18.235 1.00 27.06 ? 143  HIS B O   1 
ATOM   4068 C CB  . HIS B 1 163 ? -3.100  70.049  16.052 1.00 26.46 ? 143  HIS B CB  1 
ATOM   4069 C CG  . HIS B 1 163 ? -4.371  69.951  15.268 1.00 29.92 ? 143  HIS B CG  1 
ATOM   4070 N ND1 . HIS B 1 163 ? -4.413  69.444  13.989 1.00 32.19 ? 143  HIS B ND1 1 
ATOM   4071 C CD2 . HIS B 1 163 ? -5.645  70.303  15.578 1.00 30.33 ? 143  HIS B CD2 1 
ATOM   4072 C CE1 . HIS B 1 163 ? -5.658  69.480  13.545 1.00 34.58 ? 143  HIS B CE1 1 
ATOM   4073 N NE2 . HIS B 1 163 ? -6.426  69.991  14.492 1.00 31.69 ? 143  HIS B NE2 1 
ATOM   4074 N N   . LEU B 1 164 ? -0.110  71.714  16.625 1.00 25.57 ? 144  LEU B N   1 
ATOM   4075 C CA  . LEU B 1 164 ? 1.018   71.777  17.550 1.00 26.05 ? 144  LEU B CA  1 
ATOM   4076 C C   . LEU B 1 164 ? 1.041   73.103  18.296 1.00 26.30 ? 144  LEU B C   1 
ATOM   4077 O O   . LEU B 1 164 ? 0.727   74.150  17.736 1.00 27.58 ? 144  LEU B O   1 
ATOM   4078 C CB  . LEU B 1 164 ? 2.357   71.544  16.829 1.00 24.66 ? 144  LEU B CB  1 
ATOM   4079 C CG  . LEU B 1 164 ? 2.546   70.140  16.230 1.00 26.46 ? 144  LEU B CG  1 
ATOM   4080 C CD1 . LEU B 1 164 ? 3.728   70.114  15.294 1.00 26.30 ? 144  LEU B CD1 1 
ATOM   4081 C CD2 . LEU B 1 164 ? 2.678   69.025  17.284 1.00 24.78 ? 144  LEU B CD2 1 
ATOM   4082 N N   . GLN B 1 165 ? 1.413   73.035  19.562 1.00 26.56 ? 145  GLN B N   1 
ATOM   4083 C CA  . GLN B 1 165 ? 1.602   74.200  20.390 1.00 26.11 ? 145  GLN B CA  1 
ATOM   4084 C C   . GLN B 1 165 ? 3.048   74.297  20.844 1.00 25.95 ? 145  GLN B C   1 
ATOM   4085 O O   . GLN B 1 165 ? 3.793   73.292  20.787 1.00 24.85 ? 145  GLN B O   1 
ATOM   4086 C CB  . GLN B 1 165 ? 0.686   74.107  21.595 1.00 25.97 ? 145  GLN B CB  1 
ATOM   4087 C CG  . GLN B 1 165 ? -0.764  74.113  21.214 1.00 28.20 ? 145  GLN B CG  1 
ATOM   4088 C CD  . GLN B 1 165 ? -1.662  73.982  22.412 1.00 31.12 ? 145  GLN B CD  1 
ATOM   4089 O OE1 . GLN B 1 165 ? -2.839  73.649  22.268 1.00 33.31 ? 145  GLN B OE1 1 
ATOM   4090 N NE2 . GLN B 1 165 ? -1.119  74.236  23.613 1.00 31.97 ? 145  GLN B NE2 1 
ATOM   4091 N N   . PRO B 1 166 ? 3.461   75.510  21.288 1.00 25.72 ? 146  PRO B N   1 
ATOM   4092 C CA  . PRO B 1 166 ? 4.772   75.680  21.889 1.00 25.57 ? 146  PRO B CA  1 
ATOM   4093 C C   . PRO B 1 166 ? 5.013   74.660  22.992 1.00 24.42 ? 146  PRO B C   1 
ATOM   4094 O O   . PRO B 1 166 ? 6.128   74.150  23.095 1.00 25.72 ? 146  PRO B O   1 
ATOM   4095 C CB  . PRO B 1 166 ? 4.712   77.110  22.480 1.00 25.18 ? 146  PRO B CB  1 
ATOM   4096 C CG  . PRO B 1 166 ? 3.797   77.821  21.630 1.00 25.77 ? 146  PRO B CG  1 
ATOM   4097 C CD  . PRO B 1 166 ? 2.732   76.796  21.233 1.00 26.10 ? 146  PRO B CD  1 
ATOM   4098 N N   . ASN B 1 167 ? 3.970   74.345  23.777 1.00 23.91 ? 147  ASN B N   1 
ATOM   4099 C CA  . ASN B 1 167 ? 4.091   73.439  24.935 1.00 22.37 ? 147  ASN B CA  1 
ATOM   4100 C C   . ASN B 1 167 ? 3.737   71.961  24.679 1.00 21.54 ? 147  ASN B C   1 
ATOM   4101 O O   . ASN B 1 167 ? 3.684   71.162  25.623 1.00 20.17 ? 147  ASN B O   1 
ATOM   4102 C CB  . ASN B 1 167 ? 3.293   73.961  26.143 1.00 21.92 ? 147  ASN B CB  1 
ATOM   4103 C CG  . ASN B 1 167 ? 1.833   74.126  25.853 1.00 23.28 ? 147  ASN B CG  1 
ATOM   4104 O OD1 . ASN B 1 167 ? 1.423   74.239  24.683 1.00 21.90 ? 147  ASN B OD1 1 
ATOM   4105 N ND2 . ASN B 1 167 ? 1.012   74.149  26.918 1.00 23.71 ? 147  ASN B ND2 1 
ATOM   4106 N N   . THR B 1 168 ? 3.509   71.597  23.420 1.00 20.27 ? 148  THR B N   1 
ATOM   4107 C CA  . THR B 1 168 ? 3.207   70.195  23.067 1.00 20.45 ? 148  THR B CA  1 
ATOM   4108 C C   . THR B 1 168 ? 4.380   69.279  23.427 1.00 20.14 ? 148  THR B C   1 
ATOM   4109 O O   . THR B 1 168 ? 5.461   69.399  22.829 1.00 20.87 ? 148  THR B O   1 
ATOM   4110 C CB  . THR B 1 168 ? 2.820   70.029  21.547 1.00 20.36 ? 148  THR B CB  1 
ATOM   4111 O OG1 . THR B 1 168 ? 1.618   70.775  21.260 1.00 22.42 ? 148  THR B OG1 1 
ATOM   4112 C CG2 . THR B 1 168 ? 2.554   68.551  21.228 1.00 19.99 ? 148  THR B CG2 1 
ATOM   4113 N N   . LYS B 1 169 ? 4.166   68.404  24.415 1.00 19.07 ? 149  LYS B N   1 
ATOM   4114 C CA  . LYS B 1 169 ? 5.189   67.453  24.913 1.00 18.68 ? 149  LYS B CA  1 
ATOM   4115 C C   . LYS B 1 169 ? 5.012   66.067  24.285 1.00 18.34 ? 149  LYS B C   1 
ATOM   4116 O O   . LYS B 1 169 ? 5.974   65.378  23.983 1.00 17.99 ? 149  LYS B O   1 
ATOM   4117 C CB  . LYS B 1 169 ? 5.099   67.343  26.433 1.00 18.30 ? 149  LYS B CB  1 
ATOM   4118 C CG  . LYS B 1 169 ? 6.237   66.568  27.159 1.00 23.48 ? 149  LYS B CG  1 
ATOM   4119 C CD  . LYS B 1 169 ? 7.563   67.376  27.178 1.00 30.36 ? 149  LYS B CD  1 
ATOM   4120 C CE  . LYS B 1 169 ? 8.398   67.206  28.518 1.00 35.29 ? 149  LYS B CE  1 
ATOM   4121 N NZ  . LYS B 1 169 ? 7.726   67.633  29.860 1.00 34.11 ? 149  LYS B NZ  1 
ATOM   4122 N N   . ILE B 1 170 ? 3.750   65.649  24.110 1.00 17.02 ? 150  ILE B N   1 
ATOM   4123 C CA  . ILE B 1 170 ? 3.489   64.336  23.580 1.00 17.85 ? 150  ILE B CA  1 
ATOM   4124 C C   . ILE B 1 170 ? 2.568   64.405  22.377 1.00 17.83 ? 150  ILE B C   1 
ATOM   4125 O O   . ILE B 1 170 ? 1.602   65.180  22.377 1.00 17.37 ? 150  ILE B O   1 
ATOM   4126 C CB  . ILE B 1 170 ? 2.823   63.438  24.645 1.00 17.19 ? 150  ILE B CB  1 
ATOM   4127 C CG1 . ILE B 1 170 ? 3.775   63.220  25.852 1.00 19.39 ? 150  ILE B CG1 1 
ATOM   4128 C CG2 . ILE B 1 170 ? 2.352   62.105  24.004 1.00 18.82 ? 150  ILE B CG2 1 
ATOM   4129 C CD1 . ILE B 1 170 ? 3.103   62.513  26.999 1.00 18.66 ? 150  ILE B CD1 1 
ATOM   4130 N N   . VAL B 1 171 ? 2.880   63.626  21.353 1.00 17.11 ? 151  VAL B N   1 
ATOM   4131 C CA  . VAL B 1 171 ? 1.916   63.404  20.278 1.00 17.46 ? 151  VAL B CA  1 
ATOM   4132 C C   . VAL B 1 171 ? 1.562   61.922  20.315 1.00 18.20 ? 151  VAL B C   1 
ATOM   4133 O O   . VAL B 1 171 ? 2.452   61.068  20.168 1.00 19.18 ? 151  VAL B O   1 
ATOM   4134 C CB  . VAL B 1 171 ? 2.499   63.803  18.912 1.00 17.81 ? 151  VAL B CB  1 
ATOM   4135 C CG1 . VAL B 1 171 ? 1.555   63.372  17.773 1.00 14.25 ? 151  VAL B CG1 1 
ATOM   4136 C CG2 . VAL B 1 171 ? 2.717   65.359  18.859 1.00 15.77 ? 151  VAL B CG2 1 
ATOM   4137 N N   . PHE B 1 172 ? 0.266   61.621  20.498 1.00 18.39 ? 152  PHE B N   1 
ATOM   4138 C CA  . PHE B 1 172 ? -0.167  60.238  20.745 1.00 18.57 ? 152  PHE B CA  1 
ATOM   4139 C C   . PHE B 1 172 ? -0.927  59.661  19.562 1.00 18.21 ? 152  PHE B C   1 
ATOM   4140 O O   . PHE B 1 172 ? -1.973  60.181  19.202 1.00 19.24 ? 152  PHE B O   1 
ATOM   4141 C CB  . PHE B 1 172 ? -1.002  60.127  22.036 1.00 18.06 ? 152  PHE B CB  1 
ATOM   4142 C CG  . PHE B 1 172 ? -1.221  58.672  22.504 1.00 17.84 ? 152  PHE B CG  1 
ATOM   4143 C CD1 . PHE B 1 172 ? -2.206  57.855  21.926 1.00 17.76 ? 152  PHE B CD1 1 
ATOM   4144 C CD2 . PHE B 1 172 ? -0.427  58.136  23.525 1.00 19.23 ? 152  PHE B CD2 1 
ATOM   4145 C CE1 . PHE B 1 172 ? -2.386  56.536  22.363 1.00 17.22 ? 152  PHE B CE1 1 
ATOM   4146 C CE2 . PHE B 1 172 ? -0.608  56.814  23.966 1.00 17.13 ? 152  PHE B CE2 1 
ATOM   4147 C CZ  . PHE B 1 172 ? -1.602  56.021  23.381 1.00 20.96 ? 152  PHE B CZ  1 
ATOM   4148 N N   . LEU B 1 173 ? -0.372  58.618  18.939 1.00 17.92 ? 153  LEU B N   1 
ATOM   4149 C CA  . LEU B 1 173 ? -0.954  58.016  17.732 1.00 17.07 ? 153  LEU B CA  1 
ATOM   4150 C C   . LEU B 1 173 ? -1.605  56.696  18.074 1.00 17.26 ? 153  LEU B C   1 
ATOM   4151 O O   . LEU B 1 173 ? -1.205  56.054  19.041 1.00 16.52 ? 153  LEU B O   1 
ATOM   4152 C CB  . LEU B 1 173 ? 0.165   57.716  16.714 1.00 16.28 ? 153  LEU B CB  1 
ATOM   4153 C CG  . LEU B 1 173 ? 1.062   58.878  16.293 1.00 19.42 ? 153  LEU B CG  1 
ATOM   4154 C CD1 . LEU B 1 173 ? 2.002   58.464  15.123 1.00 20.61 ? 153  LEU B CD1 1 
ATOM   4155 C CD2 . LEU B 1 173 ? 0.255   60.074  15.921 1.00 16.05 ? 153  LEU B CD2 1 
ATOM   4156 N N   . GLU B 1 174 ? -2.612  56.287  17.282 1.00 16.60 ? 154  GLU B N   1 
ATOM   4157 C CA  . GLU B 1 174 ? -3.131  54.902  17.317 1.00 16.65 ? 154  GLU B CA  1 
ATOM   4158 C C   . GLU B 1 174 ? -3.561  54.503  15.912 1.00 17.01 ? 154  GLU B C   1 
ATOM   4159 O O   . GLU B 1 174 ? -4.453  55.117  15.353 1.00 17.19 ? 154  GLU B O   1 
ATOM   4160 C CB  . GLU B 1 174 ? -4.302  54.766  18.295 1.00 16.55 ? 154  GLU B CB  1 
ATOM   4161 C CG  . GLU B 1 174 ? -4.863  53.352  18.371 1.00 16.26 ? 154  GLU B CG  1 
ATOM   4162 C CD  . GLU B 1 174 ? -5.885  53.216  19.471 1.00 18.01 ? 154  GLU B CD  1 
ATOM   4163 O OE1 . GLU B 1 174 ? -5.790  54.023  20.453 1.00 16.96 ? 154  GLU B OE1 1 
ATOM   4164 O OE2 . GLU B 1 174 ? -6.774  52.312  19.352 1.00 18.11 ? 154  GLU B OE2 1 
ATOM   4165 N N   . SER B 1 175 ? -2.887  53.519  15.322 1.00 17.29 ? 155  SER B N   1 
ATOM   4166 C CA  . SER B 1 175 ? -3.070  53.188  13.914 1.00 17.68 ? 155  SER B CA  1 
ATOM   4167 C C   . SER B 1 175 ? -3.033  51.684  13.744 1.00 18.77 ? 155  SER B C   1 
ATOM   4168 O O   . SER B 1 175 ? -2.029  51.043  14.106 1.00 19.45 ? 155  SER B O   1 
ATOM   4169 C CB  . SER B 1 175 ? -1.963  53.823  13.047 1.00 17.48 ? 155  SER B CB  1 
ATOM   4170 O OG  . SER B 1 175 ? -2.210  53.591  11.671 1.00 17.73 ? 155  SER B OG  1 
ATOM   4171 N N   . PRO B 1 176 ? -4.112  51.091  13.202 1.00 17.94 ? 156  PRO B N   1 
ATOM   4172 C CA  . PRO B 1 176 ? -5.441  51.678  12.908 1.00 17.34 ? 156  PRO B CA  1 
ATOM   4173 C C   . PRO B 1 176 ? -6.110  52.182  14.192 1.00 17.34 ? 156  PRO B C   1 
ATOM   4174 O O   . PRO B 1 176 ? -5.729  51.751  15.275 1.00 17.04 ? 156  PRO B O   1 
ATOM   4175 C CB  . PRO B 1 176 ? -6.241  50.486  12.337 1.00 17.15 ? 156  PRO B CB  1 
ATOM   4176 C CG  . PRO B 1 176 ? -5.215  49.516  11.840 1.00 18.42 ? 156  PRO B CG  1 
ATOM   4177 C CD  . PRO B 1 176 ? -4.073  49.657  12.874 1.00 17.66 ? 156  PRO B CD  1 
ATOM   4178 N N   . GLY B 1 177 ? -7.115  53.059  14.042 1.00 16.90 ? 157  GLY B N   1 
ATOM   4179 C CA  . GLY B 1 177 ? -7.828  53.700  15.143 1.00 18.65 ? 157  GLY B CA  1 
ATOM   4180 C C   . GLY B 1 177 ? -8.741  52.686  15.819 1.00 18.31 ? 157  GLY B C   1 
ATOM   4181 O O   . GLY B 1 177 ? -9.053  51.666  15.216 1.00 19.66 ? 157  GLY B O   1 
ATOM   4182 N N   . SER B 1 178 ? -9.115  52.940  17.080 1.00 17.49 ? 158  SER B N   1 
ATOM   4183 C CA  . SER B 1 178 ? -10.011 52.048  17.808 1.00 18.07 ? 158  SER B CA  1 
ATOM   4184 C C   . SER B 1 178 ? -11.342 52.121  17.126 1.00 18.10 ? 158  SER B C   1 
ATOM   4185 O O   . SER B 1 178 ? -11.768 53.213  16.745 1.00 18.76 ? 158  SER B O   1 
ATOM   4186 C CB  . SER B 1 178 ? -10.211 52.489  19.268 1.00 17.78 ? 158  SER B CB  1 
ATOM   4187 O OG  . SER B 1 178 ? -9.141  52.013  20.092 1.00 17.95 ? 158  SER B OG  1 
ATOM   4188 N N   . ILE B 1 179 ? -11.976 50.960  16.969 1.00 18.72 ? 159  ILE B N   1 
ATOM   4189 C CA  . ILE B 1 179 ? -13.359 50.811  16.459 1.00 18.60 ? 159  ILE B CA  1 
ATOM   4190 C C   . ILE B 1 179 ? -13.577 51.128  14.955 1.00 18.58 ? 159  ILE B C   1 
ATOM   4191 O O   . ILE B 1 179 ? -14.118 50.300  14.203 1.00 17.77 ? 159  ILE B O   1 
ATOM   4192 C CB  . ILE B 1 179 ? -14.404 51.555  17.370 1.00 19.01 ? 159  ILE B CB  1 
ATOM   4193 C CG1 . ILE B 1 179 ? -14.199 51.151  18.843 1.00 17.66 ? 159  ILE B CG1 1 
ATOM   4194 C CG2 . ILE B 1 179 ? -15.843 51.242  16.941 1.00 20.71 ? 159  ILE B CG2 1 
ATOM   4195 C CD1 . ILE B 1 179 ? -15.075 51.899  19.867 1.00 20.49 ? 159  ILE B CD1 1 
ATOM   4196 N N   . THR B 1 180 ? -13.187 52.326  14.549 1.00 18.55 ? 160  THR B N   1 
ATOM   4197 C CA  . THR B 1 180 ? -13.444 52.830  13.195 1.00 18.79 ? 160  THR B CA  1 
ATOM   4198 C C   . THR B 1 180 ? -12.271 52.537  12.234 1.00 19.13 ? 160  THR B C   1 
ATOM   4199 O O   . THR B 1 180 ? -12.402 52.696  11.021 1.00 18.96 ? 160  THR B O   1 
ATOM   4200 C CB  . THR B 1 180 ? -13.733 54.339  13.239 1.00 19.18 ? 160  THR B CB  1 
ATOM   4201 O OG1 . THR B 1 180 ? -12.757 55.013  14.082 1.00 17.23 ? 160  THR B OG1 1 
ATOM   4202 C CG2 . THR B 1 180 ? -15.157 54.588  13.740 1.00 19.31 ? 160  THR B CG2 1 
ATOM   4203 N N   . MET B 1 181 ? -11.133 52.134  12.799 1.00 18.17 ? 161  MET B N   1 
ATOM   4204 C CA  . MET B 1 181 ? -9.998  51.537  12.044 1.00 18.44 ? 161  MET B CA  1 
ATOM   4205 C C   . MET B 1 181 ? -9.241  52.442  11.051 1.00 18.79 ? 161  MET B C   1 
ATOM   4206 O O   . MET B 1 181 ? -8.612  51.914  10.131 1.00 19.99 ? 161  MET B O   1 
ATOM   4207 C CB  . MET B 1 181 ? -10.443 50.267  11.261 1.00 18.44 ? 161  MET B CB  1 
ATOM   4208 C CG  . MET B 1 181 ? -11.396 49.327  11.975 1.00 19.11 ? 161  MET B CG  1 
ATOM   4209 S SD  . MET B 1 181 ? -10.859 48.789  13.609 1.00 18.68 ? 161  MET B SD  1 
ATOM   4210 C CE  . MET B 1 181 ? -9.240  48.155  13.308 1.00 13.63 ? 161  MET B CE  1 
ATOM   4211 N N   . GLU B 1 182 ? -9.209  53.765  11.250 1.00 19.25 ? 162  GLU B N   1 
ATOM   4212 C CA  . GLU B 1 182 ? -8.514  54.646  10.289 1.00 18.15 ? 162  GLU B CA  1 
ATOM   4213 C C   . GLU B 1 182 ? -7.020  54.459  10.449 1.00 17.98 ? 162  GLU B C   1 
ATOM   4214 O O   . GLU B 1 182 ? -6.529  54.457  11.576 1.00 17.88 ? 162  GLU B O   1 
ATOM   4215 C CB  . GLU B 1 182 ? -8.881  56.132  10.484 1.00 17.54 ? 162  GLU B CB  1 
ATOM   4216 C CG  . GLU B 1 182 ? -10.400 56.449  10.281 1.00 18.30 ? 162  GLU B CG  1 
ATOM   4217 C CD  . GLU B 1 182 ? -11.194 56.335  11.562 1.00 20.48 ? 162  GLU B CD  1 
ATOM   4218 O OE1 . GLU B 1 182 ? -10.795 55.503  12.419 1.00 18.69 ? 162  GLU B OE1 1 
ATOM   4219 O OE2 . GLU B 1 182 ? -12.238 57.045  11.690 1.00 18.59 ? 162  GLU B OE2 1 
ATOM   4220 N N   . VAL B 1 183 ? -6.302  54.293  9.341  1.00 18.00 ? 163  VAL B N   1 
ATOM   4221 C CA  . VAL B 1 183 ? -4.825  54.200  9.410  1.00 18.41 ? 163  VAL B CA  1 
ATOM   4222 C C   . VAL B 1 183 ? -4.175  55.595  9.254  1.00 19.31 ? 163  VAL B C   1 
ATOM   4223 O O   . VAL B 1 183 ? -4.515  56.323  8.312  1.00 19.37 ? 163  VAL B O   1 
ATOM   4224 C CB  . VAL B 1 183 ? -4.271  53.175  8.368  1.00 18.50 ? 163  VAL B CB  1 
ATOM   4225 C CG1 . VAL B 1 183 ? -2.736  53.069  8.433  1.00 19.83 ? 163  VAL B CG1 1 
ATOM   4226 C CG2 . VAL B 1 183 ? -4.872  51.798  8.639  1.00 20.94 ? 163  VAL B CG2 1 
ATOM   4227 N N   . HIS B 1 184 ? -3.222  55.934  10.143 1.00 18.64 ? 164  HIS B N   1 
ATOM   4228 C CA  . HIS B 1 184 ? -2.451  57.161  10.069 1.00 19.04 ? 164  HIS B CA  1 
ATOM   4229 C C   . HIS B 1 184 ? -1.473  57.100  8.882  1.00 19.68 ? 164  HIS B C   1 
ATOM   4230 O O   . HIS B 1 184 ? -0.977  56.019  8.505  1.00 19.36 ? 164  HIS B O   1 
ATOM   4231 C CB  . HIS B 1 184 ? -1.581  57.339  11.340 1.00 19.27 ? 164  HIS B CB  1 
ATOM   4232 C CG  . HIS B 1 184 ? -2.326  57.710  12.589 1.00 17.88 ? 164  HIS B CG  1 
ATOM   4233 N ND1 . HIS B 1 184 ? -3.418  58.556  12.602 1.00 18.31 ? 164  HIS B ND1 1 
ATOM   4234 C CD2 . HIS B 1 184 ? -2.107  57.363  13.888 1.00 16.81 ? 164  HIS B CD2 1 
ATOM   4235 C CE1 . HIS B 1 184 ? -3.835  58.715  13.852 1.00 19.53 ? 164  HIS B CE1 1 
ATOM   4236 N NE2 . HIS B 1 184 ? -3.067  57.991  14.651 1.00 19.17 ? 164  HIS B NE2 1 
ATOM   4237 N N   . ASP B 1 185 ? -1.185  58.264  8.314  1.00 19.44 ? 165  ASP B N   1 
ATOM   4238 C CA  . ASP B 1 185 ? 0.007   58.420  7.490  1.00 20.38 ? 165  ASP B CA  1 
ATOM   4239 C C   . ASP B 1 185 ? 1.115   58.797  8.472  1.00 19.79 ? 165  ASP B C   1 
ATOM   4240 O O   . ASP B 1 185 ? 1.446   59.992  8.622  1.00 20.24 ? 165  ASP B O   1 
ATOM   4241 C CB  . ASP B 1 185 ? -0.212  59.515  6.459  1.00 20.01 ? 165  ASP B CB  1 
ATOM   4242 C CG  . ASP B 1 185 ? 0.939   59.661  5.477  1.00 22.80 ? 165  ASP B CG  1 
ATOM   4243 O OD1 . ASP B 1 185 ? 2.050   59.092  5.697  1.00 20.18 ? 165  ASP B OD1 1 
ATOM   4244 O OD2 . ASP B 1 185 ? 0.716   60.402  4.503  1.00 24.03 ? 165  ASP B OD2 1 
ATOM   4245 N N   . VAL B 1 186 ? 1.671   57.772  9.136  1.00 20.28 ? 166  VAL B N   1 
ATOM   4246 C CA  . VAL B 1 186 ? 2.741   57.965  10.116 1.00 19.58 ? 166  VAL B CA  1 
ATOM   4247 C C   . VAL B 1 186 ? 3.984   58.738  9.592  1.00 20.51 ? 166  VAL B C   1 
ATOM   4248 O O   . VAL B 1 186 ? 4.358   59.723  10.235 1.00 20.88 ? 166  VAL B O   1 
ATOM   4249 C CB  . VAL B 1 186 ? 3.129   56.664  10.892 1.00 20.23 ? 166  VAL B CB  1 
ATOM   4250 C CG1 . VAL B 1 186 ? 4.383   56.916  11.741 1.00 18.81 ? 166  VAL B CG1 1 
ATOM   4251 C CG2 . VAL B 1 186 ? 2.012   56.228  11.809 1.00 17.88 ? 166  VAL B CG2 1 
ATOM   4252 N N   . PRO B 1 187 ? 4.601   58.319  8.438  1.00 20.66 ? 167  PRO B N   1 
ATOM   4253 C CA  . PRO B 1 187 ? 5.698   59.109  7.850  1.00 21.31 ? 167  PRO B CA  1 
ATOM   4254 C C   . PRO B 1 187 ? 5.439   60.626  7.770  1.00 21.00 ? 167  PRO B C   1 
ATOM   4255 O O   . PRO B 1 187 ? 6.309   61.409  8.167  1.00 21.21 ? 167  PRO B O   1 
ATOM   4256 C CB  . PRO B 1 187 ? 5.885   58.478  6.457  1.00 21.26 ? 167  PRO B CB  1 
ATOM   4257 C CG  . PRO B 1 187 ? 5.477   57.070  6.644  1.00 20.70 ? 167  PRO B CG  1 
ATOM   4258 C CD  . PRO B 1 187 ? 4.368   57.082  7.666  1.00 21.26 ? 167  PRO B CD  1 
ATOM   4259 N N   . ALA B 1 188 ? 4.246   61.025  7.305  1.00 21.41 ? 168  ALA B N   1 
ATOM   4260 C CA  . ALA B 1 188 ? 3.886   62.446  7.135  1.00 21.36 ? 168  ALA B CA  1 
ATOM   4261 C C   . ALA B 1 188 ? 3.685   63.119  8.480  1.00 21.20 ? 168  ALA B C   1 
ATOM   4262 O O   . ALA B 1 188 ? 4.108   64.245  8.681  1.00 22.32 ? 168  ALA B O   1 
ATOM   4263 C CB  . ALA B 1 188 ? 2.587   62.568  6.311  1.00 21.08 ? 168  ALA B CB  1 
ATOM   4264 N N   . ILE B 1 189 ? 3.021   62.423  9.405  1.00 21.40 ? 169  ILE B N   1 
ATOM   4265 C CA  . ILE B 1 189 ? 2.794   62.948  10.754 1.00 21.13 ? 169  ILE B CA  1 
ATOM   4266 C C   . ILE B 1 189 ? 4.098   63.167  11.483 1.00 21.39 ? 169  ILE B C   1 
ATOM   4267 O O   . ILE B 1 189 ? 4.340   64.265  12.015 1.00 21.91 ? 169  ILE B O   1 
ATOM   4268 C CB  . ILE B 1 189 ? 1.871   62.019  11.590 1.00 20.24 ? 169  ILE B CB  1 
ATOM   4269 C CG1 . ILE B 1 189 ? 0.439   62.061  11.032 1.00 22.12 ? 169  ILE B CG1 1 
ATOM   4270 C CG2 . ILE B 1 189 ? 1.898   62.389  13.072 1.00 20.70 ? 169  ILE B CG2 1 
ATOM   4271 C CD1 . ILE B 1 189 ? -0.569  61.191  11.792 1.00 21.88 ? 169  ILE B CD1 1 
ATOM   4272 N N   . VAL B 1 190 ? 4.927   62.131  11.516 1.00 20.71 ? 170  VAL B N   1 
ATOM   4273 C CA  . VAL B 1 190 ? 6.237   62.209  12.186 1.00 20.33 ? 170  VAL B CA  1 
ATOM   4274 C C   . VAL B 1 190 ? 7.105   63.341  11.625 1.00 20.39 ? 170  VAL B C   1 
ATOM   4275 O O   . VAL B 1 190 ? 7.599   64.182  12.379 1.00 19.76 ? 170  VAL B O   1 
ATOM   4276 C CB  . VAL B 1 190 ? 7.002   60.824  12.206 1.00 20.79 ? 170  VAL B CB  1 
ATOM   4277 C CG1 . VAL B 1 190 ? 8.476   61.009  12.510 1.00 21.12 ? 170  VAL B CG1 1 
ATOM   4278 C CG2 . VAL B 1 190 ? 6.379   59.875  13.223 1.00 18.89 ? 170  VAL B CG2 1 
ATOM   4279 N N   . ALA B 1 191 ? 7.279   63.378  10.312 1.00 21.15 ? 171  ALA B N   1 
ATOM   4280 C CA  . ALA B 1 191 ? 8.027   64.464  9.673  1.00 21.30 ? 171  ALA B CA  1 
ATOM   4281 C C   . ALA B 1 191 ? 7.490   65.843  10.037 1.00 21.54 ? 171  ALA B C   1 
ATOM   4282 O O   . ALA B 1 191 ? 8.265   66.765  10.272 1.00 22.60 ? 171  ALA B O   1 
ATOM   4283 C CB  . ALA B 1 191 ? 8.066   64.286  8.158  1.00 20.58 ? 171  ALA B CB  1 
ATOM   4284 N N   . ALA B 1 192 ? 6.170   65.983  10.128 1.00 22.67 ? 172  ALA B N   1 
ATOM   4285 C CA  . ALA B 1 192 ? 5.565   67.272  10.452 1.00 22.48 ? 172  ALA B CA  1 
ATOM   4286 C C   . ALA B 1 192 ? 5.844   67.710  11.881 1.00 22.20 ? 172  ALA B C   1 
ATOM   4287 O O   . ALA B 1 192 ? 6.178   68.885  12.141 1.00 21.07 ? 172  ALA B O   1 
ATOM   4288 C CB  . ALA B 1 192 ? 4.053   67.256  10.155 1.00 23.10 ? 172  ALA B CB  1 
ATOM   4289 N N   . VAL B 1 193 ? 5.707   66.760  12.807 1.00 21.45 ? 173  VAL B N   1 
ATOM   4290 C CA  . VAL B 1 193 ? 5.965   66.987  14.222 1.00 21.48 ? 173  VAL B CA  1 
ATOM   4291 C C   . VAL B 1 193 ? 7.431   67.370  14.440 1.00 21.79 ? 173  VAL B C   1 
ATOM   4292 O O   . VAL B 1 193 ? 7.693   68.365  15.121 1.00 21.90 ? 173  VAL B O   1 
ATOM   4293 C CB  . VAL B 1 193 ? 5.597   65.734  15.129 1.00 20.73 ? 173  VAL B CB  1 
ATOM   4294 C CG1 . VAL B 1 193 ? 6.149   65.912  16.564 1.00 22.15 ? 173  VAL B CG1 1 
ATOM   4295 C CG2 . VAL B 1 193 ? 4.059   65.500  15.153 1.00 19.83 ? 173  VAL B CG2 1 
ATOM   4296 N N   . ARG B 1 194 ? 8.357   66.580  13.885 1.00 21.47 ? 174  ARG B N   1 
ATOM   4297 C CA  . ARG B 1 194 ? 9.798   66.834  14.036 1.00 22.17 ? 174  ARG B CA  1 
ATOM   4298 C C   . ARG B 1 194 ? 10.200  68.203  13.466 1.00 22.62 ? 174  ARG B C   1 
ATOM   4299 O O   . ARG B 1 194 ? 11.176  68.784  13.921 1.00 23.03 ? 174  ARG B O   1 
ATOM   4300 C CB  . ARG B 1 194 ? 10.666  65.754  13.347 1.00 21.47 ? 174  ARG B CB  1 
ATOM   4301 C CG  . ARG B 1 194 ? 10.616  64.303  13.952 1.00 22.50 ? 174  ARG B CG  1 
ATOM   4302 C CD  . ARG B 1 194 ? 10.907  64.285  15.460 1.00 20.38 ? 174  ARG B CD  1 
ATOM   4303 N NE  . ARG B 1 194 ? 10.707  62.957  16.040 1.00 18.93 ? 174  ARG B NE  1 
ATOM   4304 C CZ  . ARG B 1 194 ? 10.469  62.728  17.328 1.00 16.41 ? 174  ARG B CZ  1 
ATOM   4305 N NH1 . ARG B 1 194 ? 10.402  63.741  18.168 1.00 19.83 ? 174  ARG B NH1 1 
ATOM   4306 N NH2 . ARG B 1 194 ? 10.296  61.481  17.770 1.00 18.00 ? 174  ARG B NH2 1 
ATOM   4307 N N   . SER B 1 195 ? 9.474   68.689  12.452 1.00 23.54 ? 175  SER B N   1 
ATOM   4308 C CA  . SER B 1 195 ? 9.803   69.982  11.808 1.00 23.57 ? 175  SER B CA  1 
ATOM   4309 C C   . SER B 1 195 ? 9.510   71.181  12.718 1.00 24.40 ? 175  SER B C   1 
ATOM   4310 O O   . SER B 1 195 ? 10.061  72.267  12.507 1.00 25.44 ? 175  SER B O   1 
ATOM   4311 C CB  . SER B 1 195 ? 9.135   70.135  10.428 1.00 22.79 ? 175  SER B CB  1 
ATOM   4312 O OG  . SER B 1 195 ? 7.749   70.448  10.531 1.00 22.29 ? 175  SER B OG  1 
ATOM   4313 N N   . VAL B 1 196 ? 8.661   70.981  13.732 1.00 25.06 ? 176  VAL B N   1 
ATOM   4314 C CA  . VAL B 1 196 ? 8.131   72.087  14.546 1.00 25.52 ? 176  VAL B CA  1 
ATOM   4315 C C   . VAL B 1 196 ? 8.506   71.917  16.018 1.00 25.18 ? 176  VAL B C   1 
ATOM   4316 O O   . VAL B 1 196 ? 8.910   72.862  16.658 1.00 24.94 ? 176  VAL B O   1 
ATOM   4317 C CB  . VAL B 1 196 ? 6.577   72.202  14.405 1.00 25.88 ? 176  VAL B CB  1 
ATOM   4318 C CG1 . VAL B 1 196 ? 6.033   73.396  15.208 1.00 27.74 ? 176  VAL B CG1 1 
ATOM   4319 C CG2 . VAL B 1 196 ? 6.149   72.295  12.938 1.00 26.86 ? 176  VAL B CG2 1 
ATOM   4320 N N   . VAL B 1 197 ? 8.358   70.700  16.548 1.00 25.54 ? 177  VAL B N   1 
ATOM   4321 C CA  . VAL B 1 197 ? 8.702   70.362  17.932 1.00 25.23 ? 177  VAL B CA  1 
ATOM   4322 C C   . VAL B 1 197 ? 9.563   69.073  17.888 1.00 24.80 ? 177  VAL B C   1 
ATOM   4323 O O   . VAL B 1 197 ? 9.108   67.980  18.261 1.00 23.84 ? 177  VAL B O   1 
ATOM   4324 C CB  . VAL B 1 197 ? 7.396   70.179  18.824 1.00 25.74 ? 177  VAL B CB  1 
ATOM   4325 C CG1 . VAL B 1 197 ? 7.708   69.974  20.303 1.00 24.93 ? 177  VAL B CG1 1 
ATOM   4326 C CG2 . VAL B 1 197 ? 6.439   71.373  18.695 1.00 26.23 ? 177  VAL B CG2 1 
ATOM   4327 N N   . PRO B 1 198 ? 10.818  69.184  17.387 1.00 24.73 ? 178  PRO B N   1 
ATOM   4328 C CA  . PRO B 1 198 ? 11.609  67.969  17.226 1.00 24.17 ? 178  PRO B CA  1 
ATOM   4329 C C   . PRO B 1 198 ? 11.787  67.183  18.514 1.00 23.64 ? 178  PRO B C   1 
ATOM   4330 O O   . PRO B 1 198 ? 11.976  65.976  18.424 1.00 24.81 ? 178  PRO B O   1 
ATOM   4331 C CB  . PRO B 1 198 ? 12.974  68.485  16.716 1.00 24.19 ? 178  PRO B CB  1 
ATOM   4332 C CG  . PRO B 1 198 ? 12.961  69.964  16.903 1.00 24.19 ? 178  PRO B CG  1 
ATOM   4333 C CD  . PRO B 1 198 ? 11.538  70.392  16.918 1.00 24.48 ? 178  PRO B CD  1 
ATOM   4334 N N   . ASP B 1 199 ? 11.731  67.841  19.683 1.00 23.83 ? 179  ASP B N   1 
ATOM   4335 C CA  . ASP B 1 199 ? 11.911  67.133  20.978 1.00 24.02 ? 179  ASP B CA  1 
ATOM   4336 C C   . ASP B 1 199 ? 10.628  66.588  21.607 1.00 23.78 ? 179  ASP B C   1 
ATOM   4337 O O   . ASP B 1 199 ? 10.641  66.138  22.757 1.00 24.31 ? 179  ASP B O   1 
ATOM   4338 C CB  . ASP B 1 199 ? 12.712  67.955  22.013 1.00 25.23 ? 179  ASP B CB  1 
ATOM   4339 C CG  . ASP B 1 199 ? 11.926  69.141  22.610 1.00 26.24 ? 179  ASP B CG  1 
ATOM   4340 O OD1 . ASP B 1 199 ? 10.794  69.427  22.141 1.00 28.91 ? 179  ASP B OD1 1 
ATOM   4341 O OD2 . ASP B 1 199 ? 12.458  69.783  23.566 1.00 28.83 ? 179  ASP B OD2 1 
ATOM   4342 N N   . ALA B 1 200 ? 9.521   66.620  20.861 1.00 23.45 ? 180  ALA B N   1 
ATOM   4343 C CA  . ALA B 1 200 ? 8.285   65.987  21.321 1.00 21.61 ? 180  ALA B CA  1 
ATOM   4344 C C   . ALA B 1 200 ? 8.518   64.491  21.516 1.00 20.76 ? 180  ALA B C   1 
ATOM   4345 O O   . ALA B 1 200 ? 9.417   63.893  20.887 1.00 20.22 ? 180  ALA B O   1 
ATOM   4346 C CB  . ALA B 1 200 ? 7.124   66.238  20.340 1.00 20.99 ? 180  ALA B CB  1 
ATOM   4347 N N   . ILE B 1 201 ? 7.730   63.903  22.414 1.00 19.51 ? 181  ILE B N   1 
ATOM   4348 C CA  . ILE B 1 201 ? 7.723   62.445  22.564 1.00 18.33 ? 181  ILE B CA  1 
ATOM   4349 C C   . ILE B 1 201 ? 6.577   61.878  21.736 1.00 18.31 ? 181  ILE B C   1 
ATOM   4350 O O   . ILE B 1 201 ? 5.406   62.162  22.007 1.00 18.02 ? 181  ILE B O   1 
ATOM   4351 C CB  . ILE B 1 201 ? 7.657   61.990  24.057 1.00 18.05 ? 181  ILE B CB  1 
ATOM   4352 C CG1 . ILE B 1 201 ? 8.629   62.777  24.942 1.00 19.81 ? 181  ILE B CG1 1 
ATOM   4353 C CG2 . ILE B 1 201 ? 7.888   60.492  24.150 1.00 17.30 ? 181  ILE B CG2 1 
ATOM   4354 C CD1 . ILE B 1 201 ? 10.115  62.563  24.604 1.00 19.44 ? 181  ILE B CD1 1 
ATOM   4355 N N   . ILE B 1 202 ? 6.897   61.111  20.704 1.00 17.48 ? 182  ILE B N   1 
ATOM   4356 C CA  . ILE B 1 202 ? 5.835   60.566  19.881 1.00 17.17 ? 182  ILE B CA  1 
ATOM   4357 C C   . ILE B 1 202 ? 5.631   59.123  20.311 1.00 17.29 ? 182  ILE B C   1 
ATOM   4358 O O   . ILE B 1 202 ? 6.589   58.320  20.379 1.00 17.52 ? 182  ILE B O   1 
ATOM   4359 C CB  . ILE B 1 202 ? 6.114   60.648  18.354 1.00 17.45 ? 182  ILE B CB  1 
ATOM   4360 C CG1 . ILE B 1 202 ? 6.507   62.090  17.958 1.00 18.15 ? 182  ILE B CG1 1 
ATOM   4361 C CG2 . ILE B 1 202 ? 4.883   60.095  17.517 1.00 18.85 ? 182  ILE B CG2 1 
ATOM   4362 C CD1 . ILE B 1 202 ? 6.879   62.246  16.467 1.00 17.99 ? 182  ILE B CD1 1 
ATOM   4363 N N   . MET B 1 203 ? 4.391   58.793  20.596 1.00 16.66 ? 183  MET B N   1 
ATOM   4364 C CA  . MET B 1 203 ? 4.050   57.470  21.093 1.00 17.91 ? 183  MET B CA  1 
ATOM   4365 C C   . MET B 1 203 ? 2.962   56.930  20.229 1.00 17.09 ? 183  MET B C   1 
ATOM   4366 O O   . MET B 1 203 ? 2.233   57.694  19.622 1.00 18.24 ? 183  MET B O   1 
ATOM   4367 C CB  . MET B 1 203 ? 3.516   57.521  22.521 1.00 18.24 ? 183  MET B CB  1 
ATOM   4368 C CG  . MET B 1 203 ? 4.406   58.238  23.506 1.00 18.90 ? 183  MET B CG  1 
ATOM   4369 S SD  . MET B 1 203 ? 3.661   58.137  25.160 1.00 22.69 ? 183  MET B SD  1 
ATOM   4370 C CE  . MET B 1 203 ? 4.879   59.099  26.068 1.00 20.65 ? 183  MET B CE  1 
ATOM   4371 N N   . ILE B 1 204 ? 2.876   55.612  20.177 1.00 16.28 ? 184  ILE B N   1 
ATOM   4372 C CA  . ILE B 1 204 ? 1.817   54.940  19.440 1.00 15.76 ? 184  ILE B CA  1 
ATOM   4373 C C   . ILE B 1 204 ? 1.252   53.767  20.247 1.00 14.99 ? 184  ILE B C   1 
ATOM   4374 O O   . ILE B 1 204 ? 1.989   53.027  20.909 1.00 12.89 ? 184  ILE B O   1 
ATOM   4375 C CB  . ILE B 1 204 ? 2.294   54.475  18.017 1.00 15.66 ? 184  ILE B CB  1 
ATOM   4376 C CG1 . ILE B 1 204 ? 1.040   54.034  17.186 1.00 17.27 ? 184  ILE B CG1 1 
ATOM   4377 C CG2 . ILE B 1 204 ? 3.344   53.376  18.150 1.00 16.65 ? 184  ILE B CG2 1 
ATOM   4378 C CD1 . ILE B 1 204 ? 1.259   53.868  15.659 1.00 18.16 ? 184  ILE B CD1 1 
ATOM   4379 N N   . ASP B 1 205 ? -0.065  53.630  20.261 1.00 14.75 ? 185  ASP B N   1 
ATOM   4380 C CA  . ASP B 1 205 ? -0.681  52.374  20.671 1.00 15.94 ? 185  ASP B CA  1 
ATOM   4381 C C   . ASP B 1 205 ? -0.708  51.441  19.458 1.00 16.06 ? 185  ASP B C   1 
ATOM   4382 O O   . ASP B 1 205 ? -1.588  51.542  18.555 1.00 16.53 ? 185  ASP B O   1 
ATOM   4383 C CB  . ASP B 1 205 ? -2.109  52.597  21.175 1.00 15.74 ? 185  ASP B CB  1 
ATOM   4384 C CG  . ASP B 1 205 ? -2.727  51.316  21.783 1.00 18.28 ? 185  ASP B CG  1 
ATOM   4385 O OD1 . ASP B 1 205 ? -2.379  50.173  21.349 1.00 14.61 ? 185  ASP B OD1 1 
ATOM   4386 O OD2 . ASP B 1 205 ? -3.577  51.472  22.693 1.00 16.23 ? 185  ASP B OD2 1 
ATOM   4387 N N   . ASN B 1 206 ? 0.251   50.527  19.462 1.00 16.30 ? 186  ASN B N   1 
ATOM   4388 C CA  . ASN B 1 206 ? 0.547   49.627  18.327 1.00 16.30 ? 186  ASN B CA  1 
ATOM   4389 C C   . ASN B 1 206 ? -0.035  48.194  18.524 1.00 16.53 ? 186  ASN B C   1 
ATOM   4390 O O   . ASN B 1 206 ? 0.514   47.185  18.033 1.00 15.57 ? 186  ASN B O   1 
ATOM   4391 C CB  . ASN B 1 206 ? 2.071   49.591  18.126 1.00 16.60 ? 186  ASN B CB  1 
ATOM   4392 C CG  . ASN B 1 206 ? 2.485   49.157  16.746 1.00 17.67 ? 186  ASN B CG  1 
ATOM   4393 O OD1 . ASN B 1 206 ? 3.654   48.823  16.556 1.00 20.28 ? 186  ASN B OD1 1 
ATOM   4394 N ND2 . ASN B 1 206 ? 1.578   49.213  15.761 1.00 13.10 ? 186  ASN B ND2 1 
ATOM   4395 N N   . THR B 1 207 ? -1.176  48.125  19.232 1.00 15.32 ? 187  THR B N   1 
ATOM   4396 C CA  . THR B 1 207 ? -1.739  46.826  19.655 1.00 16.14 ? 187  THR B CA  1 
ATOM   4397 C C   . THR B 1 207 ? -2.346  46.029  18.466 1.00 15.72 ? 187  THR B C   1 
ATOM   4398 O O   . THR B 1 207 ? -2.181  44.808  18.356 1.00 15.81 ? 187  THR B O   1 
ATOM   4399 C CB  . THR B 1 207 ? -2.833  46.995  20.788 1.00 15.31 ? 187  THR B CB  1 
ATOM   4400 O OG1 . THR B 1 207 ? -2.313  47.730  21.919 1.00 15.92 ? 187  THR B OG1 1 
ATOM   4401 C CG2 . THR B 1 207 ? -3.278  45.617  21.280 1.00 17.52 ? 187  THR B CG2 1 
ATOM   4402 N N   . TRP B 1 208 ? -3.060  46.715  17.571 1.00 16.37 ? 188  TRP B N   1 
ATOM   4403 C CA  . TRP B 1 208 ? -3.615  46.054  16.383 1.00 16.83 ? 188  TRP B CA  1 
ATOM   4404 C C   . TRP B 1 208 ? -2.586  45.255  15.562 1.00 16.89 ? 188  TRP B C   1 
ATOM   4405 O O   . TRP B 1 208 ? -2.868  44.137  15.143 1.00 15.82 ? 188  TRP B O   1 
ATOM   4406 C CB  . TRP B 1 208 ? -4.295  47.068  15.486 1.00 18.91 ? 188  TRP B CB  1 
ATOM   4407 C CG  . TRP B 1 208 ? -5.143  46.463  14.350 1.00 16.38 ? 188  TRP B CG  1 
ATOM   4408 C CD1 . TRP B 1 208 ? -6.469  46.078  14.407 1.00 18.42 ? 188  TRP B CD1 1 
ATOM   4409 C CD2 . TRP B 1 208 ? -4.703  46.185  13.024 1.00 17.78 ? 188  TRP B CD2 1 
ATOM   4410 N NE1 . TRP B 1 208 ? -6.863  45.592  13.187 1.00 15.05 ? 188  TRP B NE1 1 
ATOM   4411 C CE2 . TRP B 1 208 ? -5.815  45.666  12.309 1.00 18.81 ? 188  TRP B CE2 1 
ATOM   4412 C CE3 . TRP B 1 208 ? -3.481  46.348  12.355 1.00 18.54 ? 188  TRP B CE3 1 
ATOM   4413 C CZ2 . TRP B 1 208 ? -5.732  45.289  10.953 1.00 15.48 ? 188  TRP B CZ2 1 
ATOM   4414 C CZ3 . TRP B 1 208 ? -3.393  45.986  11.017 1.00 18.55 ? 188  TRP B CZ3 1 
ATOM   4415 C CH2 . TRP B 1 208 ? -4.516  45.471  10.323 1.00 16.03 ? 188  TRP B CH2 1 
ATOM   4416 N N   . ALA B 1 209 ? -1.410  45.852  15.366 1.00 16.74 ? 189  ALA B N   1 
ATOM   4417 C CA  . ALA B 1 209 ? -0.280  45.278  14.639 1.00 17.07 ? 189  ALA B CA  1 
ATOM   4418 C C   . ALA B 1 209 ? 0.547   44.247  15.440 1.00 18.14 ? 189  ALA B C   1 
ATOM   4419 O O   . ALA B 1 209 ? 1.437   43.575  14.874 1.00 17.30 ? 189  ALA B O   1 
ATOM   4420 C CB  . ALA B 1 209 ? 0.650   46.415  14.181 1.00 16.93 ? 189  ALA B CB  1 
ATOM   4421 N N   . ALA B 1 210 ? 0.235   44.138  16.736 1.00 17.23 ? 190  ALA B N   1 
ATOM   4422 C CA  . ALA B 1 210 ? 0.935   43.326  17.700 1.00 16.48 ? 190  ALA B CA  1 
ATOM   4423 C C   . ALA B 1 210 ? 2.414   43.727  17.777 1.00 16.62 ? 190  ALA B C   1 
ATOM   4424 O O   . ALA B 1 210 ? 3.228   42.892  18.061 1.00 16.81 ? 190  ALA B O   1 
ATOM   4425 C CB  . ALA B 1 210 ? 0.784   41.791  17.425 1.00 16.32 ? 190  ALA B CB  1 
ATOM   4426 N N   . GLY B 1 211 ? 2.712   44.988  17.496 1.00 17.79 ? 191  GLY B N   1 
ATOM   4427 C CA  . GLY B 1 211 ? 4.088   45.510  17.499 1.00 18.90 ? 191  GLY B CA  1 
ATOM   4428 C C   . GLY B 1 211 ? 4.932   45.015  16.327 1.00 20.32 ? 191  GLY B C   1 
ATOM   4429 O O   . GLY B 1 211 ? 6.095   45.421  16.192 1.00 21.54 ? 191  GLY B O   1 
ATOM   4430 N N   . VAL B 1 212 ? 4.401   44.121  15.497 1.00 20.00 ? 192  VAL B N   1 
ATOM   4431 C CA  . VAL B 1 212 ? 5.268   43.425  14.512 1.00 20.07 ? 192  VAL B CA  1 
ATOM   4432 C C   . VAL B 1 212 ? 4.807   43.611  13.066 1.00 20.93 ? 192  VAL B C   1 
ATOM   4433 O O   . VAL B 1 212 ? 5.615   43.536  12.134 1.00 21.23 ? 192  VAL B O   1 
ATOM   4434 C CB  . VAL B 1 212 ? 5.480   41.916  14.809 1.00 21.64 ? 192  VAL B CB  1 
ATOM   4435 C CG1 . VAL B 1 212 ? 6.085   41.692  16.183 1.00 21.40 ? 192  VAL B CG1 1 
ATOM   4436 C CG2 . VAL B 1 212 ? 4.146   41.115  14.662 1.00 19.04 ? 192  VAL B CG2 1 
ATOM   4437 N N   . LEU B 1 213 ? 3.508   43.852  12.851 1.00 18.95 ? 193  LEU B N   1 
ATOM   4438 C CA  . LEU B 1 213 ? 3.038   44.161  11.482 1.00 19.81 ? 193  LEU B CA  1 
ATOM   4439 C C   . LEU B 1 213 ? 3.309   45.619  11.059 1.00 19.90 ? 193  LEU B C   1 
ATOM   4440 O O   . LEU B 1 213 ? 3.135   46.002  9.882  1.00 21.01 ? 193  LEU B O   1 
ATOM   4441 C CB  . LEU B 1 213 ? 1.550   43.843  11.364 1.00 19.25 ? 193  LEU B CB  1 
ATOM   4442 C CG  . LEU B 1 213 ? 1.268   42.390  11.749 1.00 19.60 ? 193  LEU B CG  1 
ATOM   4443 C CD1 . LEU B 1 213 ? -0.233  42.162  11.689 1.00 18.56 ? 193  LEU B CD1 1 
ATOM   4444 C CD2 . LEU B 1 213 ? 2.028   41.432  10.818 1.00 19.76 ? 193  LEU B CD2 1 
ATOM   4445 N N   . PHE B 1 214 ? 3.685   46.424  12.042 1.00 19.06 ? 194  PHE B N   1 
ATOM   4446 C CA  . PHE B 1 214 ? 4.056   47.799  11.825 1.00 18.77 ? 194  PHE B CA  1 
ATOM   4447 C C   . PHE B 1 214 ? 5.208   48.115  12.789 1.00 19.26 ? 194  PHE B C   1 
ATOM   4448 O O   . PHE B 1 214 ? 5.007   48.124  14.017 1.00 19.52 ? 194  PHE B O   1 
ATOM   4449 C CB  . PHE B 1 214 ? 2.839   48.708  12.062 1.00 18.36 ? 194  PHE B CB  1 
ATOM   4450 C CG  . PHE B 1 214 ? 3.168   50.153  11.971 1.00 19.02 ? 194  PHE B CG  1 
ATOM   4451 C CD1 . PHE B 1 214 ? 3.414   50.737  10.732 1.00 20.48 ? 194  PHE B CD1 1 
ATOM   4452 C CD2 . PHE B 1 214 ? 3.309   50.925  13.123 1.00 18.78 ? 194  PHE B CD2 1 
ATOM   4453 C CE1 . PHE B 1 214 ? 3.741   52.079  10.619 1.00 17.97 ? 194  PHE B CE1 1 
ATOM   4454 C CE2 . PHE B 1 214 ? 3.650   52.296  13.017 1.00 19.78 ? 194  PHE B CE2 1 
ATOM   4455 C CZ  . PHE B 1 214 ? 3.872   52.858  11.740 1.00 15.55 ? 194  PHE B CZ  1 
ATOM   4456 N N   . LYS B 1 215 ? 6.408   48.345  12.249 1.00 18.12 ? 195  LYS B N   1 
ATOM   4457 C CA  . LYS B 1 215 ? 7.570   48.578  13.067 1.00 20.29 ? 195  LYS B CA  1 
ATOM   4458 C C   . LYS B 1 215 ? 7.716   50.052  13.412 1.00 19.30 ? 195  LYS B C   1 
ATOM   4459 O O   . LYS B 1 215 ? 8.506   50.788  12.814 1.00 18.48 ? 195  LYS B O   1 
ATOM   4460 C CB  . LYS B 1 215 ? 8.835   47.964  12.428 1.00 20.95 ? 195  LYS B CB  1 
ATOM   4461 C CG  . LYS B 1 215 ? 8.716   46.404  12.351 1.00 27.43 ? 195  LYS B CG  1 
ATOM   4462 C CD  . LYS B 1 215 ? 9.124   45.679  13.678 1.00 33.70 ? 195  LYS B CD  1 
ATOM   4463 C CE  . LYS B 1 215 ? 10.606  45.195  13.660 1.00 36.36 ? 195  LYS B CE  1 
ATOM   4464 N NZ  . LYS B 1 215 ? 11.664  46.158  14.209 1.00 38.02 ? 195  LYS B NZ  1 
ATOM   4465 N N   . ALA B 1 216 ? 6.990   50.427  14.470 1.00 18.68 ? 196  ALA B N   1 
ATOM   4466 C CA  . ALA B 1 216 ? 6.810   51.802  14.906 1.00 19.60 ? 196  ALA B CA  1 
ATOM   4467 C C   . ALA B 1 216 ? 8.137   52.512  15.124 1.00 19.65 ? 196  ALA B C   1 
ATOM   4468 O O   . ALA B 1 216 ? 8.305   53.670  14.730 1.00 19.06 ? 196  ALA B O   1 
ATOM   4469 C CB  . ALA B 1 216 ? 5.999   51.828  16.191 1.00 19.50 ? 196  ALA B CB  1 
ATOM   4470 N N   . LEU B 1 217 ? 9.066   51.816  15.759 1.00 19.96 ? 197  LEU B N   1 
ATOM   4471 C CA  . LEU B 1 217 ? 10.361  52.434  16.053 1.00 20.89 ? 197  LEU B CA  1 
ATOM   4472 C C   . LEU B 1 217 ? 11.218  52.736  14.814 1.00 22.36 ? 197  LEU B C   1 
ATOM   4473 O O   . LEU B 1 217 ? 12.040  53.653  14.841 1.00 22.68 ? 197  LEU B O   1 
ATOM   4474 C CB  . LEU B 1 217 ? 11.132  51.615  17.094 1.00 20.59 ? 197  LEU B CB  1 
ATOM   4475 C CG  . LEU B 1 217 ? 10.803  51.908  18.578 1.00 22.06 ? 197  LEU B CG  1 
ATOM   4476 C CD1 . LEU B 1 217 ? 9.389   52.369  18.911 1.00 24.15 ? 197  LEU B CD1 1 
ATOM   4477 C CD2 . LEU B 1 217 ? 11.178  50.764  19.488 1.00 22.87 ? 197  LEU B CD2 1 
ATOM   4478 N N   . ASP B 1 218 ? 11.017  51.991  13.735 1.00 22.57 ? 198  ASP B N   1 
ATOM   4479 C CA  . ASP B 1 218 ? 11.675  52.296  12.469 1.00 24.01 ? 198  ASP B CA  1 
ATOM   4480 C C   . ASP B 1 218 ? 11.103  53.547  11.808 1.00 24.07 ? 198  ASP B C   1 
ATOM   4481 O O   . ASP B 1 218 ? 11.682  54.064  10.852 1.00 24.17 ? 198  ASP B O   1 
ATOM   4482 C CB  . ASP B 1 218 ? 11.501  51.144  11.498 1.00 25.09 ? 198  ASP B CB  1 
ATOM   4483 C CG  . ASP B 1 218 ? 12.348  49.939  11.853 1.00 29.18 ? 198  ASP B CG  1 
ATOM   4484 O OD1 . ASP B 1 218 ? 13.127  49.991  12.827 1.00 32.54 ? 198  ASP B OD1 1 
ATOM   4485 O OD2 . ASP B 1 218 ? 12.219  48.921  11.146 1.00 34.24 ? 198  ASP B OD2 1 
ATOM   4486 N N   . PHE B 1 219 ? 9.963   54.034  12.305 1.00 22.70 ? 199  PHE B N   1 
ATOM   4487 C CA  . PHE B 1 219 ? 9.257   55.135  11.670 1.00 22.39 ? 199  PHE B CA  1 
ATOM   4488 C C   . PHE B 1 219 ? 9.534   56.454  12.384 1.00 22.80 ? 199  PHE B C   1 
ATOM   4489 O O   . PHE B 1 219 ? 8.897   57.481  12.081 1.00 23.16 ? 199  PHE B O   1 
ATOM   4490 C CB  . PHE B 1 219 ? 7.744   54.811  11.593 1.00 21.93 ? 199  PHE B CB  1 
ATOM   4491 C CG  . PHE B 1 219 ? 7.375   53.965  10.408 1.00 22.60 ? 199  PHE B CG  1 
ATOM   4492 C CD1 . PHE B 1 219 ? 7.592   52.585  10.407 1.00 24.88 ? 199  PHE B CD1 1 
ATOM   4493 C CD2 . PHE B 1 219 ? 6.876   54.550  9.243  1.00 26.10 ? 199  PHE B CD2 1 
ATOM   4494 C CE1 . PHE B 1 219 ? 7.289   51.796  9.268  1.00 24.33 ? 199  PHE B CE1 1 
ATOM   4495 C CE2 . PHE B 1 219 ? 6.555   53.766  8.110  1.00 24.44 ? 199  PHE B CE2 1 
ATOM   4496 C CZ  . PHE B 1 219 ? 6.775   52.399  8.118  1.00 23.52 ? 199  PHE B CZ  1 
ATOM   4497 N N   . GLY B 1 220 ? 10.494  56.428  13.312 1.00 22.29 ? 200  GLY B N   1 
ATOM   4498 C CA  . GLY B 1 220 ? 10.864  57.587  14.114 1.00 21.40 ? 200  GLY B CA  1 
ATOM   4499 C C   . GLY B 1 220 ? 9.914   57.880  15.279 1.00 20.81 ? 200  GLY B C   1 
ATOM   4500 O O   . GLY B 1 220 ? 9.879   59.000  15.782 1.00 19.78 ? 200  GLY B O   1 
ATOM   4501 N N   . ILE B 1 221 ? 9.144   56.874  15.704 1.00 20.46 ? 201  ILE B N   1 
ATOM   4502 C CA  . ILE B 1 221 ? 8.299   56.978  16.896 1.00 19.77 ? 201  ILE B CA  1 
ATOM   4503 C C   . ILE B 1 221 ? 9.193   56.645  18.075 1.00 20.07 ? 201  ILE B C   1 
ATOM   4504 O O   . ILE B 1 221 ? 10.122  55.810  17.941 1.00 19.66 ? 201  ILE B O   1 
ATOM   4505 C CB  . ILE B 1 221 ? 7.035   56.034  16.795 1.00 21.31 ? 201  ILE B CB  1 
ATOM   4506 C CG1 . ILE B 1 221 ? 6.124   56.496  15.638 1.00 20.42 ? 201  ILE B CG1 1 
ATOM   4507 C CG2 . ILE B 1 221 ? 6.281   55.912  18.171 1.00 18.86 ? 201  ILE B CG2 1 
ATOM   4508 C CD1 . ILE B 1 221 ? 5.038   55.467  15.205 1.00 19.93 ? 201  ILE B CD1 1 
ATOM   4509 N N   . ASP B 1 222 ? 8.973   57.332  19.197 1.00 18.38 ? 202  ASP B N   1 
ATOM   4510 C CA  . ASP B 1 222 ? 9.786   57.105  20.384 1.00 17.79 ? 202  ASP B CA  1 
ATOM   4511 C C   . ASP B 1 222 ? 9.295   55.902  21.232 1.00 16.65 ? 202  ASP B C   1 
ATOM   4512 O O   . ASP B 1 222 ? 10.114  55.230  21.829 1.00 18.60 ? 202  ASP B O   1 
ATOM   4513 C CB  . ASP B 1 222 ? 9.806   58.351  21.282 1.00 18.13 ? 202  ASP B CB  1 
ATOM   4514 C CG  . ASP B 1 222 ? 10.338  59.570  20.571 1.00 18.72 ? 202  ASP B CG  1 
ATOM   4515 O OD1 . ASP B 1 222 ? 11.548  59.584  20.380 1.00 17.47 ? 202  ASP B OD1 1 
ATOM   4516 O OD2 . ASP B 1 222 ? 9.573   60.481  20.215 1.00 18.73 ? 202  ASP B OD2 1 
ATOM   4517 N N   . VAL B 1 223 ? 7.991   55.681  21.341 1.00 16.70 ? 203  VAL B N   1 
ATOM   4518 C CA  . VAL B 1 223 ? 7.510   54.647  22.271 1.00 15.13 ? 203  VAL B CA  1 
ATOM   4519 C C   . VAL B 1 223 ? 6.372   53.872  21.581 1.00 15.43 ? 203  VAL B C   1 
ATOM   4520 O O   . VAL B 1 223 ? 5.440   54.470  21.089 1.00 16.75 ? 203  VAL B O   1 
ATOM   4521 C CB  . VAL B 1 223 ? 7.052   55.262  23.645 1.00 14.08 ? 203  VAL B CB  1 
ATOM   4522 C CG1 . VAL B 1 223 ? 6.614   54.173  24.598 1.00 14.33 ? 203  VAL B CG1 1 
ATOM   4523 C CG2 . VAL B 1 223 ? 8.162   56.176  24.295 1.00 17.33 ? 203  VAL B CG2 1 
ATOM   4524 N N   . SER B 1 224 ? 6.495   52.556  21.528 1.00 15.33 ? 204  SER B N   1 
ATOM   4525 C CA  . SER B 1 224 ? 5.476   51.703  20.931 1.00 15.41 ? 204  SER B CA  1 
ATOM   4526 C C   . SER B 1 224 ? 4.860   50.951  22.075 1.00 15.73 ? 204  SER B C   1 
ATOM   4527 O O   . SER B 1 224 ? 5.524   50.118  22.723 1.00 14.96 ? 204  SER B O   1 
ATOM   4528 C CB  . SER B 1 224 ? 6.063   50.737  19.909 1.00 16.84 ? 204  SER B CB  1 
ATOM   4529 O OG  . SER B 1 224 ? 5.087   49.796  19.472 1.00 17.73 ? 204  SER B OG  1 
ATOM   4530 N N   . ILE B 1 225 ? 3.554   51.196  22.285 1.00 14.46 ? 205  ILE B N   1 
ATOM   4531 C CA  . ILE B 1 225 ? 2.854   50.711  23.474 1.00 15.91 ? 205  ILE B CA  1 
ATOM   4532 C C   . ILE B 1 225 ? 1.894   49.596  22.972 1.00 14.47 ? 205  ILE B C   1 
ATOM   4533 O O   . ILE B 1 225 ? 1.441   49.697  21.872 1.00 13.45 ? 205  ILE B O   1 
ATOM   4534 C CB  . ILE B 1 225 ? 1.991   51.826  24.121 1.00 16.24 ? 205  ILE B CB  1 
ATOM   4535 C CG1 . ILE B 1 225 ? 2.870   52.972  24.611 1.00 15.65 ? 205  ILE B CG1 1 
ATOM   4536 C CG2 . ILE B 1 225 ? 1.128   51.266  25.232 1.00 15.00 ? 205  ILE B CG2 1 
ATOM   4537 C CD1 . ILE B 1 225 ? 2.133   54.238  24.994 1.00 15.11 ? 205  ILE B CD1 1 
ATOM   4538 N N   . GLN B 1 226 ? 1.755   48.512  23.714 1.00 14.86 ? 206  GLN B N   1 
ATOM   4539 C CA  . GLN B 1 226 ? 0.759   47.482  23.413 1.00 16.26 ? 206  GLN B CA  1 
ATOM   4540 C C   . GLN B 1 226 ? 0.002   47.027  24.638 1.00 16.43 ? 206  GLN B C   1 
