data_2FVA
# 
_entry.id   2FVA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2FVA         pdb_00002fva 10.2210/pdb2fva/pdb 
RCSB  RCSB036354   ?            ?                   
WWPDB D_1000036354 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB  2AVA 'Structure entry without fatty acid' unspecified 
BMRB 6390 'NMR assignments for 18:0-ACP'       unspecified 
PDB  2fve .                                    unspecified 
PDB  2fvf .                                    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FVA 
_pdbx_database_status.recvd_initial_deposition_date   2006-01-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zornetzer, G.A.' 1 
'Fox, B.G.'       2 
'Markley, J.L.'   3 
# 
_citation.id                        primary 
_citation.title                     'Solution structures of spinach acyl carrier protein with decanoate and stearate' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            45 
_citation.page_first                5217 
_citation.page_last                 5227 
_citation.year                      2006 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16618110 
_citation.pdbx_database_id_DOI      10.1021/bi052062d 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zornetzer, G.A.' 1 ? 
primary 'Fox, B.G.'       2 ? 
primary 'Markley, J.L.'   3 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Acyl Carrier Protein'  8844.879 1 ? ? ? ? 
2 non-polymer syn "4'-PHOSPHOPANTETHEINE" 358.348  1 ? ? ? ? 
3 non-polymer syn 'STEARIC ACID'          284.477  1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEK
KA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEK
KA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  LYS n 
1 3  LYS n 
1 4  GLU n 
1 5  THR n 
1 6  ILE n 
1 7  ASP n 
1 8  LYS n 
1 9  VAL n 
1 10 SER n 
1 11 ASP n 
1 12 ILE n 
1 13 VAL n 
1 14 LYS n 
1 15 GLU n 
1 16 LYS n 
1 17 LEU n 
1 18 ALA n 
1 19 LEU n 
1 20 GLY n 
1 21 ALA n 
1 22 ASP n 
1 23 VAL n 
1 24 VAL n 
1 25 VAL n 
1 26 THR n 
1 27 ALA n 
1 28 ASP n 
1 29 SER n 
1 30 GLU n 
1 31 PHE n 
1 32 SER n 
1 33 LYS n 
1 34 LEU n 
1 35 GLY n 
1 36 ALA n 
1 37 ASP n 
1 38 SER n 
1 39 LEU n 
1 40 ASP n 
1 41 THR n 
1 42 VAL n 
1 43 GLU n 
1 44 ILE n 
1 45 VAL n 
1 46 MET n 
1 47 ASN n 
1 48 LEU n 
1 49 GLU n 
1 50 GLU n 
1 51 GLU n 
1 52 PHE n 
1 53 GLY n 
1 54 ILE n 
1 55 ASN n 
1 56 VAL n 
1 57 ASP n 
1 58 GLU n 
1 59 ASP n 
1 60 LYS n 
1 61 ALA n 
1 62 GLN n 
1 63 ASP n 
1 64 ILE n 
1 65 SER n 
1 66 THR n 
1 67 ILE n 
1 68 GLN n 
1 69 GLN n 
1 70 ALA n 
1 71 ALA n 
1 72 ASP n 
1 73 VAL n 
1 74 ILE n 
1 75 GLU n 
1 76 GLY n 
1 77 LEU n 
1 78 LEU n 
1 79 GLU n 
1 80 LYS n 
1 81 LYS n 
1 82 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               spinach 
_entity_src_gen.gene_src_genus                     Spinacia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Spinacia oleracea' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pSACP-2t 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACP1_SPIOL 
_struct_ref.pdbx_db_accession          P07854 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           57 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2FVA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 82 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07854 
_struct_ref_seq.db_align_beg                  57 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  138 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       82 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'        89.093  
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'        133.103 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'        75.067  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'       165.189 
PNS non-polymer         . "4'-PHOSPHOPANTETHEINE" ? 'C11 H23 N2 O7 P S' 358.348 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'        105.093 
STE non-polymer         . 'STEARIC ACID'          ? 'C18 H36 O2'        284.477 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'        119.119 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'       117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY       1 
2 1 3D_13C-separated_NOESY       1 
3 1 'f1 filtered NOESY-15N HSQC' 1 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 287 1 6.1 '100 mM NaCl' atm K 
2 287 1 6.1 '100 mM NaCl' atm K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '2 mM protein, 10 mM MES pH 6.1, 100 mM NaCl, 95% H2O / 5% D2O' '95% H2O/5% D2O' 
2 '2 mM protein, 10 mM MES pH 6.1, 100 mM NaCl, 100% D2O'         '100% D2O'       
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DMX   Bruker 500 ? 
2 DMX   Bruker 600 ? 
3 DMX   Bruker 750 ? 
4 INOVA Varian 600 ? 
# 
_pdbx_nmr_refine.entry_id           2FVA 
_pdbx_nmr_refine.method             
;Torsion angle dynamics followed by torsion angle dynamics with ambiguous restraints, NOESY restraints, and ramachandran database potentials
;
_pdbx_nmr_refine.details            
;Used CYANA for initial structure generation. Docking of the fatty acid (with ramachandran database potentials) was performed in XPLOR-NIH 2.0.12
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2FVA 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with lowest energy whose fatty acids form a aligned cluster' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2FVA 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' CYANA     2.1   ? 1 
refinement           XPLOR-NIH 2.12  ? 2 
collection           XwinNMR   2.6   ? 3 
collection           VNMR      6.1   ? 4 
'data analysis'      NMRPipe   ?     ? 5 
'data analysis'      Sparky    3.111 ? 6 
# 
_exptl.entry_id          2FVA 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2FVA 
_struct.title                     'Structure of 18:0-ACP with docked fatty acid' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FVA 
_struct_keywords.pdbx_keywords   'BIOSYNTHETIC PROTEIN' 
_struct_keywords.text            '4-helix bundle, BIOSYNTHETIC PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 2  ? ALA A 18 ? LYS A 2  ALA A 18 1 ? 17 
HELX_P HELX_P2 2 ASP A 40 ? GLY A 53 ? ASP A 40 GLY A 53 1 ? 14 
HELX_P HELX_P3 3 THR A 66 ? LYS A 80 ? THR A 66 LYS A 80 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale none ? A SER 38 CB  ? ? ? 1_555 B PNS . O23 ? ? A SER 38  A PNS 101 1_555 ? ? ? ? ? ? ? 1.422 ? ? 
covale2 covale none ? B PNS .  S44 ? ? ? 1_555 C STE . C1  ? ? A PNS 101 A STE 102 1_555 ? ? ? ? ? ? ? 1.740 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PNS 101 ? 5 'BINDING SITE FOR RESIDUE PNS A 101' 
AC2 Software A STE 102 ? 8 'BINDING SITE FOR RESIDUE STE A 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 LYS A 16 ? LYS A 16  . ? 1_555 ? 
2  AC1 5 ALA A 36 ? ALA A 36  . ? 1_555 ? 
3  AC1 5 SER A 38 ? SER A 38  . ? 1_555 ? 
4  AC1 5 ASP A 40 ? ASP A 40  . ? 1_555 ? 
5  AC1 5 STE C .  ? STE A 102 . ? 1_555 ? 
6  AC2 8 GLY A 35 ? GLY A 35  . ? 1_555 ? 
7  AC2 8 SER A 38 ? SER A 38  . ? 1_555 ? 
8  AC2 8 ASP A 40 ? ASP A 40  . ? 1_555 ? 
9  AC2 8 THR A 41 ? THR A 41  . ? 1_555 ? 
10 AC2 8 LEU A 48 ? LEU A 48  . ? 1_555 ? 
11 AC2 8 VAL A 56 ? VAL A 56  . ? 1_555 ? 
12 AC2 8 ILE A 74 ? ILE A 74  . ? 1_555 ? 
13 AC2 8 PNS B .  ? PNS A 101 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FVA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FVA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . ALA A 1 1  ? -10.204 -3.569  7.160   1.00 1.00 ? 1   ALA A N    1  
ATOM   2     C CA   . ALA A 1 1  ? -10.272 -3.626  5.672   1.00 1.00 ? 1   ALA A CA   1  
ATOM   3     C C    . ALA A 1 1  ? -10.462 -5.074  5.231   1.00 1.00 ? 1   ALA A C    1  
ATOM   4     O O    . ALA A 1 1  ? -10.255 -6.003  6.011   1.00 1.00 ? 1   ALA A O    1  
ATOM   5     C CB   . ALA A 1 1  ? -8.977  -3.065  5.083   1.00 1.00 ? 1   ALA A CB   1  
ATOM   6     H H1   . ALA A 1 1  ? -11.067 -3.981  7.564   1.00 1.00 ? 1   ALA A H1   1  
ATOM   7     H H2   . ALA A 1 1  ? -10.115 -2.578  7.464   1.00 1.00 ? 1   ALA A H2   1  
ATOM   8     H H3   . ALA A 1 1  ? -9.376  -4.107  7.489   1.00 1.00 ? 1   ALA A H3   1  
ATOM   9     H HA   . ALA A 1 1  ? -11.107 -3.035  5.329   1.00 1.00 ? 1   ALA A HA   1  
ATOM   10    H HB1  . ALA A 1 1  ? -8.659  -2.210  5.660   1.00 1.00 ? 1   ALA A HB1  1  
ATOM   11    H HB2  . ALA A 1 1  ? -9.149  -2.763  4.058   1.00 1.00 ? 1   ALA A HB2  1  
ATOM   12    H HB3  . ALA A 1 1  ? -8.209  -3.824  5.111   1.00 1.00 ? 1   ALA A HB3  1  
ATOM   13    N N    . LYS A 1 2  ? -10.852 -5.259  3.976   1.00 1.00 ? 2   LYS A N    1  
ATOM   14    C CA   . LYS A 1 2  ? -11.067 -6.599  3.438   1.00 1.00 ? 2   LYS A CA   1  
ATOM   15    C C    . LYS A 1 2  ? -9.732  -7.273  3.143   1.00 1.00 ? 2   LYS A C    1  
ATOM   16    O O    . LYS A 1 2  ? -8.748  -6.611  2.818   1.00 1.00 ? 2   LYS A O    1  
ATOM   17    C CB   . LYS A 1 2  ? -11.896 -6.518  2.157   1.00 1.00 ? 2   LYS A CB   1  
ATOM   18    C CG   . LYS A 1 2  ? -13.231 -5.830  2.449   1.00 1.00 ? 2   LYS A CG   1  
ATOM   19    C CD   . LYS A 1 2  ? -14.184 -6.822  3.119   1.00 1.00 ? 2   LYS A CD   1  
ATOM   20    C CE   . LYS A 1 2  ? -15.543 -6.157  3.335   1.00 1.00 ? 2   LYS A CE   1  
ATOM   21    N NZ   . LYS A 1 2  ? -16.487 -7.139  3.941   1.00 1.00 ? 2   LYS A NZ   1  
ATOM   22    H H    . LYS A 1 2  ? -11.004 -4.479  3.398   1.00 1.00 ? 2   LYS A H    1  
ATOM   23    H HA   . LYS A 1 2  ? -11.600 -7.185  4.168   1.00 1.00 ? 2   LYS A HA   1  
ATOM   24    H HB2  . LYS A 1 2  ? -11.357 -5.956  1.411   1.00 1.00 ? 2   LYS A HB2  1  
ATOM   25    H HB3  . LYS A 1 2  ? -12.084 -7.518  1.788   1.00 1.00 ? 2   LYS A HB3  1  
ATOM   26    H HG2  . LYS A 1 2  ? -13.062 -4.992  3.113   1.00 1.00 ? 2   LYS A HG2  1  
ATOM   27    H HG3  . LYS A 1 2  ? -13.665 -5.476  1.529   1.00 1.00 ? 2   LYS A HG3  1  
ATOM   28    H HD2  . LYS A 1 2  ? -14.302 -7.687  2.484   1.00 1.00 ? 2   LYS A HD2  1  
ATOM   29    H HD3  . LYS A 1 2  ? -13.781 -7.126  4.072   1.00 1.00 ? 2   LYS A HD3  1  
ATOM   30    H HE2  . LYS A 1 2  ? -15.430 -5.310  3.996   1.00 1.00 ? 2   LYS A HE2  1  
ATOM   31    H HE3  . LYS A 1 2  ? -15.935 -5.821  2.385   1.00 1.00 ? 2   LYS A HE3  1  
ATOM   32    H HZ1  . LYS A 1 2  ? -16.116 -7.453  4.860   1.00 1.00 ? 2   LYS A HZ1  1  
ATOM   33    H HZ2  . LYS A 1 2  ? -16.588 -7.959  3.309   1.00 1.00 ? 2   LYS A HZ2  1  
ATOM   34    H HZ3  . LYS A 1 2  ? -17.415 -6.690  4.079   1.00 1.00 ? 2   LYS A HZ3  1  
ATOM   35    N N    . LYS A 1 3  ? -9.707  -8.597  3.256   1.00 1.00 ? 3   LYS A N    1  
ATOM   36    C CA   . LYS A 1 3  ? -8.486  -9.351  3.008   1.00 1.00 ? 3   LYS A CA   1  
ATOM   37    C C    . LYS A 1 3  ? -8.023  -9.169  1.568   1.00 1.00 ? 3   LYS A C    1  
ATOM   38    O O    . LYS A 1 3  ? -6.826  -9.068  1.298   1.00 1.00 ? 3   LYS A O    1  
ATOM   39    C CB   . LYS A 1 3  ? -8.724  -10.837 3.286   1.00 1.00 ? 3   LYS A CB   1  
ATOM   40    C CG   . LYS A 1 3  ? -9.032  -11.038 4.771   1.00 1.00 ? 3   LYS A CG   1  
ATOM   41    C CD   . LYS A 1 3  ? -9.066  -12.535 5.087   1.00 1.00 ? 3   LYS A CD   1  
ATOM   42    C CE   . LYS A 1 3  ? -10.235 -13.187 4.349   1.00 1.00 ? 3   LYS A CE   1  
ATOM   43    N NZ   . LYS A 1 3  ? -10.524 -14.519 4.954   1.00 1.00 ? 3   LYS A NZ   1  
ATOM   44    H H    . LYS A 1 3  ? -10.524 -9.074  3.513   1.00 1.00 ? 3   LYS A H    1  
ATOM   45    H HA   . LYS A 1 3  ? -7.712  -8.995  3.674   1.00 1.00 ? 3   LYS A HA   1  
ATOM   46    H HB2  . LYS A 1 3  ? -9.560  -11.181 2.693   1.00 1.00 ? 3   LYS A HB2  1  
ATOM   47    H HB3  . LYS A 1 3  ? -7.841  -11.400 3.023   1.00 1.00 ? 3   LYS A HB3  1  
ATOM   48    H HG2  . LYS A 1 3  ? -8.268  -10.560 5.364   1.00 1.00 ? 3   LYS A HG2  1  
ATOM   49    H HG3  . LYS A 1 3  ? -9.994  -10.601 5.001   1.00 1.00 ? 3   LYS A HG3  1  
ATOM   50    H HD2  . LYS A 1 3  ? -8.139  -12.989 4.769   1.00 1.00 ? 3   LYS A HD2  1  
ATOM   51    H HD3  . LYS A 1 3  ? -9.189  -12.675 6.151   1.00 1.00 ? 3   LYS A HD3  1  
ATOM   52    H HE2  . LYS A 1 3  ? -11.109 -12.559 4.430   1.00 1.00 ? 3   LYS A HE2  1  
ATOM   53    H HE3  . LYS A 1 3  ? -9.978  -13.316 3.307   1.00 1.00 ? 3   LYS A HE3  1  
ATOM   54    H HZ1  . LYS A 1 3  ? -10.980 -14.388 5.879   1.00 1.00 ? 3   LYS A HZ1  1  
ATOM   55    H HZ2  . LYS A 1 3  ? -9.634  -15.044 5.076   1.00 1.00 ? 3   LYS A HZ2  1  
ATOM   56    H HZ3  . LYS A 1 3  ? -11.160 -15.054 4.330   1.00 1.00 ? 3   LYS A HZ3  1  
ATOM   57    N N    . GLU A 1 4  ? -8.979  -9.130  0.646   1.00 1.00 ? 4   GLU A N    1  
ATOM   58    C CA   . GLU A 1 4  ? -8.655  -8.973  -0.767  1.00 1.00 ? 4   GLU A CA   1  
ATOM   59    C C    . GLU A 1 4  ? -7.861  -7.693  -0.997  1.00 1.00 ? 4   GLU A C    1  
ATOM   60    O O    . GLU A 1 4  ? -6.850  -7.697  -1.698  1.00 1.00 ? 4   GLU A O    1  
ATOM   61    C CB   . GLU A 1 4  ? -9.944  -8.935  -1.594  1.00 1.00 ? 4   GLU A CB   1  
ATOM   62    C CG   . GLU A 1 4  ? -10.704 -7.640  -1.295  1.00 1.00 ? 4   GLU A CG   1  
ATOM   63    C CD   . GLU A 1 4  ? -12.129 -7.738  -1.825  1.00 1.00 ? 4   GLU A CD   1  
ATOM   64    O OE1  . GLU A 1 4  ? -12.412 -8.689  -2.535  1.00 1.00 ? 4   GLU A OE1  1  
ATOM   65    O OE2  . GLU A 1 4  ? -12.917 -6.860  -1.514  1.00 1.00 ? 4   GLU A OE2  1  
ATOM   66    H H    . GLU A 1 4  ? -9.916  -9.208  0.920   1.00 1.00 ? 4   GLU A H    1  
ATOM   67    H HA   . GLU A 1 4  ? -8.063  -9.818  -1.086  1.00 1.00 ? 4   GLU A HA   1  
ATOM   68    H HB2  . GLU A 1 4  ? -9.698  -8.974  -2.645  1.00 1.00 ? 4   GLU A HB2  1  
ATOM   69    H HB3  . GLU A 1 4  ? -10.564 -9.781  -1.336  1.00 1.00 ? 4   GLU A HB3  1  
ATOM   70    H HG2  . GLU A 1 4  ? -10.727 -7.476  -0.228  1.00 1.00 ? 4   GLU A HG2  1  
ATOM   71    H HG3  . GLU A 1 4  ? -10.201 -6.812  -1.774  1.00 1.00 ? 4   GLU A HG3  1  
ATOM   72    N N    . THR A 1 5  ? -8.328  -6.598  -0.409  1.00 1.00 ? 5   THR A N    1  
ATOM   73    C CA   . THR A 1 5  ? -7.659  -5.312  -0.558  1.00 1.00 ? 5   THR A CA   1  
ATOM   74    C C    . THR A 1 5  ? -6.317  -5.319  0.168   1.00 1.00 ? 5   THR A C    1  
ATOM   75    O O    . THR A 1 5  ? -5.322  -4.805  -0.339  1.00 1.00 ? 5   THR A O    1  
ATOM   76    C CB   . THR A 1 5  ? -8.539  -4.196  -0.000  1.00 1.00 ? 5   THR A CB   1  
ATOM   77    O OG1  . THR A 1 5  ? -9.884  -4.406  -0.406  1.00 1.00 ? 5   THR A OG1  1  
ATOM   78    C CG2  . THR A 1 5  ? -8.054  -2.846  -0.540  1.00 1.00 ? 5   THR A CG2  1  
ATOM   79    H H    . THR A 1 5  ? -9.141  -6.654  0.141   1.00 1.00 ? 5   THR A H    1  
ATOM   80    H HA   . THR A 1 5  ? -7.483  -5.132  -1.611  1.00 1.00 ? 5   THR A HA   1  
ATOM   81    H HB   . THR A 1 5  ? -8.481  -4.191  1.077   1.00 1.00 ? 5   THR A HB   1  
ATOM   82    H HG1  . THR A 1 5  ? -9.897  -4.506  -1.359  1.00 1.00 ? 5   THR A HG1  1  
ATOM   83    H HG21 . THR A 1 5  ? -8.313  -2.761  -1.586  1.00 1.00 ? 5   THR A HG21 1  
ATOM   84    H HG22 . THR A 1 5  ? -6.982  -2.780  -0.430  1.00 1.00 ? 5   THR A HG22 1  
ATOM   85    H HG23 . THR A 1 5  ? -8.524  -2.048  0.013   1.00 1.00 ? 5   THR A HG23 1  
ATOM   86    N N    . ILE A 1 6  ? -6.303  -5.903  1.363   1.00 1.00 ? 6   ILE A N    1  
ATOM   87    C CA   . ILE A 1 6  ? -5.079  -5.965  2.154   1.00 1.00 ? 6   ILE A CA   1  
ATOM   88    C C    . ILE A 1 6  ? -4.000  -6.745  1.410   1.00 1.00 ? 6   ILE A C    1  
ATOM   89    O O    . ILE A 1 6  ? -2.842  -6.325  1.364   1.00 1.00 ? 6   ILE A O    1  
ATOM   90    C CB   . ILE A 1 6  ? -5.363  -6.642  3.499   1.00 1.00 ? 6   ILE A CB   1  
ATOM   91    C CG1  . ILE A 1 6  ? -6.232  -5.722  4.359   1.00 1.00 ? 6   ILE A CG1  1  
ATOM   92    C CG2  . ILE A 1 6  ? -4.043  -6.921  4.221   1.00 1.00 ? 6   ILE A CG2  1  
ATOM   93    C CD1  . ILE A 1 6  ? -6.755  -6.498  5.569   1.00 1.00 ? 6   ILE A CD1  1  
ATOM   94    H H    . ILE A 1 6  ? -7.127  -6.297  1.717   1.00 1.00 ? 6   ILE A H    1  
ATOM   95    H HA   . ILE A 1 6  ? -4.727  -4.963  2.337   1.00 1.00 ? 6   ILE A HA   1  
ATOM   96    H HB   . ILE A 1 6  ? -5.884  -7.575  3.329   1.00 1.00 ? 6   ILE A HB   1  
ATOM   97    H HG12 . ILE A 1 6  ? -5.638  -4.884  4.698   1.00 1.00 ? 6   ILE A HG12 1  
ATOM   98    H HG13 . ILE A 1 6  ? -7.063  -5.361  3.775   1.00 1.00 ? 6   ILE A HG13 1  
ATOM   99    H HG21 . ILE A 1 6  ? -3.549  -7.761  3.754   1.00 1.00 ? 6   ILE A HG21 1  
ATOM   100   H HG22 . ILE A 1 6  ? -4.241  -7.148  5.253   1.00 1.00 ? 6   ILE A HG22 1  
ATOM   101   H HG23 . ILE A 1 6  ? -3.408  -6.049  4.154   1.00 1.00 ? 6   ILE A HG23 1  
ATOM   102   H HD11 . ILE A 1 6  ? -5.942  -7.038  6.031   1.00 1.00 ? 6   ILE A HD11 1  
ATOM   103   H HD12 . ILE A 1 6  ? -7.513  -7.197  5.245   1.00 1.00 ? 6   ILE A HD12 1  
ATOM   104   H HD13 . ILE A 1 6  ? -7.182  -5.809  6.282   1.00 1.00 ? 6   ILE A HD13 1  
ATOM   105   N N    . ASP A 1 7  ? -4.385  -7.873  0.830   1.00 1.00 ? 7   ASP A N    1  
ATOM   106   C CA   . ASP A 1 7  ? -3.441  -8.700  0.082   1.00 1.00 ? 7   ASP A CA   1  
ATOM   107   C C    . ASP A 1 7  ? -2.892  -7.923  -1.112  1.00 1.00 ? 7   ASP A C    1  
ATOM   108   O O    . ASP A 1 7  ? -1.724  -8.071  -1.475  1.00 1.00 ? 7   ASP A O    1  
ATOM   109   C CB   . ASP A 1 7  ? -4.133  -9.972  -0.407  1.00 1.00 ? 7   ASP A CB   1  
ATOM   110   C CG   . ASP A 1 7  ? -4.346  -10.928 0.761   1.00 1.00 ? 7   ASP A CG   1  
ATOM   111   O OD1  . ASP A 1 7  ? -3.711  -10.734 1.786   1.00 1.00 ? 7   ASP A OD1  1  
ATOM   112   O OD2  . ASP A 1 7  ? -5.140  -11.843 0.616   1.00 1.00 ? 7   ASP A OD2  1  
ATOM   113   H H    . ASP A 1 7  ? -5.318  -8.164  0.909   1.00 1.00 ? 7   ASP A H    1  
ATOM   114   H HA   . ASP A 1 7  ? -2.621  -8.970  0.729   1.00 1.00 ? 7   ASP A HA   1  
ATOM   115   H HB2  . ASP A 1 7  ? -5.089  -9.717  -0.840  1.00 1.00 ? 7   ASP A HB2  1  
ATOM   116   H HB3  . ASP A 1 7  ? -3.518  -10.449 -1.153  1.00 1.00 ? 7   ASP A HB3  1  
ATOM   117   N N    . LYS A 1 8  ? -3.742  -7.107  -1.726  1.00 1.00 ? 8   LYS A N    1  
ATOM   118   C CA   . LYS A 1 8  ? -3.324  -6.309  -2.870  1.00 1.00 ? 8   LYS A CA   1  
ATOM   119   C C    . LYS A 1 8  ? -2.319  -5.244  -2.454  1.00 1.00 ? 8   LYS A C    1  
ATOM   120   O O    . LYS A 1 8  ? -1.281  -5.075  -3.090  1.00 1.00 ? 8   LYS A O    1  
ATOM   121   C CB   . LYS A 1 8  ? -4.544  -5.635  -3.506  1.00 1.00 ? 8   LYS A CB   1  
ATOM   122   C CG   . LYS A 1 8  ? -5.371  -6.680  -4.260  1.00 1.00 ? 8   LYS A CG   1  
ATOM   123   C CD   . LYS A 1 8  ? -4.832  -6.829  -5.685  1.00 1.00 ? 8   LYS A CD   1  
ATOM   124   C CE   . LYS A 1 8  ? -5.518  -5.810  -6.600  1.00 1.00 ? 8   LYS A CE   1  
ATOM   125   N NZ   . LYS A 1 8  ? -6.966  -6.143  -6.713  1.00 1.00 ? 8   LYS A NZ   1  
ATOM   126   H H    . LYS A 1 8  ? -4.661  -7.032  -1.393  1.00 1.00 ? 8   LYS A H    1  
ATOM   127   H HA   . LYS A 1 8  ? -2.865  -6.960  -3.601  1.00 1.00 ? 8   LYS A HA   1  
ATOM   128   H HB2  . LYS A 1 8  ? -5.150  -5.188  -2.734  1.00 1.00 ? 8   LYS A HB2  1  
ATOM   129   H HB3  . LYS A 1 8  ? -4.215  -4.870  -4.194  1.00 1.00 ? 8   LYS A HB3  1  
ATOM   130   H HG2  . LYS A 1 8  ? -5.306  -7.628  -3.749  1.00 1.00 ? 8   LYS A HG2  1  
ATOM   131   H HG3  . LYS A 1 8  ? -6.403  -6.366  -4.296  1.00 1.00 ? 8   LYS A HG3  1  
ATOM   132   H HD2  . LYS A 1 8  ? -3.765  -6.653  -5.689  1.00 1.00 ? 8   LYS A HD2  1  
ATOM   133   H HD3  . LYS A 1 8  ? -5.033  -7.824  -6.045  1.00 1.00 ? 8   LYS A HD3  1  
ATOM   134   H HE2  . LYS A 1 8  ? -5.411  -4.819  -6.179  1.00 1.00 ? 8   LYS A HE2  1  
ATOM   135   H HE3  . LYS A 1 8  ? -5.061  -5.837  -7.576  1.00 1.00 ? 8   LYS A HE3  1  
ATOM   136   H HZ1  . LYS A 1 8  ? -7.232  -6.799  -5.953  1.00 1.00 ? 8   LYS A HZ1  1  
ATOM   137   H HZ2  . LYS A 1 8  ? -7.144  -6.591  -7.636  1.00 1.00 ? 8   LYS A HZ2  1  
ATOM   138   H HZ3  . LYS A 1 8  ? -7.530  -5.274  -6.635  1.00 1.00 ? 8   LYS A HZ3  1  
ATOM   139   N N    . VAL A 1 9  ? -2.629  -4.535  -1.372  1.00 1.00 ? 9   VAL A N    1  
ATOM   140   C CA   . VAL A 1 9  ? -1.747  -3.480  -0.886  1.00 1.00 ? 9   VAL A CA   1  
ATOM   141   C C    . VAL A 1 9  ? -0.382  -4.052  -0.522  1.00 1.00 ? 9   VAL A C    1  
ATOM   142   O O    . VAL A 1 9  ? 0.652   -3.509  -0.913  1.00 1.00 ? 9   VAL A O    1  
ATOM   143   C CB   . VAL A 1 9  ? -2.365  -2.813  0.344   1.00 1.00 ? 9   VAL A CB   1  
ATOM   144   C CG1  . VAL A 1 9  ? -1.399  -1.761  0.894   1.00 1.00 ? 9   VAL A CG1  1  
ATOM   145   C CG2  . VAL A 1 9  ? -3.683  -2.142  -0.047  1.00 1.00 ? 9   VAL A CG2  1  
ATOM   146   H H    . VAL A 1 9  ? -3.469  -4.717  -0.903  1.00 1.00 ? 9   VAL A H    1  
ATOM   147   H HA   . VAL A 1 9  ? -1.624  -2.738  -1.659  1.00 1.00 ? 9   VAL A HA   1  
ATOM   148   H HB   . VAL A 1 9  ? -2.552  -3.559  1.104   1.00 1.00 ? 9   VAL A HB   1  
ATOM   149   H HG11 . VAL A 1 9  ? -0.600  -2.250  1.431   1.00 1.00 ? 9   VAL A HG11 1  
ATOM   150   H HG12 . VAL A 1 9  ? -1.931  -1.099  1.563   1.00 1.00 ? 9   VAL A HG12 1  
ATOM   151   H HG13 . VAL A 1 9  ? -0.988  -1.190  0.075   1.00 1.00 ? 9   VAL A HG13 1  
ATOM   152   H HG21 . VAL A 1 9  ? -3.477  -1.206  -0.542  1.00 1.00 ? 9   VAL A HG21 1  
ATOM   153   H HG22 . VAL A 1 9  ? -4.270  -1.958  0.841   1.00 1.00 ? 9   VAL A HG22 1  
ATOM   154   H HG23 . VAL A 1 9  ? -4.232  -2.787  -0.714  1.00 1.00 ? 9   VAL A HG23 1  
ATOM   155   N N    . SER A 1 10 ? -0.383  -5.152  0.220   1.00 1.00 ? 10  SER A N    1  
ATOM   156   C CA   . SER A 1 10 ? 0.861   -5.794  0.621   1.00 1.00 ? 10  SER A CA   1  
ATOM   157   C C    . SER A 1 10 ? 1.614   -6.310  -0.606  1.00 1.00 ? 10  SER A C    1  
ATOM   158   O O    . SER A 1 10 ? 2.843   -6.338  -0.625  1.00 1.00 ? 10  SER A O    1  
ATOM   159   C CB   . SER A 1 10 ? 0.570   -6.962  1.565   1.00 1.00 ? 10  SER A CB   1  
ATOM   160   O OG   . SER A 1 10 ? -0.053  -8.013  0.842   1.00 1.00 ? 10  SER A OG   1  
ATOM   161   H H    . SER A 1 10 ? -1.237  -5.535  0.510   1.00 1.00 ? 10  SER A H    1  
ATOM   162   H HA   . SER A 1 10 ? 1.482   -5.076  1.133   1.00 1.00 ? 10  SER A HA   1  
ATOM   163   H HB2  . SER A 1 10 ? 1.492   -7.319  1.995   1.00 1.00 ? 10  SER A HB2  1  
ATOM   164   H HB3  . SER A 1 10 ? -0.087  -6.624  2.356   1.00 1.00 ? 10  SER A HB3  1  
ATOM   165   H HG   . SER A 1 10 ? 0.562   -8.313  0.168   1.00 1.00 ? 10  SER A HG   1  
ATOM   166   N N    . ASP A 1 11 ? 0.863   -6.720  -1.624  1.00 1.00 ? 11  ASP A N    1  