ATOM   4541 O O   . GLN B 1 226 ? 0.531   46.926  25.756 1.00 15.35 ? 206  GLN B O   1 
ATOM   4542 C CB  . GLN B 1 226 ? 1.415   46.229  22.832 1.00 16.63 ? 206  GLN B CB  1 
ATOM   4543 C CG  . GLN B 1 226 ? 1.962   46.332  21.404 1.00 17.32 ? 206  GLN B CG  1 
ATOM   4544 C CD  . GLN B 1 226 ? 2.290   44.952  20.881 1.00 20.21 ? 206  GLN B CD  1 
ATOM   4545 O OE1 . GLN B 1 226 ? 1.416   44.136  20.778 1.00 22.02 ? 206  GLN B OE1 1 
ATOM   4546 N NE2 . GLN B 1 226 ? 3.572   44.687  20.563 1.00 18.27 ? 206  GLN B NE2 1 
ATOM   4547 N N   . ALA B 1 227 ? -1.281  46.774  24.423 1.00 17.57 ? 207  ALA B N   1 
ATOM   4548 C CA  . ALA B 1 227 ? -1.988  45.887  25.299 1.00 18.16 ? 207  ALA B CA  1 
ATOM   4549 C C   . ALA B 1 227 ? -1.553  44.462  24.883 1.00 17.90 ? 207  ALA B C   1 
ATOM   4550 O O   . ALA B 1 227 ? -2.049  43.895  23.911 1.00 17.97 ? 207  ALA B O   1 
ATOM   4551 C CB  . ALA B 1 227 ? -3.510  46.086  25.165 1.00 18.74 ? 207  ALA B CB  1 
ATOM   4552 N N   . ALA B 1 228 ? -0.567  43.916  25.577 1.00 16.55 ? 208  ALA B N   1 
ATOM   4553 C CA  . ALA B 1 228 ? -0.081  42.556  25.281 1.00 17.50 ? 208  ALA B CA  1 
ATOM   4554 C C   . ALA B 1 228 ? -1.163  41.528  25.524 1.00 17.53 ? 208  ALA B C   1 
ATOM   4555 O O   . ALA B 1 228 ? -1.135  40.442  24.949 1.00 17.45 ? 208  ALA B O   1 
ATOM   4556 C CB  . ALA B 1 228 ? 1.227   42.232  26.050 1.00 16.98 ? 208  ALA B CB  1 
ATOM   4557 N N   . THR B 1 229 ? -2.141  41.931  26.328 1.00 18.19 ? 209  THR B N   1 
ATOM   4558 C CA  . THR B 1 229 ? -3.434  41.258  26.529 1.00 18.07 ? 209  THR B CA  1 
ATOM   4559 C C   . THR B 1 229 ? -4.112  40.706  25.263 1.00 19.50 ? 209  THR B C   1 
ATOM   4560 O O   . THR B 1 229 ? -4.828  39.693  25.314 1.00 18.87 ? 209  THR B O   1 
ATOM   4561 C CB  . THR B 1 229 ? -4.396  42.305  27.146 1.00 19.64 ? 209  THR B CB  1 
ATOM   4562 O OG1 . THR B 1 229 ? -3.765  42.894  28.285 1.00 17.33 ? 209  THR B OG1 1 
ATOM   4563 C CG2 . THR B 1 229 ? -5.692  41.702  27.569 1.00 16.64 ? 209  THR B CG2 1 
ATOM   4564 N N   . LYS B 1 230 ? -3.946  41.427  24.158 1.00 18.94 ? 210  LYS B N   1 
ATOM   4565 C CA  . LYS B 1 230 ? -4.522  41.075  22.859 1.00 19.21 ? 210  LYS B CA  1 
ATOM   4566 C C   . LYS B 1 230 ? -3.675  39.995  22.180 1.00 19.13 ? 210  LYS B C   1 
ATOM   4567 O O   . LYS B 1 230 ? -3.508  38.901  22.729 1.00 18.80 ? 210  LYS B O   1 
ATOM   4568 C CB  . LYS B 1 230 ? -4.602  42.336  21.982 1.00 20.31 ? 210  LYS B CB  1 
ATOM   4569 C CG  . LYS B 1 230 ? -5.798  43.259  22.256 1.00 19.55 ? 210  LYS B CG  1 
ATOM   4570 C CD  . LYS B 1 230 ? -5.963  43.523  23.764 1.00 19.64 ? 210  LYS B CD  1 
ATOM   4571 C CE  . LYS B 1 230 ? -7.258  44.311  23.997 1.00 23.34 ? 210  LYS B CE  1 
ATOM   4572 N NZ  . LYS B 1 230 ? -7.709  44.202  25.424 1.00 27.23 ? 210  LYS B NZ  1 
ATOM   4573 N N   . TYR B 1 231 ? -3.157  40.268  20.996 1.00 17.74 ? 211  TYR B N   1 
ATOM   4574 C CA  . TYR B 1 231 ? -2.426  39.223  20.250 1.00 18.75 ? 211  TYR B CA  1 
ATOM   4575 C C   . TYR B 1 231 ? -1.219  38.551  20.904 1.00 17.69 ? 211  TYR B C   1 
ATOM   4576 O O   . TYR B 1 231 ? -1.027  37.378  20.687 1.00 17.43 ? 211  TYR B O   1 
ATOM   4577 C CB  . TYR B 1 231 ? -2.049  39.673  18.828 1.00 17.76 ? 211  TYR B CB  1 
ATOM   4578 C CG  . TYR B 1 231 ? -3.276  39.793  17.977 1.00 17.80 ? 211  TYR B CG  1 
ATOM   4579 C CD1 . TYR B 1 231 ? -3.982  38.673  17.594 1.00 19.52 ? 211  TYR B CD1 1 
ATOM   4580 C CD2 . TYR B 1 231 ? -3.761  41.047  17.595 1.00 19.97 ? 211  TYR B CD2 1 
ATOM   4581 C CE1 . TYR B 1 231 ? -5.142  38.782  16.849 1.00 15.82 ? 211  TYR B CE1 1 
ATOM   4582 C CE2 . TYR B 1 231 ? -4.918  41.166  16.836 1.00 19.11 ? 211  TYR B CE2 1 
ATOM   4583 C CZ  . TYR B 1 231 ? -5.591  40.039  16.451 1.00 19.70 ? 211  TYR B CZ  1 
ATOM   4584 O OH  . TYR B 1 231 ? -6.766  40.151  15.686 1.00 19.00 ? 211  TYR B OH  1 
ATOM   4585 N N   . LEU B 1 232 ? -0.408  39.273  21.688 1.00 18.51 ? 212  LEU B N   1 
ATOM   4586 C CA  . LEU B 1 232 ? 0.827   38.674  22.189 1.00 17.89 ? 212  LEU B CA  1 
ATOM   4587 C C   . LEU B 1 232 ? 0.454   37.486  23.102 1.00 18.69 ? 212  LEU B C   1 
ATOM   4588 O O   . LEU B 1 232 ? 0.954   36.371  22.926 1.00 19.43 ? 212  LEU B O   1 
ATOM   4589 C CB  . LEU B 1 232 ? 1.702   39.701  22.912 1.00 18.03 ? 212  LEU B CB  1 
ATOM   4590 C CG  . LEU B 1 232 ? 2.228   40.860  22.042 1.00 17.97 ? 212  LEU B CG  1 
ATOM   4591 C CD1 . LEU B 1 232 ? 3.261   41.694  22.818 1.00 19.74 ? 212  LEU B CD1 1 
ATOM   4592 C CD2 . LEU B 1 232 ? 2.837   40.327  20.734 1.00 17.52 ? 212  LEU B CD2 1 
ATOM   4593 N N   . VAL B 1 233 ? -0.469  37.714  24.030 1.00 19.51 ? 213  VAL B N   1 
ATOM   4594 C CA  . VAL B 1 233 ? -1.024  36.615  24.852 1.00 19.90 ? 213  VAL B CA  1 
ATOM   4595 C C   . VAL B 1 233 ? -1.846  35.654  23.988 1.00 19.88 ? 213  VAL B C   1 
ATOM   4596 O O   . VAL B 1 233 ? -1.642  34.429  24.039 1.00 18.28 ? 213  VAL B O   1 
ATOM   4597 C CB  . VAL B 1 233 ? -1.881  37.165  26.029 1.00 20.42 ? 213  VAL B CB  1 
ATOM   4598 C CG1 . VAL B 1 233 ? -2.762  36.035  26.667 1.00 18.34 ? 213  VAL B CG1 1 
ATOM   4599 C CG2 . VAL B 1 233 ? -0.966  37.801  27.097 1.00 17.79 ? 213  VAL B CG2 1 
ATOM   4600 N N   . GLY B 1 234 ? -2.815  36.206  23.249 1.00 19.58 ? 214  GLY B N   1 
ATOM   4601 C CA  . GLY B 1 234 ? -3.522  35.498  22.166 1.00 19.20 ? 214  GLY B CA  1 
ATOM   4602 C C   . GLY B 1 234 ? -4.643  34.549  22.581 1.00 19.14 ? 214  GLY B C   1 
ATOM   4603 O O   . GLY B 1 234 ? -5.178  33.851  21.724 1.00 17.66 ? 214  GLY B O   1 
ATOM   4604 N N   . HIS B 1 235 ? -4.924  34.466  23.891 1.00 18.17 ? 215  HIS B N   1 
ATOM   4605 C CA  . HIS B 1 235 ? -5.885  33.470  24.397 1.00 17.76 ? 215  HIS B CA  1 
ATOM   4606 C C   . HIS B 1 235 ? -6.911  34.065  25.356 1.00 18.62 ? 215  HIS B C   1 
ATOM   4607 O O   . HIS B 1 235 ? -7.712  33.325  25.954 1.00 18.29 ? 215  HIS B O   1 
ATOM   4608 C CB  . HIS B 1 235 ? -5.123  32.288  25.063 1.00 17.45 ? 215  HIS B CB  1 
ATOM   4609 C CG  . HIS B 1 235 ? -4.302  31.472  24.115 1.00 17.58 ? 215  HIS B CG  1 
ATOM   4610 N ND1 . HIS B 1 235 ? -3.064  31.875  23.632 1.00 15.61 ? 215  HIS B ND1 1 
ATOM   4611 C CD2 . HIS B 1 235 ? -4.534  30.247  23.589 1.00 17.60 ? 215  HIS B CD2 1 
ATOM   4612 C CE1 . HIS B 1 235 ? -2.590  30.926  22.830 1.00 14.45 ? 215  HIS B CE1 1 
ATOM   4613 N NE2 . HIS B 1 235 ? -3.467  29.932  22.787 1.00 16.37 ? 215  HIS B NE2 1 
ATOM   4614 N N   . SER B 1 236 ? -6.918  35.389  25.489 1.00 19.25 ? 216  SER B N   1 
ATOM   4615 C CA  . SER B 1 236 ? -7.937  36.091  26.296 1.00 20.85 ? 216  SER B CA  1 
ATOM   4616 C C   . SER B 1 236 ? -7.928  35.711  27.792 1.00 20.52 ? 216  SER B C   1 
ATOM   4617 O O   . SER B 1 236 ? -8.968  35.774  28.434 1.00 22.16 ? 216  SER B O   1 
ATOM   4618 C CB  . SER B 1 236 ? -9.351  35.823  25.745 1.00 21.39 ? 216  SER B CB  1 
ATOM   4619 O OG  . SER B 1 236 ? -9.384  36.020  24.338 1.00 25.97 ? 216  SER B OG  1 
ATOM   4620 N N   . ASP B 1 237 ? -6.775  35.321  28.328 1.00 19.12 ? 217  ASP B N   1 
ATOM   4621 C CA  . ASP B 1 237 ? -6.657  34.894  29.742 1.00 19.60 ? 217  ASP B CA  1 
ATOM   4622 C C   . ASP B 1 237 ? -5.534  35.500  30.577 1.00 20.71 ? 217  ASP B C   1 
ATOM   4623 O O   . ASP B 1 237 ? -5.293  35.043  31.721 1.00 22.94 ? 217  ASP B O   1 
ATOM   4624 C CB  . ASP B 1 237 ? -6.533  33.377  29.846 1.00 18.16 ? 217  ASP B CB  1 
ATOM   4625 C CG  . ASP B 1 237 ? -5.226  32.816  29.237 1.00 20.25 ? 217  ASP B CG  1 
ATOM   4626 O OD1 . ASP B 1 237 ? -4.449  33.572  28.590 1.00 17.62 ? 217  ASP B OD1 1 
ATOM   4627 O OD2 . ASP B 1 237 ? -5.012  31.591  29.419 1.00 19.88 ? 217  ASP B OD2 1 
ATOM   4628 N N   . ALA B 1 238 ? -4.838  36.480  30.039 1.00 20.56 ? 218  ALA B N   1 
ATOM   4629 C CA  . ALA B 1 238 ? -3.885  37.252  30.843 1.00 19.74 ? 218  ALA B CA  1 
ATOM   4630 C C   . ALA B 1 238 ? -3.933  38.705  30.400 1.00 19.57 ? 218  ALA B C   1 
ATOM   4631 O O   . ALA B 1 238 ? -4.153  38.969  29.240 1.00 19.96 ? 218  ALA B O   1 
ATOM   4632 C CB  . ALA B 1 238 ? -2.414  36.663  30.738 1.00 20.74 ? 218  ALA B CB  1 
ATOM   4633 N N   . MET B 1 239 ? -3.658  39.624  31.316 1.00 19.29 ? 219  MET B N   1 
ATOM   4634 C CA  . MET B 1 239 ? -3.556  41.058  31.039 1.00 19.18 ? 219  MET B CA  1 
ATOM   4635 C C   . MET B 1 239 ? -2.137  41.579  31.355 1.00 18.75 ? 219  MET B C   1 
ATOM   4636 O O   . MET B 1 239 ? -1.535  41.175  32.342 1.00 17.83 ? 219  MET B O   1 
ATOM   4637 C CB  . MET B 1 239 ? -4.656  41.812  31.825 1.00 21.69 ? 219  MET B CB  1 
ATOM   4638 C CG  . MET B 1 239 ? -5.998  41.172  31.613 1.00 20.51 ? 219  MET B CG  1 
ATOM   4639 S SD  . MET B 1 239 ? -7.440  42.158  32.073 1.00 20.16 ? 219  MET B SD  1 
ATOM   4640 C CE  . MET B 1 239 ? -7.137  43.713  31.208 1.00 17.41 ? 219  MET B CE  1 
ATOM   4641 N N   . ILE B 1 240 ? -1.622  42.462  30.486 1.00 18.04 ? 220  ILE B N   1 
ATOM   4642 C CA  . ILE B 1 240 ? -0.244  42.965  30.543 1.00 17.92 ? 220  ILE B CA  1 
ATOM   4643 C C   . ILE B 1 240 ? -0.130  44.069  29.500 1.00 18.04 ? 220  ILE B C   1 
ATOM   4644 O O   . ILE B 1 240 ? -0.721  43.951  28.395 1.00 18.17 ? 220  ILE B O   1 
ATOM   4645 C CB  . ILE B 1 240 ? 0.790   41.841  30.264 1.00 17.37 ? 220  ILE B CB  1 
ATOM   4646 C CG1 . ILE B 1 240 ? 2.178   42.422  29.927 1.00 17.28 ? 220  ILE B CG1 1 
ATOM   4647 C CG2 . ILE B 1 240 ? 0.258   40.817  29.251 1.00 17.78 ? 220  ILE B CG2 1 
ATOM   4648 C CD1 . ILE B 1 240 ? 3.390   41.420  30.124 1.00 18.89 ? 220  ILE B CD1 1 
ATOM   4649 N N   . GLY B 1 241 ? 0.604   45.115  29.847 1.00 17.69 ? 221  GLY B N   1 
ATOM   4650 C CA  . GLY B 1 241 ? 0.955   46.207  28.920 1.00 15.45 ? 221  GLY B CA  1 
ATOM   4651 C C   . GLY B 1 241 ? 2.453   46.179  28.717 1.00 16.19 ? 221  GLY B C   1 
ATOM   4652 O O   . GLY B 1 241 ? 3.185   45.745  29.599 1.00 16.86 ? 221  GLY B O   1 
ATOM   4653 N N   . THR B 1 242 ? 2.885   46.602  27.531 1.00 14.57 ? 222  THR B N   1 
ATOM   4654 C CA  . THR B 1 242 ? 4.321   46.738  27.217 1.00 16.13 ? 222  THR B CA  1 
ATOM   4655 C C   . THR B 1 242 ? 4.516   48.109  26.621 1.00 16.64 ? 222  THR B C   1 
ATOM   4656 O O   . THR B 1 242 ? 3.622   48.623  25.951 1.00 18.49 ? 222  THR B O   1 
ATOM   4657 C CB  . THR B 1 242 ? 4.780   45.652  26.195 1.00 15.20 ? 222  THR B CB  1 
ATOM   4658 O OG1 . THR B 1 242 ? 3.965   45.709  24.998 1.00 18.70 ? 222  THR B OG1 1 
ATOM   4659 C CG2 . THR B 1 242 ? 4.650   44.268  26.871 1.00 16.29 ? 222  THR B CG2 1 
ATOM   4660 N N   . ALA B 1 243 ? 5.654   48.726  26.887 1.00 17.83 ? 223  ALA B N   1 
ATOM   4661 C CA  . ALA B 1 243 ? 6.096   49.914  26.133 1.00 18.63 ? 223  ALA B CA  1 
ATOM   4662 C C   . ALA B 1 243 ? 7.511   49.666  25.734 1.00 18.34 ? 223  ALA B C   1 
ATOM   4663 O O   . ALA B 1 243 ? 8.358   49.586  26.621 1.00 19.36 ? 223  ALA B O   1 
ATOM   4664 C CB  . ALA B 1 243 ? 6.022   51.168  26.967 1.00 19.98 ? 223  ALA B CB  1 
ATOM   4665 N N   . VAL B 1 244 ? 7.749   49.473  24.430 1.00 17.23 ? 224  VAL B N   1 
ATOM   4666 C CA  . VAL B 1 244 ? 9.126   49.375  23.893 1.00 17.29 ? 224  VAL B CA  1 
ATOM   4667 C C   . VAL B 1 244 ? 9.605   50.781  23.484 1.00 17.43 ? 224  VAL B C   1 
ATOM   4668 O O   . VAL B 1 244 ? 8.947   51.474  22.695 1.00 17.98 ? 224  VAL B O   1 
ATOM   4669 C CB  . VAL B 1 244 ? 9.254   48.312  22.765 1.00 16.82 ? 224  VAL B CB  1 
ATOM   4670 C CG1 . VAL B 1 244 ? 10.715  48.242  22.236 1.00 19.45 ? 224  VAL B CG1 1 
ATOM   4671 C CG2 . VAL B 1 244 ? 8.809   46.921  23.291 1.00 16.62 ? 224  VAL B CG2 1 
ATOM   4672 N N   . CYS B 1 245 ? 10.787  51.165  23.993 1.00 17.68 ? 225  CYS B N   1 
ATOM   4673 C CA  . CYS B 1 245 ? 11.282  52.547  23.963 1.00 17.82 ? 225  CYS B CA  1 
ATOM   4674 C C   . CYS B 1 245 ? 12.514  52.537  23.085 1.00 16.85 ? 225  CYS B C   1 
ATOM   4675 O O   . CYS B 1 245 ? 13.223  51.534  23.068 1.00 17.19 ? 225  CYS B O   1 
ATOM   4676 C CB  . CYS B 1 245 ? 11.720  53.004  25.385 1.00 17.34 ? 225  CYS B CB  1 
ATOM   4677 S SG  . CYS B 1 245 ? 10.239  53.162  26.509 1.00 23.62 ? 225  CYS B SG  1 
ATOM   4678 N N   . ASN B 1 246 ? 12.713  53.596  22.314 1.00 15.71 ? 226  ASN B N   1 
ATOM   4679 C CA  . ASN B 1 246 ? 14.079  53.883  21.788 1.00 15.98 ? 226  ASN B CA  1 
ATOM   4680 C C   . ASN B 1 246 ? 15.030  54.222  22.929 1.00 16.45 ? 226  ASN B C   1 
ATOM   4681 O O   . ASN B 1 246 ? 14.606  54.413  24.086 1.00 16.35 ? 226  ASN B O   1 
ATOM   4682 C CB  . ASN B 1 246 ? 14.084  54.983  20.689 1.00 16.65 ? 226  ASN B CB  1 
ATOM   4683 C CG  . ASN B 1 246 ? 13.570  56.329  21.171 1.00 16.74 ? 226  ASN B CG  1 
ATOM   4684 O OD1 . ASN B 1 246 ? 13.451  56.581  22.378 1.00 17.43 ? 226  ASN B OD1 1 
ATOM   4685 N ND2 . ASN B 1 246 ? 13.240  57.215  20.213 1.00 17.69 ? 226  ASN B ND2 1 
ATOM   4686 N N   . ALA B 1 247 ? 16.324  54.233  22.624 1.00 17.73 ? 227  ALA B N   1 
ATOM   4687 C CA  . ALA B 1 247 ? 17.375  54.679  23.551 1.00 18.05 ? 227  ALA B CA  1 
ATOM   4688 C C   . ALA B 1 247 ? 17.157  56.047  24.199 1.00 17.52 ? 227  ALA B C   1 
ATOM   4689 O O   . ALA B 1 247 ? 17.436  56.207  25.397 1.00 18.46 ? 227  ALA B O   1 
ATOM   4690 C CB  . ALA B 1 247 ? 18.723  54.638  22.880 1.00 18.08 ? 227  ALA B CB  1 
ATOM   4691 N N   . ARG B 1 248 ? 16.695  57.024  23.412 1.00 16.58 ? 228  ARG B N   1 
ATOM   4692 C CA  . ARG B 1 248 ? 16.370  58.370  23.922 1.00 17.17 ? 228  ARG B CA  1 
ATOM   4693 C C   . ARG B 1 248 ? 15.419  58.322  25.129 1.00 16.98 ? 228  ARG B C   1 
ATOM   4694 O O   . ARG B 1 248 ? 15.596  59.035  26.118 1.00 16.32 ? 228  ARG B O   1 
ATOM   4695 C CB  . ARG B 1 248 ? 15.735  59.210  22.798 1.00 16.40 ? 228  ARG B CB  1 
ATOM   4696 C CG  . ARG B 1 248 ? 15.330  60.625  23.168 1.00 17.39 ? 228  ARG B CG  1 
ATOM   4697 C CD  . ARG B 1 248 ? 14.532  61.261  22.016 1.00 20.39 ? 228  ARG B CD  1 
ATOM   4698 N NE  . ARG B 1 248 ? 13.984  62.540  22.448 1.00 19.68 ? 228  ARG B NE  1 
ATOM   4699 C CZ  . ARG B 1 248 ? 12.780  63.009  22.171 1.00 23.01 ? 228  ARG B CZ  1 
ATOM   4700 N NH1 . ARG B 1 248 ? 11.904  62.301  21.470 1.00 19.15 ? 228  ARG B NH1 1 
ATOM   4701 N NH2 . ARG B 1 248 ? 12.439  64.187  22.651 1.00 22.20 ? 228  ARG B NH2 1 
ATOM   4702 N N   . CYS B 1 249 ? 14.354  57.534  25.005 1.00 16.85 ? 229  CYS B N   1 
ATOM   4703 C CA  . CYS B 1 249 ? 13.253  57.622  25.957 1.00 17.89 ? 229  CYS B CA  1 
ATOM   4704 C C   . CYS B 1 249 ? 13.191  56.572  27.062 1.00 18.64 ? 229  CYS B C   1 
ATOM   4705 O O   . CYS B 1 249 ? 12.374  56.674  27.983 1.00 18.25 ? 229  CYS B O   1 
ATOM   4706 C CB  . CYS B 1 249 ? 11.937  57.619  25.155 1.00 17.67 ? 229  CYS B CB  1 
ATOM   4707 S SG  . CYS B 1 249 ? 11.768  59.196  24.239 1.00 22.66 ? 229  CYS B SG  1 
ATOM   4708 N N   . TRP B 1 250 ? 14.009  55.538  26.945 1.00 18.73 ? 230  TRP B N   1 
ATOM   4709 C CA  . TRP B 1 250 ? 13.874  54.380  27.813 1.00 19.68 ? 230  TRP B CA  1 
ATOM   4710 C C   . TRP B 1 250 ? 14.057  54.704  29.289 1.00 20.20 ? 230  TRP B C   1 
ATOM   4711 O O   . TRP B 1 250 ? 13.200  54.358  30.083 1.00 20.03 ? 230  TRP B O   1 
ATOM   4712 C CB  . TRP B 1 250 ? 14.801  53.243  27.388 1.00 21.09 ? 230  TRP B CB  1 
ATOM   4713 C CG  . TRP B 1 250 ? 14.752  52.011  28.309 1.00 21.64 ? 230  TRP B CG  1 
ATOM   4714 C CD1 . TRP B 1 250 ? 13.654  51.441  28.890 1.00 23.92 ? 230  TRP B CD1 1 
ATOM   4715 C CD2 . TRP B 1 250 ? 15.874  51.209  28.697 1.00 23.47 ? 230  TRP B CD2 1 
ATOM   4716 N NE1 . TRP B 1 250 ? 14.027  50.324  29.633 1.00 25.47 ? 230  TRP B NE1 1 
ATOM   4717 C CE2 . TRP B 1 250 ? 15.384  50.163  29.526 1.00 24.49 ? 230  TRP B CE2 1 
ATOM   4718 C CE3 . TRP B 1 250 ? 17.248  51.263  28.413 1.00 25.13 ? 230  TRP B CE3 1 
ATOM   4719 C CZ2 . TRP B 1 250 ? 16.224  49.175  30.073 1.00 24.83 ? 230  TRP B CZ2 1 
ATOM   4720 C CZ3 . TRP B 1 250 ? 18.085  50.288  28.964 1.00 27.05 ? 230  TRP B CZ3 1 
ATOM   4721 C CH2 . TRP B 1 250 ? 17.572  49.266  29.789 1.00 27.79 ? 230  TRP B CH2 1 
ATOM   4722 N N   . GLU B 1 251 ? 15.172  55.335  29.654 1.00 19.35 ? 231  GLU B N   1 
ATOM   4723 C CA  . GLU B 1 251 ? 15.426  55.638  31.068 1.00 19.87 ? 231  GLU B CA  1 
ATOM   4724 C C   . GLU B 1 251 ? 14.259  56.321  31.791 1.00 19.39 ? 231  GLU B C   1 
ATOM   4725 O O   . GLU B 1 251 ? 13.828  55.848  32.844 1.00 19.44 ? 231  GLU B O   1 
ATOM   4726 C CB  . GLU B 1 251 ? 16.734  56.428  31.234 1.00 20.62 ? 231  GLU B CB  1 
ATOM   4727 C CG  . GLU B 1 251 ? 17.087  56.663  32.696 1.00 23.97 ? 231  GLU B CG  1 
ATOM   4728 C CD  . GLU B 1 251 ? 18.394  57.444  32.871 1.00 26.64 ? 231  GLU B CD  1 
ATOM   4729 O OE1 . GLU B 1 251 ? 18.838  58.103  31.913 1.00 28.52 ? 231  GLU B OE1 1 
ATOM   4730 O OE2 . GLU B 1 251 ? 18.937  57.432  33.987 1.00 30.31 ? 231  GLU B OE2 1 
ATOM   4731 N N   . GLN B 1 252 ? 13.711  57.390  31.195 1.00 18.23 ? 232  GLN B N   1 
ATOM   4732 C CA  . GLN B 1 252 ? 12.728  58.227  31.857 1.00 17.96 ? 232  GLN B CA  1 
ATOM   4733 C C   . GLN B 1 252 ? 11.420  57.451  31.972 1.00 17.27 ? 232  GLN B C   1 
ATOM   4734 O O   . GLN B 1 252 ? 10.765  57.470  33.005 1.00 16.28 ? 232  GLN B O   1 
ATOM   4735 C CB  . GLN B 1 252 ? 12.527  59.547  31.094 1.00 17.92 ? 232  GLN B CB  1 
ATOM   4736 C CG  . GLN B 1 252 ? 11.317  60.348  31.569 1.00 20.83 ? 232  GLN B CG  1 
ATOM   4737 C CD  . GLN B 1 252 ? 11.214  61.779  31.023 1.00 22.51 ? 232  GLN B CD  1 
ATOM   4738 O OE1 . GLN B 1 252 ? 12.088  62.266  30.314 1.00 24.70 ? 232  GLN B OE1 1 
ATOM   4739 N NE2 . GLN B 1 252 ? 10.129  62.469  31.394 1.00 23.07 ? 232  GLN B NE2 1 
ATOM   4740 N N   . LEU B 1 253 ? 11.092  56.704  30.932 1.00 17.41 ? 233  LEU B N   1 
ATOM   4741 C CA  . LEU B 1 253 ? 9.890   55.888  30.992 1.00 17.57 ? 233  LEU B CA  1 
ATOM   4742 C C   . LEU B 1 253 ? 10.051  54.839  32.094 1.00 17.56 ? 233  LEU B C   1 
ATOM   4743 O O   . LEU B 1 253 ? 9.175   54.663  32.929 1.00 16.55 ? 233  LEU B O   1 
ATOM   4744 C CB  . LEU B 1 253 ? 9.586   55.275  29.625 1.00 18.15 ? 233  LEU B CB  1 
ATOM   4745 C CG  . LEU B 1 253 ? 8.275   54.488  29.414 1.00 22.96 ? 233  LEU B CG  1 
ATOM   4746 C CD1 . LEU B 1 253 ? 7.193   54.741  30.405 1.00 24.92 ? 233  LEU B CD1 1 
ATOM   4747 C CD2 . LEU B 1 253 ? 7.732   54.741  28.016 1.00 24.46 ? 233  LEU B CD2 1 
ATOM   4748 N N   . ARG B 1 254 ? 11.198  54.185  32.129 1.00 16.11 ? 234  ARG B N   1 
ATOM   4749 C CA  . ARG B 1 254 ? 11.390  53.099  33.037 1.00 17.61 ? 234  ARG B CA  1 
ATOM   4750 C C   . ARG B 1 254 ? 11.408  53.563  34.491 1.00 17.38 ? 234  ARG B C   1 
ATOM   4751 O O   . ARG B 1 254 ? 10.737  52.996  35.335 1.00 17.52 ? 234  ARG B O   1 
ATOM   4752 C CB  . ARG B 1 254 ? 12.729  52.442  32.702 1.00 16.18 ? 234  ARG B CB  1 
ATOM   4753 C CG  . ARG B 1 254 ? 13.021  51.213  33.545 1.00 20.51 ? 234  ARG B CG  1 
ATOM   4754 C CD  . ARG B 1 254 ? 14.488  50.799  33.377 1.00 21.81 ? 234  ARG B CD  1 
ATOM   4755 N NE  . ARG B 1 254 ? 15.429  51.767  33.952 1.00 26.81 ? 234  ARG B NE  1 
ATOM   4756 C CZ  . ARG B 1 254 ? 16.510  52.253  33.333 1.00 28.84 ? 234  ARG B CZ  1 
ATOM   4757 N NH1 . ARG B 1 254 ? 16.803  51.864  32.097 1.00 30.31 ? 234  ARG B NH1 1 
ATOM   4758 N NH2 . ARG B 1 254 ? 17.305  53.134  33.942 1.00 27.97 ? 234  ARG B NH2 1 
ATOM   4759 N N   . GLU B 1 255 ? 12.191  54.609  34.775 1.00 18.90 ? 235  GLU B N   1 
ATOM   4760 C CA  . GLU B 1 255 ? 12.354  55.085  36.142 1.00 18.87 ? 235  GLU B CA  1 
ATOM   4761 C C   . GLU B 1 255 ? 11.071  55.743  36.674 1.00 19.26 ? 235  GLU B C   1 
ATOM   4762 O O   . GLU B 1 255 ? 10.735  55.553  37.829 1.00 19.64 ? 235  GLU B O   1 
ATOM   4763 C CB  . GLU B 1 255 ? 13.572  55.984  36.245 1.00 19.54 ? 235  GLU B CB  1 
ATOM   4764 C CG  . GLU B 1 255 ? 14.897  55.183  35.992 1.00 19.38 ? 235  GLU B CG  1 
ATOM   4765 C CD  . GLU B 1 255 ? 15.036  53.931  36.868 1.00 21.74 ? 235  GLU B CD  1 
ATOM   4766 O OE1 . GLU B 1 255 ? 14.753  54.012  38.075 1.00 23.32 ? 235  GLU B OE1 1 
ATOM   4767 O OE2 . GLU B 1 255 ? 15.479  52.872  36.360 1.00 25.50 ? 235  GLU B OE2 1 
ATOM   4768 N N   . ASN B 1 256 ? 10.350  56.468  35.812 1.00 19.13 ? 236  ASN B N   1 
ATOM   4769 C CA  . ASN B 1 256 ? 9.141   57.142  36.237 1.00 18.62 ? 236  ASN B CA  1 
ATOM   4770 C C   . ASN B 1 256 ? 8.005   56.151  36.387 1.00 19.26 ? 236  ASN B C   1 
ATOM   4771 O O   . ASN B 1 256 ? 7.214   56.278  37.329 1.00 19.48 ? 236  ASN B O   1 
ATOM   4772 C CB  . ASN B 1 256 ? 8.784   58.357  35.355 1.00 19.48 ? 236  ASN B CB  1 
ATOM   4773 C CG  . ASN B 1 256 ? 9.730   59.517  35.585 1.00 18.42 ? 236  ASN B CG  1 
ATOM   4774 O OD1 . ASN B 1 256 ? 10.401  59.562  36.621 1.00 21.35 ? 236  ASN B OD1 1 
ATOM   4775 N ND2 . ASN B 1 256 ? 9.788   60.455  34.650 1.00 16.70 ? 236  ASN B ND2 1 
ATOM   4776 N N   . ALA B 1 257 ? 7.963   55.126  35.530 1.00 18.89 ? 237  ALA B N   1 
ATOM   4777 C CA  . ALA B 1 257 ? 6.993   54.047  35.720 1.00 19.17 ? 237  ALA B CA  1 
ATOM   4778 C C   . ALA B 1 257 ? 7.325   53.253  37.001 1.00 19.19 ? 237  ALA B C   1 
ATOM   4779 O O   . ALA B 1 257 ? 6.420   52.847  37.753 1.00 20.30 ? 237  ALA B O   1 
ATOM   4780 C CB  . ALA B 1 257 ? 6.928   53.136  34.498 1.00 19.64 ? 237  ALA B CB  1 
ATOM   4781 N N   . TYR B 1 258 ? 8.616   53.051  37.287 1.00 18.29 ? 238  TYR B N   1 
ATOM   4782 C CA  . TYR B 1 258 ? 8.975   52.392  38.537 1.00 17.82 ? 238  TYR B CA  1 
ATOM   4783 C C   . TYR B 1 258 ? 8.472   53.143  39.786 1.00 17.78 ? 238  TYR B C   1 
ATOM   4784 O O   . TYR B 1 258 ? 7.969   52.521  40.735 1.00 19.33 ? 238  TYR B O   1 
ATOM   4785 C CB  . TYR B 1 258 ? 10.499  52.223  38.623 1.00 17.51 ? 238  TYR B CB  1 
ATOM   4786 C CG  . TYR B 1 258 ? 10.913  51.245  39.686 1.00 20.34 ? 238  TYR B CG  1 
ATOM   4787 C CD1 . TYR B 1 258 ? 10.644  49.876  39.543 1.00 22.98 ? 238  TYR B CD1 1 
ATOM   4788 C CD2 . TYR B 1 258 ? 11.507  51.682  40.863 1.00 18.94 ? 238  TYR B CD2 1 
ATOM   4789 C CE1 . TYR B 1 258 ? 10.994  48.984  40.540 1.00 24.71 ? 238  TYR B CE1 1 
ATOM   4790 C CE2 . TYR B 1 258 ? 11.849  50.797  41.866 1.00 21.85 ? 238  TYR B CE2 1 
ATOM   4791 C CZ  . TYR B 1 258 ? 11.630  49.450  41.687 1.00 22.24 ? 238  TYR B CZ  1 
ATOM   4792 O OH  . TYR B 1 258 ? 11.982  48.556  42.670 1.00 20.84 ? 238  TYR B OH  1 
ATOM   4793 N N   . LEU B 1 259 ? 8.588   54.467  39.775 1.00 18.14 ? 239  LEU B N   1 
ATOM   4794 C CA  . LEU B 1 259 ? 8.116   55.318  40.885 1.00 19.39 ? 239  LEU B CA  1 
ATOM   4795 C C   . LEU B 1 259 ? 6.594   55.194  41.112 1.00 18.42 ? 239  LEU B C   1 
ATOM   4796 O O   . LEU B 1 259 ? 6.111   55.447  42.223 1.00 18.82 ? 239  LEU B O   1 
ATOM   4797 C CB  . LEU B 1 259 ? 8.512   56.784  40.646 1.00 19.89 ? 239  LEU B CB  1 
ATOM   4798 C CG  . LEU B 1 259 ? 9.777   57.389  41.285 1.00 23.83 ? 239  LEU B CG  1 
ATOM   4799 C CD1 . LEU B 1 259 ? 10.395  56.444  42.340 1.00 21.26 ? 239  LEU B CD1 1 
ATOM   4800 C CD2 . LEU B 1 259 ? 10.815  57.863  40.239 1.00 26.00 ? 239  LEU B CD2 1 
ATOM   4801 N N   . MET B 1 260 ? 5.869   54.788  40.064 1.00 16.99 ? 240  MET B N   1 
ATOM   4802 C CA  . MET B 1 260 ? 4.428   54.490  40.157 1.00 16.23 ? 240  MET B CA  1 
ATOM   4803 C C   . MET B 1 260 ? 4.202   52.998  40.486 1.00 16.72 ? 240  MET B C   1 
ATOM   4804 O O   . MET B 1 260 ? 3.069   52.514  40.438 1.00 17.97 ? 240  MET B O   1 
ATOM   4805 C CB  . MET B 1 260 ? 3.708   54.884  38.857 1.00 15.89 ? 240  MET B CB  1 
ATOM   4806 C CG  . MET B 1 260 ? 3.763   56.376  38.513 1.00 11.70 ? 240  MET B CG  1 
ATOM   4807 S SD  . MET B 1 260 ? 3.223   57.452  39.839 1.00 16.65 ? 240  MET B SD  1 
ATOM   4808 C CE  . MET B 1 260 ? 1.480   57.068  39.864 1.00 11.65 ? 240  MET B CE  1 
ATOM   4809 N N   . GLY B 1 261 ? 5.293   52.279  40.817 1.00 16.87 ? 241  GLY B N   1 
ATOM   4810 C CA  . GLY B 1 261 ? 5.213   50.846  41.170 1.00 17.18 ? 241  GLY B CA  1 
ATOM   4811 C C   . GLY B 1 261 ? 4.699   49.952  40.061 1.00 17.60 ? 241  GLY B C   1 
ATOM   4812 O O   . GLY B 1 261 ? 4.173   48.865  40.328 1.00 18.63 ? 241  GLY B O   1 
ATOM   4813 N N   . GLN B 1 262 ? 4.841   50.379  38.799 1.00 18.81 ? 242  GLN B N   1 
ATOM   4814 C CA  . GLN B 1 262 ? 4.384   49.551  37.670 1.00 18.34 ? 242  GLN B CA  1 
ATOM   4815 C C   . GLN B 1 262 ? 5.242   48.321  37.380 1.00 18.86 ? 242  GLN B C   1 
ATOM   4816 O O   . GLN B 1 262 ? 6.448   48.422  37.287 1.00 17.44 ? 242  GLN B O   1 
ATOM   4817 C CB  . GLN B 1 262 ? 4.200   50.413  36.413 1.00 18.44 ? 242  GLN B CB  1 
ATOM   4818 C CG  . GLN B 1 262 ? 3.205   51.534  36.677 1.00 17.34 ? 242  GLN B CG  1 
ATOM   4819 C CD  . GLN B 1 262 ? 1.885   51.015  37.220 1.00 22.06 ? 242  GLN B CD  1 
ATOM   4820 O OE1 . GLN B 1 262 ? 1.591   51.127  38.426 1.00 23.12 ? 242  GLN B OE1 1 
ATOM   4821 N NE2 . GLN B 1 262 ? 1.076   50.439  36.344 1.00 15.91 ? 242  GLN B NE2 1 
ATOM   4822 N N   . MET B 1 263 ? 4.580   47.174  37.284 1.00 18.27 ? 243  MET B N   1 
ATOM   4823 C CA  . MET B 1 263 ? 5.159   45.881  37.025 1.00 18.96 ? 243  MET B CA  1 
ATOM   4824 C C   . MET B 1 263 ? 4.026   44.968  36.646 1.00 18.73 ? 243  MET B C   1 
ATOM   4825 O O   . MET B 1 263 ? 2.791   45.302  36.800 1.00 18.55 ? 243  MET B O   1 
ATOM   4826 C CB  . MET B 1 263 ? 5.938   45.298  38.242 1.00 17.56 ? 243  MET B CB  1 
ATOM   4827 C CG  . MET B 1 263 ? 5.098   45.135  39.537 1.00 17.61 ? 243  MET B CG  1 
ATOM   4828 S SD  . MET B 1 263 ? 5.827   44.246  40.906 1.00 20.09 ? 243  MET B SD  1 
ATOM   4829 C CE  . MET B 1 263 ? 5.894   42.549  40.283 1.00 23.88 ? 243  MET B CE  1 
ATOM   4830 N N   . VAL B 1 264 ? 4.443   43.788  36.184 1.00 19.58 ? 244  VAL B N   1 
ATOM   4831 C CA  . VAL B 1 264 ? 3.551   42.675  35.915 1.00 18.63 ? 244  VAL B CA  1 
ATOM   4832 C C   . VAL B 1 264 ? 4.086   41.417  36.603 1.00 18.35 ? 244  VAL B C   1 
ATOM   4833 O O   . VAL B 1 264 ? 5.256   41.309  36.867 1.00 18.62 ? 244  VAL B O   1 
ATOM   4834 C CB  . VAL B 1 264 ? 3.380   42.465  34.383 1.00 18.37 ? 244  VAL B CB  1 
ATOM   4835 C CG1 . VAL B 1 264 ? 4.585   41.781  33.792 1.00 19.28 ? 244  VAL B CG1 1 
ATOM   4836 C CG2 . VAL B 1 264 ? 2.034   41.711  34.057 1.00 18.31 ? 244  VAL B CG2 1 
ATOM   4837 N N   . ASP B 1 265 ? 3.222   40.476  36.938 1.00 18.84 ? 245  ASP B N   1 
ATOM   4838 C CA  . ASP B 1 265 ? 3.668   39.279  37.665 1.00 19.02 ? 245  ASP B CA  1 
ATOM   4839 C C   . ASP B 1 265 ? 4.433   38.295  36.772 1.00 20.24 ? 245  ASP B C   1 
ATOM   4840 O O   . ASP B 1 265 ? 4.223   38.252  35.556 1.00 18.93 ? 245  ASP B O   1 
ATOM   4841 C CB  . ASP B 1 265 ? 2.483   38.556  38.252 1.00 20.36 ? 245  ASP B CB  1 
ATOM   4842 C CG  . ASP B 1 265 ? 1.602   37.998  37.174 1.00 21.67 ? 245  ASP B CG  1 
ATOM   4843 O OD1 . ASP B 1 265 ? 0.787   38.767  36.591 1.00 26.28 ? 245  ASP B OD1 1 
ATOM   4844 O OD2 . ASP B 1 265 ? 1.716   36.783  36.936 1.00 21.20 ? 245  ASP B OD2 1 
ATOM   4845 N N   . ALA B 1 266 ? 5.346   37.536  37.393 1.00 19.71 ? 246  ALA B N   1 
ATOM   4846 C CA  . ALA B 1 266 ? 6.224   36.640  36.655 1.00 19.94 ? 246  ALA B CA  1 
ATOM   4847 C C   . ALA B 1 266 ? 5.480   35.643  35.789 1.00 19.96 ? 246  ALA B C   1 
ATOM   4848 O O   . ALA B 1 266 ? 5.890   35.433  34.678 1.00 18.05 ? 246  ALA B O   1 
ATOM   4849 C CB  . ALA B 1 266 ? 7.175   35.900  37.586 1.00 20.91 ? 246  ALA B CB  1 
ATOM   4850 N N   . ASP B 1 267 ? 4.392   35.052  36.309 1.00 18.11 ? 247  ASP B N   1 
ATOM   4851 C CA  . ASP B 1 267 ? 3.542   34.105  35.537 1.00 19.35 ? 247  ASP B CA  1 
ATOM   4852 C C   . ASP B 1 267 ? 2.955   34.681  34.266 1.00 17.71 ? 247  ASP B C   1 
ATOM   4853 O O   . ASP B 1 267 ? 3.040   34.049  33.229 1.00 15.51 ? 247  ASP B O   1 
ATOM   4854 C CB  . ASP B 1 267 ? 2.462   33.473  36.408 1.00 20.09 ? 247  ASP B CB  1 
ATOM   4855 C CG  . ASP B 1 267 ? 3.038   32.432  37.335 1.00 23.59 ? 247  ASP B CG  1 
ATOM   4856 O OD1 . ASP B 1 267 ? 3.706   32.798  38.332 1.00 24.00 ? 247  ASP B OD1 1 
ATOM   4857 O OD2 . ASP B 1 267 ? 2.861   31.249  37.038 1.00 28.42 ? 247  ASP B OD2 1 
ATOM   4858 N N   . THR B 1 268 ? 2.401   35.884  34.363 1.00 17.96 ? 248  THR B N   1 
ATOM   4859 C CA  . THR B 1 268 ? 1.924   36.589  33.181 1.00 17.74 ? 248  THR B CA  1 
ATOM   4860 C C   . THR B 1 268 ? 3.048   36.860  32.195 1.00 17.66 ? 248  THR B C   1 
ATOM   4861 O O   . THR B 1 268 ? 2.831   36.692  31.008 1.00 17.97 ? 248  THR B O   1 
ATOM   4862 C CB  . THR B 1 268 ? 1.124   37.872  33.540 1.00 17.43 ? 248  THR B CB  1 
ATOM   4863 O OG1 . THR B 1 268 ? 0.012   37.481  34.377 1.00 20.59 ? 248  THR B OG1 1 
ATOM   4864 C CG2 . THR B 1 268 ? 0.630   38.582  32.254 1.00 16.67 ? 248  THR B CG2 1 
ATOM   4865 N N   . ALA B 1 269 ? 4.245   37.220  32.668 1.00 17.11 ? 249  ALA B N   1 
ATOM   4866 C CA  . ALA B 1 269 ? 5.375   37.490  31.754 1.00 17.70 ? 249  ALA B CA  1 
ATOM   4867 C C   . ALA B 1 269 ? 5.722   36.214  30.974 1.00 16.89 ? 249  ALA B C   1 
ATOM   4868 O O   . ALA B 1 269 ? 5.935   36.251  29.767 1.00 17.49 ? 249  ALA B O   1 
ATOM   4869 C CB  . ALA B 1 269 ? 6.613   38.029  32.517 1.00 15.93 ? 249  ALA B CB  1 
ATOM   4870 N N   . TYR B 1 270 ? 5.780   35.091  31.677 1.00 16.80 ? 250  TYR B N   1 
ATOM   4871 C CA  . TYR B 1 270 ? 5.974   33.769  31.072 1.00 16.43 ? 250  TYR B CA  1 
ATOM   4872 C C   . TYR B 1 270 ? 4.987   33.471  29.962 1.00 17.68 ? 250  TYR B C   1 
ATOM   4873 O O   . TYR B 1 270 ? 5.351   33.062  28.867 1.00 16.99 ? 250  TYR B O   1 
ATOM   4874 C CB  . TYR B 1 270 ? 5.828   32.687  32.143 1.00 16.71 ? 250  TYR B CB  1 
ATOM   4875 C CG  . TYR B 1 270 ? 5.973   31.289  31.574 1.00 20.40 ? 250  TYR B CG  1 
ATOM   4876 C CD1 . TYR B 1 270 ? 4.856   30.542  31.145 1.00 16.88 ? 250  TYR B CD1 1 
ATOM   4877 C CD2 . TYR B 1 270 ? 7.228   30.710  31.466 1.00 17.87 ? 250  TYR B CD2 1 
ATOM   4878 C CE1 . TYR B 1 270 ? 5.005   29.255  30.614 1.00 17.35 ? 250  TYR B CE1 1 
ATOM   4879 C CE2 . TYR B 1 270 ? 7.409   29.403  30.942 1.00 20.19 ? 250  TYR B CE2 1 
ATOM   4880 C CZ  . TYR B 1 270 ? 6.321   28.691  30.505 1.00 18.22 ? 250  TYR B CZ  1 
ATOM   4881 O OH  . TYR B 1 270 ? 6.523   27.411  30.010 1.00 19.70 ? 250  TYR B OH  1 
ATOM   4882 N N   . ILE B 1 271 ? 3.721   33.668  30.283 1.00 17.27 ? 251  ILE B N   1 
ATOM   4883 C CA  . ILE B 1 271 ? 2.612   33.377  29.381 1.00 19.72 ? 251  ILE B CA  1 
ATOM   4884 C C   . ILE B 1 271 ? 2.639   34.302  28.174 1.00 18.68 ? 251  ILE B C   1 
ATOM   4885 O O   . ILE B 1 271 ? 2.294   33.889  27.053 1.00 18.33 ? 251  ILE B O   1 
ATOM   4886 C CB  . ILE B 1 271 ? 1.246   33.425  30.166 1.00 20.44 ? 251  ILE B CB  1 
ATOM   4887 C CG1 . ILE B 1 271 ? 0.991   32.100  30.903 1.00 25.66 ? 251  ILE B CG1 1 
ATOM   4888 C CG2 . ILE B 1 271 ? 0.046   33.731  29.274 1.00 23.92 ? 251  ILE B CG2 1 
ATOM   4889 C CD1 . ILE B 1 271 ? 0.802   30.822  29.967 1.00 27.61 ? 251  ILE B CD1 1 
ATOM   4890 N N   . THR B 1 272 ? 3.076   35.554  28.401 1.00 17.54 ? 252  THR B N   1 
ATOM   4891 C CA  . THR B 1 272 ? 3.291   36.434  27.265 1.00 16.85 ? 252  THR B CA  1 
ATOM   4892 C C   . THR B 1 272 ? 4.437   35.953  26.344 1.00 16.19 ? 252  THR B C   1 
ATOM   4893 O O   . THR B 1 272 ? 4.214   35.837  25.141 1.00 15.76 ? 252  THR B O   1 
ATOM   4894 C CB  . THR B 1 272 ? 3.456   37.896  27.720 1.00 16.24 ? 252  THR B CB  1 
ATOM   4895 O OG1 . THR B 1 272 ? 2.330   38.230  28.528 1.00 16.93 ? 252  THR B OG1 1 
ATOM   4896 C CG2 . THR B 1 272 ? 3.488   38.791  26.534 1.00 15.13 ? 252  THR B CG2 1 
ATOM   4897 N N   . SER B 1 273 ? 5.619   35.665  26.878 1.00 16.54 ? 253  SER B N   1 
ATOM   4898 C CA  . SER B 1 273 ? 6.700   35.102  26.058 1.00 15.87 ? 253  SER B CA  1 
ATOM   4899 C C   . SER B 1 273 ? 6.223   33.859  25.271 1.00 15.61 ? 253  SER B C   1 
ATOM   4900 O O   . SER B 1 273 ? 6.556   33.667  24.097 1.00 13.87 ? 253  SER B O   1 
ATOM   4901 C CB  . SER B 1 273 ? 7.878   34.675  26.954 1.00 16.77 ? 253  SER B CB  1 
ATOM   4902 O OG  . SER B 1 273 ? 8.597   35.792  27.437 1.00 16.03 ? 253  SER B OG  1 
ATOM   4903 N N   . ARG B 1 274 ? 5.428   33.024  25.949 1.00 16.63 ? 254  ARG B N   1 
ATOM   4904 C CA  . ARG B 1 274 ? 4.864   31.797  25.395 1.00 16.37 ? 254  ARG B CA  1 
ATOM   4905 C C   . ARG B 1 274 ? 3.913   32.104  24.251 1.00 16.71 ? 254  ARG B C   1 
ATOM   4906 O O   . ARG B 1 274 ? 3.908   31.388  23.258 1.00 18.15 ? 254  ARG B O   1 
ATOM   4907 C CB  . ARG B 1 274 ? 4.085   31.049  26.489 1.00 15.51 ? 254  ARG B CB  1 
ATOM   4908 C CG  . ARG B 1 274 ? 3.677   29.589  26.156 1.00 15.91 ? 254  ARG B CG  1 
ATOM   4909 C CD  . ARG B 1 274 ? 3.127   28.942  27.409 1.00 16.74 ? 254  ARG B CD  1 
ATOM   4910 N NE  . ARG B 1 274 ? 2.723   27.519  27.329 1.00 18.16 ? 254  ARG B NE  1 
ATOM   4911 C CZ  . ARG B 1 274 ? 1.600   27.049  26.763 1.00 17.04 ? 254  ARG B CZ  1 
ATOM   4912 N NH1 . ARG B 1 274 ? 0.753   27.850  26.106 1.00 18.19 ? 254  ARG B NH1 1 
ATOM   4913 N NH2 . ARG B 1 274 ? 1.323   25.751  26.853 1.00 15.77 ? 254  ARG B NH2 1 
ATOM   4914 N N   . GLY B 1 275 ? 3.076   33.124  24.410 1.00 17.37 ? 255  GLY B N   1 
ATOM   4915 C CA  . GLY B 1 275 ? 2.278   33.674  23.325 1.00 14.98 ? 255  GLY B CA  1 
ATOM   4916 C C   . GLY B 1 275 ? 3.033   34.069  22.069 1.00 15.29 ? 255  GLY B C   1 
ATOM   4917 O O   . GLY B 1 275 ? 2.599   33.784  20.969 1.00 15.50 ? 255  GLY B O   1 
ATOM   4918 N N   . LEU B 1 276 ? 4.225   34.652  22.225 1.00 15.43 ? 256  LEU B N   1 
ATOM   4919 C CA  . LEU B 1 276 ? 4.996   35.051  21.057 1.00 16.51 ? 256  LEU B CA  1 
ATOM   4920 C C   . LEU B 1 276 ? 5.209   33.847  20.121 1.00 16.94 ? 256  LEU B C   1 
ATOM   4921 O O   . LEU B 1 276 ? 5.265   34.005  18.926 1.00 17.04 ? 256  LEU B O   1 
ATOM   4922 C CB  . LEU B 1 276 ? 6.372   35.611  21.486 1.00 16.06 ? 256  LEU B CB  1 
ATOM   4923 C CG  . LEU B 1 276 ? 6.332   36.810  22.435 1.00 17.91 ? 256  LEU B CG  1 
ATOM   4924 C CD1 . LEU B 1 276 ? 7.779   37.113  22.825 1.00 17.88 ? 256  LEU B CD1 1 
ATOM   4925 C CD2 . LEU B 1 276 ? 5.682   38.080  21.791 1.00 17.17 ? 256  LEU B CD2 1 
ATOM   4926 N N   . ARG B 1 277 ? 5.312   32.654  20.700 1.00 18.59 ? 257  ARG B N   1 
ATOM   4927 C CA  . ARG B 1 277 ? 5.747   31.457  19.957 1.00 19.86 ? 257  ARG B CA  1 
ATOM   4928 C C   . ARG B 1 277 ? 4.827   31.108  18.805 1.00 20.11 ? 257  ARG B C   1 
ATOM   4929 O O   . ARG B 1 277 ? 5.305   30.660  17.783 1.00 20.30 ? 257  ARG B O   1 
ATOM   4930 C CB  . ARG B 1 277 ? 5.942   30.235  20.874 1.00 18.63 ? 257  ARG B CB  1 
ATOM   4931 C CG  . ARG B 1 277 ? 6.754   30.548  22.116 1.00 18.82 ? 257  ARG B CG  1 
ATOM   4932 C CD  . ARG B 1 277 ? 8.146   31.186  21.819 1.00 16.64 ? 257  ARG B CD  1 
ATOM   4933 N NE  . ARG B 1 277 ? 8.768   31.586  23.071 1.00 17.68 ? 257  ARG B NE  1 
ATOM   4934 C CZ  . ARG B 1 277 ? 9.688   32.540  23.223 1.00 17.42 ? 257  ARG B CZ  1 
ATOM   4935 N NH1 . ARG B 1 277 ? 10.087  33.275  22.196 1.00 13.71 ? 257  ARG B NH1 1 
ATOM   4936 N NH2 . ARG B 1 277 ? 10.158  32.798  24.435 1.00 18.09 ? 257  ARG B NH2 1 
ATOM   4937 N N   . THR B 1 278 ? 3.522   31.316  18.988 1.00 18.39 ? 258  THR B N   1 
ATOM   4938 C CA  . THR B 1 278 ? 2.542   31.042  17.963 1.00 19.20 ? 258  THR B CA  1 
ATOM   4939 C C   . THR B 1 278 ? 1.989   32.331  17.308 1.00 19.09 ? 258  THR B C   1 
ATOM   4940 O O   . THR B 1 278 ? 0.991   32.276  16.573 1.00 18.31 ? 258  THR B O   1 
ATOM   4941 C CB  . THR B 1 278 ? 1.318   30.310  18.579 1.00 19.13 ? 258  THR B CB  1 
ATOM   4942 O OG1 . THR B 1 278 ? 0.781   31.099  19.648 1.00 19.25 ? 258  THR B OG1 1 
ATOM   4943 C CG2 . THR B 1 278 ? 1.696   28.898  19.129 1.00 15.87 ? 258  THR B CG2 1 
ATOM   4944 N N   . LEU B 1 279 ? 2.603   33.473  17.561 1.00 19.96 ? 259  LEU B N   1 
ATOM   4945 C CA  . LEU B 1 279 ? 2.013   34.736  17.042 1.00 19.46 ? 259  LEU B CA  1 
ATOM   4946 C C   . LEU B 1 279 ? 2.016   34.779  15.512 1.00 19.27 ? 259  LEU B C   1 
ATOM   4947 O O   . LEU B 1 279 ? 1.105   35.257  14.927 1.00 19.64 ? 259  LEU B O   1 
ATOM   4948 C CB  . LEU B 1 279 ? 2.703   35.957  17.632 1.00 19.86 ? 259  LEU B CB  1 
ATOM   4949 C CG  . LEU B 1 279 ? 2.178   37.335  17.191 1.00 17.11 ? 259  LEU B CG  1 
ATOM   4950 C CD1 . LEU B 1 279 ? 0.766   37.624  17.755 1.00 15.11 ? 259  LEU B CD1 1 
ATOM   4951 C CD2 . LEU B 1 279 ? 3.131   38.404  17.670 1.00 20.85 ? 259  LEU B CD2 1 
ATOM   4952 N N   . GLY B 1 280 ? 3.026   34.232  14.869 1.00 18.90 ? 260  GLY B N   1 
ATOM   4953 C CA  . GLY B 1 280 ? 3.064   34.235  13.380 1.00 19.29 ? 260  GLY B CA  1 
ATOM   4954 C C   . GLY B 1 280 ? 1.986   33.372  12.762 1.00 18.48 ? 260  GLY B C   1 
ATOM   4955 O O   . GLY B 1 280 ? 1.240   33.831  11.874 1.00 18.78 ? 260  GLY B O   1 
ATOM   4956 N N   . VAL B 1 281 ? 1.876   32.120  13.215 1.00 19.26 ? 261  VAL B N   1 
ATOM   4957 C CA  . VAL B 1 281 ? 0.850   31.228  12.679 1.00 20.36 ? 261  VAL B CA  1 
ATOM   4958 C C   . VAL B 1 281 ? -0.539  31.780  12.973 1.00 20.20 ? 261  VAL B C   1 
ATOM   4959 O O   . VAL B 1 281 ? -1.451  31.626  12.151 1.00 22.36 ? 261  VAL B O   1 
ATOM   4960 C CB  . VAL B 1 281 ? 0.935   29.721  13.174 1.00 20.23 ? 261  VAL B CB  1 
ATOM   4961 C CG1 . VAL B 1 281 ? 2.239   29.094  12.671 1.00 23.63 ? 261  VAL B CG1 1 
ATOM   4962 C CG2 . VAL B 1 281 ? 0.732   29.575  14.726 1.00 19.89 ? 261  VAL B CG2 1 
ATOM   4963 N N   . ARG B 1 282 ? -0.701  32.437  14.122 1.00 19.34 ? 262  ARG B N   1 
ATOM   4964 C CA  . ARG B 1 282 ? -2.019  32.987  14.482 1.00 17.81 ? 262  ARG B CA  1 
ATOM   4965 C C   . ARG B 1 282 ? -2.373  34.197  13.624 1.00 18.23 ? 262  ARG B C   1 
ATOM   4966 O O   . ARG B 1 282 ? -3.463  34.272  13.025 1.00 17.31 ? 262  ARG B O   1 
ATOM   4967 C CB  . ARG B 1 282 ? -2.105  33.328  15.986 1.00 17.62 ? 262  ARG B CB  1 
ATOM   4968 C CG  . ARG B 1 282 ? -2.297  32.076  16.888 1.00 18.58 ? 262  ARG B CG  1 
ATOM   4969 C CD  . ARG B 1 282 ? -2.374  32.421  18.376 1.00 18.85 ? 262  ARG B CD  1 
ATOM   4970 N NE  . ARG B 1 282 ? -1.162  32.996  18.981 1.00 17.14 ? 262  ARG B NE  1 
ATOM   4971 C CZ  . ARG B 1 282 ? -1.024  34.298  19.280 1.00 17.87 ? 262  ARG B CZ  1 
ATOM   4972 N NH1 . ARG B 1 282 ? -2.001  35.171  18.968 1.00 15.93 ? 262  ARG B NH1 1 
ATOM   4973 N NH2 . ARG B 1 282 ? 0.065   34.735  19.914 1.00 18.39 ? 262  ARG B NH2 1 
ATOM   4974 N N   . LEU B 1 283 ? -1.484  35.172  13.586 1.00 18.23 ? 263  LEU B N   1 
ATOM   4975 C CA  . LEU B 1 283 ? -1.706  36.365  12.760 1.00 18.45 ? 263  LEU B CA  1 
ATOM   4976 C C   . LEU B 1 283 ? -1.970  36.078  11.281 1.00 18.23 ? 263  LEU B C   1 
ATOM   4977 O O   . LEU B 1 283 ? -2.797  36.776  10.674 1.00 17.64 ? 263  LEU B O   1 
ATOM   4978 C CB  . LEU B 1 283 ? -0.506  37.303  12.864 1.00 18.44 ? 263  LEU B CB  1 
ATOM   4979 C CG  . LEU B 1 283 ? -0.411  38.109  14.145 1.00 20.09 ? 263  LEU B CG  1 
ATOM   4980 C CD1 . LEU B 1 283 ? 0.871   38.926  14.118 1.00 21.72 ? 263  LEU B CD1 1 
ATOM   4981 C CD2 . LEU B 1 283 ? -1.642  39.012  14.344 1.00 20.15 ? 263  LEU B CD2 1 
ATOM   4982 N N   . ARG B 1 284 ? -1.262  35.093  10.698 1.00 18.89 ? 264  ARG B N   1 
ATOM   4983 C CA  . ARG B 1 284 ? -1.488  34.744  9.274  1.00 19.58 ? 264  ARG B CA  1 
ATOM   4984 C C   . ARG B 1 284 ? -2.912  34.247  9.118  1.00 18.86 ? 264  ARG B C   1 
ATOM   4985 O O   . ARG B 1 284 ? -3.612  34.597  8.155  1.00 17.70 ? 264  ARG B O   1 
ATOM   4986 C CB  . ARG B 1 284 ? -0.487  33.715  8.761  1.00 19.72 ? 264  ARG B CB  1 
ATOM   4987 C CG  . ARG B 1 284 ? 0.888   34.359  8.458  1.00 21.11 ? 264  ARG B CG  1 
ATOM   4988 C CD  . ARG B 1 284 ? 1.873   33.409  7.670  1.00 24.21 ? 264  ARG B CD  1 
ATOM   4989 N NE  . ARG B 1 284 ? 2.255   32.223  8.469  1.00 27.43 ? 264  ARG B NE  1 
ATOM   4990 C CZ  . ARG B 1 284 ? 3.213   32.213  9.405  1.00 29.16 ? 264  ARG B CZ  1 
ATOM   4991 N NH1 . ARG B 1 284 ? 3.907   33.322  9.664  1.00 31.45 ? 264  ARG B NH1 1 
ATOM   4992 N NH2 . ARG B 1 284 ? 3.492   31.100  10.086 1.00 27.66 ? 264  ARG B NH2 1 
ATOM   4993 N N   . GLN B 1 285 ? -3.372  33.482  10.098 1.00 18.65 ? 265  GLN B N   1 
ATOM   4994 C CA  . GLN B 1 285 ? -4.730  32.975  10.022 1.00 18.99 ? 265  GLN B CA  1 
ATOM   4995 C C   . GLN B 1 285 ? -5.761  34.097  10.232 1.00 19.68 ? 265  GLN B C   1 
ATOM   4996 O O   . GLN B 1 285 ? -6.736  34.179  9.486  1.00 20.58 ? 265  GLN B O   1 
ATOM   4997 C CB  . GLN B 1 285 ? -4.913  31.866  11.041 1.00 20.74 ? 265  GLN B CB  1 
ATOM   4998 C CG  . GLN B 1 285 ? -6.322  31.293  11.103 1.00 21.82 ? 265  GLN B CG  1 
ATOM   4999 C CD  . GLN B 1 285 ? -6.622  30.295  10.019 1.00 28.28 ? 265  GLN B CD  1 
ATOM   5000 O OE1 . GLN B 1 285 ? -5.725  29.669  9.432  1.00 29.45 ? 265  GLN B OE1 1 
ATOM   5001 N NE2 . GLN B 1 285 ? -7.913  30.119  9.746  1.00 32.98 ? 265  GLN B NE2 1 
ATOM   5002 N N   . HIS B 1 286 ? -5.576  34.924  11.258 1.00 18.85 ? 266  HIS B N   1 
ATOM   5003 C CA  . HIS B 1 286 ? -6.405  36.135  11.463 1.00 18.39 ? 266  HIS B CA  1 
ATOM   5004 C C   . HIS B 1 286 ? -6.447  37.025  10.215 1.00 19.35 ? 266  HIS B C   1 
ATOM   5005 O O   . HIS B 1 286 ? -7.501  37.502  9.848  1.00 21.13 ? 266  HIS B O   1 
ATOM   5006 C CB  . HIS B 1 286 ? -5.887  36.974  12.615 1.00 17.69 ? 266  HIS B CB  1 
ATOM   5007 C CG  . HIS B 1 286 ? -5.946  36.290  13.937 1.00 17.96 ? 266  HIS B CG  1 
ATOM   5008 N ND1 . HIS B 1 286 ? -7.124  35.866  14.503 1.00 17.41 ? 266  HIS B ND1 1 
ATOM   5009 C CD2 . HIS B 1 286 ? -4.969  35.997  14.823 1.00 18.44 ? 266  HIS B CD2 1 
ATOM   5010 C CE1 . HIS B 1 286 ? -6.867  35.331  15.684 1.00 19.62 ? 266  HIS B CE1 1 
ATOM   5011 N NE2 . HIS B 1 286 ? -5.563  35.391  15.894 1.00 18.79 ? 266  HIS B NE2 1 
ATOM   5012 N N   . HIS B 1 287 ? -5.302  37.261  9.583  1.00 19.46 ? 267  HIS B N   1 