ATOM   167   C CA   . ASP A 1 11 ? 1.469   -7.247  -2.840  1.00 1.00 ? 11  ASP A CA   1  
ATOM   168   C C    . ASP A 1 11 ? 2.283   -6.168  -3.548  1.00 1.00 ? 11  ASP A C    1  
ATOM   169   O O    . ASP A 1 11 ? 3.340   -6.446  -4.111  1.00 1.00 ? 11  ASP A O    1  
ATOM   170   C CB   . ASP A 1 11 ? 0.378   -7.763  -3.782  1.00 1.00 ? 11  ASP A CB   1  
ATOM   171   C CG   . ASP A 1 11 ? 0.003   -9.196  -3.413  1.00 1.00 ? 11  ASP A CG   1  
ATOM   172   O OD1  . ASP A 1 11 ? 0.644   -9.747  -2.532  1.00 1.00 ? 11  ASP A OD1  1  
ATOM   173   O OD2  . ASP A 1 11 ? -0.919  -9.719  -4.012  1.00 1.00 ? 11  ASP A OD2  1  
ATOM   174   H H    . ASP A 1 11 ? -0.112  -6.667  -1.557  1.00 1.00 ? 11  ASP A H    1  
ATOM   175   H HA   . ASP A 1 11 ? 2.126   -8.063  -2.580  1.00 1.00 ? 11  ASP A HA   1  
ATOM   176   H HB2  . ASP A 1 11 ? -0.493  -7.133  -3.703  1.00 1.00 ? 11  ASP A HB2  1  
ATOM   177   H HB3  . ASP A 1 11 ? 0.741   -7.743  -4.798  1.00 1.00 ? 11  ASP A HB3  1  
ATOM   178   N N    . ILE A 1 12 ? 1.785   -4.938  -3.508  1.00 1.00 ? 12  ILE A N    1  
ATOM   179   C CA   . ILE A 1 12 ? 2.475   -3.830  -4.150  1.00 1.00 ? 12  ILE A CA   1  
ATOM   180   C C    . ILE A 1 12 ? 3.894   -3.694  -3.608  1.00 1.00 ? 12  ILE A C    1  
ATOM   181   O O    . ILE A 1 12 ? 4.837   -3.494  -4.369  1.00 1.00 ? 12  ILE A O    1  
ATOM   182   C CB   . ILE A 1 12 ? 1.705   -2.524  -3.915  1.00 1.00 ? 12  ILE A CB   1  
ATOM   183   C CG1  . ILE A 1 12 ? 0.726   -2.286  -5.067  1.00 1.00 ? 12  ILE A CG1  1  
ATOM   184   C CG2  . ILE A 1 12 ? 2.682   -1.351  -3.823  1.00 1.00 ? 12  ILE A CG2  1  
ATOM   185   C CD1  . ILE A 1 12 ? -0.422  -3.291  -4.985  1.00 1.00 ? 12  ILE A CD1  1  
ATOM   186   H H    . ILE A 1 12 ? 0.938   -4.775  -3.040  1.00 1.00 ? 12  ILE A H    1  
ATOM   187   H HA   . ILE A 1 12 ? 2.524   -4.015  -5.213  1.00 1.00 ? 12  ILE A HA   1  
ATOM   188   H HB   . ILE A 1 12 ? 1.150   -2.600  -2.987  1.00 1.00 ? 12  ILE A HB   1  
ATOM   189   H HG12 . ILE A 1 12 ? 0.337   -1.283  -5.007  1.00 1.00 ? 12  ILE A HG12 1  
ATOM   190   H HG13 . ILE A 1 12 ? 1.247   -2.411  -6.008  1.00 1.00 ? 12  ILE A HG13 1  
ATOM   191   H HG21 . ILE A 1 12 ? 3.386   -1.413  -4.643  1.00 1.00 ? 12  ILE A HG21 1  
ATOM   192   H HG22 . ILE A 1 12 ? 3.220   -1.405  -2.885  1.00 1.00 ? 12  ILE A HG22 1  
ATOM   193   H HG23 . ILE A 1 12 ? 2.143   -0.425  -3.877  1.00 1.00 ? 12  ILE A HG23 1  
ATOM   194   H HD11 . ILE A 1 12 ? -1.016  -3.231  -5.883  1.00 1.00 ? 12  ILE A HD11 1  
ATOM   195   H HD12 . ILE A 1 12 ? -1.038  -3.058  -4.129  1.00 1.00 ? 12  ILE A HD12 1  
ATOM   196   H HD13 . ILE A 1 12 ? -0.021  -4.288  -4.883  1.00 1.00 ? 12  ILE A HD13 1  
ATOM   197   N N    . VAL A 1 13 ? 4.027   -3.779  -2.292  1.00 1.00 ? 13  VAL A N    1  
ATOM   198   C CA   . VAL A 1 13 ? 5.331   -3.642  -1.660  1.00 1.00 ? 13  VAL A CA   1  
ATOM   199   C C    . VAL A 1 13 ? 6.283   -4.730  -2.141  1.00 1.00 ? 13  VAL A C    1  
ATOM   200   O O    . VAL A 1 13 ? 7.441   -4.458  -2.460  1.00 1.00 ? 13  VAL A O    1  
ATOM   201   C CB   . VAL A 1 13 ? 5.183   -3.730  -0.136  1.00 1.00 ? 13  VAL A CB   1  
ATOM   202   C CG1  . VAL A 1 13 ? 6.552   -3.541  0.522   1.00 1.00 ? 13  VAL A CG1  1  
ATOM   203   C CG2  . VAL A 1 13 ? 4.228   -2.637  0.349   1.00 1.00 ? 13  VAL A CG2  1  
ATOM   204   H H    . VAL A 1 13 ? 3.235   -3.944  -1.736  1.00 1.00 ? 13  VAL A H    1  
ATOM   205   H HA   . VAL A 1 13 ? 5.744   -2.675  -1.911  1.00 1.00 ? 13  VAL A HA   1  
ATOM   206   H HB   . VAL A 1 13 ? 4.788   -4.700  0.130   1.00 1.00 ? 13  VAL A HB   1  
ATOM   207   H HG11 . VAL A 1 13 ? 7.136   -4.442  0.406   1.00 1.00 ? 13  VAL A HG11 1  
ATOM   208   H HG12 . VAL A 1 13 ? 6.420   -3.329  1.574   1.00 1.00 ? 13  VAL A HG12 1  
ATOM   209   H HG13 . VAL A 1 13 ? 7.066   -2.716  0.052   1.00 1.00 ? 13  VAL A HG13 1  
ATOM   210   H HG21 . VAL A 1 13 ? 3.288   -2.724  -0.174  1.00 1.00 ? 13  VAL A HG21 1  
ATOM   211   H HG22 . VAL A 1 13 ? 4.662   -1.668  0.150   1.00 1.00 ? 13  VAL A HG22 1  
ATOM   212   H HG23 . VAL A 1 13 ? 4.064   -2.750  1.410   1.00 1.00 ? 13  VAL A HG23 1  
ATOM   213   N N    . LYS A 1 14 ? 5.789   -5.961  -2.190  1.00 1.00 ? 14  LYS A N    1  
ATOM   214   C CA   . LYS A 1 14 ? 6.612   -7.084  -2.619  1.00 1.00 ? 14  LYS A CA   1  
ATOM   215   C C    . LYS A 1 14 ? 7.076   -6.901  -4.054  1.00 1.00 ? 14  LYS A C    1  
ATOM   216   O O    . LYS A 1 14 ? 8.211   -7.232  -4.398  1.00 1.00 ? 14  LYS A O    1  
ATOM   217   C CB   . LYS A 1 14 ? 5.814   -8.384  -2.501  1.00 1.00 ? 14  LYS A CB   1  
ATOM   218   C CG   . LYS A 1 14 ? 5.285   -8.536  -1.071  1.00 1.00 ? 14  LYS A CG   1  
ATOM   219   C CD   . LYS A 1 14 ? 5.103   -10.021 -0.742  1.00 1.00 ? 14  LYS A CD   1  
ATOM   220   C CE   . LYS A 1 14 ? 5.880   -10.360 0.533   1.00 1.00 ? 14  LYS A CE   1  
ATOM   221   N NZ   . LYS A 1 14 ? 5.095   -9.924  1.721   1.00 1.00 ? 14  LYS A NZ   1  
ATOM   222   H H    . LYS A 1 14 ? 4.855   -6.116  -1.936  1.00 1.00 ? 14  LYS A H    1  
ATOM   223   H HA   . LYS A 1 14 ? 7.477   -7.152  -1.971  1.00 1.00 ? 14  LYS A HA   1  
ATOM   224   H HB2  . LYS A 1 14 ? 4.987   -8.367  -3.192  1.00 1.00 ? 14  LYS A HB2  1  
ATOM   225   H HB3  . LYS A 1 14 ? 6.460   -9.221  -2.736  1.00 1.00 ? 14  LYS A HB3  1  
ATOM   226   H HG2  . LYS A 1 14 ? 5.983   -8.088  -0.380  1.00 1.00 ? 14  LYS A HG2  1  
ATOM   227   H HG3  . LYS A 1 14 ? 4.331   -8.031  -0.989  1.00 1.00 ? 14  LYS A HG3  1  
ATOM   228   H HD2  . LYS A 1 14 ? 4.055   -10.234 -0.593  1.00 1.00 ? 14  LYS A HD2  1  
ATOM   229   H HD3  . LYS A 1 14 ? 5.476   -10.624 -1.556  1.00 1.00 ? 14  LYS A HD3  1  
ATOM   230   H HE2  . LYS A 1 14 ? 6.050   -11.420 0.578   1.00 1.00 ? 14  LYS A HE2  1  
ATOM   231   H HE3  . LYS A 1 14 ? 6.832   -9.847  0.526   1.00 1.00 ? 14  LYS A HE3  1  
ATOM   232   H HZ1  . LYS A 1 14 ? 5.218   -10.614 2.489   1.00 1.00 ? 14  LYS A HZ1  1  
ATOM   233   H HZ2  . LYS A 1 14 ? 4.088   -9.862  1.467   1.00 1.00 ? 14  LYS A HZ2  1  
ATOM   234   H HZ3  . LYS A 1 14 ? 5.430   -8.992  2.038   1.00 1.00 ? 14  LYS A HZ3  1  
ATOM   235   N N    . GLU A 1 15 ? 6.191   -6.375  -4.893  1.00 1.00 ? 15  GLU A N    1  
ATOM   236   C CA   . GLU A 1 15 ? 6.516   -6.164  -6.299  1.00 1.00 ? 15  GLU A CA   1  
ATOM   237   C C    . GLU A 1 15 ? 7.694   -5.215  -6.447  1.00 1.00 ? 15  GLU A C    1  
ATOM   238   O O    . GLU A 1 15 ? 8.349   -5.179  -7.490  1.00 1.00 ? 15  GLU A O    1  
ATOM   239   C CB   . GLU A 1 15 ? 5.300   -5.598  -7.037  1.00 1.00 ? 15  GLU A CB   1  
ATOM   240   C CG   . GLU A 1 15 ? 4.225   -6.679  -7.163  1.00 1.00 ? 15  GLU A CG   1  
ATOM   241   C CD   . GLU A 1 15 ? 2.959   -6.087  -7.771  1.00 1.00 ? 15  GLU A CD   1  
ATOM   242   O OE1  . GLU A 1 15 ? 2.964   -4.903  -8.068  1.00 1.00 ? 15  GLU A OE1  1  
ATOM   243   O OE2  . GLU A 1 15 ? 1.999   -6.824  -7.929  1.00 1.00 ? 15  GLU A OE2  1  
ATOM   244   H H    . GLU A 1 15 ? 5.306   -6.116  -4.559  1.00 1.00 ? 15  GLU A H    1  
ATOM   245   H HA   . GLU A 1 15 ? 6.773   -7.118  -6.740  1.00 1.00 ? 15  GLU A HA   1  
ATOM   246   H HB2  . GLU A 1 15 ? 4.903   -4.760  -6.480  1.00 1.00 ? 15  GLU A HB2  1  
ATOM   247   H HB3  . GLU A 1 15 ? 5.597   -5.269  -8.020  1.00 1.00 ? 15  GLU A HB3  1  
ATOM   248   H HG2  . GLU A 1 15 ? 4.589   -7.474  -7.800  1.00 1.00 ? 15  GLU A HG2  1  
ATOM   249   H HG3  . GLU A 1 15 ? 4.001   -7.080  -6.188  1.00 1.00 ? 15  GLU A HG3  1  
ATOM   250   N N    . LYS A 1 16 ? 7.961   -4.445  -5.400  1.00 1.00 ? 16  LYS A N    1  
ATOM   251   C CA   . LYS A 1 16 ? 9.061   -3.486  -5.426  1.00 1.00 ? 16  LYS A CA   1  
ATOM   252   C C    . LYS A 1 16 ? 10.391  -4.209  -5.591  1.00 1.00 ? 16  LYS A C    1  
ATOM   253   O O    . LYS A 1 16 ? 11.267  -3.762  -6.334  1.00 1.00 ? 16  LYS A O    1  
ATOM   254   C CB   . LYS A 1 16 ? 9.076   -2.676  -4.129  1.00 1.00 ? 16  LYS A CB   1  
ATOM   255   C CG   . LYS A 1 16 ? 7.698   -2.055  -3.900  1.00 1.00 ? 16  LYS A CG   1  
ATOM   256   C CD   . LYS A 1 16 ? 7.487   -0.894  -4.873  1.00 1.00 ? 16  LYS A CD   1  
ATOM   257   C CE   . LYS A 1 16 ? 8.319   0.306   -4.422  1.00 1.00 ? 16  LYS A CE   1  
ATOM   258   N NZ   . LYS A 1 16 ? 7.771   1.549   -5.034  1.00 1.00 ? 16  LYS A NZ   1  
ATOM   259   H H    . LYS A 1 16 ? 7.406   -4.517  -4.594  1.00 1.00 ? 16  LYS A H    1  
ATOM   260   H HA   . LYS A 1 16 ? 8.926   -2.821  -6.260  1.00 1.00 ? 16  LYS A HA   1  
ATOM   261   H HB2  . LYS A 1 16 ? 9.325   -3.319  -3.302  1.00 1.00 ? 16  LYS A HB2  1  
ATOM   262   H HB3  . LYS A 1 16 ? 9.814   -1.892  -4.207  1.00 1.00 ? 16  LYS A HB3  1  
ATOM   263   H HG2  . LYS A 1 16 ? 6.938   -2.803  -4.061  1.00 1.00 ? 16  LYS A HG2  1  
ATOM   264   H HG3  . LYS A 1 16 ? 7.629   -1.693  -2.885  1.00 1.00 ? 16  LYS A HG3  1  
ATOM   265   H HD2  . LYS A 1 16 ? 7.792   -1.192  -5.862  1.00 1.00 ? 16  LYS A HD2  1  
ATOM   266   H HD3  . LYS A 1 16 ? 6.442   -0.623  -4.889  1.00 1.00 ? 16  LYS A HD3  1  
ATOM   267   H HE2  . LYS A 1 16 ? 8.282   0.391   -3.346  1.00 1.00 ? 16  LYS A HE2  1  
ATOM   268   H HE3  . LYS A 1 16 ? 9.344   0.175   -4.738  1.00 1.00 ? 16  LYS A HE3  1  
ATOM   269   H HZ1  . LYS A 1 16 ? 6.889   1.327   -5.537  1.00 1.00 ? 16  LYS A HZ1  1  
ATOM   270   H HZ2  . LYS A 1 16 ? 8.465   1.942   -5.702  1.00 1.00 ? 16  LYS A HZ2  1  
ATOM   271   H HZ3  . LYS A 1 16 ? 7.576   2.246   -4.287  1.00 1.00 ? 16  LYS A HZ3  1  
ATOM   272   N N    . LEU A 1 17 ? 10.544  -5.331  -4.891  1.00 1.00 ? 17  LEU A N    1  
ATOM   273   C CA   . LEU A 1 17 ? 11.774  -6.109  -4.966  1.00 1.00 ? 17  LEU A CA   1  
ATOM   274   C C    . LEU A 1 17 ? 11.471  -7.561  -5.322  1.00 1.00 ? 17  LEU A C    1  
ATOM   275   O O    . LEU A 1 17 ? 12.268  -8.458  -5.044  1.00 1.00 ? 17  LEU A O    1  
ATOM   276   C CB   . LEU A 1 17 ? 12.515  -6.054  -3.631  1.00 1.00 ? 17  LEU A CB   1  
ATOM   277   C CG   . LEU A 1 17 ? 11.588  -6.541  -2.513  1.00 1.00 ? 17  LEU A CG   1  
ATOM   278   C CD1  . LEU A 1 17 ? 12.425  -6.944  -1.296  1.00 1.00 ? 17  LEU A CD1  1  
ATOM   279   C CD2  . LEU A 1 17 ? 10.621  -5.421  -2.122  1.00 1.00 ? 17  LEU A CD2  1  
ATOM   280   H H    . LEU A 1 17 ? 9.815   -5.640  -4.315  1.00 1.00 ? 17  LEU A H    1  
ATOM   281   H HA   . LEU A 1 17 ? 12.410  -5.691  -5.735  1.00 1.00 ? 17  LEU A HA   1  
ATOM   282   H HB2  . LEU A 1 17 ? 13.390  -6.681  -3.674  1.00 1.00 ? 17  LEU A HB2  1  
ATOM   283   H HB3  . LEU A 1 17 ? 12.817  -5.034  -3.429  1.00 1.00 ? 17  LEU A HB3  1  
ATOM   284   H HG   . LEU A 1 17 ? 11.027  -7.395  -2.857  1.00 1.00 ? 17  LEU A HG   1  
ATOM   285   H HD11 . LEU A 1 17 ? 12.964  -6.081  -0.931  1.00 1.00 ? 17  LEU A HD11 1  
ATOM   286   H HD12 . LEU A 1 17 ? 13.124  -7.713  -1.579  1.00 1.00 ? 17  LEU A HD12 1  
ATOM   287   H HD13 . LEU A 1 17 ? 11.773  -7.313  -0.519  1.00 1.00 ? 17  LEU A HD13 1  
ATOM   288   H HD21 . LEU A 1 17 ? 9.705   -5.524  -2.683  1.00 1.00 ? 17  LEU A HD21 1  
ATOM   289   H HD22 . LEU A 1 17 ? 11.070  -4.462  -2.336  1.00 1.00 ? 17  LEU A HD22 1  
ATOM   290   H HD23 . LEU A 1 17 ? 10.403  -5.483  -1.067  1.00 1.00 ? 17  LEU A HD23 1  
ATOM   291   N N    . ALA A 1 18 ? 10.313  -7.786  -5.930  1.00 1.00 ? 18  ALA A N    1  
ATOM   292   C CA   . ALA A 1 18 ? 9.917   -9.133  -6.325  1.00 1.00 ? 18  ALA A CA   1  
ATOM   293   C C    . ALA A 1 18 ? 9.932   -10.072 -5.130  1.00 1.00 ? 18  ALA A C    1  
ATOM   294   O O    . ALA A 1 18 ? 10.909  -10.785 -4.896  1.00 1.00 ? 18  ALA A O    1  
ATOM   295   C CB   . ALA A 1 18 ? 10.873  -9.661  -7.400  1.00 1.00 ? 18  ALA A CB   1  
ATOM   296   H H    . ALA A 1 18 ? 9.712   -7.035  -6.119  1.00 1.00 ? 18  ALA A H    1  
ATOM   297   H HA   . ALA A 1 18 ? 8.918   -9.101  -6.734  1.00 1.00 ? 18  ALA A HA   1  
ATOM   298   H HB1  . ALA A 1 18 ? 10.533  -10.627 -7.742  1.00 1.00 ? 18  ALA A HB1  1  
ATOM   299   H HB2  . ALA A 1 18 ? 11.866  -9.755  -6.984  1.00 1.00 ? 18  ALA A HB2  1  
ATOM   300   H HB3  . ALA A 1 18 ? 10.896  -8.971  -8.232  1.00 1.00 ? 18  ALA A HB3  1  
ATOM   301   N N    . LEU A 1 19 ? 8.843   -10.070 -4.366  1.00 1.00 ? 19  LEU A N    1  
ATOM   302   C CA   . LEU A 1 19 ? 8.736   -10.931 -3.196  1.00 1.00 ? 19  LEU A CA   1  
ATOM   303   C C    . LEU A 1 19 ? 7.424   -11.711 -3.223  1.00 1.00 ? 19  LEU A C    1  
ATOM   304   O O    . LEU A 1 19 ? 6.717   -11.723 -4.227  1.00 1.00 ? 19  LEU A O    1  
ATOM   305   C CB   . LEU A 1 19 ? 8.807   -10.094 -1.919  1.00 1.00 ? 19  LEU A CB   1  
ATOM   306   C CG   . LEU A 1 19 ? 10.059  -10.481 -1.120  1.00 1.00 ? 19  LEU A CG   1  
ATOM   307   C CD1  . LEU A 1 19 ? 11.304  -10.273 -1.989  1.00 1.00 ? 19  LEU A CD1  1  
ATOM   308   C CD2  . LEU A 1 19 ? 10.154  -9.611  0.133   1.00 1.00 ? 19  LEU A CD2  1  
ATOM   309   H H    . LEU A 1 19 ? 8.095   -9.476  -4.596  1.00 1.00 ? 19  LEU A H    1  
ATOM   310   H HA   . LEU A 1 19 ? 9.552   -11.639 -3.202  1.00 1.00 ? 19  LEU A HA   1  
ATOM   311   H HB2  . LEU A 1 19 ? 8.863   -9.046  -2.180  1.00 1.00 ? 19  LEU A HB2  1  
ATOM   312   H HB3  . LEU A 1 19 ? 7.936   -10.268 -1.317  1.00 1.00 ? 19  LEU A HB3  1  
ATOM   313   H HG   . LEU A 1 19 ? 9.991   -11.523 -0.837  1.00 1.00 ? 19  LEU A HG   1  
ATOM   314   H HD11 . LEU A 1 19 ? 12.071  -9.783  -1.409  1.00 1.00 ? 19  LEU A HD11 1  
ATOM   315   H HD12 . LEU A 1 19 ? 11.053  -9.661  -2.842  1.00 1.00 ? 19  LEU A HD12 1  
ATOM   316   H HD13 . LEU A 1 19 ? 11.670  -11.230 -2.332  1.00 1.00 ? 19  LEU A HD13 1  
ATOM   317   H HD21 . LEU A 1 19 ? 9.901   -8.593  -0.119  1.00 1.00 ? 19  LEU A HD21 1  
ATOM   318   H HD22 . LEU A 1 19 ? 11.166  -9.647  0.514   1.00 1.00 ? 19  LEU A HD22 1  
ATOM   319   H HD23 . LEU A 1 19 ? 9.474   -9.981  0.879   1.00 1.00 ? 19  LEU A HD23 1  
ATOM   320   N N    . GLY A 1 20 ? 7.101   -12.353 -2.100  1.00 1.00 ? 20  GLY A N    1  
ATOM   321   C CA   . GLY A 1 20 ? 5.872   -13.128 -2.004  1.00 1.00 ? 20  GLY A CA   1  
ATOM   322   C C    . GLY A 1 20 ? 6.126   -14.596 -2.320  1.00 1.00 ? 20  GLY A C    1  
ATOM   323   O O    . GLY A 1 20 ? 5.200   -15.405 -2.346  1.00 1.00 ? 20  GLY A O    1  
ATOM   324   H H    . GLY A 1 20 ? 7.704   -12.304 -1.328  1.00 1.00 ? 20  GLY A H    1  
ATOM   325   H HA2  . GLY A 1 20 ? 5.477   -13.042 -1.002  1.00 1.00 ? 20  GLY A HA2  1  
ATOM   326   H HA3  . GLY A 1 20 ? 5.147   -12.735 -2.703  1.00 1.00 ? 20  GLY A HA3  1  
ATOM   327   N N    . ALA A 1 21 ? 7.389   -14.935 -2.556  1.00 1.00 ? 21  ALA A N    1  
ATOM   328   C CA   . ALA A 1 21 ? 7.757   -16.313 -2.863  1.00 1.00 ? 21  ALA A CA   1  
ATOM   329   C C    . ALA A 1 21 ? 7.901   -17.124 -1.582  1.00 1.00 ? 21  ALA A C    1  
ATOM   330   O O    . ALA A 1 21 ? 7.068   -17.979 -1.278  1.00 1.00 ? 21  ALA A O    1  
ATOM   331   C CB   . ALA A 1 21 ? 9.075   -16.341 -3.637  1.00 1.00 ? 21  ALA A CB   1  
ATOM   332   H H    . ALA A 1 21 ? 8.087   -14.247 -2.524  1.00 1.00 ? 21  ALA A H    1  
ATOM   333   H HA   . ALA A 1 21 ? 6.984   -16.755 -3.471  1.00 1.00 ? 21  ALA A HA   1  
ATOM   334   H HB1  . ALA A 1 21 ? 9.844   -15.848 -3.059  1.00 1.00 ? 21  ALA A HB1  1  
ATOM   335   H HB2  . ALA A 1 21 ? 8.950   -15.829 -4.579  1.00 1.00 ? 21  ALA A HB2  1  
ATOM   336   H HB3  . ALA A 1 21 ? 9.364   -17.366 -3.820  1.00 1.00 ? 21  ALA A HB3  1  
ATOM   337   N N    . ASP A 1 22 ? 8.964   -16.854 -0.829  1.00 1.00 ? 22  ASP A N    1  
ATOM   338   C CA   . ASP A 1 22 ? 9.205   -17.564 0.422   1.00 1.00 ? 22  ASP A CA   1  
ATOM   339   C C    . ASP A 1 22 ? 9.126   -16.605 1.603   1.00 1.00 ? 22  ASP A C    1  
ATOM   340   O O    . ASP A 1 22 ? 9.670   -16.877 2.676   1.00 1.00 ? 22  ASP A O    1  
ATOM   341   C CB   . ASP A 1 22 ? 10.584  -18.224 0.391   1.00 1.00 ? 22  ASP A CB   1  
ATOM   342   C CG   . ASP A 1 22 ? 10.566  -19.418 -0.559  1.00 1.00 ? 22  ASP A CG   1  
ATOM   343   O OD1  . ASP A 1 22 ? 9.484   -19.851 -0.916  1.00 1.00 ? 22  ASP A OD1  1  
ATOM   344   O OD2  . ASP A 1 22 ? 11.638  -19.880 -0.917  1.00 1.00 ? 22  ASP A OD2  1  
ATOM   345   H H    . ASP A 1 22 ? 9.597   -16.166 -1.122  1.00 1.00 ? 22  ASP A H    1  
ATOM   346   H HA   . ASP A 1 22 ? 8.454   -18.329 0.545   1.00 1.00 ? 22  ASP A HA   1  
ATOM   347   H HB2  . ASP A 1 22 ? 11.317  -17.508 0.053   1.00 1.00 ? 22  ASP A HB2  1  
ATOM   348   H HB3  . ASP A 1 22 ? 10.842  -18.562 1.383   1.00 1.00 ? 22  ASP A HB3  1  
ATOM   349   N N    . VAL A 1 23 ? 8.448   -15.478 1.404   1.00 1.00 ? 23  VAL A N    1  
ATOM   350   C CA   . VAL A 1 23 ? 8.313   -14.483 2.461   1.00 1.00 ? 23  VAL A CA   1  
ATOM   351   C C    . VAL A 1 23 ? 6.863   -14.376 2.919   1.00 1.00 ? 23  VAL A C    1  
ATOM   352   O O    . VAL A 1 23 ? 5.949   -14.289 2.100   1.00 1.00 ? 23  VAL A O    1  
ATOM   353   C CB   . VAL A 1 23 ? 8.789   -13.117 1.952   1.00 1.00 ? 23  VAL A CB   1  
ATOM   354   C CG1  . VAL A 1 23 ? 8.661   -12.083 3.072   1.00 1.00 ? 23  VAL A CG1  1  
ATOM   355   C CG2  . VAL A 1 23 ? 10.252  -13.218 1.514   1.00 1.00 ? 23  VAL A CG2  1  
ATOM   356   H H    . VAL A 1 23 ? 8.033   -15.315 0.532   1.00 1.00 ? 23  VAL A H    1  
ATOM   357   H HA   . VAL A 1 23 ? 8.926   -14.771 3.302   1.00 1.00 ? 23  VAL A HA   1  
ATOM   358   H HB   . VAL A 1 23 ? 8.180   -12.816 1.113   1.00 1.00 ? 23  VAL A HB   1  
ATOM   359   H HG11 . VAL A 1 23 ? 9.240   -11.207 2.821   1.00 1.00 ? 23  VAL A HG11 1  
ATOM   360   H HG12 . VAL A 1 23 ? 9.030   -12.505 3.997   1.00 1.00 ? 23  VAL A HG12 1  
ATOM   361   H HG13 . VAL A 1 23 ? 7.624   -11.808 3.190   1.00 1.00 ? 23  VAL A HG13 1  
ATOM   362   H HG21 . VAL A 1 23 ? 10.314  -13.774 0.590   1.00 1.00 ? 23  VAL A HG21 1  
ATOM   363   H HG22 . VAL A 1 23 ? 10.822  -13.724 2.279   1.00 1.00 ? 23  VAL A HG22 1  
ATOM   364   H HG23 . VAL A 1 23 ? 10.651  -12.225 1.365   1.00 1.00 ? 23  VAL A HG23 1  
ATOM   365   N N    . VAL A 1 24 ? 6.662   -14.387 4.232   1.00 1.00 ? 24  VAL A N    1  
ATOM   366   C CA   . VAL A 1 24 ? 5.318   -14.287 4.789   1.00 1.00 ? 24  VAL A CA   1  
ATOM   367   C C    . VAL A 1 24 ? 4.803   -12.857 4.688   1.00 1.00 ? 24  VAL A C    1  
ATOM   368   O O    . VAL A 1 24 ? 5.536   -11.900 4.949   1.00 1.00 ? 24  VAL A O    1  
ATOM   369   C CB   . VAL A 1 24 ? 5.325   -14.726 6.254   1.00 1.00 ? 24  VAL A CB   1  
ATOM   370   C CG1  . VAL A 1 24 ? 6.110   -13.710 7.087   1.00 1.00 ? 24  VAL A CG1  1  
ATOM   371   C CG2  . VAL A 1 24 ? 3.887   -14.805 6.770   1.00 1.00 ? 24  VAL A CG2  1  
ATOM   372   H H    . VAL A 1 24 ? 7.429   -14.463 4.836   1.00 1.00 ? 24  VAL A H    1  
ATOM   373   H HA   . VAL A 1 24 ? 4.658   -14.935 4.233   1.00 1.00 ? 24  VAL A HA   1  
ATOM   374   H HB   . VAL A 1 24 ? 5.794   -15.696 6.336   1.00 1.00 ? 24  VAL A HB   1  
ATOM   375   H HG11 . VAL A 1 24 ? 5.510   -12.825 7.236   1.00 1.00 ? 24  VAL A HG11 1  
ATOM   376   H HG12 . VAL A 1 24 ? 7.022   -13.445 6.569   1.00 1.00 ? 24  VAL A HG12 1  
ATOM   377   H HG13 . VAL A 1 24 ? 6.357   -14.143 8.045   1.00 1.00 ? 24  VAL A HG13 1  
ATOM   378   H HG21 . VAL A 1 24 ? 3.329   -15.509 6.172   1.00 1.00 ? 24  VAL A HG21 1  
ATOM   379   H HG22 . VAL A 1 24 ? 3.427   -13.831 6.704   1.00 1.00 ? 24  VAL A HG22 1  
ATOM   380   H HG23 . VAL A 1 24 ? 3.892   -15.130 7.800   1.00 1.00 ? 24  VAL A HG23 1  
ATOM   381   N N    . VAL A 1 25 ? 3.536   -12.712 4.312   1.00 1.00 ? 25  VAL A N    1  
ATOM   382   C CA   . VAL A 1 25 ? 2.936   -11.391 4.176   1.00 1.00 ? 25  VAL A CA   1  
ATOM   383   C C    . VAL A 1 25 ? 1.921   -11.148 5.286   1.00 1.00 ? 25  VAL A C    1  
ATOM   384   O O    . VAL A 1 25 ? 1.080   -12.001 5.575   1.00 1.00 ? 25  VAL A O    1  
ATOM   385   C CB   . VAL A 1 25 ? 2.241   -11.269 2.818   1.00 1.00 ? 25  VAL A CB   1  
ATOM   386   C CG1  . VAL A 1 25 ? 1.048   -12.226 2.766   1.00 1.00 ? 25  VAL A CG1  1  
ATOM   387   C CG2  . VAL A 1 25 ? 1.750   -9.833  2.623   1.00 1.00 ? 25  VAL A CG2  1  
ATOM   388   H H    . VAL A 1 25 ? 2.999   -13.508 4.117   1.00 1.00 ? 25  VAL A H    1  
ATOM   389   H HA   . VAL A 1 25 ? 3.709   -10.640 4.239   1.00 1.00 ? 25  VAL A HA   1  
ATOM   390   H HB   . VAL A 1 25 ? 2.939   -11.522 2.034   1.00 1.00 ? 25  VAL A HB   1  
ATOM   391   H HG11 . VAL A 1 25 ? 1.349   -13.195 3.135   1.00 1.00 ? 25  VAL A HG11 1  
ATOM   392   H HG12 . VAL A 1 25 ? 0.706   -12.319 1.746   1.00 1.00 ? 25  VAL A HG12 1  
ATOM   393   H HG13 . VAL A 1 25 ? 0.249   -11.839 3.380   1.00 1.00 ? 25  VAL A HG13 1  
ATOM   394   H HG21 . VAL A 1 25 ? 2.530   -9.144  2.913   1.00 1.00 ? 25  VAL A HG21 1  
ATOM   395   H HG22 . VAL A 1 25 ? 0.876   -9.664  3.233   1.00 1.00 ? 25  VAL A HG22 1  
ATOM   396   H HG23 . VAL A 1 25 ? 1.501   -9.676  1.583   1.00 1.00 ? 25  VAL A HG23 1  
ATOM   397   N N    . THR A 1 26 ? 2.004   -9.978  5.913   1.00 1.00 ? 26  THR A N    1  
ATOM   398   C CA   . THR A 1 26 ? 1.087   -9.628  6.993   1.00 1.00 ? 26  THR A CA   1  
ATOM   399   C C    . THR A 1 26 ? 0.555   -8.213  6.809   1.00 1.00 ? 26  THR A C    1  
ATOM   400   O O    . THR A 1 26 ? 1.162   -7.396  6.116   1.00 1.00 ? 26  THR A O    1  
ATOM   401   C CB   . THR A 1 26 ? 1.801   -9.740  8.340   1.00 1.00 ? 26  THR A CB   1  
ATOM   402   O OG1  . THR A 1 26 ? 3.043   -9.057  8.272   1.00 1.00 ? 26  THR A OG1  1  
ATOM   403   C CG2  . THR A 1 26 ? 2.040   -11.211 8.674   1.00 1.00 ? 26  THR A CG2  1  
ATOM   404   H H    . THR A 1 26 ? 2.694   -9.336  5.645   1.00 1.00 ? 26  THR A H    1  
ATOM   405   H HA   . THR A 1 26 ? 0.253   -10.319 6.981   1.00 1.00 ? 26  THR A HA   1  
ATOM   406   H HB   . THR A 1 26 ? 1.187   -9.293  9.110   1.00 1.00 ? 26  THR A HB   1  
ATOM   407   H HG1  . THR A 1 26 ? 3.646   -9.478  8.890   1.00 1.00 ? 26  THR A HG1  1  
ATOM   408   H HG21 . THR A 1 26 ? 1.105   -11.676 8.949   1.00 1.00 ? 26  THR A HG21 1  
ATOM   409   H HG22 . THR A 1 26 ? 2.735   -11.285 9.499   1.00 1.00 ? 26  THR A HG22 1  
ATOM   410   H HG23 . THR A 1 26 ? 2.453   -11.713 7.810   1.00 1.00 ? 26  THR A HG23 1  
ATOM   411   N N    . ALA A 1 27 ? -0.585  -7.927  7.433   1.00 1.00 ? 27  ALA A N    1  
ATOM   412   C CA   . ALA A 1 27 ? -1.188  -6.605  7.329   1.00 1.00 ? 27  ALA A CA   1  
ATOM   413   C C    . ALA A 1 27 ? -0.651  -5.679  8.414   1.00 1.00 ? 27  ALA A C    1  
ATOM   414   O O    . ALA A 1 27 ? -0.554  -4.470  8.220   1.00 1.00 ? 27  ALA A O    1  
ATOM   415   C CB   . ALA A 1 27 ? -2.711  -6.718  7.458   1.00 1.00 ? 27  ALA A CB   1  
ATOM   416   H H    . ALA A 1 27 ? -1.022  -8.616  7.972   1.00 1.00 ? 27  ALA A H    1  
ATOM   417   H HA   . ALA A 1 27 ? -0.953  -6.185  6.361   1.00 1.00 ? 27  ALA A HA   1  
ATOM   418   H HB1  . ALA A 1 27 ? -3.034  -7.675  7.077   1.00 1.00 ? 27  ALA A HB1  1  
ATOM   419   H HB2  . ALA A 1 27 ? -3.180  -5.925  6.893   1.00 1.00 ? 27  ALA A HB2  1  
ATOM   420   H HB3  . ALA A 1 27 ? -2.993  -6.633  8.498   1.00 1.00 ? 27  ALA A HB3  1  
ATOM   421   N N    . ASP A 1 28 ? -0.309  -6.259  9.561   1.00 1.00 ? 28  ASP A N    1  
ATOM   422   C CA   . ASP A 1 28 ? 0.207   -5.475  10.676  1.00 1.00 ? 28  ASP A CA   1  
ATOM   423   C C    . ASP A 1 28 ? 1.675   -5.135  10.459  1.00 1.00 ? 28  ASP A C    1  
ATOM   424   O O    . ASP A 1 28 ? 2.290   -4.444  11.272  1.00 1.00 ? 28  ASP A O    1  
ATOM   425   C CB   . ASP A 1 28 ? 0.049   -6.258  11.980  1.00 1.00 ? 28  ASP A CB   1  
ATOM   426   C CG   . ASP A 1 28 ? -1.431  -6.427  12.312  1.00 1.00 ? 28  ASP A CG   1  
ATOM   427   O OD1  . ASP A 1 28 ? -2.244  -5.824  11.631  1.00 1.00 ? 28  ASP A OD1  1  
ATOM   428   O OD2  . ASP A 1 28 ? -1.730  -7.159  13.242  1.00 1.00 ? 28  ASP A OD2  1  
ATOM   429   H H    . ASP A 1 28 ? -0.405  -7.228  9.658   1.00 1.00 ? 28  ASP A H    1  
ATOM   430   H HA   . ASP A 1 28 ? -0.359  -4.556  10.747  1.00 1.00 ? 28  ASP A HA   1  
ATOM   431   H HB2  . ASP A 1 28 ? 0.505   -7.231  11.872  1.00 1.00 ? 28  ASP A HB2  1  
ATOM   432   H HB3  . ASP A 1 28 ? 0.534   -5.721  12.782  1.00 1.00 ? 28  ASP A HB3  1  
ATOM   433   N N    . SER A 1 29 ? 2.236   -5.626  9.358   1.00 1.00 ? 29  SER A N    1  
ATOM   434   C CA   . SER A 1 29 ? 3.636   -5.366  9.043   1.00 1.00 ? 29  SER A CA   1  
ATOM   435   C C    . SER A 1 29 ? 3.787   -4.008  8.368   1.00 1.00 ? 29  SER A C    1  
ATOM   436   O O    . SER A 1 29 ? 3.595   -3.879  7.159   1.00 1.00 ? 29  SER A O    1  
ATOM   437   C CB   . SER A 1 29 ? 4.173   -6.460  8.119   1.00 1.00 ? 29  SER A CB   1  
ATOM   438   O OG   . SER A 1 29 ? 5.244   -5.938  7.345   1.00 1.00 ? 29  SER A OG   1  
ATOM   439   H H    . SER A 1 29 ? 1.697   -6.172  8.747   1.00 1.00 ? 29  SER A H    1  
ATOM   440   H HA   . SER A 1 29 ? 4.206   -5.368  9.959   1.00 1.00 ? 29  SER A HA   1  
ATOM   441   H HB2  . SER A 1 29 ? 4.532   -7.289  8.709   1.00 1.00 ? 29  SER A HB2  1  
ATOM   442   H HB3  . SER A 1 29 ? 3.382   -6.801  7.466   1.00 1.00 ? 29  SER A HB3  1  
ATOM   443   H HG   . SER A 1 29 ? 5.032   -6.074  6.417   1.00 1.00 ? 29  SER A HG   1  
ATOM   444   N N    . GLU A 1 30 ? 4.138   -2.996  9.156   1.00 1.00 ? 30  GLU A N    1  
ATOM   445   C CA   . GLU A 1 30 ? 4.306   -1.648  8.625   1.00 1.00 ? 30  GLU A CA   1  
ATOM   446   C C    . GLU A 1 30 ? 5.019   -1.690  7.276   1.00 1.00 ? 30  GLU A C    1  
ATOM   447   O O    . GLU A 1 30 ? 5.806   -2.598  7.008   1.00 1.00 ? 30  GLU A O    1  
ATOM   448   C CB   . GLU A 1 30 ? 5.121   -0.803  9.607   1.00 1.00 ? 30  GLU A CB   1  
ATOM   449   C CG   . GLU A 1 30 ? 4.325   -0.615  10.900  1.00 1.00 ? 30  GLU A CG   1  
ATOM   450   C CD   . GLU A 1 30 ? 5.197   0.058   11.955  1.00 1.00 ? 30  GLU A CD   1  
ATOM   451   O OE1  . GLU A 1 30 ? 6.315   0.422   11.627  1.00 1.00 ? 30  GLU A OE1  1  
ATOM   452   O OE2  . GLU A 1 30 ? 4.735   0.199   13.075  1.00 1.00 ? 30  GLU A OE2  1  
ATOM   453   H H    . GLU A 1 30 ? 4.279   -3.158  10.113  1.00 1.00 ? 30  GLU A H    1  
ATOM   454   H HA   . GLU A 1 30 ? 3.337   -1.199  8.496   1.00 1.00 ? 30  GLU A HA   1  
ATOM   455   H HB2  . GLU A 1 30 ? 6.054   -1.298  9.825   1.00 1.00 ? 30  GLU A HB2  1  
ATOM   456   H HB3  . GLU A 1 30 ? 5.321   0.165   9.167   1.00 1.00 ? 30  GLU A HB3  1  
ATOM   457   H HG2  . GLU A 1 30 ? 3.462   0.002   10.704  1.00 1.00 ? 30  GLU A HG2  1  
ATOM   458   H HG3  . GLU A 1 30 ? 4.003   -1.579  11.264  1.00 1.00 ? 30  GLU A HG3  1  
ATOM   459   N N    . PHE A 1 31 ? 4.739   -0.703  6.434   1.00 1.00 ? 31  PHE A N    1  
ATOM   460   C CA   . PHE A 1 31 ? 5.357   -0.639  5.116   1.00 1.00 ? 31  PHE A CA   1  
ATOM   461   C C    . PHE A 1 31 ? 6.877   -0.605  5.239   1.00 1.00 ? 31  PHE A C    1  
ATOM   462   O O    . PHE A 1 31 ? 7.585   -1.246  4.464   1.00 1.00 ? 31  PHE A O    1  
ATOM   463   C CB   . PHE A 1 31 ? 4.878   0.613   4.376   1.00 1.00 ? 31  PHE A CB   1  
ATOM   464   C CG   . PHE A 1 31 ? 3.453   0.412   3.918   1.00 1.00 ? 31  PHE A CG   1  
ATOM   465   C CD1  . PHE A 1 31 ? 3.196   -0.199  2.684   1.00 1.00 ? 31  PHE A CD1  1  
ATOM   466   C CD2  . PHE A 1 31 ? 2.391   0.836   4.725   1.00 1.00 ? 31  PHE A CD2  1  
ATOM   467   C CE1  . PHE A 1 31 ? 1.875   -0.386  2.258   1.00 1.00 ? 31  PHE A CE1  1  
ATOM   468   C CE2  . PHE A 1 31 ? 1.072   0.650   4.299   1.00 1.00 ? 31  PHE A CE2  1  
ATOM   469   C CZ   . PHE A 1 31 ? 0.812   0.038   3.065   1.00 1.00 ? 31  PHE A CZ   1  
ATOM   470   H H    . PHE A 1 31 ? 4.100   -0.008  6.702   1.00 1.00 ? 31  PHE A H    1  
ATOM   471   H HA   . PHE A 1 31 ? 5.070   -1.511  4.549   1.00 1.00 ? 31  PHE A HA   1  
ATOM   472   H HB2  . PHE A 1 31 ? 4.923   1.462   5.040   1.00 1.00 ? 31  PHE A HB2  1  
ATOM   473   H HB3  . PHE A 1 31 ? 5.508   0.786   3.519   1.00 1.00 ? 31  PHE A HB3  1  
ATOM   474   H HD1  . PHE A 1 31 ? 4.014   -0.526  2.062   1.00 1.00 ? 31  PHE A HD1  1  
ATOM   475   H HD2  . PHE A 1 31 ? 2.590   1.308   5.675   1.00 1.00 ? 31  PHE A HD2  1  
ATOM   476   H HE1  . PHE A 1 31 ? 1.675   -0.857  1.308   1.00 1.00 ? 31  PHE A HE1  1  
ATOM   477   H HE2  . PHE A 1 31 ? 0.252   0.978   4.922   1.00 1.00 ? 31  PHE A HE2  1  
ATOM   478   H HZ   . PHE A 1 31 ? -0.204  -0.106  2.737   1.00 1.00 ? 31  PHE A HZ   1  
ATOM   479   N N    . SER A 1 32 ? 7.371   0.144   6.219   1.00 1.00 ? 32  SER A N    1  
ATOM   480   C CA   . SER A 1 32 ? 8.809   0.256   6.430   1.00 1.00 ? 32  SER A CA   1  
ATOM   481   C C    . SER A 1 32 ? 9.426   -1.117  6.660   1.00 1.00 ? 32  SER A C    1  
ATOM   482   O O    . SER A 1 32 ? 8.833   -1.975  7.312   1.00 1.00 ? 32  SER A O    1  
ATOM   483   C CB   . SER A 1 32 ? 9.089   1.150   7.640   1.00 1.00 ? 32  SER A CB   1  
ATOM   484   O OG   . SER A 1 32 ? 10.478  1.122   7.937   1.00 1.00 ? 32  SER A OG   1  
ATOM   485   H H    . SER A 1 32 ? 6.757   0.632   6.809   1.00 1.00 ? 32  SER A H    1  
ATOM   486   H HA   . SER A 1 32 ? 9.258   0.702   5.555   1.00 1.00 ? 32  SER A HA   1  
ATOM   487   H HB2  . SER A 1 32 ? 8.794   2.165   7.418   1.00 1.00 ? 32  SER A HB2  1  
ATOM   488   H HB3  . SER A 1 32 ? 8.526   0.792   8.490   1.00 1.00 ? 32  SER A HB3  1  
ATOM   489   H HG   . SER A 1 32 ? 10.932  1.661   7.288   1.00 1.00 ? 32  SER A HG   1  
ATOM   490   N N    . LYS A 1 33 ? 10.622  -1.321  6.114   1.00 1.00 ? 33  LYS A N    1  
ATOM   491   C CA   . LYS A 1 33 ? 11.311  -2.597  6.264   1.00 1.00 ? 33  LYS A CA   1  
ATOM   492   C C    . LYS A 1 33 ? 12.823  -2.401  6.198   1.00 1.00 ? 33  LYS A C    1  
ATOM   493   O O    . LYS A 1 33 ? 13.310  -1.465  5.564   1.00 1.00 ? 33  LYS A O    1  
ATOM   494   C CB   . LYS A 1 33 ? 10.870  -3.562  5.163   1.00 1.00 ? 33  LYS A CB   1  
ATOM   495   C CG   . LYS A 1 33 ? 11.458  -4.948  5.432   1.00 1.00 ? 33  LYS A CG   1  
ATOM   496   C CD   . LYS A 1 33 ? 10.927  -5.939  4.394   1.00 1.00 ? 33  LYS A CD   1  
ATOM   497   C CE   . LYS A 1 33 ? 11.488  -7.332  4.684   1.00 1.00 ? 33  LYS A CE   1  
ATOM   498   N NZ   . LYS A 1 33 ? 12.958  -7.336  4.440   1.00 1.00 ? 33  LYS A NZ   1  
ATOM   499   H H    . LYS A 1 33 ? 11.048  -0.602  5.604   1.00 1.00 ? 33  LYS A H    1  
ATOM   500   H HA   . LYS A 1 33 ? 11.056  -3.023  7.225   1.00 1.00 ? 33  LYS A HA   1  
ATOM   501   H HB2  . LYS A 1 33 ? 9.793   -3.623  5.147   1.00 1.00 ? 33  LYS A HB2  1  
ATOM   502   H HB3  . LYS A 1 33 ? 11.224  -3.202  4.208   1.00 1.00 ? 33  LYS A HB3  1  
ATOM   503   H HG2  . LYS A 1 33 ? 12.535  -4.902  5.368   1.00 1.00 ? 33  LYS A HG2  1  
ATOM   504   H HG3  . LYS A 1 33 ? 11.170  -5.275  6.421   1.00 1.00 ? 33  LYS A HG3  1  
ATOM   505   H HD2  . LYS A 1 33 ? 9.848   -5.968  4.444   1.00 1.00 ? 33  LYS A HD2  1  
ATOM   506   H HD3  . LYS A 1 33 ? 11.234  -5.626  3.408   1.00 1.00 ? 33  LYS A HD3  1  
ATOM   507   H HE2  . LYS A 1 33 ? 11.293  -7.592  5.714   1.00 1.00 ? 33  LYS A HE2  1  
ATOM   508   H HE3  . LYS A 1 33 ? 11.014  -8.053  4.035   1.00 1.00 ? 33  LYS A HE3  1  
ATOM   509   H HZ1  . LYS A 1 33 ? 13.448  -6.938  5.267   1.00 1.00 ? 33  LYS A HZ1  1  
ATOM   510   H HZ2  . LYS A 1 33 ? 13.171  -6.759  3.600   1.00 1.00 ? 33  LYS A HZ2  1  
ATOM   511   H HZ3  . LYS A 1 33 ? 13.282  -8.310  4.282   1.00 1.00 ? 33  LYS A HZ3  1  
ATOM   512   N N    . LEU A 1 34 ? 13.560  -3.290  6.857   1.00 1.00 ? 34  LEU A N    1  
ATOM   513   C CA   . LEU A 1 34 ? 15.015  -3.201  6.868   1.00 1.00 ? 34  LEU A CA   1  
ATOM   514   C C    . LEU A 1 34 ? 15.573  -3.404  5.466   1.00 1.00 ? 34  LEU A C    1  
ATOM   515   O O    . LEU A 1 34 ? 15.198  -4.344  4.766   1.00 1.00 ? 34  LEU A O    1  
ATOM   516   C CB   . LEU A 1 34 ? 15.592  -4.263  7.807   1.00 1.00 ? 34  LEU A CB   1  
ATOM   517   C CG   . LEU A 1 34 ? 17.120  -4.183  7.787   1.00 1.00 ? 34  LEU A CG   1  
ATOM   518   C CD1  . LEU A 1 34 ? 17.569  -2.784  8.214   1.00 1.00 ? 34  LEU A CD1  1  
ATOM   519   C CD2  . LEU A 1 34 ? 17.697  -5.220  8.756   1.00 1.00 ? 34  LEU A CD2  1  
ATOM   520   H H    . LEU A 1 34 ? 13.116  -4.016  7.344   1.00 1.00 ? 34  LEU A H    1  
ATOM   521   H HA   . LEU A 1 34 ? 15.300  -2.224  7.224   1.00 1.00 ? 34  LEU A HA   1  
ATOM   522   H HB2  . LEU A 1 34 ? 15.237  -4.085  8.813   1.00 1.00 ? 34  LEU A HB2  1  
ATOM   523   H HB3  . LEU A 1 34 ? 15.279  -5.243  7.483   1.00 1.00 ? 34  LEU A HB3  1  
ATOM   524   H HG   . LEU A 1 34 ? 17.480  -4.388  6.789   1.00 1.00 ? 34  LEU A HG   1  
ATOM   525   H HD11 . LEU A 1 34 ? 18.563  -2.830  8.625   1.00 1.00 ? 34  LEU A HD11 1  
ATOM   526   H HD12 . LEU A 1 34 ? 16.887  -2.399  8.961   1.00 1.00 ? 34  LEU A HD12 1  
ATOM   527   H HD13 . LEU A 1 34 ? 17.566  -2.128  7.355   1.00 1.00 ? 34  LEU A HD13 1  
ATOM   528   H HD21 . LEU A 1 34 ? 17.346  -6.202  8.482   1.00 1.00 ? 34  LEU A HD21 1  
ATOM   529   H HD22 . LEU A 1 34 ? 17.378  -4.987  9.761   1.00 1.00 ? 34  LEU A HD22 1  
ATOM   530   H HD23 . LEU A 1 34 ? 18.776  -5.195  8.707   1.00 1.00 ? 34  LEU A HD23 1  
ATOM   531   N N    . GLY A 1 35 ? 16.479  -2.517  5.062   1.00 1.00 ? 35  GLY A N    1  
ATOM   532   C CA   . GLY A 1 35 ? 17.084  -2.607  3.737   1.00 1.00 ? 35  GLY A CA   1  
ATOM   533   C C    . GLY A 1 35 ? 17.017  -1.265  3.017   1.00 1.00 ? 35  GLY A C    1  
ATOM   534   O O    . GLY A 1 35 ? 15.984  -0.905  2.453   1.00 1.00 ? 35  GLY A O    1  
ATOM   535   H H    . GLY A 1 35 ? 16.741  -1.789  5.663   1.00 1.00 ? 35  GLY A H    1  
ATOM   536   H HA2  . GLY A 1 35 ? 18.117  -2.903  3.841   1.00 1.00 ? 35  GLY A HA2  1  
ATOM   537   H HA3  . GLY A 1 35 ? 16.558  -3.348  3.153   1.00 1.00 ? 35  GLY A HA3  1  
ATOM   538   N N    . ALA A 1 36 ? 18.124  -0.530  3.039   1.00 1.00 ? 36  ALA A N    1  
ATOM   539   C CA   . ALA A 1 36 ? 18.179  0.772   2.384   1.00 1.00 ? 36  ALA A CA   1  
ATOM   540   C C    . ALA A 1 36 ? 17.254  1.763   3.085   1.00 1.00 ? 36  ALA A C    1  
ATOM   541   O O    . ALA A 1 36 ? 17.622  2.915   3.311   1.00 1.00 ? 36  ALA A O    1  
ATOM   542   C CB   . ALA A 1 36 ? 17.766  0.636   0.918   1.00 1.00 ? 36  ALA A CB   1  
ATOM   543   H H    . ALA A 1 36 ? 18.918  -0.869  3.503   1.00 1.00 ? 36  ALA A H    1  
ATOM   544   H HA   . ALA A 1 36 ? 19.190  1.145   2.430   1.00 1.00 ? 36  ALA A HA   1  
ATOM   545   H HB1  . ALA A 1 36 ? 18.150  1.475   0.356   1.00 1.00 ? 36  ALA A HB1  1  
ATOM   546   H HB2  . ALA A 1 36 ? 16.690  0.617   0.845   1.00 1.00 ? 36  ALA A HB2  1  
ATOM   547   H HB3  . ALA A 1 36 ? 18.170  -0.282  0.513   1.00 1.00 ? 36  ALA A HB3  1  
ATOM   548   N N    . ASP A 1 37 ? 16.052  1.308   3.420   1.00 1.00 ? 37  ASP A N    1  
ATOM   549   C CA   . ASP A 1 37 ? 15.084  2.162   4.095   1.00 1.00 ? 37  ASP A CA   1  
ATOM   550   C C    . ASP A 1 37 ? 14.828  3.428   3.285   1.00 1.00 ? 37  ASP A C    1  
ATOM   551   O O    . ASP A 1 37 ? 14.590  4.498   3.845   1.00 1.00 ? 37  ASP A O    1  
ATOM   552   C CB   . ASP A 1 37 ? 15.601  2.539   5.485   1.00 1.00 ? 37  ASP A CB   1  
ATOM   553   C CG   . ASP A 1 37 ? 15.537  1.330   6.411   1.00 1.00 ? 37  ASP A CG   1  
ATOM   554   O OD1  . ASP A 1 37 ? 14.849  0.382   6.070   1.00 1.00 ? 37  ASP A OD1  1  
ATOM   555   O OD2  . ASP A 1 37 ? 16.180  1.369   7.448   1.00 1.00 ? 37  ASP A OD2  1  
ATOM   556   H H    . ASP A 1 37 ? 15.812  0.380   3.211   1.00 1.00 ? 37  ASP A H    1  
ATOM   557   H HA   . ASP A 1 37 ? 14.154  1.623   4.204   1.00 1.00 ? 37  ASP A HA   1  
ATOM   558   H HB2  . ASP A 1 37 ? 16.623  2.879   5.408   1.00 1.00 ? 37  ASP A HB2  1  
ATOM   559   H HB3  . ASP A 1 37 ? 14.991  3.333   5.891   1.00 1.00 ? 37  ASP A HB3  1  
ATOM   560   N N    . SER A 1 38 ? 14.881  3.300   1.964   1.00 1.00 ? 38  SER A N    1  
ATOM   561   C CA   . SER A 1 38 ? 14.653  4.441   1.085   1.00 1.00 ? 38  SER A CA   1  
ATOM   562   C C    . SER A 1 38 ? 13.165  4.765   1.004   1.00 1.00 ? 38  SER A C    1  
ATOM   563   O O    . SER A 1 38 ? 12.318  3.917   1.285   1.00 1.00 ? 38  SER A O    1  
ATOM   564   C CB   . SER A 1 38 ? 15.186  4.136   -0.316  1.00 1.00 ? 38  SER A CB   1  
ATOM   565   H H    . SER A 1 38 ? 15.077  2.423   1.573   1.00 1.00 ? 38  SER A H    1  
ATOM   566   H HA   . SER A 1 38 ? 15.177  5.297   1.479   1.00 1.00 ? 38  SER A HA   1  
ATOM   567   H HB2  . SER A 1 38 ? 14.970  4.968   -0.972  1.00 1.00 ? 38  SER A HB2  1  
ATOM   568   H HB3  . SER A 1 38 ? 14.711  3.246   -0.698  1.00 1.00 ? 38  SER A HB3  1  
ATOM   569   N N    . LEU A 1 39 ? 12.854  5.998   0.615   1.00 1.00 ? 39  LEU A N    1  
ATOM   570   C CA   . LEU A 1 39 ? 11.462  6.423   0.500   1.00 1.00 ? 39  LEU A CA   1  
ATOM   571   C C    . LEU A 1 39 ? 10.890  6.014   -0.848  1.00 1.00 ? 39  LEU A C    1  
ATOM   572   O O    . LEU A 1 39 ? 11.509  6.231   -1.891  1.00 1.00 ? 39  LEU A O    1  
ATOM   573   C CB   . LEU A 1 39 ? 11.370  7.942   0.658   1.00 1.00 ? 39  LEU A CB   1  
ATOM   574   C CG   . LEU A 1 39 ? 11.487  8.312   2.139   1.00 1.00 ? 39  LEU A CG   1  
ATOM   575   C CD1  . LEU A 1 39 ? 10.232  7.850   2.884   1.00 1.00 ? 39  LEU A CD1  1  
ATOM   576   C CD2  . LEU A 1 39 ? 12.719  7.624   2.738   1.00 1.00 ? 39  LEU A CD2  1  
ATOM   577   H H    . LEU A 1 39 ? 13.571  6.632   0.407   1.00 1.00 ? 39  LEU A H    1  
ATOM   578   H HA   . LEU A 1 39 ? 10.886  5.951   1.280   1.00 1.00 ? 39  LEU A HA   1  
ATOM   579   H HB2  . LEU A 1 39 ? 12.167  8.412   0.104   1.00 1.00 ? 39  LEU A HB2  1  
ATOM   580   H HB3  . LEU A 1 39 ? 10.417  8.286   0.277   1.00 1.00 ? 39  LEU A HB3  1  
ATOM   581   H HG   . LEU A 1 39 ? 11.589  9.381   2.236   1.00 1.00 ? 39  LEU A HG   1  
ATOM   582   H HD11 . LEU A 1 39 ? 10.380  6.846   3.257   1.00 1.00 ? 39  LEU A HD11 1  
ATOM   583   H HD12 . LEU A 1 39 ? 9.386   7.860   2.212   1.00 1.00 ? 39  LEU A HD12 1  
ATOM   584   H HD13 . LEU A 1 39 ? 10.040  8.513   3.711   1.00 1.00 ? 39  LEU A HD13 1  
ATOM   585   H HD21 . LEU A 1 39 ? 13.554  7.734   2.064   1.00 1.00 ? 39  LEU A HD21 1  
ATOM   586   H HD22 . LEU A 1 39 ? 12.507  6.575   2.885   1.00 1.00 ? 39  LEU A HD22 1  
ATOM   587   H HD23 . LEU A 1 39 ? 12.956  8.079   3.687   1.00 1.00 ? 39  LEU A HD23 1  
ATOM   588   N N    . ASP A 1 40 ? 9.700   5.420   -0.826  1.00 1.00 ? 40  ASP A N    1  
ATOM   589   C CA   . ASP A 1 40 ? 9.050   4.981   -2.057  1.00 1.00 ? 40  ASP A CA   1  
ATOM   590   C C    . ASP A 1 40 ? 7.563   5.314   -2.026  1.00 1.00 ? 40  ASP A C    1  
ATOM   591   O O    . ASP A 1 40 ? 6.755   4.655   -2.682  1.00 1.00 ? 40  ASP A O    1  
ATOM   592   C CB   . ASP A 1 40 ? 9.235   3.473   -2.236  1.00 1.00 ? 40  ASP A CB   1  
ATOM   593   C CG   . ASP A 1 40 ? 10.677  3.167   -2.625  1.00 1.00 ? 40  ASP A CG   1  
ATOM   594   O OD1  . ASP A 1 40 ? 11.405  4.102   -2.911  1.00 1.00 ? 40  ASP A OD1  1  
ATOM   595   O OD2  . ASP A 1 40 ? 11.033  1.999   -2.632  1.00 1.00 ? 40  ASP A OD2  1  
ATOM   596   H H    . ASP A 1 40 ? 9.252   5.274   0.032   1.00 1.00 ? 40  ASP A H    1  
ATOM   597   H HA   . ASP A 1 40 ? 9.505   5.489   -2.896  1.00 1.00 ? 40  ASP A HA   1  
ATOM   598   H HB2  . ASP A 1 40 ? 9.000   2.972   -1.308  1.00 1.00 ? 40  ASP A HB2  1  
ATOM   599   H HB3  . ASP A 1 40 ? 8.573   3.121   -3.011  1.00 1.00 ? 40  ASP A HB3  1  
ATOM   600   N N    . THR A 1 41 ? 7.206   6.340   -1.262  1.00 1.00 ? 41  THR A N    1  
ATOM   601   C CA   . THR A 1 41 ? 5.812   6.751   -1.152  1.00 1.00 ? 41  THR A CA   1  
ATOM   602   C C    . THR A 1 41 ? 5.262   7.148   -2.519  1.00 1.00 ? 41  THR A C    1  
ATOM   603   O O    . THR A 1 41 ? 4.139   6.793   -2.870  1.00 1.00 ? 41  THR A O    1  
ATOM   604   C CB   . THR A 1 41 ? 5.689   7.932   -0.187  1.00 1.00 ? 41  THR A CB   1  
ATOM   605   O OG1  . THR A 1 41 ? 6.389   7.635   1.013   1.00 1.00 ? 41  THR A OG1  1  
ATOM   606   C CG2  . THR A 1 41 ? 4.214   8.182   0.130   1.00 1.00 ? 41  THR A CG2  1  
ATOM   607   H H    . THR A 1 41 ? 7.893   6.829   -0.761  1.00 1.00 ? 41  THR A H    1  
ATOM   608   H HA   . THR A 1 41 ? 5.232   5.924   -0.769  1.00 1.00 ? 41  THR A HA   1  
ATOM   609   H HB   . THR A 1 41 ? 6.112   8.815   -0.643  1.00 1.00 ? 41  THR A HB   1  
ATOM   610   H HG1  . THR A 1 41 ? 7.276   7.356   0.778   1.00 1.00 ? 41  THR A HG1  1  
ATOM   611   H HG21 . THR A 1 41 ? 4.116   9.098   0.694   1.00 1.00 ? 41  THR A HG21 1  
ATOM   612   H HG22 . THR A 1 41 ? 3.827   7.359   0.713   1.00 1.00 ? 41  THR A HG22 1  
ATOM   613   H HG23 . THR A 1 41 ? 3.655   8.264   -0.791  1.00 1.00 ? 41  THR A HG23 1  
ATOM   614   N N    . VAL A 1 42 ? 6.059   7.889   -3.278  1.00 1.00 ? 42  VAL A N    1  
ATOM   615   C CA   . VAL A 1 42 ? 5.643   8.334   -4.604  1.00 1.00 ? 42  VAL A CA   1  
ATOM   616   C C    . VAL A 1 42 ? 5.397   7.135   -5.513  1.00 1.00 ? 42  VAL A C    1  
ATOM   617   O O    . VAL A 1 42 ? 4.432   7.108   -6.275  1.00 1.00 ? 42  VAL A O    1  
ATOM   618   C CB   . VAL A 1 42 ? 6.712   9.240   -5.213  1.00 1.00 ? 42  VAL A CB   1  
ATOM   619   C CG1  . VAL A 1 42 ? 6.320   9.604   -6.645  1.00 1.00 ? 42  VAL A CG1  1  
ATOM   620   C CG2  . VAL A 1 42 ? 6.835   10.517  -4.378  1.00 1.00 ? 42  VAL A CG2  1  
ATOM   621   H H    . VAL A 1 42 ? 6.947   8.141   -2.945  1.00 1.00 ? 42  VAL A H    1  
ATOM   622   H HA   . VAL A 1 42 ? 4.722   8.894   -4.508  1.00 1.00 ? 42  VAL A HA   1  
ATOM   623   H HB   . VAL A 1 42 ? 7.660   8.720   -5.221  1.00 1.00 ? 42  VAL A HB   1  
ATOM   624   H HG11 . VAL A 1 42 ? 5.283   9.907   -6.668  1.00 1.00 ? 42  VAL A HG11 1  
ATOM   625   H HG12 . VAL A 1 42 ? 6.454   8.743   -7.286  1.00 1.00 ? 42  VAL A HG12 1  
ATOM   626   H HG13 . VAL A 1 42 ? 6.939   10.415  -6.994  1.00 1.00 ? 42  VAL A HG13 1  
ATOM   627   H HG21 . VAL A 1 42 ? 7.704   11.073  -4.698  1.00 1.00 ? 42  VAL A HG21 1  
ATOM   628   H HG22 . VAL A 1 42 ? 6.938   10.256  -3.336  1.00 1.00 ? 42  VAL A HG22 1  
ATOM   629   H HG23 . VAL A 1 42 ? 5.950   11.121  -4.513  1.00 1.00 ? 42  VAL A HG23 1  
ATOM   630   N N    . GLU A 1 43 ? 6.298   6.163   -5.458  1.00 1.00 ? 43  GLU A N    1  
ATOM   631   C CA   . GLU A 1 43 ? 6.164   4.964   -6.269  1.00 1.00 ? 43  GLU A CA   1  
ATOM   632   C C    . GLU A 1 43 ? 5.082   4.042   -5.719  1.00 1.00 ? 43  GLU A C    1  
ATOM   633   O O    . GLU A 1 43 ? 4.310   3.449   -6.468  1.00 1.00 ? 43  GLU A O    1  
ATOM   634   C CB   . GLU A 1 43 ? 7.499   4.216   -6.323  1.00 1.00 ? 43  GLU A CB   1  
ATOM   635   C CG   . GLU A 1 43 ? 8.524   5.052   -7.092  1.00 1.00 ? 43  GLU A CG   1  
ATOM   636   C CD   . GLU A 1 43 ? 9.881   4.357   -7.076  1.00 1.00 ? 43  GLU A CD   1  
ATOM   637   O OE1  . GLU A 1 43 ? 9.962   3.269   -6.529  1.00 1.00 ? 43  GLU A OE1  1  
ATOM   638   O OE2  . GLU A 1 43 ? 10.820  4.922   -7.612  1.00 1.00 ? 43  GLU A OE2  1  
ATOM   639   H H    . GLU A 1 43 ? 7.052   6.239   -4.834  1.00 1.00 ? 43  GLU A H    1  
ATOM   640   H HA   . GLU A 1 43 ? 5.891   5.255   -7.278  1.00 1.00 ? 43  GLU A HA   1  
ATOM   641   H HB2  . GLU A 1 43 ? 7.855   4.047   -5.316  1.00 1.00 ? 43  GLU A HB2  1  
ATOM   642   H HB3  . GLU A 1 43 ? 7.364   3.267   -6.820  1.00 1.00 ? 43  GLU A HB3  1  
ATOM   643   H HG2  . GLU A 1 43 ? 8.195   5.171   -8.113  1.00 1.00 ? 43  GLU A HG2  1  
ATOM   644   H HG3  . GLU A 1 43 ? 8.614   6.023   -6.627  1.00 1.00 ? 43  GLU A HG3  1  
ATOM   645   N N    . ILE A 1 44 ? 5.049   3.913   -4.392  1.00 1.00 ? 44  ILE A N    1  
ATOM   646   C CA   . ILE A 1 44 ? 4.079   3.038   -3.756  1.00 1.00 ? 44  ILE A CA   1  
ATOM   647   C C    . ILE A 1 44 ? 2.662   3.547   -3.935  1.00 1.00 ? 44  ILE A C    1  
ATOM   648   O O    . ILE A 1 44 ? 1.757   2.788   -4.278  1.00 1.00 ? 44  ILE A O    1  
ATOM   649   C CB   . ILE A 1 44 ? 4.396   2.924   -2.253  1.00 1.00 ? 44  ILE A CB   1  
ATOM   650   C CG1  . ILE A 1 44 ? 5.700   2.145   -2.058  1.00 1.00 ? 44  ILE A CG1  1  
ATOM   651   C CG2  . ILE A 1 44 ? 3.249   2.195   -1.542  1.00 1.00 ? 44  ILE A CG2  1  
ATOM   652   C CD1  . ILE A 1 44 ? 5.404   0.643   -2.014  1.00 1.00 ? 44  ILE A CD1  1  
ATOM   653   H H    . ILE A 1 44 ? 5.674   4.429   -3.843  1.00 1.00 ? 44  ILE A H    1  
ATOM   654   H HA   . ILE A 1 44 ? 4.162   2.049   -4.193  1.00 1.00 ? 44  ILE A HA   1  
ATOM   655   H HB   . ILE A 1 44 ? 4.501   3.915   -1.836  1.00 1.00 ? 44  ILE A HB   1  
ATOM   656   H HG12 . ILE A 1 44 ? 6.371   2.353   -2.879  1.00 1.00 ? 44  ILE A HG12 1  
ATOM   657   H HG13 . ILE A 1 44 ? 6.163   2.448   -1.131  1.00 1.00 ? 44  ILE A HG13 1  
ATOM   658   H HG21 . ILE A 1 44 ? 2.945   1.345   -2.141  1.00 1.00 ? 44  ILE A HG21 1  
ATOM   659   H HG22 . ILE A 1 44 ? 2.420   2.863   -1.417  1.00 1.00 ? 44  ILE A HG22 1  
ATOM   660   H HG23 . ILE A 1 44 ? 3.591   1.847   -0.578  1.00 1.00 ? 44  ILE A HG23 1  
ATOM   661   H HD11 . ILE A 1 44 ? 6.303   0.092   -2.199  1.00 1.00 ? 44  ILE A HD11 1  
ATOM   662   H HD12 . ILE A 1 44 ? 4.666   0.402   -2.766  1.00 1.00 ? 44  ILE A HD12 1  