ATOM   5013 C CA  . HIS B 1 287 ? -5.220  38.010  8.347  1.00 19.88 ? 267  HIS B CA  1 
ATOM   5014 C C   . HIS B 1 287 ? -6.039  37.332  7.241  1.00 19.78 ? 267  HIS B C   1 
ATOM   5015 O O   . HIS B 1 287 ? -6.980  37.903  6.722  1.00 19.36 ? 267  HIS B O   1 
ATOM   5016 C CB  . HIS B 1 287 ? -3.740  38.107  7.947  1.00 19.39 ? 267  HIS B CB  1 
ATOM   5017 C CG  . HIS B 1 287 ? -3.454  38.966  6.749  1.00 23.27 ? 267  HIS B CG  1 
ATOM   5018 N ND1 . HIS B 1 287 ? -4.304  39.085  5.673  1.00 27.80 ? 267  HIS B ND1 1 
ATOM   5019 C CD2 . HIS B 1 287 ? -2.349  39.679  6.428  1.00 23.45 ? 267  HIS B CD2 1 
ATOM   5020 C CE1 . HIS B 1 287 ? -3.769  39.884  4.766  1.00 26.69 ? 267  HIS B CE1 1 
ATOM   5021 N NE2 . HIS B 1 287 ? -2.575  40.252  5.196  1.00 28.10 ? 267  HIS B NE2 1 
ATOM   5022 N N   . GLU B 1 288 ? -5.664  36.121  6.856  1.00 20.56 ? 268  GLU B N   1 
ATOM   5023 C CA  . GLU B 1 288 ? -6.403  35.399  5.827  1.00 21.59 ? 268  GLU B CA  1 
ATOM   5024 C C   . GLU B 1 288 ? -7.918  35.408  6.043  1.00 20.85 ? 268  GLU B C   1 
ATOM   5025 O O   . GLU B 1 288 ? -8.670  35.809  5.148  1.00 19.67 ? 268  GLU B O   1 
ATOM   5026 C CB  . GLU B 1 288 ? -5.877  33.968  5.710  1.00 22.97 ? 268  GLU B CB  1 
ATOM   5027 C CG  . GLU B 1 288 ? -6.568  33.135  4.615  1.00 28.57 ? 268  GLU B CG  1 
ATOM   5028 C CD  . GLU B 1 288 ? -5.874  31.770  4.409  1.00 37.65 ? 268  GLU B CD  1 
ATOM   5029 O OE1 . GLU B 1 288 ? -4.759  31.723  3.824  1.00 40.01 ? 268  GLU B OE1 1 
ATOM   5030 O OE2 . GLU B 1 288 ? -6.462  30.747  4.834  1.00 40.84 ? 268  GLU B OE2 1 
ATOM   5031 N N   . SER B 1 289 ? -8.365  34.969  7.227  1.00 19.86 ? 269  SER B N   1 
ATOM   5032 C CA  . SER B 1 289 ? -9.792  34.878  7.514  1.00 19.93 ? 269  SER B CA  1 
ATOM   5033 C C   . SER B 1 289 ? -10.507 36.236  7.562  1.00 19.98 ? 269  SER B C   1 
ATOM   5034 O O   . SER B 1 289 ? -11.633 36.350  7.049  1.00 20.38 ? 269  SER B O   1 
ATOM   5035 C CB  . SER B 1 289 ? -10.046 34.114  8.804  1.00 19.21 ? 269  SER B CB  1 
ATOM   5036 O OG  . SER B 1 289 ? -9.687  32.760  8.664  1.00 20.39 ? 269  SER B OG  1 
ATOM   5037 N N   . SER B 1 290 ? -9.912  37.234  8.212  1.00 20.56 ? 270  SER B N   1 
ATOM   5038 C CA  . SER B 1 290 ? -10.601 38.524  8.322  1.00 20.43 ? 270  SER B CA  1 
ATOM   5039 C C   . SER B 1 290 ? -10.773 39.181  6.965  1.00 20.58 ? 270  SER B C   1 
ATOM   5040 O O   . SER B 1 290 ? -11.769 39.820  6.724  1.00 18.58 ? 270  SER B O   1 
ATOM   5041 C CB  . SER B 1 290 ? -9.910  39.500  9.286  1.00 20.92 ? 270  SER B CB  1 
ATOM   5042 O OG  . SER B 1 290 ? -8.665  39.949  8.778  1.00 21.69 ? 270  SER B OG  1 
ATOM   5043 N N   . LEU B 1 291 ? -9.770  39.058  6.103  1.00 20.27 ? 271  LEU B N   1 
ATOM   5044 C CA  . LEU B 1 291 ? -9.866  39.632  4.772  1.00 21.76 ? 271  LEU B CA  1 
ATOM   5045 C C   . LEU B 1 291 ? -10.973 38.959  3.947  1.00 21.90 ? 271  LEU B C   1 
ATOM   5046 O O   . LEU B 1 291 ? -11.745 39.646  3.266  1.00 21.13 ? 271  LEU B O   1 
ATOM   5047 C CB  . LEU B 1 291 ? -8.511  39.556  4.069  1.00 21.57 ? 271  LEU B CB  1 
ATOM   5048 C CG  . LEU B 1 291 ? -8.339  40.233  2.706  1.00 26.36 ? 271  LEU B CG  1 
ATOM   5049 C CD1 . LEU B 1 291 ? -8.931  41.662  2.677  1.00 27.87 ? 271  LEU B CD1 1 
ATOM   5050 C CD2 . LEU B 1 291 ? -6.844  40.262  2.363  1.00 29.52 ? 271  LEU B CD2 1 
ATOM   5051 N N   . LYS B 1 292 ? -11.059 37.626  4.007  1.00 21.98 ? 272  LYS B N   1 
ATOM   5052 C CA  . LYS B 1 292 ? -12.137 36.909  3.343  1.00 22.39 ? 272  LYS B CA  1 
ATOM   5053 C C   . LYS B 1 292 ? -13.503 37.403  3.870  1.00 22.24 ? 272  LYS B C   1 
ATOM   5054 O O   . LYS B 1 292 ? -14.418 37.651  3.074  1.00 21.80 ? 272  LYS B O   1 
ATOM   5055 C CB  . LYS B 1 292 ? -11.985 35.373  3.455  1.00 22.94 ? 272  LYS B CB  1 
ATOM   5056 C CG  . LYS B 1 292 ? -13.036 34.620  2.611  1.00 27.06 ? 272  LYS B CG  1 
ATOM   5057 C CD  . LYS B 1 292 ? -12.873 33.093  2.566  1.00 34.26 ? 272  LYS B CD  1 
ATOM   5058 C CE  . LYS B 1 292 ? -13.743 32.500  1.425  1.00 36.08 ? 272  LYS B CE  1 
ATOM   5059 N NZ  . LYS B 1 292 ? -14.253 31.108  1.673  1.00 36.37 ? 272  LYS B NZ  1 
ATOM   5060 N N   . VAL B 1 293 ? -13.640 37.581  5.194  1.00 21.63 ? 273  VAL B N   1 
ATOM   5061 C CA  . VAL B 1 293 ? -14.949 38.030  5.734  1.00 21.55 ? 273  VAL B CA  1 
ATOM   5062 C C   . VAL B 1 293 ? -15.283 39.452  5.234  1.00 21.41 ? 273  VAL B C   1 
ATOM   5063 O O   . VAL B 1 293 ? -16.437 39.745  4.873  1.00 22.05 ? 273  VAL B O   1 
ATOM   5064 C CB  . VAL B 1 293 ? -15.018 37.944  7.283  1.00 21.76 ? 273  VAL B CB  1 
ATOM   5065 C CG1 . VAL B 1 293 ? -16.285 38.634  7.801  1.00 22.76 ? 273  VAL B CG1 1 
ATOM   5066 C CG2 . VAL B 1 293 ? -14.947 36.439  7.754  1.00 20.39 ? 273  VAL B CG2 1 
ATOM   5067 N N   . ALA B 1 294 ? -14.253 40.302  5.192  1.00 21.83 ? 274  ALA B N   1 
ATOM   5068 C CA  . ALA B 1 294 ? -14.400 41.724  4.849  1.00 20.95 ? 274  ALA B CA  1 
ATOM   5069 C C   . ALA B 1 294 ? -14.758 41.893  3.370  1.00 21.16 ? 274  ALA B C   1 
ATOM   5070 O O   . ALA B 1 294 ? -15.647 42.702  3.004  1.00 21.67 ? 274  ALA B O   1 
ATOM   5071 C CB  . ALA B 1 294 ? -13.123 42.466  5.185  1.00 18.89 ? 274  ALA B CB  1 
ATOM   5072 N N   . GLU B 1 295 ? -14.114 41.096  2.521  1.00 21.85 ? 275  GLU B N   1 
ATOM   5073 C CA  . GLU B 1 295 ? -14.487 41.036  1.088  1.00 22.56 ? 275  GLU B CA  1 
ATOM   5074 C C   . GLU B 1 295 ? -15.956 40.626  0.863  1.00 22.47 ? 275  GLU B C   1 
ATOM   5075 O O   . GLU B 1 295 ? -16.683 41.257  0.093  1.00 22.38 ? 275  GLU B O   1 
ATOM   5076 C CB  . GLU B 1 295 ? -13.509 40.145  0.290  1.00 23.47 ? 275  GLU B CB  1 
ATOM   5077 C CG  . GLU B 1 295 ? -12.129 40.739  0.242  1.00 26.67 ? 275  GLU B CG  1 
ATOM   5078 C CD  . GLU B 1 295 ? -11.076 39.905  -0.492 1.00 33.92 ? 275  GLU B CD  1 
ATOM   5079 O OE1 . GLU B 1 295 ? -11.328 38.754  -0.894 1.00 36.28 ? 275  GLU B OE1 1 
ATOM   5080 O OE2 . GLU B 1 295 ? -9.958  40.424  -0.684 1.00 37.19 ? 275  GLU B OE2 1 
ATOM   5081 N N   . TRP B 1 296 ? -16.385 39.586  1.566  1.00 22.11 ? 276  TRP B N   1 
ATOM   5082 C CA  . TRP B 1 296 ? -17.752 39.095  1.495  1.00 21.80 ? 276  TRP B CA  1 
ATOM   5083 C C   . TRP B 1 296 ? -18.720 40.144  2.067  1.00 21.05 ? 276  TRP B C   1 
ATOM   5084 O O   . TRP B 1 296 ? -19.783 40.419  1.474  1.00 20.57 ? 276  TRP B O   1 
ATOM   5085 C CB  . TRP B 1 296 ? -17.857 37.743  2.227  1.00 21.80 ? 276  TRP B CB  1 
ATOM   5086 C CG  . TRP B 1 296 ? -19.292 37.279  2.375  1.00 21.97 ? 276  TRP B CG  1 
ATOM   5087 C CD1 . TRP B 1 296 ? -20.036 36.609  1.452  1.00 23.04 ? 276  TRP B CD1 1 
ATOM   5088 C CD2 . TRP B 1 296 ? -20.130 37.452  3.527  1.00 23.56 ? 276  TRP B CD2 1 
ATOM   5089 N NE1 . TRP B 1 296 ? -21.305 36.353  1.956  1.00 24.10 ? 276  TRP B NE1 1 
ATOM   5090 C CE2 . TRP B 1 296 ? -21.394 36.880  3.218  1.00 23.04 ? 276  TRP B CE2 1 
ATOM   5091 C CE3 . TRP B 1 296 ? -19.935 38.029  4.797  1.00 23.06 ? 276  TRP B CE3 1 
ATOM   5092 C CZ2 . TRP B 1 296 ? -22.451 36.849  4.135  1.00 24.20 ? 276  TRP B CZ2 1 
ATOM   5093 C CZ3 . TRP B 1 296 ? -21.003 38.031  5.690  1.00 24.17 ? 276  TRP B CZ3 1 
ATOM   5094 C CH2 . TRP B 1 296 ? -22.240 37.444  5.352  1.00 23.18 ? 276  TRP B CH2 1 
ATOM   5095 N N   . LEU B 1 297 ? -18.356 40.770  3.192  1.00 20.43 ? 277  LEU B N   1 
ATOM   5096 C CA  . LEU B 1 297 ? -19.181 41.878  3.692  1.00 20.30 ? 277  LEU B CA  1 
ATOM   5097 C C   . LEU B 1 297 ? -19.281 43.034  2.693  1.00 21.17 ? 277  LEU B C   1 
ATOM   5098 O O   . LEU B 1 297 ? -20.363 43.568  2.494  1.00 20.27 ? 277  LEU B O   1 
ATOM   5099 C CB  . LEU B 1 297 ? -18.722 42.395  5.048  1.00 19.86 ? 277  LEU B CB  1 
ATOM   5100 C CG  . LEU B 1 297 ? -18.816 41.464  6.255  1.00 19.34 ? 277  LEU B CG  1 
ATOM   5101 C CD1 . LEU B 1 297 ? -17.917 42.033  7.308  1.00 18.09 ? 277  LEU B CD1 1 
ATOM   5102 C CD2 . LEU B 1 297 ? -20.273 41.356  6.773  1.00 17.21 ? 277  LEU B CD2 1 
ATOM   5103 N N   . ALA B 1 298 ? -18.182 43.379  2.029  1.00 20.81 ? 278  ALA B N   1 
ATOM   5104 C CA  . ALA B 1 298 ? -18.180 44.468  1.068  1.00 23.10 ? 278  ALA B CA  1 
ATOM   5105 C C   . ALA B 1 298 ? -19.169 44.267  -0.104 1.00 24.53 ? 278  ALA B C   1 
ATOM   5106 O O   . ALA B 1 298 ? -19.685 45.251  -0.664 1.00 24.92 ? 278  ALA B O   1 
ATOM   5107 C CB  . ALA B 1 298 ? -16.758 44.742  0.555  1.00 22.74 ? 278  ALA B CB  1 
ATOM   5108 N N   . GLU B 1 299 ? -19.448 43.010  -0.452 1.00 25.40 ? 279  GLU B N   1 
ATOM   5109 C CA  . GLU B 1 299 ? -20.378 42.692  -1.549 1.00 26.71 ? 279  GLU B CA  1 
ATOM   5110 C C   . GLU B 1 299 ? -21.812 42.514  -1.035 1.00 26.81 ? 279  GLU B C   1 
ATOM   5111 O O   . GLU B 1 299 ? -22.733 42.293  -1.823 1.00 25.97 ? 279  GLU B O   1 
ATOM   5112 C CB  . GLU B 1 299 ? -19.965 41.409  -2.268 1.00 27.49 ? 279  GLU B CB  1 
ATOM   5113 C CG  . GLU B 1 299 ? -18.704 41.513  -3.117 1.00 32.08 ? 279  GLU B CG  1 
ATOM   5114 C CD  . GLU B 1 299 ? -18.285 40.156  -3.732 1.00 38.88 ? 279  GLU B CD  1 
ATOM   5115 O OE1 . GLU B 1 299 ? -17.332 39.520  -3.195 1.00 40.59 ? 279  GLU B OE1 1 
ATOM   5116 O OE2 . GLU B 1 299 ? -18.911 39.721  -4.739 1.00 40.59 ? 279  GLU B OE2 1 
ATOM   5117 N N   . HIS B 1 300 ? -21.996 42.601  0.276  1.00 25.63 ? 280  HIS B N   1 
ATOM   5118 C CA  . HIS B 1 300 ? -23.299 42.325  0.860  1.00 25.43 ? 280  HIS B CA  1 
ATOM   5119 C C   . HIS B 1 300 ? -24.275 43.514  0.821  1.00 25.33 ? 280  HIS B C   1 
ATOM   5120 O O   . HIS B 1 300 ? -23.933 44.622  1.237  1.00 24.55 ? 280  HIS B O   1 
ATOM   5121 C CB  . HIS B 1 300 ? -23.166 41.811  2.295  1.00 25.75 ? 280  HIS B CB  1 
ATOM   5122 C CG  . HIS B 1 300 ? -24.408 41.159  2.790  1.00 24.31 ? 280  HIS B CG  1 
ATOM   5123 N ND1 . HIS B 1 300 ? -24.532 39.794  2.899  1.00 25.54 ? 280  HIS B ND1 1 
ATOM   5124 C CD2 . HIS B 1 300 ? -25.615 41.676  3.121  1.00 25.11 ? 280  HIS B CD2 1 
ATOM   5125 C CE1 . HIS B 1 300 ? -25.749 39.496  3.319  1.00 24.90 ? 280  HIS B CE1 1 
ATOM   5126 N NE2 . HIS B 1 300 ? -26.426 40.623  3.457  1.00 27.04 ? 280  HIS B NE2 1 
ATOM   5127 N N   . PRO B 1 301 ? -25.514 43.265  0.355  1.00 25.50 ? 281  PRO B N   1 
ATOM   5128 C CA  . PRO B 1 301 ? -26.551 44.292  0.214  1.00 25.74 ? 281  PRO B CA  1 
ATOM   5129 C C   . PRO B 1 301 ? -26.879 45.070  1.484  1.00 25.37 ? 281  PRO B C   1 
ATOM   5130 O O   . PRO B 1 301 ? -27.286 46.215  1.379  1.00 24.99 ? 281  PRO B O   1 
ATOM   5131 C CB  . PRO B 1 301 ? -27.799 43.494  -0.209 1.00 26.01 ? 281  PRO B CB  1 
ATOM   5132 C CG  . PRO B 1 301 ? -27.292 42.207  -0.736 1.00 26.13 ? 281  PRO B CG  1 
ATOM   5133 C CD  . PRO B 1 301 ? -25.974 41.935  -0.099 1.00 25.59 ? 281  PRO B CD  1 
ATOM   5134 N N   . GLN B 1 302 ? -26.731 44.456  2.657  1.00 24.77 ? 282  GLN B N   1 
ATOM   5135 C CA  . GLN B 1 302 ? -27.156 45.114  3.902  1.00 24.59 ? 282  GLN B CA  1 
ATOM   5136 C C   . GLN B 1 302 ? -26.047 45.960  4.507  1.00 23.37 ? 282  GLN B C   1 
ATOM   5137 O O   . GLN B 1 302 ? -26.250 46.631  5.495  1.00 23.79 ? 282  GLN B O   1 
ATOM   5138 C CB  . GLN B 1 302 ? -27.720 44.096  4.910  1.00 24.13 ? 282  GLN B CB  1 
ATOM   5139 C CG  . GLN B 1 302 ? -29.101 43.566  4.483  1.00 25.13 ? 282  GLN B CG  1 
ATOM   5140 C CD  . GLN B 1 302 ? -29.466 42.289  5.187  1.00 24.31 ? 282  GLN B CD  1 
ATOM   5141 O OE1 . GLN B 1 302 ? -29.362 41.187  4.622  1.00 26.82 ? 282  GLN B OE1 1 
ATOM   5142 N NE2 . GLN B 1 302 ? -29.864 42.413  6.440  1.00 24.87 ? 282  GLN B NE2 1 
ATOM   5143 N N   . VAL B 1 303 ? -24.886 45.947  3.856  1.00 23.81 ? 283  VAL B N   1 
ATOM   5144 C CA  . VAL B 1 303 ? -23.665 46.591  4.330  1.00 22.83 ? 283  VAL B CA  1 
ATOM   5145 C C   . VAL B 1 303 ? -23.341 47.871  3.565  1.00 22.75 ? 283  VAL B C   1 
ATOM   5146 O O   . VAL B 1 303 ? -23.220 47.852  2.346  1.00 21.81 ? 283  VAL B O   1 
ATOM   5147 C CB  . VAL B 1 303 ? -22.442 45.608  4.234  1.00 23.13 ? 283  VAL B CB  1 
ATOM   5148 C CG1 . VAL B 1 303 ? -21.107 46.329  4.539  1.00 22.73 ? 283  VAL B CG1 1 
ATOM   5149 C CG2 . VAL B 1 303 ? -22.631 44.421  5.165  1.00 20.76 ? 283  VAL B CG2 1 
ATOM   5150 N N   . ALA B 1 304 ? -23.164 48.960  4.297  1.00 22.04 ? 284  ALA B N   1 
ATOM   5151 C CA  . ALA B 1 304 ? -22.908 50.257  3.698  1.00 22.72 ? 284  ALA B CA  1 
ATOM   5152 C C   . ALA B 1 304 ? -21.441 50.471  3.370  1.00 22.87 ? 284  ALA B C   1 
ATOM   5153 O O   . ALA B 1 304 ? -21.122 51.034  2.328  1.00 23.08 ? 284  ALA B O   1 
ATOM   5154 C CB  . ALA B 1 304 ? -23.432 51.385  4.612  1.00 23.41 ? 284  ALA B CB  1 
ATOM   5155 N N   . ARG B 1 305 ? -20.559 49.997  4.254  1.00 22.03 ? 285  ARG B N   1 
ATOM   5156 C CA  . ARG B 1 305 ? -19.118 50.263  4.162  1.00 22.10 ? 285  ARG B CA  1 
ATOM   5157 C C   . ARG B 1 305 ? -18.367 49.270  5.037  1.00 21.10 ? 285  ARG B C   1 
ATOM   5158 O O   . ARG B 1 305 ? -18.887 48.839  6.066  1.00 21.07 ? 285  ARG B O   1 
ATOM   5159 C CB  . ARG B 1 305 ? -18.843 51.686  4.668  1.00 21.90 ? 285  ARG B CB  1 
ATOM   5160 C CG  . ARG B 1 305 ? -17.589 52.322  4.096  1.00 25.10 ? 285  ARG B CG  1 
ATOM   5161 C CD  . ARG B 1 305 ? -16.893 53.084  5.203  1.00 30.85 ? 285  ARG B CD  1 
ATOM   5162 N NE  . ARG B 1 305 ? -17.568 54.330  5.450  1.00 33.07 ? 285  ARG B NE  1 
ATOM   5163 C CZ  . ARG B 1 305 ? -17.549 55.010  6.591  1.00 32.58 ? 285  ARG B CZ  1 
ATOM   5164 N NH1 . ARG B 1 305 ? -16.895 54.572  7.680  1.00 32.61 ? 285  ARG B NH1 1 
ATOM   5165 N NH2 . ARG B 1 305 ? -18.211 56.149  6.624  1.00 32.99 ? 285  ARG B NH2 1 
ATOM   5166 N N   . VAL B 1 306 ? -17.138 48.919  4.648  1.00 21.27 ? 286  VAL B N   1 
ATOM   5167 C CA  . VAL B 1 306 ? -16.297 48.032  5.460  1.00 19.77 ? 286  VAL B CA  1 
ATOM   5168 C C   . VAL B 1 306 ? -15.007 48.768  5.795  1.00 20.31 ? 286  VAL B C   1 
ATOM   5169 O O   . VAL B 1 306 ? -14.319 49.273  4.901  1.00 19.67 ? 286  VAL B O   1 
ATOM   5170 C CB  . VAL B 1 306 ? -15.954 46.679  4.750  1.00 20.36 ? 286  VAL B CB  1 
ATOM   5171 C CG1 . VAL B 1 306 ? -15.027 45.799  5.625  1.00 19.58 ? 286  VAL B CG1 1 
ATOM   5172 C CG2 . VAL B 1 306 ? -17.211 45.902  4.383  1.00 18.18 ? 286  VAL B CG2 1 
ATOM   5173 N N   . ASN B 1 307 ? -14.701 48.826  7.086  1.00 20.11 ? 287  ASN B N   1 
ATOM   5174 C CA  . ASN B 1 307 ? -13.512 49.497  7.580  1.00 18.94 ? 287  ASN B CA  1 
ATOM   5175 C C   . ASN B 1 307 ? -12.515 48.416  7.910  1.00 19.24 ? 287  ASN B C   1 
ATOM   5176 O O   . ASN B 1 307 ? -12.392 48.029  9.059  1.00 18.41 ? 287  ASN B O   1 
ATOM   5177 C CB  . ASN B 1 307 ? -13.827 50.286  8.858  1.00 19.29 ? 287  ASN B CB  1 
ATOM   5178 C CG  . ASN B 1 307 ? -15.017 51.209  8.708  1.00 17.69 ? 287  ASN B CG  1 
ATOM   5179 O OD1 . ASN B 1 307 ? -15.163 51.904  7.691  1.00 19.35 ? 287  ASN B OD1 1 
ATOM   5180 N ND2 . ASN B 1 307 ? -15.875 51.230  9.724  1.00 15.45 ? 287  ASN B ND2 1 
ATOM   5181 N N   . HIS B 1 308 ? -11.842 47.880  6.903  1.00 20.35 ? 288  HIS B N   1 
ATOM   5182 C CA  . HIS B 1 308 ? -10.737 46.960  7.174  1.00 20.60 ? 288  HIS B CA  1 
ATOM   5183 C C   . HIS B 1 308 ? -9.472  47.585  6.570  1.00 20.86 ? 288  HIS B C   1 
ATOM   5184 O O   . HIS B 1 308 ? -9.469  47.858  5.375  1.00 21.54 ? 288  HIS B O   1 
ATOM   5185 C CB  . HIS B 1 308 ? -11.009 45.586  6.531  1.00 20.79 ? 288  HIS B CB  1 
ATOM   5186 C CG  . HIS B 1 308 ? -9.985  44.553  6.884  1.00 21.10 ? 288  HIS B CG  1 
ATOM   5187 N ND1 . HIS B 1 308 ? -10.319 43.315  7.390  1.00 21.93 ? 288  HIS B ND1 1 
ATOM   5188 C CD2 . HIS B 1 308 ? -8.634  44.596  6.857  1.00 19.45 ? 288  HIS B CD2 1 
ATOM   5189 C CE1 . HIS B 1 308 ? -9.215  42.637  7.650  1.00 23.91 ? 288  HIS B CE1 1 
ATOM   5190 N NE2 . HIS B 1 308 ? -8.181  43.391  7.335  1.00 23.37 ? 288  HIS B NE2 1 
ATOM   5191 N N   . PRO B 1 309 ? -8.389  47.782  7.362  1.00 21.89 ? 289  PRO B N   1 
ATOM   5192 C CA  . PRO B 1 309 ? -7.226  48.447  6.762  1.00 22.17 ? 289  PRO B CA  1 
ATOM   5193 C C   . PRO B 1 309 ? -6.709  47.821  5.449  1.00 23.05 ? 289  PRO B C   1 
ATOM   5194 O O   . PRO B 1 309 ? -6.192  48.560  4.589  1.00 22.50 ? 289  PRO B O   1 
ATOM   5195 C CB  . PRO B 1 309 ? -6.158  48.379  7.856  1.00 22.82 ? 289  PRO B CB  1 
ATOM   5196 C CG  . PRO B 1 309 ? -6.940  48.255  9.122  1.00 22.10 ? 289  PRO B CG  1 
ATOM   5197 C CD  . PRO B 1 309 ? -8.156  47.434  8.773  1.00 21.12 ? 289  PRO B CD  1 
ATOM   5198 N N   . ALA B 1 310 ? -6.865  46.509  5.289  1.00 23.82 ? 290  ALA B N   1 
ATOM   5199 C CA  . ALA B 1 310 ? -6.363  45.812  4.101  1.00 25.89 ? 290  ALA B CA  1 
ATOM   5200 C C   . ALA B 1 310 ? -7.230  45.968  2.838  1.00 27.29 ? 290  ALA B C   1 
ATOM   5201 O O   . ALA B 1 310 ? -6.871  45.474  1.760  1.00 28.20 ? 290  ALA B O   1 
ATOM   5202 C CB  . ALA B 1 310 ? -6.064  44.300  4.417  1.00 25.18 ? 290  ALA B CB  1 
ATOM   5203 N N   . LEU B 1 311 ? -8.329  46.705  2.957  1.00 28.61 ? 291  LEU B N   1 
ATOM   5204 C CA  . LEU B 1 311 ? -9.355  46.757  1.930  1.00 29.42 ? 291  LEU B CA  1 
ATOM   5205 C C   . LEU B 1 311 ? -9.419  48.138  1.283  1.00 30.20 ? 291  LEU B C   1 
ATOM   5206 O O   . LEU B 1 311 ? -9.542  49.144  1.984  1.00 30.06 ? 291  LEU B O   1 
ATOM   5207 C CB  . LEU B 1 311 ? -10.714 46.374  2.560  1.00 29.94 ? 291  LEU B CB  1 
ATOM   5208 C CG  . LEU B 1 311 ? -11.766 45.644  1.735  1.00 30.42 ? 291  LEU B CG  1 
ATOM   5209 C CD1 . LEU B 1 311 ? -11.281 44.277  1.255  1.00 30.27 ? 291  LEU B CD1 1 
ATOM   5210 C CD2 . LEU B 1 311 ? -13.074 45.528  2.511  1.00 29.88 ? 291  LEU B CD2 1 
ATOM   5211 N N   . PRO B 1 312 ? -9.329  48.209  -0.068 1.00 30.98 ? 292  PRO B N   1 
ATOM   5212 C CA  . PRO B 1 312 ? -9.456  49.524  -0.733 1.00 30.82 ? 292  PRO B CA  1 
ATOM   5213 C C   . PRO B 1 312 ? -10.767 50.256  -0.338 1.00 30.19 ? 292  PRO B C   1 
ATOM   5214 O O   . PRO B 1 312 ? -11.768 49.600  -0.032 1.00 30.82 ? 292  PRO B O   1 
ATOM   5215 C CB  . PRO B 1 312 ? -9.397  49.179  -2.236 1.00 31.32 ? 292  PRO B CB  1 
ATOM   5216 C CG  . PRO B 1 312 ? -8.750  47.836  -2.306 1.00 31.33 ? 292  PRO B CG  1 
ATOM   5217 C CD  . PRO B 1 312 ? -9.068  47.113  -1.023 1.00 31.22 ? 292  PRO B CD  1 
ATOM   5218 N N   . GLY B 1 313 ? -10.736 51.584  -0.266 1.00 28.71 ? 293  GLY B N   1 
ATOM   5219 C CA  . GLY B 1 313 ? -11.913 52.367  0.144  1.00 28.28 ? 293  GLY B CA  1 
ATOM   5220 C C   . GLY B 1 313 ? -12.069 52.562  1.642  1.00 27.85 ? 293  GLY B C   1 
ATOM   5221 O O   . GLY B 1 313 ? -12.999 53.272  2.116  1.00 27.96 ? 293  GLY B O   1 
ATOM   5222 N N   . SER B 1 314 ? -11.202 51.870  2.385  1.00 26.92 ? 294  SER B N   1 
ATOM   5223 C CA  . SER B 1 314 ? -11.102 52.014  3.830  1.00 26.66 ? 294  SER B CA  1 
ATOM   5224 C C   . SER B 1 314 ? -10.084 53.148  4.118  1.00 25.40 ? 294  SER B C   1 
ATOM   5225 O O   . SER B 1 314 ? -9.068  53.265  3.432  1.00 24.77 ? 294  SER B O   1 
ATOM   5226 C CB  . SER B 1 314 ? -10.676 50.677  4.447  1.00 26.07 ? 294  SER B CB  1 
ATOM   5227 O OG  . SER B 1 314 ? -10.706 50.728  5.866  1.00 29.47 ? 294  SER B OG  1 
ATOM   5228 N N   . LYS B 1 315 ? -10.388 53.973  5.117  1.00 25.58 ? 295  LYS B N   1 
ATOM   5229 C CA  . LYS B 1 315 ? -9.588  55.157  5.448  1.00 24.44 ? 295  LYS B CA  1 
ATOM   5230 C C   . LYS B 1 315 ? -8.146  54.809  5.820  1.00 24.30 ? 295  LYS B C   1 
ATOM   5231 O O   . LYS B 1 315 ? -7.908  54.024  6.738  1.00 22.64 ? 295  LYS B O   1 
ATOM   5232 C CB  . LYS B 1 315 ? -10.242 55.960  6.572  1.00 25.12 ? 295  LYS B CB  1 
ATOM   5233 C CG  . LYS B 1 315 ? -11.344 56.891  6.107  1.00 26.97 ? 295  LYS B CG  1 
ATOM   5234 C CD  . LYS B 1 315 ? -11.854 57.775  7.254  1.00 30.86 ? 295  LYS B CD  1 
ATOM   5235 C CE  . LYS B 1 315 ? -12.556 59.010  6.706  1.00 33.48 ? 295  LYS B CE  1 
ATOM   5236 N NZ  . LYS B 1 315 ? -13.003 60.022  7.737  1.00 34.16 ? 295  LYS B NZ  1 
ATOM   5237 N N   . GLY B 1 316 ? -7.211  55.414  5.097  1.00 23.70 ? 296  GLY B N   1 
ATOM   5238 C CA  . GLY B 1 316 ? -5.775  55.155  5.281  1.00 23.94 ? 296  GLY B CA  1 
ATOM   5239 C C   . GLY B 1 316 ? -5.295  53.837  4.716  1.00 23.54 ? 296  GLY B C   1 
ATOM   5240 O O   . GLY B 1 316 ? -4.168  53.444  4.979  1.00 23.86 ? 296  GLY B O   1 
ATOM   5241 N N   . HIS B 1 317 ? -6.118  53.152  3.914  1.00 24.06 ? 297  HIS B N   1 
ATOM   5242 C CA  . HIS B 1 317 ? -5.702  51.868  3.330  1.00 24.89 ? 297  HIS B CA  1 
ATOM   5243 C C   . HIS B 1 317 ? -4.343  51.950  2.594  1.00 25.00 ? 297  HIS B C   1 
ATOM   5244 O O   . HIS B 1 317 ? -3.503  51.049  2.704  1.00 25.08 ? 297  HIS B O   1 
ATOM   5245 C CB  . HIS B 1 317 ? -6.790  51.275  2.405  1.00 24.05 ? 297  HIS B CB  1 
ATOM   5246 C CG  . HIS B 1 317 ? -6.290  50.165  1.541  1.00 24.27 ? 297  HIS B CG  1 
ATOM   5247 N ND1 . HIS B 1 317 ? -5.952  50.347  0.215  1.00 25.76 ? 297  HIS B ND1 1 
ATOM   5248 C CD2 . HIS B 1 317 ? -6.004  48.873  1.830  1.00 22.34 ? 297  HIS B CD2 1 
ATOM   5249 C CE1 . HIS B 1 317 ? -5.502  49.206  -0.278 1.00 22.41 ? 297  HIS B CE1 1 
ATOM   5250 N NE2 . HIS B 1 317 ? -5.533  48.293  0.674  1.00 24.73 ? 297  HIS B NE2 1 
ATOM   5251 N N   . GLU B 1 318 ? -4.140  53.040  1.849  1.00 25.41 ? 298  GLU B N   1 
ATOM   5252 C CA  . GLU B 1 318 ? -2.907  53.218  1.102  1.00 26.68 ? 298  GLU B CA  1 
ATOM   5253 C C   . GLU B 1 318 ? -1.690  53.323  2.036  1.00 25.33 ? 298  GLU B C   1 
ATOM   5254 O O   . GLU B 1 318 ? -0.587  52.898  1.667  1.00 24.95 ? 298  GLU B O   1 
ATOM   5255 C CB  . GLU B 1 318 ? -2.994  54.418  0.131  1.00 27.56 ? 298  GLU B CB  1 
ATOM   5256 C CG  . GLU B 1 318 ? -3.413  54.039  -1.315 1.00 32.98 ? 298  GLU B CG  1 
ATOM   5257 C CD  . GLU B 1 318 ? -2.446  53.037  -2.006 1.00 38.91 ? 298  GLU B CD  1 
ATOM   5258 O OE1 . GLU B 1 318 ? -1.217  52.990  -1.674 1.00 43.41 ? 298  GLU B OE1 1 
ATOM   5259 O OE2 . GLU B 1 318 ? -2.922  52.299  -2.886 1.00 40.40 ? 298  GLU B OE2 1 
ATOM   5260 N N   . PHE B 1 319 ? -1.881  53.875  3.234  1.00 24.30 ? 299  PHE B N   1 
ATOM   5261 C CA  . PHE B 1 319 ? -0.782  53.949  4.210  1.00 24.07 ? 299  PHE B CA  1 
ATOM   5262 C C   . PHE B 1 319 ? -0.532  52.530  4.759  1.00 24.35 ? 299  PHE B C   1 
ATOM   5263 O O   . PHE B 1 319 ? 0.624   52.100  4.912  1.00 24.59 ? 299  PHE B O   1 
ATOM   5264 C CB  . PHE B 1 319 ? -1.062  54.978  5.331  1.00 23.64 ? 299  PHE B CB  1 
ATOM   5265 C CG  . PHE B 1 319 ? -1.645  56.308  4.844  1.00 23.56 ? 299  PHE B CG  1 
ATOM   5266 C CD1 . PHE B 1 319 ? -1.064  57.024  3.774  1.00 21.93 ? 299  PHE B CD1 1 
ATOM   5267 C CD2 . PHE B 1 319 ? -2.781  56.846  5.462  1.00 18.24 ? 299  PHE B CD2 1 
ATOM   5268 C CE1 . PHE B 1 319 ? -1.629  58.236  3.307  1.00 22.20 ? 299  PHE B CE1 1 
ATOM   5269 C CE2 . PHE B 1 319 ? -3.338  58.082  5.025  1.00 21.55 ? 299  PHE B CE2 1 
ATOM   5270 C CZ  . PHE B 1 319 ? -2.760  58.769  3.941  1.00 21.62 ? 299  PHE B CZ  1 
ATOM   5271 N N   . TRP B 1 320 ? -1.618  51.788  5.003  1.00 23.78 ? 300  TRP B N   1 
ATOM   5272 C CA  . TRP B 1 320 ? -1.522  50.375  5.426  1.00 23.43 ? 300  TRP B CA  1 
ATOM   5273 C C   . TRP B 1 320 ? -0.683  49.538  4.438  1.00 23.43 ? 300  TRP B C   1 
ATOM   5274 O O   . TRP B 1 320 ? 0.227   48.808  4.830  1.00 24.01 ? 300  TRP B O   1 
ATOM   5275 C CB  . TRP B 1 320 ? -2.923  49.746  5.649  1.00 22.63 ? 300  TRP B CB  1 
ATOM   5276 C CG  . TRP B 1 320 ? -2.782  48.271  5.956  1.00 22.70 ? 300  TRP B CG  1 
ATOM   5277 C CD1 . TRP B 1 320 ? -2.552  47.710  7.171  1.00 23.53 ? 300  TRP B CD1 1 
ATOM   5278 C CD2 . TRP B 1 320 ? -2.789  47.190  5.014  1.00 20.35 ? 300  TRP B CD2 1 
ATOM   5279 N NE1 . TRP B 1 320 ? -2.414  46.351  7.061  1.00 22.25 ? 300  TRP B NE1 1 
ATOM   5280 C CE2 . TRP B 1 320 ? -2.551  46.004  5.744  1.00 21.80 ? 300  TRP B CE2 1 
ATOM   5281 C CE3 . TRP B 1 320 ? -2.951  47.110  3.624  1.00 19.91 ? 300  TRP B CE3 1 
ATOM   5282 C CZ2 . TRP B 1 320 ? -2.486  44.754  5.134  1.00 21.71 ? 300  TRP B CZ2 1 
ATOM   5283 C CZ3 . TRP B 1 320 ? -2.899  45.879  3.019  1.00 21.35 ? 300  TRP B CZ3 1 
ATOM   5284 C CH2 . TRP B 1 320 ? -2.674  44.708  3.775  1.00 22.86 ? 300  TRP B CH2 1 
ATOM   5285 N N   . LYS B 1 321 ? -0.971  49.698  3.155  1.00 23.33 ? 301  LYS B N   1 
ATOM   5286 C CA  . LYS B 1 321 ? -0.311  48.924  2.108  1.00 23.63 ? 301  LYS B CA  1 
ATOM   5287 C C   . LYS B 1 321 ? 1.176   49.232  2.039  1.00 22.53 ? 301  LYS B C   1 
ATOM   5288 O O   . LYS B 1 321 ? 2.021   48.325  1.860  1.00 21.95 ? 301  LYS B O   1 
ATOM   5289 C CB  . LYS B 1 321 ? -0.990  49.197  0.764  1.00 24.39 ? 301  LYS B CB  1 
ATOM   5290 C CG  . LYS B 1 321 ? -0.424  48.364  -0.334 1.00 27.40 ? 301  LYS B CG  1 
ATOM   5291 C CD  . LYS B 1 321 ? -1.461  47.965  -1.346 1.00 32.44 ? 301  LYS B CD  1 
ATOM   5292 C CE  . LYS B 1 321 ? -0.810  47.891  -2.708 1.00 33.50 ? 301  LYS B CE  1 
ATOM   5293 N NZ  . LYS B 1 321 ? -1.799  48.250  -3.743 1.00 35.37 ? 301  LYS B NZ  1 
ATOM   5294 N N   . ARG B 1 322 ? 1.483   50.513  2.198  1.00 21.87 ? 302  ARG B N   1 
ATOM   5295 C CA  . ARG B 1 322 ? 2.842   51.011  2.116  1.00 21.92 ? 302  ARG B CA  1 
ATOM   5296 C C   . ARG B 1 322 ? 3.648   50.645  3.369  1.00 22.52 ? 302  ARG B C   1 
ATOM   5297 O O   . ARG B 1 322 ? 4.819   50.228  3.264  1.00 23.51 ? 302  ARG B O   1 
ATOM   5298 C CB  . ARG B 1 322 ? 2.784   52.535  1.931  1.00 23.13 ? 302  ARG B CB  1 
ATOM   5299 C CG  . ARG B 1 322 ? 4.118   53.220  1.601  1.00 22.72 ? 302  ARG B CG  1 
ATOM   5300 C CD  . ARG B 1 322 ? 4.000   54.727  1.726  1.00 24.75 ? 302  ARG B CD  1 
ATOM   5301 N NE  . ARG B 1 322 ? 3.585   55.117  3.075  1.00 25.96 ? 302  ARG B NE  1 
ATOM   5302 C CZ  . ARG B 1 322 ? 3.019   56.276  3.392  1.00 24.26 ? 302  ARG B CZ  1 
ATOM   5303 N NH1 . ARG B 1 322 ? 2.809   57.190  2.466  1.00 27.29 ? 302  ARG B NH1 1 
ATOM   5304 N NH2 . ARG B 1 322 ? 2.688   56.532  4.643  1.00 27.52 ? 302  ARG B NH2 1 
ATOM   5305 N N   . ASP B 1 323 ? 3.031   50.781  4.548  1.00 21.29 ? 303  ASP B N   1 
ATOM   5306 C CA  . ASP B 1 323 ? 3.789   50.791  5.818  1.00 21.71 ? 303  ASP B CA  1 
ATOM   5307 C C   . ASP B 1 323 ? 3.683   49.520  6.660  1.00 21.83 ? 303  ASP B C   1 
ATOM   5308 O O   . ASP B 1 323 ? 4.461   49.333  7.583  1.00 22.32 ? 303  ASP B O   1 
ATOM   5309 C CB  . ASP B 1 323 ? 3.351   51.989  6.687  1.00 21.67 ? 303  ASP B CB  1 
ATOM   5310 C CG  . ASP B 1 323 ? 3.565   53.325  6.016  1.00 21.36 ? 303  ASP B CG  1 
ATOM   5311 O OD1 . ASP B 1 323 ? 4.435   53.448  5.113  1.00 21.05 ? 303  ASP B OD1 1 
ATOM   5312 O OD2 . ASP B 1 323 ? 2.849   54.268  6.404  1.00 20.49 ? 303  ASP B OD2 1 
ATOM   5313 N N   . PHE B 1 324 ? 2.681   48.684  6.404  1.00 21.08 ? 304  PHE B N   1 
ATOM   5314 C CA  . PHE B 1 324 ? 2.466   47.495  7.227  1.00 20.46 ? 304  PHE B CA  1 
ATOM   5315 C C   . PHE B 1 324 ? 2.956   46.263  6.478  1.00 21.46 ? 304  PHE B C   1 
ATOM   5316 O O   . PHE B 1 324 ? 2.971   46.258  5.249  1.00 21.13 ? 304  PHE B O   1 
ATOM   5317 C CB  . PHE B 1 324 ? 0.964   47.317  7.557  1.00 20.41 ? 304  PHE B CB  1 
ATOM   5318 C CG  . PHE B 1 324 ? 0.425   48.266  8.613  1.00 18.49 ? 304  PHE B CG  1 
ATOM   5319 C CD1 . PHE B 1 324 ? 0.365   49.647  8.383  1.00 17.30 ? 304  PHE B CD1 1 
ATOM   5320 C CD2 . PHE B 1 324 ? -0.105  47.750  9.806  1.00 17.17 ? 304  PHE B CD2 1 
ATOM   5321 C CE1 . PHE B 1 324 ? -0.163  50.511  9.345  1.00 18.93 ? 304  PHE B CE1 1 
ATOM   5322 C CE2 . PHE B 1 324 ? -0.646  48.590  10.771 1.00 16.02 ? 304  PHE B CE2 1 
ATOM   5323 C CZ  . PHE B 1 324 ? -0.672  49.968  10.558 1.00 19.49 ? 304  PHE B CZ  1 
ATOM   5324 N N   . THR B 1 325 ? 3.321   45.210  7.206  1.00 21.61 ? 305  THR B N   1 
ATOM   5325 C CA  . THR B 1 325 ? 3.688   43.936  6.569  1.00 23.03 ? 305  THR B CA  1 
ATOM   5326 C C   . THR B 1 325 ? 2.598   42.878  6.730  1.00 23.02 ? 305  THR B C   1 
ATOM   5327 O O   . THR B 1 325 ? 2.848   41.684  6.518  1.00 24.35 ? 305  THR B O   1 
ATOM   5328 C CB  . THR B 1 325 ? 4.930   43.303  7.200  1.00 21.55 ? 305  THR B CB  1 
ATOM   5329 O OG1 . THR B 1 325 ? 4.741   43.235  8.622  1.00 23.83 ? 305  THR B OG1 1 
ATOM   5330 C CG2 . THR B 1 325 ? 6.199   44.098  6.869  1.00 24.86 ? 305  THR B CG2 1 
ATOM   5331 N N   . GLY B 1 326 ? 1.402   43.291  7.132  1.00 23.20 ? 306  GLY B N   1 
ATOM   5332 C CA  . GLY B 1 326 ? 0.371   42.322  7.407  1.00 21.62 ? 306  GLY B CA  1 
ATOM   5333 C C   . GLY B 1 326 ? -0.857  42.962  8.017  1.00 21.23 ? 306  GLY B C   1 
ATOM   5334 O O   . GLY B 1 326 ? -0.883  44.162  8.302  1.00 21.39 ? 306  GLY B O   1 
ATOM   5335 N N   . SER B 1 327 ? -1.888  42.142  8.176  1.00 21.48 ? 307  SER B N   1 
ATOM   5336 C CA  . SER B 1 327 ? -3.102  42.507  8.899  1.00 20.61 ? 307  SER B CA  1 
ATOM   5337 C C   . SER B 1 327 ? -3.394  41.535  10.064 1.00 19.59 ? 307  SER B C   1 
ATOM   5338 O O   . SER B 1 327 ? -3.043  40.370  9.993  1.00 20.13 ? 307  SER B O   1 
ATOM   5339 C CB  . SER B 1 327 ? -4.286  42.514  7.935  1.00 21.15 ? 307  SER B CB  1 
ATOM   5340 O OG  . SER B 1 327 ? -5.467  42.712  8.658  1.00 23.05 ? 307  SER B OG  1 
ATOM   5341 N N   . SER B 1 328 ? -4.049  42.003  11.127 1.00 18.76 ? 308  SER B N   1 
ATOM   5342 C CA  . SER B 1 328 ? -4.522  41.117  12.148 1.00 16.81 ? 308  SER B CA  1 
ATOM   5343 C C   . SER B 1 328 ? -6.002  40.898  11.851 1.00 18.63 ? 308  SER B C   1 
ATOM   5344 O O   . SER B 1 328 ? -6.422  41.110  10.714 1.00 21.03 ? 308  SER B O   1 
ATOM   5345 C CB  . SER B 1 328 ? -4.311  41.684  13.546 1.00 16.90 ? 308  SER B CB  1 
ATOM   5346 O OG  . SER B 1 328 ? -5.061  42.891  13.756 1.00 16.41 ? 308  SER B OG  1 
ATOM   5347 N N   . GLY B 1 329 ? -6.786  40.519  12.862 1.00 17.90 ? 309  GLY B N   1 
ATOM   5348 C CA  . GLY B 1 329 ? -8.171  40.074  12.634 1.00 18.21 ? 309  GLY B CA  1 
ATOM   5349 C C   . GLY B 1 329 ? -9.285  40.992  13.092 1.00 18.79 ? 309  GLY B C   1 
ATOM   5350 O O   . GLY B 1 329 ? -10.472 40.655  12.973 1.00 18.93 ? 309  GLY B O   1 
ATOM   5351 N N   . LEU B 1 330 ? -8.916  42.155  13.598 1.00 17.33 ? 310  LEU B N   1 
ATOM   5352 C CA  . LEU B 1 330 ? -9.905  43.150  14.036 1.00 16.78 ? 310  LEU B CA  1 
ATOM   5353 C C   . LEU B 1 330 ? -10.287 44.149  12.959 1.00 17.21 ? 310  LEU B C   1 
ATOM   5354 O O   . LEU B 1 330 ? -9.412  44.760  12.343 1.00 18.29 ? 310  LEU B O   1 
ATOM   5355 C CB  . LEU B 1 330 ? -9.387  43.893  15.252 1.00 17.33 ? 310  LEU B CB  1 
ATOM   5356 C CG  . LEU B 1 330 ? -10.443 44.681  16.047 1.00 16.77 ? 310  LEU B CG  1 
ATOM   5357 C CD1 . LEU B 1 330 ? -11.384 43.758  16.767 1.00 17.29 ? 310  LEU B CD1 1 
ATOM   5358 C CD2 . LEU B 1 330 ? -9.689  45.695  17.032 1.00 18.19 ? 310  LEU B CD2 1 
ATOM   5359 N N   . PHE B 1 331 ? -11.596 44.300  12.728 1.00 16.21 ? 311  PHE B N   1 
ATOM   5360 C CA  . PHE B 1 331 ? -12.093 45.351  11.845 1.00 16.90 ? 311  PHE B CA  1 
ATOM   5361 C C   . PHE B 1 331 ? -13.567 45.703  12.144 1.00 17.01 ? 311  PHE B C   1 
ATOM   5362 O O   . PHE B 1 331 ? -14.150 45.162  13.086 1.00 17.94 ? 311  PHE B O   1 
ATOM   5363 C CB  . PHE B 1 331 ? -11.856 44.956  10.369 1.00 16.83 ? 311  PHE B CB  1 
ATOM   5364 C CG  . PHE B 1 331 ? -12.791 43.895  9.857  1.00 17.37 ? 311  PHE B CG  1 
ATOM   5365 C CD1 . PHE B 1 331 ? -12.591 42.547  10.149 1.00 19.26 ? 311  PHE B CD1 1 
ATOM   5366 C CD2 . PHE B 1 331 ? -13.858 44.255  9.047  1.00 17.57 ? 311  PHE B CD2 1 
ATOM   5367 C CE1 . PHE B 1 331 ? -13.486 41.553  9.655  1.00 17.79 ? 311  PHE B CE1 1 
ATOM   5368 C CE2 . PHE B 1 331 ? -14.726 43.293  8.535  1.00 16.08 ? 311  PHE B CE2 1 
ATOM   5369 C CZ  . PHE B 1 331 ? -14.547 41.952  8.822  1.00 18.36 ? 311  PHE B CZ  1 
ATOM   5370 N N   . SER B 1 332 ? -14.152 46.607  11.358 1.00 14.67 ? 312  SER B N   1 
ATOM   5371 C CA  . SER B 1 332 ? -15.574 46.900  11.538 1.00 16.44 ? 312  SER B CA  1 
ATOM   5372 C C   . SER B 1 332 ? -16.231 47.136  10.226 1.00 16.51 ? 312  SER B C   1 
ATOM   5373 O O   . SER B 1 332 ? -15.568 47.306  9.189  1.00 16.82 ? 312  SER B O   1 
ATOM   5374 C CB  . SER B 1 332 ? -15.736 48.120  12.468 1.00 16.08 ? 312  SER B CB  1 
ATOM   5375 O OG  . SER B 1 332 ? -15.166 49.312  11.923 1.00 17.03 ? 312  SER B OG  1 
ATOM   5376 N N   . PHE B 1 333 ? -17.568 47.147  10.261 1.00 17.32 ? 313  PHE B N   1 
ATOM   5377 C CA  . PHE B 1 333 ? -18.330 47.467  9.077  1.00 17.55 ? 313  PHE B CA  1 
ATOM   5378 C C   . PHE B 1 333 ? -19.575 48.240  9.538  1.00 16.78 ? 313  PHE B C   1 
ATOM   5379 O O   . PHE B 1 333 ? -19.942 48.174  10.716 1.00 16.13 ? 313  PHE B O   1 
ATOM   5380 C CB  . PHE B 1 333 ? -18.678 46.210  8.262  1.00 17.68 ? 313  PHE B CB  1 
ATOM   5381 C CG  . PHE B 1 333 ? -19.674 45.291  8.926  1.00 18.61 ? 313  PHE B CG  1 
ATOM   5382 C CD1 . PHE B 1 333 ? -19.256 44.315  9.820  1.00 23.14 ? 313  PHE B CD1 1 
ATOM   5383 C CD2 . PHE B 1 333 ? -21.048 45.398  8.632  1.00 22.83 ? 313  PHE B CD2 1 
ATOM   5384 C CE1 . PHE B 1 333 ? -20.198 43.424  10.436 1.00 22.78 ? 313  PHE B CE1 1 
ATOM   5385 C CE2 . PHE B 1 333 ? -21.991 44.530  9.234  1.00 22.22 ? 313  PHE B CE2 1 
ATOM   5386 C CZ  . PHE B 1 333 ? -21.558 43.545  10.140 1.00 24.08 ? 313  PHE B CZ  1 
ATOM   5387 N N   . VAL B 1 334 ? -20.121 49.027  8.631  1.00 18.35 ? 314  VAL B N   1 
ATOM   5388 C CA  . VAL B 1 334 ? -21.296 49.853  8.879  1.00 19.41 ? 314  VAL B CA  1 
ATOM   5389 C C   . VAL B 1 334 ? -22.489 49.265  8.138  1.00 20.22 ? 314  VAL B C   1 
ATOM   5390 O O   . VAL B 1 334 ? -22.450 49.069  6.909  1.00 19.93 ? 314  VAL B O   1 
ATOM   5391 C CB  . VAL B 1 334 ? -21.079 51.321  8.428  1.00 19.70 ? 314  VAL B CB  1 
ATOM   5392 C CG1 . VAL B 1 334 ? -22.307 52.182  8.766  1.00 20.01 ? 314  VAL B CG1 1 
ATOM   5393 C CG2 . VAL B 1 334 ? -19.801 51.900  9.075  1.00 19.98 ? 314  VAL B CG2 1 
ATOM   5394 N N   . LEU B 1 335 ? -23.532 48.958  8.890  1.00 21.07 ? 315  LEU B N   1 
ATOM   5395 C CA  . LEU B 1 335 ? -24.791 48.503  8.308  1.00 22.28 ? 315  LEU B CA  1 
ATOM   5396 C C   . LEU B 1 335 ? -25.495 49.617  7.528  1.00 23.76 ? 315  LEU B C   1 
ATOM   5397 O O   . LEU B 1 335 ? -25.338 50.807  7.847  1.00 24.13 ? 315  LEU B O   1 
ATOM   5398 C CB  . LEU B 1 335 ? -25.695 47.996  9.429  1.00 22.42 ? 315  LEU B CB  1 
ATOM   5399 C CG  . LEU B 1 335 ? -25.306 46.667  10.063 1.00 21.34 ? 315  LEU B CG  1 
ATOM   5400 C CD1 . LEU B 1 335 ? -26.081 46.437  11.358 1.00 22.21 ? 315  LEU B CD1 1 
ATOM   5401 C CD2 . LEU B 1 335 ? -25.551 45.532  9.052  1.00 19.84 ? 315  LEU B CD2 1 
ATOM   5402 N N   . LYS B 1 336 ? -26.256 49.257  6.496  1.00 24.05 ? 316  LYS B N   1 
ATOM   5403 C CA  . LYS B 1 336 ? -27.054 50.275  5.810  1.00 26.06 ? 316  LYS B CA  1 
ATOM   5404 C C   . LYS B 1 336 ? -28.126 50.858  6.748  1.00 25.91 ? 316  LYS B C   1 
ATOM   5405 O O   . LYS B 1 336 ? -28.413 52.026  6.691  1.00 25.85 ? 316  LYS B O   1 
ATOM   5406 C CB  . LYS B 1 336 ? -27.650 49.753  4.495  1.00 26.16 ? 316  LYS B CB  1 
ATOM   5407 C CG  . LYS B 1 336 ? -26.722 49.997  3.292  1.00 29.47 ? 316  LYS B CG  1 
ATOM   5408 C CD  . LYS B 1 336 ? -27.268 49.379  1.999  1.00 32.60 ? 316  LYS B CD  1 
ATOM   5409 C CE  . LYS B 1 336 ? -26.148 49.216  0.963  1.00 34.35 ? 316  LYS B CE  1 
ATOM   5410 N NZ  . LYS B 1 336 ? -26.737 48.715  -0.330 1.00 35.07 ? 316  LYS B NZ  1 
ATOM   5411 N N   . LYS B 1 337 ? -28.644 50.043  7.657  1.00 27.03 ? 317  LYS B N   1 
ATOM   5412 C CA  . LYS B 1 337 ? -29.621 50.498  8.645  1.00 28.56 ? 317  LYS B CA  1 
ATOM   5413 C C   . LYS B 1 337 ? -28.992 51.093  9.903  1.00 28.14 ? 317  LYS B C   1 
ATOM   5414 O O   . LYS B 1 337 ? -27.907 50.685  10.306 1.00 28.22 ? 317  LYS B O   1 
ATOM   5415 C CB  . LYS B 1 337 ? -30.469 49.312  9.089  1.00 28.45 ? 317  LYS B CB  1 
ATOM   5416 C CG  . LYS B 1 337 ? -31.942 49.605  9.117  1.00 32.38 ? 317  LYS B CG  1 
ATOM   5417 C CD  . LYS B 1 337 ? -32.695 48.548  8.330  1.00 34.08 ? 317  LYS B CD  1 
ATOM   5418 C CE  . LYS B 1 337 ? -33.068 47.344  9.177  1.00 36.96 ? 317  LYS B CE  1 
ATOM   5419 N NZ  . LYS B 1 337 ? -34.259 46.643  8.600  1.00 38.12 ? 317  LYS B NZ  1 
ATOM   5420 N N   . LYS B 1 338 ? -29.697 52.015  10.554 1.00 27.47 ? 318  LYS B N   1 
ATOM   5421 C CA  . LYS B 1 338 ? -29.399 52.257  11.963 1.00 27.42 ? 318  LYS B CA  1 
ATOM   5422 C C   . LYS B 1 338 ? -30.398 51.444  12.779 1.00 27.17 ? 318  LYS B C   1 
ATOM   5423 O O   . LYS B 1 338 ? -31.580 51.785  12.860 1.00 25.02 ? 318  LYS B O   1 
ATOM   5424 C CB  . LYS B 1 338 ? -29.448 53.742  12.333 1.00 27.52 ? 318  LYS B CB  1 
ATOM   5425 C CG  . LYS B 1 338 ? -29.263 53.954  13.832 1.00 29.52 ? 318  LYS B CG  1 
ATOM   5426 C CD  . LYS B 1 338 ? -28.938 55.370  14.145 1.00 31.73 ? 318  LYS B CD  1 
ATOM   5427 C CE  . LYS B 1 338 ? -29.324 55.657  15.572 1.00 34.91 ? 318  LYS B CE  1 
ATOM   5428 N NZ  . LYS B 1 338 ? -29.941 57.023  15.621 1.00 38.13 ? 318  LYS B NZ  1 
ATOM   5429 N N   . LEU B 1 339 ? -29.921 50.343  13.359 1.00 27.43 ? 319  LEU B N   1 
ATOM   5430 C CA  . LEU B 1 339 ? -30.802 49.415  14.082 1.00 27.24 ? 319  LEU B CA  1 
ATOM   5431 C C   . LEU B 1 339 ? -31.435 50.065  15.315 1.00 27.92 ? 319  LEU B C   1 
ATOM   5432 O O   . LEU B 1 339 ? -30.780 50.825  16.047 1.00 27.37 ? 319  LEU B O   1 
ATOM   5433 C CB  . LEU B 1 339 ? -30.048 48.134  14.471 1.00 26.96 ? 319  LEU B CB  1 
ATOM   5434 C CG  . LEU B 1 339 ? -29.418 47.345  13.325 1.00 26.48 ? 319  LEU B CG  1 
ATOM   5435 C CD1 . LEU B 1 339 ? -28.789 46.109  13.939 1.00 28.27 ? 319  LEU B CD1 1 
ATOM   5436 C CD2 . LEU B 1 339 ? -30.408 46.980  12.211 1.00 27.20 ? 319  LEU B CD2 1 
ATOM   5437 N N   . ASN B 1 340 ? -32.728 49.817  15.500 1.00 28.67 ? 320  ASN B N   1 
ATOM   5438 C CA  . ASN B 1 340 ? -33.378 50.170  16.754 1.00 29.99 ? 320  ASN B CA  1 
ATOM   5439 C C   . ASN B 1 340 ? -33.060 49.090  17.775 1.00 30.62 ? 320  ASN B C   1 
ATOM   5440 O O   . ASN B 1 340 ? -32.406 48.090  17.446 1.00 30.68 ? 320  ASN B O   1 
ATOM   5441 C CB  . ASN B 1 340 ? -34.889 50.365  16.567 1.00 30.59 ? 320  ASN B CB  1 
ATOM   5442 C CG  . ASN B 1 340 ? -35.604 49.099  16.117 1.00 30.33 ? 320  ASN B CG  1 
ATOM   5443 O OD1 . ASN B 1 340 ? -35.302 48.001  16.572 1.00 31.37 ? 320  ASN B OD1 1 
ATOM   5444 N ND2 . ASN B 1 340 ? -36.576 49.258  15.227 1.00 31.25 ? 320  ASN B ND2 1 
ATOM   5445 N N   . ASN B 1 341 ? -33.501 49.284  19.011 1.00 31.22 ? 321  ASN B N   1 
ATOM   5446 C CA  . ASN B 1 341 ? -33.073 48.419  20.111 1.00 31.68 ? 321  ASN B CA  1 
ATOM   5447 C C   . ASN B 1 341 ? -33.459 46.962  19.940 1.00 31.97 ? 321  ASN B C   1 
ATOM   5448 O O   . ASN B 1 341 ? -32.684 46.057  20.252 1.00 31.73 ? 321  ASN B O   1 
ATOM   5449 C CB  . ASN B 1 341 ? -33.588 48.958  21.446 1.00 32.33 ? 321  ASN B CB  1 
ATOM   5450 C CG  . ASN B 1 341 ? -32.769 50.127  21.948 1.00 33.97 ? 321  ASN B CG  1 
ATOM   5451 O OD1 . ASN B 1 341 ? -31.554 50.024  22.128 1.00 35.38 ? 321  ASN B OD1 1 
ATOM   5452 N ND2 . ASN B 1 341 ? -33.427 51.243  22.178 1.00 35.19 ? 321  ASN B ND2 1 
ATOM   5453 N N   . GLU B 1 342 ? -34.651 46.746  19.414 1.00 31.47 ? 322  GLU B N   1 
ATOM   5454 C CA  . GLU B 1 342 ? -35.183 45.415  19.227 1.00 31.72 ? 322  GLU B CA  1 
ATOM   5455 C C   . GLU B 1 342 ? -34.447 44.680  18.108 1.00 29.86 ? 322  GLU B C   1 
ATOM   5456 O O   . GLU B 1 342 ? -34.284 43.458  18.166 1.00 29.20 ? 322  GLU B O   1 
ATOM   5457 C CB  . GLU B 1 342 ? -36.664 45.491  18.898 1.00 32.19 ? 322  GLU B CB  1 
ATOM   5458 C CG  . GLU B 1 342 ? -37.399 44.197  19.150 1.00 38.18 ? 322  GLU B CG  1 
ATOM   5459 C CD  . GLU B 1 342 ? -38.401 43.838  18.059 1.00 44.22 ? 322  GLU B CD  1 
ATOM   5460 O OE1 . GLU B 1 342 ? -39.170 44.724  17.618 1.00 47.26 ? 322  GLU B OE1 1 
ATOM   5461 O OE2 . GLU B 1 342 ? -38.430 42.649  17.647 1.00 47.53 ? 322  GLU B OE2 1 
ATOM   5462 N N   . GLU B 1 343 ? -34.063 45.408  17.068 1.00 27.75 ? 323  GLU B N   1 
ATOM   5463 C CA  . GLU B 1 343 ? -33.391 44.760  15.952 1.00 27.75 ? 323  GLU B CA  1 
ATOM   5464 C C   . GLU B 1 343 ? -31.983 44.442  16.411 1.00 26.59 ? 323  GLU B C   1 
ATOM   5465 O O   . GLU B 1 343 ? -31.394 43.487  15.972 1.00 25.85 ? 323  GLU B O   1 
ATOM   5466 C CB  . GLU B 1 343 ? -33.283 45.671  14.745 1.00 28.35 ? 323  GLU B CB  1 
ATOM   5467 C CG  . GLU B 1 343 ? -34.573 45.968  14.057 1.00 29.12 ? 323  GLU B CG  1 
ATOM   5468 C CD  . GLU B 1 343 ? -34.413 47.134  13.106 1.00 31.30 ? 323  GLU B CD  1 
ATOM   5469 O OE1 . GLU B 1 343 ? -33.838 48.190  13.504 1.00 29.99 ? 323  GLU B OE1 1 
ATOM   5470 O OE2 . GLU B 1 343 ? -34.847 46.972  11.951 1.00 32.00 ? 323  GLU B OE2 1 
ATOM   5471 N N   . LEU B 1 344 ? -31.472 45.274  17.306 1.00 26.67 ? 324  LEU B N   1 
ATOM   5472 C CA  . LEU B 1 344 ? -30.108 45.159  17.814 1.00 27.06 ? 324  LEU B CA  1 
ATOM   5473 C C   . LEU B 1 344 ? -29.993 43.899  18.658 1.00 27.30 ? 324  LEU B C   1 
ATOM   5474 O O   . LEU B 1 344 ? -29.007 43.137  18.533 1.00 27.34 ? 324  LEU B O   1 
ATOM   5475 C CB  . LEU B 1 344 ? -29.780 46.388  18.674 1.00 26.98 ? 324  LEU B CB  1 
ATOM   5476 C CG  . LEU B 1 344 ? -28.337 46.828  18.921 1.00 27.82 ? 324  LEU B CG  1 
ATOM   5477 C CD1 . LEU B 1 344 ? -27.556 46.863  17.622 1.00 25.92 ? 324  LEU B CD1 1 
ATOM   5478 C CD2 . LEU B 1 344 ? -28.388 48.208  19.525 1.00 27.64 ? 324  LEU B CD2 1 
ATOM   5479 N N   . ALA B 1 345 ? -30.992 43.691  19.517 1.00 27.09 ? 325  ALA B N   1 
ATOM   5480 C CA  . ALA B 1 345 ? -31.070 42.489  20.352 1.00 27.73 ? 325  ALA B CA  1 
ATOM   5481 C C   . ALA B 1 345 ? -31.249 41.253  19.494 1.00 28.02 ? 325  ALA B C   1 
ATOM   5482 O O   . ALA B 1 345 ? -30.594 40.227  19.718 1.00 27.87 ? 325  ALA B O   1 
ATOM   5483 C CB  . ALA B 1 345 ? -32.185 42.591  21.408 1.00 27.94 ? 325  ALA B CB  1 
ATOM   5484 N N   . ASN B 1 346 ? -32.132 41.361  18.502 1.00 27.86 ? 326  ASN B N   1 
ATOM   5485 C CA  . ASN B 1 346 ? -32.387 40.260  17.591 1.00 28.39 ? 326  ASN B CA  1 
ATOM   5486 C C   . ASN B 1 346 ? -31.094 39.798  16.900 1.00 27.99 ? 326  ASN B C   1 
ATOM   5487 O O   . ASN B 1 346 ? -30.826 38.611  16.829 1.00 28.08 ? 326  ASN B O   1 
ATOM   5488 C CB  . ASN B 1 346 ? -33.428 40.654  16.550 1.00 28.83 ? 326  ASN B CB  1 
ATOM   5489 C CG  . ASN B 1 346 ? -33.981 39.460  15.804 1.00 32.38 ? 326  ASN B CG  1 
ATOM   5490 O OD1 . ASN B 1 346 ? -34.034 39.467  14.573 1.00 38.35 ? 326  ASN B OD1 1 
ATOM   5491 N ND2 . ASN B 1 346 ? -34.399 38.418  16.540 1.00 33.11 ? 326  ASN B ND2 1 
ATOM   5492 N N   . TYR B 1 347 ? -30.314 40.766  16.420 1.00 26.87 ? 327  TYR B N   1 
ATOM   5493 C CA  . TYR B 1 347 ? -29.102 40.520  15.688 1.00 25.60 ? 327  TYR B CA  1 
ATOM   5494 C C   . TYR B 1 347 ? -28.065 39.907  16.623 1.00 25.29 ? 327  TYR B C   1 
ATOM   5495 O O   . TYR B 1 347 ? -27.604 38.793  16.393 1.00 25.43 ? 327  TYR B O   1 
ATOM   5496 C CB  . TYR B 1 347 ? -28.604 41.855  15.118 1.00 25.66 ? 327  TYR B CB  1 
ATOM   5497 C CG  . TYR B 1 347 ? -27.314 41.798  14.316 1.00 23.75 ? 327  TYR B CG  1 
ATOM   5498 C CD1 . TYR B 1 347 ? -27.270 41.151  13.077 1.00 23.91 ? 327  TYR B CD1 1 
ATOM   5499 C CD2 . TYR B 1 347 ? -26.174 42.427  14.772 1.00 26.93 ? 327  TYR B CD2 1 
ATOM   5500 C CE1 . TYR B 1 347 ? -26.105 41.115  12.322 1.00 23.82 ? 327  TYR B CE1 1 
ATOM   5501 C CE2 . TYR B 1 347 ? -24.977 42.405  14.022 1.00 23.62 ? 327  TYR B CE2 1 
ATOM   5502 C CZ  . TYR B 1 347 ? -24.960 41.737  12.798 1.00 23.81 ? 327  TYR B CZ  1 
ATOM   5503 O OH  . TYR B 1 347 ? -23.817 41.697  12.025 1.00 24.26 ? 327  TYR B OH  1 
ATOM   5504 N N   . LEU B 1 348 ? -27.733 40.631  17.686 1.00 24.22 ? 328  LEU B N   1 
ATOM   5505 C CA  . LEU B 1 348 ? -26.616 40.264  18.568 1.00 24.07 ? 328  LEU B CA  1 
ATOM   5506 C C   . LEU B 1 348 ? -26.902 39.087  19.479 1.00 24.52 ? 328  LEU B C   1 
ATOM   5507 O O   . LEU B 1 348 ? -25.987 38.349  19.835 1.00 24.98 ? 328  LEU B O   1 
ATOM   5508 C CB  . LEU B 1 348 ? -26.161 41.476  19.410 1.00 23.92 ? 328  LEU B CB  1 
ATOM   5509 C CG  . LEU B 1 348 ? -25.603 42.702  18.678 1.00 22.89 ? 328  LEU B CG  1 
ATOM   5510 C CD1 . LEU B 1 348 ? -25.358 43.881  19.633 1.00 21.39 ? 328  LEU B CD1 1 
ATOM   5511 C CD2 . LEU B 1 348 ? -24.291 42.329  17.930 1.00 22.85 ? 328  LEU B CD2 1 
ATOM   5512 N N   . ASP B 1 349 ? -28.160 38.909  19.882 1.00 25.07 ? 329  ASP B N   1 
ATOM   5513 C CA  . ASP B 1 349 ? -28.466 37.862  20.868 1.00 25.48 ? 329  ASP B CA  1 
ATOM   5514 C C   . ASP B 1 349 ? -28.413 36.452  20.285 1.00 25.29 ? 329  ASP B C   1 
ATOM   5515 O O   . ASP B 1 349 ? -28.303 35.475  21.032 1.00 26.61 ? 329  ASP B O   1 
ATOM   5516 C CB  . ASP B 1 349 ? -29.843 38.111  21.524 1.00 24.69 ? 329  ASP B CB  1 
ATOM   5517 C CG  . ASP B 1 349 ? -29.823 39.297  22.498 1.00 25.13 ? 329  ASP B CG  1 
ATOM   5518 O OD1 . ASP B 1 349 ? -28.764 39.937  22.716 1.00 21.55 ? 329  ASP B OD1 1 
ATOM   5519 O OD2 . ASP B 1 349 ? -30.877 39.613  23.067 1.00 25.44 ? 329  ASP B OD2 1 
ATOM   5520 N N   . ASN B 1 350 ? -28.455 36.346  18.960 1.00 24.67 ? 330  ASN B N   1 
ATOM   5521 C CA  . ASN B 1 350 ? -28.729 35.064  18.333 1.00 23.88 ? 330  ASN B CA  1 
ATOM   5522 C C   . ASN B 1 350 ? -27.619 34.445  17.496 1.00 24.25 ? 330  ASN B C   1 
ATOM   5523 O O   . ASN B 1 350 ? -27.831 33.476  16.725 1.00 23.51 ? 330  ASN B O   1 
ATOM   5524 C CB  . ASN B 1 350 ? -30.069 35.151  17.585 1.00 23.81 ? 330  ASN B CB  1 
ATOM   5525 C CG  . ASN B 1 350 ? -31.233 35.390  18.533 1.00 26.30 ? 330  ASN B CG  1 
ATOM   5526 O OD1 . ASN B 1 350 ? -31.539 34.545  19.376 1.00 28.97 ? 330  ASN B OD1 1 
ATOM   5527 N ND2 . ASN B 1 350 ? -31.869 36.551  18.418 1.00 24.13 ? 330  ASN B ND2 1 
ATOM   5528 N N   . PHE B 1 351 ? -26.415 34.974  17.693 1.00 23.55 ? 331  PHE B N   1 
ATOM   5529 C CA  . PHE B 1 351 ? -25.210 34.410  17.080 1.00 24.68 ? 331  PHE B CA  1 
ATOM   5530 C C   . PHE B 1 351 ? -24.789 33.066  17.703 1.00 24.52 ? 331  PHE B C   1 
ATOM   5531 O O   . PHE B 1 351 ? -24.972 32.851  18.897 1.00 24.58 ? 331  PHE B O   1 
ATOM   5532 C CB  . PHE B 1 351 ? -24.090 35.421  17.173 1.00 24.18 ? 331  PHE B CB  1 
ATOM   5533 C CG  . PHE B 1 351 ? -24.145 36.471  16.102 1.00 24.94 ? 331  PHE B CG  1 
ATOM   5534 C CD1 . PHE B 1 351 ? -23.659 36.204  14.826 1.00 24.96 ? 331  PHE B CD1 1 
ATOM   5535 C CD2 . PHE B 1 351 ? -24.691 37.725  16.362 1.00 22.80 ? 331  PHE B CD2 1 
ATOM   5536 C CE1 . PHE B 1 351 ? -23.708 37.160  13.825 1.00 24.01 ? 331  PHE B CE1 1 
ATOM   5537 C CE2 . PHE B 1 351 ? -24.749 38.679  15.354 1.00 23.67 ? 331  PHE B CE2 1 
ATOM   5538 C CZ  . PHE B 1 351 ? -24.265 38.391  14.080 1.00 24.35 ? 331  PHE B CZ  1 
ATOM   5539 N N   . SER B 1 352 ? -24.253 32.162  16.882 1.00 24.97 ? 332  SER B N   1 
ATOM   5540 C CA  . SER B 1 352 ? -23.833 30.850  17.370 1.00 24.46 ? 332  SER B CA  1 
ATOM   5541 C C   . SER B 1 352 ? -22.333 30.729  17.642 1.00 23.90 ? 332  SER B C   1 
ATOM   5542 O O   . SER B 1 352 ? -21.939 29.941  18.497 1.00 22.94 ? 332  SER B O   1 
ATOM   5543 C CB  . SER B 1 352 ? -24.249 29.761  16.390 1.00 25.11 ? 332  SER B CB  1 
ATOM   5544 O OG  . SER B 1 352 ? -25.652 29.733  16.254 1.00 27.86 ? 332  SER B OG  1 
ATOM   5545 N N   . LEU B 1 353 ? -21.522 31.484  16.902 1.00 22.54 ? 333  LEU B N   1 
ATOM   5546 C CA  . LEU B 1 353 ? -20.061 31.439  17.037 1.00 22.97 ? 333  LEU B CA  1 
ATOM   5547 C C   . LEU B 1 353 ? -19.446 32.744  17.503 1.00 23.31 ? 333  LEU B C   1 
ATOM   5548 O O   . LEU B 1 353 ? -18.416 32.709  18.179 1.00 24.52 ? 333  LEU B O   1 
ATOM   5549 C CB  . LEU B 1 353 ? -19.396 31.029  15.714 1.00 22.43 ? 333  LEU B CB  1 
ATOM   5550 C CG  . LEU B 1 353 ? -19.840 29.667  15.169 1.00 23.01 ? 333  LEU B CG  1 
ATOM   5551 C CD1 . LEU B 1 353 ? -19.452 29.481  13.678 1.00 23.17 ? 333  LEU B CD1 1 
ATOM   5552 C CD2 . LEU B 1 353 ? -19.353 28.515  16.066 1.00 21.36 ? 333  LEU B CD2 1 
ATOM   5553 N N   . PHE B 1 354 ? -20.013 33.884  17.103 1.00 22.44 ? 334  PHE B N   1 
ATOM   5554 C CA  . PHE B 1 354 ? -19.543 35.181  17.607 1.00 23.49 ? 334  PHE B CA  1 
ATOM   5555 C C   . PHE B 1 354 ? -20.131 35.375  19.014 1.00 24.46 ? 334  PHE B C   1 
ATOM   5556 O O   . PHE B 1 354 ? -21.284 35.018  19.257 1.00 25.70 ? 334  PHE B O   1 
ATOM   5557 C CB  . PHE B 1 354 ? -19.979 36.334  16.689 1.00 22.55 ? 334  PHE B CB  1 
ATOM   5558 C CG  . PHE B 1 354 ? -19.255 36.386  15.372 1.00 22.73 ? 334  PHE B CG  1 
ATOM   5559 C CD1 . PHE B 1 354 ? -19.727 35.677  14.266 1.00 21.55 ? 334  PHE B CD1 1 
ATOM   5560 C CD2 . PHE B 1 354 ? -18.080 37.162  15.232 1.00 22.07 ? 334  PHE B CD2 1 
ATOM   5561 C CE1 . PHE B 1 354 ? -19.030 35.723  13.041 1.00 21.43 ? 334  PHE B CE1 1 
ATOM   5562 C CE2 . PHE B 1 354 ? -17.396 37.222  14.008 1.00 23.09 ? 334  PHE B CE2 1 
ATOM   5563 C CZ  . PHE B 1 354 ? -17.879 36.500  12.909 1.00 23.04 ? 334  PHE B CZ  1 
ATOM   5564 N N   . SER B 1 355 ? -19.328 35.883  19.940 1.00 24.94 ? 335  SER B N   1 
ATOM   5565 C CA  . SER B 1 355 ? -19.782 36.182  21.293 1.00 25.31 ? 335  SER B CA  1 
ATOM   5566 C C   . SER B 1 355 ? -19.635 37.690  21.479 1.00 24.98 ? 335  SER B C   1 
ATOM   5567 O O   . SER B 1 355 ? -18.796 38.302  20.834 1.00 23.72 ? 335  SER B O   1 
ATOM   5568 C CB  . SER B 1 355 ? -18.855 35.528  22.326 1.00 25.77 ? 335  SER B CB  1 
ATOM   5569 O OG  . SER B 1 355 ? -18.762 34.137  22.144 1.00 31.60 ? 335  SER B OG  1 
ATOM   5570 N N   . MET B 1 356 ? -20.444 38.283  22.356 1.00 25.29 ? 336  MET B N   1 
ATOM   5571 C CA  . MET B 1 356 ? -20.214 39.668  22.783 1.00 25.39 ? 336  MET B CA  1 
ATOM   5572 C C   . MET B 1 356 ? -19.254 39.727  23.959 1.00 25.28 ? 336  MET B C   1 
ATOM   5573 O O   . MET B 1 356 ? -19.437 39.032  24.956 1.00 24.00 ? 336  MET B O   1 
ATOM   5574 C CB  . MET B 1 356 ? -21.520 40.353  23.166 1.00 25.73 ? 336  MET B CB  1 
ATOM   5575 C CG  . MET B 1 356 ? -22.431 40.612  21.995 1.00 26.38 ? 336  MET B CG  1 
ATOM   5576 S SD  . MET B 1 356 ? -24.000 41.276  22.604 1.00 30.39 ? 336  MET B SD  1 
ATOM   5577 C CE  . MET B 1 356 ? -24.825 39.769  23.046 1.00 25.91 ? 336  MET B CE  1 
ATOM   5578 N N   . ALA B 1 357 ? -18.254 40.591  23.841 1.00 25.26 ? 337  ALA B N   1 
ATOM   5579 C CA  . ALA B 1 357 ? -17.251 40.802  24.865 1.00 25.53 ? 337  ALA B CA  1 
ATOM   5580 C C   . ALA B 1 357 ? -16.358 41.928  24.391 1.00 25.89 ? 337  ALA B C   1 
ATOM   5581 O O   . ALA B 1 357 ? -16.254 42.170  23.194 1.00 26.44 ? 337  ALA B O   1 
ATOM   5582 C CB  . ALA B 1 357 ? -16.380 39.520  25.092 1.00 24.57 ? 337  ALA B CB  1 
ATOM   5583 N N   . TYR B 1 358 ? -15.697 42.560  25.349 1.00 26.00 ? 338  TYR B N   1 
ATOM   5584 C CA  . TYR B 1 358 ? -14.639 43.538  25.109 1.00 26.21 ? 338  TYR B CA  1 
ATOM   5585 C C   . TYR B 1 358 ? -13.290 42.818  25.002 1.00 25.97 ? 338  TYR B C   1 
ATOM   5586 O O   . TYR B 1 358 ? -13.211 41.608  25.189 1.00 26.98 ? 338  TYR B O   1 
ATOM   5587 C CB  . TYR B 1 358 ? -14.658 44.575  26.222 1.00 26.49 ? 338  TYR B CB  1 
ATOM   5588 C CG  . TYR B 1 358 ? -15.934 45.407  26.215 1.00 28.57 ? 338  TYR B CG  1 
ATOM   5589 C CD1 . TYR B 1 358 ? -16.171 46.324  25.198 1.00 31.27 ? 338  TYR B CD1 1 
ATOM   5590 C CD2 . TYR B 1 358 ? -16.893 45.262  27.218 1.00 27.85 ? 338  TYR B CD2 1 
ATOM   5591 C CE1 . TYR B 1 358 ? -17.309 47.092  25.184 1.00 32.09 ? 338  TYR B CE1 1 
ATOM   5592 C CE2 . TYR B 1 358 ? -18.052 46.017  27.217 1.00 29.98 ? 338  TYR B CE2 1 
ATOM   5593 C CZ  . TYR B 1 358 ? -18.255 46.926  26.190 1.00 32.37 ? 338  TYR B CZ  1 
ATOM   5594 O OH  . TYR B 1 358 ? -19.366 47.714  26.169 1.00 31.14 ? 338  TYR B OH  1 
ATOM   5595 N N   . SER B 1 359 ? -12.235 43.549  24.682 1.00 24.80 ? 339  SER B N   1 
ATOM   5596 C CA  . SER B 1 359 ? -10.989 42.910  24.271 1.00 23.76 ? 339  SER B CA  1 
ATOM   5597 C C   . SER B 1 359 ? -11.223 42.144  22.952 1.00 22.64 ? 339  SER B C   1 
ATOM   5598 O O   . SER B 1 359 ? -12.338 42.161  22.379 1.00 21.30 ? 339  SER B O   1 
ATOM   5599 C CB  . SER B 1 359 ? -10.374 42.016  25.358 1.00 24.84 ? 339  SER B CB  1 
ATOM   5600 O OG  . SER B 1 359 ? -8.962  41.872  25.136 1.00 21.49 ? 339  SER B OG  1 
ATOM   5601 N N   . TRP B 1 360 ? -10.149 41.522  22.485 1.00 21.35 ? 340  TRP B N   1 
ATOM   5602 C CA  . TRP B 1 360 ? -10.024 40.984  21.150 1.00 19.32 ? 340  TRP B CA  1 
ATOM   5603 C C   . TRP B 1 360 ? -8.593  40.448  21.055 1.00 19.65 ? 340  TRP B C   1 
ATOM   5604 O O   . TRP B 1 360 ? -7.842  40.507  22.029 1.00 19.97 ? 340  TRP B O   1 
ATOM   5605 C CB  . TRP B 1 360 ? -10.342 42.074  20.094 1.00 18.29 ? 340  TRP B CB  1 
ATOM   5606 C CG  . TRP B 1 360 ? -9.647  43.428  20.304 1.00 19.26 ? 340  TRP B CG  1 
ATOM   5607 C CD1 . TRP B 1 360 ? -10.104 44.507  21.039 1.00 19.37 ? 340  TRP B CD1 1 
ATOM   5608 C CD2 . TRP B 1 360 ? -8.402  43.844  19.729 1.00 18.08 ? 340  TRP B CD2 1 
ATOM   5609 N NE1 . TRP B 1 360 ? -9.206  45.546  20.966 1.00 22.27 ? 340  TRP B NE1 1 
ATOM   5610 C CE2 . TRP B 1 360 ? -8.162  45.175  20.154 1.00 19.18 ? 340  TRP B CE2 1 
ATOM   5611 C CE3 . TRP B 1 360 ? -7.469  43.222  18.881 1.00 20.67 ? 340  TRP B CE3 1 
ATOM   5612 C CZ2 . TRP B 1 360 ? -7.008  45.894  19.762 1.00 18.66 ? 340  TRP B CZ2 1 
ATOM   5613 C CZ3 . TRP B 1 360 ? -6.333  43.921  18.489 1.00 16.32 ? 340  TRP B CZ3 1 
ATOM   5614 C CH2 . TRP B 1 360 ? -6.112  45.254  18.941 1.00 20.30 ? 340  TRP B CH2 1 
ATOM   5615 N N   . GLY B 1 361 ? -8.214  39.885  19.920 1.00 18.52 ? 341  GLY B N   1 
ATOM   5616 C CA  . GLY B 1 361 ? -6.846  39.368  19.797 1.00 18.87 ? 341  GLY B CA  1 
ATOM   5617 C C   . GLY B 1 361 ? -6.642  37.964  20.372 1.00 19.52 ? 341  GLY B C   1 
ATOM   5618 O O   . GLY B 1 361 ? -5.505  37.461  20.454 1.00 20.26 ? 341  GLY B O   1 
ATOM   5619 N N   . GLY B 1 362 ? -7.744  37.322  20.756 1.00 18.56 ? 342  GLY B N   1 
ATOM   5620 C CA  . GLY B 1 362 ? -7.768  35.904  21.087 1.00 17.30 ? 342  GLY B CA  1 
ATOM   5621 C C   . GLY B 1 362 ? -8.024  34.963  19.930 1.00 17.25 ? 342  GLY B C   1 
ATOM   5622 O O   . GLY B 1 362 ? -7.972  35.341  18.753 1.00 16.49 ? 342  GLY B O   1 
ATOM   5623 N N   . TYR B 1 363 ? -8.234  33.699  20.272 1.00 18.22 ? 343  TYR B N   1 
ATOM   5624 C CA  . TYR B 1 363 ? -8.427  32.645  19.285 1.00 17.92 ? 343  TYR B CA  1 
ATOM   5625 C C   . TYR B 1 363 ? -9.880  32.599  18.837 1.00 17.67 ? 343  TYR B C   1 
ATOM   5626 O O   . TYR B 1 363 ? -10.208 31.890  17.885 1.00 18.63 ? 343  TYR B O   1 
ATOM   5627 C CB  . TYR B 1 363 ? -8.031  31.285  19.883 1.00 16.71 ? 343  TYR B CB  1 
ATOM   5628 C CG  . TYR B 1 363 ? -8.711  30.918  21.195 1.00 16.45 ? 343  TYR B CG  1 
ATOM   5629 C CD1 . TYR B 1 363 ? -10.014 30.407  21.210 1.00 18.48 ? 343  TYR B CD1 1 
ATOM   5630 C CD2 . TYR B 1 363 ? -8.041  31.023  22.404 1.00 19.49 ? 343  TYR B CD2 1 
ATOM   5631 C CE1 . TYR B 1 363 ? -10.649 30.060  22.401 1.00 18.23 ? 343  TYR B CE1 1 
ATOM   5632 C CE2 . TYR B 1 363 ? -8.658  30.692  23.595 1.00 16.11 ? 343  TYR B CE2 1 
ATOM   5633 C CZ  . TYR B 1 363 ? -9.966  30.203  23.585 1.00 20.98 ? 343  TYR B CZ  1 
ATOM   5634 O OH  . TYR B 1 363 ? -10.564 29.812  24.746 1.00 19.65 ? 343  TYR B OH  1 
ATOM   5635 N N   . GLU B 1 364 ? -10.754 33.301  19.545 1.00 18.69 ? 344  GLU B N   1 
ATOM   5636 C CA  . GLU B 1 364 ? -12.190 33.179  19.258 1.00 19.30 ? 344  GLU B CA  1 
ATOM   5637 C C   . GLU B 1 364 ? -12.709 34.478  18.648 1.00 19.20 ? 344  GLU B C   1 
ATOM   5638 O O   . GLU B 1 364 ? -12.099 35.542  18.868 1.00 19.15 ? 344  GLU B O   1 
ATOM   5639 C CB  . GLU B 1 364 ? -12.980 32.739  20.518 1.00 19.88 ? 344  GLU B CB  1 
ATOM   5640 C CG  . GLU B 1 364 ? -13.573 33.852  21.396 1.00 23.81 ? 344  GLU B CG  1 
ATOM   5641 C CD  . GLU B 1 364 ? -12.560 34.714  22.134 1.00 25.78 ? 344  GLU B CD  1 
ATOM   5642 O OE1 . GLU B 1 364 ? -11.330 34.513  22.024 1.00 24.57 ? 344  GLU B OE1 1 
ATOM   5643 O OE2 . GLU B 1 364 ? -13.003 35.634  22.845 1.00 29.41 ? 344  GLU B OE2 1 
ATOM   5644 N N   . SER B 1 365 ? -13.794 34.372  17.877 1.00 18.67 ? 345  SER B N   1 
ATOM   5645 C CA  . SER B 1 365 ? -14.475 35.502  17.214 1.00 18.73 ? 345  SER B CA  1 
ATOM   5646 C C   . SER B 1 365 ? -15.417 36.280  18.132 1.00 18.78 ? 345  SER B C   1 
ATOM   5647 O O   . SER B 1 365 ? -16.126 35.687  18.946 1.00 20.19 ? 345  SER B O   1 
ATOM   5648 C CB  . SER B 1 365 ? -15.224 35.034  15.969 1.00 17.80 ? 345  SER B CB  1 
ATOM   5649 O OG  . SER B 1 365 ? -14.319 34.462  15.008 1.00 16.07 ? 345  SER B OG  1 
ATOM   5650 N N   . LEU B 1 366 ? -15.388 37.604  18.019 1.00 19.78 ? 346  LEU B N   1 
ATOM   5651 C CA  . LEU B 1 366 ? -16.227 38.482  18.848 1.00 19.59 ? 346  LEU B CA  1 
ATOM   5652 C C   . LEU B 1 366 ? -16.964 39.536  18.008 1.00 20.04 ? 346  LEU B C   1 
ATOM   5653 O O   . LEU B 1 366 ? -16.563 39.873  16.873 1.00 19.90 ? 346  LEU B O   1 
ATOM   5654 C CB  . LEU B 1 366 ? -15.397 39.157  19.943 1.00 19.02 ? 346  LEU B CB  1 
ATOM   5655 C CG  . LEU B 1 366 ? -14.536 38.334  20.891 1.00 18.66 ? 346  LEU B CG  1 
ATOM   5656 C CD1 . LEU B 1 366 ? -13.703 39.283  21.760 1.00 19.60 ? 346  LEU B CD1 1 
ATOM   5657 C CD2 . LEU B 1 366 ? -15.401 37.408  21.778 1.00 18.92 ? 346  LEU B CD2 1 
ATOM   5658 N N   . ILE B 1 367 ? -18.031 40.068  18.591 1.00 20.01 ? 347  ILE B N   1 
ATOM   5659 C CA  . ILE B 1 367 ? -18.929 41.020  17.929 1.00 21.06 ? 347  ILE B CA  1 
ATOM   5660 C C   . ILE B 1 367 ? -19.408 42.042  18.949 1.00 21.22 ? 347  ILE B C   1 
ATOM   5661 O O   . ILE B 1 367 ? -19.745 41.683  20.077 1.00 20.86 ? 347  ILE B O   1 
ATOM   5662 C CB  . ILE B 1 367 ? -20.127 40.320  17.228 1.00 21.05 ? 347  ILE B CB  1 
ATOM   5663 C CG1 . ILE B 1 367 ? -20.938 41.316  16.379 1.00 21.13 ? 347  ILE B CG1 1 
ATOM   5664 C CG2 . ILE B 1 367 ? -21.034 39.546  18.224 1.00 20.36 ? 347  ILE B CG2 1 
ATOM   5665 C CD1 . ILE B 1 367 ? -21.603 40.656  15.203 1.00 19.96 ? 347  ILE B CD1 1 
ATOM   5666 N N   . LEU B 1 368 ? -19.362 43.312  18.557 1.00 22.12 ? 348  LEU B N   1 
ATOM   5667 C CA  . LEU B 1 368 ? -19.827 44.418  19.375 1.00 23.37 ? 348  LEU B CA  1 
ATOM   5668 C C   . LEU B 1 368 ? -20.549 45.400  18.459 1.00 23.05 ? 348  LEU B C   1 
ATOM   5669 O O   . LEU B 1 368 ? -20.146 45.568  17.296 1.00 23.23 ? 348  LEU B O   1 
ATOM   5670 C CB  . LEU B 1 368 ? -18.648 45.119  20.071 1.00 24.04 ? 348  LEU B CB  1 
ATOM   5671 C CG  . LEU B 1 368 ? -18.059 44.488  21.328 1.00 28.29 ? 348  LEU B CG  1 
ATOM   5672 C CD1 . LEU B 1 368 ? -17.236 45.523  22.087 1.00 27.51 ? 348  LEU B CD1 1 
ATOM   5673 C CD2 . LEU B 1 368 ? -19.168 43.908  22.242 1.00 31.28 ? 348  LEU B CD2 1 
ATOM   5674 N N   . ALA B 1 369 ? -21.635 46.010  18.952 1.00 21.84 ? 349  ALA B N   1 
ATOM   5675 C CA  . ALA B 1 369 ? -22.291 47.079  18.183 1.00 21.91 ? 349  ALA B CA  1 
ATOM   5676 C C   . ALA B 1 369 ? -21.988 48.442  18.762 1.00 21.50 ? 349  ALA B C   1 
ATOM   5677 O O   . ALA B 1 369 ? -21.941 48.591  19.973 1.00 22.23 ? 349  ALA B O   1 
ATOM   5678 C CB  . ALA B 1 369 ? -23.836 46.869  18.128 1.00 21.25 ? 349  ALA B CB  1 
ATOM   5679 N N   . ASN B 1 370 ? -21.836 49.451  17.906 1.00 21.79 ? 350  ASN B N   1 
ATOM   5680 C CA  . ASN B 1 370 ? -21.821 50.825  18.377 1.00 22.93 ? 350  ASN B CA  1 
ATOM   5681 C C   . ASN B 1 370 ? -22.768 51.659  17.501 1.00 22.73 ? 350  ASN B C   1 
ATOM   5682 O O   . ASN B 1 370 ? -22.732 51.549  16.273 1.00 21.63 ? 350  ASN B O   1 
ATOM   5683 C CB  . ASN B 1 370 ? -20.408 51.423  18.298 1.00 23.51 ? 350  ASN B CB  1 
ATOM   5684 C CG  . ASN B 1 370 ? -19.494 51.002  19.436 1.00 26.78 ? 350  ASN B CG  1 
ATOM   5685 O OD1 . ASN B 1 370 ? -19.632 51.439  20.589 1.00 32.58 ? 350  ASN B OD1 1 
ATOM   5686 N ND2 . ASN B 1 370 ? -18.487 50.239  19.092 1.00 27.40 ? 350  ASN B ND2 1 
ATOM   5687 N N   . GLN B 1 371 ? -23.579 52.507  18.122 1.00 22.20 ? 351  GLN B N   1 
ATOM   5688 C CA  . GLN B 1 371 ? -24.414 53.436  17.368 1.00 22.87 ? 351  GLN B CA  1 
ATOM   5689 C C   . GLN B 1 371 ? -23.621 54.710  17.024 1.00 22.29 ? 351  GLN B C   1 
ATOM   5690 O O   . GLN B 1 371 ? -22.715 55.089  17.762 1.00 23.26 ? 351  GLN B O   1 
ATOM   5691 C CB  . GLN B 1 371 ? -25.675 53.794  18.187 1.00 22.35 ? 351  GLN B CB  1 
ATOM   5692 C CG  . GLN B 1 371 ? -26.624 52.594  18.465 1.00 22.65 ? 351  GLN B CG  1 
ATOM   5693 C CD  . GLN B 1 371 ? -27.364 52.069  17.213 1.00 22.02 ? 351  GLN B CD  1 
ATOM   5694 O OE1 . GLN B 1 371 ? -26.886 52.172  16.077 1.00 19.46 ? 351  GLN B OE1 1 
ATOM   5695 N NE2 . GLN B 1 371 ? -28.550 51.505  17.434 1.00 22.35 ? 351  GLN B NE2 1 
ATOM   5696 N N   . PRO B 1 372 ? -23.945 55.369  15.904 1.00 22.63 ? 352  PRO B N   1 
ATOM   5697 C CA  . PRO B 1 372 ? -23.244 56.599  15.507 1.00 23.00 ? 352  PRO B CA  1 
ATOM   5698 C C   . PRO B 1 372 ? -23.146 57.596  16.650 1.00 23.48 ? 352  PRO B C   1 
ATOM   5699 O O   . PRO B 1 372 ? -22.104 58.195  16.846 1.00 23.56 ? 352  PRO B O   1 
ATOM   5700 C CB  . PRO B 1 372 ? -24.152 57.181  14.415 1.00 23.30 ? 352  PRO B CB  1 
ATOM   5701 C CG  . PRO B 1 372 ? -24.840 56.034  13.852 1.00 23.35 ? 352  PRO B CG  1 
ATOM   5702 C CD  . PRO B 1 372 ? -24.996 55.003  14.934 1.00 22.46 ? 352  PRO B CD  1 
ATOM   5703 N N   . GLU B 1 373 ? -24.237 57.778  17.391 1.00 24.41 ? 353  GLU B N   1 
ATOM   5704 C CA  . GLU B 1 373 ? -24.254 58.706  18.536 1.00 25.00 ? 353  GLU B CA  1 
ATOM   5705 C C   . GLU B 1 373 ? -23.189 58.374  19.615 1.00 25.01 ? 353  GLU B C   1 
ATOM   5706 O O   . GLU B 1 373 ? -22.554 59.294  20.141 1.00 23.38 ? 353  GLU B O   1 
ATOM   5707 C CB  . GLU B 1 373 ? -25.684 58.883  19.098 1.00 26.12 ? 353  GLU B CB  1 
ATOM   5708 C CG  . GLU B 1 373 ? -26.374 57.564  19.465 1.00 29.82 ? 353  GLU B CG  1 
ATOM   5709 C CD  . GLU B 1 373 ? -27.244 56.973  18.328 1.00 32.11 ? 353  GLU B CD  1 
ATOM   5710 O OE1 . GLU B 1 373 ? -26.835 57.024  17.144 1.00 31.79 ? 353  GLU B OE1 1 
ATOM   5711 O OE2 . GLU B 1 373 ? -28.332 56.421  18.636 1.00 32.86 ? 353  GLU B OE2 1 
ATOM   5712 N N   . HIS B 1 374 ? -22.979 57.080  19.895 1.00 25.06 ? 354  HIS B N   1 
ATOM   5713 C CA  . HIS B 1 374 ? -21.934 56.611  20.804 1.00 25.35 ? 354  HIS B CA  1 
ATOM   5714 C C   . HIS B 1 374 ? -20.543 57.021  20.287 1.00 24.34 ? 354  HIS B C   1 
ATOM   5715 O O   . HIS B 1 374 ? -19.744 57.581  21.020 1.00 23.10 ? 354  HIS B O   1 
ATOM   5716 C CB  . HIS B 1 374 ? -21.928 55.072  20.981 1.00 26.54 ? 354  HIS B CB  1 
ATOM   5717 C CG  . HIS B 1 374 ? -23.247 54.463  21.379 1.00 31.87 ? 354  HIS B CG  1 
ATOM   5718 N ND1 . HIS B 1 374 ? -23.615 53.173  21.011 1.00 35.17 ? 354  HIS B ND1 1 
ATOM   5719 C CD2 . HIS B 1 374 ? -24.266 54.940  22.141 1.00 36.18 ? 354  HIS B CD2 1 
ATOM   5720 C CE1 . HIS B 1 374 ? -24.813 52.904  21.507 1.00 37.30 ? 354  HIS B CE1 1 
ATOM   5721 N NE2 . HIS B 1 374 ? -25.232 53.958  22.191 1.00 36.61 ? 354  HIS B NE2 1 
ATOM   5722 N N   . ILE B 1 375 ? -20.276 56.716  19.015 1.00 23.36 ? 355  ILE B N   1 
ATOM   5723 C CA  . ILE B 1 375 ? -19.007 57.056  18.385 1.00 22.48 ? 355  ILE B CA  1 
ATOM   5724 C C   . ILE B 1 375 ? -18.826 58.591  18.277 1.00 22.89 ? 355  ILE B C   1 
ATOM   5725 O O   . ILE B 1 375 ? -17.770 59.113  18.602 1.00 22.79 ? 355  ILE B O   1 
ATOM   5726 C CB  . ILE B 1 375 ? -18.850 56.330  17.028 1.00 23.08 ? 355  ILE B CB  1 
ATOM   5727 C CG1 . ILE B 1 375 ? -19.081 54.804  17.208 1.00 22.60 ? 355  ILE B CG1 1 
ATOM   5728 C CG2 . ILE B 1 375 ? -17.476 56.635  16.358 1.00 19.37 ? 355  ILE B CG2 1 
ATOM   5729 C CD1 . ILE B 1 375 ? -18.193 54.156  18.307 1.00 25.25 ? 355  ILE B CD1 1 
ATOM   5730 N N   . ALA B 1 376 ? -19.865 59.326  17.881 1.00 21.89 ? 356  ALA B N   1 
ATOM   5731 C CA  . ALA B 1 376 ? -19.671 60.787  17.814 1.00 21.97 ? 356  ALA B CA  1 
ATOM   5732 C C   . ALA B 1 376 ? -19.178 61.360  19.165 1.00 21.15 ? 356  ALA B C   1 
ATOM   5733 O O   . ALA B 1 376 ? -18.383 62.297  19.188 1.00 20.91 ? 356  ALA B O   1 
ATOM   5734 C CB  . ALA B 1 376 ? -20.920 61.460  17.370 1.00 21.78 ? 356  ALA B CB  1 
ATOM   5735 N N   . ALA B 1 377 ? -19.636 60.752  20.262 1.00 21.17 ? 357  ALA B N   1 
ATOM   5736 C CA  . ALA B 1 377 ? -19.343 61.214  21.618 1.00 21.18 ? 357  ALA B CA  1 
ATOM   5737 C C   . ALA B 1 377 ? -17.920 60.928  22.065 1.00 21.79 ? 357  ALA B C   1 
ATOM   5738 O O   . ALA B 1 377 ? -17.455 61.519  23.058 1.00 22.09 ? 357  ALA B O   1 
ATOM   5739 C CB  . ALA B 1 377 ? -20.317 60.620  22.602 1.00 21.23 ? 357  ALA B CB  1 
ATOM   5740 N N   . ILE B 1 378 ? -17.225 60.036  21.350 1.00 20.38 ? 358  ILE B N   1 
ATOM   5741 C CA  . ILE B 1 378 ? -15.832 59.705  21.685 1.00 20.90 ? 358  ILE B CA  1 
ATOM   5742 C C   . ILE B 1 378 ? -14.922 60.059  20.527 1.00 19.91 ? 358  ILE B C   1 
ATOM   5743 O O   . ILE B 1 378 ? -13.856 59.467  20.347 1.00 21.95 ? 358  ILE B O   1 
ATOM   5744 C CB  . ILE B 1 378 ? -15.692 58.229  22.134 1.00 20.43 ? 358  ILE B CB  1 
ATOM   5745 C CG1 . ILE B 1 378 ? -16.050 57.256  21.014 1.00 17.88 ? 358  ILE B CG1 1 
ATOM   5746 C CG2 . ILE B 1 378 ? -16.569 57.951  23.357 1.00 22.83 ? 358  ILE B CG2 1 
ATOM   5747 C CD1 . ILE B 1 378 ? -15.614 55.818  21.308 1.00 16.84 ? 358  ILE B CD1 1 
ATOM   5748 N N   . ARG B 1 379 ? -15.352 61.048  19.745 1.00 20.57 ? 359  ARG B N   1 
ATOM   5749 C CA  . ARG B 1 379 ? -14.514 61.647  18.701 1.00 20.82 ? 359  ARG B CA  1 
ATOM   5750 C C   . ARG B 1 379 ? -14.356 63.172  18.903 1.00 21.16 ? 359  ARG B C   1 
ATOM   5751 O O   . ARG B 1 379 ? -14.920 63.962  18.146 1.00 21.72 ? 359  ARG B O   1 
ATOM   5752 C CB  . ARG B 1 379 ? -15.049 61.326  17.296 1.00 19.71 ? 359  ARG B CB  1 
ATOM   5753 C CG  . ARG B 1 379 ? -15.052 59.832  16.980 1.00 19.47 ? 359  ARG B CG  1 
ATOM   5754 C CD  . ARG B 1 379 ? -13.627 59.320  16.710 1.00 19.31 ? 359  ARG B CD  1 
ATOM   5755 N NE  . ARG B 1 379 ? -13.600 57.876  16.426 1.00 18.47 ? 359  ARG B NE  1 
ATOM   5756 C CZ  . ARG B 1 379 ? -13.377 56.919  17.319 1.00 20.51 ? 359  ARG B CZ  1 
ATOM   5757 N NH1 . ARG B 1 379 ? -13.119 57.203  18.605 1.00 18.52 ? 359  ARG B NH1 1 
ATOM   5758 N NH2 . ARG B 1 379 ? -13.383 55.657  16.900 1.00 23.61 ? 359  ARG B NH2 1 
ATOM   5759 N N   . PRO B 1 380 ? -13.587 63.584  19.933 1.00 21.57 ? 360  PRO B N   1 
ATOM   5760 C CA  . PRO B 1 380 ? -13.431 65.013  20.235 1.00 21.67 ? 360  PRO B CA  1 
ATOM   5761 C C   . PRO B 1 380 ? -12.746 65.790  19.083 1.00 21.99 ? 360  PRO B C   1 
ATOM   5762 O O   . PRO B 1 380 ? -11.884 65.247  18.388 1.00 21.01 ? 360  PRO B O   1 
ATOM   5763 C CB  . PRO B 1 380 ? -12.568 65.007  21.503 1.00 22.69 ? 360  PRO B CB  1 
ATOM   5764 C CG  . PRO B 1 380 ? -11.808 63.690  21.403 1.00 20.91 ? 360  PRO B CG  1 
ATOM   5765 C CD  . PRO B 1 380 ? -12.836 62.734  20.871 1.00 21.41 ? 360  PRO B CD  1 
ATOM   5766 N N   . GLN B 1 381 ? -13.135 67.048  18.904 1.00 22.67 ? 361  GLN B N   1 
ATOM   5767 C CA  . GLN B 1 381 ? -12.688 67.883  17.787 1.00 24.48 ? 361  GLN B CA  1 
ATOM   5768 C C   . GLN B 1 381 ? -12.686 67.189  16.434 1.00 24.97 ? 361  GLN B C   1 
ATOM   5769 O O   . GLN B 1 381 ? -11.688 67.267  15.701 1.00 26.86 ? 361  GLN B O   1 
ATOM   5770 C CB  . GLN B 1 381 ? -11.284 68.416  18.032 1.00 24.77 ? 361  GLN B CB  1 
ATOM   5771 C CG  . GLN B 1 381 ? -11.171 69.355  19.171 1.00 26.86 ? 361  GLN B CG  1 
ATOM   5772 C CD  . GLN B 1 381 ? -9.728  69.738  19.342 1.00 30.27 ? 361  GLN B CD  1 
ATOM   5773 O OE1 . GLN B 1 381 ? -9.176  70.527  18.561 1.00 32.58 ? 361  GLN B OE1 1 
ATOM   5774 N NE2 . GLN B 1 381 ? -9.088  69.129  20.316 1.00 29.01 ? 361  GLN B NE2 1 
ATOM   5775 N N   . GLY B 1 382 ? -13.789 66.522  16.112 1.00 24.89 ? 362  GLY B N   1 
ATOM   5776 C CA  . GLY B 1 382 ? -13.917 65.823  14.839 1.00 24.77 ? 362  GLY B CA  1 
ATOM   5777 C C   . GLY B 1 382 ? -15.338 65.368  14.635 1.00 25.05 ? 362  GLY B C   1 
ATOM   5778 O O   . GLY B 1 382 ? -16.152 65.445  15.551 1.00 24.29 ? 362  GLY B O   1 
ATOM   5779 N N   . GLU B 1 383 ? -15.639 64.943  13.411 1.00 24.99 ? 363  GLU B N   1 
ATOM   5780 C CA  . GLU B 1 383 ? -16.986 64.526  13.012 1.00 25.27 ? 363  GLU B CA  1 
ATOM   5781 C C   . GLU B 1 383 ? -16.921 63.085  12.601 1.00 24.35 ? 363  GLU B C   1 
ATOM   5782 O O   . GLU B 1 383 ? -15.882 62.642  12.111 1.00 24.96 ? 363  GLU B O   1 
ATOM   5783 C CB  . GLU B 1 383 ? -17.454 65.308  11.777 1.00 26.57 ? 363  GLU B CB  1 
ATOM   5784 C CG  . GLU B 1 383 ? -16.316 65.555  10.762 1.00 33.00 ? 363  GLU B CG  1 
ATOM   5785 C CD  . GLU B 1 383 ? -16.015 64.408  9.766  1.00 41.54 ? 363  GLU B CD  1 
ATOM   5786 O OE1 . GLU B 1 383 ? -14.955 63.725  9.925  1.00 46.30 ? 363  GLU B OE1 1 
ATOM   5787 O OE2 . GLU B 1 383 ? -16.789 64.224  8.788  1.00 42.84 ? 363  GLU B OE2 1 
ATOM   5788 N N   . ILE B 1 384 ? -18.003 62.341  12.784 1.00 22.38 ? 364  ILE B N   1 
ATOM   5789 C CA  . ILE B 1 384 ? -18.009 60.975  12.258 1.00 21.62 ? 364  ILE B CA  1 
ATOM   5790 C C   . ILE B 1 384 ? -18.365 60.988  10.775 1.00 21.64 ? 364  ILE B C   1 
ATOM   5791 O O   . ILE B 1 384 ? -18.740 62.030  10.221 1.00 21.88 ? 364  ILE B O   1 
ATOM   5792 C CB  . ILE B 1 384 ? -18.884 59.969  13.077 1.00 20.92 ? 364  ILE B CB  1 
ATOM   5793 C CG1 . ILE B 1 384 ? -20.360 60.335  13.027 1.00 20.29 ? 364  ILE B CG1 1 
ATOM   5794 C CG2 . ILE B 1 384 ? -18.401 59.850  14.518 1.00 22.75 ? 364  ILE B CG2 1 
ATOM   5795 C CD1 . ILE B 1 384 ? -21.181 59.197  13.494 1.00 18.01 ? 364  ILE B CD1 1 
ATOM   5796 N N   . ASP B 1 385 ? -18.226 59.848  10.113 1.00 21.86 ? 365  ASP B N   1 
ATOM   5797 C CA  . ASP B 1 385 ? -18.515 59.791  8.664  1.00 23.02 ? 365  ASP B CA  1 
ATOM   5798 C C   . ASP B 1 385 ? -19.558 58.732  8.260  1.00 23.28 ? 365  ASP B C   1 
ATOM   5799 O O   . ASP B 1 385 ? -19.599 58.309  7.097  1.00 23.10 ? 365  ASP B O   1 
ATOM   5800 C CB  . ASP B 1 385 ? -17.196 59.552  7.892  1.00 23.30 ? 365  ASP B CB  1 
ATOM   5801 C CG  . ASP B 1 385 ? -16.495 58.252  8.309  1.00 25.05 ? 365  ASP B CG  1 
ATOM   5802 O OD1 . ASP B 1 385 ? -17.125 57.391  8.948  1.00 26.99 ? 365  ASP B OD1 1 
ATOM   5803 O OD2 . ASP B 1 385 ? -15.286 58.078  8.012  1.00 29.84 ? 365  ASP B OD2 1 
ATOM   5804 N N   . PHE B 1 386 ? -20.370 58.251  9.211  1.00 23.06 ? 366  PHE B N   1 
ATOM   5805 C CA  . PHE B 1 386 ? -21.348 57.205  8.884  1.00 22.97 ? 366  PHE B CA  1 
ATOM   5806 C C   . PHE B 1 386 ? -22.601 57.522  9.656  1.00 23.23 ? 366  PHE B C   1 
ATOM   5807 O O   . PHE B 1 386 ? -22.575 58.340  10.584 1.00 23.08 ? 366  PHE B O   1 
ATOM   5808 C CB  . PHE B 1 386 ? -20.838 55.796  9.274  1.00 22.38 ? 366  PHE B CB  1 
ATOM   5809 C CG  . PHE B 1 386 ? -20.537 55.637  10.761 1.00 21.87 ? 366  PHE B CG  1 
ATOM   5810 C CD1 . PHE B 1 386 ? -19.318 56.079  11.305 1.00 21.00 ? 366  PHE B CD1 1 
ATOM   5811 C CD2 . PHE B 1 386 ? -21.467 55.048  11.615 1.00 23.11 ? 366  PHE B CD2 1 
ATOM   5812 C CE1 . PHE B 1 386 ? -19.041 55.949  12.673 1.00 22.43 ? 366  PHE B CE1 1 
ATOM   5813 C CE2 . PHE B 1 386 ? -21.195 54.888  12.999 1.00 21.84 ? 366  PHE B CE2 1 
ATOM   5814 C CZ  . PHE B 1 386 ? -19.956 55.339  13.527 1.00 20.83 ? 366  PHE B CZ  1 
ATOM   5815 N N   . SER B 1 387 ? -23.688 56.854  9.300  1.00 24.13 ? 367  SER B N   1 
ATOM   5816 C CA  . SER B 1 387 ? -24.948 57.036  10.004 1.00 25.03 ? 367  SER B CA  1 
ATOM   5817 C C   . SER B 1 387 ? -25.636 55.693  10.349 1.00 25.30 ? 367  SER B C   1 
ATOM   5818 O O   . SER B 1 387 ? -26.675 55.668  11.033 1.00 25.14 ? 367  SER B O   1 
ATOM   5819 C CB  . SER B 1 387 ? -25.893 57.913  9.157  1.00 25.14 ? 367  SER B CB  1 
ATOM   5820 O OG  . SER B 1 387 ? -25.966 57.401  7.841  1.00 24.93 ? 367  SER B OG  1 
ATOM   5821 N N   . GLY B 1 388 ? -25.103 54.579  9.855  1.00 24.69 ? 368  GLY B N   1 
ATOM   5822 C CA  . GLY B 1 388 ? -25.719 53.286  10.191 1.00 24.54 ? 368  GLY B CA  1 
ATOM   5823 C C   . GLY B 1 388 ? -25.080 52.732  11.459 1.00 23.70 ? 368  GLY B C   1 
ATOM   5824 O O   . GLY B 1 388 ? -24.104 53.284  11.961 1.00 23.40 ? 368  GLY B O   1 
ATOM   5825 N N   . THR B 1 389 ? -25.619 51.625  11.972 1.00 23.10 ? 369  THR B N   1 
ATOM   5826 C CA  . THR B 1 389 ? -25.034 50.961  13.129 1.00 21.93 ? 369  THR B CA  1 
ATOM   5827 C C   . THR B 1 389 ? -23.644 50.390  12.776 1.00 20.90 ? 369  THR B C   1 
ATOM   5828 O O   . THR B 1 389 ? -23.438 49.801  11.705 1.00 20.51 ? 369  THR B O   1 
ATOM   5829 C CB  . THR B 1 389 ? -25.978 49.866  13.640 1.00 22.68 ? 369  THR B CB  1 
ATOM   5830 O OG1 . THR B 1 389 ? -27.205 50.489  14.055 1.00 22.31 ? 369  THR B OG1 1 
ATOM   5831 C CG2 . THR B 1 389 ? -25.353 49.054  14.816 1.00 19.57 ? 369  THR B CG2 1 
ATOM   5832 N N   . LEU B 1 390 ? -22.686 50.607  13.653 1.00 20.74 ? 370  LEU B N   1 
ATOM   5833 C CA  . LEU B 1 390 ? -21.350 50.109  13.339 1.00 18.80 ? 370  LEU B CA  1 
ATOM   5834 C C   . LEU B 1 390 ? -21.167 48.805  14.106 1.00 19.19 ? 370  LEU B C   1 
ATOM   5835 O O   . LEU B 1 390 ? -21.372 48.756  15.339 1.00 17.99 ? 370  LEU B O   1 
ATOM   5836 C CB  . LEU B 1 390 ? -20.253 51.159  13.684 1.00 19.39 ? 370  LEU B CB  1 
ATOM   5837 C CG  . LEU B 1 390 ? -18.806 50.706  13.361 1.00 19.60 ? 370  LEU B CG  1 
ATOM   5838 C CD1 . LEU B 1 390 ? -17.878 51.833  13.117 1.00 22.26 ? 370  LEU B CD1 1 
ATOM   5839 C CD2 . LEU B 1 390 ? -18.260 49.862  14.526 1.00 27.05 ? 370  LEU B CD2 1 
ATOM   5840 N N   . ILE B 1 391 ? -20.754 47.772  13.379 1.00 18.63 ? 371  ILE B N   1 
ATOM   5841 C CA  . ILE B 1 391 ? -20.360 46.483  13.983 1.00 18.53 ? 371  ILE B CA  1 
ATOM   5842 C C   . ILE B 1 391 ? -18.813 46.252  13.976 1.00 18.48 ? 371  ILE B C   1 
ATOM   5843 O O   . ILE B 1 391 ? -18.182 46.236  12.908 1.00 17.67 ? 371  ILE B O   1 
ATOM   5844 C CB  . ILE B 1 391 ? -21.071 45.310  13.285 1.00 19.50 ? 371  ILE B CB  1 
ATOM   5845 C CG1 . ILE B 1 391 ? -22.590 45.581  13.149 1.00 20.63 ? 371  ILE B CG1 1 
ATOM   5846 C CG2 . ILE B 1 391 ? -20.786 43.993  14.016 1.00 19.05 ? 371  ILE B CG2 1 
ATOM   5847 C CD1 . ILE B 1 391 ? -23.336 45.742  14.523 1.00 23.68 ? 371  ILE B CD1 1 
ATOM   5848 N N   . ARG B 1 392 ? -18.217 46.071  15.158 1.00 17.11 ? 372  ARG B N   1 
ATOM   5849 C CA  . ARG B 1 392 ? -16.797 45.679  15.250 1.00 17.32 ? 372  ARG B CA  1 
ATOM   5850 C C   . ARG B 1 392 ? -16.693 44.162  15.400 1.00 17.34 ? 372  ARG B C   1 
ATOM   5851 O O   . ARG B 1 392 ? -17.271 43.568  16.320 1.00 18.94 ? 372  ARG B O   1 
ATOM   5852 C CB  . ARG B 1 392 ? -16.068 46.381  16.390 1.00 16.08 ? 372  ARG B CB  1 
ATOM   5853 C CG  . ARG B 1 392 ? -14.545 46.341  16.227 1.00 14.86 ? 372  ARG B CG  1 
ATOM   5854 C CD  . ARG B 1 392 ? -13.898 46.838  17.492 1.00 17.74 ? 372  ARG B CD  1 
ATOM   5855 N NE  . ARG B 1 392 ? -14.028 45.920  18.636 1.00 15.44 ? 372  ARG B NE  1 
ATOM   5856 C CZ  . ARG B 1 392 ? -13.432 46.101  19.816 1.00 22.37 ? 372  ARG B CZ  1 
ATOM   5857 N NH1 . ARG B 1 392 ? -12.596 47.145  19.998 1.00 21.91 ? 372  ARG B NH1 1 
ATOM   5858 N NH2 . ARG B 1 392 ? -13.623 45.215  20.797 1.00 17.18 ? 372  ARG B NH2 1 
ATOM   5859 N N   . LEU B 1 393 ? -15.958 43.546  14.475 1.00 18.22 ? 373  LEU B N   1 
ATOM   5860 C CA  . LEU B 1 393 ? -15.729 42.095  14.470 1.00 17.55 ? 373  LEU B CA  1 
ATOM   5861 C C   . LEU B 1 393 ? -14.289 41.769  14.862 1.00 18.60 ? 373  LEU B C   1 
ATOM   5862 O O   . LEU B 1 393 ? -13.387 42.412  14.367 1.00 18.70 ? 373  LEU B O   1 
ATOM   5863 C CB  . LEU B 1 393 ? -15.958 41.574  13.057 1.00 17.65 ? 373  LEU B CB  1 
ATOM   5864 C CG  . LEU B 1 393 ? -17.390 41.511  12.512 1.00 17.22 ? 373  LEU B CG  1 
ATOM   5865 C CD1 . LEU B 1 393 ? -17.414 40.726  11.187 1.00 19.34 ? 373  LEU B CD1 1 
ATOM   5866 C CD2 . LEU B 1 393 ? -18.398 40.923  13.527 1.00 20.21 ? 373  LEU B CD2 1 
ATOM   5867 N N   . HIS B 1 394 ? -14.096 40.790  15.745 1.00 18.84 ? 374  HIS B N   1 
ATOM   5868 C CA  . HIS B 1 394 ? -12.807 40.134  15.848 1.00 19.19 ? 374  HIS B CA  1 
ATOM   5869 C C   . HIS B 1 394 ? -12.931 38.758  15.202 1.00 19.33 ? 374  HIS B C   1 
ATOM   5870 O O   . HIS B 1 394 ? -13.773 37.956  15.589 1.00 20.63 ? 374  HIS B O   1 
ATOM   5871 C CB  . HIS B 1 394 ? -12.316 39.938  17.275 1.00 18.82 ? 374  HIS B CB  1 
ATOM   5872 C CG  . HIS B 1 394 ? -10.976 39.282  17.298 1.00 20.29 ? 374  HIS B CG  1 
ATOM   5873 N ND1 . HIS B 1 394 ? -10.796 37.939  17.578 1.00 20.33 ? 374  HIS B ND1 1 
ATOM   5874 C CD2 . HIS B 1 394 ? -9.776  39.752  16.898 1.00 20.60 ? 374  HIS B CD2 1 
ATOM   5875 C CE1 . HIS B 1 394 ? -9.525  37.635  17.405 1.00 19.49 ? 374  HIS B CE1 1 
ATOM   5876 N NE2 . HIS B 1 394 ? -8.887  38.717  16.999 1.00 19.01 ? 374  HIS B NE2 1 
ATOM   5877 N N   . ILE B 1 395 ? -12.138 38.513  14.184 1.00 18.27 ? 375  ILE B N   1 
ATOM   5878 C CA  . ILE B 1 395 ? -12.178 37.225  13.482 1.00 17.98 ? 375  ILE B CA  1 
ATOM   5879 C C   . ILE B 1 395 ? -11.083 36.331  14.132 1.00 17.71 ? 375  ILE B C   1 
ATOM   5880 O O   . ILE B 1 395 ? -9.897  36.676  14.079 1.00 18.67 ? 375  ILE B O   1 
ATOM   5881 C CB  . ILE B 1 395 ? -11.980 37.401  11.946 1.00 17.18 ? 375  ILE B CB  1 
ATOM   5882 C CG1 . ILE B 1 395 ? -13.006 38.386  11.357 1.00 17.78 ? 375  ILE B CG1 1 
ATOM   5883 C CG2 . ILE B 1 395 ? -12.021 36.045  11.240 1.00 17.29 ? 375  ILE B CG2 1 
ATOM   5884 C CD1 . ILE B 1 395 ? -14.442 37.916  11.546 1.00 17.82 ? 375  ILE B CD1 1 
ATOM   5885 N N   . GLY B 1 396 ? -11.515 35.275  14.811 1.00 18.09 ? 376  GLY B N   1 
ATOM   5886 C CA  . GLY B 1 396 ? -10.641 34.334  15.506 1.00 18.18 ? 376  GLY B CA  1 
ATOM   5887 C C   . GLY B 1 396 ? -10.178 33.213  14.590 1.00 18.14 ? 376  GLY B C   1 
ATOM   5888 O O   . GLY B 1 396 ? -10.028 33.396  13.386 1.00 18.96 ? 376  GLY B O   1 
ATOM   5889 N N   . LEU B 1 397 ? -9.986  32.031  15.161 1.00 18.40 ? 377  LEU B N   1 
ATOM   5890 C CA  . LEU B 1 397 ? -9.393  30.914  14.418 1.00 19.38 ? 377  LEU B CA  1 
ATOM   5891 C C   . LEU B 1 397 ? -10.379 29.872  13.939 1.00 19.09 ? 377  LEU B C   1 
ATOM   5892 O O   . LEU B 1 397 ? -9.985  28.801  13.423 1.00 20.29 ? 377  LEU B O   1 
ATOM   5893 C CB  . LEU B 1 397 ? -8.272  30.243  15.253 1.00 19.28 ? 377  LEU B CB  1 
ATOM   5894 C CG  . LEU B 1 397 ? -7.190  31.198  15.771 1.00 20.08 ? 377  LEU B CG  1 
ATOM   5895 C CD1 . LEU B 1 397 ? -6.286  30.452  16.776 1.00 19.52 ? 377  LEU B CD1 1 
ATOM   5896 C CD2 . LEU B 1 397 ? -6.365  31.870  14.618 1.00 20.82 ? 377  LEU B CD2 1 
ATOM   5897 N N   . GLU B 1 398 ? -11.671 30.133  14.118 1.00 18.45 ? 378  GLU B N   1 
ATOM   5898 C CA  . GLU B 1 398 ? -12.666 29.182  13.617 1.00 19.20 ? 378  GLU B CA  1 
ATOM   5899 C C   . GLU B 1 398 ? -12.620 29.083  12.083 1.00 19.49 ? 378  GLU B C   1 
ATOM   5900 O O   . GLU B 1 398 ? -11.933 29.875  11.400 1.00 19.11 ? 378  GLU B O   1 
ATOM   5901 C CB  . GLU B 1 398 ? -14.057 29.619  14.061 1.00 18.49 ? 378  GLU B CB  1 
ATOM   5902 C CG  . GLU B 1 398 ? -14.182 29.855  15.586 1.00 18.51 ? 378  GLU B CG  1 
ATOM   5903 C CD  . GLU B 1 398 ? -13.993 31.342  16.003 1.00 18.44 ? 378  GLU B CD  1 
ATOM   5904 O OE1 . GLU B 1 398 ? -13.285 32.094  15.276 1.00 17.58 ? 378  GLU B OE1 1 
ATOM   5905 O OE2 . GLU B 1 398 ? -14.575 31.753  17.038 1.00 17.09 ? 378  GLU B OE2 1 
ATOM   5906 N N   . ASP B 1 399 ? -13.368 28.119  11.540 1.00 20.42 ? 379  ASP B N   1 
ATOM   5907 C CA  . ASP B 1 399 ? -13.451 27.984  10.096 1.00 20.87 ? 379  ASP B CA  1 
ATOM   5908 C C   . ASP B 1 399 ? -14.143 29.215  9.500  1.00 21.32 ? 379  ASP B C   1 
ATOM   5909 O O   . ASP B 1 399 ? -15.238 29.603  9.953  1.00 19.49 ? 379  ASP B O   1 
ATOM   5910 C CB  . ASP B 1 399 ? -14.191 26.719  9.719  1.00 21.16 ? 379  ASP B CB  1 
ATOM   5911 C CG  . ASP B 1 399 ? -14.251 26.525  8.251  1.00 24.13 ? 379  ASP B CG  1 
ATOM   5912 O OD1 . ASP B 1 399 ? -13.417 25.763  7.745  1.00 27.77 ? 379  ASP B OD1 1 
ATOM   5913 O OD2 . ASP B 1 399 ? -15.122 27.130  7.604  1.00 23.75 ? 379  ASP B OD2 1 
ATOM   5914 N N   . VAL B 1 400 ? -13.515 29.821  8.496  1.00 20.91 ? 380  VAL B N   1 
ATOM   5915 C CA  . VAL B 1 400 ? -14.012 31.089  7.964  1.00 22.09 ? 380  VAL B CA  1 
ATOM   5916 C C   . VAL B 1 400 ? -15.431 30.959  7.364  1.00 22.86 ? 380  VAL B C   1 
ATOM   5917 O O   . VAL B 1 400 ? -16.275 31.859  7.490  1.00 23.49 ? 380  VAL B O   1 
ATOM   5918 C CB  . VAL B 1 400 ? -12.972 31.781  7.017  1.00 21.91 ? 380  VAL B CB  1 
ATOM   5919 C CG1 . VAL B 1 400 ? -12.786 30.998  5.717  1.00 21.74 ? 380  VAL B CG1 1 
ATOM   5920 C CG2 . VAL B 1 400 ? -13.387 33.265  6.763  1.00 22.15 ? 380  VAL B CG2 1 
ATOM   5921 N N   . ASP B 1 401 ? -15.730 29.810  6.760  1.00 23.89 ? 381  ASP B N   1 
ATOM   5922 C CA  . ASP B 1 401 ? -17.077 29.609  6.205  1.00 24.12 ? 381  ASP B CA  1 
ATOM   5923 C C   . ASP B 1 401 ? -18.159 29.475  7.296  1.00 23.52 ? 381  ASP B C   1 
ATOM   5924 O O   . ASP B 1 401 ? -19.275 29.976  7.132  1.00 23.43 ? 381  ASP B O   1 
ATOM   5925 C CB  . ASP B 1 401 ? -17.073 28.461  5.211  1.00 24.78 ? 381  ASP B CB  1 
ATOM   5926 C CG  . ASP B 1 401 ? -16.146 28.743  4.045  1.00 27.49 ? 381  ASP B CG  1 
ATOM   5927 O OD1 . ASP B 1 401 ? -16.200 29.860  3.475  1.00 31.92 ? 381  ASP B OD1 1 
ATOM   5928 O OD2 . ASP B 1 401 ? -15.328 27.872  3.710  1.00 31.69 ? 381  ASP B OD2 1 
ATOM   5929 N N   . ASP B 1 402 ? -17.807 28.849  8.421  1.00 23.06 ? 382  ASP B N   1 
ATOM   5930 C CA  . ASP B 1 402 ? -18.708 28.773  9.576  1.00 22.44 ? 382  ASP B CA  1 
ATOM   5931 C C   . ASP B 1 402 ? -18.981 30.172  10.071 1.00 22.02 ? 382  ASP B C   1 
ATOM   5932 O O   . ASP B 1 402 ? -20.095 30.492  10.487 1.00 22.12 ? 382  ASP B O   1 
ATOM   5933 C CB  . ASP B 1 402 ? -18.074 27.968  10.705 1.00 21.44 ? 382  ASP B CB  1 
ATOM   5934 C CG  . ASP B 1 402 ? -18.113 26.487  10.453 1.00 23.78 ? 382  ASP B CG  1 
ATOM   5935 O OD1 . ASP B 1 402 ? -18.914 26.022  9.588  1.00 25.25 ? 382  ASP B OD1 1 
ATOM   5936 O OD2 . ASP B 1 402 ? -17.365 25.777  11.157 1.00 20.66 ? 382  ASP B OD2 1 
ATOM   5937 N N   . LEU B 1 403 ? -17.936 31.005  10.038 1.00 21.72 ? 383  LEU B N   1 
ATOM   5938 C CA  . LEU B 1 403 ? -18.068 32.360  10.518 1.00 21.56 ? 383  LEU B CA  1 
ATOM   5939 C C   . LEU B 1 403 ? -18.956 33.170  9.574  1.00 21.12 ? 383  LEU B C   1 
ATOM   5940 O O   . LEU B 1 403 ? -19.863 33.864  10.013 1.00 20.86 ? 383  LEU B O   1 
ATOM   5941 C CB  . LEU B 1 403 ? -16.701 33.018  10.732 1.00 21.24 ? 383  LEU B CB  1 
ATOM   5942 C CG  . LEU B 1 403 ? -15.842 32.531  11.897 1.00 21.22 ? 383  LEU B CG  1 
ATOM   5943 C CD1 . LEU B 1 403 ? -14.477 33.269  11.910 1.00 22.18 ? 383  LEU B CD1 1 
ATOM   5944 C CD2 . LEU B 1 403 ? -16.642 32.732  13.226 1.00 21.17 ? 383  LEU B CD2 1 
ATOM   5945 N N   . ILE B 1 404 ? -18.709 33.057  8.286  1.00 20.51 ? 384  ILE B N   1 
ATOM   5946 C CA  . ILE B 1 404 ? -19.572 33.711  7.309  1.00 20.64 ? 384  ILE B CA  1 
ATOM   5947 C C   . ILE B 1 404 ? -21.016 33.237  7.386  1.00 21.48 ? 384  ILE B C   1 
ATOM   5948 O O   . ILE B 1 404 ? -21.906 34.055  7.284  1.00 20.92 ? 384  ILE B O   1 
ATOM   5949 C CB  . ILE B 1 404 ? -18.990 33.603  5.888  1.00 20.69 ? 384  ILE B CB  1 
ATOM   5950 C CG1 . ILE B 1 404 ? -17.744 34.489  5.785  1.00 18.66 ? 384  ILE B CG1 1 
ATOM   5951 C CG2 . ILE B 1 404 ? -20.000 34.030  4.802  1.00 21.24 ? 384  ILE B CG2 1 
ATOM   5952 C CD1 . ILE B 1 404 ? -16.978 34.243  4.537  1.00 20.94 ? 384  ILE B CD1 1 
ATOM   5953 N N   . ALA B 1 405 ? -21.251 31.937  7.600  1.00 22.01 ? 385  ALA B N   1 
ATOM   5954 C CA  . ALA B 1 405 ? -22.631 31.449  7.826  1.00 22.41 ? 385  ALA B CA  1 
ATOM   5955 C C   . ALA B 1 405 ? -23.321 32.129  9.027  1.00 22.74 ? 385  ALA B C   1 
ATOM   5956 O O   . ALA B 1 405 ? -24.516 32.454  8.965  1.00 22.96 ? 385  ALA B O   1 
ATOM   5957 C CB  . ALA B 1 405 ? -22.635 29.966  8.003  1.00 22.47 ? 385  ALA B CB  1 
ATOM   5958 N N   . ASP B 1 406 ? -22.585 32.321  10.123 1.00 22.31 ? 386  ASP B N   1 