ATOM   663   H HD13 . ILE A 1 44 ? 5.011   0.386   -1.038  1.00 1.00 ? 44  ILE A HD13 1  
ATOM   664   N N    . VAL A 1 45 ? 2.476   4.843   -3.711  1.00 1.00 ? 45  VAL A N    1  
ATOM   665   C CA   . VAL A 1 45 ? 1.152   5.442   -3.823  1.00 1.00 ? 45  VAL A CA   1  
ATOM   666   C C    . VAL A 1 45 ? 0.603   5.284   -5.233  1.00 1.00 ? 45  VAL A C    1  
ATOM   667   O O    . VAL A 1 45 ? -0.565  4.944   -5.421  1.00 1.00 ? 45  VAL A O    1  
ATOM   668   C CB   . VAL A 1 45 ? 1.222   6.930   -3.464  1.00 1.00 ? 45  VAL A CB   1  
ATOM   669   C CG1  . VAL A 1 45 ? 2.074   7.663   -4.502  1.00 1.00 ? 45  VAL A CG1  1  
ATOM   670   C CG2  . VAL A 1 45 ? -0.190  7.519   -3.453  1.00 1.00 ? 45  VAL A CG2  1  
ATOM   671   H H    . VAL A 1 45 ? 3.240   5.404   -3.461  1.00 1.00 ? 45  VAL A H    1  
ATOM   672   H HA   . VAL A 1 45 ? 0.486   4.951   -3.127  1.00 1.00 ? 45  VAL A HA   1  
ATOM   673   H HB   . VAL A 1 45 ? 1.669   7.046   -2.486  1.00 1.00 ? 45  VAL A HB   1  
ATOM   674   H HG11 . VAL A 1 45 ? 2.912   7.046   -4.778  1.00 1.00 ? 45  VAL A HG11 1  
ATOM   675   H HG12 . VAL A 1 45 ? 2.432   8.592   -4.083  1.00 1.00 ? 45  VAL A HG12 1  
ATOM   676   H HG13 . VAL A 1 45 ? 1.475   7.871   -5.377  1.00 1.00 ? 45  VAL A HG13 1  
ATOM   677   H HG21 . VAL A 1 45 ? -0.165  8.505   -3.013  1.00 1.00 ? 45  VAL A HG21 1  
ATOM   678   H HG22 . VAL A 1 45 ? -0.842  6.882   -2.875  1.00 1.00 ? 45  VAL A HG22 1  
ATOM   679   H HG23 . VAL A 1 45 ? -0.558  7.587   -4.468  1.00 1.00 ? 45  VAL A HG23 1  
ATOM   680   N N    . MET A 1 46 ? 1.454   5.531   -6.223  1.00 1.00 ? 46  MET A N    1  
ATOM   681   C CA   . MET A 1 46 ? 1.044   5.418   -7.617  1.00 1.00 ? 46  MET A CA   1  
ATOM   682   C C    . MET A 1 46 ? 0.663   3.980   -7.952  1.00 1.00 ? 46  MET A C    1  
ATOM   683   O O    . MET A 1 46 ? -0.283  3.735   -8.698  1.00 1.00 ? 46  MET A O    1  
ATOM   684   C CB   . MET A 1 46 ? 2.174   5.880   -8.536  1.00 1.00 ? 46  MET A CB   1  
ATOM   685   C CG   . MET A 1 46 ? 2.267   7.407   -8.508  1.00 1.00 ? 46  MET A CG   1  
ATOM   686   S SD   . MET A 1 46 ? 0.645   8.122   -8.879  1.00 1.00 ? 46  MET A SD   1  
ATOM   687   C CE   . MET A 1 46 ? 0.409   7.324   -10.486 1.00 1.00 ? 46  MET A CE   1  
ATOM   688   H H    . MET A 1 46 ? 2.374   5.794   -6.014  1.00 1.00 ? 46  MET A H    1  
ATOM   689   H HA   . MET A 1 46 ? 0.180   6.048   -7.775  1.00 1.00 ? 46  MET A HA   1  
ATOM   690   H HB2  . MET A 1 46 ? 3.109   5.456   -8.194  1.00 1.00 ? 46  MET A HB2  1  
ATOM   691   H HB3  . MET A 1 46 ? 1.980   5.548   -9.543  1.00 1.00 ? 46  MET A HB3  1  
ATOM   692   H HG2  . MET A 1 46 ? 2.588   7.730   -7.529  1.00 1.00 ? 46  MET A HG2  1  
ATOM   693   H HG3  . MET A 1 46 ? 2.982   7.737   -9.247  1.00 1.00 ? 46  MET A HG3  1  
ATOM   694   H HE1  . MET A 1 46 ? -0.252  7.926   -11.091 1.00 1.00 ? 46  MET A HE1  1  
ATOM   695   H HE2  . MET A 1 46 ? -0.026  6.344   -10.346 1.00 1.00 ? 46  MET A HE2  1  
ATOM   696   H HE3  . MET A 1 46 ? 1.365   7.224   -10.980 1.00 1.00 ? 46  MET A HE3  1  
ATOM   697   N N    . ASN A 1 47 ? 1.413   3.035   -7.394  1.00 1.00 ? 47  ASN A N    1  
ATOM   698   C CA   . ASN A 1 47 ? 1.146   1.621   -7.643  1.00 1.00 ? 47  ASN A CA   1  
ATOM   699   C C    . ASN A 1 47 ? -0.261  1.254   -7.176  1.00 1.00 ? 47  ASN A C    1  
ATOM   700   O O    . ASN A 1 47 ? -1.010  0.595   -7.897  1.00 1.00 ? 47  ASN A O    1  
ATOM   701   C CB   . ASN A 1 47 ? 2.171   0.761   -6.900  1.00 1.00 ? 47  ASN A CB   1  
ATOM   702   C CG   . ASN A 1 47 ? 2.274   -0.611  -7.558  1.00 1.00 ? 47  ASN A CG   1  
ATOM   703   O OD1  . ASN A 1 47 ? 3.141   -1.409  -7.201  1.00 1.00 ? 47  ASN A OD1  1  
ATOM   704   N ND2  . ASN A 1 47 ? 1.433   -0.935  -8.503  1.00 1.00 ? 47  ASN A ND2  1  
ATOM   705   H H    . ASN A 1 47 ? 2.157   3.289   -6.812  1.00 1.00 ? 47  ASN A H    1  
ATOM   706   H HA   . ASN A 1 47 ? 1.226   1.429   -8.699  1.00 1.00 ? 47  ASN A HA   1  
ATOM   707   H HB2  . ASN A 1 47 ? 3.135   1.246   -6.931  1.00 1.00 ? 47  ASN A HB2  1  
ATOM   708   H HB3  . ASN A 1 47 ? 1.862   0.643   -5.874  1.00 1.00 ? 47  ASN A HB3  1  
ATOM   709   H HD21 . ASN A 1 47 ? 0.743   -0.299  -8.784  1.00 1.00 ? 47  ASN A HD21 1  
ATOM   710   H HD22 . ASN A 1 47 ? 1.492   -1.815  -8.929  1.00 1.00 ? 47  ASN A HD22 1  
ATOM   711   N N    . LEU A 1 48 ? -0.611  1.688   -5.970  1.00 1.00 ? 48  LEU A N    1  
ATOM   712   C CA   . LEU A 1 48 ? -1.935  1.401   -5.425  1.00 1.00 ? 48  LEU A CA   1  
ATOM   713   C C    . LEU A 1 48 ? -3.011  2.120   -6.238  1.00 1.00 ? 48  LEU A C    1  
ATOM   714   O O    . LEU A 1 48 ? -4.011  1.518   -6.625  1.00 1.00 ? 48  LEU A O    1  
ATOM   715   C CB   . LEU A 1 48 ? -2.005  1.875   -3.970  1.00 1.00 ? 48  LEU A CB   1  
ATOM   716   C CG   . LEU A 1 48 ? -0.910  1.181   -3.158  1.00 1.00 ? 48  LEU A CG   1  
ATOM   717   C CD1  . LEU A 1 48 ? -0.630  1.987   -1.887  1.00 1.00 ? 48  LEU A CD1  1  
ATOM   718   C CD2  . LEU A 1 48 ? -1.360  -0.229  -2.779  1.00 1.00 ? 48  LEU A CD2  1  
ATOM   719   H H    . LEU A 1 48 ? 0.032   2.199   -5.435  1.00 1.00 ? 48  LEU A H    1  
ATOM   720   H HA   . LEU A 1 48 ? -2.114  0.346   -5.464  1.00 1.00 ? 48  LEU A HA   1  
ATOM   721   H HB2  . LEU A 1 48 ? -1.872  2.943   -3.926  1.00 1.00 ? 48  LEU A HB2  1  
ATOM   722   H HB3  . LEU A 1 48 ? -2.974  1.614   -3.557  1.00 1.00 ? 48  LEU A HB3  1  
ATOM   723   H HG   . LEU A 1 48 ? -0.006  1.125   -3.749  1.00 1.00 ? 48  LEU A HG   1  
ATOM   724   H HD11 . LEU A 1 48 ? 0.102   1.470   -1.286  1.00 1.00 ? 48  LEU A HD11 1  
ATOM   725   H HD12 . LEU A 1 48 ? -1.546  2.099   -1.325  1.00 1.00 ? 48  LEU A HD12 1  
ATOM   726   H HD13 . LEU A 1 48 ? -0.251  2.963   -2.155  1.00 1.00 ? 48  LEU A HD13 1  
ATOM   727   H HD21 . LEU A 1 48 ? -2.289  -0.172  -2.232  1.00 1.00 ? 48  LEU A HD21 1  
ATOM   728   H HD22 . LEU A 1 48 ? -0.608  -0.695  -2.164  1.00 1.00 ? 48  LEU A HD22 1  
ATOM   729   H HD23 . LEU A 1 48 ? -1.507  -0.814  -3.673  1.00 1.00 ? 48  LEU A HD23 1  
ATOM   730   N N    . GLU A 1 49 ? -2.787  3.402   -6.510  1.00 1.00 ? 49  GLU A N    1  
ATOM   731   C CA   . GLU A 1 49 ? -3.745  4.185   -7.281  1.00 1.00 ? 49  GLU A CA   1  
ATOM   732   C C    . GLU A 1 49 ? -3.845  3.644   -8.707  1.00 1.00 ? 49  GLU A C    1  
ATOM   733   O O    . GLU A 1 49 ? -4.928  3.599   -9.289  1.00 1.00 ? 49  GLU A O    1  
ATOM   734   C CB   . GLU A 1 49 ? -3.306  5.652   -7.323  1.00 1.00 ? 49  GLU A CB   1  
ATOM   735   C CG   . GLU A 1 49 ? -4.424  6.501   -7.932  1.00 1.00 ? 49  GLU A CG   1  
ATOM   736   C CD   . GLU A 1 49 ? -3.956  7.944   -8.088  1.00 1.00 ? 49  GLU A CD   1  
ATOM   737   O OE1  . GLU A 1 49 ? -2.998  8.309   -7.428  1.00 1.00 ? 49  GLU A OE1  1  
ATOM   738   O OE2  . GLU A 1 49 ? -4.563  8.661   -8.865  1.00 1.00 ? 49  GLU A OE2  1  
ATOM   739   H H    . GLU A 1 49 ? -1.974  3.832   -6.172  1.00 1.00 ? 49  GLU A H    1  
ATOM   740   H HA   . GLU A 1 49 ? -4.713  4.123   -6.816  1.00 1.00 ? 49  GLU A HA   1  
ATOM   741   H HB2  . GLU A 1 49 ? -3.099  5.990   -6.321  1.00 1.00 ? 49  GLU A HB2  1  
ATOM   742   H HB3  . GLU A 1 49 ? -2.416  5.746   -7.927  1.00 1.00 ? 49  GLU A HB3  1  
ATOM   743   H HG2  . GLU A 1 49 ? -4.692  6.103   -8.897  1.00 1.00 ? 49  GLU A HG2  1  
ATOM   744   H HG3  . GLU A 1 49 ? -5.287  6.475   -7.280  1.00 1.00 ? 49  GLU A HG3  1  
ATOM   745   N N    . GLU A 1 50 ? -2.706  3.240   -9.263  1.00 1.00 ? 50  GLU A N    1  
ATOM   746   C CA   . GLU A 1 50 ? -2.681  2.706   -10.618 1.00 1.00 ? 50  GLU A CA   1  
ATOM   747   C C    . GLU A 1 50 ? -3.370  1.347   -10.678 1.00 1.00 ? 50  GLU A C    1  
ATOM   748   O O    . GLU A 1 50 ? -4.151  1.076   -11.588 1.00 1.00 ? 50  GLU A O    1  
ATOM   749   C CB   . GLU A 1 50 ? -1.233  2.567   -11.096 1.00 1.00 ? 50  GLU A CB   1  
ATOM   750   C CG   . GLU A 1 50 ? -1.218  2.139   -12.564 1.00 1.00 ? 50  GLU A CG   1  
ATOM   751   C CD   . GLU A 1 50 ? 0.220   2.048   -13.066 1.00 1.00 ? 50  GLU A CD   1  
ATOM   752   O OE1  . GLU A 1 50 ? 1.095   2.569   -12.394 1.00 1.00 ? 50  GLU A OE1  1  
ATOM   753   O OE2  . GLU A 1 50 ? 0.425   1.454   -14.112 1.00 1.00 ? 50  GLU A OE2  1  
ATOM   754   H H    . GLU A 1 50 ? -1.875  3.299   -8.751  1.00 1.00 ? 50  GLU A H    1  
ATOM   755   H HA   . GLU A 1 50 ? -3.198  3.391   -11.275 1.00 1.00 ? 50  GLU A HA   1  
ATOM   756   H HB2  . GLU A 1 50 ? -0.725  3.514   -10.989 1.00 1.00 ? 50  GLU A HB2  1  
ATOM   757   H HB3  . GLU A 1 50 ? -0.729  1.818   -10.500 1.00 1.00 ? 50  GLU A HB3  1  
ATOM   758   H HG2  . GLU A 1 50 ? -1.695  1.176   -12.664 1.00 1.00 ? 50  GLU A HG2  1  
ATOM   759   H HG3  . GLU A 1 50 ? -1.754  2.869   -13.154 1.00 1.00 ? 50  GLU A HG3  1  
ATOM   760   N N    . GLU A 1 51 ? -3.075  0.498   -9.697  1.00 1.00 ? 51  GLU A N    1  
ATOM   761   C CA   . GLU A 1 51 ? -3.666  -0.833  -9.654  1.00 1.00 ? 51  GLU A CA   1  
ATOM   762   C C    . GLU A 1 51 ? -5.166  -0.749  -9.392  1.00 1.00 ? 51  GLU A C    1  
ATOM   763   O O    . GLU A 1 51 ? -5.972  -1.213  -10.198 1.00 1.00 ? 51  GLU A O    1  
ATOM   764   C CB   . GLU A 1 51 ? -3.001  -1.661  -8.552  1.00 1.00 ? 51  GLU A CB   1  
ATOM   765   C CG   . GLU A 1 51 ? -3.536  -3.095  -8.596  1.00 1.00 ? 51  GLU A CG   1  
ATOM   766   C CD   . GLU A 1 51 ? -2.869  -3.934  -7.513  1.00 1.00 ? 51  GLU A CD   1  
ATOM   767   O OE1  . GLU A 1 51 ? -3.249  -3.791  -6.362  1.00 1.00 ? 51  GLU A OE1  1  
ATOM   768   O OE2  . GLU A 1 51 ? -1.987  -4.708  -7.848  1.00 1.00 ? 51  GLU A OE2  1  
ATOM   769   H H    . GLU A 1 51 ? -2.448  0.771   -8.993  1.00 1.00 ? 51  GLU A H    1  
ATOM   770   H HA   . GLU A 1 51 ? -3.502  -1.322  -10.602 1.00 1.00 ? 51  GLU A HA   1  
ATOM   771   H HB2  . GLU A 1 51 ? -1.933  -1.671  -8.702  1.00 1.00 ? 51  GLU A HB2  1  
ATOM   772   H HB3  . GLU A 1 51 ? -3.225  -1.226  -7.588  1.00 1.00 ? 51  GLU A HB3  1  
ATOM   773   H HG2  . GLU A 1 51 ? -4.604  -3.085  -8.435  1.00 1.00 ? 51  GLU A HG2  1  
ATOM   774   H HG3  . GLU A 1 51 ? -3.322  -3.526  -9.563  1.00 1.00 ? 51  GLU A HG3  1  
ATOM   775   N N    . PHE A 1 52 ? -5.531  -0.152  -8.264  1.00 1.00 ? 52  PHE A N    1  
ATOM   776   C CA   . PHE A 1 52 ? -6.938  -0.012  -7.904  1.00 1.00 ? 52  PHE A CA   1  
ATOM   777   C C    . PHE A 1 52 ? -7.667  0.858   -8.921  1.00 1.00 ? 52  PHE A C    1  
ATOM   778   O O    . PHE A 1 52 ? -8.835  0.622   -9.232  1.00 1.00 ? 52  PHE A O    1  
ATOM   779   C CB   . PHE A 1 52 ? -7.065  0.607   -6.512  1.00 1.00 ? 52  PHE A CB   1  
ATOM   780   C CG   . PHE A 1 52 ? -6.658  -0.405  -5.470  1.00 1.00 ? 52  PHE A CG   1  
ATOM   781   C CD1  . PHE A 1 52 ? -7.390  -1.590  -5.324  1.00 1.00 ? 52  PHE A CD1  1  
ATOM   782   C CD2  . PHE A 1 52 ? -5.550  -0.161  -4.648  1.00 1.00 ? 52  PHE A CD2  1  
ATOM   783   C CE1  . PHE A 1 52 ? -7.015  -2.530  -4.356  1.00 1.00 ? 52  PHE A CE1  1  
ATOM   784   C CE2  . PHE A 1 52 ? -5.176  -1.100  -3.682  1.00 1.00 ? 52  PHE A CE2  1  
ATOM   785   C CZ   . PHE A 1 52 ? -5.907  -2.285  -3.535  1.00 1.00 ? 52  PHE A CZ   1  
ATOM   786   H H    . PHE A 1 52 ? -4.843  0.201   -7.660  1.00 1.00 ? 52  PHE A H    1  
ATOM   787   H HA   . PHE A 1 52 ? -7.393  -0.992  -7.893  1.00 1.00 ? 52  PHE A HA   1  
ATOM   788   H HB2  . PHE A 1 52 ? -6.419  1.472   -6.447  1.00 1.00 ? 52  PHE A HB2  1  
ATOM   789   H HB3  . PHE A 1 52 ? -8.086  0.908   -6.343  1.00 1.00 ? 52  PHE A HB3  1  
ATOM   790   H HD1  . PHE A 1 52 ? -8.246  -1.780  -5.955  1.00 1.00 ? 52  PHE A HD1  1  
ATOM   791   H HD2  . PHE A 1 52 ? -4.987  0.751   -4.760  1.00 1.00 ? 52  PHE A HD2  1  
ATOM   792   H HE1  . PHE A 1 52 ? -7.578  -3.445  -4.244  1.00 1.00 ? 52  PHE A HE1  1  
ATOM   793   H HE2  . PHE A 1 52 ? -4.321  -0.913  -3.050  1.00 1.00 ? 52  PHE A HE2  1  
ATOM   794   H HZ   . PHE A 1 52 ? -5.618  -3.008  -2.789  1.00 1.00 ? 52  PHE A HZ   1  
ATOM   795   N N    . GLY A 1 53 ? -6.972  1.867   -9.435  1.00 1.00 ? 53  GLY A N    1  
ATOM   796   C CA   . GLY A 1 53 ? -7.564  2.769   -10.416 1.00 1.00 ? 53  GLY A CA   1  
ATOM   797   C C    . GLY A 1 53 ? -8.363  3.869   -9.733  1.00 1.00 ? 53  GLY A C    1  
ATOM   798   O O    . GLY A 1 53 ? -9.375  4.335   -10.254 1.00 1.00 ? 53  GLY A O    1  
ATOM   799   H H    . GLY A 1 53 ? -6.045  2.007   -9.151  1.00 1.00 ? 53  GLY A H    1  
ATOM   800   H HA2  . GLY A 1 53 ? -6.778  3.215   -11.008 1.00 1.00 ? 53  GLY A HA2  1  
ATOM   801   H HA3  . GLY A 1 53 ? -8.222  2.207   -11.065 1.00 1.00 ? 53  GLY A HA3  1  
ATOM   802   N N    . ILE A 1 54 ? -7.903  4.283   -8.553  1.00 1.00 ? 54  ILE A N    1  
ATOM   803   C CA   . ILE A 1 54 ? -8.586  5.332   -7.803  1.00 1.00 ? 54  ILE A CA   1  
ATOM   804   C C    . ILE A 1 54 ? -7.831  6.647   -7.910  1.00 1.00 ? 54  ILE A C    1  
ATOM   805   O O    . ILE A 1 54 ? -6.997  6.828   -8.798  1.00 1.00 ? 54  ILE A O    1  
ATOM   806   C CB   . ILE A 1 54 ? -8.700  4.922   -6.332  1.00 1.00 ? 54  ILE A CB   1  
ATOM   807   C CG1  . ILE A 1 54 ? -7.318  4.530   -5.803  1.00 1.00 ? 54  ILE A CG1  1  
ATOM   808   C CG2  . ILE A 1 54 ? -9.653  3.733   -6.204  1.00 1.00 ? 54  ILE A CG2  1  
ATOM   809   C CD1  . ILE A 1 54 ? -7.426  4.141   -4.328  1.00 1.00 ? 54  ILE A CD1  1  
ATOM   810   H H    . ILE A 1 54 ? -7.089  3.879   -8.187  1.00 1.00 ? 54  ILE A H    1  
ATOM   811   H HA   . ILE A 1 54 ? -9.580  5.460   -8.204  1.00 1.00 ? 54  ILE A HA   1  
ATOM   812   H HB   . ILE A 1 54 ? -9.083  5.753   -5.757  1.00 1.00 ? 54  ILE A HB   1  
ATOM   813   H HG12 . ILE A 1 54 ? -6.941  3.694   -6.371  1.00 1.00 ? 54  ILE A HG12 1  
ATOM   814   H HG13 . ILE A 1 54 ? -6.645  5.366   -5.901  1.00 1.00 ? 54  ILE A HG13 1  
ATOM   815   H HG21 . ILE A 1 54 ? -9.230  2.879   -6.712  1.00 1.00 ? 54  ILE A HG21 1  
ATOM   816   H HG22 . ILE A 1 54 ? -10.604 3.983   -6.645  1.00 1.00 ? 54  ILE A HG22 1  
ATOM   817   H HG23 . ILE A 1 54 ? -9.794  3.496   -5.158  1.00 1.00 ? 54  ILE A HG23 1  
ATOM   818   H HD11 . ILE A 1 54 ? -7.716  5.003   -3.748  1.00 1.00 ? 54  ILE A HD11 1  
ATOM   819   H HD12 . ILE A 1 54 ? -6.471  3.775   -3.980  1.00 1.00 ? 54  ILE A HD12 1  
ATOM   820   H HD13 . ILE A 1 54 ? -8.168  3.365   -4.213  1.00 1.00 ? 54  ILE A HD13 1  
ATOM   821   N N    . ASN A 1 55 ? -8.125  7.570   -7.000  1.00 1.00 ? 55  ASN A N    1  
ATOM   822   C CA   . ASN A 1 55 ? -7.464  8.871   -6.998  1.00 1.00 ? 55  ASN A CA   1  
ATOM   823   C C    . ASN A 1 55 ? -7.061  9.259   -5.579  1.00 1.00 ? 55  ASN A C    1  
ATOM   824   O O    . ASN A 1 55 ? -7.822  9.920   -4.868  1.00 1.00 ? 55  ASN A O    1  
ATOM   825   C CB   . ASN A 1 55 ? -8.396  9.934   -7.579  1.00 1.00 ? 55  ASN A CB   1  
ATOM   826   C CG   . ASN A 1 55 ? -9.851  9.524   -7.369  1.00 1.00 ? 55  ASN A CG   1  
ATOM   827   O OD1  . ASN A 1 55 ? -10.730 9.948   -8.116  1.00 1.00 ? 55  ASN A OD1  1  
ATOM   828   N ND2  . ASN A 1 55 ? -10.156 8.719   -6.388  1.00 1.00 ? 55  ASN A ND2  1  
ATOM   829   H H    . ASN A 1 55 ? -8.802  7.376   -6.318  1.00 1.00 ? 55  ASN A H    1  
ATOM   830   H HA   . ASN A 1 55 ? -6.574  8.812   -7.608  1.00 1.00 ? 55  ASN A HA   1  
ATOM   831   H HB2  . ASN A 1 55 ? -8.216  10.879  -7.088  1.00 1.00 ? 55  ASN A HB2  1  
ATOM   832   H HB3  . ASN A 1 55 ? -8.205  10.039  -8.637  1.00 1.00 ? 55  ASN A HB3  1  
ATOM   833   H HD21 . ASN A 1 55 ? -9.452  8.382   -5.793  1.00 1.00 ? 55  ASN A HD21 1  
ATOM   834   H HD22 . ASN A 1 55 ? -11.087 8.451   -6.247  1.00 1.00 ? 55  ASN A HD22 1  
ATOM   835   N N    . VAL A 1 56 ? -5.861  8.860   -5.175  1.00 1.00 ? 56  VAL A N    1  
ATOM   836   C CA   . VAL A 1 56 ? -5.376  9.168   -3.837  1.00 1.00 ? 56  VAL A CA   1  
ATOM   837   C C    . VAL A 1 56 ? -4.436  10.368  -3.871  1.00 1.00 ? 56  VAL A C    1  
ATOM   838   O O    . VAL A 1 56 ? -3.470  10.392  -4.632  1.00 1.00 ? 56  VAL A O    1  
ATOM   839   C CB   . VAL A 1 56 ? -4.636  7.957   -3.260  1.00 1.00 ? 56  VAL A CB   1  
ATOM   840   C CG1  . VAL A 1 56 ? -3.327  7.744   -4.024  1.00 1.00 ? 56  VAL A CG1  1  
ATOM   841   C CG2  . VAL A 1 56 ? -4.329  8.203   -1.781  1.00 1.00 ? 56  VAL A CG2  1  
ATOM   842   H H    . VAL A 1 56 ? -5.296  8.344   -5.787  1.00 1.00 ? 56  VAL A H    1  
ATOM   843   H HA   . VAL A 1 56 ? -6.215  9.396   -3.198  1.00 1.00 ? 56  VAL A HA   1  
ATOM   844   H HB   . VAL A 1 56 ? -5.256  7.077   -3.357  1.00 1.00 ? 56  VAL A HB   1  
ATOM   845   H HG11 . VAL A 1 56 ? -2.967  6.741   -3.848  1.00 1.00 ? 56  VAL A HG11 1  
ATOM   846   H HG12 . VAL A 1 56 ? -2.592  8.458   -3.681  1.00 1.00 ? 56  VAL A HG12 1  
ATOM   847   H HG13 . VAL A 1 56 ? -3.501  7.886   -5.080  1.00 1.00 ? 56  VAL A HG13 1  
ATOM   848   H HG21 . VAL A 1 56 ? -3.553  7.526   -1.456  1.00 1.00 ? 56  VAL A HG21 1  
ATOM   849   H HG22 . VAL A 1 56 ? -5.221  8.035   -1.195  1.00 1.00 ? 56  VAL A HG22 1  
ATOM   850   H HG23 . VAL A 1 56 ? -3.996  9.220   -1.645  1.00 1.00 ? 56  VAL A HG23 1  
ATOM   851   N N    . ASP A 1 57 ? -4.725  11.362  -3.037  1.00 1.00 ? 57  ASP A N    1  
ATOM   852   C CA   . ASP A 1 57 ? -3.898  12.561  -2.977  1.00 1.00 ? 57  ASP A CA   1  
ATOM   853   C C    . ASP A 1 57 ? -2.665  12.320  -2.114  1.00 1.00 ? 57  ASP A C    1  
ATOM   854   O O    . ASP A 1 57 ? -2.649  11.417  -1.277  1.00 1.00 ? 57  ASP A O    1  
ATOM   855   C CB   . ASP A 1 57 ? -4.708  13.724  -2.400  1.00 1.00 ? 57  ASP A CB   1  
ATOM   856   C CG   . ASP A 1 57 ? -5.722  14.214  -3.429  1.00 1.00 ? 57  ASP A CG   1  
ATOM   857   O OD1  . ASP A 1 57 ? -5.586  13.853  -4.586  1.00 1.00 ? 57  ASP A OD1  1  
ATOM   858   O OD2  . ASP A 1 57 ? -6.621  14.943  -3.044  1.00 1.00 ? 57  ASP A OD2  1  
ATOM   859   H H    . ASP A 1 57 ? -5.510  11.288  -2.452  1.00 1.00 ? 57  ASP A H    1  
ATOM   860   H HA   . ASP A 1 57 ? -3.582  12.818  -3.977  1.00 1.00 ? 57  ASP A HA   1  
ATOM   861   H HB2  . ASP A 1 57 ? -5.228  13.395  -1.513  1.00 1.00 ? 57  ASP A HB2  1  
ATOM   862   H HB3  . ASP A 1 57 ? -4.040  14.533  -2.144  1.00 1.00 ? 57  ASP A HB3  1  
ATOM   863   N N    . GLU A 1 58 ? -1.636  13.135  -2.321  1.00 1.00 ? 58  GLU A N    1  
ATOM   864   C CA   . GLU A 1 58 ? -0.404  13.002  -1.551  1.00 1.00 ? 58  GLU A CA   1  
ATOM   865   C C    . GLU A 1 58 ? -0.661  13.295  -0.076  1.00 1.00 ? 58  GLU A C    1  
ATOM   866   O O    . GLU A 1 58 ? -0.003  12.735  0.800   1.00 1.00 ? 58  GLU A O    1  
ATOM   867   C CB   . GLU A 1 58 ? 0.651   13.973  -2.088  1.00 1.00 ? 58  GLU A CB   1  
ATOM   868   C CG   . GLU A 1 58 ? 0.991   13.606  -3.535  1.00 1.00 ? 58  GLU A CG   1  
ATOM   869   C CD   . GLU A 1 58 ? 1.672   12.243  -3.582  1.00 1.00 ? 58  GLU A CD   1  
ATOM   870   O OE1  . GLU A 1 58 ? 2.194   11.827  -2.562  1.00 1.00 ? 58  GLU A OE1  1  
ATOM   871   O OE2  . GLU A 1 58 ? 1.660   11.634  -4.639  1.00 1.00 ? 58  GLU A OE2  1  
ATOM   872   H H    . GLU A 1 58 ? -1.704  13.834  -3.003  1.00 1.00 ? 58  GLU A H    1  
ATOM   873   H HA   . GLU A 1 58 ? -0.035  11.993  -1.649  1.00 1.00 ? 58  GLU A HA   1  
ATOM   874   H HB2  . GLU A 1 58 ? 0.267   14.981  -2.051  1.00 1.00 ? 58  GLU A HB2  1  
ATOM   875   H HB3  . GLU A 1 58 ? 1.543   13.904  -1.483  1.00 1.00 ? 58  GLU A HB3  1  
ATOM   876   H HG2  . GLU A 1 58 ? 0.082   13.574  -4.117  1.00 1.00 ? 58  GLU A HG2  1  
ATOM   877   H HG3  . GLU A 1 58 ? 1.655   14.352  -3.947  1.00 1.00 ? 58  GLU A HG3  1  
ATOM   878   N N    . ASP A 1 59 ? -1.620  14.176  0.189   1.00 1.00 ? 59  ASP A N    1  
ATOM   879   C CA   . ASP A 1 59 ? -1.952  14.537  1.563   1.00 1.00 ? 59  ASP A CA   1  
ATOM   880   C C    . ASP A 1 59 ? -2.534  13.340  2.305   1.00 1.00 ? 59  ASP A C    1  
ATOM   881   O O    . ASP A 1 59 ? -2.513  13.290  3.536   1.00 1.00 ? 59  ASP A O    1  
ATOM   882   C CB   . ASP A 1 59 ? -2.964  15.684  1.570   1.00 1.00 ? 59  ASP A CB   1  
ATOM   883   C CG   . ASP A 1 59 ? -2.290  16.976  1.122   1.00 1.00 ? 59  ASP A CG   1  
ATOM   884   O OD1  . ASP A 1 59 ? -1.070  17.010  1.102   1.00 1.00 ? 59  ASP A OD1  1  
ATOM   885   O OD2  . ASP A 1 59 ? -3.002  17.914  0.804   1.00 1.00 ? 59  ASP A OD2  1  
ATOM   886   H H    . ASP A 1 59 ? -2.112  14.590  -0.549  1.00 1.00 ? 59  ASP A H    1  
ATOM   887   H HA   . ASP A 1 59 ? -1.054  14.859  2.066   1.00 1.00 ? 59  ASP A HA   1  
ATOM   888   H HB2  . ASP A 1 59 ? -3.776  15.450  0.896   1.00 1.00 ? 59  ASP A HB2  1  
ATOM   889   H HB3  . ASP A 1 59 ? -3.354  15.812  2.568   1.00 1.00 ? 59  ASP A HB3  1  
ATOM   890   N N    . LYS A 1 60 ? -3.052  12.375  1.552   1.00 1.00 ? 60  LYS A N    1  
ATOM   891   C CA   . LYS A 1 60 ? -3.627  11.178  2.148   1.00 1.00 ? 60  LYS A CA   1  
ATOM   892   C C    . LYS A 1 60 ? -2.576  10.079  2.263   1.00 1.00 ? 60  LYS A C    1  
ATOM   893   O O    . LYS A 1 60 ? -2.653  9.219   3.139   1.00 1.00 ? 60  LYS A O    1  
ATOM   894   C CB   . LYS A 1 60 ? -4.798  10.679  1.300   1.00 1.00 ? 60  LYS A CB   1  
ATOM   895   C CG   . LYS A 1 60 ? -5.680  9.751   2.139   1.00 1.00 ? 60  LYS A CG   1  
ATOM   896   C CD   . LYS A 1 60 ? -6.712  10.581  2.909   1.00 1.00 ? 60  LYS A CD   1  
ATOM   897   C CE   . LYS A 1 60 ? -7.637  9.649   3.688   1.00 1.00 ? 60  LYS A CE   1  
ATOM   898   N NZ   . LYS A 1 60 ? -8.622  10.459  4.458   1.00 1.00 ? 60  LYS A NZ   1  
ATOM   899   H H    . LYS A 1 60 ? -3.047  12.472  0.577   1.00 1.00 ? 60  LYS A H    1  
ATOM   900   H HA   . LYS A 1 60 ? -3.988  11.415  3.139   1.00 1.00 ? 60  LYS A HA   1  
ATOM   901   H HB2  . LYS A 1 60 ? -5.379  11.525  0.962   1.00 1.00 ? 60  LYS A HB2  1  
ATOM   902   H HB3  . LYS A 1 60 ? -4.420  10.140  0.445   1.00 1.00 ? 60  LYS A HB3  1  
ATOM   903   H HG2  . LYS A 1 60 ? -6.188  9.055   1.490   1.00 1.00 ? 60  LYS A HG2  1  
ATOM   904   H HG3  . LYS A 1 60 ? -5.065  9.205   2.841   1.00 1.00 ? 60  LYS A HG3  1  
ATOM   905   H HD2  . LYS A 1 60 ? -6.203  11.243  3.592   1.00 1.00 ? 60  LYS A HD2  1  
ATOM   906   H HD3  . LYS A 1 60 ? -7.294  11.165  2.210   1.00 1.00 ? 60  LYS A HD3  1  
ATOM   907   H HE2  . LYS A 1 60 ? -8.162  9.002   3.001   1.00 1.00 ? 60  LYS A HE2  1  
ATOM   908   H HE3  . LYS A 1 60 ? -7.052  9.050   4.371   1.00 1.00 ? 60  LYS A HE3  1  
ATOM   909   H HZ1  . LYS A 1 60 ? -8.557  11.455  4.166   1.00 1.00 ? 60  LYS A HZ1  1  
ATOM   910   H HZ2  . LYS A 1 60 ? -8.416  10.381  5.475   1.00 1.00 ? 60  LYS A HZ2  1  
ATOM   911   H HZ3  . LYS A 1 60 ? -9.581  10.107  4.272   1.00 1.00 ? 60  LYS A HZ3  1  