ATOM   5959 C CA  . ASP B 1 406 ? -23.145 32.960  11.322 1.00 23.02 ? 386  ASP B CA  1 
ATOM   5960 C C   . ASP B 1 406 ? -23.518 34.434  11.045 1.00 22.55 ? 386  ASP B C   1 
ATOM   5961 O O   . ASP B 1 406 ? -24.605 34.869  11.400 1.00 22.98 ? 386  ASP B O   1 
ATOM   5962 C CB  . ASP B 1 406 ? -22.147 32.864  12.465 1.00 22.69 ? 386  ASP B CB  1 
ATOM   5963 C CG  . ASP B 1 406 ? -22.795 32.791  13.824 1.00 20.92 ? 386  ASP B CG  1 
ATOM   5964 O OD1 . ASP B 1 406 ? -23.961 32.392  13.946 1.00 23.83 ? 386  ASP B OD1 1 
ATOM   5965 O OD2 . ASP B 1 406 ? -22.117 33.161  14.802 1.00 23.89 ? 386  ASP B OD2 1 
ATOM   5966 N N   . LEU B 1 407 ? -22.581 35.183  10.444 1.00 23.14 ? 387  LEU B N   1 
ATOM   5967 C CA  . LEU B 1 407 ? -22.835 36.540  9.966  1.00 23.19 ? 387  LEU B CA  1 
ATOM   5968 C C   . LEU B 1 407 ? -24.018 36.561  8.997  1.00 23.09 ? 387  LEU B C   1 
ATOM   5969 O O   . LEU B 1 407 ? -24.895 37.408  9.097  1.00 22.53 ? 387  LEU B O   1 
ATOM   5970 C CB  . LEU B 1 407 ? -21.590 37.129  9.313  1.00 23.71 ? 387  LEU B CB  1 
ATOM   5971 C CG  . LEU B 1 407 ? -20.412 37.414  10.262 1.00 21.74 ? 387  LEU B CG  1 
ATOM   5972 C CD1 . LEU B 1 407 ? -19.277 37.812  9.404  1.00 22.81 ? 387  LEU B CD1 1 
ATOM   5973 C CD2 . LEU B 1 407 ? -20.711 38.530  11.271 1.00 24.95 ? 387  LEU B CD2 1 
ATOM   5974 N N   . ASP B 1 408 ? -24.059 35.598  8.085  1.00 23.07 ? 388  ASP B N   1 
ATOM   5975 C CA  . ASP B 1 408 ? -25.171 35.528  7.152  1.00 24.17 ? 388  ASP B CA  1 
ATOM   5976 C C   . ASP B 1 408 ? -26.526 35.311  7.846  1.00 23.37 ? 388  ASP B C   1 
ATOM   5977 O O   . ASP B 1 408 ? -27.535 35.925  7.481  1.00 21.36 ? 388  ASP B O   1 
ATOM   5978 C CB  . ASP B 1 408 ? -24.922 34.451  6.102  1.00 25.21 ? 388  ASP B CB  1 
ATOM   5979 C CG  . ASP B 1 408 ? -25.866 34.570  4.948  1.00 27.63 ? 388  ASP B CG  1 
ATOM   5980 O OD1 . ASP B 1 408 ? -25.956 35.672  4.360  1.00 31.19 ? 388  ASP B OD1 1 
ATOM   5981 O OD2 . ASP B 1 408 ? -26.531 33.561  4.640  1.00 33.62 ? 388  ASP B OD2 1 
ATOM   5982 N N   . ALA B 1 409 ? -26.564 34.435  8.843  1.00 24.18 ? 389  ALA B N   1 
ATOM   5983 C CA  . ALA B 1 409 ? -27.832 34.254  9.575  1.00 24.12 ? 389  ALA B CA  1 
ATOM   5984 C C   . ALA B 1 409 ? -28.237 35.556  10.291 1.00 24.29 ? 389  ALA B C   1 
ATOM   5985 O O   . ALA B 1 409 ? -29.419 35.891  10.380 1.00 23.75 ? 389  ALA B O   1 
ATOM   5986 C CB  . ALA B 1 409 ? -27.762 33.077  10.559 1.00 23.89 ? 389  ALA B CB  1 
ATOM   5987 N N   . GLY B 1 410 ? -27.251 36.288  10.794 1.00 23.82 ? 390  GLY B N   1 
ATOM   5988 C CA  . GLY B 1 410 ? -27.489 37.578  11.446 1.00 23.50 ? 390  GLY B CA  1 
ATOM   5989 C C   . GLY B 1 410 ? -28.159 38.576  10.522 1.00 22.95 ? 390  GLY B C   1 
ATOM   5990 O O   . GLY B 1 410 ? -29.115 39.293  10.923 1.00 22.86 ? 390  GLY B O   1 
ATOM   5991 N N   . PHE B 1 411 ? -27.687 38.625  9.275  1.00 22.26 ? 391  PHE B N   1 
ATOM   5992 C CA  . PHE B 1 411 ? -28.251 39.551  8.308  1.00 22.76 ? 391  PHE B CA  1 
ATOM   5993 C C   . PHE B 1 411 ? -29.727 39.263  8.101  1.00 23.76 ? 391  PHE B C   1 
ATOM   5994 O O   . PHE B 1 411 ? -30.512 40.195  8.040  1.00 24.59 ? 391  PHE B O   1 
ATOM   5995 C CB  . PHE B 1 411 ? -27.528 39.513  6.978  1.00 22.28 ? 391  PHE B CB  1 
ATOM   5996 C CG  . PHE B 1 411 ? -26.201 40.244  6.989  1.00 21.23 ? 391  PHE B CG  1 
ATOM   5997 C CD1 . PHE B 1 411 ? -26.104 41.548  7.478  1.00 20.89 ? 391  PHE B CD1 1 
ATOM   5998 C CD2 . PHE B 1 411 ? -25.052 39.630  6.508  1.00 23.48 ? 391  PHE B CD2 1 
ATOM   5999 C CE1 . PHE B 1 411 ? -24.881 42.225  7.464  1.00 19.86 ? 391  PHE B CE1 1 
ATOM   6000 C CE2 . PHE B 1 411 ? -23.863 40.300  6.490  1.00 19.10 ? 391  PHE B CE2 1 
ATOM   6001 C CZ  . PHE B 1 411 ? -23.790 41.603  6.959  1.00 19.44 ? 391  PHE B CZ  1 
ATOM   6002 N N   . ALA B 1 412 ? -30.081 37.979  8.041  1.00 24.47 ? 392  ALA B N   1 
ATOM   6003 C CA  . ALA B 1 412 ? -31.461 37.555  7.800  1.00 25.65 ? 392  ALA B CA  1 
ATOM   6004 C C   . ALA B 1 412 ? -32.367 37.964  8.954  1.00 26.59 ? 392  ALA B C   1 
ATOM   6005 O O   . ALA B 1 412 ? -33.575 38.145  8.768  1.00 27.06 ? 392  ALA B O   1 
ATOM   6006 C CB  . ALA B 1 412 ? -31.521 36.036  7.587  1.00 25.72 ? 392  ALA B CB  1 
ATOM   6007 N N   . ARG B 1 413 ? -31.791 38.073  10.147 1.00 26.92 ? 393  ARG B N   1 
ATOM   6008 C CA  . ARG B 1 413 ? -32.526 38.487  11.338 1.00 27.75 ? 393  ARG B CA  1 
ATOM   6009 C C   . ARG B 1 413 ? -32.882 39.983  11.317 1.00 29.13 ? 393  ARG B C   1 
ATOM   6010 O O   . ARG B 1 413 ? -33.824 40.391  12.005 1.00 30.28 ? 393  ARG B O   1 
ATOM   6011 C CB  . ARG B 1 413 ? -31.756 38.136  12.629 1.00 27.20 ? 393  ARG B CB  1 
ATOM   6012 C CG  . ARG B 1 413 ? -31.707 36.660  12.974 1.00 25.67 ? 393  ARG B CG  1 
ATOM   6013 C CD  . ARG B 1 413 ? -31.314 36.435  14.444 1.00 22.63 ? 393  ARG B CD  1 
ATOM   6014 N NE  . ARG B 1 413 ? -29.922 36.824  14.723 1.00 22.95 ? 393  ARG B NE  1 
ATOM   6015 C CZ  . ARG B 1 413 ? -28.843 36.093  14.410 1.00 23.60 ? 393  ARG B CZ  1 
ATOM   6016 N NH1 . ARG B 1 413 ? -28.931 34.912  13.782 1.00 23.67 ? 393  ARG B NH1 1 
ATOM   6017 N NH2 . ARG B 1 413 ? -27.649 36.551  14.724 1.00 17.62 ? 393  ARG B NH2 1 
ATOM   6018 N N   . ILE B 1 414 ? -32.155 40.798  10.541 1.00 29.07 ? 394  ILE B N   1 
ATOM   6019 C CA  . ILE B 1 414 ? -32.426 42.262  10.474 1.00 29.77 ? 394  ILE B CA  1 
ATOM   6020 C C   . ILE B 1 414 ? -32.783 42.819  9.073  1.00 31.12 ? 394  ILE B C   1 
ATOM   6021 O O   . ILE B 1 414 ? -32.655 44.037  8.841  1.00 31.37 ? 394  ILE B O   1 
ATOM   6022 C CB  . ILE B 1 414 ? -31.262 43.113  11.071 1.00 29.77 ? 394  ILE B CB  1 
ATOM   6023 C CG1 . ILE B 1 414 ? -29.945 42.866  10.299 1.00 28.21 ? 394  ILE B CG1 1 
ATOM   6024 C CG2 . ILE B 1 414 ? -31.088 42.848  12.569 1.00 27.21 ? 394  ILE B CG2 1 
ATOM   6025 C CD1 . ILE B 1 414 ? -28.808 43.835  10.635 1.00 29.37 ? 394  ILE B CD1 1 
ATOM   6026 N N   . VAL B 1 415 ? -33.216 41.947  8.154  1.00 32.39 ? 395  VAL B N   1 
ATOM   6027 C CA  . VAL B 1 415 ? -33.580 42.376  6.776  1.00 34.67 ? 395  VAL B CA  1 
ATOM   6028 C C   . VAL B 1 415 ? -34.864 43.203  6.744  1.00 35.62 ? 395  VAL B C   1 
ATOM   6029 O O   . VAL B 1 415 ? -35.009 44.098  5.899  1.00 36.70 ? 395  VAL B O   1 
ATOM   6030 C CB  . VAL B 1 415 ? -33.794 41.207  5.747  1.00 34.78 ? 395  VAL B CB  1 
ATOM   6031 C CG1 . VAL B 1 415 ? -32.531 40.476  5.480  1.00 35.39 ? 395  VAL B CG1 1 
ATOM   6032 C CG2 . VAL B 1 415 ? -34.922 40.238  6.178  1.00 35.47 ? 395  VAL B CG2 1 
ATOM   6033 O OXT . VAL B 1 415 ? -35.774 42.972  7.545  1.00 36.20 ? 395  VAL B OXT 1 
HETATM 6034 O O4  . P3F C 2 .   ? -5.127  10.415  46.593 1.00 17.26 ? 700  P3F A O4  1 
HETATM 6035 P P1  . P3F C 2 .   ? -5.247  11.447  47.689 1.00 20.85 ? 700  P3F A P1  1 
HETATM 6036 O O2  . P3F C 2 .   ? -6.671  11.879  47.998 1.00 23.63 ? 700  P3F A O2  1 
HETATM 6037 O O3  . P3F C 2 .   ? -4.225  12.578  47.687 1.00 18.65 ? 700  P3F A O3  1 
HETATM 6038 O O1  . P3F C 2 .   ? -4.797  10.594  48.995 1.00 22.72 ? 700  P3F A O1  1 
HETATM 6039 C C5  . P3F C 2 .   ? -5.564  9.452   49.403 1.00 22.81 ? 700  P3F A C5  1 
HETATM 6040 C C4  . P3F C 2 .   ? -5.394  9.175   50.890 1.00 22.73 ? 700  P3F A C4  1 
HETATM 6041 C C3  . P3F C 2 .   ? -4.273  8.432   51.268 1.00 17.28 ? 700  P3F A C3  1 
HETATM 6042 N N1  . P3F C 2 .   ? -4.051  8.109   52.549 1.00 21.46 ? 700  P3F A N1  1 
HETATM 6043 C C2  . P3F C 2 .   ? -4.872  8.514   53.541 1.00 18.31 ? 700  P3F A C2  1 
HETATM 6044 C C1  . P3F C 2 .   ? -4.560  8.121   54.980 1.00 17.92 ? 700  P3F A C1  1 
HETATM 6045 C C17 . P3F C 2 .   ? -6.012  9.259   53.190 1.00 20.31 ? 700  P3F A C17 1 
HETATM 6046 O O9  . P3F C 2 .   ? -6.840  9.658   54.185 1.00 18.49 ? 700  P3F A O9  1 
HETATM 6047 C C6  . P3F C 2 .   ? -6.268  9.662   51.863 1.00 19.85 ? 700  P3F A C6  1 
HETATM 6048 C C7  . P3F C 2 .   ? -7.594  10.371  51.589 1.00 19.60 ? 700  P3F A C7  1 
HETATM 6049 N N2  . P3F C 2 .   ? -8.289  11.470  51.547 1.00 19.29 ? 700  P3F A N2  1 
HETATM 6050 N N3  . P3F C 2 .   ? -9.683  11.041  51.378 1.00 20.76 ? 700  P3F A N3  1 
HETATM 6051 C C8  . P3F C 2 .   ? -10.786 10.927  52.294 1.00 23.79 ? 700  P3F A C8  1 
HETATM 6052 O O5  . P3F C 2 .   ? -11.003 11.287  53.473 1.00 24.16 ? 700  P3F A O5  1 
HETATM 6053 C C9  . P3F C 2 .   ? -11.959 10.264  51.627 1.00 22.41 ? 700  P3F A C9  1 
HETATM 6054 N N4  . P3F C 2 .   ? -11.803 9.571   50.361 1.00 19.24 ? 700  P3F A N4  1 
HETATM 6055 C C10 . P3F C 2 .   ? -12.516 8.425   50.039 1.00 21.51 ? 700  P3F A C10 1 
HETATM 6056 O O6  . P3F C 2 .   ? -13.307 7.816   50.807 1.00 20.49 ? 700  P3F A O6  1 
HETATM 6057 C C11 . P3F C 2 .   ? -12.343 7.848   48.686 1.00 20.81 ? 700  P3F A C11 1 
HETATM 6058 C C16 . P3F C 2 .   ? -12.663 8.646   47.587 1.00 19.89 ? 700  P3F A C16 1 
HETATM 6059 C C18 . P3F C 2 .   ? -13.237 9.965   47.766 1.00 22.09 ? 700  P3F A C18 1 
HETATM 6060 F F2  . P3F C 2 .   ? -14.459 9.838   48.321 1.00 19.62 ? 700  P3F A F2  1 
HETATM 6061 F F1  . P3F C 2 .   ? -13.332 10.603  46.593 1.00 21.02 ? 700  P3F A F1  1 
HETATM 6062 F F3  . P3F C 2 .   ? -12.600 10.731  48.590 1.00 19.46 ? 700  P3F A F3  1 
HETATM 6063 C C12 . P3F C 2 .   ? -11.808 6.584   48.478 1.00 21.97 ? 700  P3F A C12 1 
HETATM 6064 C C13 . P3F C 2 .   ? -11.657 6.129   47.150 1.00 20.94 ? 700  P3F A C13 1 
HETATM 6065 C C14 . P3F C 2 .   ? -11.985 6.932   46.078 1.00 18.72 ? 700  P3F A C14 1 
HETATM 6066 C C15 . P3F C 2 .   ? -12.523 8.200   46.276 1.00 18.73 ? 700  P3F A C15 1 
HETATM 6067 O O4  . P3F D 2 .   ? -5.983  47.420  29.566 1.00 18.09 ? 700  P3F B O4  1 
HETATM 6068 P P1  . P3F D 2 .   ? -6.205  46.304  28.559 1.00 19.89 ? 700  P3F B P1  1 
HETATM 6069 O O2  . P3F D 2 .   ? -7.668  45.882  28.399 1.00 24.57 ? 700  P3F B O2  1 
HETATM 6070 O O3  . P3F D 2 .   ? -5.027  45.330  28.470 1.00 16.64 ? 700  P3F B O3  1 
HETATM 6071 O O1  . P3F D 2 .   ? -5.797  47.101  27.217 1.00 21.20 ? 700  P3F B O1  1 
HETATM 6072 C C5  . P3F D 2 .   ? -6.410  48.357  26.911 1.00 19.78 ? 700  P3F B C5  1 
HETATM 6073 C C4  . P3F D 2 .   ? -6.490  48.596  25.406 1.00 20.65 ? 700  P3F B C4  1 
HETATM 6074 C C3  . P3F D 2 .   ? -5.431  49.355  24.876 1.00 19.48 ? 700  P3F B C3  1 
HETATM 6075 N N1  . P3F D 2 .   ? -5.404  49.662  23.557 1.00 21.43 ? 700  P3F B N1  1 
HETATM 6076 C C2  . P3F D 2 .   ? -6.376  49.253  22.683 1.00 20.01 ? 700  P3F B C2  1 
HETATM 6077 C C1  . P3F D 2 .   ? -6.229  49.615  21.197 1.00 17.18 ? 700  P3F B C1  1 
HETATM 6078 C C17 . P3F D 2 .   ? -7.437  48.491  23.191 1.00 19.53 ? 700  P3F B C17 1 
HETATM 6079 O O9  . P3F D 2 .   ? -8.414  48.048  22.351 1.00 18.42 ? 700  P3F B O9  1 
HETATM 6080 C C6  . P3F D 2 .   ? -7.492  48.116  24.547 1.00 17.94 ? 700  P3F B C6  1 
HETATM 6081 C C7  . P3F D 2 .   ? -8.772  47.406  24.906 1.00 19.80 ? 700  P3F B C7  1 
HETATM 6082 N N2  . P3F D 2 .   ? -9.407  46.325  24.714 1.00 25.38 ? 700  P3F B N2  1 
HETATM 6083 N N3  . P3F D 2 .   ? -10.754 46.490  25.222 1.00 20.12 ? 700  P3F B N3  1 
HETATM 6084 C C8  . P3F D 2 .   ? -11.969 46.727  24.511 1.00 23.76 ? 700  P3F B C8  1 
HETATM 6085 O O5  . P3F D 2 .   ? -12.273 46.671  23.293 1.00 24.12 ? 700  P3F B O5  1 
HETATM 6086 C C9  . P3F D 2 .   ? -13.046 46.973  25.575 1.00 20.12 ? 700  P3F B C9  1 
HETATM 6087 N N4  . P3F D 2 .   ? -12.907 48.121  26.494 1.00 17.85 ? 700  P3F B N4  1 
HETATM 6088 C C10 . P3F D 2 .   ? -13.909 48.949  26.993 1.00 20.71 ? 700  P3F B C10 1 
HETATM 6089 O O6  . P3F D 2 .   ? -15.186 48.920  26.755 1.00 20.88 ? 700  P3F B O6  1 
HETATM 6090 C C11 . P3F D 2 .   ? -13.641 50.029  27.967 1.00 18.69 ? 700  P3F B C11 1 
HETATM 6091 C C16 . P3F D 2 .   ? -13.393 49.634  29.300 1.00 18.47 ? 700  P3F B C16 1 
HETATM 6092 C C18 . P3F D 2 .   ? -13.482 48.263  29.701 1.00 20.37 ? 700  P3F B C18 1 
HETATM 6093 F F2  . P3F D 2 .   ? -14.685 47.782  29.347 1.00 20.29 ? 700  P3F B F2  1 
HETATM 6094 F F1  . P3F D 2 .   ? -13.429 48.363  31.045 1.00 18.69 ? 700  P3F B F1  1 
HETATM 6095 F F3  . P3F D 2 .   ? -12.671 47.459  29.003 1.00 20.39 ? 700  P3F B F3  1 
HETATM 6096 C C12 . P3F D 2 .   ? -13.670 51.359  27.577 1.00 18.52 ? 700  P3F B C12 1 
HETATM 6097 C C13 . P3F D 2 .   ? -13.404 52.284  28.634 1.00 20.53 ? 700  P3F B C13 1 
HETATM 6098 C C14 . P3F D 2 .   ? -13.191 51.864  30.001 1.00 20.36 ? 700  P3F B C14 1 
HETATM 6099 C C15 . P3F D 2 .   ? -13.151 50.515  30.347 1.00 18.63 ? 700  P3F B C15 1 
HETATM 6100 O O   . HOH E 3 .   ? 10.635  22.189  27.824 1.00 20.32 ? 701  HOH A O   1 
HETATM 6101 O O   . HOH E 3 .   ? 10.349  26.522  32.560 1.00 20.11 ? 702  HOH A O   1 
HETATM 6102 O O   . HOH E 3 .   ? -8.923  8.966   58.514 1.00 16.65 ? 703  HOH A O   1 
HETATM 6103 O O   . HOH E 3 .   ? -1.959  8.227   57.832 1.00 19.51 ? 704  HOH A O   1 
HETATM 6104 O O   . HOH E 3 .   ? -4.001  1.381   62.357 1.00 15.85 ? 705  HOH A O   1 
HETATM 6105 O O   . HOH E 3 .   ? 11.131  8.742   58.568 1.00 20.65 ? 706  HOH A O   1 
HETATM 6106 O O   . HOH E 3 .   ? 3.036   27.248  53.405 1.00 15.15 ? 707  HOH A O   1 
HETATM 6107 O O   . HOH E 3 .   ? -29.999 20.245  74.519 1.00 34.72 ? 708  HOH A O   1 
HETATM 6108 O O   . HOH E 3 .   ? -11.240 4.630   54.750 1.00 13.93 ? 709  HOH A O   1 
HETATM 6109 O O   . HOH E 3 .   ? -4.936  4.777   48.622 1.00 19.88 ? 710  HOH A O   1 
HETATM 6110 O O   . HOH E 3 .   ? 1.078   8.980   60.222 1.00 17.87 ? 711  HOH A O   1 
HETATM 6111 O O   . HOH E 3 .   ? -21.947 19.374  78.628 1.00 27.46 ? 712  HOH A O   1 
HETATM 6112 O O   . HOH E 3 .   ? -4.623  20.193  52.457 1.00 18.14 ? 713  HOH A O   1 
HETATM 6113 O O   . HOH E 3 .   ? -7.660  25.900  65.429 1.00 16.09 ? 714  HOH A O   1 
HETATM 6114 O O   . HOH E 3 .   ? 8.182   -7.842  68.088 1.00 27.14 ? 715  HOH A O   1 
HETATM 6115 O O   . HOH E 3 .   ? -3.169  3.759   52.986 1.00 17.57 ? 716  HOH A O   1 
HETATM 6116 O O   . HOH E 3 .   ? 6.187   26.360  60.172 1.00 23.06 ? 717  HOH A O   1 
HETATM 6117 O O   . HOH E 3 .   ? -1.751  30.453  53.656 1.00 15.56 ? 718  HOH A O   1 
HETATM 6118 O O   . HOH E 3 .   ? 3.039   4.490   64.711 1.00 18.22 ? 719  HOH A O   1 
HETATM 6119 O O   . HOH E 3 .   ? 7.542   14.085  39.361 1.00 16.50 ? 720  HOH A O   1 
HETATM 6120 O O   . HOH E 3 .   ? 2.560   26.800  31.225 1.00 19.08 ? 721  HOH A O   1 
HETATM 6121 O O   . HOH E 3 .   ? -0.756  30.503  50.832 1.00 14.86 ? 722  HOH A O   1 
HETATM 6122 O O   . HOH E 3 .   ? -10.396 2.489   56.557 1.00 19.80 ? 723  HOH A O   1 
HETATM 6123 O O   . HOH E 3 .   ? -2.787  22.672  57.546 1.00 18.54 ? 724  HOH A O   1 
HETATM 6124 O O   . HOH E 3 .   ? -21.443 17.604  68.060 1.00 20.55 ? 725  HOH A O   1 
HETATM 6125 O O   . HOH E 3 .   ? 0.325   -3.024  66.900 1.00 17.39 ? 726  HOH A O   1 
HETATM 6126 O O   . HOH E 3 .   ? 0.024   33.084  49.992 1.00 15.18 ? 727  HOH A O   1 
HETATM 6127 O O   . HOH E 3 .   ? 20.588  7.263   52.894 1.00 45.26 ? 728  HOH A O   1 
HETATM 6128 O O   . HOH E 3 .   ? 1.060   27.510  65.757 1.00 21.87 ? 729  HOH A O   1 
HETATM 6129 O O   . HOH E 3 .   ? 6.070   -3.286  39.432 1.00 22.39 ? 730  HOH A O   1 
HETATM 6130 O O   . HOH E 3 .   ? 1.123   24.706  49.917 1.00 16.76 ? 731  HOH A O   1 
HETATM 6131 O O   . HOH E 3 .   ? 10.018  22.892  44.852 1.00 15.63 ? 732  HOH A O   1 
HETATM 6132 O O   . HOH E 3 .   ? 8.350   26.243  46.669 1.00 21.26 ? 733  HOH A O   1 
HETATM 6133 O O   . HOH E 3 .   ? 12.695  14.809  67.358 1.00 44.88 ? 734  HOH A O   1 
HETATM 6134 O O   . HOH E 3 .   ? 2.249   -4.342  71.119 1.00 20.09 ? 735  HOH A O   1 
HETATM 6135 O O   . HOH E 3 .   ? -0.029  3.506   37.925 0.50 21.47 ? 736  HOH A O   1 
HETATM 6136 O O   . HOH E 3 .   ? 16.755  13.776  36.241 1.00 22.15 ? 737  HOH A O   1 
HETATM 6137 O O   . HOH E 3 .   ? 17.717  14.821  42.651 1.00 39.81 ? 738  HOH A O   1 
HETATM 6138 O O   . HOH E 3 .   ? -28.055 5.291   73.275 1.00 56.13 ? 739  HOH A O   1 
HETATM 6139 O O   . HOH E 3 .   ? -6.118  -9.938  66.132 1.00 47.03 ? 740  HOH A O   1 
HETATM 6140 O O   . HOH E 3 .   ? -13.548 14.367  58.511 1.00 22.57 ? 741  HOH A O   1 
HETATM 6141 O O   . HOH E 3 .   ? -20.689 2.752   70.771 1.00 26.06 ? 742  HOH A O   1 
HETATM 6142 O O   . HOH E 3 .   ? 6.527   10.559  52.065 1.00 16.84 ? 743  HOH A O   1 
HETATM 6143 O O   . HOH E 3 .   ? -15.137 15.992  48.680 1.00 17.91 ? 744  HOH A O   1 
HETATM 6144 O O   . HOH E 3 .   ? -8.950  20.353  55.875 1.00 20.58 ? 745  HOH A O   1 
HETATM 6145 O O   . HOH E 3 .   ? 12.041  14.148  39.918 1.00 31.58 ? 746  HOH A O   1 
HETATM 6146 O O   . HOH E 3 .   ? 2.195   18.737  66.352 1.00 28.31 ? 747  HOH A O   1 
HETATM 6147 O O   . HOH E 3 .   ? -16.495 9.822   84.547 1.00 38.36 ? 748  HOH A O   1 
HETATM 6148 O O   . HOH E 3 .   ? 4.391   1.242   40.189 1.00 23.92 ? 749  HOH A O   1 
HETATM 6149 O O   . HOH E 3 .   ? 12.063  23.064  48.009 1.00 26.96 ? 750  HOH A O   1 
HETATM 6150 O O   . HOH E 3 .   ? -14.794 27.249  58.961 1.00 20.31 ? 751  HOH A O   1 
HETATM 6151 O O   . HOH E 3 .   ? -20.972 12.492  55.864 1.00 27.01 ? 752  HOH A O   1 
HETATM 6152 O O   . HOH E 3 .   ? 11.705  9.228   38.544 1.00 33.61 ? 753  HOH A O   1 
HETATM 6153 O O   . HOH E 3 .   ? 15.128  11.563  45.534 1.00 21.65 ? 754  HOH A O   1 
HETATM 6154 O O   . HOH E 3 .   ? 8.223   18.039  34.273 1.00 20.18 ? 755  HOH A O   1 
HETATM 6155 O O   . HOH E 3 .   ? 11.832  23.635  66.016 1.00 28.64 ? 756  HOH A O   1 
HETATM 6156 O O   . HOH E 3 .   ? -26.743 26.616  65.028 1.00 45.94 ? 757  HOH A O   1 
HETATM 6157 O O   . HOH E 3 .   ? 11.559  -13.078 53.576 1.00 31.42 ? 758  HOH A O   1 
HETATM 6158 O O   . HOH E 3 .   ? -13.170 14.919  55.941 1.00 26.41 ? 759  HOH A O   1 
HETATM 6159 O O   . HOH E 3 .   ? 18.384  0.838   53.745 1.00 24.75 ? 760  HOH A O   1 
HETATM 6160 O O   . HOH E 3 .   ? -0.564  16.319  73.748 1.00 25.10 ? 761  HOH A O   1 
HETATM 6161 O O   . HOH E 3 .   ? -18.894 2.150   49.807 1.00 45.49 ? 762  HOH A O   1 
HETATM 6162 O O   . HOH E 3 .   ? 24.165  6.013   30.955 1.00 39.77 ? 763  HOH A O   1 
HETATM 6163 O O   . HOH E 3 .   ? -4.426  3.387   46.318 1.00 21.46 ? 764  HOH A O   1 
HETATM 6164 O O   . HOH E 3 .   ? 15.480  15.200  34.316 1.00 18.81 ? 765  HOH A O   1 
HETATM 6165 O O   . HOH E 3 .   ? 10.177  7.449   39.648 1.00 21.68 ? 766  HOH A O   1 
HETATM 6166 O O   . HOH E 3 .   ? -13.796 -0.687  65.197 1.00 22.16 ? 767  HOH A O   1 
HETATM 6167 O O   . HOH E 3 .   ? 11.073  25.979  47.357 1.00 24.64 ? 768  HOH A O   1 
HETATM 6168 O O   . HOH E 3 .   ? -16.172 -6.257  60.216 1.00 27.22 ? 769  HOH A O   1 
HETATM 6169 O O   . HOH E 3 .   ? -4.894  -9.262  46.479 1.00 24.65 ? 770  HOH A O   1 
HETATM 6170 O O   . HOH E 3 .   ? -4.537  19.897  48.993 1.00 24.61 ? 771  HOH A O   1 
HETATM 6171 O O   . HOH E 3 .   ? -1.788  -2.976  71.948 1.00 28.18 ? 772  HOH A O   1 
HETATM 6172 O O   . HOH E 3 .   ? -0.542  15.186  56.113 1.00 24.27 ? 773  HOH A O   1 
HETATM 6173 O O   . HOH E 3 .   ? 7.782   8.544   40.129 1.00 24.07 ? 774  HOH A O   1 
HETATM 6174 O O   . HOH E 3 .   ? 8.958   12.639  64.820 1.00 36.81 ? 775  HOH A O   1 
HETATM 6175 O O   . HOH E 3 .   ? -6.045  26.511  69.891 1.00 28.03 ? 776  HOH A O   1 
HETATM 6176 O O   . HOH E 3 .   ? 21.106  19.374  35.649 1.00 27.49 ? 777  HOH A O   1 
HETATM 6177 O O   . HOH E 3 .   ? -21.348 0.085   53.197 1.00 43.24 ? 778  HOH A O   1 
HETATM 6178 O O   . HOH E 3 .   ? 0.429   -17.145 58.142 1.00 55.86 ? 779  HOH A O   1 
HETATM 6179 O O   . HOH E 3 .   ? -26.292 16.811  76.419 1.00 27.20 ? 780  HOH A O   1 
HETATM 6180 O O   . HOH E 3 .   ? 11.470  -0.252  65.260 1.00 22.81 ? 781  HOH A O   1 
HETATM 6181 O O   . HOH E 3 .   ? 0.855   15.195  53.759 1.00 18.13 ? 782  HOH A O   1 
HETATM 6182 O O   . HOH E 3 .   ? -5.983  6.369   69.036 1.00 25.14 ? 783  HOH A O   1 
HETATM 6183 O O   . HOH E 3 .   ? 1.907   24.381  32.390 1.00 29.58 ? 784  HOH A O   1 
HETATM 6184 O O   . HOH E 3 .   ? -15.302 24.427  56.776 1.00 26.36 ? 785  HOH A O   1 
HETATM 6185 O O   . HOH E 3 .   ? 23.290  20.770  28.333 1.00 30.50 ? 786  HOH A O   1 
HETATM 6186 O O   . HOH E 3 .   ? 19.758  5.089   35.655 1.00 41.57 ? 787  HOH A O   1 
HETATM 6187 O O   . HOH E 3 .   ? 8.429   5.231   31.470 1.00 18.97 ? 788  HOH A O   1 
HETATM 6188 O O   . HOH E 3 .   ? 9.293   27.234  49.178 1.00 21.78 ? 789  HOH A O   1 
HETATM 6189 O O   . HOH E 3 .   ? -9.832  -2.978  63.215 1.00 18.81 ? 790  HOH A O   1 
HETATM 6190 O O   . HOH E 3 .   ? 13.517  -8.900  64.870 1.00 28.53 ? 791  HOH A O   1 
HETATM 6191 O O   . HOH E 3 .   ? -2.163  15.731  40.569 1.00 23.30 ? 792  HOH A O   1 
HETATM 6192 O O   . HOH E 3 .   ? 12.118  -3.064  68.568 1.00 32.58 ? 793  HOH A O   1 
HETATM 6193 O O   . HOH E 3 .   ? 2.394   31.207  33.526 1.00 31.78 ? 794  HOH A O   1 
HETATM 6194 O O   . HOH E 3 .   ? 14.409  1.953   56.959 1.00 25.48 ? 795  HOH A O   1 
HETATM 6195 O O   . HOH E 3 .   ? 8.328   -6.307  41.544 1.00 27.58 ? 796  HOH A O   1 
HETATM 6196 O O   . HOH E 3 .   ? 8.996   -12.986 52.098 1.00 34.94 ? 797  HOH A O   1 
HETATM 6197 O O   . HOH E 3 .   ? 4.302   3.031   66.847 1.00 16.69 ? 798  HOH A O   1 
HETATM 6198 O O   . HOH E 3 .   ? -21.108 21.276  54.309 1.00 22.75 ? 799  HOH A O   1 
HETATM 6199 O O   . HOH E 3 .   ? -24.682 -0.034  72.642 1.00 52.21 ? 800  HOH A O   1 
HETATM 6200 O O   . HOH E 3 .   ? -17.679 -6.198  62.612 1.00 34.56 ? 801  HOH A O   1 
HETATM 6201 O O   . HOH E 3 .   ? 20.108  3.437   47.463 1.00 32.12 ? 802  HOH A O   1 
HETATM 6202 O O   . HOH E 3 .   ? -13.424 8.179   75.141 1.00 30.51 ? 803  HOH A O   1 
HETATM 6203 O O   . HOH E 3 .   ? 2.621   26.498  42.056 1.00 38.04 ? 804  HOH A O   1 
HETATM 6204 O O   . HOH E 3 .   ? -6.791  18.318  51.448 1.00 20.83 ? 805  HOH A O   1 
HETATM 6205 O O   . HOH E 3 .   ? -1.695  14.194  75.248 1.00 25.95 ? 806  HOH A O   1 
HETATM 6206 O O   . HOH E 3 .   ? 6.093   21.047  33.572 1.00 21.34 ? 807  HOH A O   1 
HETATM 6207 O O   . HOH E 3 .   ? 14.770  -3.353  46.178 1.00 24.56 ? 808  HOH A O   1 
HETATM 6208 O O   . HOH E 3 .   ? 16.914  16.058  44.969 1.00 30.22 ? 809  HOH A O   1 
HETATM 6209 O O   . HOH E 3 .   ? -7.458  -3.160  67.467 1.00 29.86 ? 810  HOH A O   1 
HETATM 6210 O O   . HOH E 3 .   ? 12.710  2.616   34.987 1.00 27.57 ? 811  HOH A O   1 
HETATM 6211 O O   . HOH E 3 .   ? -8.926  -6.631  63.750 1.00 33.04 ? 812  HOH A O   1 
HETATM 6212 O O   . HOH E 3 .   ? 16.647  30.551  57.712 1.00 27.36 ? 813  HOH A O   1 
HETATM 6213 O O   . HOH E 3 .   ? -23.442 10.707  55.528 1.00 56.74 ? 814  HOH A O   1 
HETATM 6214 O O   . HOH E 3 .   ? -25.414 2.821   70.021 1.00 41.69 ? 815  HOH A O   1 
HETATM 6215 O O   . HOH E 3 .   ? -8.098  28.469  68.778 1.00 23.63 ? 816  HOH A O   1 
HETATM 6216 O O   . HOH E 3 .   ? 17.019  22.157  56.083 1.00 36.26 ? 817  HOH A O   1 
HETATM 6217 O O   . HOH E 3 .   ? 6.304   -18.086 57.171 1.00 48.12 ? 818  HOH A O   1 
HETATM 6218 O O   . HOH E 3 .   ? 17.781  -1.390  55.038 1.00 28.91 ? 819  HOH A O   1 
HETATM 6219 O O   . HOH E 3 .   ? 6.556   -10.114 72.082 1.00 45.12 ? 820  HOH A O   1 
HETATM 6220 O O   . HOH E 3 .   ? -11.894 23.259  76.631 1.00 43.41 ? 821  HOH A O   1 
HETATM 6221 O O   . HOH E 3 .   ? -14.034 -1.515  50.048 1.00 32.90 ? 822  HOH A O   1 
HETATM 6222 O O   . HOH E 3 .   ? -12.028 2.319   72.849 1.00 58.62 ? 823  HOH A O   1 
HETATM 6223 O O   . HOH E 3 .   ? 16.268  4.233   56.982 1.00 23.01 ? 824  HOH A O   1 
HETATM 6224 O O   . HOH E 3 .   ? -3.923  -11.719 57.712 1.00 47.87 ? 825  HOH A O   1 
HETATM 6225 O O   . HOH E 3 .   ? -5.394  24.563  74.381 1.00 45.82 ? 826  HOH A O   1 
HETATM 6226 O O   . HOH E 3 .   ? 19.508  23.847  52.923 1.00 47.76 ? 827  HOH A O   1 
HETATM 6227 O O   . HOH E 3 .   ? 20.138  33.425  39.213 1.00 32.91 ? 828  HOH A O   1 
HETATM 6228 O O   . HOH E 3 .   ? 18.846  29.218  48.646 1.00 24.13 ? 829  HOH A O   1 
HETATM 6229 O O   . HOH E 3 .   ? -14.736 -5.948  56.527 1.00 40.14 ? 830  HOH A O   1 
HETATM 6230 O O   . HOH E 3 .   ? -13.066 -6.114  46.413 1.00 36.49 ? 831  HOH A O   1 
HETATM 6231 O O   . HOH E 3 .   ? -11.725 0.806   67.123 1.00 32.89 ? 832  HOH A O   1 
HETATM 6232 O O   . HOH E 3 .   ? -13.368 0.404   44.710 1.00 25.55 ? 833  HOH A O   1 
HETATM 6233 O O   . HOH E 3 .   ? -17.055 4.229   50.714 1.00 38.79 ? 834  HOH A O   1 
HETATM 6234 O O   . HOH E 3 .   ? 0.601   27.599  39.107 1.00 38.96 ? 835  HOH A O   1 
HETATM 6235 O O   . HOH E 3 .   ? -32.869 5.972   58.771 1.00 39.25 ? 836  HOH A O   1 
HETATM 6236 O O   . HOH E 3 .   ? 6.967   -13.698 47.951 1.00 32.07 ? 837  HOH A O   1 
HETATM 6237 O O   . HOH E 3 .   ? -20.665 -5.572  62.930 1.00 37.70 ? 838  HOH A O   1 
HETATM 6238 O O   . HOH E 3 .   ? -0.904  -16.652 49.179 1.00 32.96 ? 839  HOH A O   1 
HETATM 6239 O O   . HOH E 3 .   ? -17.911 27.589  55.205 1.00 47.81 ? 840  HOH A O   1 
HETATM 6240 O O   . HOH E 3 .   ? 19.273  18.102  52.347 1.00 37.50 ? 841  HOH A O   1 
HETATM 6241 O O   . HOH E 3 .   ? -24.931 25.890  63.119 1.00 26.14 ? 842  HOH A O   1 
HETATM 6242 O O   . HOH E 3 .   ? 20.211  30.364  54.124 1.00 43.44 ? 843  HOH A O   1 
HETATM 6243 O O   . HOH E 3 .   ? 11.696  -9.734  39.569 1.00 48.98 ? 844  HOH A O   1 
HETATM 6244 O O   . HOH E 3 .   ? -3.526  -15.672 43.509 1.00 41.54 ? 845  HOH A O   1 
HETATM 6245 O O   . HOH E 3 .   ? -9.738  34.126  70.480 1.00 51.04 ? 846  HOH A O   1 
HETATM 6246 O O   . HOH E 3 .   ? 20.162  18.292  41.255 1.00 37.49 ? 847  HOH A O   1 
HETATM 6247 O O   . HOH E 3 .   ? -21.844 7.160   80.690 1.00 51.49 ? 848  HOH A O   1 
HETATM 6248 O O   . HOH E 3 .   ? 15.865  -8.480  50.437 1.00 31.41 ? 849  HOH A O   1 
HETATM 6249 O O   . HOH E 3 .   ? 20.961  25.153  38.965 1.00 28.23 ? 850  HOH A O   1 
HETATM 6250 O O   . HOH E 3 .   ? -0.364  22.526  39.344 1.00 33.79 ? 851  HOH A O   1 
HETATM 6251 O O   . HOH E 3 .   ? 0.110   16.545  38.965 1.00 28.59 ? 852  HOH A O   1 
HETATM 6252 O O   . HOH E 3 .   ? -5.878  20.750  75.954 1.00 34.73 ? 853  HOH A O   1 
HETATM 6253 O O   . HOH E 3 .   ? -9.180  -3.093  69.795 1.00 23.46 ? 854  HOH A O   1 
HETATM 6254 O O   . HOH E 3 .   ? -34.560 18.467  66.879 1.00 45.06 ? 855  HOH A O   1 
HETATM 6255 O O   . HOH E 3 .   ? -19.975 8.938   49.237 1.00 40.96 ? 856  HOH A O   1 
HETATM 6256 O O   . HOH E 3 .   ? 32.690  17.038  27.335 1.00 53.25 ? 857  HOH A O   1 
HETATM 6257 O O   . HOH E 3 .   ? 29.787  16.621  22.418 1.00 32.06 ? 858  HOH A O   1 
HETATM 6258 O O   . HOH E 3 .   ? 4.004   5.277   76.331 1.00 27.00 ? 859  HOH A O   1 
HETATM 6259 O O   . HOH E 3 .   ? 20.028  4.929   43.047 1.00 36.71 ? 860  HOH A O   1 
HETATM 6260 O O   . HOH E 3 .   ? -29.169 11.890  73.372 1.00 35.68 ? 861  HOH A O   1 
HETATM 6261 O O   . HOH E 3 .   ? -15.087 0.391   47.803 1.00 36.68 ? 862  HOH A O   1 
HETATM 6262 O O   . HOH E 3 .   ? -9.326  3.459   68.022 1.00 31.76 ? 863  HOH A O   1 
HETATM 6263 O O   . HOH E 3 .   ? -10.976 6.623   73.884 1.00 35.51 ? 864  HOH A O   1 
HETATM 6264 O O   . HOH E 3 .   ? 3.759   12.298  71.284 1.00 54.73 ? 865  HOH A O   1 
HETATM 6265 O O   . HOH E 3 .   ? 8.926   10.920  37.968 1.00 27.64 ? 866  HOH A O   1 
HETATM 6266 O O   . HOH E 3 .   ? -13.160 8.947   54.333 1.00 42.98 ? 867  HOH A O   1 
HETATM 6267 O O   . HOH E 3 .   ? -6.135  -14.997 55.083 1.00 30.53 ? 868  HOH A O   1 
HETATM 6268 O O   . HOH E 3 .   ? 13.426  9.487   43.293 1.00 31.04 ? 869  HOH A O   1 
HETATM 6269 O O   . HOH E 3 .   ? 16.911  14.091  46.691 1.00 31.97 ? 870  HOH A O   1 
HETATM 6270 O O   . HOH E 3 .   ? -5.453  -13.847 43.571 1.00 33.69 ? 871  HOH A O   1 
HETATM 6271 O O   . HOH E 3 .   ? -5.029  0.531   73.299 1.00 32.07 ? 872  HOH A O   1 
HETATM 6272 O O   . HOH E 3 .   ? -11.680 14.519  78.522 1.00 36.71 ? 873  HOH A O   1 
HETATM 6273 O O   . HOH E 3 .   ? 5.257   14.251  71.922 1.00 45.75 ? 874  HOH A O   1 
HETATM 6274 O O   . HOH E 3 .   ? 4.723   12.256  73.981 1.00 34.45 ? 875  HOH A O   1 
HETATM 6275 O O   . HOH E 3 .   ? -2.298  19.843  42.166 1.00 26.26 ? 876  HOH A O   1 
HETATM 6276 O O   . HOH E 3 .   ? 20.414  1.044   43.882 1.00 48.27 ? 877  HOH A O   1 
HETATM 6277 O O   . HOH E 3 .   ? -36.235 11.462  64.247 1.00 43.02 ? 878  HOH A O   1 
HETATM 6278 O O   . HOH E 3 .   ? -6.790  -10.509 60.942 1.00 37.84 ? 879  HOH A O   1 
HETATM 6279 O O   . HOH E 3 .   ? -13.038 2.979   43.305 1.00 24.86 ? 880  HOH A O   1 
HETATM 6280 O O   . HOH E 3 .   ? 18.952  20.171  30.006 1.00 41.96 ? 881  HOH A O   1 
HETATM 6281 O O   . HOH E 3 .   ? -32.089 19.995  58.748 1.00 34.22 ? 882  HOH A O   1 
HETATM 6282 O O   . HOH E 3 .   ? -15.432 5.343   76.281 1.00 40.00 ? 883  HOH A O   1 
HETATM 6283 O O   . HOH E 3 .   ? 6.834   -14.609 40.126 1.00 41.29 ? 884  HOH A O   1 
HETATM 6284 O O   . HOH E 3 .   ? -8.144  -9.267  62.719 1.00 34.75 ? 885  HOH A O   1 
HETATM 6285 O O   . HOH E 3 .   ? 16.237  6.605   58.969 1.00 47.55 ? 886  HOH A O   1 
HETATM 6286 O O   . HOH E 3 .   ? 12.064  13.089  65.067 1.00 38.27 ? 887  HOH A O   1 
HETATM 6287 O O   . HOH E 3 .   ? 3.296   15.830  71.565 1.00 32.89 ? 888  HOH A O   1 
HETATM 6288 O O   . HOH E 3 .   ? -19.904 28.886  66.145 1.00 38.69 ? 889  HOH A O   1 
HETATM 6289 O O   . HOH E 3 .   ? 16.177  11.259  62.628 1.00 46.60 ? 890  HOH A O   1 
HETATM 6290 O O   . HOH E 3 .   ? -17.733 0.461   51.510 1.00 40.22 ? 891  HOH A O   1 
HETATM 6291 O O   . HOH E 3 .   ? 1.145   22.229  69.944 1.00 38.64 ? 892  HOH A O   1 
HETATM 6292 O O   . HOH E 3 .   ? 28.005  17.913  31.167 1.00 55.71 ? 893  HOH A O   1 
HETATM 6293 O O   . HOH E 3 .   ? -23.018 21.583  57.019 1.00 40.55 ? 894  HOH A O   1 
HETATM 6294 O O   . HOH E 3 .   ? 10.596  -4.364  37.309 1.00 36.92 ? 895  HOH A O   1 
HETATM 6295 O O   . HOH E 3 .   ? 12.332  -14.240 50.098 1.00 37.40 ? 896  HOH A O   1 
HETATM 6296 O O   . HOH E 3 .   ? 23.303  26.434  48.648 1.00 42.70 ? 897  HOH A O   1 
HETATM 6297 O O   . HOH E 3 .   ? 13.726  9.004   65.428 1.00 42.72 ? 898  HOH A O   1 
HETATM 6298 O O   . HOH E 3 .   ? -27.209 10.660  73.994 1.00 44.70 ? 899  HOH A O   1 
HETATM 6299 O O   . HOH E 3 .   ? 23.905  27.574  42.126 1.00 54.07 ? 900  HOH A O   1 
HETATM 6300 O O   . HOH E 3 .   ? 17.967  1.034   46.204 1.00 32.31 ? 901  HOH A O   1 
HETATM 6301 O O   . HOH E 3 .   ? -5.655  14.806  77.391 1.00 31.79 ? 902  HOH A O   1 
HETATM 6302 O O   . HOH E 3 .   ? 11.663  -15.727 55.081 1.00 34.18 ? 903  HOH A O   1 
HETATM 6303 O O   . HOH E 3 .   ? -33.878 17.446  60.307 1.00 58.68 ? 904  HOH A O   1 
HETATM 6304 O O   . HOH E 3 .   ? 27.988  20.809  26.812 1.00 50.45 ? 905  HOH A O   1 
HETATM 6305 O O   . HOH E 3 .   ? 12.515  -6.689  46.836 1.00 34.54 ? 906  HOH A O   1 
HETATM 6306 O O   . HOH E 3 .   ? -27.652 -1.573  58.336 1.00 50.36 ? 907  HOH A O   1 
HETATM 6307 O O   . HOH E 3 .   ? -4.326  7.454   58.585 1.00 20.05 ? 908  HOH A O   1 
HETATM 6308 O O   . HOH E 3 .   ? 8.716   9.819   58.103 1.00 19.26 ? 909  HOH A O   1 
HETATM 6309 O O   . HOH E 3 .   ? -6.675  8.794   59.994 1.00 18.41 ? 910  HOH A O   1 
HETATM 6310 O O   . HOH E 3 .   ? -17.514 18.351  78.162 1.00 27.67 ? 911  HOH A O   1 
HETATM 6311 O O   . HOH E 3 .   ? 16.725  5.888   55.183 1.00 27.29 ? 912  HOH A O   1 
HETATM 6312 O O   . HOH E 3 .   ? 13.265  31.243  41.995 1.00 50.98 ? 913  HOH A O   1 
HETATM 6313 O O   . HOH E 3 .   ? -10.763 7.384   55.290 1.00 23.08 ? 914  HOH A O   1 
HETATM 6314 O O   . HOH E 3 .   ? -22.818 4.256   71.152 1.00 34.80 ? 915  HOH A O   1 
HETATM 6315 O O   . HOH E 3 .   ? 17.649  11.563  46.458 1.00 27.92 ? 916  HOH A O   1 
HETATM 6316 O O   . HOH E 3 .   ? -17.776 3.343   54.821 1.00 56.67 ? 917  HOH A O   1 
HETATM 6317 O O   . HOH E 3 .   ? 20.065  25.098  26.074 1.00 52.93 ? 918  HOH A O   1 
HETATM 6318 O O   . HOH E 3 .   ? 24.628  7.665   27.360 1.00 46.82 ? 919  HOH A O   1 
HETATM 6319 O O   . HOH E 3 .   ? 14.091  9.056   38.554 1.00 37.58 ? 920  HOH A O   1 
HETATM 6320 O O   . HOH E 3 .   ? -9.726  -10.145 64.712 1.00 45.68 ? 921  HOH A O   1 
HETATM 6321 O O   . HOH E 3 .   ? 26.617  10.495  25.036 1.00 44.29 ? 922  HOH A O   1 
HETATM 6322 O O   . HOH E 3 .   ? -1.534  -13.370 68.068 1.00 44.41 ? 923  HOH A O   1 
HETATM 6323 O O   . HOH E 3 .   ? -30.014 11.652  55.768 1.00 35.26 ? 924  HOH A O   1 
HETATM 6324 O O   . HOH E 3 .   ? -2.567  -0.889  73.648 1.00 31.06 ? 925  HOH A O   1 
HETATM 6325 O O   . HOH E 3 .   ? -28.522 25.355  70.468 1.00 47.94 ? 926  HOH A O   1 
HETATM 6326 O O   . HOH E 3 .   ? -1.923  -15.018 56.356 1.00 33.74 ? 927  HOH A O   1 
HETATM 6327 O O   . HOH E 3 .   ? 16.270  2.670   60.696 1.00 43.55 ? 928  HOH A O   1 
HETATM 6328 O O   . HOH E 3 .   ? -11.450 -8.543  68.893 1.00 48.34 ? 929  HOH A O   1 
HETATM 6329 O O   . HOH E 3 .   ? 10.267  -19.152 54.879 1.00 35.47 ? 930  HOH A O   1 
HETATM 6330 O O   . HOH E 3 .   ? 8.099   26.528  61.704 1.00 41.33 ? 931  HOH A O   1 
HETATM 6331 O O   . HOH E 3 .   ? -3.890  22.109  41.947 1.00 28.11 ? 932  HOH A O   1 
HETATM 6332 O O   . HOH E 3 .   ? -14.697 3.985   67.147 1.00 34.82 ? 933  HOH A O   1 
HETATM 6333 O O   . HOH E 3 .   ? -29.114 4.512   69.081 1.00 36.01 ? 934  HOH A O   1 
HETATM 6334 O O   . HOH E 3 .   ? 10.794  -10.726 45.011 1.00 49.00 ? 935  HOH A O   1 
HETATM 6335 O O   . HOH E 3 .   ? -6.595  -11.857 47.858 1.00 39.06 ? 936  HOH A O   1 
HETATM 6336 O O   . HOH E 3 .   ? -19.396 6.032   54.396 1.00 59.30 ? 937  HOH A O   1 
HETATM 6337 O O   . HOH E 3 .   ? -25.102 10.927  80.591 1.00 41.42 ? 938  HOH A O   1 
HETATM 6338 O O   . HOH E 3 .   ? -17.230 34.007  68.272 1.00 62.55 ? 939  HOH A O   1 
HETATM 6339 O O   . HOH E 3 .   ? 18.678  32.067  46.109 1.00 32.25 ? 940  HOH A O   1 
HETATM 6340 O O   . HOH E 3 .   ? 8.021   17.405  65.886 1.00 37.79 ? 941  HOH A O   1 
HETATM 6341 O O   . HOH E 3 .   ? -26.962 6.251   57.293 1.00 43.51 ? 942  HOH A O   1 
HETATM 6342 O O   . HOH E 3 .   ? 10.875  9.604   69.366 1.00 46.03 ? 943  HOH A O   1 
HETATM 6343 O O   . HOH E 3 .   ? -31.353 18.429  56.981 1.00 39.09 ? 944  HOH A O   1 
HETATM 6344 O O   . HOH E 3 .   ? -12.098 -5.398  67.202 1.00 33.82 ? 945  HOH A O   1 
HETATM 6345 O O   . HOH E 3 .   ? 1.967   26.989  69.949 1.00 48.11 ? 946  HOH A O   1 
HETATM 6346 O O   . HOH E 3 .   ? -32.829 17.744  71.842 1.00 50.61 ? 947  HOH A O   1 
HETATM 6347 O O   . HOH E 3 .   ? -12.004 -2.792  66.792 1.00 37.39 ? 948  HOH A O   1 
HETATM 6348 O O   . HOH E 3 .   ? 21.033  18.375  31.466 1.00 29.58 ? 949  HOH A O   1 
HETATM 6349 O O   . HOH E 3 .   ? -19.662 10.975  78.424 1.00 49.86 ? 950  HOH A O   1 
HETATM 6350 O O   . HOH E 3 .   ? -19.473 26.077  56.649 1.00 57.62 ? 951  HOH A O   1 
HETATM 6351 O O   . HOH E 3 .   ? 8.465   14.776  36.934 1.00 48.92 ? 952  HOH A O   1 
HETATM 6352 O O   . HOH E 3 .   ? -0.253  30.412  39.222 1.00 47.72 ? 953  HOH A O   1 
HETATM 6353 O O   . HOH E 3 .   ? 13.027  19.721  66.562 1.00 44.19 ? 954  HOH A O   1 
HETATM 6354 O O   . HOH E 3 .   ? -9.554  -1.951  66.071 1.00 38.42 ? 955  HOH A O   1 
HETATM 6355 O O   . HOH E 3 .   ? -4.675  -7.834  67.747 1.00 44.23 ? 956  HOH A O   1 
HETATM 6356 O O   . HOH E 3 .   ? 18.545  -3.475  47.561 1.00 30.82 ? 957  HOH A O   1 
HETATM 6357 O O   . HOH E 3 .   ? 9.543   -3.902  70.111 1.00 37.27 ? 958  HOH A O   1 
HETATM 6358 O O   . HOH E 3 .   ? 3.433   -19.502 50.476 1.00 56.90 ? 959  HOH A O   1 
HETATM 6359 O O   . HOH E 3 .   ? -28.641 24.550  65.330 1.00 30.84 ? 960  HOH A O   1 
HETATM 6360 O O   . HOH E 3 .   ? -31.195 7.506   66.537 1.00 44.91 ? 961  HOH A O   1 
HETATM 6361 O O   . HOH E 3 .   ? -23.621 26.412  71.191 1.00 56.33 ? 962  HOH A O   1 
HETATM 6362 O O   . HOH E 3 .   ? 19.372  12.040  50.786 1.00 43.22 ? 963  HOH A O   1 
HETATM 6363 O O   . HOH E 3 .   ? -16.267 9.458   76.065 1.00 45.41 ? 964  HOH A O   1 
HETATM 6364 O O   . HOH E 3 .   ? 28.971  11.051  35.691 1.00 46.34 ? 965  HOH A O   1 
HETATM 6365 O O   . HOH E 3 .   ? 17.283  13.543  57.484 1.00 40.80 ? 966  HOH A O   1 
HETATM 6366 O O   . HOH E 3 .   ? -19.204 14.029  81.819 1.00 40.78 ? 967  HOH A O   1 
HETATM 6367 O O   . HOH E 3 .   ? -15.803 12.099  83.304 1.00 28.78 ? 968  HOH A O   1 
HETATM 6368 O O   . HOH E 3 .   ? -4.833  -13.904 39.762 1.00 53.27 ? 969  HOH A O   1 
HETATM 6369 O O   . HOH E 3 .   ? -24.002 0.041   54.497 1.00 52.82 ? 970  HOH A O   1 
HETATM 6370 O O   . HOH E 3 .   ? -34.046 15.955  58.224 1.00 47.98 ? 971  HOH A O   1 
HETATM 6371 O O   . HOH E 3 .   ? -10.040 7.914   76.120 1.00 43.16 ? 972  HOH A O   1 
HETATM 6372 O O   . HOH E 3 .   ? 18.114  11.899  54.453 1.00 42.99 ? 973  HOH A O   1 
HETATM 6373 O O   . HOH E 3 .   ? -16.355 5.377   54.886 1.00 51.34 ? 974  HOH A O   1 
HETATM 6374 O O   . HOH E 3 .   ? 16.491  32.405  51.965 1.00 46.65 ? 975  HOH A O   1 
HETATM 6375 O O   . HOH E 3 .   ? -9.881  -10.640 41.141 1.00 37.01 ? 976  HOH A O   1 
HETATM 6376 O O   . HOH E 3 .   ? 7.987   17.538  70.508 1.00 39.91 ? 977  HOH A O   1 
HETATM 6377 O O   . HOH E 3 .   ? -21.917 28.286  65.274 1.00 52.56 ? 978  HOH A O   1 
HETATM 6378 O O   . HOH E 3 .   ? 5.654   -16.527 45.619 1.00 58.52 ? 979  HOH A O   1 
HETATM 6379 O O   . HOH E 3 .   ? -29.047 8.239   73.433 1.00 43.90 ? 980  HOH A O   1 
HETATM 6380 O O   . HOH E 3 .   ? -17.895 6.967   47.647 1.00 40.72 ? 981  HOH A O   1 
HETATM 6381 O O   . HOH E 3 .   ? 14.837  7.484   31.479 1.00 34.66 ? 982  HOH A O   1 
HETATM 6382 O O   . HOH E 3 .   ? -11.907 -4.222  52.033 1.00 27.92 ? 983  HOH A O   1 
HETATM 6383 O O   . HOH E 3 .   ? -13.575 4.720   49.277 1.00 43.77 ? 984  HOH A O   1 
HETATM 6384 O O   . HOH E 3 .   ? -13.658 4.654   53.507 1.00 26.97 ? 985  HOH A O   1 
HETATM 6385 O O   . HOH E 3 .   ? -10.933 4.339   44.998 1.00 31.34 ? 986  HOH A O   1 
HETATM 6386 O O   . HOH E 3 .   ? 16.397  30.869  54.871 1.00 32.90 ? 987  HOH A O   1 
HETATM 6387 O O   . HOH E 3 .   ? 18.941  27.987  52.952 1.00 43.62 ? 988  HOH A O   1 
HETATM 6388 O O   . HOH E 3 .   ? 21.913  22.800  38.599 1.00 43.07 ? 989  HOH A O   1 
HETATM 6389 O O   . HOH E 3 .   ? 20.817  26.455  36.770 1.00 33.65 ? 990  HOH A O   1 
HETATM 6390 O O   . HOH E 3 .   ? 25.346  25.844  43.691 1.00 58.60 ? 991  HOH A O   1 
HETATM 6391 O O   . HOH E 3 .   ? 23.467  24.929  45.386 1.00 28.27 ? 992  HOH A O   1 
HETATM 6392 O O   . HOH E 3 .   ? 3.347   22.590  36.152 1.00 23.91 ? 993  HOH A O   1 
HETATM 6393 O O   . HOH E 3 .   ? 30.939  13.480  21.717 1.00 49.29 ? 994  HOH A O   1 
HETATM 6394 O O   . HOH E 3 .   ? 30.434  12.438  23.978 1.00 45.08 ? 995  HOH A O   1 
HETATM 6395 O O   . HOH E 3 .   ? 18.243  3.281   35.591 1.00 42.43 ? 996  HOH A O   1 
HETATM 6396 O O   . HOH E 3 .   ? 21.988  4.832   34.338 1.00 47.93 ? 997  HOH A O   1 
HETATM 6397 O O   . HOH E 3 .   ? 18.554  14.102  48.729 1.00 39.55 ? 998  HOH A O   1 
HETATM 6398 O O   . HOH E 3 .   ? 21.189  6.939   39.554 1.00 43.15 ? 999  HOH A O   1 
HETATM 6399 O O   . HOH E 3 .   ? 31.770  18.315  23.836 1.00 36.08 ? 1000 HOH A O   1 
HETATM 6400 O O   . HOH E 3 .   ? 21.431  8.276   37.290 1.00 29.00 ? 1001 HOH A O   1 
HETATM 6401 O O   . HOH E 3 .   ? 18.555  11.847  43.765 1.00 36.26 ? 1002 HOH A O   1 
HETATM 6402 O O   . HOH E 3 .   ? 11.277  16.792  65.728 1.00 64.47 ? 1003 HOH A O   1 
HETATM 6403 O O   . HOH E 3 .   ? 10.480  15.552  62.639 1.00 39.24 ? 1004 HOH A O   1 
HETATM 6404 O O   . HOH E 3 .   ? -6.805  3.088   45.051 1.00 20.87 ? 1005 HOH A O   1 
HETATM 6405 O O   . HOH E 3 .   ? 6.282   -14.793 43.788 1.00 29.78 ? 1006 HOH A O   1 
HETATM 6406 O O   . HOH E 3 .   ? -0.222  -15.486 46.693 1.00 43.17 ? 1007 HOH A O   1 
HETATM 6407 O O   . HOH E 3 .   ? -4.552  -14.334 57.524 1.00 31.08 ? 1008 HOH A O   1 
HETATM 6408 O O   . HOH E 3 .   ? -5.279  -15.549 59.746 1.00 44.76 ? 1009 HOH A O   1 
HETATM 6409 O O   . HOH E 3 .   ? -7.792  -13.198 53.098 1.00 43.49 ? 1010 HOH A O   1 
HETATM 6410 O O   . HOH E 3 .   ? -7.457  -13.407 61.048 1.00 30.46 ? 1011 HOH A O   1 
HETATM 6411 O O   . HOH E 3 .   ? -11.367 -0.321  63.491 1.00 21.03 ? 1012 HOH A O   1 
HETATM 6412 O O   . HOH E 3 .   ? -13.870 -0.036  41.231 1.00 33.15 ? 1013 HOH A O   1 
HETATM 6413 O O   . HOH E 3 .   ? -12.230 2.991   46.926 1.00 32.41 ? 1014 HOH A O   1 
HETATM 6414 O O   . HOH E 3 .   ? -0.756  -10.157 72.865 1.00 27.64 ? 1015 HOH A O   1 
HETATM 6415 O O   . HOH E 3 .   ? 3.424   -6.899  70.947 1.00 26.57 ? 1016 HOH A O   1 
HETATM 6416 O O   . HOH E 3 .   ? 6.080   -7.011  71.947 1.00 30.85 ? 1017 HOH A O   1 
HETATM 6417 O O   . HOH E 3 .   ? 6.038   -6.537  74.577 1.00 28.74 ? 1018 HOH A O   1 
HETATM 6418 O O   . HOH E 3 .   ? 8.442   -6.844  70.581 1.00 29.46 ? 1019 HOH A O   1 
HETATM 6419 O O   . HOH E 3 .   ? -3.770  -5.466  71.961 1.00 54.90 ? 1020 HOH A O   1 
HETATM 6420 O O   . HOH E 3 .   ? -6.354  -5.647  71.151 1.00 42.86 ? 1021 HOH A O   1 
HETATM 6421 O O   . HOH E 3 .   ? -2.164  -8.987  70.510 1.00 45.48 ? 1022 HOH A O   1 
HETATM 6422 O O   . HOH E 3 .   ? 0.056   -3.596  69.643 1.00 22.16 ? 1023 HOH A O   1 
HETATM 6423 O O   . HOH E 3 .   ? 13.386  -4.154  64.507 1.00 31.53 ? 1024 HOH A O   1 
HETATM 6424 O O   . HOH E 3 .   ? 14.435  -6.704  65.508 1.00 40.22 ? 1025 HOH A O   1 
HETATM 6425 O O   . HOH E 3 .   ? 12.848  1.502   67.250 1.00 32.75 ? 1026 HOH A O   1 
HETATM 6426 O O   . HOH E 3 .   ? 13.705  4.456   67.094 1.00 37.77 ? 1027 HOH A O   1 
HETATM 6427 O O   . HOH E 3 .   ? 6.057   -2.103  72.562 1.00 48.39 ? 1028 HOH A O   1 
HETATM 6428 O O   . HOH E 3 .   ? 11.768  -2.842  66.064 1.00 26.70 ? 1029 HOH A O   1 
HETATM 6429 O O   . HOH E 3 .   ? -7.144  -13.836 63.757 1.00 37.92 ? 1030 HOH A O   1 
HETATM 6430 O O   . HOH E 3 .   ? 8.886   -21.519 55.582 1.00 29.38 ? 1031 HOH A O   1 
HETATM 6431 O O   . HOH E 3 .   ? 9.092   -17.456 57.145 1.00 32.91 ? 1032 HOH A O   1 