ATOM   912   N N    . ALA A 1 61 ? -1.594  10.110  1.366   1.00 1.00 ? 61  ALA A N    1  
ATOM   913   C CA   . ALA A 1 61 ? -0.532  9.109   1.375   1.00 1.00 ? 61  ALA A CA   1  
ATOM   914   C C    . ALA A 1 61 ? 0.752   9.697   1.940   1.00 1.00 ? 61  ALA A C    1  
ATOM   915   O O    . ALA A 1 61 ? 1.837   9.498   1.388   1.00 1.00 ? 61  ALA A O    1  
ATOM   916   C CB   . ALA A 1 61 ? -0.281  8.606   -0.048  1.00 1.00 ? 61  ALA A CB   1  
ATOM   917   H H    . ALA A 1 61 ? -1.583  10.820  0.690   1.00 1.00 ? 61  ALA A H    1  
ATOM   918   H HA   . ALA A 1 61 ? -0.837  8.277   1.989   1.00 1.00 ? 61  ALA A HA   1  
ATOM   919   H HB1  . ALA A 1 61 ? 0.205   9.380   -0.625  1.00 1.00 ? 61  ALA A HB1  1  
ATOM   920   H HB2  . ALA A 1 61 ? -1.223  8.349   -0.512  1.00 1.00 ? 61  ALA A HB2  1  
ATOM   921   H HB3  . ALA A 1 61 ? 0.353   7.732   -0.014  1.00 1.00 ? 61  ALA A HB3  1  
ATOM   922   N N    . GLN A 1 62 ? 0.630   10.429  3.045   1.00 1.00 ? 62  GLN A N    1  
ATOM   923   C CA   . GLN A 1 62 ? 1.789   11.046  3.675   1.00 1.00 ? 62  GLN A CA   1  
ATOM   924   C C    . GLN A 1 62 ? 1.993   10.504  5.081   1.00 1.00 ? 62  GLN A C    1  
ATOM   925   O O    . GLN A 1 62 ? 3.125   10.355  5.545   1.00 1.00 ? 62  GLN A O    1  
ATOM   926   C CB   . GLN A 1 62 ? 1.599   12.566  3.734   1.00 1.00 ? 62  GLN A CB   1  
ATOM   927   C CG   . GLN A 1 62 ? 0.378   12.894  4.597   1.00 1.00 ? 62  GLN A CG   1  
ATOM   928   C CD   . GLN A 1 62 ? 0.086   14.390  4.541   1.00 1.00 ? 62  GLN A CD   1  
ATOM   929   O OE1  . GLN A 1 62 ? 0.626   15.097  3.690   1.00 1.00 ? 62  GLN A OE1  1  
ATOM   930   N NE2  . GLN A 1 62 ? -0.746  14.916  5.398   1.00 1.00 ? 62  GLN A NE2  1  
ATOM   931   H H    . GLN A 1 62 ? -0.258  10.550  3.443   1.00 1.00 ? 62  GLN A H    1  
ATOM   932   H HA   . GLN A 1 62 ? 2.669   10.834  3.085   1.00 1.00 ? 62  GLN A HA   1  
ATOM   933   H HB2  . GLN A 1 62 ? 2.477   13.022  4.166   1.00 1.00 ? 62  GLN A HB2  1  
ATOM   934   H HB3  . GLN A 1 62 ? 1.447   12.951  2.737   1.00 1.00 ? 62  GLN A HB3  1  
ATOM   935   H HG2  . GLN A 1 62 ? -0.478  12.346  4.230   1.00 1.00 ? 62  GLN A HG2  1  
ATOM   936   H HG3  . GLN A 1 62 ? 0.574   12.607  5.620   1.00 1.00 ? 62  GLN A HG3  1  
ATOM   937   H HE21 . GLN A 1 62 ? -1.174  14.350  6.074   1.00 1.00 ? 62  GLN A HE21 1  
ATOM   938   H HE22 . GLN A 1 62 ? -0.939  15.876  5.368   1.00 1.00 ? 62  GLN A HE22 1  
ATOM   939   N N    . ASP A 1 63 ? 0.889   10.212  5.764   1.00 1.00 ? 63  ASP A N    1  
ATOM   940   C CA   . ASP A 1 63 ? 0.957   9.695   7.125   1.00 1.00 ? 63  ASP A CA   1  
ATOM   941   C C    . ASP A 1 63 ? -0.013  8.538   7.313   1.00 1.00 ? 63  ASP A C    1  
ATOM   942   O O    . ASP A 1 63 ? -0.822  8.536   8.243   1.00 1.00 ? 63  ASP A O    1  
ATOM   943   C CB   . ASP A 1 63 ? 0.624   10.811  8.120   1.00 1.00 ? 63  ASP A CB   1  
ATOM   944   C CG   . ASP A 1 63 ? 0.831   10.316  9.547   1.00 1.00 ? 63  ASP A CG   1  
ATOM   945   O OD1  . ASP A 1 63 ? 1.055   9.128   9.714   1.00 1.00 ? 63  ASP A OD1  1  
ATOM   946   O OD2  . ASP A 1 63 ? 0.763   11.132  10.452  1.00 1.00 ? 63  ASP A OD2  1  
ATOM   947   H H    . ASP A 1 63 ? 0.015   10.342  5.341   1.00 1.00 ? 63  ASP A H    1  
ATOM   948   H HA   . ASP A 1 63 ? 1.961   9.346   7.322   1.00 1.00 ? 63  ASP A HA   1  
ATOM   949   H HB2  . ASP A 1 63 ? 1.266   11.659  7.938   1.00 1.00 ? 63  ASP A HB2  1  
ATOM   950   H HB3  . ASP A 1 63 ? -0.407  11.108  7.992   1.00 1.00 ? 63  ASP A HB3  1  
ATOM   951   N N    . ILE A 1 64 ? 0.069   7.553   6.425   1.00 1.00 ? 64  ILE A N    1  
ATOM   952   C CA   . ILE A 1 64 ? -0.802  6.389   6.506   1.00 1.00 ? 64  ILE A CA   1  
ATOM   953   C C    . ILE A 1 64 ? -0.175  5.308   7.383   1.00 1.00 ? 64  ILE A C    1  
ATOM   954   O O    . ILE A 1 64 ? 0.998   4.968   7.221   1.00 1.00 ? 64  ILE A O    1  
ATOM   955   C CB   . ILE A 1 64 ? -1.055  5.824   5.106   1.00 1.00 ? 64  ILE A CB   1  
ATOM   956   C CG1  . ILE A 1 64 ? -1.784  6.873   4.262   1.00 1.00 ? 64  ILE A CG1  1  
ATOM   957   C CG2  . ILE A 1 64 ? -1.916  4.562   5.210   1.00 1.00 ? 64  ILE A CG2  1  
ATOM   958   C CD1  . ILE A 1 64 ? -3.130  7.209   4.907   1.00 1.00 ? 64  ILE A CD1  1  
ATOM   959   H H    . ILE A 1 64 ? 0.729   7.611   5.702   1.00 1.00 ? 64  ILE A H    1  
ATOM   960   H HA   . ILE A 1 64 ? -1.745  6.680   6.944   1.00 1.00 ? 64  ILE A HA   1  
ATOM   961   H HB   . ILE A 1 64 ? -0.113  5.578   4.642   1.00 1.00 ? 64  ILE A HB   1  
ATOM   962   H HG12 . ILE A 1 64 ? -1.181  7.766   4.202   1.00 1.00 ? 64  ILE A HG12 1  
ATOM   963   H HG13 . ILE A 1 64 ? -1.952  6.482   3.269   1.00 1.00 ? 64  ILE A HG13 1  
ATOM   964   H HG21 . ILE A 1 64 ? -2.769  4.763   5.846   1.00 1.00 ? 64  ILE A HG21 1  
ATOM   965   H HG22 . ILE A 1 64 ? -1.334  3.762   5.632   1.00 1.00 ? 64  ILE A HG22 1  
ATOM   966   H HG23 . ILE A 1 64 ? -2.263  4.284   4.227   1.00 1.00 ? 64  ILE A HG23 1  
ATOM   967   H HD11 . ILE A 1 64 ? -3.505  6.347   5.440   1.00 1.00 ? 64  ILE A HD11 1  
ATOM   968   H HD12 . ILE A 1 64 ? -3.836  7.491   4.146   1.00 1.00 ? 64  ILE A HD12 1  
ATOM   969   H HD13 . ILE A 1 64 ? -3.002  8.027   5.603   1.00 1.00 ? 64  ILE A HD13 1  
ATOM   970   N N    . SER A 1 65 ? -0.957  4.775   8.310   1.00 1.00 ? 65  SER A N    1  
ATOM   971   C CA   . SER A 1 65 ? -0.478  3.725   9.203   1.00 1.00 ? 65  SER A CA   1  
ATOM   972   C C    . SER A 1 65 ? -0.044  2.501   8.398   1.00 1.00 ? 65  SER A C    1  
ATOM   973   O O    . SER A 1 65 ? 0.059   2.554   7.175   1.00 1.00 ? 65  SER A O    1  
ATOM   974   C CB   . SER A 1 65 ? -1.571  3.331   10.191  1.00 1.00 ? 65  SER A CB   1  
ATOM   975   O OG   . SER A 1 65 ? -1.144  3.631   11.512  1.00 1.00 ? 65  SER A OG   1  
ATOM   976   H H    . SER A 1 65 ? -1.887  5.088   8.397   1.00 1.00 ? 65  SER A H    1  
ATOM   977   H HA   . SER A 1 65 ? 0.376   4.102   9.751   1.00 1.00 ? 65  SER A HA   1  
ATOM   978   H HB2  . SER A 1 65 ? -2.470  3.885   9.974   1.00 1.00 ? 65  SER A HB2  1  
ATOM   979   H HB3  . SER A 1 65 ? -1.774  2.272   10.106  1.00 1.00 ? 65  SER A HB3  1  
ATOM   980   H HG   . SER A 1 65 ? -1.775  4.240   11.897  1.00 1.00 ? 65  SER A HG   1  
ATOM   981   N N    . THR A 1 66 ? 0.217   1.404   9.101   1.00 1.00 ? 66  THR A N    1  
ATOM   982   C CA   . THR A 1 66 ? 0.640   0.170   8.450   1.00 1.00 ? 66  THR A CA   1  
ATOM   983   C C    . THR A 1 66 ? -0.280  -0.164  7.279   1.00 1.00 ? 66  THR A C    1  
ATOM   984   O O    . THR A 1 66 ? -1.124  0.641   6.890   1.00 1.00 ? 66  THR A O    1  
ATOM   985   C CB   . THR A 1 66 ? 0.634   -0.983  9.453   1.00 1.00 ? 66  THR A CB   1  
ATOM   986   O OG1  . THR A 1 66 ? 0.855   -2.206  8.767   1.00 1.00 ? 66  THR A OG1  1  
ATOM   987   C CG2  . THR A 1 66 ? -0.720  -1.033  10.165  1.00 1.00 ? 66  THR A CG2  1  
ATOM   988   H H    . THR A 1 66 ? 0.108   1.419   10.078  1.00 1.00 ? 66  THR A H    1  
ATOM   989   H HA   . THR A 1 66 ? 1.645   0.305   8.077   1.00 1.00 ? 66  THR A HA   1  
ATOM   990   H HB   . THR A 1 66 ? 1.415   -0.833  10.181  1.00 1.00 ? 66  THR A HB   1  
ATOM   991   H HG1  . THR A 1 66 ? 0.258   -2.864  9.134   1.00 1.00 ? 66  THR A HG1  1  
ATOM   992   H HG21 . THR A 1 66 ? -1.486  -0.628  9.518   1.00 1.00 ? 66  THR A HG21 1  
ATOM   993   H HG22 . THR A 1 66 ? -0.672  -0.450  11.072  1.00 1.00 ? 66  THR A HG22 1  
ATOM   994   H HG23 . THR A 1 66 ? -0.961  -2.058  10.407  1.00 1.00 ? 66  THR A HG23 1  
ATOM   995   N N    . ILE A 1 67 ? -0.110  -1.357  6.724   1.00 1.00 ? 67  ILE A N    1  
ATOM   996   C CA   . ILE A 1 67 ? -0.925  -1.788  5.593   1.00 1.00 ? 67  ILE A CA   1  
ATOM   997   C C    . ILE A 1 67 ? -2.402  -1.796  5.971   1.00 1.00 ? 67  ILE A C    1  
ATOM   998   O O    . ILE A 1 67 ? -3.257  -1.395  5.180   1.00 1.00 ? 67  ILE A O    1  
ATOM   999   C CB   . ILE A 1 67 ? -0.497  -3.182  5.140   1.00 1.00 ? 67  ILE A CB   1  
ATOM   1000  C CG1  . ILE A 1 67 ? 0.892   -3.110  4.499   1.00 1.00 ? 67  ILE A CG1  1  
ATOM   1001  C CG2  . ILE A 1 67 ? -1.502  -3.722  4.119   1.00 1.00 ? 67  ILE A CG2  1  
ATOM   1002  C CD1  . ILE A 1 67 ? 1.455   -4.524  4.340   1.00 1.00 ? 67  ILE A CD1  1  
ATOM   1003  H H    . ILE A 1 67 ? 0.574   -1.964  7.082   1.00 1.00 ? 67  ILE A H    1  
ATOM   1004  H HA   . ILE A 1 67 ? -0.777  -1.097  4.777   1.00 1.00 ? 67  ILE A HA   1  
ATOM   1005  H HB   . ILE A 1 67 ? -0.464  -3.845  5.995   1.00 1.00 ? 67  ILE A HB   1  
ATOM   1006  H HG12 . ILE A 1 67 ? 0.815   -2.640  3.528   1.00 1.00 ? 67  ILE A HG12 1  
ATOM   1007  H HG13 . ILE A 1 67 ? 1.549   -2.528  5.126   1.00 1.00 ? 67  ILE A HG13 1  
ATOM   1008  H HG21 . ILE A 1 67 ? -1.732  -2.949  3.402   1.00 1.00 ? 67  ILE A HG21 1  
ATOM   1009  H HG22 . ILE A 1 67 ? -2.406  -4.019  4.630   1.00 1.00 ? 67  ILE A HG22 1  
ATOM   1010  H HG23 . ILE A 1 67 ? -1.079  -4.573  3.611   1.00 1.00 ? 67  ILE A HG23 1  
ATOM   1011  H HD11 . ILE A 1 67 ? 1.812   -4.877  5.296   1.00 1.00 ? 67  ILE A HD11 1  
ATOM   1012  H HD12 . ILE A 1 67 ? 2.272   -4.508  3.634   1.00 1.00 ? 67  ILE A HD12 1  
ATOM   1013  H HD13 . ILE A 1 67 ? 0.681   -5.183  3.980   1.00 1.00 ? 67  ILE A HD13 1  
ATOM   1014  N N    . GLN A 1 68 ? -2.694  -2.274  7.175   1.00 1.00 ? 68  GLN A N    1  
ATOM   1015  C CA   . GLN A 1 68 ? -4.075  -2.337  7.639   1.00 1.00 ? 68  GLN A CA   1  
ATOM   1016  C C    . GLN A 1 68 ? -4.807  -1.036  7.342   1.00 1.00 ? 68  GLN A C    1  
ATOM   1017  O O    . GLN A 1 68 ? -5.899  -1.044  6.773   1.00 1.00 ? 68  GLN A O    1  
ATOM   1018  C CB   . GLN A 1 68 ? -4.102  -2.605  9.149   1.00 1.00 ? 68  GLN A CB   1  
ATOM   1019  C CG   . GLN A 1 68 ? -3.736  -4.067  9.417   1.00 1.00 ? 68  GLN A CG   1  
ATOM   1020  C CD   . GLN A 1 68 ? -4.945  -4.962  9.167   1.00 1.00 ? 68  GLN A CD   1  
ATOM   1021  O OE1  . GLN A 1 68 ? -5.643  -5.340  10.109  1.00 1.00 ? 68  GLN A OE1  1  
ATOM   1022  N NE2  . GLN A 1 68 ? -5.241  -5.320  7.949   1.00 1.00 ? 68  GLN A NE2  1  
ATOM   1023  H H    . GLN A 1 68 ? -1.971  -2.577  7.761   1.00 1.00 ? 68  GLN A H    1  
ATOM   1024  H HA   . GLN A 1 68 ? -4.576  -3.149  7.136   1.00 1.00 ? 68  GLN A HA   1  
ATOM   1025  H HB2  . GLN A 1 68 ? -3.390  -1.960  9.641   1.00 1.00 ? 68  GLN A HB2  1  
ATOM   1026  H HB3  . GLN A 1 68 ? -5.092  -2.407  9.532   1.00 1.00 ? 68  GLN A HB3  1  
ATOM   1027  H HG2  . GLN A 1 68 ? -2.932  -4.360  8.758   1.00 1.00 ? 68  GLN A HG2  1  
ATOM   1028  H HG3  . GLN A 1 68 ? -3.416  -4.174  10.442  1.00 1.00 ? 68  GLN A HG3  1  
ATOM   1029  H HE21 . GLN A 1 68 ? -4.686  -5.017  7.201   1.00 1.00 ? 68  GLN A HE21 1  
ATOM   1030  H HE22 . GLN A 1 68 ? -6.017  -5.895  7.780   1.00 1.00 ? 68  GLN A HE22 1  
ATOM   1031  N N    . GLN A 1 69 ? -4.202  0.081   7.729   1.00 1.00 ? 69  GLN A N    1  
ATOM   1032  C CA   . GLN A 1 69 ? -4.812  1.384   7.503   1.00 1.00 ? 69  GLN A CA   1  
ATOM   1033  C C    . GLN A 1 69 ? -4.883  1.696   6.013   1.00 1.00 ? 69  GLN A C    1  
ATOM   1034  O O    . GLN A 1 69 ? -5.887  2.215   5.525   1.00 1.00 ? 69  GLN A O    1  
ATOM   1035  C CB   . GLN A 1 69 ? -4.000  2.471   8.215   1.00 1.00 ? 69  GLN A CB   1  
ATOM   1036  C CG   . GLN A 1 69 ? -4.712  3.817   8.074   1.00 1.00 ? 69  GLN A CG   1  
ATOM   1037  C CD   . GLN A 1 69 ? -6.037  3.786   8.827   1.00 1.00 ? 69  GLN A CD   1  
ATOM   1038  O OE1  . GLN A 1 69 ? -6.143  3.147   9.873   1.00 1.00 ? 69  GLN A OE1  1  
ATOM   1039  N NE2  . GLN A 1 69 ? -7.061  4.444   8.356   1.00 1.00 ? 69  GLN A NE2  1  
ATOM   1040  H H    . GLN A 1 69 ? -3.331  0.031   8.173   1.00 1.00 ? 69  GLN A H    1  
ATOM   1041  H HA   . GLN A 1 69 ? -5.813  1.378   7.909   1.00 1.00 ? 69  GLN A HA   1  
ATOM   1042  H HB2  . GLN A 1 69 ? -3.904  2.221   9.260   1.00 1.00 ? 69  GLN A HB2  1  
ATOM   1043  H HB3  . GLN A 1 69 ? -3.019  2.537   7.767   1.00 1.00 ? 69  GLN A HB3  1  
ATOM   1044  H HG2  . GLN A 1 69 ? -4.086  4.597   8.480   1.00 1.00 ? 69  GLN A HG2  1  
ATOM   1045  H HG3  . GLN A 1 69 ? -4.898  4.015   7.030   1.00 1.00 ? 69  GLN A HG3  1  
ATOM   1046  H HE21 . GLN A 1 69 ? -6.973  4.953   7.523   1.00 1.00 ? 69  GLN A HE21 1  
ATOM   1047  H HE22 . GLN A 1 69 ? -7.915  4.429   8.835   1.00 1.00 ? 69  GLN A HE22 1  
ATOM   1048  N N    . ALA A 1 70 ? -3.812  1.375   5.295   1.00 1.00 ? 70  ALA A N    1  
ATOM   1049  C CA   . ALA A 1 70 ? -3.761  1.640   3.863   1.00 1.00 ? 70  ALA A CA   1  
ATOM   1050  C C    . ALA A 1 70 ? -4.942  0.992   3.152   1.00 1.00 ? 70  ALA A C    1  
ATOM   1051  O O    . ALA A 1 70 ? -5.602  1.622   2.325   1.00 1.00 ? 70  ALA A O    1  
ATOM   1052  C CB   . ALA A 1 70 ? -2.453  1.095   3.280   1.00 1.00 ? 70  ALA A CB   1  
ATOM   1053  H H    . ALA A 1 70 ? -3.044  0.957   5.739   1.00 1.00 ? 70  ALA A H    1  
ATOM   1054  H HA   . ALA A 1 70 ? -3.795  2.706   3.701   1.00 1.00 ? 70  ALA A HA   1  
ATOM   1055  H HB1  . ALA A 1 70 ? -2.352  0.052   3.539   1.00 1.00 ? 70  ALA A HB1  1  
ATOM   1056  H HB2  . ALA A 1 70 ? -1.619  1.649   3.685   1.00 1.00 ? 70  ALA A HB2  1  
ATOM   1057  H HB3  . ALA A 1 70 ? -2.467  1.199   2.205   1.00 1.00 ? 70  ALA A HB3  1  
ATOM   1058  N N    . ALA A 1 71 ? -5.207  -0.267  3.482   1.00 1.00 ? 71  ALA A N    1  
ATOM   1059  C CA   . ALA A 1 71 ? -6.311  -0.988  2.864   1.00 1.00 ? 71  ALA A CA   1  
ATOM   1060  C C    . ALA A 1 71 ? -7.642  -0.318  3.187   1.00 1.00 ? 71  ALA A C    1  
ATOM   1061  O O    . ALA A 1 71 ? -8.503  -0.177  2.319   1.00 1.00 ? 71  ALA A O    1  
ATOM   1062  C CB   . ALA A 1 71 ? -6.336  -2.435  3.372   1.00 1.00 ? 71  ALA A CB   1  
ATOM   1063  H H    . ALA A 1 71 ? -4.649  -0.717  4.150   1.00 1.00 ? 71  ALA A H    1  
ATOM   1064  H HA   . ALA A 1 71 ? -6.172  -0.999  1.795   1.00 1.00 ? 71  ALA A HA   1  
ATOM   1065  H HB1  . ALA A 1 71 ? -5.396  -2.912  3.143   1.00 1.00 ? 71  ALA A HB1  1  
ATOM   1066  H HB2  . ALA A 1 71 ? -7.139  -2.972  2.890   1.00 1.00 ? 71  ALA A HB2  1  
ATOM   1067  H HB3  . ALA A 1 71 ? -6.489  -2.440  4.440   1.00 1.00 ? 71  ALA A HB3  1  
ATOM   1068  N N    . ASP A 1 72 ? -7.801  0.099   4.438   1.00 1.00 ? 72  ASP A N    1  
ATOM   1069  C CA   . ASP A 1 72 ? -9.036  0.747   4.865   1.00 1.00 ? 72  ASP A CA   1  
ATOM   1070  C C    . ASP A 1 72 ? -9.252  2.049   4.109   1.00 1.00 ? 72  ASP A C    1  
ATOM   1071  O O    . ASP A 1 72 ? -10.361 2.343   3.661   1.00 1.00 ? 72  ASP A O    1  
ATOM   1072  C CB   . ASP A 1 72 ? -8.983  1.029   6.368   1.00 1.00 ? 72  ASP A CB   1  
ATOM   1073  C CG   . ASP A 1 72 ? -10.277 1.697   6.819   1.00 1.00 ? 72  ASP A CG   1  
ATOM   1074  O OD1  . ASP A 1 72 ? -11.325 1.101   6.632   1.00 1.00 ? 72  ASP A OD1  1  
ATOM   1075  O OD2  . ASP A 1 72 ? -10.202 2.795   7.345   1.00 1.00 ? 72  ASP A OD2  1  
ATOM   1076  H H    . ASP A 1 72 ? -7.077  -0.031  5.085   1.00 1.00 ? 72  ASP A H    1  
ATOM   1077  H HA   . ASP A 1 72 ? -9.865  0.079   4.665   1.00 1.00 ? 72  ASP A HA   1  
ATOM   1078  H HB2  . ASP A 1 72 ? -8.853  0.102   6.905   1.00 1.00 ? 72  ASP A HB2  1  
ATOM   1079  H HB3  . ASP A 1 72 ? -8.151  1.684   6.580   1.00 1.00 ? 72  ASP A HB3  1  
ATOM   1080  N N    . VAL A 1 73 ? -8.185  2.828   3.964   1.00 1.00 ? 73  VAL A N    1  
ATOM   1081  C CA   . VAL A 1 73 ? -8.269  4.101   3.260   1.00 1.00 ? 73  VAL A CA   1  
ATOM   1082  C C    . VAL A 1 73 ? -8.656  3.883   1.801   1.00 1.00 ? 73  VAL A C    1  
ATOM   1083  O O    . VAL A 1 73 ? -9.493  4.604   1.256   1.00 1.00 ? 73  VAL A O    1  
ATOM   1084  C CB   . VAL A 1 73 ? -6.925  4.827   3.333   1.00 1.00 ? 73  VAL A CB   1  
ATOM   1085  C CG1  . VAL A 1 73 ? -6.984  6.099   2.484   1.00 1.00 ? 73  VAL A CG1  1  
ATOM   1086  C CG2  . VAL A 1 73 ? -6.622  5.198   4.786   1.00 1.00 ? 73  VAL A CG2  1  
ATOM   1087  H H    . VAL A 1 73 ? -7.324  2.540   4.339   1.00 1.00 ? 73  VAL A H    1  
ATOM   1088  H HA   . VAL A 1 73 ? -9.022  4.714   3.734   1.00 1.00 ? 73  VAL A HA   1  
ATOM   1089  H HB   . VAL A 1 73 ? -6.146  4.181   2.955   1.00 1.00 ? 73  VAL A HB   1  
ATOM   1090  H HG11 . VAL A 1 73 ? -6.951  5.835   1.437   1.00 1.00 ? 73  VAL A HG11 1  
ATOM   1091  H HG12 . VAL A 1 73 ? -6.144  6.732   2.723   1.00 1.00 ? 73  VAL A HG12 1  
ATOM   1092  H HG13 . VAL A 1 73 ? -7.904  6.627   2.692   1.00 1.00 ? 73  VAL A HG13 1  
ATOM   1093  H HG21 . VAL A 1 73 ? -6.851  4.360   5.426   1.00 1.00 ? 73  VAL A HG21 1  
ATOM   1094  H HG22 . VAL A 1 73 ? -7.225  6.048   5.073   1.00 1.00 ? 73  VAL A HG22 1  
ATOM   1095  H HG23 . VAL A 1 73 ? -5.577  5.450   4.881   1.00 1.00 ? 73  VAL A HG23 1  
ATOM   1096  N N    . ILE A 1 74 ? -8.036  2.892   1.173   1.00 1.00 ? 74  ILE A N    1  
ATOM   1097  C CA   . ILE A 1 74 ? -8.318  2.588   -0.226  1.00 1.00 ? 74  ILE A CA   1  
ATOM   1098  C C    . ILE A 1 74 ? -9.773  2.176   -0.405  1.00 1.00 ? 74  ILE A C    1  
ATOM   1099  O O    . ILE A 1 74 ? -10.435 2.593   -1.356  1.00 1.00 ? 74  ILE A O    1  
ATOM   1100  C CB   . ILE A 1 74 ? -7.397  1.477   -0.718  1.00 1.00 ? 74  ILE A CB   1  
ATOM   1101  C CG1  . ILE A 1 74 ? -5.983  2.028   -0.919  1.00 1.00 ? 74  ILE A CG1  1  
ATOM   1102  C CG2  . ILE A 1 74 ? -7.922  0.919   -2.044  1.00 1.00 ? 74  ILE A CG2  1  
ATOM   1103  C CD1  . ILE A 1 74 ? -4.980  0.873   -0.948  1.00 1.00 ? 74  ILE A CD1  1  
ATOM   1104  H H    . ILE A 1 74 ? -7.382  2.345   1.659   1.00 1.00 ? 74  ILE A H    1  
ATOM   1105  H HA   . ILE A 1 74 ? -8.132  3.479   -0.816  1.00 1.00 ? 74  ILE A HA   1  
ATOM   1106  H HB   . ILE A 1 74 ? -7.367  0.683   0.018   1.00 1.00 ? 74  ILE A HB   1  
ATOM   1107  H HG12 . ILE A 1 74 ? -5.940  2.563   -1.861  1.00 1.00 ? 74  ILE A HG12 1  
ATOM   1108  H HG13 . ILE A 1 74 ? -5.739  2.698   -0.115  1.00 1.00 ? 74  ILE A HG13 1  
ATOM   1109  H HG21 . ILE A 1 74 ? -8.706  0.203   -1.845  1.00 1.00 ? 74  ILE A HG21 1  
ATOM   1110  H HG22 . ILE A 1 74 ? -7.121  0.437   -2.579  1.00 1.00 ? 74  ILE A HG22 1  
ATOM   1111  H HG23 . ILE A 1 74 ? -8.318  1.729   -2.638  1.00 1.00 ? 74  ILE A HG23 1  
ATOM   1112  H HD11 . ILE A 1 74 ? -4.576  0.730   0.044   1.00 1.00 ? 74  ILE A HD11 1  
ATOM   1113  H HD12 . ILE A 1 74 ? -4.180  1.107   -1.632  1.00 1.00 ? 74  ILE A HD12 1  
ATOM   1114  H HD13 . ILE A 1 74 ? -5.476  -0.032  -1.267  1.00 1.00 ? 74  ILE A HD13 1  
ATOM   1115  N N    . GLU A 1 75 ? -10.260 1.344   0.508   1.00 1.00 ? 75  GLU A N    1  
ATOM   1116  C CA   . GLU A 1 75 ? -11.643 0.882   0.446   1.00 1.00 ? 75  GLU A CA   1  
ATOM   1117  C C    . GLU A 1 75 ? -12.592 2.063   0.271   1.00 1.00 ? 75  GLU A C    1  
ATOM   1118  O O    . GLU A 1 75 ? -13.569 1.979   -0.474  1.00 1.00 ? 75  GLU A O    1  
ATOM   1119  C CB   . GLU A 1 75 ? -11.997 0.121   1.724   1.00 1.00 ? 75  GLU A CB   1  
ATOM   1120  C CG   . GLU A 1 75 ? -11.425 -1.295  1.651   1.00 1.00 ? 75  GLU A CG   1  
ATOM   1121  C CD   . GLU A 1 75 ? -11.713 -2.041  2.949   1.00 1.00 ? 75  GLU A CD   1  
ATOM   1122  O OE1  . GLU A 1 75 ? -12.231 -1.422  3.864   1.00 1.00 ? 75  GLU A OE1  1  
ATOM   1123  O OE2  . GLU A 1 75 ? -11.409 -3.219  3.010   1.00 1.00 ? 75  GLU A OE2  1  
ATOM   1124  H H    . GLU A 1 75 ? -9.682  1.040   1.239   1.00 1.00 ? 75  GLU A H    1  
ATOM   1125  H HA   . GLU A 1 75 ? -11.751 0.218   -0.399  1.00 1.00 ? 75  GLU A HA   1  
ATOM   1126  H HB2  . GLU A 1 75 ? -11.574 0.634   2.577   1.00 1.00 ? 75  GLU A HB2  1  
ATOM   1127  H HB3  . GLU A 1 75 ? -13.069 0.071   1.829   1.00 1.00 ? 75  GLU A HB3  1  
ATOM   1128  H HG2  . GLU A 1 75 ? -11.884 -1.823  0.825   1.00 1.00 ? 75  GLU A HG2  1  
ATOM   1129  H HG3  . GLU A 1 75 ? -10.359 -1.246  1.494   1.00 1.00 ? 75  GLU A HG3  1  
ATOM   1130  N N    . GLY A 1 76 ? -12.303 3.157   0.967   1.00 1.00 ? 76  GLY A N    1  
ATOM   1131  C CA   . GLY A 1 76 ? -13.133 4.351   0.873   1.00 1.00 ? 76  GLY A CA   1  
ATOM   1132  C C    . GLY A 1 76 ? -12.983 5.011   -0.495  1.00 1.00 ? 76  GLY A C    1  
ATOM   1133  O O    . GLY A 1 76 ? -13.963 5.456   -1.093  1.00 1.00 ? 76  GLY A O    1  
ATOM   1134  H H    . GLY A 1 76 ? -11.517 3.162   1.551   1.00 1.00 ? 76  GLY A H    1  
ATOM   1135  H HA2  . GLY A 1 76 ? -14.168 4.078   1.023   1.00 1.00 ? 76  GLY A HA2  1  
ATOM   1136  H HA3  . GLY A 1 76 ? -12.836 5.052   1.637   1.00 1.00 ? 76  GLY A HA3  1  
ATOM   1137  N N    . LEU A 1 77 ? -11.750 5.073   -0.984  1.00 1.00 ? 77  LEU A N    1  
ATOM   1138  C CA   . LEU A 1 77 ? -11.477 5.679   -2.285  1.00 1.00 ? 77  LEU A CA   1  
ATOM   1139  C C    . LEU A 1 77 ? -12.147 4.880   -3.397  1.00 1.00 ? 77  LEU A C    1  
ATOM   1140  O O    . LEU A 1 77 ? -12.655 5.447   -4.364  1.00 1.00 ? 77  LEU A O    1  
ATOM   1141  C CB   . LEU A 1 77 ? -9.973  5.744   -2.527  1.00 1.00 ? 77  LEU A CB   1  
ATOM   1142  C CG   . LEU A 1 77 ? -9.345  6.767   -1.576  1.00 1.00 ? 77  LEU A CG   1  
ATOM   1143  C CD1  . LEU A 1 77 ? -7.820  6.634   -1.620  1.00 1.00 ? 77  LEU A CD1  1  
ATOM   1144  C CD2  . LEU A 1 77 ? -9.747  8.179   -2.008  1.00 1.00 ? 77  LEU A CD2  1  
ATOM   1145  H H    . LEU A 1 77 ? -11.007 4.701   -0.465  1.00 1.00 ? 77  LEU A H    1  
ATOM   1146  H HA   . LEU A 1 77 ? -11.882 6.682   -2.288  1.00 1.00 ? 77  LEU A HA   1  
ATOM   1147  H HB2  . LEU A 1 77 ? -9.539  4.773   -2.349  1.00 1.00 ? 77  LEU A HB2  1  
ATOM   1148  H HB3  . LEU A 1 77 ? -9.785  6.041   -3.551  1.00 1.00 ? 77  LEU A HB3  1  
ATOM   1149  H HG   . LEU A 1 77 ? -9.694  6.584   -0.571  1.00 1.00 ? 77  LEU A HG   1  
ATOM   1150  H HD11 . LEU A 1 77 ? -7.387  7.221   -0.823  1.00 1.00 ? 77  LEU A HD11 1  
ATOM   1151  H HD12 . LEU A 1 77 ? -7.456  6.993   -2.570  1.00 1.00 ? 77  LEU A HD12 1  
ATOM   1152  H HD13 . LEU A 1 77 ? -7.545  5.599   -1.494  1.00 1.00 ? 77  LEU A HD13 1  
ATOM   1153  H HD21 . LEU A 1 77 ? -10.730 8.409   -1.622  1.00 1.00 ? 77  LEU A HD21 1  
ATOM   1154  H HD22 . LEU A 1 77 ? -9.759  8.238   -3.085  1.00 1.00 ? 77  LEU A HD22 1  
ATOM   1155  H HD23 . LEU A 1 77 ? -9.035  8.893   -1.617  1.00 1.00 ? 77  LEU A HD23 1  
ATOM   1156  N N    . LEU A 1 78 ? -12.136 3.559   -3.256  1.00 1.00 ? 78  LEU A N    1  
ATOM   1157  C CA   . LEU A 1 78 ? -12.753 2.689   -4.250  1.00 1.00 ? 78  LEU A CA   1  
ATOM   1158  C C    . LEU A 1 78 ? -14.249 2.971   -4.348  1.00 1.00 ? 78  LEU A C    1  
ATOM   1159  O O    . LEU A 1 78 ? -14.864 2.759   -5.396  1.00 1.00 ? 78  LEU A O    1  