HETATM 6432 O O   . HOH E 3 .   ? 15.487  -0.308  58.222 1.00 36.62 ? 1033 HOH A O   1 
HETATM 6433 O O   . HOH E 3 .   ? 16.148  -5.619  55.253 1.00 41.04 ? 1034 HOH A O   1 
HETATM 6434 O O   . HOH E 3 .   ? 14.962  -2.318  56.154 1.00 28.35 ? 1035 HOH A O   1 
HETATM 6435 O O   . HOH E 3 .   ? 9.070   9.763   65.555 1.00 19.07 ? 1036 HOH A O   1 
HETATM 6436 O O   . HOH E 3 .   ? -7.847  24.136  53.322 1.00 29.90 ? 1037 HOH A O   1 
HETATM 6437 O O   . HOH E 3 .   ? 15.968  -1.010  45.300 1.00 22.37 ? 1038 HOH A O   1 
HETATM 6438 O O   . HOH E 3 .   ? 2.527   20.068  68.698 1.00 35.27 ? 1039 HOH A O   1 
HETATM 6439 O O   . HOH E 3 .   ? -0.398  26.846  67.928 1.00 37.53 ? 1040 HOH A O   1 
HETATM 6440 O O   . HOH E 3 .   ? -2.978  15.062  77.583 1.00 29.50 ? 1041 HOH A O   1 
HETATM 6441 O O   . HOH E 3 .   ? 0.272   12.552  76.313 1.00 29.01 ? 1042 HOH A O   1 
HETATM 6442 O O   . HOH E 3 .   ? 2.136   16.094  74.004 1.00 31.51 ? 1043 HOH A O   1 
HETATM 6443 O O   . HOH E 3 .   ? 2.660   13.473  75.481 1.00 32.65 ? 1044 HOH A O   1 
HETATM 6444 O O   . HOH E 3 .   ? -0.510  18.655  75.032 1.00 34.42 ? 1045 HOH A O   1 
HETATM 6445 O O   . HOH E 3 .   ? -4.751  21.566  73.658 1.00 23.54 ? 1046 HOH A O   1 
HETATM 6446 O O   . HOH E 3 .   ? -15.397 19.686  79.426 1.00 32.85 ? 1047 HOH A O   1 
HETATM 6447 O O   . HOH E 3 .   ? -11.615 20.724  76.493 1.00 31.22 ? 1048 HOH A O   1 
HETATM 6448 O O   . HOH E 3 .   ? -27.573 19.154  73.532 1.00 30.28 ? 1049 HOH A O   1 
HETATM 6449 O O   . HOH E 3 .   ? -28.077 15.104  77.450 1.00 26.02 ? 1050 HOH A O   1 
HETATM 6450 O O   . HOH E 3 .   ? -28.255 12.965  76.167 1.00 43.18 ? 1051 HOH A O   1 
HETATM 6451 O O   . HOH E 3 .   ? -24.709 18.950  77.392 1.00 28.52 ? 1052 HOH A O   1 
HETATM 6452 O O   . HOH E 3 .   ? -19.683 18.013  79.035 1.00 29.01 ? 1053 HOH A O   1 
HETATM 6453 O O   . HOH E 3 .   ? -6.778  -1.221  73.626 1.00 34.73 ? 1054 HOH A O   1 
HETATM 6454 O O   . HOH E 3 .   ? -8.972  7.122   80.599 1.00 55.10 ? 1055 HOH A O   1 
HETATM 6455 O O   . HOH E 3 .   ? -10.748 -1.563  73.805 1.00 49.92 ? 1056 HOH A O   1 
HETATM 6456 O O   . HOH E 3 .   ? -3.848  2.920   75.599 1.00 33.04 ? 1057 HOH A O   1 
HETATM 6457 O O   . HOH E 3 .   ? -2.225  2.626   74.058 1.00 28.90 ? 1058 HOH A O   1 
HETATM 6458 O O   . HOH E 3 .   ? -8.355  -3.122  72.305 1.00 37.70 ? 1059 HOH A O   1 
HETATM 6459 O O   . HOH E 3 .   ? -10.462 6.116   78.268 1.00 48.53 ? 1060 HOH A O   1 
HETATM 6460 O O   . HOH E 3 .   ? -6.163  2.117   75.337 1.00 34.95 ? 1061 HOH A O   1 
HETATM 6461 O O   . HOH E 3 .   ? -37.547 17.698  66.922 1.00 65.45 ? 1062 HOH A O   1 
HETATM 6462 O O   . HOH E 3 .   ? -31.887 23.599  70.807 1.00 54.38 ? 1063 HOH A O   1 
HETATM 6463 O O   . HOH E 3 .   ? -36.536 12.083  68.916 1.00 40.01 ? 1064 HOH A O   1 
HETATM 6464 O O   . HOH E 3 .   ? -32.697 15.417  64.641 1.00 34.86 ? 1065 HOH A O   1 
HETATM 6465 O O   . HOH E 3 .   ? 24.355  26.285  23.581 1.00 47.41 ? 1066 HOH A O   1 
HETATM 6466 O O   . HOH E 3 .   ? -25.614 24.562  56.645 1.00 47.53 ? 1067 HOH A O   1 
HETATM 6467 O O   . HOH E 3 .   ? -23.306 -3.007  61.597 1.00 47.66 ? 1068 HOH A O   1 
HETATM 6468 O O   . HOH E 3 .   ? -9.540  20.760  77.829 1.00 33.73 ? 1069 HOH A O   1 
HETATM 6469 O O   . HOH E 3 .   ? -15.664 30.856  74.829 1.00 44.34 ? 1070 HOH A O   1 
HETATM 6470 O O   . HOH E 3 .   ? -19.479 31.268  70.919 1.00 44.59 ? 1071 HOH A O   1 
HETATM 6471 O O   . HOH E 3 .   ? -17.771 30.222  72.553 1.00 42.18 ? 1072 HOH A O   1 
HETATM 6472 O O   . HOH E 3 .   ? -19.182 32.784  73.129 1.00 40.37 ? 1073 HOH A O   1 
HETATM 6473 O O   . HOH E 3 .   ? -11.173 31.754  71.797 1.00 36.41 ? 1074 HOH A O   1 
HETATM 6474 O O   . HOH E 3 .   ? -14.947 26.466  74.350 1.00 34.61 ? 1075 HOH A O   1 
HETATM 6475 O O   . HOH E 3 .   ? -31.598 22.391  68.161 1.00 40.19 ? 1076 HOH A O   1 
HETATM 6476 O O   . HOH E 3 .   ? -34.869 15.744  74.882 1.00 50.95 ? 1077 HOH A O   1 
HETATM 6477 O O   . HOH E 3 .   ? -32.606 15.381  77.307 1.00 44.04 ? 1078 HOH A O   1 
HETATM 6478 O O   . HOH E 3 .   ? -28.844 23.771  68.011 1.00 35.02 ? 1079 HOH A O   1 
HETATM 6479 O O   . HOH E 3 .   ? -27.771 12.483  71.307 1.00 36.07 ? 1080 HOH A O   1 
HETATM 6480 O O   . HOH E 3 .   ? 21.017  35.466  37.861 1.00 35.02 ? 1081 HOH A O   1 
HETATM 6481 O O   . HOH E 3 .   ? 20.381  26.596  55.689 1.00 55.53 ? 1082 HOH A O   1 
HETATM 6482 O O   . HOH E 3 .   ? -35.336 20.106  57.581 1.00 67.96 ? 1083 HOH A O   1 
HETATM 6483 O O   . HOH E 3 .   ? 5.875   19.149  35.159 1.00 27.84 ? 1084 HOH A O   1 
HETATM 6484 O O   . HOH E 3 .   ? -8.469  8.370   55.901 1.00 17.10 ? 1085 HOH A O   1 
HETATM 6485 O O   . HOH E 3 .   ? 19.440  2.810   55.073 1.00 40.07 ? 1086 HOH A O   1 
HETATM 6486 O O   . HOH E 3 .   ? 22.053  2.644   54.138 1.00 38.72 ? 1087 HOH A O   1 
HETATM 6487 O O   . HOH E 3 .   ? 18.710  4.934   53.826 1.00 26.84 ? 1088 HOH A O   1 
HETATM 6488 O O   . HOH E 3 .   ? 11.698  9.659   66.789 1.00 37.75 ? 1089 HOH A O   1 
HETATM 6489 O O   . HOH E 3 .   ? 16.781  12.959  39.066 1.00 33.51 ? 1090 HOH A O   1 
HETATM 6490 O O   . HOH E 3 .   ? -22.706 5.007   75.093 1.00 53.08 ? 1091 HOH A O   1 
HETATM 6491 O O   . HOH E 3 .   ? -12.070 9.305   77.020 1.00 44.97 ? 1092 HOH A O   1 
HETATM 6492 O O   . HOH E 3 .   ? -19.767 4.365   75.973 1.00 43.22 ? 1093 HOH A O   1 
HETATM 6493 O O   . HOH E 3 .   ? -21.501 9.600   79.461 1.00 43.17 ? 1094 HOH A O   1 
HETATM 6494 O O   . HOH E 3 .   ? -5.326  -9.590  63.349 1.00 26.16 ? 1095 HOH A O   1 
HETATM 6495 O O   . HOH E 3 .   ? 15.854  13.717  41.479 1.00 31.43 ? 1096 HOH A O   1 
HETATM 6496 O O   . HOH E 3 .   ? 22.968  18.758  29.377 1.00 39.60 ? 1097 HOH A O   1 
HETATM 6497 O O   . HOH E 3 .   ? 22.460  19.771  33.474 1.00 53.91 ? 1098 HOH A O   1 
HETATM 6498 O O   . HOH E 3 .   ? 9.772   10.751  41.306 1.00 25.11 ? 1099 HOH A O   1 
HETATM 6499 O O   . HOH E 3 .   ? 25.153  20.587  33.483 1.00 53.43 ? 1100 HOH A O   1 
HETATM 6500 O O   . HOH E 3 .   ? 24.789  17.390  31.128 1.00 40.00 ? 1101 HOH A O   1 
HETATM 6501 O O   . HOH E 3 .   ? -23.827 23.600  64.360 1.00 25.87 ? 1102 HOH A O   1 
HETATM 6502 O O   . HOH E 3 .   ? 17.047  -2.326  43.130 1.00 36.55 ? 1103 HOH A O   1 
HETATM 6503 O O   . HOH E 3 .   ? -11.369 -4.166  49.363 1.00 21.22 ? 1104 HOH A O   1 
HETATM 6504 O O   . HOH E 3 .   ? 25.660  7.873   29.642 1.00 43.61 ? 1105 HOH A O   1 
HETATM 6505 O O   . HOH E 3 .   ? -18.895 1.224   53.809 1.00 45.45 ? 1106 HOH A O   1 
HETATM 6506 O O   . HOH E 3 .   ? 19.507  17.811  45.548 1.00 40.38 ? 1107 HOH A O   1 
HETATM 6507 O O   . HOH E 3 .   ? 6.142   -12.530 68.321 1.00 34.62 ? 1108 HOH A O   1 
HETATM 6508 O O   . HOH E 3 .   ? -3.750  5.282   76.945 1.00 35.34 ? 1109 HOH A O   1 
HETATM 6509 O O   . HOH E 3 .   ? 11.661  -5.254  39.805 1.00 34.62 ? 1110 HOH A O   1 
HETATM 6510 O O   . HOH E 3 .   ? 9.796   7.950   73.787 1.00 43.25 ? 1111 HOH A O   1 
HETATM 6511 O O   . HOH E 3 .   ? -18.781 9.614   54.522 1.00 37.31 ? 1112 HOH A O   1 
HETATM 6512 O O   . HOH E 3 .   ? 28.307  18.009  33.866 1.00 53.48 ? 1113 HOH A O   1 
HETATM 6513 O O   . HOH E 3 .   ? -23.534 7.612   56.971 1.00 49.86 ? 1114 HOH A O   1 
HETATM 6514 O O   . HOH E 3 .   ? 23.659  18.396  36.835 1.00 62.98 ? 1115 HOH A O   1 
HETATM 6515 O O   . HOH E 3 .   ? -25.724 10.739  70.751 1.00 22.27 ? 1116 HOH A O   1 
HETATM 6516 O O   . HOH E 3 .   ? 18.360  21.652  51.988 1.00 43.22 ? 1117 HOH A O   1 
HETATM 6517 O O   . HOH E 3 .   ? 9.819   13.223  39.797 1.00 36.42 ? 1118 HOH A O   1 
HETATM 6518 O O   . HOH E 3 .   ? 1.583   7.914   79.119 1.00 41.00 ? 1119 HOH A O   1 
HETATM 6519 O O   . HOH E 3 .   ? -15.939 -1.902  47.110 1.00 38.04 ? 1120 HOH A O   1 
HETATM 6520 O O   . HOH E 3 .   ? 21.057  10.748  44.095 1.00 47.37 ? 1121 HOH A O   1 
HETATM 6521 O O   . HOH E 3 .   ? -18.982 8.513   77.542 1.00 50.62 ? 1122 HOH A O   1 
HETATM 6522 O O   . HOH E 3 .   ? -10.336 3.698   74.111 1.00 55.08 ? 1123 HOH A O   1 
HETATM 6523 O O   . HOH E 3 .   ? 14.308  -3.333  59.933 1.00 49.54 ? 1124 HOH A O   1 
HETATM 6524 O O   . HOH E 3 .   ? 14.977  14.679  59.700 1.00 51.66 ? 1125 HOH A O   1 
HETATM 6525 O O   . HOH E 3 .   ? -15.738 7.545   49.710 1.00 53.92 ? 1126 HOH A O   1 
HETATM 6526 O O   . HOH E 3 .   ? 16.565  11.141  42.288 1.00 52.53 ? 1127 HOH A O   1 
HETATM 6527 O O   . HOH E 3 .   ? 0.992   25.048  35.682 1.00 61.10 ? 1128 HOH A O   1 
HETATM 6528 O O   . HOH E 3 .   ? -35.102 11.969  66.504 1.00 46.72 ? 1129 HOH A O   1 
HETATM 6529 O O   . HOH E 3 .   ? 20.515  8.576   48.052 1.00 34.34 ? 1130 HOH A O   1 
HETATM 6530 O O   . HOH E 3 .   ? 14.431  -7.213  56.457 1.00 39.75 ? 1131 HOH A O   1 
HETATM 6531 O O   . HOH E 3 .   ? 12.895  10.643  40.858 1.00 43.09 ? 1132 HOH A O   1 
HETATM 6532 O O   . HOH E 3 .   ? 8.718   27.084  67.257 1.00 61.64 ? 1133 HOH A O   1 
HETATM 6533 O O   . HOH E 3 .   ? -13.845 -5.459  53.485 1.00 46.08 ? 1134 HOH A O   1 
HETATM 6534 O O   . HOH E 3 .   ? -32.027 20.766  71.982 1.00 39.72 ? 1135 HOH A O   1 
HETATM 6535 O O   . HOH E 3 .   ? -0.923  -16.564 68.227 1.00 51.39 ? 1136 HOH A O   1 
HETATM 6536 O O   . HOH E 3 .   ? -22.145 26.496  56.487 1.00 51.67 ? 1137 HOH A O   1 
HETATM 6537 O O   . HOH E 3 .   ? 24.071  21.601  46.619 1.00 58.45 ? 1138 HOH A O   1 
HETATM 6538 O O   . HOH E 3 .   ? -10.785 -8.286  40.166 1.00 51.74 ? 1139 HOH A O   1 
HETATM 6539 O O   . HOH E 3 .   ? -35.358 5.376   63.816 1.00 47.80 ? 1140 HOH A O   1 
HETATM 6540 O O   . HOH E 3 .   ? 17.032  31.727  48.947 1.00 45.98 ? 1141 HOH A O   1 
HETATM 6541 O O   . HOH E 3 .   ? 24.016  12.918  44.207 1.00 49.19 ? 1142 HOH A O   1 
HETATM 6542 O O   . HOH E 3 .   ? 16.103  23.483  67.305 1.00 36.58 ? 1143 HOH A O   1 
HETATM 6543 O O   . HOH E 3 .   ? -8.522  11.114  78.701 1.00 37.25 ? 1144 HOH A O   1 
HETATM 6544 O O   . HOH E 3 .   ? 13.218  -7.433  49.270 1.00 51.54 ? 1145 HOH A O   1 
HETATM 6545 O O   . HOH E 3 .   ? 14.318  17.870  62.918 1.00 53.17 ? 1146 HOH A O   1 
HETATM 6546 O O   . HOH E 3 .   ? 12.717  16.169  60.054 1.00 73.66 ? 1147 HOH A O   1 
HETATM 6547 O O   . HOH E 3 .   ? -22.351 29.934  58.038 1.00 51.79 ? 1148 HOH A O   1 
HETATM 6548 O O   . HOH F 3 .   ? 11.625  35.668  46.887 1.00 20.12 ? 701  HOH B O   1 
HETATM 6549 O O   . HOH F 3 .   ? -18.003 63.589  16.747 1.00 26.85 ? 702  HOH B O   1 
HETATM 6550 O O   . HOH F 3 .   ? -2.538  60.823  8.772  1.00 19.01 ? 703  HOH B O   1 
HETATM 6551 O O   . HOH F 3 .   ? 15.451  42.629  39.987 1.00 21.60 ? 704  HOH B O   1 
HETATM 6552 O O   . HOH F 3 .   ? -2.140  42.729  19.797 1.00 25.76 ? 705  HOH B O   1 
HETATM 6553 O O   . HOH F 3 .   ? -26.186 34.188  13.527 1.00 23.33 ? 706  HOH B O   1 
HETATM 6554 O O   . HOH F 3 .   ? 16.656  60.115  30.991 1.00 35.50 ? 707  HOH B O   1 
HETATM 6555 O O   . HOH F 3 .   ? -4.612  53.980  23.026 1.00 17.10 ? 708  HOH B O   1 
HETATM 6556 O O   . HOH F 3 .   ? -4.618  34.891  18.472 1.00 21.85 ? 709  HOH B O   1 
HETATM 6557 O O   . HOH F 3 .   ? 10.649  31.252  42.248 1.00 21.83 ? 710  HOH B O   1 
HETATM 6558 O O   . HOH F 3 .   ? -10.582 37.504  20.633 1.00 20.86 ? 711  HOH B O   1 
HETATM 6559 O O   . HOH F 3 .   ? -1.972  27.325  24.918 1.00 14.11 ? 712  HOH B O   1 
HETATM 6560 O O   . HOH F 3 .   ? 0.510   53.479  10.802 1.00 24.15 ? 713  HOH B O   1 
HETATM 6561 O O   . HOH F 3 .   ? 14.033  46.184  28.867 1.00 19.05 ? 714  HOH B O   1 
HETATM 6562 O O   . HOH F 3 .   ? -5.955  37.624  23.852 1.00 17.90 ? 715  HOH B O   1 
HETATM 6563 O O   . HOH F 3 .   ? 5.922   61.130  35.765 1.00 20.10 ? 716  HOH B O   1 
HETATM 6564 O O   . HOH F 3 .   ? -11.543 27.504  5.477  1.00 33.70 ? 717  HOH B O   1 
HETATM 6565 O O   . HOH F 3 .   ? -1.002  48.789  15.350 1.00 18.54 ? 718  HOH B O   1 
HETATM 6566 O O   . HOH F 3 .   ? -13.150 65.674  11.450 1.00 30.66 ? 719  HOH B O   1 
HETATM 6567 O O   . HOH F 3 .   ? 9.524   34.919  30.193 1.00 16.83 ? 720  HOH B O   1 
HETATM 6568 O O   . HOH F 3 .   ? -10.160 31.829  11.165 1.00 20.13 ? 721  HOH B O   1 
HETATM 6569 O O   . HOH F 3 .   ? 7.499   31.537  28.390 1.00 16.00 ? 722  HOH B O   1 
HETATM 6570 O O   . HOH F 3 .   ? 11.483  48.535  35.954 1.00 32.06 ? 723  HOH B O   1 
HETATM 6571 O O   . HOH F 3 .   ? -5.866  67.109  29.674 1.00 21.50 ? 724  HOH B O   1 
HETATM 6572 O O   . HOH F 3 .   ? 28.384  49.923  43.838 1.00 53.23 ? 725  HOH B O   1 
HETATM 6573 O O   . HOH F 3 .   ? 15.227  50.286  42.710 1.00 44.37 ? 726  HOH B O   1 
HETATM 6574 O O   . HOH F 3 .   ? 12.695  55.193  39.594 1.00 24.15 ? 727  HOH B O   1 
HETATM 6575 O O   . HOH F 3 .   ? -22.614 45.247  21.613 1.00 24.77 ? 728  HOH B O   1 
HETATM 6576 O O   . HOH F 3 .   ? -8.572  48.977  16.386 1.00 17.79 ? 729  HOH B O   1 
HETATM 6577 O O   . HOH F 3 .   ? 5.217   47.292  23.046 1.00 14.59 ? 730  HOH B O   1 
HETATM 6578 O O   . HOH F 3 .   ? -12.844 53.227  22.189 1.00 17.63 ? 731  HOH B O   1 
HETATM 6579 O O   . HOH F 3 .   ? 11.261  71.207  20.190 1.00 32.56 ? 732  HOH B O   1 
HETATM 6580 O O   . HOH F 3 .   ? 6.289   48.050  9.225  1.00 21.30 ? 733  HOH B O   1 
HETATM 6581 O O   . HOH F 3 .   ? -6.060  52.923  27.593 1.00 22.38 ? 734  HOH B O   1 
HETATM 6582 O O   . HOH F 3 .   ? 16.008  41.799  47.312 1.00 20.10 ? 735  HOH B O   1 
HETATM 6583 O O   . HOH F 3 .   ? -5.229  54.306  29.812 1.00 15.48 ? 736  HOH B O   1 
HETATM 6584 O O   . HOH F 3 .   ? 6.516   45.292  9.797  1.00 25.38 ? 737  HOH B O   1 
HETATM 6585 O O   . HOH F 3 .   ? -24.117 39.934  9.785  1.00 24.07 ? 738  HOH B O   1 
HETATM 6586 O O   . HOH F 3 .   ? 7.438   49.277  34.942 1.00 21.41 ? 739  HOH B O   1 
HETATM 6587 O O   . HOH F 3 .   ? -6.468  56.270  13.722 1.00 20.26 ? 740  HOH B O   1 
HETATM 6588 O O   . HOH F 3 .   ? -12.087 55.312  20.318 1.00 17.64 ? 741  HOH B O   1 
HETATM 6589 O O   . HOH F 3 .   ? -22.432 36.606  23.420 1.00 27.39 ? 742  HOH B O   1 
HETATM 6590 O O   . HOH F 3 .   ? -9.924  49.390  20.596 1.00 17.99 ? 743  HOH B O   1 
HETATM 6591 O O   . HOH F 3 .   ? 7.473   43.640  35.730 1.00 15.17 ? 744  HOH B O   1 
HETATM 6592 O O   . HOH F 3 .   ? -30.351 45.235  7.397  1.00 39.27 ? 745  HOH B O   1 
HETATM 6593 O O   . HOH F 3 .   ? -16.330 58.082  11.755 1.00 25.47 ? 746  HOH B O   1 
HETATM 6594 O O   . HOH F 3 .   ? 5.710   58.565  36.376 1.00 24.22 ? 747  HOH B O   1 
HETATM 6595 O O   . HOH F 3 .   ? -15.235 43.313  18.318 1.00 19.50 ? 748  HOH B O   1 
HETATM 6596 O O   . HOH F 3 .   ? 21.299  22.230  35.849 1.00 34.08 ? 749  HOH B O   1 
HETATM 6597 O O   . HOH F 3 .   ? 5.029   65.692  6.516  1.00 23.92 ? 750  HOH B O   1 
HETATM 6598 O O   . HOH F 3 .   ? 4.098   56.619  35.037 1.00 17.99 ? 751  HOH B O   1 
HETATM 6599 O O   . HOH F 3 .   ? -23.631 57.405  4.718  1.00 41.00 ? 752  HOH B O   1 
HETATM 6600 O O   . HOH F 3 .   ? 9.424   46.985  33.550 1.00 27.11 ? 753  HOH B O   1 
HETATM 6601 O O   . HOH F 3 .   ? 9.069   49.158  16.076 1.00 22.36 ? 754  HOH B O   1 
HETATM 6602 O O   . HOH F 3 .   ? 32.663  39.788  48.941 1.00 47.63 ? 755  HOH B O   1 
HETATM 6603 O O   . HOH F 3 .   ? 9.091   52.528  43.471 1.00 21.71 ? 756  HOH B O   1 
HETATM 6604 O O   . HOH F 3 .   ? -30.438 38.487  4.736  1.00 34.52 ? 757  HOH B O   1 
HETATM 6605 O O   . HOH F 3 .   ? -13.899 58.038  13.542 1.00 22.51 ? 758  HOH B O   1 
HETATM 6606 O O   . HOH F 3 .   ? -3.759  49.540  18.155 1.00 19.53 ? 759  HOH B O   1 
HETATM 6607 O O   . HOH F 3 .   ? 4.462   31.454  15.215 1.00 29.38 ? 760  HOH B O   1 
HETATM 6608 O O   . HOH F 3 .   ? -10.876 48.694  18.121 1.00 14.95 ? 761  HOH B O   1 
HETATM 6609 O O   . HOH F 3 .   ? 8.659   42.946  38.194 1.00 49.42 ? 762  HOH B O   1 
HETATM 6610 O O   . HOH F 3 .   ? -5.360  37.900  27.246 1.00 28.78 ? 763  HOH B O   1 
HETATM 6611 O O   . HOH F 3 .   ? -1.377  30.155  9.816  1.00 21.84 ? 764  HOH B O   1 
HETATM 6612 O O   . HOH F 3 .   ? 8.544   39.646  40.719 1.00 17.05 ? 765  HOH B O   1 
HETATM 6613 O O   . HOH F 3 .   ? 0.088   64.514  4.663  1.00 23.75 ? 766  HOH B O   1 
HETATM 6614 O O   . HOH F 3 .   ? 8.564   58.052  9.458  1.00 27.76 ? 767  HOH B O   1 
HETATM 6615 O O   . HOH F 3 .   ? -34.144 34.543  10.334 1.00 41.30 ? 768  HOH B O   1 
HETATM 6616 O O   . HOH F 3 .   ? 9.939   31.839  27.476 1.00 24.17 ? 769  HOH B O   1 
HETATM 6617 O O   . HOH F 3 .   ? 15.627  44.092  16.459 1.00 36.32 ? 770  HOH B O   1 
HETATM 6618 O O   . HOH F 3 .   ? 6.659   48.154  16.671 1.00 22.33 ? 771  HOH B O   1 
HETATM 6619 O O   . HOH F 3 .   ? 11.598  43.704  34.613 1.00 28.61 ? 772  HOH B O   1 
HETATM 6620 O O   . HOH F 3 .   ? -7.466  54.838  31.249 1.00 20.62 ? 773  HOH B O   1 
HETATM 6621 O O   . HOH F 3 .   ? 0.004   54.251  37.882 0.50 22.91 ? 774  HOH B O   1 
HETATM 6622 O O   . HOH F 3 .   ? -8.045  39.395  24.965 1.00 23.50 ? 775  HOH B O   1 
HETATM 6623 O O   . HOH F 3 .   ? -9.210  31.197  6.391  1.00 26.68 ? 776  HOH B O   1 
HETATM 6624 O O   . HOH F 3 .   ? 1.368   54.758  8.612  1.00 22.76 ? 777  HOH B O   1 
HETATM 6625 O O   . HOH F 3 .   ? 24.278  30.200  48.655 1.00 40.78 ? 778  HOH B O   1 
HETATM 6626 O O   . HOH F 3 .   ? -18.521 48.387  17.530 1.00 51.07 ? 779  HOH B O   1 
HETATM 6627 O O   . HOH F 3 .   ? 16.955  56.993  20.450 1.00 22.14 ? 780  HOH B O   1 
HETATM 6628 O O   . HOH F 3 .   ? 8.990   46.926  37.014 1.00 27.98 ? 781  HOH B O   1 
HETATM 6629 O O   . HOH F 3 .   ? -6.177  50.443  17.540 1.00 21.31 ? 782  HOH B O   1 
HETATM 6630 O O   . HOH F 3 .   ? -12.417 61.845  27.339 1.00 24.43 ? 783  HOH B O   1 
HETATM 6631 O O   . HOH F 3 .   ? -1.296  62.008  4.390  1.00 23.85 ? 784  HOH B O   1 
HETATM 6632 O O   . HOH F 3 .   ? 3.153   31.067  44.335 1.00 19.04 ? 785  HOH B O   1 
HETATM 6633 O O   . HOH F 3 .   ? 16.354  41.727  29.238 1.00 28.65 ? 786  HOH B O   1 
HETATM 6634 O O   . HOH F 3 .   ? -6.109  69.625  18.136 1.00 47.88 ? 787  HOH B O   1 
HETATM 6635 O O   . HOH F 3 .   ? -3.595  41.420  2.087  1.00 27.30 ? 788  HOH B O   1 
HETATM 6636 O O   . HOH F 3 .   ? 8.914   60.619  8.583  1.00 22.95 ? 789  HOH B O   1 
HETATM 6637 O O   . HOH F 3 .   ? 3.607   35.220  39.144 1.00 23.81 ? 790  HOH B O   1 
HETATM 6638 O O   . HOH F 3 .   ? -16.611 66.171  18.820 1.00 26.08 ? 791  HOH B O   1 
HETATM 6639 O O   . HOH F 3 .   ? 4.083   60.046  4.074  1.00 32.20 ? 792  HOH B O   1 
HETATM 6640 O O   . HOH F 3 .   ? -15.018 52.986  23.458 1.00 26.35 ? 793  HOH B O   1 
HETATM 6641 O O   . HOH F 3 .   ? -14.670 42.754  21.142 1.00 23.06 ? 794  HOH B O   1 
HETATM 6642 O O   . HOH F 3 .   ? 13.276  70.191  13.290 1.00 28.68 ? 795  HOH B O   1 
HETATM 6643 O O   . HOH F 3 .   ? 17.142  53.064  20.186 1.00 30.09 ? 796  HOH B O   1 
HETATM 6644 O O   . HOH F 3 .   ? -33.811 50.313  11.927 1.00 40.75 ? 797  HOH B O   1 
HETATM 6645 O O   . HOH F 3 .   ? -0.116  37.729  6.781  1.00 33.81 ? 798  HOH B O   1 
HETATM 6646 O O   . HOH F 3 .   ? 10.003  41.734  14.282 1.00 37.83 ? 799  HOH B O   1 
HETATM 6647 O O   . HOH F 3 .   ? 7.828   30.620  25.704 1.00 19.96 ? 800  HOH B O   1 
HETATM 6648 O O   . HOH F 3 .   ? -7.858  35.904  2.626  1.00 37.34 ? 801  HOH B O   1 
HETATM 6649 O O   . HOH F 3 .   ? -20.398 47.133  1.064  1.00 47.45 ? 802  HOH B O   1 
HETATM 6650 O O   . HOH F 3 .   ? -31.319 34.080  10.535 1.00 31.69 ? 803  HOH B O   1 
HETATM 6651 O O   . HOH F 3 .   ? -10.757 37.844  23.613 1.00 32.86 ? 804  HOH B O   1 
HETATM 6652 O O   . HOH F 3 .   ? 19.989  24.425  34.618 1.00 28.02 ? 805  HOH B O   1 
HETATM 6653 O O   . HOH F 3 .   ? -14.591 56.184  10.094 1.00 24.86 ? 806  HOH B O   1 
HETATM 6654 O O   . HOH F 3 .   ? -8.866  53.602  -0.375 1.00 38.14 ? 807  HOH B O   1 
HETATM 6655 O O   . HOH F 3 .   ? -24.146 60.222  11.421 1.00 28.95 ? 808  HOH B O   1 
HETATM 6656 O O   . HOH F 3 .   ? 16.609  44.826  35.158 1.00 30.66 ? 809  HOH B O   1 
HETATM 6657 O O   . HOH F 3 .   ? 10.872  34.669  26.583 1.00 30.05 ? 810  HOH B O   1 
HETATM 6658 O O   . HOH F 3 .   ? -5.822  71.422  32.671 1.00 33.72 ? 811  HOH B O   1 
HETATM 6659 O O   . HOH F 3 .   ? 5.966   71.581  27.277 1.00 32.08 ? 812  HOH B O   1 
HETATM 6660 O O   . HOH F 3 .   ? -0.729  35.303  36.240 1.00 31.23 ? 813  HOH B O   1 
HETATM 6661 O O   . HOH F 3 .   ? 13.785  61.109  28.145 1.00 26.65 ? 814  HOH B O   1 
HETATM 6662 O O   . HOH F 3 .   ? -9.568  31.369  3.801  1.00 44.81 ? 815  HOH B O   1 
HETATM 6663 O O   . HOH F 3 .   ? 12.656  55.919  17.357 1.00 21.09 ? 816  HOH B O   1 
HETATM 6664 O O   . HOH F 3 .   ? 0.349   41.024  36.683 1.00 32.04 ? 817  HOH B O   1 
HETATM 6665 O O   . HOH F 3 .   ? -11.453 53.450  31.635 1.00 24.23 ? 818  HOH B O   1 
HETATM 6666 O O   . HOH F 3 .   ? -12.869 65.156  25.270 1.00 50.78 ? 819  HOH B O   1 
HETATM 6667 O O   . HOH F 3 .   ? -16.942 33.462  20.393 1.00 24.74 ? 820  HOH B O   1 
HETATM 6668 O O   . HOH F 3 .   ? 18.934  54.180  26.516 1.00 34.43 ? 821  HOH B O   1 
HETATM 6669 O O   . HOH F 3 .   ? -29.835 40.946  2.111  1.00 41.07 ? 822  HOH B O   1 
HETATM 6670 O O   . HOH F 3 .   ? -15.282 69.099  16.848 1.00 49.87 ? 823  HOH B O   1 
HETATM 6671 O O   . HOH F 3 .   ? -6.467  36.713  33.898 1.00 21.87 ? 824  HOH B O   1 
HETATM 6672 O O   . HOH F 3 .   ? -10.660 67.868  30.759 1.00 36.47 ? 825  HOH B O   1 
HETATM 6673 O O   . HOH F 3 .   ? -30.839 53.598  6.255  1.00 53.14 ? 826  HOH B O   1 
HETATM 6674 O O   . HOH F 3 .   ? 11.482  62.742  34.869 1.00 33.68 ? 827  HOH B O   1 
HETATM 6675 O O   . HOH F 3 .   ? -36.053 40.100  17.968 1.00 61.87 ? 828  HOH B O   1 
HETATM 6676 O O   . HOH F 3 .   ? 7.912   64.097  33.402 1.00 26.12 ? 829  HOH B O   1 
HETATM 6677 O O   . HOH F 3 .   ? 9.847   50.446  35.121 1.00 28.41 ? 830  HOH B O   1 
HETATM 6678 O O   . HOH F 3 .   ? -15.217 59.261  26.995 1.00 25.68 ? 831  HOH B O   1 
HETATM 6679 O O   . HOH F 3 .   ? -2.026  74.282  26.728 1.00 28.68 ? 832  HOH B O   1 
HETATM 6680 O O   . HOH F 3 .   ? -2.555  33.569  32.686 1.00 32.53 ? 833  HOH B O   1 
HETATM 6681 O O   . HOH F 3 .   ? 20.694  32.643  34.704 1.00 25.55 ? 834  HOH B O   1 
HETATM 6682 O O   . HOH F 3 .   ? -10.605 60.844  8.989  1.00 25.98 ? 835  HOH B O   1 
HETATM 6683 O O   . HOH F 3 .   ? -16.555 49.325  2.016  1.00 35.81 ? 836  HOH B O   1 
HETATM 6684 O O   . HOH F 3 .   ? 14.822  52.019  18.938 1.00 27.90 ? 837  HOH B O   1 
HETATM 6685 O O   . HOH F 3 .   ? -9.042  51.660  7.448  1.00 32.69 ? 838  HOH B O   1 
HETATM 6686 O O   . HOH F 3 .   ? 21.309  35.272  35.148 1.00 43.88 ? 839  HOH B O   1 
HETATM 6687 O O   . HOH F 3 .   ? 17.473  32.415  16.108 1.00 42.54 ? 840  HOH B O   1 
HETATM 6688 O O   . HOH F 3 .   ? 0.565   30.185  8.031  1.00 40.62 ? 841  HOH B O   1 
HETATM 6689 O O   . HOH F 3 .   ? -9.284  33.798  23.119 1.00 42.75 ? 842  HOH B O   1 
HETATM 6690 O O   . HOH F 3 .   ? 21.215  38.290  38.005 1.00 27.73 ? 843  HOH B O   1 
HETATM 6691 O O   . HOH F 3 .   ? -9.956  28.686  10.117 1.00 52.97 ? 844  HOH B O   1 
HETATM 6692 O O   . HOH F 3 .   ? -26.217 30.722  7.450  1.00 34.54 ? 845  HOH B O   1 
HETATM 6693 O O   . HOH F 3 .   ? -14.639 56.169  6.359  1.00 37.81 ? 846  HOH B O   1 
HETATM 6694 O O   . HOH F 3 .   ? 11.739  64.924  27.137 1.00 38.70 ? 847  HOH B O   1 
HETATM 6695 O O   . HOH F 3 .   ? -3.948  35.707  34.031 1.00 27.53 ? 848  HOH B O   1 
HETATM 6696 O O   . HOH F 3 .   ? -14.020 64.112  30.769 1.00 43.49 ? 849  HOH B O   1 
HETATM 6697 O O   . HOH F 3 .   ? -9.059  68.280  15.449 1.00 30.37 ? 850  HOH B O   1 
HETATM 6698 O O   . HOH F 3 .   ? 6.094   38.612  39.908 1.00 25.40 ? 851  HOH B O   1 
HETATM 6699 O O   . HOH F 3 .   ? 28.824  39.738  38.657 1.00 51.26 ? 852  HOH B O   1 
HETATM 6700 O O   . HOH F 3 .   ? -23.959 36.747  -0.217 1.00 46.54 ? 853  HOH B O   1 
HETATM 6701 O O   . HOH F 3 .   ? 19.297  37.606  43.722 1.00 40.10 ? 854  HOH B O   1 
HETATM 6702 O O   . HOH F 3 .   ? 13.263  60.360  18.693 1.00 28.26 ? 855  HOH B O   1 
HETATM 6703 O O   . HOH F 3 .   ? 18.383  25.730  28.132 1.00 55.50 ? 856  HOH B O   1 
HETATM 6704 O O   . HOH F 3 .   ? 5.128   46.907  3.293  1.00 55.99 ? 857  HOH B O   1 
HETATM 6705 O O   . HOH F 3 .   ? 25.177  40.535  42.519 1.00 30.68 ? 858  HOH B O   1 
HETATM 6706 O O   . HOH F 3 .   ? -24.947 50.068  20.548 1.00 39.91 ? 859  HOH B O   1 
HETATM 6707 O O   . HOH F 3 .   ? -12.026 59.583  10.684 1.00 28.49 ? 860  HOH B O   1 
HETATM 6708 O O   . HOH F 3 .   ? 19.931  50.043  32.231 1.00 35.33 ? 861  HOH B O   1 
HETATM 6709 O O   . HOH F 3 .   ? -26.286 34.772  23.130 1.00 29.59 ? 862  HOH B O   1 
HETATM 6710 O O   . HOH F 3 .   ? -19.709 56.189  23.762 1.00 47.36 ? 863  HOH B O   1 
HETATM 6711 O O   . HOH F 3 .   ? -11.780 67.702  12.834 1.00 28.76 ? 864  HOH B O   1 
HETATM 6712 O O   . HOH F 3 .   ? -17.545 64.565  20.674 1.00 48.73 ? 865  HOH B O   1 
HETATM 6713 O O   . HOH F 3 .   ? -16.005 37.995  -1.835 1.00 56.17 ? 866  HOH B O   1 
HETATM 6714 O O   . HOH F 3 .   ? 3.591   70.012  7.626  1.00 38.07 ? 867  HOH B O   1 
HETATM 6715 O O   . HOH F 3 .   ? 16.271  38.277  12.296 1.00 41.49 ? 868  HOH B O   1 
HETATM 6716 O O   . HOH F 3 .   ? -12.903 63.135  12.975 1.00 40.54 ? 869  HOH B O   1 
HETATM 6717 O O   . HOH F 3 .   ? -8.884  70.765  23.744 1.00 37.65 ? 870  HOH B O   1 
HETATM 6718 O O   . HOH F 3 .   ? 1.622   28.560  44.688 1.00 43.09 ? 871  HOH B O   1 
HETATM 6719 O O   . HOH F 3 .   ? 5.385   30.476  12.507 1.00 39.76 ? 872  HOH B O   1 
HETATM 6720 O O   . HOH F 3 .   ? -6.922  37.337  31.447 1.00 54.92 ? 873  HOH B O   1 
HETATM 6721 O O   . HOH F 3 .   ? 15.412  52.845  42.736 1.00 32.73 ? 874  HOH B O   1 
HETATM 6722 O O   . HOH F 3 .   ? -13.046 55.107  29.299 1.00 34.76 ? 875  HOH B O   1 
HETATM 6723 O O   . HOH F 3 .   ? -18.558 57.176  26.178 1.00 36.52 ? 876  HOH B O   1 
HETATM 6724 O O   . HOH F 3 .   ? 10.521  61.952  10.017 1.00 26.68 ? 877  HOH B O   1 
HETATM 6725 O O   . HOH F 3 .   ? 21.973  50.257  33.771 1.00 51.94 ? 878  HOH B O   1 
HETATM 6726 O O   . HOH F 3 .   ? 18.174  39.967  22.157 1.00 50.94 ? 879  HOH B O   1 
HETATM 6727 O O   . HOH F 3 .   ? -23.157 52.635  1.034  1.00 54.62 ? 880  HOH B O   1 
HETATM 6728 O O   . HOH F 3 .   ? 9.425   67.450  6.420  1.00 41.61 ? 881  HOH B O   1 
HETATM 6729 O O   . HOH F 3 .   ? -24.302 29.665  12.543 1.00 31.17 ? 882  HOH B O   1 
HETATM 6730 O O   . HOH F 3 .   ? -3.988  39.798  34.661 1.00 30.51 ? 883  HOH B O   1 
HETATM 6731 O O   . HOH F 3 .   ? 23.757  39.355  44.204 1.00 41.95 ? 884  HOH B O   1 
HETATM 6732 O O   . HOH F 3 .   ? 0.557   45.846  3.949  1.00 44.02 ? 885  HOH B O   1 
HETATM 6733 O O   . HOH F 3 .   ? -13.850 49.831  2.082  1.00 45.83 ? 886  HOH B O   1 
HETATM 6734 O O   . HOH F 3 .   ? -18.452 30.978  3.031  1.00 34.15 ? 887  HOH B O   1 
HETATM 6735 O O   . HOH F 3 .   ? 19.321  49.058  25.591 1.00 36.20 ? 888  HOH B O   1 
HETATM 6736 O O   . HOH F 3 .   ? 17.686  28.614  25.396 1.00 28.82 ? 889  HOH B O   1 
HETATM 6737 O O   . HOH F 3 .   ? -12.228 60.648  13.682 1.00 24.71 ? 890  HOH B O   1 
HETATM 6738 O O   . HOH F 3 .   ? 21.461  39.294  42.547 1.00 30.34 ? 891  HOH B O   1 
HETATM 6739 O O   . HOH F 3 .   ? -10.806 65.624  36.310 1.00 35.84 ? 892  HOH B O   1 
HETATM 6740 O O   . HOH F 3 .   ? 10.779  48.835  9.302  1.00 44.77 ? 893  HOH B O   1 
HETATM 6741 O O   . HOH F 3 .   ? 6.019   58.284  2.714  1.00 40.10 ? 894  HOH B O   1 
HETATM 6742 O O   . HOH F 3 .   ? -16.003 57.634  29.319 1.00 34.57 ? 895  HOH B O   1 
HETATM 6743 O O   . HOH F 3 .   ? -27.572 55.323  7.649  1.00 32.94 ? 896  HOH B O   1 
HETATM 6744 O O   . HOH F 3 .   ? 6.853   53.642  4.537  1.00 37.82 ? 897  HOH B O   1 
HETATM 6745 O O   . HOH F 3 .   ? -7.401  72.919  20.515 1.00 45.73 ? 898  HOH B O   1 
HETATM 6746 O O   . HOH F 3 .   ? -11.931 29.909  2.670  1.00 52.14 ? 899  HOH B O   1 
HETATM 6747 O O   . HOH F 3 .   ? 9.535   66.414  32.828 1.00 48.13 ? 900  HOH B O   1 
HETATM 6748 O O   . HOH F 3 .   ? -15.147 36.663  0.594  1.00 36.51 ? 901  HOH B O   1 
HETATM 6749 O O   . HOH F 3 .   ? -21.981 33.792  24.199 1.00 51.11 ? 902  HOH B O   1 
HETATM 6750 O O   . HOH F 3 .   ? -35.539 42.291  20.164 1.00 36.96 ? 903  HOH B O   1 
HETATM 6751 O O   . HOH F 3 .   ? -29.215 35.048  24.081 1.00 41.66 ? 904  HOH B O   1 
HETATM 6752 O O   . HOH F 3 .   ? 10.656  33.310  45.830 1.00 19.73 ? 905  HOH B O   1 
HETATM 6753 O O   . HOH F 3 .   ? 9.878   24.595  28.906 1.00 19.73 ? 906  HOH B O   1 
HETATM 6754 O O   . HOH F 3 .   ? -3.417  61.277  6.110  1.00 19.79 ? 907  HOH B O   1 
HETATM 6755 O O   . HOH F 3 .   ? 16.714  44.156  37.976 1.00 26.72 ? 908  HOH B O   1 
HETATM 6756 O O   . HOH F 3 .   ? 13.224  26.704  32.697 1.00 47.94 ? 909  HOH B O   1 
HETATM 6757 O O   . HOH F 3 .   ? 19.717  59.535  27.157 1.00 58.59 ? 910  HOH B O   1 
HETATM 6758 O O   . HOH F 3 .   ? -19.599 63.543  14.768 1.00 32.56 ? 911  HOH B O   1 
HETATM 6759 O O   . HOH F 3 .   ? -0.600  42.688  21.821 1.00 22.17 ? 912  HOH B O   1 
HETATM 6760 O O   . HOH F 3 .   ? -9.406  55.330  1.448  1.00 41.82 ? 913  HOH B O   1 
HETATM 6761 O O   . HOH F 3 .   ? -6.967  30.977  7.320  1.00 67.68 ? 914  HOH B O   1 
HETATM 6762 O O   . HOH F 3 .   ? -28.585 47.058  7.055  1.00 33.50 ? 915  HOH B O   1 
HETATM 6763 O O   . HOH F 3 .   ? -15.217 68.286  20.671 1.00 29.60 ? 916  HOH B O   1 
HETATM 6764 O O   . HOH F 3 .   ? 22.664  32.900  27.813 1.00 37.46 ? 917  HOH B O   1 
HETATM 6765 O O   . HOH F 3 .   ? -8.003  68.231  28.691 1.00 54.44 ? 918  HOH B O   1 
HETATM 6766 O O   . HOH F 3 .   ? 17.007  29.747  21.099 1.00 41.15 ? 919  HOH B O   1 
HETATM 6767 O O   . HOH F 3 .   ? -18.615 48.382  0.162  1.00 40.91 ? 920  HOH B O   1 
HETATM 6768 O O   . HOH F 3 .   ? -14.237 52.363  4.765  1.00 57.06 ? 921  HOH B O   1 
HETATM 6769 O O   . HOH F 3 .   ? -6.010  74.941  12.157 1.00 53.75 ? 922  HOH B O   1 
HETATM 6770 O O   . HOH F 3 .   ? 21.756  31.044  24.817 1.00 43.26 ? 923  HOH B O   1 
HETATM 6771 O O   . HOH F 3 .   ? -29.934 55.459  8.702  1.00 59.80 ? 924  HOH B O   1 
HETATM 6772 O O   . HOH F 3 .   ? -5.835  71.118  10.346 1.00 48.63 ? 925  HOH B O   1 
HETATM 6773 O O   . HOH F 3 .   ? 5.662   40.936  9.463  1.00 45.71 ? 926  HOH B O   1 
HETATM 6774 O O   . HOH F 3 .   ? 9.647   73.101  25.978 1.00 47.58 ? 927  HOH B O   1 
HETATM 6775 O O   . HOH F 3 .   ? -10.340 62.374  37.992 1.00 34.10 ? 928  HOH B O   1 
HETATM 6776 O O   . HOH F 3 .   ? -3.157  27.508  8.309  1.00 45.61 ? 929  HOH B O   1 
HETATM 6777 O O   . HOH F 3 .   ? 3.408   75.942  17.955 1.00 48.64 ? 930  HOH B O   1 
HETATM 6778 O O   . HOH F 3 .   ? -20.334 30.026  4.604  1.00 31.48 ? 931  HOH B O   1 
HETATM 6779 O O   . HOH F 3 .   ? 8.320   69.136  23.526 1.00 32.55 ? 932  HOH B O   1 
HETATM 6780 O O   . HOH F 3 .   ? 12.703  48.334  31.177 1.00 28.14 ? 933  HOH B O   1 
HETATM 6781 O O   . HOH F 3 .   ? -14.599 60.982  10.202 1.00 31.17 ? 934  HOH B O   1 
HETATM 6782 O O   . HOH F 3 .   ? -3.899  72.505  19.419 1.00 46.63 ? 935  HOH B O   1 
HETATM 6783 O O   . HOH F 3 .   ? 14.186  53.825  16.853 1.00 33.74 ? 936  HOH B O   1 
HETATM 6784 O O   . HOH F 3 .   ? -5.191  43.503  1.049  1.00 41.69 ? 937  HOH B O   1 
HETATM 6785 O O   . HOH F 3 .   ? -0.979  72.796  30.241 1.00 49.95 ? 938  HOH B O   1 
HETATM 6786 O O   . HOH F 3 .   ? -24.933 44.696  -2.451 1.00 49.94 ? 939  HOH B O   1 
HETATM 6787 O O   . HOH F 3 .   ? -34.880 51.874  19.595 1.00 42.55 ? 940  HOH B O   1 
HETATM 6788 O O   . HOH F 3 .   ? -14.688 25.438  5.364  1.00 42.47 ? 941  HOH B O   1 
HETATM 6789 O O   . HOH F 3 .   ? -22.045 28.629  11.317 1.00 34.60 ? 942  HOH B O   1 
HETATM 6790 O O   . HOH F 3 .   ? -25.347 53.385  6.807  1.00 42.43 ? 943  HOH B O   1 
HETATM 6791 O O   . HOH F 3 .   ? -18.058 53.376  26.413 1.00 48.16 ? 944  HOH B O   1 
HETATM 6792 O O   . HOH F 3 .   ? -32.761 45.982  5.747  1.00 58.84 ? 945  HOH B O   1 
HETATM 6793 O O   . HOH F 3 .   ? -4.972  47.168  -2.586 1.00 51.27 ? 946  HOH B O   1 
HETATM 6794 O O   . HOH F 3 .   ? 22.340  22.937  30.961 1.00 48.62 ? 947  HOH B O   1 
HETATM 6795 O O   . HOH F 3 .   ? -4.277  73.636  25.353 1.00 45.03 ? 948  HOH B O   1 
HETATM 6796 O O   . HOH F 3 .   ? -27.007 31.663  14.858 1.00 30.91 ? 949  HOH B O   1 
HETATM 6797 O O   . HOH F 3 .   ? 2.659   76.118  29.828 1.00 37.44 ? 950  HOH B O   1 
HETATM 6798 O O   . HOH F 3 .   ? -12.658 49.256  -2.944 1.00 32.73 ? 951  HOH B O   1 
HETATM 6799 O O   . HOH F 3 .   ? 16.063  43.844  27.410 1.00 33.89 ? 952  HOH B O   1 
HETATM 6800 O O   . HOH F 3 .   ? -29.346 51.625  20.212 1.00 46.22 ? 953  HOH B O   1 
HETATM 6801 O O   . HOH F 3 .   ? -28.148 57.648  11.700 1.00 36.79 ? 954  HOH B O   1 
HETATM 6802 O O   . HOH F 3 .   ? -34.810 51.065  9.845  1.00 58.73 ? 955  HOH B O   1 
HETATM 6803 O O   . HOH F 3 .   ? -6.892  28.838  2.510  1.00 53.03 ? 956  HOH B O   1 
HETATM 6804 O O   . HOH F 3 .   ? 15.934  49.484  16.060 1.00 42.62 ? 957  HOH B O   1 
HETATM 6805 O O   . HOH F 3 .   ? -16.466 53.950  10.617 1.00 47.59 ? 958  HOH B O   1 
HETATM 6806 O O   . HOH F 3 .   ? 11.591  48.046  33.263 1.00 37.28 ? 959  HOH B O   1 
HETATM 6807 O O   . HOH F 3 .   ? -34.151 37.630  20.113 1.00 38.92 ? 960  HOH B O   1 
HETATM 6808 O O   . HOH F 3 .   ? 5.555   72.205  31.291 1.00 38.41 ? 961  HOH B O   1 
HETATM 6809 O O   . HOH F 3 .   ? 6.222   72.655  34.795 1.00 46.46 ? 962  HOH B O   1 
HETATM 6810 O O   . HOH F 3 .   ? -17.566 25.474  3.261  1.00 38.01 ? 963  HOH B O   1 
HETATM 6811 O O   . HOH F 3 .   ? -35.250 42.267  13.459 1.00 42.76 ? 964  HOH B O   1 
HETATM 6812 O O   . HOH F 3 .   ? 20.854  32.609  47.376 1.00 43.42 ? 965  HOH B O   1 
HETATM 6813 O O   . HOH F 3 .   ? -23.827 47.059  -0.177 1.00 55.42 ? 966  HOH B O   1 
HETATM 6814 O O   . HOH F 3 .   ? 12.895  46.509  11.965 1.00 46.85 ? 967  HOH B O   1 
HETATM 6815 O O   . HOH F 3 .   ? 20.770  48.710  47.465 1.00 41.76 ? 968  HOH B O   1 
HETATM 6816 O O   . HOH F 3 .   ? 12.377  42.576  14.214 1.00 50.16 ? 969  HOH B O   1 
HETATM 6817 O O   . HOH F 3 .   ? 18.307  55.370  35.940 1.00 45.70 ? 970  HOH B O   1 
HETATM 6818 O O   . HOH F 3 .   ? -3.376  30.423  7.988  1.00 36.54 ? 971  HOH B O   1 
HETATM 6819 O O   . HOH F 3 .   ? -17.306 19.988  12.581 1.00 51.08 ? 972  HOH B O   1 
HETATM 6820 O O   . HOH F 3 .   ? -27.087 32.756  20.541 1.00 42.71 ? 973  HOH B O   1 
HETATM 6821 O O   . HOH F 3 .   ? -19.119 59.027  4.520  1.00 50.02 ? 974  HOH B O   1 
HETATM 6822 O O   . HOH F 3 .   ? -20.825 48.110  -2.095 1.00 46.39 ? 975  HOH B O   1 
HETATM 6823 O O   . HOH F 3 .   ? 16.208  26.298  25.183 1.00 46.48 ? 976  HOH B O   1 
HETATM 6824 O O   . HOH F 3 .   ? -15.780 52.041  0.840  1.00 51.37 ? 977  HOH B O   1 
HETATM 6825 O O   . HOH F 3 .   ? 19.587  52.696  31.174 1.00 38.55 ? 978  HOH B O   1 
HETATM 6826 O O   . HOH F 3 .   ? -22.404 32.410  20.860 1.00 49.81 ? 979  HOH B O   1 
HETATM 6827 O O   . HOH F 3 .   ? 15.844  25.272  22.863 1.00 45.05 ? 980  HOH B O   1 
HETATM 6828 O O   . HOH F 3 .   ? 29.520  37.106  46.801 1.00 45.04 ? 981  HOH B O   1 
HETATM 6829 O O   . HOH F 3 .   ? 11.311  74.533  16.220 1.00 44.60 ? 982  HOH B O   1 
HETATM 6830 O O   . HOH F 3 .   ? 4.325   57.518  -0.495 1.00 42.39 ? 983  HOH B O   1 
HETATM 6831 O O   . HOH F 3 .   ? -31.819 57.252  19.046 1.00 44.29 ? 984  HOH B O   1 
HETATM 6832 O O   . HOH F 3 .   ? 10.250  37.510  8.182  1.00 50.24 ? 985  HOH B O   1 
HETATM 6833 O O   . HOH F 3 .   ? -19.796 48.475  22.264 1.00 51.96 ? 986  HOH B O   1 
HETATM 6834 O O   . HOH F 3 .   ? 20.959  37.827  26.769 1.00 58.84 ? 987  HOH B O   1 
HETATM 6835 O O   . HOH F 3 .   ? -36.138 41.104  9.527  1.00 54.47 ? 988  HOH B O   1 
HETATM 6836 O O   . HOH F 3 .   ? 16.083  46.829  32.159 1.00 42.15 ? 989  HOH B O   1 
HETATM 6837 O O   . HOH F 3 .   ? -9.402  66.957  8.785  1.00 47.20 ? 990  HOH B O   1 
HETATM 6838 O O   . HOH F 3 .   ? -14.533 48.972  22.461 1.00 33.39 ? 991  HOH B O   1 
HETATM 6839 O O   . HOH F 3 .   ? -16.699 50.518  28.124 1.00 70.64 ? 992  HOH B O   1 
HETATM 6840 O O   . HOH F 3 .   ? -12.396 50.413  21.682 1.00 25.94 ? 993  HOH B O   1 
HETATM 6841 O O   . HOH F 3 .   ? -17.706 50.766  25.897 1.00 41.04 ? 994  HOH B O   1 
HETATM 6842 O O   . HOH F 3 .   ? -18.783 50.834  29.827 1.00 47.30 ? 995  HOH B O   1 
HETATM 6843 O O   . HOH F 3 .   ? -13.276 54.703  33.584 1.00 27.56 ? 996  HOH B O   1 
HETATM 6844 O O   . HOH F 3 .   ? -13.981 57.370  32.339 1.00 28.54 ? 997  HOH B O   1 
HETATM 6845 O O   . HOH F 3 .   ? 25.745  31.805  51.350 1.00 45.79 ? 998  HOH B O   1 
HETATM 6846 O O   . HOH F 3 .   ? 12.207  39.149  6.971  1.00 61.29 ? 999  HOH B O   1 
HETATM 6847 O O   . HOH F 3 .   ? 9.197   44.535  9.609  1.00 42.53 ? 1000 HOH B O   1 
HETATM 6848 O O   . HOH F 3 .   ? 15.239  35.544  18.484 1.00 31.39 ? 1001 HOH B O   1 
HETATM 6849 O O   . HOH F 3 .   ? 14.466  26.807  19.497 1.00 40.80 ? 1002 HOH B O   1 
HETATM 6850 O O   . HOH F 3 .   ? 17.320  43.478  25.197 1.00 42.35 ? 1003 HOH B O   1 
HETATM 6851 O O   . HOH F 3 .   ? 20.580  31.552  37.121 1.00 33.23 ? 1004 HOH B O   1 
HETATM 6852 O O   . HOH F 3 .   ? 21.928  34.637  45.848 1.00 38.57 ? 1005 HOH B O   1 
HETATM 6853 O O   . HOH F 3 .   ? 32.093  44.940  48.470 1.00 48.46 ? 1006 HOH B O   1 
HETATM 6854 O O   . HOH F 3 .   ? 25.443  49.657  47.408 1.00 49.78 ? 1007 HOH B O   1 
HETATM 6855 O O   . HOH F 3 .   ? 32.594  44.297  50.965 1.00 40.55 ? 1008 HOH B O   1 
HETATM 6856 O O   . HOH F 3 .   ? 32.553  49.385  40.331 1.00 58.48 ? 1009 HOH B O   1 
HETATM 6857 O O   . HOH F 3 .   ? 31.040  51.123  38.573 1.00 47.58 ? 1010 HOH B O   1 
HETATM 6858 O O   . HOH F 3 .   ? 24.675  51.131  35.543 1.00 55.53 ? 1011 HOH B O   1 
HETATM 6859 O O   . HOH F 3 .   ? 24.668  55.528  39.419 1.00 45.57 ? 1012 HOH B O   1 
HETATM 6860 O O   . HOH F 3 .   ? 16.943  42.875  31.087 1.00 50.50 ? 1013 HOH B O   1 
HETATM 6861 O O   . HOH F 3 .   ? 20.017  51.854  25.767 1.00 41.56 ? 1014 HOH B O   1 
HETATM 6862 O O   . HOH F 3 .   ? 19.205  57.662  29.257 1.00 29.77 ? 1015 HOH B O   1 
HETATM 6863 O O   . HOH F 3 .   ? 21.383  49.519  36.587 1.00 28.73 ? 1016 HOH B O   1 
HETATM 6864 O O   . HOH F 3 .   ? 13.744  48.836  36.129 1.00 36.99 ? 1017 HOH B O   1 
HETATM 6865 O O   . HOH F 3 .   ? 20.007  39.045  32.601 1.00 38.58 ? 1018 HOH B O   1 
HETATM 6866 O O   . HOH F 3 .   ? 21.458  39.591  28.673 1.00 51.76 ? 1019 HOH B O   1 
HETATM 6867 O O   . HOH F 3 .   ? 9.565   44.691  34.972 1.00 34.61 ? 1020 HOH B O   1 
HETATM 6868 O O   . HOH F 3 .   ? 15.404  44.270  32.927 1.00 35.86 ? 1021 HOH B O   1 
HETATM 6869 O O   . HOH F 3 .   ? 19.732  54.206  29.017 1.00 32.33 ? 1022 HOH B O   1 
HETATM 6870 O O   . HOH F 3 .   ? -2.575  37.995  33.767 1.00 31.78 ? 1023 HOH B O   1 
HETATM 6871 O O   . HOH F 3 .   ? -2.342  41.989  35.284 1.00 31.44 ? 1024 HOH B O   1 
HETATM 6872 O O   . HOH F 3 .   ? 13.794  63.172  26.494 1.00 41.47 ? 1025 HOH B O   1 
HETATM 6873 O O   . HOH F 3 .   ? 11.269  66.755  25.297 1.00 40.83 ? 1026 HOH B O   1 
HETATM 6874 O O   . HOH F 3 .   ? 10.602  64.856  29.492 1.00 55.70 ? 1027 HOH B O   1 
HETATM 6875 O O   . HOH F 3 .   ? -2.590  75.728  40.911 1.00 41.71 ? 1028 HOH B O   1 
HETATM 6876 O O   . HOH F 3 .   ? -3.436  76.596  43.396 1.00 48.55 ? 1029 HOH B O   1 
HETATM 6877 O O   . HOH F 3 .   ? 4.189   73.540  43.050 1.00 40.80 ? 1030 HOH B O   1 
HETATM 6878 O O   . HOH F 3 .   ? -6.886  71.450  38.793 1.00 42.85 ? 1031 HOH B O   1 
HETATM 6879 O O   . HOH F 3 .   ? -10.474 70.328  31.884 1.00 48.05 ? 1032 HOH B O   1 
HETATM 6880 O O   . HOH F 3 .   ? 8.515   75.994  25.491 1.00 44.75 ? 1033 HOH B O   1 
HETATM 6881 O O   . HOH F 3 .   ? -0.909  74.438  34.232 1.00 43.99 ? 1034 HOH B O   1 
HETATM 6882 O O   . HOH F 3 .   ? -12.620 62.558  24.865 1.00 35.58 ? 1035 HOH B O   1 
HETATM 6883 O O   . HOH F 3 .   ? -9.461  72.589  6.720  1.00 38.33 ? 1036 HOH B O   1 
HETATM 6884 O O   . HOH F 3 .   ? -8.930  74.266  4.855  1.00 54.14 ? 1037 HOH B O   1 
HETATM 6885 O O   . HOH F 3 .   ? -7.178  65.033  5.231  1.00 49.57 ? 1038 HOH B O   1 
HETATM 6886 O O   . HOH F 3 .   ? -7.716  67.436  12.988 1.00 25.66 ? 1039 HOH B O   1 
HETATM 6887 O O   . HOH F 3 .   ? -4.659  76.346  10.673 1.00 39.91 ? 1040 HOH B O   1 
HETATM 6888 O O   . HOH F 3 .   ? -6.226  72.333  18.117 1.00 45.73 ? 1041 HOH B O   1 
HETATM 6889 O O   . HOH F 3 .   ? -7.544  74.603  9.762  1.00 33.69 ? 1042 HOH B O   1 
HETATM 6890 O O   . HOH F 3 .   ? 8.208   70.506  29.746 1.00 49.81 ? 1043 HOH B O   1 
HETATM 6891 O O   . HOH F 3 .   ? 7.564   75.573  18.942 1.00 47.82 ? 1044 HOH B O   1 
HETATM 6892 O O   . HOH F 3 .   ? 9.220   76.361  23.000 1.00 44.21 ? 1045 HOH B O   1 
HETATM 6893 O O   . HOH F 3 .   ? 6.932   71.961  23.776 1.00 38.04 ? 1046 HOH B O   1 
HETATM 6894 O O   . HOH F 3 .   ? 10.228  73.197  21.189 1.00 39.94 ? 1047 HOH B O   1 
HETATM 6895 O O   . HOH F 3 .   ? 6.895   75.072  27.298 1.00 64.63 ? 1048 HOH B O   1 
HETATM 6896 O O   . HOH F 3 .   ? -21.025 54.818  4.949  1.00 47.76 ? 1049 HOH B O   1 
HETATM 6897 O O   . HOH F 3 .   ? -25.847 58.089  2.397  1.00 47.81 ? 1050 HOH B O   1 
HETATM 6898 O O   . HOH F 3 .   ? -30.402 47.416  4.680  1.00 31.11 ? 1051 HOH B O   1 
HETATM 6899 O O   . HOH F 3 .   ? -25.976 59.735  13.494 1.00 49.94 ? 1052 HOH B O   1 
HETATM 6900 O O   . HOH F 3 .   ? -32.231 57.954  14.445 1.00 51.80 ? 1053 HOH B O   1 
HETATM 6901 O O   . HOH F 3 .   ? -30.511 57.427  10.850 1.00 46.77 ? 1054 HOH B O   1 
HETATM 6902 O O   . HOH F 3 .   ? -23.384 55.130  6.872  1.00 23.70 ? 1055 HOH B O   1 
HETATM 6903 O O   . HOH F 3 .   ? 7.421   47.725  5.483  1.00 50.84 ? 1056 HOH B O   1 
HETATM 6904 O O   . HOH F 3 .   ? 8.648   47.944  8.119  1.00 41.33 ? 1057 HOH B O   1 
HETATM 6905 O O   . HOH F 3 .   ? 12.787  50.603  5.843  1.00 54.17 ? 1058 HOH B O   1 
HETATM 6906 O O   . HOH F 3 .   ? 10.298  51.202  7.388  1.00 61.35 ? 1059 HOH B O   1 
HETATM 6907 O O   . HOH F 3 .   ? 10.601  53.699  7.706  1.00 38.06 ? 1060 HOH B O   1 
HETATM 6908 O O   . HOH F 3 .   ? 8.273   56.063  4.960  1.00 49.71 ? 1061 HOH B O   1 
HETATM 6909 O O   . HOH F 3 .   ? 7.742   50.188  5.273  1.00 54.30 ? 1062 HOH B O   1 
HETATM 6910 O O   . HOH F 3 .   ? 7.865   53.249  1.350  1.00 45.89 ? 1063 HOH B O   1 
HETATM 6911 O O   . HOH F 3 .   ? 4.035   43.227  -0.336 1.00 59.57 ? 1064 HOH B O   1 
HETATM 6912 O O   . HOH F 3 .   ? 0.201   42.110  3.818  1.00 48.70 ? 1065 HOH B O   1 
HETATM 6913 O O   . HOH F 3 .   ? -1.232  41.347  1.463  1.00 44.17 ? 1066 HOH B O   1 
HETATM 6914 O O   . HOH F 3 .   ? 1.038   45.682  1.352  1.00 51.46 ? 1067 HOH B O   1 
HETATM 6915 O O   . HOH F 3 .   ? -1.533  44.121  -0.210 1.00 40.52 ? 1068 HOH B O   1 
HETATM 6916 O O   . HOH F 3 .   ? 6.473   50.005  1.158  1.00 36.53 ? 1069 HOH B O   1 
HETATM 6917 O O   . HOH F 3 .   ? 6.650   61.626  4.507  1.00 42.37 ? 1070 HOH B O   1 
HETATM 6918 O O   . HOH F 3 .   ? 13.937  64.618  10.987 1.00 45.63 ? 1071 HOH B O   1 
HETATM 6919 O O   . HOH F 3 .   ? 14.260  66.881  12.346 1.00 40.94 ? 1072 HOH B O   1 
HETATM 6920 O O   . HOH F 3 .   ? 17.370  65.974  8.207  1.00 52.77 ? 1073 HOH B O   1 
HETATM 6921 O O   . HOH F 3 .   ? 20.133  66.095  8.296  1.00 44.91 ? 1074 HOH B O   1 
HETATM 6922 O O   . HOH F 3 .   ? 9.656   74.276  8.632  1.00 43.45 ? 1075 HOH B O   1 
HETATM 6923 O O   . HOH F 3 .   ? 11.101  76.115  10.651 1.00 48.82 ? 1076 HOH B O   1 
HETATM 6924 O O   . HOH F 3 .   ? 9.592   60.414  6.073  1.00 48.86 ? 1077 HOH B O   1 
HETATM 6925 O O   . HOH F 3 .   ? 12.275  60.450  11.891 1.00 34.37 ? 1078 HOH B O   1 
HETATM 6926 O O   . HOH F 3 .   ? 16.879  62.854  8.437  1.00 47.28 ? 1079 HOH B O   1 
HETATM 6927 O O   . HOH F 3 .   ? 12.653  58.285  10.661 1.00 55.27 ? 1080 HOH B O   1 
HETATM 6928 O O   . HOH F 3 .   ? 11.910  64.160  8.804  1.00 41.31 ? 1081 HOH B O   1 
HETATM 6929 O O   . HOH F 3 .   ? 13.938  61.858  16.715 1.00 33.23 ? 1082 HOH B O   1 
HETATM 6930 O O   . HOH F 3 .   ? 10.681  66.798  9.414  1.00 32.72 ? 1083 HOH B O   1 
HETATM 6931 O O   . HOH F 3 .   ? 3.484   76.660  -1.864 1.00 50.67 ? 1084 HOH B O   1 
HETATM 6932 O O   . HOH F 3 .   ? -1.722  68.479  3.357  1.00 70.45 ? 1085 HOH B O   1 
HETATM 6933 O O   . HOH F 3 .   ? -2.534  66.195  4.531  1.00 67.71 ? 1086 HOH B O   1 
HETATM 6934 O O   . HOH F 3 .   ? -2.022  68.002  0.152  1.00 58.13 ? 1087 HOH B O   1 
HETATM 6935 O O   . HOH F 3 .   ? 1.498   75.211  -3.665 1.00 56.28 ? 1088 HOH B O   1 
HETATM 6936 O O   . HOH F 3 .   ? 0.093   70.255  4.308  1.00 49.30 ? 1089 HOH B O   1 
HETATM 6937 O O   . HOH F 3 .   ? 9.453   71.039  27.605 1.00 51.66 ? 1090 HOH B O   1 
HETATM 6938 O O   . HOH F 3 .   ? -3.620  38.831  1.429  1.00 51.23 ? 1091 HOH B O   1 
HETATM 6939 O O   . HOH F 3 .   ? 1.739   37.866  9.657  1.00 46.94 ? 1092 HOH B O   1 
HETATM 6940 O O   . HOH F 3 .   ? -0.248  38.944  9.196  1.00 33.90 ? 1093 HOH B O   1 
HETATM 6941 O O   . HOH F 3 .   ? 9.592   56.229  7.392  1.00 38.06 ? 1094 HOH B O   1 
HETATM 6942 O O   . HOH F 3 .   ? 11.580  61.011  14.576 1.00 27.97 ? 1095 HOH B O   1 
HETATM 6943 O O   . HOH F 3 .   ? 17.372  46.880  15.173 1.00 49.64 ? 1096 HOH B O   1 
HETATM 6944 O O   . HOH F 3 .   ? 18.989  50.079  14.706 1.00 46.84 ? 1097 HOH B O   1 
HETATM 6945 O O   . HOH F 3 .   ? 21.558  51.942  15.483 1.00 39.77 ? 1098 HOH B O   1 
HETATM 6946 O O   . HOH F 3 .   ? 19.113  50.996  20.998 1.00 44.38 ? 1099 HOH B O   1 
HETATM 6947 O O   . HOH F 3 .   ? 24.728  39.316  25.258 1.00 47.17 ? 1100 HOH B O   1 
HETATM 6948 O O   . HOH F 3 .   ? 26.519  38.685  22.687 1.00 41.55 ? 1101 HOH B O   1 
HETATM 6949 O O   . HOH F 3 .   ? 17.396  43.970  20.861 1.00 43.90 ? 1102 HOH B O   1 
HETATM 6950 O O   . HOH F 3 .   ? 17.271  46.408  18.871 1.00 52.78 ? 1103 HOH B O   1 
HETATM 6951 O O   . HOH F 3 .   ? 17.848  45.836  23.432 1.00 51.96 ? 1104 HOH B O   1 
HETATM 6952 O O   . HOH F 3 .   ? 22.978  53.124  42.486 1.00 38.76 ? 1105 HOH B O   1 
HETATM 6953 O O   . HOH F 3 .   ? -11.045 24.895  3.704  1.00 48.32 ? 1106 HOH B O   1 
HETATM 6954 O O   . HOH F 3 .   ? -11.020 29.041  7.740  1.00 28.23 ? 1107 HOH B O   1 
HETATM 6955 O O   . HOH F 3 .   ? -8.862  34.672  -0.926 1.00 48.77 ? 1108 HOH B O   1 
HETATM 6956 O O   . HOH F 3 .   ? -6.686  39.715  -1.270 1.00 48.20 ? 1109 HOH B O   1 
HETATM 6957 O O   . HOH F 3 .   ? -4.243  43.276  -7.364 1.00 52.96 ? 1110 HOH B O   1 
HETATM 6958 O O   . HOH F 3 .   ? -5.427  43.889  -2.966 1.00 45.81 ? 1111 HOH B O   1 
HETATM 6959 O O   . HOH F 3 .   ? -6.686  42.424  -1.185 1.00 41.32 ? 1112 HOH B O   1 
HETATM 6960 O O   . HOH F 3 .   ? -8.591  34.543  -4.155 1.00 53.19 ? 1113 HOH B O   1 
HETATM 6961 O O   . HOH F 3 .   ? -4.410  40.918  -5.769 1.00 47.26 ? 1114 HOH B O   1 
HETATM 6962 O O   . HOH F 3 .   ? -36.234 38.345  8.684  1.00 58.57 ? 1115 HOH B O   1 
HETATM 6963 O O   . HOH F 3 .   ? -9.336  37.027  0.194  1.00 45.04 ? 1116 HOH B O   1 
HETATM 6964 O O   . HOH F 3 .   ? -26.397 38.668  -1.326 1.00 52.04 ? 1117 HOH B O   1 
HETATM 6965 O O   . HOH F 3 .   ? -27.617 37.287  3.881  1.00 45.42 ? 1118 HOH B O   1 
HETATM 6966 O O   . HOH F 3 .   ? -10.557 39.121  -3.583 1.00 50.90 ? 1119 HOH B O   1 
HETATM 6967 O O   . HOH F 3 .   ? -21.970 39.227  -0.090 1.00 43.07 ? 1120 HOH B O   1 
HETATM 6968 O O   . HOH F 3 .   ? -25.488 53.654  3.067  1.00 50.44 ? 1121 HOH B O   1 
HETATM 6969 O O   . HOH F 3 .   ? -38.232 46.776  14.316 1.00 52.01 ? 1122 HOH B O   1 
HETATM 6970 O O   . HOH F 3 .   ? -34.871 59.601  14.724 1.00 58.94 ? 1123 HOH B O   1 
HETATM 6971 O O   . HOH F 3 .   ? -31.649 53.444  9.211  1.00 46.30 ? 1124 HOH B O   1 
HETATM 6972 O O   . HOH F 3 .   ? -33.574 53.803  15.812 1.00 40.03 ? 1125 HOH B O   1 
HETATM 6973 O O   . HOH F 3 .   ? -31.457 56.900  21.920 1.00 44.58 ? 1126 HOH B O   1 
HETATM 6974 O O   . HOH F 3 .   ? -36.737 48.900  19.487 1.00 45.51 ? 1127 HOH B O   1 
HETATM 6975 O O   . HOH F 3 .   ? -35.192 35.126  12.746 1.00 49.78 ? 1128 HOH B O   1 
HETATM 6976 O O   . HOH F 3 .   ? -34.453 35.327  16.607 1.00 72.82 ? 1129 HOH B O   1 
HETATM 6977 O O   . HOH F 3 .   ? -30.945 33.078  12.987 1.00 28.66 ? 1130 HOH B O   1 
HETATM 6978 O O   . HOH F 3 .   ? -21.844 26.565  9.273  1.00 43.41 ? 1131 HOH B O   1 
HETATM 6979 O O   . HOH F 3 .   ? -19.991 19.701  12.789 1.00 58.81 ? 1132 HOH B O   1 
HETATM 6980 O O   . HOH F 3 .   ? -20.139 23.180  9.228  1.00 56.17 ? 1133 HOH B O   1 
HETATM 6981 O O   . HOH F 3 .   ? 15.151  58.683  28.901 1.00 22.71 ? 1134 HOH B O   1 
HETATM 6982 O O   . HOH F 3 .   ? 24.383  37.184  45.627 1.00 23.05 ? 1135 HOH B O   1 
HETATM 6983 O O   . HOH F 3 .   ? 21.470  23.135  27.958 1.00 44.48 ? 1136 HOH B O   1 
HETATM 6984 O O   . HOH F 3 .   ? 23.953  22.900  35.212 1.00 43.17 ? 1137 HOH B O   1 
HETATM 6985 O O   . HOH F 3 .   ? -31.341 36.684  25.338 1.00 54.83 ? 1138 HOH B O   1 
HETATM 6986 O O   . HOH F 3 .   ? 31.172  41.274  50.499 1.00 30.04 ? 1139 HOH B O   1 
HETATM 6987 O O   . HOH F 3 .   ? -13.073 53.939  6.385  1.00 33.17 ? 1140 HOH B O   1 
HETATM 6988 O O   . HOH F 3 .   ? -10.458 68.273  35.883 1.00 42.14 ? 1141 HOH B O   1 
HETATM 6989 O O   . HOH F 3 .   ? 16.961  56.905  27.952 1.00 24.34 ? 1142 HOH B O   1 
HETATM 6990 O O   . HOH F 3 .   ? -11.828 36.612  -4.422 1.00 52.14 ? 1143 HOH B O   1 
HETATM 6991 O O   . HOH F 3 .   ? 15.968  59.492  19.388 1.00 32.62 ? 1144 HOH B O   1 
HETATM 6992 O O   . HOH F 3 .   ? -28.688 33.205  22.244 1.00 45.75 ? 1145 HOH B O   1 
HETATM 6993 O O   . HOH F 3 .   ? -4.535  69.800  3.109  1.00 39.12 ? 1146 HOH B O   1 
HETATM 6994 O O   . HOH F 3 .   ? -27.978 50.984  -1.418 1.00 61.55 ? 1147 HOH B O   1 
HETATM 6995 O O   . HOH F 3 .   ? 16.536  46.359  27.905 1.00 45.93 ? 1148 HOH B O   1 
HETATM 6996 O O   . HOH F 3 .   ? 3.713   44.758  2.320  1.00 52.61 ? 1149 HOH B O   1 
HETATM 6997 O O   . HOH F 3 .   ? -22.308 49.551  -0.030 1.00 56.19 ? 1150 HOH B O   1 
HETATM 6998 O O   . HOH F 3 .   ? -28.211 53.475  23.452 1.00 48.28 ? 1151 HOH B O   1 
HETATM 6999 O O   . HOH F 3 .   ? -8.426  64.570  7.856  1.00 43.49 ? 1152 HOH B O   1 
HETATM 7000 O O   . HOH F 3 .   ? -31.174 53.503  17.458 1.00 58.63 ? 1153 HOH B O   1 
HETATM 7001 O O   . HOH F 3 .   ? -22.927 33.434  1.520  1.00 59.36 ? 1154 HOH B O   1 
HETATM 7002 O O   . HOH F 3 .   ? 11.855  72.584  10.397 1.00 37.23 ? 1155 HOH B O   1 
HETATM 7003 O O   . HOH F 3 .   ? -17.475 52.227  22.761 1.00 45.76 ? 1156 HOH B O   1 
HETATM 7004 O O   . HOH F 3 .   ? -5.835  70.766  7.364  1.00 58.50 ? 1157 HOH B O   1 
HETATM 7005 O O   . HOH F 3 .   ? 25.740  50.153  44.715 1.00 43.43 ? 1158 HOH B O   1 
HETATM 7006 O O   . HOH F 3 .   ? 2.284   74.933  14.398 1.00 51.90 ? 1159 HOH B O   1 
HETATM 7007 O O   . HOH F 3 .   ? -2.770  32.921  5.491  1.00 64.33 ? 1160 HOH B O   1 
HETATM 7008 O O   . HOH F 3 .   ? 22.156  40.436  31.166 1.00 58.98 ? 1161 HOH B O   1 
HETATM 7009 O O   . HOH F 3 .   ? 21.892  25.393  32.642 1.00 39.76 ? 1162 HOH B O   1 
HETATM 7010 O O   . HOH F 3 .   ? -29.256 57.250  21.749 1.00 41.44 ? 1163 HOH B O   1 
HETATM 7011 O O   . HOH F 3 .   ? 12.471  68.315  10.667 1.00 43.12 ? 1164 HOH B O   1 
HETATM 7012 O O   . HOH F 3 .   ? -14.971 50.424  24.650 1.00 43.55 ? 1165 HOH B O   1 
HETATM 7013 O O   . HOH F 3 .   ? 8.352   74.440  21.475 1.00 43.95 ? 1166 HOH B O   1 
HETATM 7014 O O   . HOH F 3 .   ? 14.634  46.343  35.735 1.00 56.86 ? 1167 HOH B O   1 
HETATM 7015 O O   . HOH F 3 .   ? 20.987  60.741  32.337 1.00 52.26 ? 1168 HOH B O   1 
HETATM 7016 O O   . HOH F 3 .   ? 4.245   74.642  41.120 1.00 45.42 ? 1169 HOH B O   1 
HETATM 7017 O O   . HOH F 3 .   ? 2.227   39.810  4.878  1.00 58.49 ? 1170 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   ?   ?   ?   A . n 
A 1 22  ALA 22  2   ?   ?   ?   A . n 
A 1 23  ASP 23  3   ?   ?   ?   A . n 
A 1 24  LYS 24  4   ?   ?   ?   A . n 
A 1 25  LYS 25  5   5   LYS LYS A . n 
A 1 26  LEU 26  6   6   LEU LEU A . n 
A 1 27  ASP 27  7   7   ASP ASP A . n 
A 1 28  THR 28  8   8   THR THR A . n 
A 1 29  GLN 29  9   9   GLN GLN A . n 
A 1 30  LEU 30  10  10  LEU LEU A . n 
A 1 31  VAL 31  11  11  VAL VAL A . n 
A 1 32  ASN 32  12  12  ASN ASN A . n 
A 1 33  ALA 33  13  13  ALA ALA A . n 
A 1 34  GLY 34  14  14  GLY GLY A . n 
A 1 35  ARG 35  15  15  ARG ARG A . n 
A 1 36  SER 36  16  16  SER SER A . n 
A 1 37  LYS 37  17  17  LYS LYS A . n 
A 1 38  LYS 38  18  18  LYS LYS A . n 
A 1 39  TYR 39  19  19  TYR TYR A . n 
A 1 40  THR 40  20  20  THR THR A . n 
A 1 41  LEU 41  21  21  LEU LEU A . n 
A 1 42  GLY 42  22  22  GLY GLY A . n 
A 1 43  ALA 43  23  23  ALA ALA A . n 
A 1 44  VAL 44  24  24  VAL VAL A . n 
A 1 45  ASN 45  25  25  ASN ASN A . n 
A 1 46  SER 46  26  26  SER SER A . n 
A 1 47  VAL 47  27  27  VAL VAL A . n 
A 1 48  ILE 48  28  28  ILE ILE A . n 
A 1 49  GLN 49  29  29  GLN GLN A . n 
A 1 50  ARG 50  30  30  ARG ARG A . n 
A 1 51  ALA 51  31  31  ALA ALA A . n 
A 1 52  SER 52  32  32  SER SER A . n 
A 1 53  SER 53  33  33  SER SER A . n 
A 1 54  LEU 54  34  34  LEU LEU A . n 
A 1 55  VAL 55  35  35  VAL VAL A . n 
A 1 56  PHE 56  36  36  PHE PHE A . n 
A 1 57  ASP 57  37  37  ASP ASP A . n 
A 1 58  SER 58  38  38  SER SER A . n 
A 1 59  VAL 59  39  39  VAL VAL A . n 
A 1 60  GLU 60  40  40  GLU GLU A . n 
A 1 61  ALA 61  41  41  ALA ALA A . n 
A 1 62  LYS 62  42  42  LYS LYS A . n 
A 1 63  LYS 63  43  43  LYS LYS A . n 
A 1 64  HIS 64  44  44  HIS HIS A . n 
A 1 65  ALA 65  45  45  ALA ALA A . n 
A 1 66  THR 66  46  46  THR THR A . n 
A 1 67  ARG 67  47  47  ARG ARG A . n 
A 1 68  ASN 68  48  48  ASN ASN A . n 
A 1 69  ARG 69  49  49  ARG ARG A . n 
A 1 70  ALA 70  50  50  ALA ALA A . n 
A 1 71  ASN 71  51  51  ASN ASN A . n 
A 1 72  GLY 72  52  52  GLY GLY A . n 
A 1 73  GLU 73  53  53  GLU GLU A . n 
A 1 74  LEU 74  54  54  LEU LEU A . n 
A 1 75  PHE 75  55  55  PHE PHE A . n 
A 1 76  TYR 76  56  56  TYR TYR A . n 
A 1 77  GLY 77  57  57  GLY GLY A . n 
A 1 78  ARG 78  58  58  ARG ARG A . n 
A 1 79  ARG 79  59  59  ARG ARG A . n 
A 1 80  GLY 80  60  60  GLY GLY A . n 
A 1 81  THR 81  61  61  THR THR A . n 
A 1 82  LEU 82  62  62  LEU LEU A . n 
A 1 83  THR 83  63  63  THR THR A . n 
A 1 84  HIS 84  64  64  HIS HIS A . n 
A 1 85  PHE 85  65  65  PHE PHE A . n 
A 1 86  SER 86  66  66  SER SER A . n 
A 1 87  LEU 87  67  67  LEU LEU A . n 
A 1 88  GLN 88  68  68  GLN GLN A . n 
A 1 89  GLN 89  69  69  GLN GLN A . n 
A 1 90  ALA 90  70  70  ALA ALA A . n 
A 1 91  MET 91  71  71  MET MET A . n 
A 1 92  CYS 92  72  72  CYS CYS A . n 
A 1 93  GLU 93  73  73  GLU GLU A . n 
A 1 94  LEU 94  74  74  LEU LEU A . n 
A 1 95  GLU 95  75  75  GLU GLU A . n 
A 1 96  GLY 96  76  76  GLY GLY A . n 
A 1 97  GLY 97  77  77  GLY GLY A . n 
A 1 98  ALA 98  78  78  ALA ALA A . n 
A 1 99  GLY 99  79  79  GLY GLY A . n 
A 1 100 CYS 100 80  80  CYS CYS A . n 
A 1 101 VAL 101 81  81  VAL VAL A . n 
A 1 102 LEU 102 82  82  LEU LEU A . n 
A 1 103 PHE 103 83  83  PHE PHE A . n 
A 1 104 PRO 104 84  84  PRO PRO A . n 
A 1 105 CYS 105 85  85  CYS CYS A . n 
A 1 106 GLY 106 86  86  GLY GLY A . n 
A 1 107 ALA 107 87  87  ALA ALA A . n 
A 1 108 ALA 108 88  88  ALA ALA A . n 
A 1 109 ALA 109 89  89  ALA ALA A . n 
A 1 110 VAL 110 90  90  VAL VAL A . n 
A 1 111 ALA 111 91  91  ALA ALA A . n 
A 1 112 ASN 112 92  92  ASN ASN A . n 
A 1 113 SER 113 93  93  SER SER A . n 
A 1 114 ILE 114 94  94  ILE ILE A . n 
A 1 115 LEU 115 95  95  LEU LEU A . n 
A 1 116 ALA 116 96  96  ALA ALA A . n 
A 1 117 PHE 117 97  97  PHE PHE A . n 
A 1 118 ILE 118 98  98  ILE ILE A . n 
A 1 119 GLU 119 99  99  GLU GLU A . n 
A 1 120 GLN 120 100 100 GLN GLN A . n 
A 1 121 GLY 121 101 101 GLY GLY A . n 
A 1 122 ASP 122 102 102 ASP ASP A . n 
A 1 123 HIS 123 103 103 HIS HIS A . n 
A 1 124 VAL 124 104 104 VAL VAL A . n 
A 1 125 LEU 125 105 105 LEU LEU A . n 
A 1 126 MET 126 106 106 MET MET A . n 
A 1 127 THR 127 107 107 THR THR A . n 
A 1 128 ASN 128 108 108 ASN ASN A . n 
A 1 129 THR 129 109 109 THR THR A . n 
A 1 130 ALA 130 110 110 ALA ALA A . n 
A 1 131 TYR 131 111 111 TYR TYR A . n 
A 1 132 GLU 132 112 112 GLU GLU A . n 
A 1 133 PRO 133 113 113 PRO PRO A . n 
A 1 134 SER 134 114 114 SER SER A . n 
A 1 135 GLN 135 115 115 GLN GLN A . n 
A 1 136 ASP 136 116 116 ASP ASP A . n 
A 1 137 PHE 137 117 117 PHE PHE A . n 
A 1 138 CYS 138 118 118 CYS CYS A . n 
A 1 139 SER 139 119 119 SER SER A . n 
A 1 140 LYS 140 120 120 LYS LYS A . n 
A 1 141 ILE 141 121 121 ILE ILE A . n 
A 1 142 LEU 142 122 122 LEU LEU A . n 
A 1 143 SER 143 123 123 SER SER A . n 
A 1 144 LYS 144 124 124 LYS LYS A . n 
A 1 145 LEU 145 125 125 LEU LEU A . n 
A 1 146 GLY 146 126 126 GLY GLY A . n 
A 1 147 VAL 147 127 127 VAL VAL A . n 
A 1 148 THR 148 128 128 THR THR A . n 
A 1 149 THR 149 129 129 THR THR A . n 
A 1 150 SER 150 130 130 SER SER A . n 
A 1 151 TRP 151 131 131 TRP TRP A . n 
A 1 152 PHE 152 132 132 PHE PHE A . n 
A 1 153 ASP 153 133 133 ASP ASP A . n 
A 1 154 PRO 154 134 134 PRO PRO A . n 
A 1 155 LEU 155 135 135 LEU LEU A . n 
A 1 156 ILE 156 136 136 ILE ILE A . n 
A 1 157 GLY 157 137 137 GLY GLY A . n 
A 1 158 ALA 158 138 138 ALA ALA A . n 
A 1 159 ASP 159 139 139 ASP ASP A . n 
A 1 160 ILE 160 140 140 ILE ILE A . n 
A 1 161 VAL 161 141 141 VAL VAL A . n 
A 1 162 LYS 162 142 142 LYS LYS A . n 
A 1 163 HIS 163 143 143 HIS HIS A . n 
A 1 164 LEU 164 144 144 LEU LEU A . n 
A 1 165 GLN 165 145 145 GLN GLN A . n 
A 1 166 PRO 166 146 146 PRO PRO A . n 
A 1 167 ASN 167 147 147 ASN ASN A . n 
A 1 168 THR 168 148 148 THR THR A . n 
A 1 169 LYS 169 149 149 LYS LYS A . n 
A 1 170 ILE 170 150 150 ILE ILE A . n 
A 1 171 VAL 171 151 151 VAL VAL A . n 
A 1 172 PHE 172 152 152 PHE PHE A . n 
A 1 173 LEU 173 153 153 LEU LEU A . n 
A 1 174 GLU 174 154 154 GLU GLU A . n 
A 1 175 SER 175 155 155 SER SER A . n 
A 1 176 PRO 176 156 156 PRO PRO A . n 
A 1 177 GLY 177 157 157 GLY GLY A . n 
A 1 178 SER 178 158 158 SER SER A . n 
A 1 179 ILE 179 159 159 ILE ILE A . n 
A 1 180 THR 180 160 160 THR THR A . n 
A 1 181 MET 181 161 161 MET MET A . n 
A 1 182 GLU 182 162 162 GLU GLU A . n 
A 1 183 VAL 183 163 163 VAL VAL A . n 
A 1 184 HIS 184 164 164 HIS HIS A . n 
A 1 185 ASP 185 165 165 ASP ASP A . n 
A 1 186 VAL 186 166 166 VAL VAL A . n 
A 1 187 PRO 187 167 167 PRO PRO A . n 
A 1 188 ALA 188 168 168 ALA ALA A . n 
A 1 189 ILE 189 169 169 ILE ILE A . n 
A 1 190 VAL 190 170 170 VAL VAL A . n 
A 1 191 ALA 191 171 171 ALA ALA A . n 
A 1 192 ALA 192 172 172 ALA ALA A . n 
A 1 193 VAL 193 173 173 VAL VAL A . n 
A 1 194 ARG 194 174 174 ARG ARG A . n 
A 1 195 SER 195 175 175 SER SER A . n 
A 1 196 VAL 196 176 176 VAL VAL A . n 
A 1 197 VAL 197 177 177 VAL VAL A . n 
A 1 198 PRO 198 178 178 PRO PRO A . n 
A 1 199 ASP 199 179 179 ASP ASP A . n 
A 1 200 ALA 200 180 180 ALA ALA A . n 
A 1 201 ILE 201 181 181 ILE ILE A . n 
A 1 202 ILE 202 182 182 ILE ILE A . n 
A 1 203 MET 203 183 183 MET MET A . n 
A 1 204 ILE 204 184 184 ILE ILE A . n 
A 1 205 ASP 205 185 185 ASP ASP A . n 
A 1 206 ASN 206 186 186 ASN ASN A . n 
A 1 207 THR 207 187 187 THR THR A . n 
A 1 208 TRP 208 188 188 TRP TRP A . n 
A 1 209 ALA 209 189 189 ALA ALA A . n 
A 1 210 ALA 210 190 190 ALA ALA A . n 
A 1 211 GLY 211 191 191 GLY GLY A . n 
A 1 212 VAL 212 192 192 VAL VAL A . n 
A 1 213 LEU 213 193 193 LEU LEU A . n 
A 1 214 PHE 214 194 194 PHE PHE A . n 
A 1 215 LYS 215 195 195 LYS LYS A . n 
A 1 216 ALA 216 196 196 ALA ALA A . n 
A 1 217 LEU 217 197 197 LEU LEU A . n 
A 1 218 ASP 218 198 198 ASP ASP A . n 
A 1 219 PHE 219 199 199 PHE PHE A . n 
A 1 220 GLY 220 200 200 GLY GLY A . n 
A 1 221 ILE 221 201 201 ILE ILE A . n 
A 1 222 ASP 222 202 202 ASP ASP A . n 
A 1 223 VAL 223 203 203 VAL VAL A . n 
A 1 224 SER 224 204 204 SER SER A . n 
A 1 225 ILE 225 205 205 ILE ILE A . n 
A 1 226 GLN 226 206 206 GLN GLN A . n 
A 1 227 ALA 227 207 207 ALA ALA A . n 
A 1 228 ALA 228 208 208 ALA ALA A . n 
A 1 229 THR 229 209 209 THR THR A . n 
A 1 230 LYS 230 210 210 LYS LYS A . n 
A 1 231 TYR 231 211 211 TYR TYR A . n 
A 1 232 LEU 232 212 212 LEU LEU A . n 
A 1 233 VAL 233 213 213 VAL VAL A . n 
A 1 234 GLY 234 214 214 GLY GLY A . n 
A 1 235 HIS 235 215 215 HIS HIS A . n 
A 1 236 SER 236 216 216 SER SER A . n 
A 1 237 ASP 237 217 217 ASP ASP A . n 
A 1 238 ALA 238 218 218 ALA ALA A . n 
A 1 239 MET 239 219 219 MET MET A . n 
A 1 240 ILE 240 220 220 ILE ILE A . n 
A 1 241 GLY 241 221 221 GLY GLY A . n 
A 1 242 THR 242 222 222 THR THR A . n 
A 1 243 ALA 243 223 223 ALA ALA A . n 
A 1 244 VAL 244 224 224 VAL VAL A . n 
A 1 245 CYS 245 225 225 CYS CYS A . n 
A 1 246 ASN 246 226 226 ASN ASN A . n 
A 1 247 ALA 247 227 227 ALA ALA A . n 
A 1 248 ARG 248 228 228 ARG ARG A . n 
A 1 249 CYS 249 229 229 CYS CYS A . n 
A 1 250 TRP 250 230 230 TRP TRP A . n 
A 1 251 GLU 251 231 231 GLU GLU A . n 
A 1 252 GLN 252 232 232 GLN GLN A . n 
A 1 253 LEU 253 233 233 LEU LEU A . n 
A 1 254 ARG 254 234 234 ARG ARG A . n 
A 1 255 GLU 255 235 235 GLU GLU A . n 
A 1 256 ASN 256 236 236 ASN ASN A . n 
A 1 257 ALA 257 237 237 ALA ALA A . n 
A 1 258 TYR 258 238 238 TYR TYR A . n 
A 1 259 LEU 259 239 239 LEU LEU A . n 
A 1 260 MET 260 240 240 MET MET A . n 
A 1 261 GLY 261 241 241 GLY GLY A . n 
A 1 262 GLN 262 242 242 GLN GLN A . n 
A 1 263 MET 263 243 243 MET MET A . n 
A 1 264 VAL 264 244 244 VAL VAL A . n 
A 1 265 ASP 265 245 245 ASP ASP A . n 
A 1 266 ALA 266 246 246 ALA ALA A . n 
A 1 267 ASP 267 247 247 ASP ASP A . n 
A 1 268 THR 268 248 248 THR THR A . n 
A 1 269 ALA 269 249 249 ALA ALA A . n 
A 1 270 TYR 270 250 250 TYR TYR A . n 
A 1 271 ILE 271 251 251 ILE ILE A . n 
A 1 272 THR 272 252 252 THR THR A . n 
A 1 273 SER 273 253 253 SER SER A . n 
A 1 274 ARG 274 254 254 ARG ARG A . n 
A 1 275 GLY 275 255 255 GLY GLY A . n 
A 1 276 LEU 276 256 256 LEU LEU A . n 
A 1 277 ARG 277 257 257 ARG ARG A . n 
A 1 278 THR 278 258 258 THR THR A . n 
A 1 279 LEU 279 259 259 LEU LEU A . n 
A 1 280 GLY 280 260 260 GLY GLY A . n 
A 1 281 VAL 281 261 261 VAL VAL A . n 
A 1 282 ARG 282 262 262 ARG ARG A . n 
A 1 283 LEU 283 263 263 LEU LEU A . n 
A 1 284 ARG 284 264 264 ARG ARG A . n 
A 1 285 GLN 285 265 265 GLN GLN A . n 
A 1 286 HIS 286 266 266 HIS HIS A . n 
A 1 287 HIS 287 267 267 HIS HIS A . n 
A 1 288 GLU 288 268 268 GLU GLU A . n 
A 1 289 SER 289 269 269 SER SER A . n 
A 1 290 SER 290 270 270 SER SER A . n 
A 1 291 LEU 291 271 271 LEU LEU A . n 
A 1 292 LYS 292 272 272 LYS LYS A . n 
A 1 293 VAL 293 273 273 VAL VAL A . n 
A 1 294 ALA 294 274 274 ALA ALA A . n 
A 1 295 GLU 295 275 275 GLU GLU A . n 
A 1 296 TRP 296 276 276 TRP TRP A . n 
A 1 297 LEU 297 277 277 LEU LEU A . n 
A 1 298 ALA 298 278 278 ALA ALA A . n 
A 1 299 GLU 299 279 279 GLU GLU A . n 
A 1 300 HIS 300 280 280 HIS HIS A . n 
A 1 301 PRO 301 281 281 PRO PRO A . n 
A 1 302 GLN 302 282 282 GLN GLN A . n 
A 1 303 VAL 303 283 283 VAL VAL A . n 
A 1 304 ALA 304 284 284 ALA ALA A . n 
A 1 305 ARG 305 285 285 ARG ARG A . n 
A 1 306 VAL 306 286 286 VAL VAL A . n 
A 1 307 ASN 307 287 287 ASN ASN A . n 
A 1 308 HIS 308 288 288 HIS HIS A . n 
A 1 309 PRO 309 289 289 PRO PRO A . n 
A 1 310 ALA 310 290 290 ALA ALA A . n 
A 1 311 LEU 311 291 291 LEU LEU A . n 
A 1 312 PRO 312 292 292 PRO PRO A . n 
A 1 313 GLY 313 293 293 GLY GLY A . n 
A 1 314 SER 314 294 294 SER SER A . n 
A 1 315 LYS 315 295 295 LYS LYS A . n 
A 1 316 GLY 316 296 296 GLY GLY A . n 
A 1 317 HIS 317 297 297 HIS HIS A . n 
A 1 318 GLU 318 298 298 GLU GLU A . n 
A 1 319 PHE 319 299 299 PHE PHE A . n 
A 1 320 TRP 320 300 300 TRP TRP A . n 
A 1 321 LYS 321 301 301 LYS LYS A . n 
A 1 322 ARG 322 302 302 ARG ARG A . n 
A 1 323 ASP 323 303 303 ASP ASP A . n 
A 1 324 PHE 324 304 304 PHE PHE A . n 
A 1 325 THR 325 305 305 THR THR A . n 
A 1 326 GLY 326 306 306 GLY GLY A . n 
A 1 327 SER 327 307 307 SER SER A . n 
A 1 328 SER 328 308 308 SER SER A . n 
A 1 329 GLY 329 309 309 GLY GLY A . n 
A 1 330 LEU 330 310 310 LEU LEU A . n 
A 1 331 PHE 331 311 311 PHE PHE A . n 
A 1 332 SER 332 312 312 SER SER A . n 
A 1 333 PHE 333 313 313 PHE PHE A . n 
A 1 334 VAL 334 314 314 VAL VAL A . n 
A 1 335 LEU 335 315 315 LEU LEU A . n 
A 1 336 LYS 336 316 316 LYS LYS A . n 
A 1 337 LYS 337 317 317 LYS LYS A . n 
A 1 338 LYS 338 318 318 LYS LYS A . n 
A 1 339 LEU 339 319 319 LEU LEU A . n 
A 1 340 ASN 340 320 320 ASN ASN A . n 
A 1 341 ASN 341 321 321 ASN ASN A . n 
A 1 342 GLU 342 322 322 GLU GLU A . n 
A 1 343 GLU 343 323 323 GLU GLU A . n 
A 1 344 LEU 344 324 324 LEU LEU A . n 
A 1 345 ALA 345 325 325 ALA ALA A . n 
A 1 346 ASN 346 326 326 ASN ASN A . n 
A 1 347 TYR 347 327 327 TYR TYR A . n 
A 1 348 LEU 348 328 328 LEU LEU A . n 
A 1 349 ASP 349 329 329 ASP ASP A . n 
A 1 350 ASN 350 330 330 ASN ASN A . n 
A 1 351 PHE 351 331 331 PHE PHE A . n 
A 1 352 SER 352 332 332 SER SER A . n 
A 1 353 LEU 353 333 333 LEU LEU A . n 
A 1 354 PHE 354 334 334 PHE PHE A . n 
A 1 355 SER 355 335 335 SER SER A . n 
A 1 356 MET 356 336 336 MET MET A . n 
A 1 357 ALA 357 337 337 ALA ALA A . n 
A 1 358 TYR 358 338 338 TYR TYR A . n 
A 1 359 SER 359 339 339 SER SER A . n 
A 1 360 TRP 360 340 340 TRP TRP A . n 
A 1 361 GLY 361 341 341 GLY GLY A . n 
A 1 362 GLY 362 342 342 GLY GLY A . n 
A 1 363 TYR 363 343 343 TYR TYR A . n 
A 1 364 GLU 364 344 344 GLU GLU A . n 
A 1 365 SER 365 345 345 SER SER A . n 
A 1 366 LEU 366 346 346 LEU LEU A . n 
A 1 367 ILE 367 347 347 ILE ILE A . n 
A 1 368 LEU 368 348 348 LEU LEU A . n 
A 1 369 ALA 369 349 349 ALA ALA A . n 
A 1 370 ASN 370 350 350 ASN ASN A . n 
A 1 371 GLN 371 351 351 GLN GLN A . n 
A 1 372 PRO 372 352 352 PRO PRO A . n 
A 1 373 GLU 373 353 353 GLU GLU A . n 
A 1 374 HIS 374 354 354 HIS HIS A . n 
A 1 375 ILE 375 355 355 ILE ILE A . n 
A 1 376 ALA 376 356 356 ALA ALA A . n 
A 1 377 ALA 377 357 357 ALA ALA A . n 
A 1 378 ILE 378 358 358 ILE ILE A . n 
A 1 379 ARG 379 359 359 ARG ARG A . n 
A 1 380 PRO 380 360 360 PRO PRO A . n 
A 1 381 GLN 381 361 361 GLN GLN A . n 
A 1 382 GLY 382 362 362 GLY GLY A . n 
A 1 383 GLU 383 363 363 GLU GLU A . n 
A 1 384 ILE 384 364 364 ILE ILE A . n 
A 1 385 ASP 385 365 365 ASP ASP A . n 
A 1 386 PHE 386 366 366 PHE PHE A . n 
A 1 387 SER 387 367 367 SER SER A . n 
A 1 388 GLY 388 368 368 GLY GLY A . n 
A 1 389 THR 389 369 369 THR THR A . n 
A 1 390 LEU 390 370 370 LEU LEU A . n 
A 1 391 ILE 391 371 371 ILE ILE A . n 
A 1 392 ARG 392 372 372 ARG ARG A . n 
A 1 393 LEU 393 373 373 LEU LEU A . n 
A 1 394 HIS 394 374 374 HIS HIS A . n 
A 1 395 ILE 395 375 375 ILE ILE A . n 
A 1 396 GLY 396 376 376 GLY GLY A . n 
A 1 397 LEU 397 377 377 LEU LEU A . n 
A 1 398 GLU 398 378 378 GLU GLU A . n 
A 1 399 ASP 399 379 379 ASP ASP A . n 
A 1 400 VAL 400 380 380 VAL VAL A . n 
A 1 401 ASP 401 381 381 ASP ASP A . n 
A 1 402 ASP 402 382 382 ASP ASP A . n 
A 1 403 LEU 403 383 383 LEU LEU A . n 
A 1 404 ILE 404 384 384 ILE ILE A . n 
A 1 405 ALA 405 385 385 ALA ALA A . n 
A 1 406 ASP 406 386 386 ASP ASP A . n 
A 1 407 LEU 407 387 387 LEU LEU A . n 
A 1 408 ASP 408 388 388 ASP ASP A . n 
A 1 409 ALA 409 389 389 ALA ALA A . n 
A 1 410 GLY 410 390 390 GLY GLY A . n 
A 1 411 PHE 411 391 391 PHE PHE A . n 
A 1 412 ALA 412 392 392 ALA ALA A . n 
A 1 413 ARG 413 393 393 ARG ARG A . n 
A 1 414 ILE 414 394 394 ILE ILE A . n 
A 1 415 VAL 415 395 395 VAL VAL A . n 
B 1 1   MET 1   -19 ?   ?   ?   B . n 
B 1 2   GLY 2   -18 ?   ?   ?   B . n 
B 1 3   SER 3   -17 ?   ?   ?   B . n 
B 1 4   SER 4   -16 ?   ?   ?   B . n 
B 1 5   HIS 5   -15 ?   ?   ?   B . n 
B 1 6   HIS 6   -14 ?   ?   ?   B . n 
B 1 7   HIS 7   -13 ?   ?   ?   B . n 
B 1 8   HIS 8   -12 ?   ?   ?   B . n 
B 1 9   HIS 9   -11 ?   ?   ?   B . n 
B 1 10  HIS 10  -10 ?   ?   ?   B . n 
B 1 11  SER 11  -9  ?   ?   ?   B . n 
B 1 12  SER 12  -8  ?   ?   ?   B . n 
B 1 13  GLY 13  -7  ?   ?   ?   B . n 
B 1 14  LEU 14  -6  ?   ?   ?   B . n 
B 1 15  VAL 15  -5  ?   ?   ?   B . n 
B 1 16  PRO 16  -4  ?   ?   ?   B . n 
B 1 17  ARG 17  -3  ?   ?   ?   B . n 
B 1 18  GLY 18  -2  ?   ?   ?   B . n 
B 1 19  SER 19  -1  ?   ?   ?   B . n 
B 1 20  HIS 20  0   ?   ?   ?   B . n 
B 1 21  MET 21  1   ?   ?   ?   B . n 
B 1 22  ALA 22  2   ?   ?   ?   B . n 
B 1 23  ASP 23  3   ?   ?   ?   B . n 
B 1 24  LYS 24  4   4   LYS LYS B . n 
B 1 25  LYS 25  5   5   LYS LYS B . n 
B 1 26  LEU 26  6   6   LEU LEU B . n 
B 1 27  ASP 27  7   7   ASP ASP B . n 
B 1 28  THR 28  8   8   THR THR B . n 
B 1 29  GLN 29  9   9   GLN GLN B . n 
B 1 30  LEU 30  10  10  LEU LEU B . n 
B 1 31  VAL 31  11  11  VAL VAL B . n 
B 1 32  ASN 32  12  12  ASN ASN B . n 
B 1 33  ALA 33  13  13  ALA ALA B . n 
B 1 34  GLY 34  14  14  GLY GLY B . n 
B 1 35  ARG 35  15  15  ARG ARG B . n 
B 1 36  SER 36  16  16  SER SER B . n 
B 1 37  LYS 37  17  17  LYS LYS B . n 
B 1 38  LYS 38  18  18  LYS LYS B . n 
B 1 39  TYR 39  19  19  TYR TYR B . n 
B 1 40  THR 40  20  20  THR THR B . n 
B 1 41  LEU 41  21  21  LEU LEU B . n 
B 1 42  GLY 42  22  22  GLY GLY B . n 
B 1 43  ALA 43  23  23  ALA ALA B . n 
B 1 44  VAL 44  24  24  VAL VAL B . n 
B 1 45  ASN 45  25  25  ASN ASN B . n 
B 1 46  SER 46  26  26  SER SER B . n 
B 1 47  VAL 47  27  27  VAL VAL B . n 
B 1 48  ILE 48  28  28  ILE ILE B . n 
B 1 49  GLN 49  29  29  GLN GLN B . n 
B 1 50  ARG 50  30  30  ARG ARG B . n 
B 1 51  ALA 51  31  31  ALA ALA B . n 
B 1 52  SER 52  32  32  SER SER B . n 
B 1 53  SER 53  33  33  SER SER B . n 
B 1 54  LEU 54  34  34  LEU LEU B . n 
B 1 55  VAL 55  35  35  VAL VAL B . n 
B 1 56  PHE 56  36  36  PHE PHE B . n 
B 1 57  ASP 57  37  37  ASP ASP B . n 
B 1 58  SER 58  38  38  SER SER B . n 
B 1 59  VAL 59  39  39  VAL VAL B . n 
B 1 60  GLU 60  40  40  GLU GLU B . n 
B 1 61  ALA 61  41  41  ALA ALA B . n 
B 1 62  LYS 62  42  42  LYS LYS B . n 
B 1 63  LYS 63  43  43  LYS LYS B . n 
B 1 64  HIS 64  44  44  HIS HIS B . n 
B 1 65  ALA 65  45  45  ALA ALA B . n 
B 1 66  THR 66  46  46  THR THR B . n 
B 1 67  ARG 67  47  47  ARG ARG B . n 
B 1 68  ASN 68  48  48  ASN ASN B . n 
B 1 69  ARG 69  49  49  ARG ARG B . n 
B 1 70  ALA 70  50  50  ALA ALA B . n 
B 1 71  ASN 71  51  51  ASN ASN B . n 
B 1 72  GLY 72  52  52  GLY GLY B . n 
B 1 73  GLU 73  53  53  GLU GLU B . n 
B 1 74  LEU 74  54  54  LEU LEU B . n 
B 1 75  PHE 75  55  55  PHE PHE B . n 
B 1 76  TYR 76  56  56  TYR TYR B . n 
B 1 77  GLY 77  57  57  GLY GLY B . n 
B 1 78  ARG 78  58  58  ARG ARG B . n 
B 1 79  ARG 79  59  59  ARG ARG B . n 
B 1 80  GLY 80  60  60  GLY GLY B . n 
B 1 81  THR 81  61  61  THR THR B . n 
B 1 82  LEU 82  62  62  LEU LEU B . n 
B 1 83  THR 83  63  63  THR THR B . n 
B 1 84  HIS 84  64  64  HIS HIS B . n 
B 1 85  PHE 85  65  65  PHE PHE B . n 
B 1 86  SER 86  66  66  SER SER B . n 
B 1 87  LEU 87  67  67  LEU LEU B . n 
B 1 88  GLN 88  68  68  GLN GLN B . n 
B 1 89  GLN 89  69  69  GLN GLN B . n 
B 1 90  ALA 90  70  70  ALA ALA B . n 
B 1 91  MET 91  71  71  MET MET B . n 
B 1 92  CYS 92  72  72  CYS CYS B . n 
B 1 93  GLU 93  73  73  GLU GLU B . n 
B 1 94  LEU 94  74  74  LEU LEU B . n 
B 1 95  GLU 95  75  75  GLU GLU B . n 
B 1 96  GLY 96  76  76  GLY GLY B . n 
B 1 97  GLY 97  77  77  GLY GLY B . n 
B 1 98  ALA 98  78  78  ALA ALA B . n 
B 1 99  GLY 99  79  79  GLY GLY B . n 
B 1 100 CYS 100 80  80  CYS CYS B . n 
B 1 101 VAL 101 81  81  VAL VAL B . n 
B 1 102 LEU 102 82  82  LEU LEU B . n 
B 1 103 PHE 103 83  83  PHE PHE B . n 
B 1 104 PRO 104 84  84  PRO PRO B . n 
B 1 105 CYS 105 85  85  CYS CYS B . n 
B 1 106 GLY 106 86  86  GLY GLY B . n 
B 1 107 ALA 107 87  87  ALA ALA B . n 
B 1 108 ALA 108 88  88  ALA ALA B . n 
B 1 109 ALA 109 89  89  ALA ALA B . n 
B 1 110 VAL 110 90  90  VAL VAL B . n 
B 1 111 ALA 111 91  91  ALA ALA B . n 
B 1 112 ASN 112 92  92  ASN ASN B . n 
B 1 113 SER 113 93  93  SER SER B . n 
B 1 114 ILE 114 94  94  ILE ILE B . n 
B 1 115 LEU 115 95  95  LEU LEU B . n 
B 1 116 ALA 116 96  96  ALA ALA B . n 
B 1 117 PHE 117 97  97  PHE PHE B . n 
B 1 118 ILE 118 98  98  ILE ILE B . n 
B 1 119 GLU 119 99  99  GLU GLU B . n 
B 1 120 GLN 120 100 100 GLN GLN B . n 
B 1 121 GLY 121 101 101 GLY GLY B . n 
B 1 122 ASP 122 102 102 ASP ASP B . n 
B 1 123 HIS 123 103 103 HIS HIS B . n 
B 1 124 VAL 124 104 104 VAL VAL B . n 
B 1 125 LEU 125 105 105 LEU LEU B . n 
B 1 126 MET 126 106 106 MET MET B . n 
B 1 127 THR 127 107 107 THR THR B . n 
B 1 128 ASN 128 108 108 ASN ASN B . n 
B 1 129 THR 129 109 109 THR THR B . n 
B 1 130 ALA 130 110 110 ALA ALA B . n 
B 1 131 TYR 131 111 111 TYR TYR B . n 
B 1 132 GLU 132 112 112 GLU GLU B . n 
B 1 133 PRO 133 113 113 PRO PRO B . n 
B 1 134 SER 134 114 114 SER SER B . n 
B 1 135 GLN 135 115 115 GLN GLN B . n 
B 1 136 ASP 136 116 116 ASP ASP B . n 
B 1 137 PHE 137 117 117 PHE PHE B . n 
B 1 138 CYS 138 118 118 CYS CYS B . n 
B 1 139 SER 139 119 119 SER SER B . n 
B 1 140 LYS 140 120 120 LYS LYS B . n 
B 1 141 ILE 141 121 121 ILE ILE B . n 
B 1 142 LEU 142 122 122 LEU LEU B . n 
B 1 143 SER 143 123 123 SER SER B . n 
B 1 144 LYS 144 124 124 LYS LYS B . n 
B 1 145 LEU 145 125 125 LEU LEU B . n 
B 1 146 GLY 146 126 126 GLY GLY B . n 
B 1 147 VAL 147 127 127 VAL VAL B . n 
B 1 148 THR 148 128 128 THR THR B . n 
B 1 149 THR 149 129 129 THR THR B . n 
B 1 150 SER 150 130 130 SER SER B . n 
B 1 151 TRP 151 131 131 TRP TRP B . n 
B 1 152 PHE 152 132 132 PHE PHE B . n 
B 1 153 ASP 153 133 133 ASP ASP B . n 
B 1 154 PRO 154 134 134 PRO PRO B . n 
B 1 155 LEU 155 135 135 LEU LEU B . n 
B 1 156 ILE 156 136 136 ILE ILE B . n 
B 1 157 GLY 157 137 137 GLY GLY B . n 
B 1 158 ALA 158 138 138 ALA ALA B . n 
B 1 159 ASP 159 139 139 ASP ASP B . n 
B 1 160 ILE 160 140 140 ILE ILE B . n 
B 1 161 VAL 161 141 141 VAL VAL B . n 
B 1 162 LYS 162 142 142 LYS LYS B . n 
B 1 163 HIS 163 143 143 HIS HIS B . n 
B 1 164 LEU 164 144 144 LEU LEU B . n 
B 1 165 GLN 165 145 145 GLN GLN B . n 
B 1 166 PRO 166 146 146 PRO PRO B . n 
B 1 167 ASN 167 147 147 ASN ASN B . n 
B 1 168 THR 168 148 148 THR THR B . n 
B 1 169 LYS 169 149 149 LYS LYS B . n 
B 1 170 ILE 170 150 150 ILE ILE B . n 
B 1 171 VAL 171 151 151 VAL VAL B . n 
B 1 172 PHE 172 152 152 PHE PHE B . n 
B 1 173 LEU 173 153 153 LEU LEU B . n 
B 1 174 GLU 174 154 154 GLU GLU B . n 
B 1 175 SER 175 155 155 SER SER B . n 
B 1 176 PRO 176 156 156 PRO PRO B . n 
B 1 177 GLY 177 157 157 GLY GLY B . n 
B 1 178 SER 178 158 158 SER SER B . n 
B 1 179 ILE 179 159 159 ILE ILE B . n 
B 1 180 THR 180 160 160 THR THR B . n 
B 1 181 MET 181 161 161 MET MET B . n 
B 1 182 GLU 182 162 162 GLU GLU B . n 
B 1 183 VAL 183 163 163 VAL VAL B . n 
B 1 184 HIS 184 164 164 HIS HIS B . n 
B 1 185 ASP 185 165 165 ASP ASP B . n 
B 1 186 VAL 186 166 166 VAL VAL B . n 
B 1 187 PRO 187 167 167 PRO PRO B . n 
B 1 188 ALA 188 168 168 ALA ALA B . n 
B 1 189 ILE 189 169 169 ILE ILE B . n 
B 1 190 VAL 190 170 170 VAL VAL B . n 
B 1 191 ALA 191 171 171 ALA ALA B . n 
B 1 192 ALA 192 172 172 ALA ALA B . n 
B 1 193 VAL 193 173 173 VAL VAL B . n 
B 1 194 ARG 194 174 174 ARG ARG B . n 
B 1 195 SER 195 175 175 SER SER B . n 
B 1 196 VAL 196 176 176 VAL VAL B . n 
B 1 197 VAL 197 177 177 VAL VAL B . n 
B 1 198 PRO 198 178 178 PRO PRO B . n 
B 1 199 ASP 199 179 179 ASP ASP B . n 
B 1 200 ALA 200 180 180 ALA ALA B . n 
B 1 201 ILE 201 181 181 ILE ILE B . n 
B 1 202 ILE 202 182 182 ILE ILE B . n 
B 1 203 MET 203 183 183 MET MET B . n 
B 1 204 ILE 204 184 184 ILE ILE B . n 
B 1 205 ASP 205 185 185 ASP ASP B . n 
B 1 206 ASN 206 186 186 ASN ASN B . n 
B 1 207 THR 207 187 187 THR THR B . n 
B 1 208 TRP 208 188 188 TRP TRP B . n 
B 1 209 ALA 209 189 189 ALA ALA B . n 
B 1 210 ALA 210 190 190 ALA ALA B . n 
B 1 211 GLY 211 191 191 GLY GLY B . n 
B 1 212 VAL 212 192 192 VAL VAL B . n 
B 1 213 LEU 213 193 193 LEU LEU B . n 
B 1 214 PHE 214 194 194 PHE PHE B . n 
B 1 215 LYS 215 195 195 LYS LYS B . n 
B 1 216 ALA 216 196 196 ALA ALA B . n 
B 1 217 LEU 217 197 197 LEU LEU B . n 
B 1 218 ASP 218 198 198 ASP ASP B . n 
B 1 219 PHE 219 199 199 PHE PHE B . n 
B 1 220 GLY 220 200 200 GLY GLY B . n 
B 1 221 ILE 221 201 201 ILE ILE B . n 
B 1 222 ASP 222 202 202 ASP ASP B . n 
B 1 223 VAL 223 203 203 VAL VAL B . n 
B 1 224 SER 224 204 204 SER SER B . n 
B 1 225 ILE 225 205 205 ILE ILE B . n 
B 1 226 GLN 226 206 206 GLN GLN B . n 
B 1 227 ALA 227 207 207 ALA ALA B . n 
B 1 228 ALA 228 208 208 ALA ALA B . n 
B 1 229 THR 229 209 209 THR THR B . n 
B 1 230 LYS 230 210 210 LYS LYS B . n 
B 1 231 TYR 231 211 211 TYR TYR B . n 
B 1 232 LEU 232 212 212 LEU LEU B . n 
B 1 233 VAL 233 213 213 VAL VAL B . n 
B 1 234 GLY 234 214 214 GLY GLY B . n 
B 1 235 HIS 235 215 215 HIS HIS B . n 
B 1 236 SER 236 216 216 SER SER B . n 
B 1 237 ASP 237 217 217 ASP ASP B . n 
B 1 238 ALA 238 218 218 ALA ALA B . n 
B 1 239 MET 239 219 219 MET MET B . n 
B 1 240 ILE 240 220 220 ILE ILE B . n 
B 1 241 GLY 241 221 221 GLY GLY B . n 
B 1 242 THR 242 222 222 THR THR B . n 
B 1 243 ALA 243 223 223 ALA ALA B . n 
B 1 244 VAL 244 224 224 VAL VAL B . n 
B 1 245 CYS 245 225 225 CYS CYS B . n 
B 1 246 ASN 246 226 226 ASN ASN B . n 
B 1 247 ALA 247 227 227 ALA ALA B . n 
B 1 248 ARG 248 228 228 ARG ARG B . n 
B 1 249 CYS 249 229 229 CYS CYS B . n 
B 1 250 TRP 250 230 230 TRP TRP B . n 
B 1 251 GLU 251 231 231 GLU GLU B . n 
B 1 252 GLN 252 232 232 GLN GLN B . n 
B 1 253 LEU 253 233 233 LEU LEU B . n 
B 1 254 ARG 254 234 234 ARG ARG B . n 
B 1 255 GLU 255 235 235 GLU GLU B . n 
B 1 256 ASN 256 236 236 ASN ASN B . n 
B 1 257 ALA 257 237 237 ALA ALA B . n 
B 1 258 TYR 258 238 238 TYR TYR B . n 
B 1 259 LEU 259 239 239 LEU LEU B . n 
B 1 260 MET 260 240 240 MET MET B . n 
B 1 261 GLY 261 241 241 GLY GLY B . n 
B 1 262 GLN 262 242 242 GLN GLN B . n 
B 1 263 MET 263 243 243 MET MET B . n 
B 1 264 VAL 264 244 244 VAL VAL B . n 
B 1 265 ASP 265 245 245 ASP ASP B . n 
B 1 266 ALA 266 246 246 ALA ALA B . n 
B 1 267 ASP 267 247 247 ASP ASP B . n 
B 1 268 THR 268 248 248 THR THR B . n 
B 1 269 ALA 269 249 249 ALA ALA B . n 
B 1 270 TYR 270 250 250 TYR TYR B . n 
B 1 271 ILE 271 251 251 ILE ILE B . n 
B 1 272 THR 272 252 252 THR THR B . n 
B 1 273 SER 273 253 253 SER SER B . n 
B 1 274 ARG 274 254 254 ARG ARG B . n 
B 1 275 GLY 275 255 255 GLY GLY B . n 
B 1 276 LEU 276 256 256 LEU LEU B . n 
B 1 277 ARG 277 257 257 ARG ARG B . n 
B 1 278 THR 278 258 258 THR THR B . n 
B 1 279 LEU 279 259 259 LEU LEU B . n 
B 1 280 GLY 280 260 260 GLY GLY B . n 
B 1 281 VAL 281 261 261 VAL VAL B . n 
B 1 282 ARG 282 262 262 ARG ARG B . n 
B 1 283 LEU 283 263 263 LEU LEU B . n 
B 1 284 ARG 284 264 264 ARG ARG B . n 
B 1 285 GLN 285 265 265 GLN GLN B . n 
B 1 286 HIS 286 266 266 HIS HIS B . n 
B 1 287 HIS 287 267 267 HIS HIS B . n 
B 1 288 GLU 288 268 268 GLU GLU B . n 
B 1 289 SER 289 269 269 SER SER B . n 
B 1 290 SER 290 270 270 SER SER B . n 
B 1 291 LEU 291 271 271 LEU LEU B . n 
B 1 292 LYS 292 272 272 LYS LYS B . n 
B 1 293 VAL 293 273 273 VAL VAL B . n 
B 1 294 ALA 294 274 274 ALA ALA B . n 
B 1 295 GLU 295 275 275 GLU GLU B . n 
B 1 296 TRP 296 276 276 TRP TRP B . n 
B 1 297 LEU 297 277 277 LEU LEU B . n 
B 1 298 ALA 298 278 278 ALA ALA B . n 
B 1 299 GLU 299 279 279 GLU GLU B . n 
B 1 300 HIS 300 280 280 HIS HIS B . n 
B 1 301 PRO 301 281 281 PRO PRO B . n 
B 1 302 GLN 302 282 282 GLN GLN B . n 
B 1 303 VAL 303 283 283 VAL VAL B . n 
B 1 304 ALA 304 284 284 ALA ALA B . n 
B 1 305 ARG 305 285 285 ARG ARG B . n 
B 1 306 VAL 306 286 286 VAL VAL B . n 
B 1 307 ASN 307 287 287 ASN ASN B . n 
B 1 308 HIS 308 288 288 HIS HIS B . n 
B 1 309 PRO 309 289 289 PRO PRO B . n 
B 1 310 ALA 310 290 290 ALA ALA B . n 
B 1 311 LEU 311 291 291 LEU LEU B . n 
B 1 312 PRO 312 292 292 PRO PRO B . n 
B 1 313 GLY 313 293 293 GLY GLY B . n 
B 1 314 SER 314 294 294 SER SER B . n 
B 1 315 LYS 315 295 295 LYS LYS B . n 
B 1 316 GLY 316 296 296 GLY GLY B . n 
B 1 317 HIS 317 297 297 HIS HIS B . n 
B 1 318 GLU 318 298 298 GLU GLU B . n 
B 1 319 PHE 319 299 299 PHE PHE B . n 
B 1 320 TRP 320 300 300 TRP TRP B . n 
B 1 321 LYS 321 301 301 LYS LYS B . n 
B 1 322 ARG 322 302 302 ARG ARG B . n 
B 1 323 ASP 323 303 303 ASP ASP B . n 
B 1 324 PHE 324 304 304 PHE PHE B . n 
B 1 325 THR 325 305 305 THR THR B . n 
B 1 326 GLY 326 306 306 GLY GLY B . n 
B 1 327 SER 327 307 307 SER SER B . n 
B 1 328 SER 328 308 308 SER SER B . n 
B 1 329 GLY 329 309 309 GLY GLY B . n 
B 1 330 LEU 330 310 310 LEU LEU B . n 
B 1 331 PHE 331 311 311 PHE PHE B . n 
B 1 332 SER 332 312 312 SER SER B . n 
B 1 333 PHE 333 313 313 PHE PHE B . n 
B 1 334 VAL 334 314 314 VAL VAL B . n 
B 1 335 LEU 335 315 315 LEU LEU B . n 
B 1 336 LYS 336 316 316 LYS LYS B . n 
B 1 337 LYS 337 317 317 LYS LYS B . n 
B 1 338 LYS 338 318 318 LYS LYS B . n 
B 1 339 LEU 339 319 319 LEU LEU B . n 
B 1 340 ASN 340 320 320 ASN ASN B . n 
B 1 341 ASN 341 321 321 ASN ASN B . n 
B 1 342 GLU 342 322 322 GLU GLU B . n 
B 1 343 GLU 343 323 323 GLU GLU B . n 
B 1 344 LEU 344 324 324 LEU LEU B . n 
B 1 345 ALA 345 325 325 ALA ALA B . n 
B 1 346 ASN 346 326 326 ASN ASN B . n 
B 1 347 TYR 347 327 327 TYR TYR B . n 
B 1 348 LEU 348 328 328 LEU LEU B . n 
B 1 349 ASP 349 329 329 ASP ASP B . n 
B 1 350 ASN 350 330 330 ASN ASN B . n 
B 1 351 PHE 351 331 331 PHE PHE B . n 
B 1 352 SER 352 332 332 SER SER B . n 
B 1 353 LEU 353 333 333 LEU LEU B . n 
B 1 354 PHE 354 334 334 PHE PHE B . n 
B 1 355 SER 355 335 335 SER SER B . n 
B 1 356 MET 356 336 336 MET MET B . n 
B 1 357 ALA 357 337 337 ALA ALA B . n 
B 1 358 TYR 358 338 338 TYR TYR B . n 
B 1 359 SER 359 339 339 SER SER B . n 
B 1 360 TRP 360 340 340 TRP TRP B . n 
B 1 361 GLY 361 341 341 GLY GLY B . n 
B 1 362 GLY 362 342 342 GLY GLY B . n 
B 1 363 TYR 363 343 343 TYR TYR B . n 
B 1 364 GLU 364 344 344 GLU GLU B . n 
B 1 365 SER 365 345 345 SER SER B . n 
B 1 366 LEU 366 346 346 LEU LEU B . n 
B 1 367 ILE 367 347 347 ILE ILE B . n 
B 1 368 LEU 368 348 348 LEU LEU B . n 
B 1 369 ALA 369 349 349 ALA ALA B . n 
B 1 370 ASN 370 350 350 ASN ASN B . n 
B 1 371 GLN 371 351 351 GLN GLN B . n 
B 1 372 PRO 372 352 352 PRO PRO B . n 
B 1 373 GLU 373 353 353 GLU GLU B . n 
B 1 374 HIS 374 354 354 HIS HIS B . n 
B 1 375 ILE 375 355 355 ILE ILE B . n 
B 1 376 ALA 376 356 356 ALA ALA B . n 
B 1 377 ALA 377 357 357 ALA ALA B . n 
B 1 378 ILE 378 358 358 ILE ILE B . n 
B 1 379 ARG 379 359 359 ARG ARG B . n 
B 1 380 PRO 380 360 360 PRO PRO B . n 
B 1 381 GLN 381 361 361 GLN GLN B . n 
B 1 382 GLY 382 362 362 GLY GLY B . n 
B 1 383 GLU 383 363 363 GLU GLU B . n 
B 1 384 ILE 384 364 364 ILE ILE B . n 
B 1 385 ASP 385 365 365 ASP ASP B . n 
B 1 386 PHE 386 366 366 PHE PHE B . n 
B 1 387 SER 387 367 367 SER SER B . n 
B 1 388 GLY 388 368 368 GLY GLY B . n 
B 1 389 THR 389 369 369 THR THR B . n 
B 1 390 LEU 390 370 370 LEU LEU B . n 
B 1 391 ILE 391 371 371 ILE ILE B . n 
B 1 392 ARG 392 372 372 ARG ARG B . n 
B 1 393 LEU 393 373 373 LEU LEU B . n 
B 1 394 HIS 394 374 374 HIS HIS B . n 
B 1 395 ILE 395 375 375 ILE ILE B . n 
B 1 396 GLY 396 376 376 GLY GLY B . n 
B 1 397 LEU 397 377 377 LEU LEU B . n 
B 1 398 GLU 398 378 378 GLU GLU B . n 
B 1 399 ASP 399 379 379 ASP ASP B . n 
B 1 400 VAL 400 380 380 VAL VAL B . n 
B 1 401 ASP 401 381 381 ASP ASP B . n 
B 1 402 ASP 402 382 382 ASP ASP B . n 
B 1 403 LEU 403 383 383 LEU LEU B . n 
B 1 404 ILE 404 384 384 ILE ILE B . n 
B 1 405 ALA 405 385 385 ALA ALA B . n 
B 1 406 ASP 406 386 386 ASP ASP B . n 
B 1 407 LEU 407 387 387 LEU LEU B . n 
B 1 408 ASP 408 388 388 ASP ASP B . n 
B 1 409 ALA 409 389 389 ALA ALA B . n 
B 1 410 GLY 410 390 390 GLY GLY B . n 
B 1 411 PHE 411 391 391 PHE PHE B . n 
B 1 412 ALA 412 392 392 ALA ALA B . n 
B 1 413 ARG 413 393 393 ARG ARG B . n 
B 1 414 ILE 414 394 394 ILE ILE B . n 
B 1 415 VAL 415 395 395 VAL VAL B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 P3F 1   700  700  P3F P3F A . 