ATOM   1160  C CB   . LEU A 1 78 ? -12.532 1.223   -3.871  1.00 1.00 ? 78  LEU A CB   1  
ATOM   1161  C CG   . LEU A 1 78 ? -11.120 0.799   -4.280  1.00 1.00 ? 78  LEU A CG   1  
ATOM   1162  C CD1  . LEU A 1 78 ? -10.733 -0.479  -3.535  1.00 1.00 ? 78  LEU A CD1  1  
ATOM   1163  C CD2  . LEU A 1 78 ? -11.084 0.539   -5.790  1.00 1.00 ? 78  LEU A CD2  1  
ATOM   1164  H H    . LEU A 1 78 ? -11.708 3.161   -2.468  1.00 1.00 ? 78  LEU A H    1  
ATOM   1165  H HA   . LEU A 1 78 ? -12.302 2.878   -5.208  1.00 1.00 ? 78  LEU A HA   1  
ATOM   1166  H HB2  . LEU A 1 78 ? -12.648 1.106   -2.804  1.00 1.00 ? 78  LEU A HB2  1  
ATOM   1167  H HB3  . LEU A 1 78 ? -13.256 0.605   -4.381  1.00 1.00 ? 78  LEU A HB3  1  
ATOM   1168  H HG   . LEU A 1 78 ? -10.421 1.584   -4.033  1.00 1.00 ? 78  LEU A HG   1  
ATOM   1169  H HD11 . LEU A 1 78 ? -9.700  -0.717  -3.740  1.00 1.00 ? 78  LEU A HD11 1  
ATOM   1170  H HD12 . LEU A 1 78 ? -11.361 -1.293  -3.865  1.00 1.00 ? 78  LEU A HD12 1  
ATOM   1171  H HD13 . LEU A 1 78 ? -10.865 -0.331  -2.475  1.00 1.00 ? 78  LEU A HD13 1  
ATOM   1172  H HD21 . LEU A 1 78 ? -11.974 0.005   -6.086  1.00 1.00 ? 78  LEU A HD21 1  
ATOM   1173  H HD22 . LEU A 1 78 ? -10.213 -0.052  -6.032  1.00 1.00 ? 78  LEU A HD22 1  
ATOM   1174  H HD23 . LEU A 1 78 ? -11.035 1.479   -6.318  1.00 1.00 ? 78  LEU A HD23 1  
ATOM   1175  N N    . GLU A 1 79 ? -14.834 3.436   -3.250  1.00 1.00 ? 79  GLU A N    1  
ATOM   1176  C CA   . GLU A 1 79 ? -16.257 3.734   -3.229  1.00 1.00 ? 79  GLU A CA   1  
ATOM   1177  C C    . GLU A 1 79 ? -16.503 5.230   -3.382  1.00 1.00 ? 79  GLU A C    1  
ATOM   1178  O O    . GLU A 1 79 ? -17.428 5.651   -4.077  1.00 1.00 ? 79  GLU A O    1  
ATOM   1179  C CB   . GLU A 1 79 ? -16.865 3.258   -1.899  1.00 1.00 ? 79  GLU A CB   1  
ATOM   1180  C CG   . GLU A 1 79 ? -16.511 1.787   -1.675  1.00 1.00 ? 79  GLU A CG   1  
ATOM   1181  C CD   . GLU A 1 79 ? -17.310 0.905   -2.626  1.00 1.00 ? 79  GLU A CD   1  
ATOM   1182  O OE1  . GLU A 1 79 ? -18.319 1.371   -3.128  1.00 1.00 ? 79  GLU A OE1  1  
ATOM   1183  O OE2  . GLU A 1 79 ? -16.906 -0.228  -2.834  1.00 1.00 ? 79  GLU A OE2  1  
ATOM   1184  H H    . GLU A 1 79 ? -14.296 3.591   -2.444  1.00 1.00 ? 79  GLU A H    1  
ATOM   1185  H HA   . GLU A 1 79 ? -16.746 3.215   -4.032  1.00 1.00 ? 79  GLU A HA   1  
ATOM   1186  H HB2  . GLU A 1 79 ? -16.473 3.856   -1.089  1.00 1.00 ? 79  GLU A HB2  1  
ATOM   1187  H HB3  . GLU A 1 79 ? -17.940 3.365   -1.936  1.00 1.00 ? 79  GLU A HB3  1  
ATOM   1188  H HG2  . GLU A 1 79 ? -15.454 1.643   -1.857  1.00 1.00 ? 79  GLU A HG2  1  
ATOM   1189  H HG3  . GLU A 1 79 ? -16.735 1.521   -0.656  1.00 1.00 ? 79  GLU A HG3  1  
ATOM   1190  N N    . LYS A 1 80 ? -15.668 6.032   -2.728  1.00 1.00 ? 80  LYS A N    1  
ATOM   1191  C CA   . LYS A 1 80 ? -15.817 7.476   -2.773  1.00 1.00 ? 80  LYS A CA   1  
ATOM   1192  C C    . LYS A 1 80 ? -15.096 8.076   -3.961  1.00 1.00 ? 80  LYS A C    1  
ATOM   1193  O O    . LYS A 1 80 ? -15.325 7.677   -5.104  1.00 1.00 ? 80  LYS A O    1  
ATOM   1194  C CB   . LYS A 1 80 ? -15.285 8.098   -1.474  1.00 1.00 ? 80  LYS A CB   1  
ATOM   1195  C CG   . LYS A 1 80 ? -16.167 7.683   -0.297  1.00 1.00 ? 80  LYS A CG   1  
ATOM   1196  C CD   . LYS A 1 80 ? -17.582 8.241   -0.495  1.00 1.00 ? 80  LYS A CD   1  
ATOM   1197  C CE   . LYS A 1 80 ? -18.494 7.147   -1.064  1.00 1.00 ? 80  LYS A CE   1  
ATOM   1198  N NZ   . LYS A 1 80 ? -19.492 6.749   -0.039  1.00 1.00 ? 80  LYS A NZ   1  
ATOM   1199  H H    . LYS A 1 80 ? -14.930 5.648   -2.214  1.00 1.00 ? 80  LYS A H    1  
ATOM   1200  H HA   . LYS A 1 80 ? -16.874 7.714   -2.856  1.00 1.00 ? 80  LYS A HA   1  
ATOM   1201  H HB2  . LYS A 1 80 ? -14.279 7.754   -1.309  1.00 1.00 ? 80  LYS A HB2  1  
ATOM   1202  H HB3  . LYS A 1 80 ? -15.290 9.171   -1.561  1.00 1.00 ? 80  LYS A HB3  1  
ATOM   1203  H HG2  . LYS A 1 80 ? -16.206 6.603   -0.242  1.00 1.00 ? 80  LYS A HG2  1  
ATOM   1204  H HG3  . LYS A 1 80 ? -15.754 8.067   0.613   1.00 1.00 ? 80  LYS A HG3  1  
ATOM   1205  H HD2  . LYS A 1 80 ? -17.973 8.574   0.452   1.00 1.00 ? 80  LYS A HD2  1  
ATOM   1206  H HD3  . LYS A 1 80 ? -17.544 9.075   -1.187  1.00 1.00 ? 80  LYS A HD3  1  
ATOM   1207  H HE2  . LYS A 1 80 ? -18.998 7.520   -1.942  1.00 1.00 ? 80  LYS A HE2  1  
ATOM   1208  H HE3  . LYS A 1 80 ? -17.897 6.282   -1.342  1.00 1.00 ? 80  LYS A HE3  1  
ATOM   1209  H HZ1  . LYS A 1 80 ? -20.428 7.110   -0.310  1.00 1.00 ? 80  LYS A HZ1  1  
ATOM   1210  H HZ2  . LYS A 1 80 ? -19.220 7.146   0.884   1.00 1.00 ? 80  LYS A HZ2  1  
ATOM   1211  H HZ3  . LYS A 1 80 ? -19.528 5.712   0.027   1.00 1.00 ? 80  LYS A HZ3  1  
ATOM   1212  N N    . LYS A 1 81 ? -14.217 9.037   -3.696  1.00 1.00 ? 81  LYS A N    1  
ATOM   1213  C CA   . LYS A 1 81 ? -13.486 9.711   -4.757  1.00 1.00 ? 81  LYS A CA   1  
ATOM   1214  C C    . LYS A 1 81 ? -12.146 10.226  -4.258  1.00 1.00 ? 81  LYS A C    1  
ATOM   1215  O O    . LYS A 1 81 ? -11.127 9.555   -4.397  1.00 1.00 ? 81  LYS A O    1  
ATOM   1216  C CB   . LYS A 1 81 ? -14.321 10.891  -5.287  1.00 1.00 ? 81  LYS A CB   1  
ATOM   1217  C CG   . LYS A 1 81 ? -15.325 10.387  -6.326  1.00 1.00 ? 81  LYS A CG   1  
ATOM   1218  C CD   . LYS A 1 81 ? -16.093 11.572  -6.912  1.00 1.00 ? 81  LYS A CD   1  
ATOM   1219  C CE   . LYS A 1 81 ? -17.082 11.068  -7.965  1.00 1.00 ? 81  LYS A CE   1  
ATOM   1220  N NZ   . LYS A 1 81 ? -17.812 12.225  -8.554  1.00 1.00 ? 81  LYS A NZ   1  
ATOM   1221  H H    . LYS A 1 81 ? -14.054 9.284   -2.760  1.00 1.00 ? 81  LYS A H    1  
ATOM   1222  H HA   . LYS A 1 81 ? -13.325 9.022   -5.562  1.00 1.00 ? 81  LYS A HA   1  
ATOM   1223  H HB2  . LYS A 1 81 ? -14.859 11.346  -4.460  1.00 1.00 ? 81  LYS A HB2  1  
ATOM   1224  H HB3  . LYS A 1 81 ? -13.671 11.621  -5.739  1.00 1.00 ? 81  LYS A HB3  1  
ATOM   1225  H HG2  . LYS A 1 81 ? -14.794 9.874   -7.116  1.00 1.00 ? 81  LYS A HG2  1  
ATOM   1226  H HG3  . LYS A 1 81 ? -16.018 9.707   -5.857  1.00 1.00 ? 81  LYS A HG3  1  
ATOM   1227  H HD2  . LYS A 1 81 ? -16.630 12.078  -6.123  1.00 1.00 ? 81  LYS A HD2  1  
ATOM   1228  H HD3  . LYS A 1 81 ? -15.398 12.258  -7.372  1.00 1.00 ? 81  LYS A HD3  1  
ATOM   1229  H HE2  . LYS A 1 81 ? -16.546 10.545  -8.743  1.00 1.00 ? 81  LYS A HE2  1  
ATOM   1230  H HE3  . LYS A 1 81 ? -17.789 10.395  -7.501  1.00 1.00 ? 81  LYS A HE3  1  
ATOM   1231  H HZ1  . LYS A 1 81 ? -18.222 12.802  -7.792  1.00 1.00 ? 81  LYS A HZ1  1  
ATOM   1232  H HZ2  . LYS A 1 81 ? -18.571 11.877  -9.174  1.00 1.00 ? 81  LYS A HZ2  1  
ATOM   1233  H HZ3  . LYS A 1 81 ? -17.151 12.806  -9.109  1.00 1.00 ? 81  LYS A HZ3  1  
ATOM   1234  N N    . ALA A 1 82 ? -12.153 11.422  -3.675  1.00 1.00 ? 82  ALA A N    1  
ATOM   1235  C CA   . ALA A 1 82 ? -10.926 12.014  -3.156  1.00 1.00 ? 82  ALA A CA   1  
ATOM   1236  C C    . ALA A 1 82 ? -11.242 13.043  -2.076  1.00 1.00 ? 82  ALA A C    1  
ATOM   1237  O O    . ALA A 1 82 ? -11.135 12.700  -0.911  1.00 1.00 ? 82  ALA A O    1  
ATOM   1238  C CB   . ALA A 1 82 ? -10.150 12.685  -4.292  1.00 1.00 ? 82  ALA A CB   1  
ATOM   1239  O OXT  . ALA A 1 82 ? -11.584 14.158  -2.431  1.00 1.00 ? 82  ALA A OXT  1  
ATOM   1240  H H    . ALA A 1 82 ? -12.999 11.909  -3.594  1.00 1.00 ? 82  ALA A H    1  
ATOM   1241  H HA   . ALA A 1 82 ? -10.314 11.232  -2.729  1.00 1.00 ? 82  ALA A HA   1  
ATOM   1242  H HB1  . ALA A 1 82 ? -10.735 13.497  -4.696  1.00 1.00 ? 82  ALA A HB1  1  
ATOM   1243  H HB2  . ALA A 1 82 ? -9.953  11.962  -5.070  1.00 1.00 ? 82  ALA A HB2  1  
ATOM   1244  H HB3  . ALA A 1 82 ? -9.215  13.068  -3.911  1.00 1.00 ? 82  ALA A HB3  1  
HETATM 1245  O O23  . PNS B 2 .  ? 16.591  3.929   -0.250  1.00 1.00 ? 101 PNS A O23  1  
HETATM 1246  P P24  . PNS B 2 .  ? 17.547  4.433   -1.443  1.00 1.00 ? 101 PNS A P24  1  
HETATM 1247  O O25  . PNS B 2 .  ? 18.813  3.671   -1.375  1.00 1.00 ? 101 PNS A O25  1  
HETATM 1248  O O26  . PNS B 2 .  ? 17.573  5.913   -1.423  1.00 1.00 ? 101 PNS A O26  1  
HETATM 1249  O O27  . PNS B 2 .  ? 16.745  3.961   -2.758  1.00 1.00 ? 101 PNS A O27  1  
HETATM 1250  C C28  . PNS B 2 .  ? 16.994  4.581   -4.012  1.00 1.00 ? 101 PNS A C28  1  
HETATM 1251  C C29  . PNS B 2 .  ? 16.020  4.021   -5.054  1.00 1.00 ? 101 PNS A C29  1  
HETATM 1252  C C30  . PNS B 2 .  ? 16.370  4.580   -6.436  1.00 1.00 ? 101 PNS A C30  1  
HETATM 1253  C C31  . PNS B 2 .  ? 14.592  4.429   -4.679  1.00 1.00 ? 101 PNS A C31  1  
HETATM 1254  C C32  . PNS B 2 .  ? 16.129  2.500   -5.099  1.00 1.00 ? 101 PNS A C32  1  
HETATM 1255  O O33  . PNS B 2 .  ? 15.738  1.976   -3.836  1.00 1.00 ? 101 PNS A O33  1  
HETATM 1256  C C34  . PNS B 2 .  ? 15.215  1.938   -6.184  1.00 1.00 ? 101 PNS A C34  1  
HETATM 1257  O O35  . PNS B 2 .  ? 15.642  1.728   -7.319  1.00 1.00 ? 101 PNS A O35  1  
HETATM 1258  N N36  . PNS B 2 .  ? 13.959  1.698   -5.827  1.00 1.00 ? 101 PNS A N36  1  
HETATM 1259  C C37  . PNS B 2 .  ? 12.994  1.161   -6.780  1.00 1.00 ? 101 PNS A C37  1  
HETATM 1260  C C38  . PNS B 2 .  ? 13.306  -0.306  -7.081  1.00 1.00 ? 101 PNS A C38  1  
HETATM 1261  C C39  . PNS B 2 .  ? 13.367  -1.103  -5.781  1.00 1.00 ? 101 PNS A C39  1  
HETATM 1262  O O40  . PNS B 2 .  ? 14.163  -2.032  -5.648  1.00 1.00 ? 101 PNS A O40  1  
HETATM 1263  N N41  . PNS B 2 .  ? 12.522  -0.732  -4.825  1.00 1.00 ? 101 PNS A N41  1  
HETATM 1264  C C42  . PNS B 2 .  ? 12.488  -1.418  -3.540  1.00 1.00 ? 101 PNS A C42  1  
HETATM 1265  C C43  . PNS B 2 .  ? 13.822  -1.244  -2.812  1.00 1.00 ? 101 PNS A C43  1  
HETATM 1266  S S44  . PNS B 2 .  ? 13.592  -1.543  -1.063  1.00 1.00 ? 101 PNS A S44  1  
HETATM 1267  H H282 . PNS B 2 .  ? 18.008  4.371   -4.319  1.00 1.00 ? 101 PNS A H282 1  
HETATM 1268  H H281 . PNS B 2 .  ? 16.857  5.648   -3.929  1.00 1.00 ? 101 PNS A H281 1  
HETATM 1269  H H303 . PNS B 2 .  ? 15.582  4.338   -7.133  1.00 1.00 ? 101 PNS A H303 1  
HETATM 1270  H H302 . PNS B 2 .  ? 16.474  5.656   -6.373  1.00 1.00 ? 101 PNS A H302 1  
HETATM 1271  H H301 . PNS B 2 .  ? 17.298  4.150   -6.775  1.00 1.00 ? 101 PNS A H301 1  
HETATM 1272  H H313 . PNS B 2 .  ? 14.280  3.878   -3.806  1.00 1.00 ? 101 PNS A H313 1  
HETATM 1273  H H312 . PNS B 2 .  ? 14.564  5.487   -4.470  1.00 1.00 ? 101 PNS A H312 1  
HETATM 1274  H H311 . PNS B 2 .  ? 13.928  4.207   -5.503  1.00 1.00 ? 101 PNS A H311 1  
HETATM 1275  H H32  . PNS B 2 .  ? 17.151  2.212   -5.306  1.00 1.00 ? 101 PNS A H32  1  
HETATM 1276  H H33  . PNS B 2 .  ? 15.061  1.310   -3.988  1.00 1.00 ? 101 PNS A H33  1  
HETATM 1277  H H36  . PNS B 2 .  ? 13.673  1.885   -4.908  1.00 1.00 ? 101 PNS A H36  1  
HETATM 1278  H H372 . PNS B 2 .  ? 13.043  1.731   -7.695  1.00 1.00 ? 101 PNS A H372 1  
HETATM 1279  H H371 . PNS B 2 .  ? 12.000  1.237   -6.366  1.00 1.00 ? 101 PNS A H371 1  
HETATM 1280  H H382 . PNS B 2 .  ? 12.533  -0.714  -7.714  1.00 1.00 ? 101 PNS A H382 1  
HETATM 1281  H H381 . PNS B 2 .  ? 14.258  -0.374  -7.586  1.00 1.00 ? 101 PNS A H381 1  
HETATM 1282  H H41  . PNS B 2 .  ? 11.909  0.016   -4.987  1.00 1.00 ? 101 PNS A H41  1  
HETATM 1283  H H422 . PNS B 2 .  ? 12.303  -2.469  -3.701  1.00 1.00 ? 101 PNS A H422 1  
HETATM 1284  H H421 . PNS B 2 .  ? 11.695  -1.005  -2.933  1.00 1.00 ? 101 PNS A H421 1  
HETATM 1285  H H431 . PNS B 2 .  ? 14.185  -0.238  -2.960  1.00 1.00 ? 101 PNS A H431 1  
HETATM 1286  H H432 . PNS B 2 .  ? 14.542  -1.948  -3.204  1.00 1.00 ? 101 PNS A H432 1  
HETATM 1287  C C1   . STE C 3 .  ? 13.593  -0.134  -0.042  1.00 1.00 ? 102 STE A C1   1  
HETATM 1288  O O1   . STE C 3 .  ? 13.739  0.990   -0.462  1.00 1.00 ? 102 STE A O1   1  
HETATM 1289  C C2   . STE C 3 .  ? 13.394  -0.494  1.401   1.00 1.00 ? 102 STE A C2   1  
HETATM 1290  C C3   . STE C 3 .  ? 11.901  -0.524  1.733   1.00 1.00 ? 102 STE A C3   1  
HETATM 1291  C C4   . STE C 3 .  ? 11.359  0.905   1.772   1.00 1.00 ? 102 STE A C4   1  
HETATM 1292  C C5   . STE C 3 .  ? 9.829   0.871   1.803   1.00 1.00 ? 102 STE A C5   1  
HETATM 1293  C C6   . STE C 3 .  ? 9.291   2.281   2.045   1.00 1.00 ? 102 STE A C6   1  
HETATM 1294  C C7   . STE C 3 .  ? 7.804   2.330   1.687   1.00 1.00 ? 102 STE A C7   1  
HETATM 1295  C C8   . STE C 3 .  ? 7.213   3.663   2.141   1.00 1.00 ? 102 STE A C8   1  
HETATM 1296  C C9   . STE C 3 .  ? 5.697   3.651   1.927   1.00 1.00 ? 102 STE A C9   1  
HETATM 1297  C C10  . STE C 3 .  ? 5.093   4.947   2.473   1.00 1.00 ? 102 STE A C10  1  
HETATM 1298  C C11  . STE C 3 .  ? 3.642   4.697   2.894   1.00 1.00 ? 102 STE A C11  1  
HETATM 1299  C C12  . STE C 3 .  ? 2.812   4.321   1.665   1.00 1.00 ? 102 STE A C12  1  
HETATM 1300  C C13  . STE C 3 .  ? 1.340   4.209   2.061   1.00 1.00 ? 102 STE A C13  1  
HETATM 1301  C C14  . STE C 3 .  ? 0.463   4.327   0.811   1.00 1.00 ? 102 STE A C14  1  
HETATM 1302  C C15  . STE C 3 .  ? -0.989  4.023   1.174   1.00 1.00 ? 102 STE A C15  1  
HETATM 1303  C C16  . STE C 3 .  ? -1.922  4.668   0.143   1.00 1.00 ? 102 STE A C16  1  
HETATM 1304  C C17  . STE C 3 .  ? -3.353  4.186   0.376   1.00 1.00 ? 102 STE A C17  1  
HETATM 1305  C C18  . STE C 3 .  ? -4.337  5.215   -0.185  1.00 1.00 ? 102 STE A C18  1  
HETATM 1306  H H21  . STE C 3 .  ? 13.823  -1.467  1.593   1.00 1.00 ? 102 STE A H21  1  
HETATM 1307  H H22  . STE C 3 .  ? 13.885  0.240   2.026   1.00 1.00 ? 102 STE A H22  1  
HETATM 1308  H H31  . STE C 3 .  ? 11.754  -0.991  2.695   1.00 1.00 ? 102 STE A H31  1  
HETATM 1309  H H32  . STE C 3 .  ? 11.376  -1.088  0.975   1.00 1.00 ? 102 STE A H32  1  
HETATM 1310  H H41  . STE C 3 .  ? 11.688  1.441   0.894   1.00 1.00 ? 102 STE A H41  1  
HETATM 1311  H H42  . STE C 3 .  ? 11.725  1.405   2.657   1.00 1.00 ? 102 STE A H42  1  
HETATM 1312  H H51  . STE C 3 .  ? 9.500   0.219   2.599   1.00 1.00 ? 102 STE A H51  1  
HETATM 1313  H H52  . STE C 3 .  ? 9.459   0.500   0.858   1.00 1.00 ? 102 STE A H52  1  
HETATM 1314  H H61  . STE C 3 .  ? 9.831   2.985   1.428   1.00 1.00 ? 102 STE A H61  1  
HETATM 1315  H H62  . STE C 3 .  ? 9.420   2.543   3.085   1.00 1.00 ? 102 STE A H62  1  
HETATM 1316  H H71  . STE C 3 .  ? 7.288   1.520   2.184   1.00 1.00 ? 102 STE A H71  1  
HETATM 1317  H H72  . STE C 3 .  ? 7.689   2.229   0.619   1.00 1.00 ? 102 STE A H72  1  
HETATM 1318  H H81  . STE C 3 .  ? 7.649   4.467   1.568   1.00 1.00 ? 102 STE A H81  1  
HETATM 1319  H H82  . STE C 3 .  ? 7.426   3.812   3.192   1.00 1.00 ? 102 STE A H82  1  
HETATM 1320  H H91  . STE C 3 .  ? 5.269   2.806   2.445   1.00 1.00 ? 102 STE A H91  1  
HETATM 1321  H H92  . STE C 3 .  ? 5.485   3.570   0.871   1.00 1.00 ? 102 STE A H92  1  
HETATM 1322  H H101 . STE C 3 .  ? 5.117   5.707   1.707   1.00 1.00 ? 102 STE A H101 1  
HETATM 1323  H H102 . STE C 3 .  ? 5.661   5.281   3.328   1.00 1.00 ? 102 STE A H102 1  
HETATM 1324  H H111 . STE C 3 .  ? 3.238   5.590   3.343   1.00 1.00 ? 102 STE A H111 1  
HETATM 1325  H H112 . STE C 3 .  ? 3.611   3.887   3.611   1.00 1.00 ? 102 STE A H112 1  
HETATM 1326  H H121 . STE C 3 .  ? 3.152   3.374   1.276   1.00 1.00 ? 102 STE A H121 1  
HETATM 1327  H H122 . STE C 3 .  ? 2.926   5.083   0.908   1.00 1.00 ? 102 STE A H122 1  
HETATM 1328  H H131 . STE C 3 .  ? 1.087   5.003   2.749   1.00 1.00 ? 102 STE A H131 1  
HETATM 1329  H H132 . STE C 3 .  ? 1.163   3.253   2.533   1.00 1.00 ? 102 STE A H132 1  
HETATM 1330  H H141 . STE C 3 .  ? 0.801   3.623   0.066   1.00 1.00 ? 102 STE A H141 1  
HETATM 1331  H H142 . STE C 3 .  ? 0.536   5.331   0.417   1.00 1.00 ? 102 STE A H142 1  
HETATM 1332  H H151 . STE C 3 .  ? -1.210  4.423   2.154   1.00 1.00 ? 102 STE A H151 1  
HETATM 1333  H H152 . STE C 3 .  ? -1.145  2.954   1.179   1.00 1.00 ? 102 STE A H152 1  
HETATM 1334  H H161 . STE C 3 .  ? -1.604  4.390   -0.850  1.00 1.00 ? 102 STE A H161 1  
HETATM 1335  H H162 . STE C 3 .  ? -1.878  5.743   0.247   1.00 1.00 ? 102 STE A H162 1  
HETATM 1336  H H171 . STE C 3 .  ? -3.526  4.066   1.436   1.00 1.00 ? 102 STE A H171 1  
HETATM 1337  H H172 . STE C 3 .  ? -3.499  3.239   -0.121  1.00 1.00 ? 102 STE A H172 1  
HETATM 1338  H H181 . STE C 3 .  ? -4.163  6.172   0.286   1.00 1.00 ? 102 STE A H181 1  
HETATM 1339  H H182 . STE C 3 .  ? -5.346  4.898   0.017   1.00 1.00 ? 102 STE A H182 1  
HETATM 1340  H H183 . STE C 3 .  ? -4.192  5.306   -1.251  1.00 1.00 ? 102 STE A H183 1  
ATOM   1341  N N    . ALA A 1 1  ? -9.406  -3.767  7.002   1.00 1.00 ? 1   ALA A N    2  
ATOM   1342  C CA   . ALA A 1 1  ? -9.617  -3.809  5.529   1.00 1.00 ? 1   ALA A CA   2  
ATOM   1343  C C    . ALA A 1 1  ? -9.898  -5.251  5.104   1.00 1.00 ? 1   ALA A C    2  
ATOM   1344  O O    . ALA A 1 1  ? -9.882  -6.166  5.925   1.00 1.00 ? 1   ALA A O    2  
ATOM   1345  C CB   . ALA A 1 1  ? -8.363  -3.282  4.824   1.00 1.00 ? 1   ALA A CB   2  
ATOM   1346  H H1   . ALA A 1 1  ? -8.420  -3.507  7.205   1.00 1.00 ? 1   ALA A H1   2  
ATOM   1347  H H2   . ALA A 1 1  ? -9.609  -4.703  7.409   1.00 1.00 ? 1   ALA A H2   2  
ATOM   1348  H H3   . ALA A 1 1  ? -10.042 -3.062  7.424   1.00 1.00 ? 1   ALA A H3   2  
ATOM   1349  H HA   . ALA A 1 1  ? -10.459 -3.187  5.269   1.00 1.00 ? 1   ALA A HA   2  
ATOM   1350  H HB1  . ALA A 1 1  ? -7.948  -2.460  5.392   1.00 1.00 ? 1   ALA A HB1  2  
ATOM   1351  H HB2  . ALA A 1 1  ? -8.627  -2.935  3.836   1.00 1.00 ? 1   ALA A HB2  2  
ATOM   1352  H HB3  . ALA A 1 1  ? -7.634  -4.072  4.748   1.00 1.00 ? 1   ALA A HB3  2  
ATOM   1353  N N    . LYS A 1 2  ? -10.148 -5.441  3.811   1.00 1.00 ? 2   LYS A N    2  
ATOM   1354  C CA   . LYS A 1 2  ? -10.429 -6.770  3.278   1.00 1.00 ? 2   LYS A CA   2  
ATOM   1355  C C    . LYS A 1 2  ? -9.130  -7.498  2.952   1.00 1.00 ? 2   LYS A C    2  
ATOM   1356  O O    . LYS A 1 2  ? -8.121  -6.876  2.634   1.00 1.00 ? 2   LYS A O    2  
ATOM   1357  C CB   . LYS A 1 2  ? -11.284 -6.656  2.015   1.00 1.00 ? 2   LYS A CB   2  
ATOM   1358  C CG   . LYS A 1 2  ? -12.672 -6.130  2.386   1.00 1.00 ? 2   LYS A CG   2  
ATOM   1359  C CD   . LYS A 1 2  ? -13.529 -6.022  1.124   1.00 1.00 ? 2   LYS A CD   2  
ATOM   1360  C CE   . LYS A 1 2  ? -14.925 -5.518  1.497   1.00 1.00 ? 2   LYS A CE   2  
ATOM   1361  N NZ   . LYS A 1 2  ? -15.755 -5.399  0.265   1.00 1.00 ? 2   LYS A NZ   2  
ATOM   1362  H H    . LYS A 1 2  ? -10.143 -4.673  3.205   1.00 1.00 ? 2   LYS A H    2  
ATOM   1363  H HA   . LYS A 1 2  ? -10.973 -7.341  4.014   1.00 1.00 ? 2   LYS A HA   2  
ATOM   1364  H HB2  . LYS A 1 2  ? -10.812 -5.979  1.319   1.00 1.00 ? 2   LYS A HB2  2  
ATOM   1365  H HB3  . LYS A 1 2  ? -11.382 -7.631  1.561   1.00 1.00 ? 2   LYS A HB3  2  
ATOM   1366  H HG2  . LYS A 1 2  ? -13.139 -6.807  3.085   1.00 1.00 ? 2   LYS A HG2  2  
ATOM   1367  H HG3  . LYS A 1 2  ? -12.577 -5.153  2.838   1.00 1.00 ? 2   LYS A HG3  2  
ATOM   1368  H HD2  . LYS A 1 2  ? -13.068 -5.332  0.433   1.00 1.00 ? 2   LYS A HD2  2  
ATOM   1369  H HD3  . LYS A 1 2  ? -13.612 -6.994  0.660   1.00 1.00 ? 2   LYS A HD3  2  
ATOM   1370  H HE2  . LYS A 1 2  ? -15.388 -6.217  2.177   1.00 1.00 ? 2   LYS A HE2  2  
ATOM   1371  H HE3  . LYS A 1 2  ? -14.845 -4.552  1.972   1.00 1.00 ? 2   LYS A HE3  2  
ATOM   1372  H HZ1  . LYS A 1 2  ? -15.716 -6.293  -0.268  1.00 1.00 ? 2   LYS A HZ1  2  
ATOM   1373  H HZ2  . LYS A 1 2  ? -15.389 -4.627  -0.327  1.00 1.00 ? 2   LYS A HZ2  2  
ATOM   1374  H HZ3  . LYS A 1 2  ? -16.740 -5.199  0.528   1.00 1.00 ? 2   LYS A HZ3  2  
ATOM   1375  N N    . LYS A 1 3  ? -9.166  -8.819  3.038   1.00 1.00 ? 3   LYS A N    2  
ATOM   1376  C CA   . LYS A 1 3  ? -7.982  -9.625  2.757   1.00 1.00 ? 3   LYS A CA   2  
ATOM   1377  C C    . LYS A 1 3  ? -7.528  -9.429  1.316   1.00 1.00 ? 3   LYS A C    2  
ATOM   1378  O O    . LYS A 1 3  ? -6.328  -9.410  1.033   1.00 1.00 ? 3   LYS A O    2  
ATOM   1379  C CB   . LYS A 1 3  ? -8.288  -11.101 2.993   1.00 1.00 ? 3   LYS A CB   2  
ATOM   1380  C CG   . LYS A 1 3  ? -8.586  -11.333 4.475   1.00 1.00 ? 3   LYS A CG   2  
ATOM   1381  C CD   . LYS A 1 3  ? -8.761  -12.832 4.738   1.00 1.00 ? 3   LYS A CD   2  
ATOM   1382  C CE   . LYS A 1 3  ? -9.990  -13.357 3.984   1.00 1.00 ? 3   LYS A CE   2  
ATOM   1383  N NZ   . LYS A 1 3  ? -10.448 -14.629 4.607   1.00 1.00 ? 3   LYS A NZ   2  
ATOM   1384  H H    . LYS A 1 3  ? -9.999  -9.263  3.300   1.00 1.00 ? 3   LYS A H    2  
ATOM   1385  H HA   . LYS A 1 3  ? -7.186  -9.323  3.419   1.00 1.00 ? 3   LYS A HA   2  
ATOM   1386  H HB2  . LYS A 1 3  ? -9.149  -11.378 2.403   1.00 1.00 ? 3   LYS A HB2  2  
ATOM   1387  H HB3  . LYS A 1 3  ? -7.440  -11.699 2.697   1.00 1.00 ? 3   LYS A HB3  2  
ATOM   1388  H HG2  . LYS A 1 3  ? -7.765  -10.954 5.070   1.00 1.00 ? 3   LYS A HG2  2  
ATOM   1389  H HG3  . LYS A 1 3  ? -9.494  -10.813 4.747   1.00 1.00 ? 3   LYS A HG3  2  
ATOM   1390  H HD2  . LYS A 1 3  ? -7.879  -13.359 4.400   1.00 1.00 ? 3   LYS A HD2  2  
ATOM   1391  H HD3  . LYS A 1 3  ? -8.892  -12.998 5.798   1.00 1.00 ? 3   LYS A HD3  2  
ATOM   1392  H HE2  . LYS A 1 3  ? -10.787 -12.630 4.028   1.00 1.00 ? 3   LYS A HE2  2  
ATOM   1393  H HE3  . LYS A 1 3  ? -9.727  -13.543 2.954   1.00 1.00 ? 3   LYS A HE3  2  
ATOM   1394  H HZ1  . LYS A 1 3  ? -10.119 -15.432 4.036   1.00 1.00 ? 3   LYS A HZ1  2  
ATOM   1395  H HZ2  . LYS A 1 3  ? -11.486 -14.635 4.652   1.00 1.00 ? 3   LYS A HZ2  2  
ATOM   1396  H HZ3  . LYS A 1 3  ? -10.058 -14.705 5.568   1.00 1.00 ? 3   LYS A HZ3  2  
ATOM   1397  N N    . GLU A 1 4  ? -8.485  -9.300  0.408   1.00 1.00 ? 4   GLU A N    2  
ATOM   1398  C CA   . GLU A 1 4  ? -8.165  -9.119  -0.999  1.00 1.00 ? 4   GLU A CA   2  
ATOM   1399  C C    . GLU A 1 4  ? -7.313  -7.866  -1.207  1.00 1.00 ? 4   GLU A C    2  
ATOM   1400  O O    . GLU A 1 4  ? -6.305  -7.896  -1.916  1.00 1.00 ? 4   GLU A O    2  
ATOM   1401  C CB   . GLU A 1 4  ? -9.460  -9.002  -1.812  1.00 1.00 ? 4   GLU A CB   2  
ATOM   1402  C CG   . GLU A 1 4  ? -10.165 -7.679  -1.483  1.00 1.00 ? 4   GLU A CG   2  
ATOM   1403  C CD   . GLU A 1 4  ? -11.609 -7.717  -1.964  1.00 1.00 ? 4   GLU A CD   2  
ATOM   1404  O OE1  . GLU A 1 4  ? -12.247 -8.740  -1.779  1.00 1.00 ? 4   GLU A OE1  2  
ATOM   1405  O OE2  . GLU A 1 4  ? -12.055 -6.722  -2.508  1.00 1.00 ? 4   GLU A OE2  2  
ATOM   1406  H H    . GLU A 1 4  ? -9.424  -9.337  0.688   1.00 1.00 ? 4   GLU A H    2  
ATOM   1407  H HA   . GLU A 1 4  ? -7.613  -9.980  -1.343  1.00 1.00 ? 4   GLU A HA   2  