D 2 P3F 1   700  700  P3F P3F B . 
E 3 HOH 1   701  4    HOH HOH A . 
E 3 HOH 2   702  5    HOH HOH A . 
E 3 HOH 3   703  7    HOH HOH A . 
E 3 HOH 4   704  9    HOH HOH A . 
E 3 HOH 5   705  10   HOH HOH A . 
E 3 HOH 6   706  12   HOH HOH A . 
E 3 HOH 7   707  13   HOH HOH A . 
E 3 HOH 8   708  16   HOH HOH A . 
E 3 HOH 9   709  17   HOH HOH A . 
E 3 HOH 10  710  20   HOH HOH A . 
E 3 HOH 11  711  22   HOH HOH A . 
E 3 HOH 12  712  23   HOH HOH A . 
E 3 HOH 13  713  24   HOH HOH A . 
E 3 HOH 14  714  25   HOH HOH A . 
E 3 HOH 15  715  26   HOH HOH A . 
E 3 HOH 16  716  28   HOH HOH A . 
E 3 HOH 17  717  29   HOH HOH A . 
E 3 HOH 18  718  30   HOH HOH A . 
E 3 HOH 19  719  32   HOH HOH A . 
E 3 HOH 20  720  36   HOH HOH A . 
E 3 HOH 21  721  43   HOH HOH A . 
E 3 HOH 22  722  44   HOH HOH A . 
E 3 HOH 23  723  45   HOH HOH A . 
E 3 HOH 24  724  49   HOH HOH A . 
E 3 HOH 25  725  53   HOH HOH A . 
E 3 HOH 26  726  54   HOH HOH A . 
E 3 HOH 27  727  57   HOH HOH A . 
E 3 HOH 28  728  59   HOH HOH A . 
E 3 HOH 29  729  61   HOH HOH A . 
E 3 HOH 30  730  62   HOH HOH A . 
E 3 HOH 31  731  63   HOH HOH A . 
E 3 HOH 32  732  66   HOH HOH A . 
E 3 HOH 33  733  67   HOH HOH A . 
E 3 HOH 34  734  68   HOH HOH A . 
E 3 HOH 35  735  76   HOH HOH A . 
E 3 HOH 36  736  79   HOH HOH A . 
E 3 HOH 37  737  80   HOH HOH A . 
E 3 HOH 38  738  81   HOH HOH A . 
E 3 HOH 39  739  82   HOH HOH A . 
E 3 HOH 40  740  83   HOH HOH A . 
E 3 HOH 41  741  84   HOH HOH A . 
E 3 HOH 42  742  87   HOH HOH A . 
E 3 HOH 43  743  88   HOH HOH A . 
E 3 HOH 44  744  89   HOH HOH A . 
E 3 HOH 45  745  92   HOH HOH A . 
E 3 HOH 46  746  98   HOH HOH A . 
E 3 HOH 47  747  100  HOH HOH A . 
E 3 HOH 48  748  102  HOH HOH A . 
E 3 HOH 49  749  104  HOH HOH A . 
E 3 HOH 50  750  105  HOH HOH A . 
E 3 HOH 51  751  106  HOH HOH A . 
E 3 HOH 52  752  107  HOH HOH A . 
E 3 HOH 53  753  108  HOH HOH A . 
E 3 HOH 54  754  110  HOH HOH A . 
E 3 HOH 55  755  111  HOH HOH A . 
E 3 HOH 56  756  112  HOH HOH A . 
E 3 HOH 57  757  118  HOH HOH A . 
E 3 HOH 58  758  120  HOH HOH A . 
E 3 HOH 59  759  122  HOH HOH A . 
E 3 HOH 60  760  123  HOH HOH A . 
E 3 HOH 61  761  126  HOH HOH A . 
E 3 HOH 62  762  131  HOH HOH A . 
E 3 HOH 63  763  133  HOH HOH A . 
E 3 HOH 64  764  134  HOH HOH A . 
E 3 HOH 65  765  135  HOH HOH A . 
E 3 HOH 66  766  137  HOH HOH A . 
E 3 HOH 67  767  138  HOH HOH A . 
E 3 HOH 68  768  139  HOH HOH A . 
E 3 HOH 69  769  141  HOH HOH A . 
E 3 HOH 70  770  144  HOH HOH A . 
E 3 HOH 71  771  146  HOH HOH A . 
E 3 HOH 72  772  150  HOH HOH A . 
E 3 HOH 73  773  152  HOH HOH A . 
E 3 HOH 74  774  158  HOH HOH A . 
E 3 HOH 75  775  160  HOH HOH A . 
E 3 HOH 76  776  164  HOH HOH A . 
E 3 HOH 77  777  167  HOH HOH A . 
E 3 HOH 78  778  169  HOH HOH A . 
E 3 HOH 79  779  170  HOH HOH A . 
E 3 HOH 80  780  171  HOH HOH A . 
E 3 HOH 81  781  173  HOH HOH A . 
E 3 HOH 82  782  176  HOH HOH A . 
E 3 HOH 83  783  185  HOH HOH A . 
E 3 HOH 84  784  186  HOH HOH A . 
E 3 HOH 85  785  187  HOH HOH A . 
E 3 HOH 86  786  189  HOH HOH A . 
E 3 HOH 87  787  190  HOH HOH A . 
E 3 HOH 88  788  192  HOH HOH A . 
E 3 HOH 89  789  195  HOH HOH A . 
E 3 HOH 90  790  196  HOH HOH A . 
E 3 HOH 91  791  197  HOH HOH A . 
E 3 HOH 92  792  198  HOH HOH A . 
E 3 HOH 93  793  199  HOH HOH A . 
E 3 HOH 94  794  200  HOH HOH A . 
E 3 HOH 95  795  201  HOH HOH A . 
E 3 HOH 96  796  202  HOH HOH A . 
E 3 HOH 97  797  203  HOH HOH A . 
E 3 HOH 98  798  207  HOH HOH A . 
E 3 HOH 99  799  208  HOH HOH A . 
E 3 HOH 100 800  212  HOH HOH A . 
E 3 HOH 101 801  215  HOH HOH A . 
E 3 HOH 102 802  218  HOH HOH A . 
E 3 HOH 103 803  220  HOH HOH A . 
E 3 HOH 104 804  222  HOH HOH A . 
E 3 HOH 105 805  224  HOH HOH A . 
E 3 HOH 106 806  227  HOH HOH A . 
E 3 HOH 107 807  230  HOH HOH A . 
E 3 HOH 108 808  233  HOH HOH A . 
E 3 HOH 109 809  237  HOH HOH A . 
E 3 HOH 110 810  239  HOH HOH A . 
E 3 HOH 111 811  241  HOH HOH A . 
E 3 HOH 112 812  243  HOH HOH A . 
E 3 HOH 113 813  244  HOH HOH A . 
E 3 HOH 114 814  247  HOH HOH A . 
E 3 HOH 115 815  251  HOH HOH A . 
E 3 HOH 116 816  253  HOH HOH A . 
E 3 HOH 117 817  257  HOH HOH A . 
E 3 HOH 118 818  258  HOH HOH A . 
E 3 HOH 119 819  259  HOH HOH A . 
E 3 HOH 120 820  261  HOH HOH A . 
E 3 HOH 121 821  265  HOH HOH A . 
E 3 HOH 122 822  268  HOH HOH A . 
E 3 HOH 123 823  271  HOH HOH A . 
E 3 HOH 124 824  272  HOH HOH A . 
E 3 HOH 125 825  273  HOH HOH A . 
E 3 HOH 126 826  275  HOH HOH A . 
E 3 HOH 127 827  277  HOH HOH A . 
E 3 HOH 128 828  279  HOH HOH A . 
E 3 HOH 129 829  284  HOH HOH A . 
E 3 HOH 130 830  288  HOH HOH A . 
E 3 HOH 131 831  289  HOH HOH A . 
E 3 HOH 132 832  292  HOH HOH A . 
E 3 HOH 133 833  293  HOH HOH A . 
E 3 HOH 134 834  300  HOH HOH A . 
E 3 HOH 135 835  302  HOH HOH A . 
E 3 HOH 136 836  303  HOH HOH A . 
E 3 HOH 137 837  305  HOH HOH A . 
E 3 HOH 138 838  306  HOH HOH A . 
E 3 HOH 139 839  307  HOH HOH A . 
E 3 HOH 140 840  311  HOH HOH A . 
E 3 HOH 141 841  312  HOH HOH A . 
E 3 HOH 142 842  313  HOH HOH A . 
E 3 HOH 143 843  315  HOH HOH A . 
E 3 HOH 144 844  316  HOH HOH A . 
E 3 HOH 145 845  317  HOH HOH A . 
E 3 HOH 146 846  318  HOH HOH A . 
E 3 HOH 147 847  319  HOH HOH A . 
E 3 HOH 148 848  321  HOH HOH A . 
E 3 HOH 149 849  326  HOH HOH A . 
E 3 HOH 150 850  332  HOH HOH A . 
E 3 HOH 151 851  339  HOH HOH A . 
E 3 HOH 152 852  340  HOH HOH A . 
E 3 HOH 153 853  344  HOH HOH A . 
E 3 HOH 154 854  347  HOH HOH A . 
E 3 HOH 155 855  349  HOH HOH A . 
E 3 HOH 156 856  354  HOH HOH A . 
E 3 HOH 157 857  356  HOH HOH A . 
E 3 HOH 158 858  357  HOH HOH A . 
E 3 HOH 159 859  359  HOH HOH A . 
E 3 HOH 160 860  360  HOH HOH A . 
E 3 HOH 161 861  361  HOH HOH A . 
E 3 HOH 162 862  365  HOH HOH A . 
E 3 HOH 163 863  366  HOH HOH A . 
E 3 HOH 164 864  367  HOH HOH A . 
E 3 HOH 165 865  369  HOH HOH A . 
E 3 HOH 166 866  373  HOH HOH A . 
E 3 HOH 167 867  374  HOH HOH A . 
E 3 HOH 168 868  375  HOH HOH A . 
E 3 HOH 169 869  376  HOH HOH A . 
E 3 HOH 170 870  377  HOH HOH A . 
E 3 HOH 171 871  378  HOH HOH A . 
E 3 HOH 172 872  379  HOH HOH A . 
E 3 HOH 173 873  381  HOH HOH A . 
E 3 HOH 174 874  382  HOH HOH A . 
E 3 HOH 175 875  383  HOH HOH A . 
E 3 HOH 176 876  385  HOH HOH A . 
E 3 HOH 177 877  386  HOH HOH A . 
E 3 HOH 178 878  388  HOH HOH A . 
E 3 HOH 179 879  395  HOH HOH A . 
E 3 HOH 180 880  397  HOH HOH A . 
E 3 HOH 181 881  402  HOH HOH A . 
E 3 HOH 182 882  403  HOH HOH A . 
E 3 HOH 183 883  404  HOH HOH A . 
E 3 HOH 184 884  405  HOH HOH A . 
E 3 HOH 185 885  407  HOH HOH A . 
E 3 HOH 186 886  409  HOH HOH A . 
E 3 HOH 187 887  411  HOH HOH A . 
E 3 HOH 188 888  417  HOH HOH A . 
E 3 HOH 189 889  419  HOH HOH A . 
E 3 HOH 190 890  421  HOH HOH A . 
E 3 HOH 191 891  422  HOH HOH A . 
E 3 HOH 192 892  424  HOH HOH A . 
E 3 HOH 193 893  426  HOH HOH A . 
E 3 HOH 194 894  428  HOH HOH A . 
E 3 HOH 195 895  433  HOH HOH A . 
E 3 HOH 196 896  435  HOH HOH A . 
E 3 HOH 197 897  441  HOH HOH A . 
E 3 HOH 198 898  445  HOH HOH A . 
E 3 HOH 199 899  448  HOH HOH A . 
E 3 HOH 200 900  449  HOH HOH A . 
E 3 HOH 201 901  452  HOH HOH A . 
E 3 HOH 202 902  454  HOH HOH A . 
E 3 HOH 203 903  457  HOH HOH A . 
E 3 HOH 204 904  458  HOH HOH A . 
E 3 HOH 205 905  462  HOH HOH A . 
E 3 HOH 206 906  463  HOH HOH A . 
E 3 HOH 207 907  468  HOH HOH A . 
E 3 HOH 208 908  476  HOH HOH A . 
E 3 HOH 209 909  478  HOH HOH A . 
E 3 HOH 210 910  479  HOH HOH A . 
E 3 HOH 211 911  480  HOH HOH A . 
E 3 HOH 212 912  481  HOH HOH A . 
E 3 HOH 213 913  482  HOH HOH A . 
E 3 HOH 214 914  483  HOH HOH A . 
E 3 HOH 215 915  484  HOH HOH A . 
E 3 HOH 216 916  486  HOH HOH A . 
E 3 HOH 217 917  489  HOH HOH A . 
E 3 HOH 218 918  492  HOH HOH A . 
E 3 HOH 219 919  494  HOH HOH A . 
E 3 HOH 220 920  497  HOH HOH A . 
E 3 HOH 221 921  500  HOH HOH A . 
E 3 HOH 222 922  501  HOH HOH A . 
E 3 HOH 223 923  504  HOH HOH A . 
E 3 HOH 224 924  509  HOH HOH A . 
E 3 HOH 225 925  510  HOH HOH A . 
E 3 HOH 226 926  511  HOH HOH A . 
E 3 HOH 227 927  512  HOH HOH A . 
E 3 HOH 228 928  513  HOH HOH A . 
E 3 HOH 229 929  514  HOH HOH A . 
E 3 HOH 230 930  515  HOH HOH A . 
E 3 HOH 231 931  516  HOH HOH A . 
E 3 HOH 232 932  520  HOH HOH A . 
E 3 HOH 233 933  523  HOH HOH A . 
E 3 HOH 234 934  528  HOH HOH A . 
E 3 HOH 235 935  529  HOH HOH A . 
E 3 HOH 236 936  530  HOH HOH A . 
E 3 HOH 237 937  532  HOH HOH A . 
E 3 HOH 238 938  533  HOH HOH A . 
E 3 HOH 239 939  540  HOH HOH A . 
E 3 HOH 240 940  542  HOH HOH A . 
E 3 HOH 241 941  544  HOH HOH A . 
E 3 HOH 242 942  546  HOH HOH A . 
E 3 HOH 243 943  547  HOH HOH A . 
E 3 HOH 244 944  548  HOH HOH A . 
E 3 HOH 245 945  550  HOH HOH A . 
E 3 HOH 246 946  560  HOH HOH A . 
E 3 HOH 247 947  561  HOH HOH A . 
E 3 HOH 248 948  562  HOH HOH A . 
E 3 HOH 249 949  566  HOH HOH A . 
E 3 HOH 250 950  567  HOH HOH A . 
E 3 HOH 251 951  570  HOH HOH A . 
E 3 HOH 252 952  571  HOH HOH A . 
E 3 HOH 253 953  572  HOH HOH A . 
E 3 HOH 254 954  573  HOH HOH A . 
E 3 HOH 255 955  577  HOH HOH A . 
E 3 HOH 256 956  578  HOH HOH A . 
E 3 HOH 257 957  586  HOH HOH A . 
E 3 HOH 258 958  595  HOH HOH A . 
E 3 HOH 259 959  598  HOH HOH A . 
E 3 HOH 260 960  604  HOH HOH A . 
E 3 HOH 261 961  608  HOH HOH A . 
E 3 HOH 262 962  612  HOH HOH A . 
E 3 HOH 263 963  614  HOH HOH A . 
E 3 HOH 264 964  617  HOH HOH A . 
E 3 HOH 265 965  619  HOH HOH A . 
E 3 HOH 266 966  628  HOH HOH A . 
E 3 HOH 267 967  631  HOH HOH A . 
E 3 HOH 268 968  637  HOH HOH A . 
E 3 HOH 269 969  647  HOH HOH A . 
E 3 HOH 270 970  650  HOH HOH A . 
E 3 HOH 271 971  658  HOH HOH A . 
E 3 HOH 272 972  663  HOH HOH A . 
E 3 HOH 273 973  669  HOH HOH A . 
E 3 HOH 274 974  670  HOH HOH A . 
E 3 HOH 275 975  674  HOH HOH A . 
E 3 HOH 276 976  675  HOH HOH A . 
E 3 HOH 277 977  679  HOH HOH A . 
E 3 HOH 278 978  682  HOH HOH A . 
E 3 HOH 279 979  683  HOH HOH A . 
E 3 HOH 280 980  687  HOH HOH A . 
E 3 HOH 281 981  702  HOH HOH A . 
E 3 HOH 282 982  703  HOH HOH A . 
E 3 HOH 283 983  704  HOH HOH A . 
E 3 HOH 284 984  705  HOH HOH A . 
E 3 HOH 285 985  706  HOH HOH A . 
E 3 HOH 286 986  707  HOH HOH A . 
E 3 HOH 287 987  708  HOH HOH A . 
E 3 HOH 288 988  709  HOH HOH A . 
E 3 HOH 289 989  710  HOH HOH A . 
E 3 HOH 290 990  711  HOH HOH A . 
E 3 HOH 291 991  712  HOH HOH A . 
E 3 HOH 292 992  714  HOH HOH A . 
E 3 HOH 293 993  717  HOH HOH A . 
E 3 HOH 294 994  718  HOH HOH A . 
E 3 HOH 295 995  719  HOH HOH A . 
E 3 HOH 296 996  722  HOH HOH A . 
E 3 HOH 297 997  723  HOH HOH A . 
E 3 HOH 298 998  724  HOH HOH A . 
E 3 HOH 299 999  725  HOH HOH A . 
E 3 HOH 300 1000 726  HOH HOH A . 
E 3 HOH 301 1001 727  HOH HOH A . 
E 3 HOH 302 1002 728  HOH HOH A . 
E 3 HOH 303 1003 729  HOH HOH A . 
E 3 HOH 304 1004 730  HOH HOH A . 
E 3 HOH 305 1005 731  HOH HOH A . 
E 3 HOH 306 1006 732  HOH HOH A . 
E 3 HOH 307 1007 733  HOH HOH A . 
E 3 HOH 308 1008 734  HOH HOH A . 
E 3 HOH 309 1009 736  HOH HOH A . 
E 3 HOH 310 1010 737  HOH HOH A . 
E 3 HOH 311 1011 738  HOH HOH A . 
E 3 HOH 312 1012 739  HOH HOH A . 
E 3 HOH 313 1013 740  HOH HOH A . 
E 3 HOH 314 1014 741  HOH HOH A . 
E 3 HOH 315 1015 742  HOH HOH A . 
E 3 HOH 316 1016 743  HOH HOH A . 
E 3 HOH 317 1017 744  HOH HOH A . 
E 3 HOH 318 1018 745  HOH HOH A . 
E 3 HOH 319 1019 746  HOH HOH A . 
E 3 HOH 320 1020 749  HOH HOH A . 
E 3 HOH 321 1021 750  HOH HOH A . 
E 3 HOH 322 1022 752  HOH HOH A . 
E 3 HOH 323 1023 753  HOH HOH A . 
E 3 HOH 324 1024 755  HOH HOH A . 
E 3 HOH 325 1025 756  HOH HOH A . 
E 3 HOH 326 1026 757  HOH HOH A . 
E 3 HOH 327 1027 758  HOH HOH A . 
E 3 HOH 328 1028 760  HOH HOH A . 
E 3 HOH 329 1029 761  HOH HOH A . 
E 3 HOH 330 1030 762  HOH HOH A . 
E 3 HOH 331 1031 763  HOH HOH A . 
E 3 HOH 332 1032 765  HOH HOH A . 
E 3 HOH 333 1033 766  HOH HOH A . 
E 3 HOH 334 1034 767  HOH HOH A . 
E 3 HOH 335 1035 768  HOH HOH A . 
E 3 HOH 336 1036 771  HOH HOH A . 
E 3 HOH 337 1037 772  HOH HOH A . 
E 3 HOH 338 1038 773  HOH HOH A . 
E 3 HOH 339 1039 774  HOH HOH A . 
E 3 HOH 340 1040 776  HOH HOH A . 
E 3 HOH 341 1041 777  HOH HOH A . 
E 3 HOH 342 1042 778  HOH HOH A . 
E 3 HOH 343 1043 779  HOH HOH A . 
E 3 HOH 344 1044 780  HOH HOH A . 
E 3 HOH 345 1045 781  HOH HOH A . 
E 3 HOH 346 1046 783  HOH HOH A . 
E 3 HOH 347 1047 784  HOH HOH A . 
E 3 HOH 348 1048 785  HOH HOH A . 
E 3 HOH 349 1049 788  HOH HOH A . 
E 3 HOH 350 1050 789  HOH HOH A . 
E 3 HOH 351 1051 790  HOH HOH A . 
E 3 HOH 352 1052 791  HOH HOH A . 
E 3 HOH 353 1053 793  HOH HOH A . 
E 3 HOH 354 1054 794  HOH HOH A . 
E 3 HOH 355 1055 795  HOH HOH A . 
E 3 HOH 356 1056 796  HOH HOH A . 
E 3 HOH 357 1057 798  HOH HOH A . 
E 3 HOH 358 1058 799  HOH HOH A . 
E 3 HOH 359 1059 800  HOH HOH A . 
E 3 HOH 360 1060 802  HOH HOH A . 
E 3 HOH 361 1061 804  HOH HOH A . 
E 3 HOH 362 1062 805  HOH HOH A . 
E 3 HOH 363 1063 806  HOH HOH A . 
E 3 HOH 364 1064 807  HOH HOH A . 
E 3 HOH 365 1065 808  HOH HOH A . 
E 3 HOH 366 1066 809  HOH HOH A . 
E 3 HOH 367 1067 811  HOH HOH A . 
E 3 HOH 368 1068 815  HOH HOH A . 
E 3 HOH 369 1069 816  HOH HOH A . 
E 3 HOH 370 1070 817  HOH HOH A . 
E 3 HOH 371 1071 818  HOH HOH A . 
E 3 HOH 372 1072 819  HOH HOH A . 
E 3 HOH 373 1073 820  HOH HOH A . 
E 3 HOH 374 1074 821  HOH HOH A . 
E 3 HOH 375 1075 823  HOH HOH A . 
E 3 HOH 376 1076 826  HOH HOH A . 
E 3 HOH 377 1077 827  HOH HOH A . 
E 3 HOH 378 1078 828  HOH HOH A . 
E 3 HOH 379 1079 829  HOH HOH A . 
E 3 HOH 380 1080 830  HOH HOH A . 
E 3 HOH 381 1081 841  HOH HOH A . 
E 3 HOH 382 1082 1048 HOH HOH A . 
E 3 HOH 383 1083 1051 HOH HOH A . 
E 3 HOH 384 1084 1068 HOH HOH A . 
E 3 HOH 385 1085 1070 HOH HOH A . 
E 3 HOH 386 1086 1072 HOH HOH A . 
E 3 HOH 387 1087 1073 HOH HOH A . 
E 3 HOH 388 1088 1075 HOH HOH A . 
E 3 HOH 389 1089 1076 HOH HOH A . 
E 3 HOH 390 1090 1078 HOH HOH A . 
E 3 HOH 391 1091 1079 HOH HOH A . 
E 3 HOH 392 1092 1080 HOH HOH A . 
E 3 HOH 393 1093 1082 HOH HOH A . 
E 3 HOH 394 1094 1083 HOH HOH A . 
E 3 HOH 395 1095 1084 HOH HOH A . 
E 3 HOH 396 1096 1085 HOH HOH A . 
E 3 HOH 397 1097 1086 HOH HOH A . 
E 3 HOH 398 1098 1087 HOH HOH A . 
E 3 HOH 399 1099 1090 HOH HOH A . 
E 3 HOH 400 1100 1091 HOH HOH A . 
E 3 HOH 401 1101 1093 HOH HOH A . 
E 3 HOH 402 1102 1096 HOH HOH A . 
E 3 HOH 403 1103 1097 HOH HOH A . 
E 3 HOH 404 1104 1098 HOH HOH A . 
E 3 HOH 405 1105 1099 HOH HOH A . 
E 3 HOH 406 1106 1101 HOH HOH A . 
E 3 HOH 407 1107 1103 HOH HOH A . 
E 3 HOH 408 1108 1106 HOH HOH A . 
E 3 HOH 409 1109 1107 HOH HOH A . 
E 3 HOH 410 1110 1108 HOH HOH A . 
E 3 HOH 411 1111 1112 HOH HOH A . 
E 3 HOH 412 1112 1115 HOH HOH A . 
E 3 HOH 413 1113 1117 HOH HOH A . 
E 3 HOH 414 1114 1120 HOH HOH A . 
E 3 HOH 415 1115 1124 HOH HOH A . 
E 3 HOH 416 1116 1126 HOH HOH A . 
E 3 HOH 417 1117 1127 HOH HOH A . 
E 3 HOH 418 1118 1128 HOH HOH A . 
E 3 HOH 419 1119 1129 HOH HOH A . 
E 3 HOH 420 1120 1134 HOH HOH A . 
E 3 HOH 421 1121 1135 HOH HOH A . 
E 3 HOH 422 1122 1136 HOH HOH A . 
E 3 HOH 423 1123 1139 HOH HOH A . 
E 3 HOH 424 1124 1140 HOH HOH A . 
E 3 HOH 425 1125 1141 HOH HOH A . 
E 3 HOH 426 1126 1142 HOH HOH A . 
E 3 HOH 427 1127 1143 HOH HOH A . 
E 3 HOH 428 1128 1145 HOH HOH A . 
E 3 HOH 429 1129 1146 HOH HOH A . 
E 3 HOH 430 1130 1147 HOH HOH A . 
E 3 HOH 431 1131 1149 HOH HOH A . 
E 3 HOH 432 1132 1150 HOH HOH A . 
E 3 HOH 433 1133 1151 HOH HOH A . 
E 3 HOH 434 1134 1152 HOH HOH A . 
E 3 HOH 435 1135 1156 HOH HOH A . 
E 3 HOH 436 1136 1157 HOH HOH A . 
E 3 HOH 437 1137 1160 HOH HOH A . 
E 3 HOH 438 1138 1161 HOH HOH A . 
E 3 HOH 439 1139 1163 HOH HOH A . 
E 3 HOH 440 1140 1167 HOH HOH A . 
E 3 HOH 441 1141 1169 HOH HOH A . 
E 3 HOH 442 1142 1173 HOH HOH A . 
E 3 HOH 443 1143 1174 HOH HOH A . 
E 3 HOH 444 1144 1175 HOH HOH A . 
E 3 HOH 445 1145 1181 HOH HOH A . 
E 3 HOH 446 1146 1184 HOH HOH A . 
E 3 HOH 447 1147 1185 HOH HOH A . 
E 3 HOH 448 1148 1190 HOH HOH A . 
F 3 HOH 1   701  1    HOH HOH B . 
F 3 HOH 2   702  2    HOH HOH B . 
F 3 HOH 3   703  3    HOH HOH B . 
F 3 HOH 4   704  6    HOH HOH B . 
F 3 HOH 5   705  8    HOH HOH B . 
F 3 HOH 6   706  11   HOH HOH B . 
F 3 HOH 7   707  14   HOH HOH B . 
F 3 HOH 8   708  18   HOH HOH B . 
F 3 HOH 9   709  19   HOH HOH B . 
F 3 HOH 10  710  21   HOH HOH B . 
F 3 HOH 11  711  27   HOH HOH B . 
F 3 HOH 12  712  31   HOH HOH B . 
F 3 HOH 13  713  33   HOH HOH B . 
F 3 HOH 14  714  35   HOH HOH B . 
F 3 HOH 15  715  37   HOH HOH B . 
F 3 HOH 16  716  38   HOH HOH B . 
F 3 HOH 17  717  39   HOH HOH B . 
F 3 HOH 18  718  40   HOH HOH B . 
F 3 HOH 19  719  41   HOH HOH B . 
F 3 HOH 20  720  47   HOH HOH B . 
F 3 HOH 21  721  48   HOH HOH B . 
F 3 HOH 22  722  50   HOH HOH B . 
F 3 HOH 23  723  51   HOH HOH B . 
F 3 HOH 24  724  52   HOH HOH B . 
F 3 HOH 25  725  55   HOH HOH B . 
F 3 HOH 26  726  56   HOH HOH B . 
F 3 HOH 27  727  58   HOH HOH B . 
F 3 HOH 28  728  60   HOH HOH B . 
F 3 HOH 29  729  64   HOH HOH B . 
F 3 HOH 30  730  65   HOH HOH B . 
F 3 HOH 31  731  69   HOH HOH B . 
F 3 HOH 32  732  70   HOH HOH B . 
F 3 HOH 33  733  71   HOH HOH B . 
F 3 HOH 34  734  72   HOH HOH B . 
F 3 HOH 35  735  74   HOH HOH B . 
F 3 HOH 36  736  75   HOH HOH B . 
F 3 HOH 37  737  77   HOH HOH B . 
F 3 HOH 38  738  78   HOH HOH B . 
F 3 HOH 39  739  85   HOH HOH B . 
F 3 HOH 40  740  86   HOH HOH B . 
F 3 HOH 41  741  90   HOH HOH B . 
F 3 HOH 42  742  91   HOH HOH B . 
F 3 HOH 43  743  93   HOH HOH B . 
F 3 HOH 44  744  94   HOH HOH B . 
F 3 HOH 45  745  95   HOH HOH B . 
F 3 HOH 46  746  96   HOH HOH B . 
F 3 HOH 47  747  97   HOH HOH B . 
F 3 HOH 48  748  99   HOH HOH B . 
F 3 HOH 49  749  101  HOH HOH B . 
F 3 HOH 50  750  103  HOH HOH B . 
F 3 HOH 51  751  113  HOH HOH B . 
F 3 HOH 52  752  114  HOH HOH B . 
F 3 HOH 53  753  115  HOH HOH B . 
F 3 HOH 54  754  116  HOH HOH B . 
F 3 HOH 55  755  117  HOH HOH B . 
F 3 HOH 56  756  119  HOH HOH B . 
F 3 HOH 57  757  121  HOH HOH B . 
F 3 HOH 58  758  124  HOH HOH B . 
F 3 HOH 59  759  125  HOH HOH B . 
F 3 HOH 60  760  127  HOH HOH B . 
F 3 HOH 61  761  128  HOH HOH B . 
F 3 HOH 62  762  130  HOH HOH B . 
F 3 HOH 63  763  132  HOH HOH B . 
F 3 HOH 64  764  136  HOH HOH B . 
F 3 HOH 65  765  140  HOH HOH B . 
F 3 HOH 66  766  142  HOH HOH B . 
F 3 HOH 67  767  143  HOH HOH B . 
F 3 HOH 68  768  145  HOH HOH B . 
F 3 HOH 69  769  147  HOH HOH B . 
F 3 HOH 70  770  148  HOH HOH B . 
F 3 HOH 71  771  151  HOH HOH B . 
F 3 HOH 72  772  153  HOH HOH B . 
F 3 HOH 73  773  155  HOH HOH B . 
F 3 HOH 74  774  156  HOH HOH B . 
F 3 HOH 75  775  157  HOH HOH B . 
F 3 HOH 76  776  161  HOH HOH B . 
F 3 HOH 77  777  162  HOH HOH B . 
F 3 HOH 78  778  163  HOH HOH B . 
F 3 HOH 79  779  165  HOH HOH B . 
F 3 HOH 80  780  166  HOH HOH B . 
F 3 HOH 81  781  168  HOH HOH B . 
F 3 HOH 82  782  172  HOH HOH B . 
F 3 HOH 83  783  174  HOH HOH B . 
F 3 HOH 84  784  175  HOH HOH B . 
F 3 HOH 85  785  177  HOH HOH B . 
F 3 HOH 86  786  178  HOH HOH B . 
F 3 HOH 87  787  180  HOH HOH B . 
F 3 HOH 88  788  181  HOH HOH B . 
F 3 HOH 89  789  182  HOH HOH B . 
F 3 HOH 90  790  183  HOH HOH B . 
F 3 HOH 91  791  184  HOH HOH B . 
F 3 HOH 92  792  191  HOH HOH B . 
F 3 HOH 93  793  193  HOH HOH B . 
F 3 HOH 94  794  204  HOH HOH B . 
F 3 HOH 95  795  206  HOH HOH B . 
F 3 HOH 96  796  209  HOH HOH B . 
F 3 HOH 97  797  210  HOH HOH B . 
F 3 HOH 98  798  211  HOH HOH B . 
F 3 HOH 99  799  213  HOH HOH B . 
F 3 HOH 100 800  214  HOH HOH B . 
F 3 HOH 101 801  216  HOH HOH B . 
F 3 HOH 102 802  219  HOH HOH B . 
F 3 HOH 103 803  221  HOH HOH B . 
F 3 HOH 104 804  223  HOH HOH B . 
F 3 HOH 105 805  225  HOH HOH B . 
F 3 HOH 106 806  226  HOH HOH B . 
F 3 HOH 107 807  228  HOH HOH B . 
F 3 HOH 108 808  229  HOH HOH B . 
F 3 HOH 109 809  232  HOH HOH B . 
F 3 HOH 110 810  234  HOH HOH B . 
F 3 HOH 111 811  235  HOH HOH B . 
F 3 HOH 112 812  236  HOH HOH B . 
F 3 HOH 113 813  238  HOH HOH B . 
F 3 HOH 114 814  240  HOH HOH B . 
F 3 HOH 115 815  242  HOH HOH B . 
F 3 HOH 116 816  245  HOH HOH B . 
F 3 HOH 117 817  246  HOH HOH B . 
F 3 HOH 118 818  249  HOH HOH B . 
F 3 HOH 119 819  250  HOH HOH B . 
F 3 HOH 120 820  254  HOH HOH B . 
F 3 HOH 121 821  255  HOH HOH B . 
F 3 HOH 122 822  256  HOH HOH B . 
F 3 HOH 123 823  263  HOH HOH B . 
F 3 HOH 124 824  264  HOH HOH B . 
F 3 HOH 125 825  266  HOH HOH B . 
F 3 HOH 126 826  267  HOH HOH B . 
F 3 HOH 127 827  270  HOH HOH B . 
F 3 HOH 128 828  274  HOH HOH B . 
F 3 HOH 129 829  276  HOH HOH B . 
F 3 HOH 130 830  278  HOH HOH B . 
F 3 HOH 131 831  280  HOH HOH B . 
F 3 HOH 132 832  281  HOH HOH B . 
F 3 HOH 133 833  282  HOH HOH B . 
F 3 HOH 134 834  283  HOH HOH B . 
F 3 HOH 135 835  285  HOH HOH B . 
F 3 HOH 136 836  286  HOH HOH B . 
F 3 HOH 137 837  287  HOH HOH B . 
F 3 HOH 138 838  290  HOH HOH B . 
F 3 HOH 139 839  291  HOH HOH B . 
F 3 HOH 140 840  299  HOH HOH B . 
F 3 HOH 141 841  301  HOH HOH B . 
F 3 HOH 142 842  304  HOH HOH B . 
F 3 HOH 143 843  308  HOH HOH B . 
F 3 HOH 144 844  310  HOH HOH B . 
F 3 HOH 145 845  314  HOH HOH B . 
F 3 HOH 146 846  320  HOH HOH B . 
F 3 HOH 147 847  322  HOH HOH B . 
F 3 HOH 148 848  324  HOH HOH B . 
F 3 HOH 149 849  325  HOH HOH B . 
F 3 HOH 150 850  327  HOH HOH B . 
F 3 HOH 151 851  328  HOH HOH B . 
F 3 HOH 152 852  330  HOH HOH B . 
F 3 HOH 153 853  331  HOH HOH B . 
F 3 HOH 154 854  333  HOH HOH B . 
F 3 HOH 155 855  334  HOH HOH B . 
F 3 HOH 156 856  336  HOH HOH B . 
F 3 HOH 157 857  337  HOH HOH B . 
F 3 HOH 158 858  338  HOH HOH B . 
F 3 HOH 159 859  341  HOH HOH B . 
F 3 HOH 160 860  342  HOH HOH B . 
F 3 HOH 161 861  343  HOH HOH B . 
F 3 HOH 162 862  345  HOH HOH B . 
F 3 HOH 163 863  346  HOH HOH B . 
F 3 HOH 164 864  348  HOH HOH B . 
F 3 HOH 165 865  350  HOH HOH B . 
F 3 HOH 166 866  351  HOH HOH B . 
F 3 HOH 167 867  352  HOH HOH B . 
F 3 HOH 168 868  353  HOH HOH B . 
F 3 HOH 169 869  355  HOH HOH B . 
F 3 HOH 170 870  362  HOH HOH B . 
F 3 HOH 171 871  363  HOH HOH B . 
F 3 HOH 172 872  364  HOH HOH B . 
F 3 HOH 173 873  368  HOH HOH B . 
F 3 HOH 174 874  371  HOH HOH B . 
F 3 HOH 175 875  372  HOH HOH B . 
F 3 HOH 176 876  380  HOH HOH B . 
F 3 HOH 177 877  384  HOH HOH B . 
F 3 HOH 178 878  393  HOH HOH B . 
F 3 HOH 179 879  394  HOH HOH B . 
F 3 HOH 180 880  396  HOH HOH B . 
F 3 HOH 181 881  399  HOH HOH B . 
F 3 HOH 182 882  401  HOH HOH B . 
F 3 HOH 183 883  406  HOH HOH B . 
F 3 HOH 184 884  413  HOH HOH B . 
F 3 HOH 185 885  414  HOH HOH B . 
F 3 HOH 186 886  416  HOH HOH B . 
F 3 HOH 187 887  418  HOH HOH B . 
F 3 HOH 188 888  420  HOH HOH B . 
F 3 HOH 189 889  430  HOH HOH B . 
F 3 HOH 190 890  432  HOH HOH B . 
F 3 HOH 191 891  437  HOH HOH B . 
F 3 HOH 192 892  438  HOH HOH B . 
F 3 HOH 193 893  439  HOH HOH B . 
F 3 HOH 194 894  440  HOH HOH B . 
F 3 HOH 195 895  442  HOH HOH B . 
F 3 HOH 196 896  443  HOH HOH B . 
F 3 HOH 197 897  444  HOH HOH B . 
F 3 HOH 198 898  446  HOH HOH B . 
F 3 HOH 199 899  447  HOH HOH B . 
F 3 HOH 200 900  453  HOH HOH B . 
F 3 HOH 201 901  455  HOH HOH B . 
F 3 HOH 202 902  460  HOH HOH B . 
F 3 HOH 203 903  461  HOH HOH B . 
F 3 HOH 204 904  465  HOH HOH B . 
F 3 HOH 205 905  469  HOH HOH B . 
F 3 HOH 206 906  470  HOH HOH B . 
F 3 HOH 207 907  471  HOH HOH B . 
F 3 HOH 208 908  472  HOH HOH B . 
F 3 HOH 209 909  473  HOH HOH B . 
F 3 HOH 210 910  474  HOH HOH B . 
F 3 HOH 211 911  475  HOH HOH B . 
F 3 HOH 212 912  477  HOH HOH B . 
F 3 HOH 213 913  488  HOH HOH B . 
F 3 HOH 214 914  491  HOH HOH B . 
F 3 HOH 215 915  493  HOH HOH B . 
F 3 HOH 216 916  506  HOH HOH B . 
F 3 HOH 217 917  507  HOH HOH B . 
F 3 HOH 218 918  508  HOH HOH B . 
F 3 HOH 219 919  517  HOH HOH B . 
F 3 HOH 220 920  518  HOH HOH B . 
F 3 HOH 221 921  519  HOH HOH B . 
F 3 HOH 222 922  521  HOH HOH B . 
F 3 HOH 223 923  522  HOH HOH B . 
F 3 HOH 224 924  524  HOH HOH B . 
F 3 HOH 225 925  525  HOH HOH B . 
F 3 HOH 226 926  527  HOH HOH B . 
F 3 HOH 227 927  531  HOH HOH B . 
F 3 HOH 228 928  534  HOH HOH B . 
F 3 HOH 229 929  535  HOH HOH B . 
F 3 HOH 230 930  537  HOH HOH B . 
F 3 HOH 231 931  538  HOH HOH B . 
F 3 HOH 232 932  539  HOH HOH B . 
F 3 HOH 233 933  541  HOH HOH B . 
F 3 HOH 234 934  543  HOH HOH B . 
F 3 HOH 235 935  545  HOH HOH B . 
F 3 HOH 236 936  549  HOH HOH B . 
F 3 HOH 237 937  551  HOH HOH B . 
F 3 HOH 238 938  555  HOH HOH B . 
F 3 HOH 239 939  556  HOH HOH B . 
F 3 HOH 240 940  558  HOH HOH B . 
F 3 HOH 241 941  559  HOH HOH B . 
F 3 HOH 242 942  563  HOH HOH B . 
F 3 HOH 243 943  564  HOH HOH B . 
F 3 HOH 244 944  568  HOH HOH B . 
F 3 HOH 245 945  569  HOH HOH B . 
F 3 HOH 246 946  580  HOH HOH B . 
F 3 HOH 247 947  582  HOH HOH B . 
F 3 HOH 248 948  583  HOH HOH B . 
F 3 HOH 249 949  584  HOH HOH B . 
F 3 HOH 250 950  585  HOH HOH B . 
F 3 HOH 251 951  587  HOH HOH B . 
F 3 HOH 252 952  591  HOH HOH B . 
F 3 HOH 253 953  592  HOH HOH B . 
F 3 HOH 254 954  593  HOH HOH B . 
F 3 HOH 255 955  594  HOH HOH B . 
F 3 HOH 256 956  596  HOH HOH B . 
F 3 HOH 257 957  601  HOH HOH B . 
F 3 HOH 258 958  602  HOH HOH B . 
F 3 HOH 259 959  605  HOH HOH B . 
F 3 HOH 260 960  609  HOH HOH B . 
F 3 HOH 261 961  610  HOH HOH B . 
F 3 HOH 262 962  615  HOH HOH B . 
F 3 HOH 263 963  616  HOH HOH B . 
F 3 HOH 264 964  620  HOH HOH B . 
F 3 HOH 265 965  621  HOH HOH B . 
F 3 HOH 266 966  623  HOH HOH B . 
F 3 HOH 267 967  624  HOH HOH B . 
F 3 HOH 268 968  629  HOH HOH B . 
F 3 HOH 269 969  630  HOH HOH B . 
F 3 HOH 270 970  633  HOH HOH B . 
F 3 HOH 271 971  634  HOH HOH B . 
F 3 HOH 272 972  639  HOH HOH B . 
F 3 HOH 273 973  641  HOH HOH B . 
F 3 HOH 274 974  642  HOH HOH B . 
F 3 HOH 275 975  644  HOH HOH B . 
F 3 HOH 276 976  645  HOH HOH B . 
F 3 HOH 277 977  646  HOH HOH B . 
F 3 HOH 278 978  649  HOH HOH B . 
F 3 HOH 279 979  651  HOH HOH B . 
F 3 HOH 280 980  652  HOH HOH B . 
F 3 HOH 281 981  655  HOH HOH B . 
F 3 HOH 282 982  659  HOH HOH B . 
F 3 HOH 283 983  661  HOH HOH B . 
F 3 HOH 284 984  666  HOH HOH B . 
F 3 HOH 285 985  668  HOH HOH B . 
F 3 HOH 286 986  672  HOH HOH B . 
F 3 HOH 287 987  677  HOH HOH B . 
F 3 HOH 288 988  685  HOH HOH B . 
F 3 HOH 289 989  689  HOH HOH B . 
F 3 HOH 290 990  693  HOH HOH B . 
F 3 HOH 291 991  694  HOH HOH B . 
F 3 HOH 292 992  695  HOH HOH B . 
F 3 HOH 293 993  696  HOH HOH B . 
F 3 HOH 294 994  697  HOH HOH B . 
F 3 HOH 295 995  698  HOH HOH B . 
F 3 HOH 296 996  699  HOH HOH B . 
F 3 HOH 297 997  701  HOH HOH B . 
F 3 HOH 298 998  713  HOH HOH B . 
F 3 HOH 299 999  832  HOH HOH B . 
F 3 HOH 300 1000 833  HOH HOH B . 
F 3 HOH 301 1001 834  HOH HOH B . 
F 3 HOH 302 1002 835  HOH HOH B . 
F 3 HOH 303 1003 839  HOH HOH B . 
F 3 HOH 304 1004 842  HOH HOH B . 
F 3 HOH 305 1005 844  HOH HOH B . 
F 3 HOH 306 1006 845  HOH HOH B . 
F 3 HOH 307 1007 846  HOH HOH B . 
F 3 HOH 308 1008 848  HOH HOH B . 
F 3 HOH 309 1009 851  HOH HOH B . 
F 3 HOH 310 1010 852  HOH HOH B . 
F 3 HOH 311 1011 855  HOH HOH B . 
F 3 HOH 312 1012 856  HOH HOH B . 
F 3 HOH 313 1013 857  HOH HOH B . 
F 3 HOH 314 1014 858  HOH HOH B . 
F 3 HOH 315 1015 859  HOH HOH B . 
F 3 HOH 316 1016 860  HOH HOH B . 
F 3 HOH 317 1017 861  HOH HOH B . 
F 3 HOH 318 1018 862  HOH HOH B . 
F 3 HOH 319 1019 863  HOH HOH B . 
F 3 HOH 320 1020 864  HOH HOH B . 
F 3 HOH 321 1021 865  HOH HOH B . 
F 3 HOH 322 1022 867  HOH HOH B . 
F 3 HOH 323 1023 868  HOH HOH B . 
F 3 HOH 324 1024 870  HOH HOH B . 
F 3 HOH 325 1025 871  HOH HOH B . 
F 3 HOH 326 1026 873  HOH HOH B . 
F 3 HOH 327 1027 875  HOH HOH B . 
F 3 HOH 328 1028 879  HOH HOH B . 
F 3 HOH 329 1029 880  HOH HOH B . 
F 3 HOH 330 1030 884  HOH HOH B . 
F 3 HOH 331 1031 885  HOH HOH B . 
F 3 HOH 332 1032 886  HOH HOH B . 
F 3 HOH 333 1033 887  HOH HOH B . 
F 3 HOH 334 1034 889  HOH HOH B . 
F 3 HOH 335 1035 892  HOH HOH B . 
F 3 HOH 336 1036 893  HOH HOH B . 
F 3 HOH 337 1037 894  HOH HOH B . 
F 3 HOH 338 1038 895  HOH HOH B . 
F 3 HOH 339 1039 896  HOH HOH B . 
F 3 HOH 340 1040 898  HOH HOH B . 
F 3 HOH 341 1041 899  HOH HOH B . 
F 3 HOH 342 1042 900  HOH HOH B . 
F 3 HOH 343 1043 901  HOH HOH B . 
F 3 HOH 344 1044 902  HOH HOH B . 
F 3 HOH 345 1045 903  HOH HOH B . 
F 3 HOH 346 1046 904  HOH HOH B . 
F 3 HOH 347 1047 906  HOH HOH B . 
F 3 HOH 348 1048 907  HOH HOH B . 
F 3 HOH 349 1049 908  HOH HOH B . 
F 3 HOH 350 1050 909  HOH HOH B . 
F 3 HOH 351 1051 911  HOH HOH B . 
F 3 HOH 352 1052 913  HOH HOH B . 
F 3 HOH 353 1053 914  HOH HOH B . 
F 3 HOH 354 1054 915  HOH HOH B . 
F 3 HOH 355 1055 921  HOH HOH B . 
F 3 HOH 356 1056 922  HOH HOH B . 
F 3 HOH 357 1057 923  HOH HOH B . 
F 3 HOH 358 1058 925  HOH HOH B . 
F 3 HOH 359 1059 926  HOH HOH B . 
F 3 HOH 360 1060 927  HOH HOH B . 
F 3 HOH 361 1061 928  HOH HOH B . 
F 3 HOH 362 1062 929  HOH HOH B . 
F 3 HOH 363 1063 932  HOH HOH B . 
F 3 HOH 364 1064 938  HOH HOH B . 
F 3 HOH 365 1065 939  HOH HOH B . 
F 3 HOH 366 1066 940  HOH HOH B . 
F 3 HOH 367 1067 941  HOH HOH B . 
F 3 HOH 368 1068 944  HOH HOH B . 
F 3 HOH 369 1069 947  HOH HOH B . 
F 3 HOH 370 1070 949  HOH HOH B . 
F 3 HOH 371 1071 951  HOH HOH B . 
F 3 HOH 372 1072 953  HOH HOH B . 
F 3 HOH 373 1073 955  HOH HOH B . 
F 3 HOH 374 1074 956  HOH HOH B . 
F 3 HOH 375 1075 957  HOH HOH B . 
F 3 HOH 376 1076 958  HOH HOH B . 
F 3 HOH 377 1077 960  HOH HOH B . 
F 3 HOH 378 1078 961  HOH HOH B . 
F 3 HOH 379 1079 962  HOH HOH B . 
F 3 HOH 380 1080 963  HOH HOH B . 
F 3 HOH 381 1081 966  HOH HOH B . 
F 3 HOH 382 1082 967  HOH HOH B . 
F 3 HOH 383 1083 968  HOH HOH B . 
F 3 HOH 384 1084 970  HOH HOH B . 
F 3 HOH 385 1085 972  HOH HOH B . 
F 3 HOH 386 1086 973  HOH HOH B . 
F 3 HOH 387 1087 974  HOH HOH B . 
F 3 HOH 388 1088 975  HOH HOH B . 
F 3 HOH 389 1089 977  HOH HOH B . 
F 3 HOH 390 1090 979  HOH HOH B . 
F 3 HOH 391 1091 981  HOH HOH B . 
F 3 HOH 392 1092 982  HOH HOH B . 
F 3 HOH 393 1093 984  HOH HOH B . 
F 3 HOH 394 1094 985  HOH HOH B . 
F 3 HOH 395 1095 986  HOH HOH B . 
F 3 HOH 396 1096 987  HOH HOH B . 
F 3 HOH 397 1097 988  HOH HOH B . 
F 3 HOH 398 1098 989  HOH HOH B . 
F 3 HOH 399 1099 990  HOH HOH B . 
F 3 HOH 400 1100 991  HOH HOH B . 
F 3 HOH 401 1101 992  HOH HOH B . 
F 3 HOH 402 1102 993  HOH HOH B . 
F 3 HOH 403 1103 994  HOH HOH B . 
F 3 HOH 404 1104 995  HOH HOH B . 
F 3 HOH 405 1105 999  HOH HOH B . 
F 3 HOH 406 1106 1000 HOH HOH B . 
F 3 HOH 407 1107 1006 HOH HOH B . 
F 3 HOH 408 1108 1009 HOH HOH B . 
F 3 HOH 409 1109 1010 HOH HOH B . 
F 3 HOH 410 1110 1011 HOH HOH B . 
F 3 HOH 411 1111 1012 HOH HOH B . 
F 3 HOH 412 1112 1013 HOH HOH B . 
F 3 HOH 413 1113 1014 HOH HOH B . 
F 3 HOH 414 1114 1018 HOH HOH B . 
F 3 HOH 415 1115 1019 HOH HOH B . 
F 3 HOH 416 1116 1020 HOH HOH B . 
F 3 HOH 417 1117 1021 HOH HOH B . 
F 3 HOH 418 1118 1022 HOH HOH B . 
F 3 HOH 419 1119 1023 HOH HOH B . 
F 3 HOH 420 1120 1024 HOH HOH B . 
F 3 HOH 421 1121 1026 HOH HOH B . 
F 3 HOH 422 1122 1028 HOH HOH B . 
F 3 HOH 423 1123 1029 HOH HOH B . 
F 3 HOH 424 1124 1030 HOH HOH B . 
F 3 HOH 425 1125 1031 HOH HOH B . 
F 3 HOH 426 1126 1032 HOH HOH B . 
F 3 HOH 427 1127 1034 HOH HOH B . 
F 3 HOH 428 1128 1039 HOH HOH B . 
F 3 HOH 429 1129 1040 HOH HOH B . 
F 3 HOH 430 1130 1047 HOH HOH B . 
F 3 HOH 431 1131 1058 HOH HOH B . 
F 3 HOH 432 1132 1064 HOH HOH B . 
F 3 HOH 433 1133 1067 HOH HOH B . 
F 3 HOH 434 1134 1069 HOH HOH B . 
F 3 HOH 435 1135 1077 HOH HOH B . 
F 3 HOH 436 1136 1089 HOH HOH B . 
F 3 HOH 437 1137 1092 HOH HOH B . 
F 3 HOH 438 1138 1094 HOH HOH B . 
F 3 HOH 439 1139 1095 HOH HOH B . 
F 3 HOH 440 1140 1109 HOH HOH B . 
F 3 HOH 441 1141 1111 HOH HOH B . 
F 3 HOH 442 1142 1114 HOH HOH B . 
F 3 HOH 443 1143 1123 HOH HOH B . 
F 3 HOH 444 1144 1125 HOH HOH B . 
F 3 HOH 445 1145 1130 HOH HOH B . 
F 3 HOH 446 1146 1132 HOH HOH B . 
F 3 HOH 447 1147 1133 HOH HOH B . 
F 3 HOH 448 1148 1137 HOH HOH B . 
F 3 HOH 449 1149 1138 HOH HOH B . 
F 3 HOH 450 1150 1144 HOH HOH B . 
F 3 HOH 451 1151 1148 HOH HOH B . 
F 3 HOH 452 1152 1153 HOH HOH B . 
F 3 HOH 453 1153 1154 HOH HOH B . 
F 3 HOH 454 1154 1155 HOH HOH B . 
F 3 HOH 455 1155 1158 HOH HOH B . 
F 3 HOH 456 1156 1159 HOH HOH B . 
F 3 HOH 457 1157 1162 HOH HOH B . 
F 3 HOH 458 1158 1164 HOH HOH B . 
F 3 HOH 459 1159 1168 HOH HOH B . 
F 3 HOH 460 1160 1171 HOH HOH B . 
F 3 HOH 461 1161 1172 HOH HOH B . 
F 3 HOH 462 1162 1176 HOH HOH B . 
F 3 HOH 463 1163 1177 HOH HOH B . 
F 3 HOH 464 1164 1180 HOH HOH B . 
F 3 HOH 465 1165 1182 HOH HOH B . 
F 3 HOH 466 1166 1183 HOH HOH B . 
F 3 HOH 467 1167 1186 HOH HOH B . 
F 3 HOH 468 1168 1187 HOH HOH B . 
F 3 HOH 469 1169 1188 HOH HOH B . 
F 3 HOH 470 1170 1189 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 22740 ? 
1 MORE         -79   ? 
1 'SSA (A^2)'  44510 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 75.7250000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 736 ? E HOH . 
2 1 B HOH 774 ? F HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-26 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
d*TREK 'data reduction' .        ? 2 
d*TREK 'data scaling'   .        ? 3 
CNS    phasing          .        ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              285 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              285 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              285 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.18 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.12 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 15  ? ? -91.70  48.75   
2  1 SER A 32  ? ? -97.62  -77.38  
3  1 PHE A 55  ? ? -140.23 -55.91  
4  1 ILE A 159 ? ? 77.90   -60.85  
5  1 THR A 209 ? ? -35.08  -37.51  
6  1 LYS A 210 ? ? -76.47  -115.96 
7  1 ILE A 220 ? ? -172.44 144.37  
8  1 SER A 308 ? ? -101.18 -156.43 
9  1 SER A 339 ? ? 69.78   -177.32 
10 1 TRP A 340 ? ? 179.47  -178.14 
11 1 ARG B 15  ? ? -93.13  49.72   
12 1 SER B 32  ? ? -103.91 -71.92  
13 1 PHE B 55  ? ? -138.18 -53.83  
14 1 THR B 61  ? ? -117.62 -168.91 
15 1 ILE B 159 ? ? 70.01   -55.45  
16 1 LYS B 210 ? ? -79.83  -121.21 
17 1 ILE B 220 ? ? -172.75 141.52  
18 1 ASN B 287 ? ? -102.91 79.13   
19 1 SER B 308 ? ? -99.20  -156.88 
20 1 SER B 339 ? ? 64.14   179.99  
21 1 TRP B 340 ? ? 176.57  179.56  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1  
2  1 Y 1 A GLY -18 ? A GLY 2  
3  1 Y 1 A SER -17 ? A SER 3  
4  1 Y 1 A SER -16 ? A SER 4  
5  1 Y 1 A HIS -15 ? A HIS 5  
6  1 Y 1 A HIS -14 ? A HIS 6  
7  1 Y 1 A HIS -13 ? A HIS 7  
8  1 Y 1 A HIS -12 ? A HIS 8  
9  1 Y 1 A HIS -11 ? A HIS 9  
10 1 Y 1 A HIS -10 ? A HIS 10 
11 1 Y 1 A SER -9  ? A SER 11 
12 1 Y 1 A SER -8  ? A SER 12 
13 1 Y 1 A GLY -7  ? A GLY 13 
14 1 Y 1 A LEU -6  ? A LEU 14 
15 1 Y 1 A VAL -5  ? A VAL 15 
16 1 Y 1 A PRO -4  ? A PRO 16 
17 1 Y 1 A ARG -3  ? A ARG 17 
18 1 Y 1 A GLY -2  ? A GLY 18 
19 1 Y 1 A SER -1  ? A SER 19 
20 1 Y 1 A HIS 0   ? A HIS 20 
21 1 Y 1 A MET 1   ? A MET 21 
22 1 Y 1 A ALA 2   ? A ALA 22 
23 1 Y 1 A ASP 3   ? A ASP 23 
24 1 Y 1 A LYS 4   ? A LYS 24 
25 1 Y 1 B MET -19 ? B MET 1  
26 1 Y 1 B GLY -18 ? B GLY 2  
27 1 Y 1 B SER -17 ? B SER 3  
28 1 Y 1 B SER -16 ? B SER 4  
29 1 Y 1 B HIS -15 ? B HIS 5  
30 1 Y 1 B HIS -14 ? B HIS 6  
31 1 Y 1 B HIS -13 ? B HIS 7  
32 1 Y 1 B HIS -12 ? B HIS 8  
33 1 Y 1 B HIS -11 ? B HIS 9  
34 1 Y 1 B HIS -10 ? B HIS 10 
35 1 Y 1 B SER -9  ? B SER 11 
36 1 Y 1 B SER -8  ? B SER 12 
37 1 Y 1 B GLY -7  ? B GLY 13 
38 1 Y 1 B LEU -6  ? B LEU 14 
39 1 Y 1 B VAL -5  ? B VAL 15 
40 1 Y 1 B PRO -4  ? B PRO 16 
41 1 Y 1 B ARG -3  ? B ARG 17 
42 1 Y 1 B GLY -2  ? B GLY 18 
43 1 Y 1 B SER -1  ? B SER 19 
44 1 Y 1 B HIS 0   ? B HIS 20 
45 1 Y 1 B MET 1   ? B MET 21 
46 1 Y 1 B ALA 2   ? B ALA 22 
47 1 Y 1 B ASP 3   ? B ASP 23 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
'PHOSPHORIC ACID MONO-(5-HYDROXY-6-METHYL-4-{[2-(2-TRIFLUOROMETHYL-BENZOYLAMINO)-ACETYL]-HYDRAZONOMETHYL}-PYRIDIN-3-YLMETHYL)ESTER' 
P3F 
3 water HOH 
#