ATOM   1408  H HB2  . GLU A 1 4  ? -9.225  -9.028  -2.868  1.00 1.00 ? 4   GLU A HB2  2  
ATOM   1409  H HB3  . GLU A 1 4  ? -10.112 -9.824  -1.569  1.00 1.00 ? 4   GLU A HB3  2  
ATOM   1410  H HG2  . GLU A 1 4  ? -10.147 -7.517  -0.418  1.00 1.00 ? 4   GLU A HG2  2  
ATOM   1411  H HG3  . GLU A 1 4  ? -9.652  -6.867  -1.978  1.00 1.00 ? 4   GLU A HG3  2  
ATOM   1412  N N    . THR A 1 5  ? -7.735  -6.761  -0.594  1.00 1.00 ? 5   THR A N    2  
ATOM   1413  C CA   . THR A 1 5  ? -7.017  -5.503  -0.724  1.00 1.00 ? 5   THR A CA   2  
ATOM   1414  C C    . THR A 1 5  ? -5.674  -5.576  -0.009  1.00 1.00 ? 5   THR A C    2  
ATOM   1415  O O    . THR A 1 5  ? -4.662  -5.086  -0.509  1.00 1.00 ? 5   THR A O    2  
ATOM   1416  C CB   . THR A 1 5  ? -7.853  -4.353  -0.149  1.00 1.00 ? 5   THR A CB   2  
ATOM   1417  O OG1  . THR A 1 5  ? -9.202  -4.516  -0.565  1.00 1.00 ? 5   THR A OG1  2  
ATOM   1418  C CG2  . THR A 1 5  ? -7.326  -3.025  -0.701  1.00 1.00 ? 5   THR A CG2  2  
ATOM   1419  H H    . THR A 1 5  ? -8.545  -6.795  -0.053  1.00 1.00 ? 5   THR A H    2  
ATOM   1420  H HA   . THR A 1 5  ? -6.843  -5.319  -1.771  1.00 1.00 ? 5   THR A HA   2  
ATOM   1421  H HB   . THR A 1 5  ? -7.792  -4.348  0.933   1.00 1.00 ? 5   THR A HB   2  
ATOM   1422  H HG1  . THR A 1 5  ? -9.643  -3.666  -0.489  1.00 1.00 ? 5   THR A HG1  2  
ATOM   1423  H HG21 . THR A 1 5  ? -7.709  -2.211  -0.106  1.00 1.00 ? 5   THR A HG21 2  
ATOM   1424  H HG22 . THR A 1 5  ? -7.655  -2.907  -1.728  1.00 1.00 ? 5   THR A HG22 2  
ATOM   1425  H HG23 . THR A 1 5  ? -6.245  -3.022  -0.670  1.00 1.00 ? 5   THR A HG23 2  
ATOM   1426  N N    . ILE A 1 6  ? -5.675  -6.192  1.167   1.00 1.00 ? 6   ILE A N    2  
ATOM   1427  C CA   . ILE A 1 6  ? -4.455  -6.327  1.948   1.00 1.00 ? 6   ILE A CA   2  
ATOM   1428  C C    . ILE A 1 6  ? -3.414  -7.128  1.180   1.00 1.00 ? 6   ILE A C    2  
ATOM   1429  O O    . ILE A 1 6  ? -2.242  -6.753  1.136   1.00 1.00 ? 6   ILE A O    2  
ATOM   1430  C CB   . ILE A 1 6  ? -4.766  -7.032  3.278   1.00 1.00 ? 6   ILE A CB   2  
ATOM   1431  C CG1  . ILE A 1 6  ? -5.598  -6.104  4.168   1.00 1.00 ? 6   ILE A CG1  2  
ATOM   1432  C CG2  . ILE A 1 6  ? -3.461  -7.397  3.992   1.00 1.00 ? 6   ILE A CG2  2  
ATOM   1433  C CD1  . ILE A 1 6  ? -6.182  -6.904  5.339   1.00 1.00 ? 6   ILE A CD1  2  
ATOM   1434  H H    . ILE A 1 6  ? -6.512  -6.565  1.513   1.00 1.00 ? 6   ILE A H    2  
ATOM   1435  H HA   . ILE A 1 6  ? -4.062  -5.346  2.158   1.00 1.00 ? 6   ILE A HA   2  
ATOM   1436  H HB   . ILE A 1 6  ? -5.326  -7.935  3.080   1.00 1.00 ? 6   ILE A HB   2  
ATOM   1437  H HG12 . ILE A 1 6  ? -4.968  -5.313  4.549   1.00 1.00 ? 6   ILE A HG12 2  
ATOM   1438  H HG13 . ILE A 1 6  ? -6.399  -5.675  3.591   1.00 1.00 ? 6   ILE A HG13 2  
ATOM   1439  H HG21 . ILE A 1 6  ? -2.770  -6.575  3.920   1.00 1.00 ? 6   ILE A HG21 2  
ATOM   1440  H HG22 . ILE A 1 6  ? -3.028  -8.268  3.523   1.00 1.00 ? 6   ILE A HG22 2  
ATOM   1441  H HG23 . ILE A 1 6  ? -3.664  -7.612  5.027   1.00 1.00 ? 6   ILE A HG23 2  
ATOM   1442  H HD11 . ILE A 1 6  ? -5.389  -7.440  5.841   1.00 1.00 ? 6   ILE A HD11 2  
ATOM   1443  H HD12 . ILE A 1 6  ? -6.911  -7.606  4.967   1.00 1.00 ? 6   ILE A HD12 2  
ATOM   1444  H HD13 . ILE A 1 6  ? -6.657  -6.229  6.037   1.00 1.00 ? 6   ILE A HD13 2  
ATOM   1445  N N    . ASP A 1 7  ? -3.841  -8.225  0.574   1.00 1.00 ? 7   ASP A N    2  
ATOM   1446  C CA   . ASP A 1 7  ? -2.927  -9.064  -0.185  1.00 1.00 ? 7   ASP A CA   2  
ATOM   1447  C C    . ASP A 1 7  ? -2.346  -8.283  -1.355  1.00 1.00 ? 7   ASP A C    2  
ATOM   1448  O O    . ASP A 1 7  ? -1.167  -8.409  -1.679  1.00 1.00 ? 7   ASP A O    2  
ATOM   1449  C CB   . ASP A 1 7  ? -3.666  -10.298 -0.705  1.00 1.00 ? 7   ASP A CB   2  
ATOM   1450  C CG   . ASP A 1 7  ? -2.664  -11.356 -1.159  1.00 1.00 ? 7   ASP A CG   2  
ATOM   1451  O OD1  . ASP A 1 7  ? -1.521  -10.999 -1.393  1.00 1.00 ? 7   ASP A OD1  2  
ATOM   1452  O OD2  . ASP A 1 7  ? -3.054  -12.508 -1.267  1.00 1.00 ? 7   ASP A OD2  2  
ATOM   1453  H H    . ASP A 1 7  ? -4.789  -8.476  0.641   1.00 1.00 ? 7   ASP A H    2  
ATOM   1454  H HA   . ASP A 1 7  ? -2.122  -9.384  0.459   1.00 1.00 ? 7   ASP A HA   2  
ATOM   1455  H HB2  . ASP A 1 7  ? -4.282  -10.698 0.082   1.00 1.00 ? 7   ASP A HB2  2  
ATOM   1456  H HB3  . ASP A 1 7  ? -4.292  -10.018 -1.538  1.00 1.00 ? 7   ASP A HB3  2  
ATOM   1457  N N    . LYS A 1 8  ? -3.182  -7.483  -1.986  1.00 1.00 ? 8   LYS A N    2  
ATOM   1458  C CA   . LYS A 1 8  ? -2.739  -6.680  -3.123  1.00 1.00 ? 8   LYS A CA   2  
ATOM   1459  C C    . LYS A 1 8  ? -1.725  -5.639  -2.688  1.00 1.00 ? 8   LYS A C    2  
ATOM   1460  O O    . LYS A 1 8  ? -0.684  -5.468  -3.320  1.00 1.00 ? 8   LYS A O    2  
ATOM   1461  C CB   . LYS A 1 8  ? -3.939  -5.974  -3.738  1.00 1.00 ? 8   LYS A CB   2  
ATOM   1462  C CG   . LYS A 1 8  ? -4.890  -7.000  -4.392  1.00 1.00 ? 8   LYS A CG   2  
ATOM   1463  C CD   . LYS A 1 8  ? -4.443  -7.302  -5.839  1.00 1.00 ? 8   LYS A CD   2  
ATOM   1464  C CE   . LYS A 1 8  ? -5.060  -6.276  -6.789  1.00 1.00 ? 8   LYS A CE   2  
ATOM   1465  N NZ   . LYS A 1 8  ? -4.534  -6.490  -8.160  1.00 1.00 ? 8   LYS A NZ   2  
ATOM   1466  H H    . LYS A 1 8  ? -4.116  -7.423  -1.680  1.00 1.00 ? 8   LYS A H    2  
ATOM   1467  H HA   . LYS A 1 8  ? -2.279  -7.324  -3.861  1.00 1.00 ? 8   LYS A HA   2  
ATOM   1468  H HB2  . LYS A 1 8  ? -4.461  -5.450  -2.953  1.00 1.00 ? 8   LYS A HB2  2  
ATOM   1469  H HB3  . LYS A 1 8  ? -3.600  -5.265  -4.474  1.00 1.00 ? 8   LYS A HB3  2  
ATOM   1470  H HG2  . LYS A 1 8  ? -4.882  -7.907  -3.816  1.00 1.00 ? 8   LYS A HG2  2  
ATOM   1471  H HG3  . LYS A 1 8  ? -5.897  -6.605  -4.403  1.00 1.00 ? 8   LYS A HG3  2  
ATOM   1472  H HD2  . LYS A 1 8  ? -3.366  -7.253  -5.914  1.00 1.00 ? 8   LYS A HD2  2  
ATOM   1473  H HD3  . LYS A 1 8  ? -4.778  -8.288  -6.123  1.00 1.00 ? 8   LYS A HD3  2  
ATOM   1474  H HE2  . LYS A 1 8  ? -6.134  -6.389  -6.792  1.00 1.00 ? 8   LYS A HE2  2  
ATOM   1475  H HE3  . LYS A 1 8  ? -4.803  -5.284  -6.454  1.00 1.00 ? 8   LYS A HE3  2  
ATOM   1476  H HZ1  . LYS A 1 8  ? -3.498  -6.411  -8.150  1.00 1.00 ? 8   LYS A HZ1  2  
ATOM   1477  H HZ2  . LYS A 1 8  ? -4.932  -5.772  -8.798  1.00 1.00 ? 8   LYS A HZ2  2  
ATOM   1478  H HZ3  . LYS A 1 8  ? -4.806  -7.438  -8.491  1.00 1.00 ? 8   LYS A HZ3  2  
ATOM   1479  N N    . VAL A 1 9  ? -2.037  -4.929  -1.611  1.00 1.00 ? 9   VAL A N    2  
ATOM   1480  C CA   . VAL A 1 9  ? -1.142  -3.897  -1.118  1.00 1.00 ? 9   VAL A CA   2  
ATOM   1481  C C    . VAL A 1 9  ? 0.209   -4.494  -0.753  1.00 1.00 ? 9   VAL A C    2  
ATOM   1482  O O    . VAL A 1 9  ? 1.255   -3.971  -1.137  1.00 1.00 ? 9   VAL A O    2  
ATOM   1483  C CB   . VAL A 1 9  ? -1.754  -3.218  0.111   1.00 1.00 ? 9   VAL A CB   2  
ATOM   1484  C CG1  . VAL A 1 9  ? -0.730  -2.275  0.749   1.00 1.00 ? 9   VAL A CG1  2  
ATOM   1485  C CG2  . VAL A 1 9  ? -2.986  -2.415  -0.309  1.00 1.00 ? 9   VAL A CG2  2  
ATOM   1486  H H    . VAL A 1 9  ? -2.887  -5.094  -1.152  1.00 1.00 ? 9   VAL A H    2  
ATOM   1487  H HA   . VAL A 1 9  ? -1.003  -3.166  -1.889  1.00 1.00 ? 9   VAL A HA   2  
ATOM   1488  H HB   . VAL A 1 9  ? -2.045  -3.971  0.832   1.00 1.00 ? 9   VAL A HB   2  
ATOM   1489  H HG11 . VAL A 1 9  ? 0.008   -2.855  1.284   1.00 1.00 ? 9   VAL A HG11 2  
ATOM   1490  H HG12 . VAL A 1 9  ? -1.229  -1.612  1.436   1.00 1.00 ? 9   VAL A HG12 2  
ATOM   1491  H HG13 . VAL A 1 9  ? -0.242  -1.698  -0.021  1.00 1.00 ? 9   VAL A HG13 2  
ATOM   1492  H HG21 . VAL A 1 9  ? -3.546  -2.140  0.572   1.00 1.00 ? 9   VAL A HG21 2  
ATOM   1493  H HG22 . VAL A 1 9  ? -3.603  -3.013  -0.960  1.00 1.00 ? 9   VAL A HG22 2  
ATOM   1494  H HG23 . VAL A 1 9  ? -2.670  -1.523  -0.826  1.00 1.00 ? 9   VAL A HG23 2  
ATOM   1495  N N    . SER A 1 10 ? 0.177   -5.594  -0.020  1.00 1.00 ? 10  SER A N    2  
ATOM   1496  C CA   . SER A 1 10 ? 1.407   -6.255  0.386   1.00 1.00 ? 10  SER A CA   2  
ATOM   1497  C C    . SER A 1 10 ? 2.188   -6.692  -0.846  1.00 1.00 ? 10  SER A C    2  
ATOM   1498  O O    . SER A 1 10 ? 3.401   -6.539  -0.901  1.00 1.00 ? 10  SER A O    2  
ATOM   1499  C CB   . SER A 1 10 ? 1.087   -7.474  1.260   1.00 1.00 ? 10  SER A CB   2  
ATOM   1500  O OG   . SER A 1 10 ? 2.246   -7.846  1.996   1.00 1.00 ? 10  SER A OG   2  
ATOM   1501  H H    . SER A 1 10 ? -0.685  -5.973  0.242   1.00 1.00 ? 10  SER A H    2  
ATOM   1502  H HA   . SER A 1 10 ? 2.012   -5.565  0.961   1.00 1.00 ? 10  SER A HA   2  
ATOM   1503  H HB2  . SER A 1 10 ? 0.293   -7.233  1.944   1.00 1.00 ? 10  SER A HB2  2  
ATOM   1504  H HB3  . SER A 1 10 ? 0.776   -8.298  0.630   1.00 1.00 ? 10  SER A HB3  2  
ATOM   1505  H HG   . SER A 1 10 ? 2.959   -7.253  1.750   1.00 1.00 ? 10  SER A HG   2  
ATOM   1506  N N    . ASP A 1 11 ? 1.482   -7.237  -1.831  1.00 1.00 ? 11  ASP A N    2  
ATOM   1507  C CA   . ASP A 1 11 ? 2.123   -7.698  -3.049  1.00 1.00 ? 11  ASP A CA   2  
ATOM   1508  C C    . ASP A 1 11 ? 2.780   -6.548  -3.775  1.00 1.00 ? 11  ASP A C    2  
ATOM   1509  O O    . ASP A 1 11 ? 3.894   -6.691  -4.266  1.00 1.00 ? 11  ASP A O    2  
ATOM   1510  C CB   . ASP A 1 11 ? 1.066   -8.361  -3.959  1.00 1.00 ? 11  ASP A CB   2  
ATOM   1511  C CG   . ASP A 1 11 ? 0.869   -9.833  -3.589  1.00 1.00 ? 11  ASP A CG   2  
ATOM   1512  O OD1  . ASP A 1 11 ? 1.593   -10.318 -2.733  1.00 1.00 ? 11  ASP A OD1  2  
ATOM   1513  O OD2  . ASP A 1 11 ? 0.003   -10.458 -4.179  1.00 1.00 ? 11  ASP A OD2  2  
ATOM   1514  H H    . ASP A 1 11 ? 0.516   -7.329  -1.738  1.00 1.00 ? 11  ASP A H    2  
ATOM   1515  H HA   . ASP A 1 11 ? 2.887   -8.415  -2.801  1.00 1.00 ? 11  ASP A HA   2  
ATOM   1516  H HB2  . ASP A 1 11 ? 0.126   -7.841  -3.840  1.00 1.00 ? 11  ASP A HB2  2  
ATOM   1517  H HB3  . ASP A 1 11 ? 1.366   -8.295  -4.989  1.00 1.00 ? 11  ASP A HB3  2  
ATOM   1518  N N    . ILE A 1 12 ? 2.094   -5.420  -3.841  1.00 1.00 ? 12  ILE A N    2  
ATOM   1519  C CA   . ILE A 1 12 ? 2.637   -4.270  -4.527  1.00 1.00 ? 12  ILE A CA   2  
ATOM   1520  C C    . ILE A 1 12 ? 3.992   -3.903  -3.938  1.00 1.00 ? 12  ILE A C    2  
ATOM   1521  O O    . ILE A 1 12 ? 4.858   -3.417  -4.653  1.00 1.00 ? 12  ILE A O    2  
ATOM   1522  C CB   . ILE A 1 12 ? 1.664   -3.063  -4.405  1.00 1.00 ? 12  ILE A CB   2  
ATOM   1523  C CG1  . ILE A 1 12 ? 0.820   -2.925  -5.683  1.00 1.00 ? 12  ILE A CG1  2  
ATOM   1524  C CG2  . ILE A 1 12 ? 2.431   -1.743  -4.179  1.00 1.00 ? 12  ILE A CG2  2  
ATOM   1525  C CD1  . ILE A 1 12 ? -0.179  -4.076  -5.767  1.00 1.00 ? 12  ILE A CD1  2  
ATOM   1526  H H    . ILE A 1 12 ? 1.204   -5.368  -3.440  1.00 1.00 ? 12  ILE A H    2  
ATOM   1527  H HA   . ILE A 1 12 ? 2.769   -4.528  -5.560  1.00 1.00 ? 12  ILE A HA   2  
ATOM   1528  H HB   . ILE A 1 12 ? 1.006   -3.234  -3.563  1.00 1.00 ? 12  ILE A HB   2  
ATOM   1529  H HG12 . ILE A 1 12 ? 0.283   -1.986  -5.651  1.00 1.00 ? 12  ILE A HG12 2  
ATOM   1530  H HG13 . ILE A 1 12 ? 1.462   -2.942  -6.552  1.00 1.00 ? 12  ILE A HG13 2  
ATOM   1531  H HG21 . ILE A 1 12 ? 2.854   -1.729  -3.182  1.00 1.00 ? 12  ILE A HG21 2  
ATOM   1532  H HG22 . ILE A 1 12 ? 1.758   -0.913  -4.295  1.00 1.00 ? 12  ILE A HG22 2  
ATOM   1533  H HG23 . ILE A 1 12 ? 3.232   -1.665  -4.900  1.00 1.00 ? 12  ILE A HG23 2  
ATOM   1534  H HD11 . ILE A 1 12 ? -0.604  -4.108  -6.760  1.00 1.00 ? 12  ILE A HD11 2  
ATOM   1535  H HD12 . ILE A 1 12 ? -0.966  -3.924  -5.044  1.00 1.00 ? 12  ILE A HD12 2  
ATOM   1536  H HD13 . ILE A 1 12 ? 0.328   -5.007  -5.562  1.00 1.00 ? 12  ILE A HD13 2  
ATOM   1537  N N    . VAL A 1 13 ? 4.145   -4.086  -2.652  1.00 1.00 ? 13  VAL A N    2  
ATOM   1538  C CA   . VAL A 1 13 ? 5.392   -3.746  -1.987  1.00 1.00 ? 13  VAL A CA   2  
ATOM   1539  C C    . VAL A 1 13 ? 6.476   -4.768  -2.324  1.00 1.00 ? 13  VAL A C    2  
ATOM   1540  O O    . VAL A 1 13 ? 7.643   -4.413  -2.509  1.00 1.00 ? 13  VAL A O    2  
ATOM   1541  C CB   . VAL A 1 13 ? 5.185   -3.690  -0.481  1.00 1.00 ? 13  VAL A CB   2  
ATOM   1542  C CG1  . VAL A 1 13 ? 6.496   -3.295  0.204   1.00 1.00 ? 13  VAL A CG1  2  
ATOM   1543  C CG2  . VAL A 1 13 ? 4.108   -2.653  -0.155  1.00 1.00 ? 13  VAL A CG2  2  
ATOM   1544  H H    . VAL A 1 13 ? 3.404   -4.442  -2.126  1.00 1.00 ? 13  VAL A H    2  
ATOM   1545  H HA   . VAL A 1 13 ? 5.712   -2.777  -2.335  1.00 1.00 ? 13  VAL A HA   2  
ATOM   1546  H HB   . VAL A 1 13 ? 4.871   -4.661  -0.125  1.00 1.00 ? 13  VAL A HB   2  
ATOM   1547  H HG11 . VAL A 1 13 ? 6.304   -3.094  1.245   1.00 1.00 ? 13  VAL A HG11 2  
ATOM   1548  H HG12 . VAL A 1 13 ? 6.892   -2.406  -0.269  1.00 1.00 ? 13  VAL A HG12 2  
ATOM   1549  H HG13 . VAL A 1 13 ? 7.206   -4.100  0.113   1.00 1.00 ? 13  VAL A HG13 2  
ATOM   1550  H HG21 . VAL A 1 13 ? 3.260   -2.796  -0.811  1.00 1.00 ? 13  VAL A HG21 2  
ATOM   1551  H HG22 . VAL A 1 13 ? 4.507   -1.660  -0.297  1.00 1.00 ? 13  VAL A HG22 2  
ATOM   1552  H HG23 . VAL A 1 13 ? 3.793   -2.774  0.870   1.00 1.00 ? 13  VAL A HG23 2  
ATOM   1553  N N    . LYS A 1 14 ? 6.085   -6.035  -2.354  1.00 1.00 ? 14  LYS A N    2  
ATOM   1554  C CA   . LYS A 1 14 ? 7.023   -7.110  -2.643  1.00 1.00 ? 14  LYS A CA   2  
ATOM   1555  C C    . LYS A 1 14 ? 7.578   -7.018  -4.054  1.00 1.00 ? 14  LYS A C    2  
ATOM   1556  O O    . LYS A 1 14 ? 8.785   -7.142  -4.272  1.00 1.00 ? 14  LYS A O    2  
ATOM   1557  C CB   . LYS A 1 14 ? 6.342   -8.453  -2.476  1.00 1.00 ? 14  LYS A CB   2  
ATOM   1558  C CG   . LYS A 1 14 ? 5.968   -8.630  -1.007  1.00 1.00 ? 14  LYS A CG   2  
ATOM   1559  C CD   . LYS A 1 14 ? 5.608   -10.107 -0.705  1.00 1.00 ? 14  LYS A CD   2  
ATOM   1560  C CE   . LYS A 1 14 ? 6.084   -10.494 0.698   1.00 1.00 ? 14  LYS A CE   2  
ATOM   1561  N NZ   . LYS A 1 14 ? 5.196   -9.877  1.715   1.00 1.00 ? 14  LYS A NZ   2  
ATOM   1562  H H    . LYS A 1 14 ? 5.144   -6.250  -2.171  1.00 1.00 ? 14  LYS A H    2  
ATOM   1563  H HA   . LYS A 1 14 ? 7.839   -7.058  -1.938  1.00 1.00 ? 14  LYS A HA   2  
ATOM   1564  H HB2  . LYS A 1 14 ? 5.448   -8.488  -3.091  1.00 1.00 ? 14  LYS A HB2  2  
ATOM   1565  H HB3  . LYS A 1 14 ? 7.021   -9.226  -2.778  1.00 1.00 ? 14  LYS A HB3  2  
ATOM   1566  H HG2  . LYS A 1 14 ? 6.782   -8.305  -0.381  1.00 1.00 ? 14  LYS A HG2  2  
ATOM   1567  H HG3  . LYS A 1 14 ? 5.109   -8.009  -0.814  1.00 1.00 ? 14  LYS A HG3  2  
ATOM   1568  H HD2  . LYS A 1 14 ? 4.538   -10.238 -0.762  1.00 1.00 ? 14  LYS A HD2  2  
ATOM   1569  H HD3  . LYS A 1 14 ? 6.075   -10.757 -1.421  1.00 1.00 ? 14  LYS A HD3  2  
ATOM   1570  H HE2  . LYS A 1 14 ? 6.056   -11.557 0.786   1.00 1.00 ? 14  LYS A HE2  2  
ATOM   1571  H HE3  . LYS A 1 14 ? 7.097   -10.159 0.861   1.00 1.00 ? 14  LYS A HE3  2  
ATOM   1572  H HZ1  . LYS A 1 14 ? 4.593   -9.166  1.256   1.00 1.00 ? 14  LYS A HZ1  2  
ATOM   1573  H HZ2  . LYS A 1 14 ? 5.775   -9.420  2.448   1.00 1.00 ? 14  LYS A HZ2  2  
ATOM   1574  H HZ3  . LYS A 1 14 ? 4.598   -10.609 2.147   1.00 1.00 ? 14  LYS A HZ3  2  
ATOM   1575  N N    . GLU A 1 15 ? 6.693   -6.813  -5.016  1.00 1.00 ? 15  GLU A N    2  
ATOM   1576  C CA   . GLU A 1 15 ? 7.103   -6.727  -6.413  1.00 1.00 ? 15  GLU A CA   2  
ATOM   1577  C C    . GLU A 1 15 ? 8.209   -5.700  -6.598  1.00 1.00 ? 15  GLU A C    2  
ATOM   1578  O O    . GLU A 1 15 ? 8.954   -5.739  -7.574  1.00 1.00 ? 15  GLU A O    2  
ATOM   1579  C CB   . GLU A 1 15 ? 5.906   -6.339  -7.290  1.00 1.00 ? 15  GLU A CB   2  
ATOM   1580  C CG   . GLU A 1 15 ? 5.271   -5.094  -6.744  1.00 1.00 ? 15  GLU A CG   2  
ATOM   1581  C CD   . GLU A 1 15 ? 4.184   -4.590  -7.701  1.00 1.00 ? 15  GLU A CD   2  
ATOM   1582  O OE1  . GLU A 1 15 ? 3.442   -5.413  -8.218  1.00 1.00 ? 15  GLU A OE1  2  
ATOM   1583  O OE2  . GLU A 1 15 ? 4.108   -3.389  -7.902  1.00 1.00 ? 15  GLU A OE2  2  
ATOM   1584  H H    . GLU A 1 15 ? 5.742   -6.745  -4.789  1.00 1.00 ? 15  GLU A H    2  
ATOM   1585  H HA   . GLU A 1 15 ? 7.471   -7.681  -6.717  1.00 1.00 ? 15  GLU A HA   2  
ATOM   1586  H HB2  . GLU A 1 15 ? 6.224   -6.160  -8.296  1.00 1.00 ? 15  GLU A HB2  2  
ATOM   1587  H HB3  . GLU A 1 15 ? 5.168   -7.124  -7.270  1.00 1.00 ? 15  GLU A HB3  2  
ATOM   1588  H HG2  . GLU A 1 15 ? 4.840   -5.354  -5.808  1.00 1.00 ? 15  GLU A HG2  2  
ATOM   1589  H HG3  . GLU A 1 15 ? 6.017   -4.327  -6.601  1.00 1.00 ? 15  GLU A HG3  2  
ATOM   1590  N N    . LYS A 1 16 ? 8.294   -4.777  -5.663  1.00 1.00 ? 16  LYS A N    2  
ATOM   1591  C CA   . LYS A 1 16 ? 9.299   -3.724  -5.727  1.00 1.00 ? 16  LYS A CA   2  
ATOM   1592  C C    . LYS A 1 16 ? 10.694  -4.318  -5.644  1.00 1.00 ? 16  LYS A C    2  
ATOM   1593  O O    . LYS A 1 16 ? 11.594  -3.894  -6.363  1.00 1.00 ? 16  LYS A O    2  
ATOM   1594  C CB   . LYS A 1 16 ? 9.083   -2.725  -4.578  1.00 1.00 ? 16  LYS A CB   2  
ATOM   1595  C CG   . LYS A 1 16 ? 7.629   -2.295  -4.522  1.00 1.00 ? 16  LYS A CG   2  
ATOM   1596  C CD   . LYS A 1 16 ? 7.291   -1.333  -5.664  1.00 1.00 ? 16  LYS A CD   2  
ATOM   1597  C CE   . LYS A 1 16 ? 5.806   -0.991  -5.641  1.00 1.00 ? 16  LYS A CE   2  
ATOM   1598  N NZ   . LYS A 1 16 ? 5.626   0.366   -6.213  1.00 1.00 ? 16  LYS A NZ   2  
ATOM   1599  H H    . LYS A 1 16 ? 7.660   -4.796  -4.920  1.00 1.00 ? 16  LYS A H    2  
ATOM   1600  H HA   . LYS A 1 16 ? 9.217   -3.208  -6.667  1.00 1.00 ? 16  LYS A HA   2  
ATOM   1601  H HB2  . LYS A 1 16 ? 9.330   -3.190  -3.652  1.00 1.00 ? 16  LYS A HB2  2  
ATOM   1602  H HB3  . LYS A 1 16 ? 9.707   -1.857  -4.731  1.00 1.00 ? 16  LYS A HB3  2  
ATOM   1603  H HG2  . LYS A 1 16 ? 7.014   -3.163  -4.588  1.00 1.00 ? 16  LYS A HG2  2  
ATOM   1604  H HG3  . LYS A 1 16 ? 7.448   -1.803  -3.578  1.00 1.00 ? 16  LYS A HG3  2  
ATOM   1605  H HD2  . LYS A 1 16 ? 7.858   -0.430  -5.540  1.00 1.00 ? 16  LYS A HD2  2  
ATOM   1606  H HD3  . LYS A 1 16 ? 7.528   -1.790  -6.605  1.00 1.00 ? 16  LYS A HD3  2  
ATOM   1607  H HE2  . LYS A 1 16 ? 5.263   -1.709  -6.236  1.00 1.00 ? 16  LYS A HE2  2  
ATOM   1608  H HE3  . LYS A 1 16 ? 5.437   -1.013  -4.632  1.00 1.00 ? 16  LYS A HE3  2  
ATOM   1609  H HZ1  . LYS A 1 16 ? 6.425   0.973   -5.932  1.00 1.00 ? 16  LYS A HZ1  2  
ATOM   1610  H HZ2  . LYS A 1 16 ? 4.740   0.773   -5.862  1.00 1.00 ? 16  LYS A HZ2  2  
ATOM   1611  H HZ3  . LYS A 1 16 ? 5.596   0.300   -7.250  1.00 1.00 ? 16  LYS A HZ3  2  
ATOM   1612  N N    . LEU A 1 17 ? 10.862  -5.316  -4.776  1.00 1.00 ? 17  LEU A N    2  
ATOM   1613  C CA   . LEU A 1 17 ? 12.163  -5.983  -4.619  1.00 1.00 ? 17  LEU A CA   2  
ATOM   1614  C C    . LEU A 1 17 ? 12.055  -7.431  -5.056  1.00 1.00 ? 17  LEU A C    2  
ATOM   1615  O O    . LEU A 1 17 ? 13.048  -8.151  -5.054  1.00 1.00 ? 17  LEU A O    2  
ATOM   1616  C CB   . LEU A 1 17 ? 12.624  -5.922  -3.150  1.00 1.00 ? 17  LEU A CB   2  
ATOM   1617  C CG   . LEU A 1 17 ? 11.385  -5.859  -2.218  1.00 1.00 ? 17  LEU A CG   2  
ATOM   1618  C CD1  . LEU A 1 17 ? 11.707  -6.534  -0.897  1.00 1.00 ? 17  LEU A CD1  2  
ATOM   1619  C CD2  . LEU A 1 17 ? 10.990  -4.393  -1.967  1.00 1.00 ? 17  LEU A CD2  2  
ATOM   1620  H H    . LEU A 1 17 ? 10.094  -5.624  -4.240  1.00 1.00 ? 17  LEU A H    2  
ATOM   1621  H HA   . LEU A 1 17 ? 12.905  -5.490  -5.242  1.00 1.00 ? 17  LEU A HA   2  
ATOM   1622  H HB2  . LEU A 1 17 ? 13.223  -6.798  -2.919  1.00 1.00 ? 17  LEU A HB2  2  
ATOM   1623  H HB3  . LEU A 1 17 ? 13.228  -5.038  -3.001  1.00 1.00 ? 17  LEU A HB3  2  
ATOM   1624  H HG   . LEU A 1 17 ? 10.552  -6.382  -2.669  1.00 1.00 ? 17  LEU A HG   2  
ATOM   1625  H HD11 . LEU A 1 17 ? 11.819  -7.587  -1.072  1.00 1.00 ? 17  LEU A HD11 2  
ATOM   1626  H HD12 . LEU A 1 17 ? 10.904  -6.360  -0.199  1.00 1.00 ? 17  LEU A HD12 2  
ATOM   1627  H HD13 . LEU A 1 17 ? 12.626  -6.132  -0.503  1.00 1.00 ? 17  LEU A HD13 2  
ATOM   1628  H HD21 . LEU A 1 17 ? 9.926   -4.343  -1.790  1.00 1.00 ? 17  LEU A HD21 2  
ATOM   1629  H HD22 . LEU A 1 17 ? 11.246  -3.802  -2.832  1.00 1.00 ? 17  LEU A HD22 2  
ATOM   1630  H HD23 . LEU A 1 17 ? 11.517  -4.007  -1.105  1.00 1.00 ? 17  LEU A HD23 2  
ATOM   1631  N N    . ALA A 1 18 ? 10.849  -7.858  -5.424  1.00 1.00 ? 18  ALA A N    2  
ATOM   1632  C CA   . ALA A 1 18 ? 10.636  -9.236  -5.862  1.00 1.00 ? 18  ALA A CA   2  
ATOM   1633  C C    . ALA A 1 18 ? 10.547  -10.189 -4.669  1.00 1.00 ? 18  ALA A C    2  
ATOM   1634  O O    . ALA A 1 18 ? 11.496  -10.903 -4.363  1.00 1.00 ? 18  ALA A O    2  
ATOM   1635  C CB   . ALA A 1 18 ? 11.776  -9.674  -6.799  1.00 1.00 ? 18  ALA A CB   2  
ATOM   1636  H H    . ALA A 1 18 ? 10.090  -7.233  -5.405  1.00 1.00 ? 18  ALA A H    2  
ATOM   1637  H HA   . ALA A 1 18 ? 9.704   -9.281  -6.405  1.00 1.00 ? 18  ALA A HA   2  
ATOM   1638  H HB1  . ALA A 1 18 ? 11.412  -10.420 -7.488  1.00 1.00 ? 18  ALA A HB1  2  
ATOM   1639  H HB2  . ALA A 1 18 ? 12.598  -10.086 -6.225  1.00 1.00 ? 18  ALA A HB2  2  
ATOM   1640  H HB3  . ALA A 1 18 ? 12.125  -8.820  -7.354  1.00 1.00 ? 18  ALA A HB3  2  
ATOM   1641  N N    . LEU A 1 19 ? 9.403   -10.188 -3.994  1.00 1.00 ? 19  LEU A N    2  
ATOM   1642  C CA   . LEU A 1 19 ? 9.194   -11.060 -2.832  1.00 1.00 ? 19  LEU A CA   2  
ATOM   1643  C C    . LEU A 1 19 ? 7.894   -11.832 -2.967  1.00 1.00 ? 19  LEU A C    2  
ATOM   1644  O O    . LEU A 1 19 ? 7.266   -11.834 -4.026  1.00 1.00 ? 19  LEU A O    2  
ATOM   1645  C CB   . LEU A 1 19 ? 9.188   -10.204 -1.547  1.00 1.00 ? 19  LEU A CB   2  
ATOM   1646  C CG   . LEU A 1 19 ? 10.469  -10.437 -0.739  1.00 1.00 ? 19  LEU A CG   2  
ATOM   1647  C CD1  . LEU A 1 19 ? 11.714  -10.161 -1.614  1.00 1.00 ? 19  LEU A CD1  2  
ATOM   1648  C CD2  . LEU A 1 19 ? 10.462  -9.505  0.480   1.00 1.00 ? 19  LEU A CD2  2  
ATOM   1649  H H    . LEU A 1 19 ? 8.684   -9.584  -4.276  1.00 1.00 ? 19  LEU A H    2  
ATOM   1650  H HA   . LEU A 1 19 ? 9.991   -11.784 -2.775  1.00 1.00 ? 19  LEU A HA   2  
ATOM   1651  H HB2  . LEU A 1 19 ? 9.133   -9.160  -1.815  1.00 1.00 ? 19  LEU A HB2  2  
ATOM   1652  H HB3  . LEU A 1 19 ? 8.341   -10.455 -0.937  1.00 1.00 ? 19  LEU A HB3  2  
ATOM   1653  H HG   . LEU A 1 19 ? 10.488  -11.464 -0.402  1.00 1.00 ? 19  LEU A HG   2  
ATOM   1654  H HD11 . LEU A 1 19 ? 12.029  -11.078 -2.086  1.00 1.00 ? 19  LEU A HD11 2  
ATOM   1655  H HD12 . LEU A 1 19 ? 12.520  -9.785  -1.000  1.00 1.00 ? 19  LEU A HD12 2  
ATOM   1656  H HD13 . LEU A 1 19 ? 11.477  -9.436  -2.377  1.00 1.00 ? 19  LEU A HD13 2  
ATOM   1657  H HD21 . LEU A 1 19 ? 11.455  -9.454  0.895   1.00 1.00 ? 19  LEU A HD21 2  
ATOM   1658  H HD22 . LEU A 1 19 ? 9.776   -9.889  1.223   1.00 1.00 ? 19  LEU A HD22 2  
ATOM   1659  H HD23 . LEU A 1 19 ? 10.145  -8.516  0.179   1.00 1.00 ? 19  LEU A HD23 2  
ATOM   1660  N N    . GLY A 1 20 ? 7.510   -12.498 -1.879  1.00 1.00 ? 20  GLY A N    2  
ATOM   1661  C CA   . GLY A 1 20 ? 6.283   -13.293 -1.860  1.00 1.00 ? 20  GLY A CA   2  
ATOM   1662  C C    . GLY A 1 20 ? 6.593   -14.768 -2.060  1.00 1.00 ? 20  GLY A C    2  
ATOM   1663  O O    . GLY A 1 20 ? 5.689   -15.600 -2.066  1.00 1.00 ? 20  GLY A O    2  
ATOM   1664  H H    . GLY A 1 20 ? 8.073   -12.460 -1.074  1.00 1.00 ? 20  GLY A H    2  
ATOM   1665  H HA2  . GLY A 1 20 ? 5.771   -13.154 -0.910  1.00 1.00 ? 20  GLY A HA2  2  
ATOM   1666  H HA3  . GLY A 1 20 ? 5.636   -12.962 -2.660  1.00 1.00 ? 20  GLY A HA3  2  
ATOM   1667  N N    . ALA A 1 21 ? 7.877   -15.089 -2.222  1.00 1.00 ? 21  ALA A N    2  
ATOM   1668  C CA   . ALA A 1 21 ? 8.290   -16.476 -2.417  1.00 1.00 ? 21  ALA A CA   2  
ATOM   1669  C C    . ALA A 1 21 ? 8.559   -17.140 -1.073  1.00 1.00 ? 21  ALA A C    2  
ATOM   1670  O O    . ALA A 1 21 ? 7.780   -17.976 -0.621  1.00 1.00 ? 21  ALA A O    2  
ATOM   1671  C CB   . ALA A 1 21 ? 9.554   -16.532 -3.276  1.00 1.00 ? 21  ALA A CB   2  
ATOM   1672  H H    . ALA A 1 21 ? 8.557   -14.382 -2.202  1.00 1.00 ? 21  ALA A H    2  
ATOM   1673  H HA   . ALA A 1 21 ? 7.502   -17.016 -2.925  1.00 1.00 ? 21  ALA A HA   2  
ATOM   1674  H HB1  . ALA A 1 21 ? 9.779   -17.561 -3.513  1.00 1.00 ? 21  ALA A HB1  2  
ATOM   1675  H HB2  . ALA A 1 21 ? 10.379  -16.098 -2.731  1.00 1.00 ? 21  ALA A HB2  2  
ATOM   1676  H HB3  . ALA A 1 21 ? 9.394   -15.979 -4.191  1.00 1.00 ? 21  ALA A HB3  2  
ATOM   1677  N N    . ASP A 1 22 ? 9.665   -16.759 -0.439  1.00 1.00 ? 22  ASP A N    2  
ATOM   1678  C CA   . ASP A 1 22 ? 10.034  -17.320 0.861   1.00 1.00 ? 22  ASP A CA   2  
ATOM   1679  C C    . ASP A 1 22 ? 9.610   -16.393 1.991   1.00 1.00 ? 22  ASP A C    2  
ATOM   1680  O O    . ASP A 1 22 ? 9.931   -16.635 3.152   1.00 1.00 ? 22  ASP A O    2  
ATOM   1681  C CB   . ASP A 1 22 ? 11.543  -17.542 0.924   1.00 1.00 ? 22  ASP A CB   2  
ATOM   1682  C CG   . ASP A 1 22 ? 12.277  -16.250 0.584   1.00 1.00 ? 22  ASP A CG   2  
ATOM   1683  O OD1  . ASP A 1 22 ? 11.618  -15.311 0.168   1.00 1.00 ? 22  ASP A OD1  2  
ATOM   1684  O OD2  . ASP A 1 22 ? 13.487  -16.221 0.739   1.00 1.00 ? 22  ASP A OD2  2  
ATOM   1685  H H    . ASP A 1 22 ? 10.245  -16.083 -0.851  1.00 1.00 ? 22  ASP A H    2  
ATOM   1686  H HA   . ASP A 1 22 ? 9.540   -18.275 0.992   1.00 1.00 ? 22  ASP A HA   2  
ATOM   1687  H HB2  . ASP A 1 22 ? 11.816  -17.858 1.921   1.00 1.00 ? 22  ASP A HB2  2  
ATOM   1688  H HB3  . ASP A 1 22 ? 11.823  -18.309 0.218   1.00 1.00 ? 22  ASP A HB3  2  
ATOM   1689  N N    . VAL A 1 23 ? 8.886   -15.329 1.645   1.00 1.00 ? 23  VAL A N    2  
ATOM   1690  C CA   . VAL A 1 23 ? 8.420   -14.360 2.640   1.00 1.00 ? 23  VAL A CA   2  
ATOM   1691  C C    . VAL A 1 23 ? 6.907   -14.440 2.790   1.00 1.00 ? 23  VAL A C    2  
ATOM   1692  O O    . VAL A 1 23 ? 6.173   -14.465 1.803   1.00 1.00 ? 23  VAL A O    2  
ATOM   1693  C CB   . VAL A 1 23 ? 8.818   -12.947 2.215   1.00 1.00 ? 23  VAL A CB   2  
ATOM   1694  C CG1  . VAL A 1 23 ? 8.335   -11.948 3.268   1.00 1.00 ? 23  VAL A CG1  2  
ATOM   1695  C CG2  . VAL A 1 23 ? 10.345  -12.866 2.086   1.00 1.00 ? 23  VAL A CG2  2  
ATOM   1696  H H    . VAL A 1 23 ? 8.662   -15.191 0.699   1.00 1.00 ? 23  VAL A H    2  
ATOM   1697  H HA   . VAL A 1 23 ? 8.873   -14.572 3.598   1.00 1.00 ? 23  VAL A HA   2  
ATOM   1698  H HB   . VAL A 1 23 ? 8.360   -12.715 1.264   1.00 1.00 ? 23  VAL A HB   2  
ATOM   1699  H HG11 . VAL A 1 23 ? 8.581   -12.317 4.253   1.00 1.00 ? 23  VAL A HG11 2  
ATOM   1700  H HG12 . VAL A 1 23 ? 7.264   -11.827 3.186   1.00 1.00 ? 23  VAL A HG12 2  
ATOM   1701  H HG13 . VAL A 1 23 ? 8.817   -10.997 3.109   1.00 1.00 ? 23  VAL A HG13 2  
ATOM   1702  H HG21 . VAL A 1 23 ? 10.658  -11.833 2.102   1.00 1.00 ? 23  VAL A HG21 2  
ATOM   1703  H HG22 . VAL A 1 23 ? 10.652  -13.316 1.155   1.00 1.00 ? 23  VAL A HG22 2  
ATOM   1704  H HG23 . VAL A 1 23 ? 10.808  -13.394 2.909   1.00 1.00 ? 23  VAL A HG23 2  
ATOM   1705  N N    . VAL A 1 24 ? 6.451   -14.496 4.037   1.00 1.00 ? 24  VAL A N    2  
ATOM   1706  C CA   . VAL A 1 24 ? 5.023   -14.582 4.317   1.00 1.00 ? 24  VAL A CA   2  
ATOM   1707  C C    . VAL A 1 24 ? 4.376   -13.208 4.219   1.00 1.00 ? 24  VAL A C    2  
ATOM   1708  O O    . VAL A 1 24 ? 4.883   -12.232 4.769   1.00 1.00 ? 24  VAL A O    2  
ATOM   1709  C CB   . VAL A 1 24 ? 4.796   -15.154 5.717   1.00 1.00 ? 24  VAL A CB   2  
ATOM   1710  C CG1  . VAL A 1 24 ? 3.298   -15.147 6.040   1.00 1.00 ? 24  VAL A CG1  2  
ATOM   1711  C CG2  . VAL A 1 24 ? 5.324   -16.590 5.774   1.00 1.00 ? 24  VAL A CG2  2  
ATOM   1712  H H    . VAL A 1 24 ? 7.088   -14.483 4.781   1.00 1.00 ? 24  VAL A H    2  
ATOM   1713  H HA   . VAL A 1 24 ? 4.563   -15.241 3.593   1.00 1.00 ? 24  VAL A HA   2  
ATOM   1714  H HB   . VAL A 1 24 ? 5.322   -14.546 6.441   1.00 1.00 ? 24  VAL A HB   2  
ATOM   1715  H HG11 . VAL A 1 24 ? 2.746   -15.515 5.186   1.00 1.00 ? 24  VAL A HG11 2  
ATOM   1716  H HG12 . VAL A 1 24 ? 2.983   -14.138 6.263   1.00 1.00 ? 24  VAL A HG12 2  
ATOM   1717  H HG13 . VAL A 1 24 ? 3.109   -15.781 6.891   1.00 1.00 ? 24  VAL A HG13 2  
ATOM   1718  H HG21 . VAL A 1 24 ? 4.973   -17.065 6.676   1.00 1.00 ? 24  VAL A HG21 2  
ATOM   1719  H HG22 . VAL A 1 24 ? 6.404   -16.577 5.768   1.00 1.00 ? 24  VAL A HG22 2  
ATOM   1720  H HG23 . VAL A 1 24 ? 4.965   -17.137 4.915   1.00 1.00 ? 24  VAL A HG23 2  
ATOM   1721  N N    . VAL A 1 25 ? 3.244   -13.143 3.528   1.00 1.00 ? 25  VAL A N    2  
ATOM   1722  C CA   . VAL A 1 25 ? 2.519   -11.883 3.376   1.00 1.00 ? 25  VAL A CA   2  
ATOM   1723  C C    . VAL A 1 25 ? 1.457   -11.759 4.464   1.00 1.00 ? 25  VAL A C    2  
ATOM   1724  O O    . VAL A 1 25 ? 0.636   -12.652 4.652   1.00 1.00 ? 25  VAL A O    2  
ATOM   1725  C CB   . VAL A 1 25 ? 1.861   -11.822 1.980   1.00 1.00 ? 25  VAL A CB   2  
ATOM   1726  C CG1  . VAL A 1 25 ? 0.704   -10.805 1.985   1.00 1.00 ? 25  VAL A CG1  2  
ATOM   1727  C CG2  . VAL A 1 25 ? 2.892   -11.404 0.935   1.00 1.00 ? 25  VAL A CG2  2  
ATOM   1728  H H    . VAL A 1 25 ? 2.881   -13.958 3.124   1.00 1.00 ? 25  VAL A H    2  
ATOM   1729  H HA   . VAL A 1 25 ? 3.213   -11.057 3.473   1.00 1.00 ? 25  VAL A HA   2  
ATOM   1730  H HB   . VAL A 1 25 ? 1.489   -12.800 1.718   1.00 1.00 ? 25  VAL A HB   2  
ATOM   1731  H HG11 . VAL A 1 25 ? -0.151  -11.234 2.486   1.00 1.00 ? 25  VAL A HG11 2  
ATOM   1732  H HG12 . VAL A 1 25 ? 0.439   -10.549 0.973   1.00 1.00 ? 25  VAL A HG12 2  
ATOM   1733  H HG13 . VAL A 1 25 ? 1.017   -9.916  2.515   1.00 1.00 ? 25  VAL A HG13 2  
ATOM   1734  H HG21 . VAL A 1 25 ? 3.026   -10.335 0.973   1.00 1.00 ? 25  VAL A HG21 2  
ATOM   1735  H HG22 . VAL A 1 25 ? 2.542   -11.688 -0.048  1.00 1.00 ? 25  VAL A HG22 2  
ATOM   1736  H HG23 . VAL A 1 25 ? 3.829   -11.894 1.139   1.00 1.00 ? 25  VAL A HG23 2  
ATOM   1737  N N    . THR A 1 26 ? 1.478   -10.627 5.165   1.00 1.00 ? 26  THR A N    2  
ATOM   1738  C CA   . THR A 1 26 ? 0.513   -10.373 6.233   1.00 1.00 ? 26  THR A CA   2  
ATOM   1739  C C    . THR A 1 26 ? -0.008  -8.945  6.139   1.00 1.00 ? 26  THR A C    2  
ATOM   1740  O O    . THR A 1 26 ? 0.398   -8.178  5.269   1.00 1.00 ? 26  THR A O    2  
ATOM   1741  C CB   . THR A 1 26 ? 1.159   -10.600 7.595   1.00 1.00 ? 26  THR A CB   2  
ATOM   1742  O OG1  . THR A 1 26 ? 1.986   -9.496  7.919   1.00 1.00 ? 26  THR A OG1  2  
ATOM   1743  C CG2  . THR A 1 26 ? 1.999   -11.871 7.547   1.00 1.00 ? 26  THR A CG2  2  
ATOM   1744  H H    . THR A 1 26 ? 2.159   -9.952  4.962   1.00 1.00 ? 26  THR A H    2  
ATOM   1745  H HA   . THR A 1 26 ? -0.325  -11.051 6.130   1.00 1.00 ? 26  THR A HA   2  
ATOM   1746  H HB   . THR A 1 26 ? 0.390   -10.711 8.343   1.00 1.00 ? 26  THR A HB   2  
ATOM   1747  H HG1  . THR A 1 26 ? 1.442   -8.838  8.355   1.00 1.00 ? 26  THR A HG1  2  
ATOM   1748  H HG21 . THR A 1 26 ? 2.413   -12.064 8.523   1.00 1.00 ? 26  THR A HG21 2  
ATOM   1749  H HG22 . THR A 1 26 ? 2.799   -11.748 6.833   1.00 1.00 ? 26  THR A HG22 2  
ATOM   1750  H HG23 . THR A 1 26 ? 1.374   -12.699 7.249   1.00 1.00 ? 26  THR A HG23 2  
ATOM   1751  N N    . ALA A 1 27 ? -0.923  -8.605  7.034   1.00 1.00 ? 27  ALA A N    2  
ATOM   1752  C CA   . ALA A 1 27 ? -1.513  -7.267  7.054   1.00 1.00 ? 27  ALA A CA   2  
ATOM   1753  C C    . ALA A 1 27 ? -0.731  -6.345  7.984   1.00 1.00 ? 27  ALA A C    2  
ATOM   1754  O O    . ALA A 1 27 ? -0.907  -5.131  7.955   1.00 1.00 ? 27  ALA A O    2  
ATOM   1755  C CB   . ALA A 1 27 ? -2.967  -7.348  7.529   1.00 1.00 ? 27  ALA A CB   2  
ATOM   1756  H H    . ALA A 1 27 ? -1.207  -9.264  7.695   1.00 1.00 ? 27  ALA A H    2  
ATOM   1757  H HA   . ALA A 1 27 ? -1.495  -6.854  6.053   1.00 1.00 ? 27  ALA A HA   2  
ATOM   1758  H HB1  . ALA A 1 27 ? -3.530  -6.521  7.118   1.00 1.00 ? 27  ALA A HB1  2  
ATOM   1759  H HB2  . ALA A 1 27 ? -3.002  -7.308  8.609   1.00 1.00 ? 27  ALA A HB2  2  
ATOM   1760  H HB3  . ALA A 1 27 ? -3.403  -8.279  7.198   1.00 1.00 ? 27  ALA A HB3  2  
ATOM   1761  N N    . ASP A 1 28 ? 0.122   -6.931  8.817   1.00 1.00 ? 28  ASP A N    2  
ATOM   1762  C CA   . ASP A 1 28 ? 0.926   -6.150  9.761   1.00 1.00 ? 28  ASP A CA   2  
ATOM   1763  C C    . ASP A 1 28 ? 2.404   -6.245  9.400   1.00 1.00 ? 28  ASP A C    2  
ATOM   1764  O O    . ASP A 1 28 ? 3.275   -5.934  10.213  1.00 1.00 ? 28  ASP A O    2  
ATOM   1765  C CB   . ASP A 1 28 ? 0.709   -6.672  11.179  1.00 1.00 ? 28  ASP A CB   2  
ATOM   1766  C CG   . ASP A 1 28 ? -0.682  -6.280  11.668  1.00 1.00 ? 28  ASP A CG   2  
ATOM   1767  O OD1  . ASP A 1 28 ? -1.302  -5.448  11.024  1.00 1.00 ? 28  ASP A OD1  2  
ATOM   1768  O OD2  . ASP A 1 28 ? -1.106  -6.817  12.676  1.00 1.00 ? 28  ASP A OD2  2  
ATOM   1769  H H    . ASP A 1 28 ? 0.213   -7.908  8.800   1.00 1.00 ? 28  ASP A H    2  
ATOM   1770  H HA   . ASP A 1 28 ? 0.621   -5.106  9.725   1.00 1.00 ? 28  ASP A HA   2  
ATOM   1771  H HB2  . ASP A 1 28 ? 0.802   -7.749  11.184  1.00 1.00 ? 28  ASP A HB2  2  
ATOM   1772  H HB3  . ASP A 1 28 ? 1.452   -6.244  11.835  1.00 1.00 ? 28  ASP A HB3  2  
ATOM   1773  N N    . SER A 1 29 ? 2.683   -6.692  8.177   1.00 1.00 ? 29  SER A N    2  
ATOM   1774  C CA   . SER A 1 29 ? 4.058   -6.827  7.723   1.00 1.00 ? 29  SER A CA   2  
ATOM   1775  C C    . SER A 1 29 ? 4.692   -5.470  7.469   1.00 1.00 ? 29  SER A C    2  
ATOM   1776  O O    . SER A 1 29 ? 5.900   -5.371  7.254   1.00 1.00 ? 29  SER A O    2  
ATOM   1777  C CB   . SER A 1 29 ? 4.119   -7.665  6.443   1.00 1.00 ? 29  SER A CB   2  
ATOM   1778  O OG   . SER A 1 29 ? 5.473   -7.819  6.042   1.00 1.00 ? 29  SER A OG   2  
ATOM   1779  H H    . SER A 1 29 ? 1.952   -6.937  7.573   1.00 1.00 ? 29  SER A H    2  
ATOM   1780  H HA   . SER A 1 29 ? 4.612   -7.321  8.495   1.00 1.00 ? 29  SER A HA   2  
ATOM   1781  H HB2  . SER A 1 29 ? 3.700   -8.639  6.628   1.00 1.00 ? 29  SER A HB2  2  
ATOM   1782  H HB3  . SER A 1 29 ? 3.555   -7.172  5.664   1.00 1.00 ? 29  SER A HB3  2  
ATOM   1783  H HG   . SER A 1 29 ? 5.744   -7.012  5.600   1.00 1.00 ? 29  SER A HG   2  
ATOM   1784  N N    . GLU A 1 30 ? 3.869   -4.433  7.487   1.00 1.00 ? 30  GLU A N    2  
ATOM   1785  C CA   . GLU A 1 30 ? 4.356   -3.079  7.257   1.00 1.00 ? 30  GLU A CA   2  
ATOM   1786  C C    . GLU A 1 30 ? 5.040   -2.981  5.898   1.00 1.00 ? 30  GLU A C    2  
ATOM   1787  O O    . GLU A 1 30 ? 6.046   -3.644  5.650   1.00 1.00 ? 30  GLU A O    2  
ATOM   1788  C CB   . GLU A 1 30 ? 5.335   -2.677  8.358   1.00 1.00 ? 30  GLU A CB   2  
ATOM   1789  C CG   . GLU A 1 30 ? 4.649   -2.780  9.720   1.00 1.00 ? 30  GLU A CG   2  
ATOM   1790  C CD   . GLU A 1 30 ? 5.634   -2.423  10.828  1.00 1.00 ? 30  GLU A CD   2  
ATOM   1791  O OE1  . GLU A 1 30 ? 6.774   -2.850  10.740  1.00 1.00 ? 30  GLU A OE1  2  
ATOM   1792  O OE2  . GLU A 1 30 ? 5.234   -1.731  11.749  1.00 1.00 ? 30  GLU A OE2  2  
ATOM   1793  H H    . GLU A 1 30 ? 2.917   -4.577  7.660   1.00 1.00 ? 30  GLU A H    2  
ATOM   1794  H HA   . GLU A 1 30 ? 3.522   -2.400  7.268   1.00 1.00 ? 30  GLU A HA   2  
ATOM   1795  H HB2  . GLU A 1 30 ? 6.197   -3.325  8.337   1.00 1.00 ? 30  GLU A HB2  2  
ATOM   1796  H HB3  . GLU A 1 30 ? 5.645   -1.658  8.198   1.00 1.00 ? 30  GLU A HB3  2  
ATOM   1797  H HG2  . GLU A 1 30 ? 3.814   -2.097  9.750   1.00 1.00 ? 30  GLU A HG2  2  
ATOM   1798  H HG3  . GLU A 1 30 ? 4.295   -3.788  9.869   1.00 1.00 ? 30  GLU A HG3  2  
ATOM   1799  N N    . PHE A 1 31 ? 4.486   -2.149  5.023   1.00 1.00 ? 31  PHE A N    2  
ATOM   1800  C CA   . PHE A 1 31 ? 5.049   -1.976  3.691   1.00 1.00 ? 31  PHE A CA   2  
ATOM   1801  C C    . PHE A 1 31 ? 6.493   -1.492  3.783   1.00 1.00 ? 31  PHE A C    2  
ATOM   1802  O O    . PHE A 1 31 ? 7.369   -1.985  3.071   1.00 1.00 ? 31  PHE A O    2  
ATOM   1803  C CB   . PHE A 1 31 ? 4.221   -0.964  2.898   1.00 1.00 ? 31  PHE A CB   2  
ATOM   1804  C CG   . PHE A 1 31 ? 4.261   0.377   3.588   1.00 1.00 ? 31  PHE A CG   2  
ATOM   1805  C CD1  . PHE A 1 31 ? 5.294   1.280   3.300   1.00 1.00 ? 31  PHE A CD1  2  
ATOM   1806  C CD2  . PHE A 1 31 ? 3.284   0.713   4.534   1.00 1.00 ? 31  PHE A CD2  2  
ATOM   1807  C CE1  . PHE A 1 31 ? 5.330   2.524   3.933   1.00 1.00 ? 31  PHE A CE1  2  
ATOM   1808  C CE2  . PHE A 1 31 ? 3.326   1.951   5.163   1.00 1.00 ? 31  PHE A CE2  2  
ATOM   1809  C CZ   . PHE A 1 31 ? 4.352   2.854   4.881   1.00 1.00 ? 31  PHE A CZ   2  
ATOM   1810  H H    . PHE A 1 31 ? 3.682   -1.647  5.275   1.00 1.00 ? 31  PHE A H    2  
ATOM   1811  H HA   . PHE A 1 31 ? 5.025   -2.925  3.178   1.00 1.00 ? 31  PHE A HA   2  
ATOM   1812  H HB2  . PHE A 1 31 ? 4.631   -0.863  1.905   1.00 1.00 ? 31  PHE A HB2  2  
ATOM   1813  H HB3  . PHE A 1 31 ? 3.198   -1.303  2.835   1.00 1.00 ? 31  PHE A HB3  2  
ATOM   1814  H HD1  . PHE A 1 31 ? 6.046   1.022   2.568   1.00 1.00 ? 31  PHE A HD1  2  
ATOM   1815  H HD2  . PHE A 1 31 ? 2.487   0.025   4.768   1.00 1.00 ? 31  PHE A HD2  2  
ATOM   1816  H HE1  . PHE A 1 31 ? 6.123   3.221   3.707   1.00 1.00 ? 31  PHE A HE1  2  
ATOM   1817  H HE2  . PHE A 1 31 ? 2.571   2.204   5.878   1.00 1.00 ? 31  PHE A HE2  2  
ATOM   1818  H HZ   . PHE A 1 31 ? 4.380   3.810   5.382   1.00 1.00 ? 31  PHE A HZ   2  
ATOM   1819  N N    . SER A 1 32 ? 6.731   -0.521  4.656   1.00 1.00 ? 32  SER A N    2  
ATOM   1820  C CA   . SER A 1 32 ? 8.073   0.025   4.824   1.00 1.00 ? 32  SER A CA   2  
ATOM   1821  C C    . SER A 1 32 ? 9.028   -1.056  5.317   1.00 1.00 ? 32  SER A C    2  
ATOM   1822  O O    . SER A 1 32 ? 8.651   -1.909  6.119   1.00 1.00 ? 32  SER A O    2  
ATOM   1823  C CB   . SER A 1 32 ? 8.043   1.174   5.834   1.00 1.00 ? 32  SER A CB   2  
ATOM   1824  O OG   . SER A 1 32 ? 8.163   0.645   7.149   1.00 1.00 ? 32  SER A OG   2  
ATOM   1825  H H    . SER A 1 32 ? 5.994   -0.163  5.193   1.00 1.00 ? 32  SER A H    2  
ATOM   1826  H HA   . SER A 1 32 ? 8.422   0.401   3.874   1.00 1.00 ? 32  SER A HA   2  
ATOM   1827  H HB2  . SER A 1 32 ? 8.865   1.847   5.648   1.00 1.00 ? 32  SER A HB2  2  
ATOM   1828  H HB3  . SER A 1 32 ? 7.109   1.714   5.738   1.00 1.00 ? 32  SER A HB3  2  
ATOM   1829  H HG   . SER A 1 32 ? 7.284   0.422   7.465   1.00 1.00 ? 32  SER A HG   2  
ATOM   1830  N N    . LYS A 1 33 ? 10.266  -1.010  4.833   1.00 1.00 ? 33  LYS A N    2  
ATOM   1831  C CA   . LYS A 1 33 ? 11.280  -1.993  5.227   1.00 1.00 ? 33  LYS A CA   2  
ATOM   1832  C C    . LYS A 1 33 ? 12.637  -1.320  5.396   1.00 1.00 ? 33  LYS A C    2  
ATOM   1833  O O    . LYS A 1 33 ? 12.923  -0.309  4.758   1.00 1.00 ? 33  LYS A O    2  
ATOM   1834  C CB   . LYS A 1 33 ? 11.378  -3.092  4.169   1.00 1.00 ? 33  LYS A CB   2  
ATOM   1835  C CG   . LYS A 1 33 ? 10.091  -3.920  4.172   1.00 1.00 ? 33  LYS A CG   2  
ATOM   1836  C CD   . LYS A 1 33 ? 10.190  -5.018  3.112   1.00 1.00 ? 33  LYS A CD   2  
ATOM   1837  C CE   . LYS A 1 33 ? 8.934   -5.891  3.163   1.00 1.00 ? 33  LYS A CE   2  
ATOM   1838  N NZ   . LYS A 1 33 ? 7.737   -5.053  2.874   1.00 1.00 ? 33  LYS A NZ   2  
ATOM   1839  H H    . LYS A 1 33 ? 10.505  -0.303  4.197   1.00 1.00 ? 33  LYS A H    2  
ATOM   1840  H HA   . LYS A 1 33 ? 10.999  -2.443  6.169   1.00 1.00 ? 33  LYS A HA   2  
ATOM   1841  H HB2  . LYS A 1 33 ? 11.518  -2.644  3.196   1.00 1.00 ? 33  LYS A HB2  2  
ATOM   1842  H HB3  . LYS A 1 33 ? 12.216  -3.732  4.395   1.00 1.00 ? 33  LYS A HB3  2  
ATOM   1843  H HG2  . LYS A 1 33 ? 9.955   -4.368  5.145   1.00 1.00 ? 33  LYS A HG2  2  
ATOM   1844  H HG3  . LYS A 1 33 ? 9.251   -3.280  3.949   1.00 1.00 ? 33  LYS A HG3  2  
ATOM   1845  H HD2  . LYS A 1 33 ? 10.278  -4.568  2.134   1.00 1.00 ? 33  LYS A HD2  2  
ATOM   1846  H HD3  . LYS A 1 33 ? 11.058  -5.629  3.306   1.00 1.00 ? 33  LYS A HD3  2  
ATOM   1847  H HE2  . LYS A 1 33 ? 9.012   -6.675  2.424   1.00 1.00 ? 33  LYS A HE2  2  
ATOM   1848  H HE3  . LYS A 1 33 ? 8.840   -6.328  4.145   1.00 1.00 ? 33  LYS A HE3  2  
ATOM   1849  H HZ1  . LYS A 1 33 ? 7.967   -4.364  2.129   1.00 1.00 ? 33  LYS A HZ1  2  
ATOM   1850  H HZ2  . LYS A 1 33 ? 7.451   -4.547  3.736   1.00 1.00 ? 33  LYS A HZ2  2  
ATOM   1851  H HZ3  . LYS A 1 33 ? 6.957   -5.660  2.552   1.00 1.00 ? 33  LYS A HZ3  2  
ATOM   1852  N N    . LEU A 1 34 ? 13.467  -1.891  6.262   1.00 1.00 ? 34  LEU A N    2  
ATOM   1853  C CA   . LEU A 1 34 ? 14.793  -1.337  6.513   1.00 1.00 ? 34  LEU A CA   2  
ATOM   1854  C C    . LEU A 1 34 ? 15.752  -1.742  5.401   1.00 1.00 ? 34  LEU A C    2  
ATOM   1855  O O    . LEU A 1 34 ? 15.826  -2.911  5.028   1.00 1.00 ? 34  LEU A O    2  
ATOM   1856  C CB   . LEU A 1 34 ? 15.320  -1.844  7.856   1.00 1.00 ? 34  LEU A CB   2  
ATOM   1857  C CG   . LEU A 1 34 ? 14.299  -1.539  8.958   1.00 1.00 ? 34  LEU A CG   2  
ATOM   1858  C CD1  . LEU A 1 34 ? 14.820  -2.070  10.297  1.00 1.00 ? 34  LEU A CD1  2  
ATOM   1859  C CD2  . LEU A 1 34 ? 14.071  -0.019  9.056   1.00 1.00 ? 34  LEU A CD2  2  
ATOM   1860  H H    . LEU A 1 34 ? 13.180  -2.696  6.745   1.00 1.00 ? 34  LEU A H    2  
ATOM   1861  H HA   . LEU A 1 34 ? 14.730  -0.262  6.542   1.00 1.00 ? 34  LEU A HA   2  
ATOM   1862  H HB2  . LEU A 1 34 ? 15.485  -2.911  7.800   1.00 1.00 ? 34  LEU A HB2  2  
ATOM   1863  H HB3  . LEU A 1 34 ? 16.250  -1.348  8.086   1.00 1.00 ? 34  LEU A HB3  2  
ATOM   1864  H HG   . LEU A 1 34 ? 13.365  -2.029  8.720   1.00 1.00 ? 34  LEU A HG   2  
ATOM   1865  H HD11 . LEU A 1 34 ? 15.610  -1.429  10.654  1.00 1.00 ? 34  LEU A HD11 2  
ATOM   1866  H HD12 . LEU A 1 34 ? 15.199  -3.073  10.165  1.00 1.00 ? 34  LEU A HD12 2  
ATOM   1867  H HD13 . LEU A 1 34 ? 14.013  -2.083  11.015  1.00 1.00 ? 34  LEU A HD13 2  
ATOM   1868  H HD21 . LEU A 1 34 ? 13.696  0.231   10.039  1.00 1.00 ? 34  LEU A HD21 2  
ATOM   1869  H HD22 . LEU A 1 34 ? 13.349  0.283   8.315   1.00 1.00 ? 34  LEU A HD22 2  
ATOM   1870  H HD23 . LEU A 1 34 ? 15.002  0.502   8.882   1.00 1.00 ? 34  LEU A HD23 2  
ATOM   1871  N N    . GLY A 1 35 ? 16.486  -0.764  4.878   1.00 1.00 ? 35  GLY A N    2  
ATOM   1872  C CA   . GLY A 1 35 ? 17.443  -1.026  3.807   1.00 1.00 ? 35  GLY A CA   2  
ATOM   1873  C C    . GLY A 1 35 ? 17.690  0.230   2.980   1.00 1.00 ? 35  GLY A C    2  
ATOM   1874  O O    . GLY A 1 35 ? 17.340  1.336   3.393   1.00 1.00 ? 35  GLY A O    2  
ATOM   1875  H H    . GLY A 1 35 ? 16.381  0.150   5.217   1.00 1.00 ? 35  GLY A H    2  
ATOM   1876  H HA2  . GLY A 1 35 ? 18.376  -1.356  4.240   1.00 1.00 ? 35  GLY A HA2  2  
ATOM   1877  H HA3  . GLY A 1 35 ? 17.056  -1.800  3.162   1.00 1.00 ? 35  GLY A HA3  2  
ATOM   1878  N N    . ALA A 1 36 ? 18.292  0.051   1.809   1.00 1.00 ? 36  ALA A N    2  
ATOM   1879  C CA   . ALA A 1 36 ? 18.582  1.176   0.928   1.00 1.00 ? 36  ALA A CA   2  
ATOM   1880  C C    . ALA A 1 36 ? 17.291  1.873   0.511   1.00 1.00 ? 36  ALA A C    2  
ATOM   1881  O O    . ALA A 1 36 ? 17.253  3.096   0.369   1.00 1.00 ? 36  ALA A O    2  
ATOM   1882  C CB   . ALA A 1 36 ? 19.324  0.688   -0.316  1.00 1.00 ? 36  ALA A CB   2  
ATOM   1883  H H    . ALA A 1 36 ? 18.545  -0.855  1.533   1.00 1.00 ? 36  ALA A H    2  
ATOM   1884  H HA   . ALA A 1 36 ? 19.207  1.881   1.455   1.00 1.00 ? 36  ALA A HA   2  
ATOM   1885  H HB1  . ALA A 1 36 ? 18.650  0.116   -0.937  1.00 1.00 ? 36  ALA A HB1  2  
ATOM   1886  H HB2  . ALA A 1 36 ? 20.154  0.064   -0.018  1.00 1.00 ? 36  ALA A HB2  2  
ATOM   1887  H HB3  . ALA A 1 36 ? 19.693  1.536   -0.871  1.00 1.00 ? 36  ALA A HB3  2  
ATOM   1888  N N    . ASP A 1 37 ? 16.236  1.090   0.314   1.00 1.00 ? 37  ASP A N    2  
ATOM   1889  C CA   . ASP A 1 37 ? 14.949  1.645   -0.087  1.00 1.00 ? 37  ASP A CA   2  
ATOM   1890  C C    . ASP A 1 37 ? 14.377  2.527   1.019   1.00 1.00 ? 37  ASP A C    2  
ATOM   1891  O O    . ASP A 1 37 ? 14.401  2.159   2.192   1.00 1.00 ? 37  ASP A O    2  
ATOM   1892  C CB   . ASP A 1 37 ? 13.967  0.515   -0.398  1.00 1.00 ? 37  ASP A CB   2  
ATOM   1893  C CG   . ASP A 1 37 ? 12.640  1.094   -0.876  1.00 1.00 ? 37  ASP A CG   2  
ATOM   1894  O OD1  . ASP A 1 37 ? 12.485  2.302   -0.811  1.00 1.00 ? 37  ASP A OD1  2  
ATOM   1895  O OD2  . ASP A 1 37 ? 11.798  0.319   -1.301  1.00 1.00 ? 37  ASP A OD2  2  
ATOM   1896  H H    . ASP A 1 37 ? 16.324  0.122   0.443   1.00 1.00 ? 37  ASP A H    2  
ATOM   1897  H HA   . ASP A 1 37 ? 15.087  2.241   -0.976  1.00 1.00 ? 37  ASP A HA   2  
ATOM   1898  H HB2  . ASP A 1 37 ? 14.381  -0.118  -1.168  1.00 1.00 ? 37  ASP A HB2  2  
ATOM   1899  H HB3  . ASP A 1 37 ? 13.800  -0.071  0.494   1.00 1.00 ? 37  ASP A HB3  2  
ATOM   1900  N N    . SER A 1 38 ? 13.861  3.691   0.634   1.00 1.00 ? 38  SER A N    2  
ATOM   1901  C CA   . SER A 1 38 ? 13.282  4.619   1.602   1.00 1.00 ? 38  SER A CA   2  
ATOM   1902  C C    . SER A 1 38 ? 12.244  5.510   0.931   1.00 1.00 ? 38  SER A C    2  
ATOM   1903  O O    . SER A 1 38 ? 12.332  5.793   -0.263  1.00 1.00 ? 38  SER A O    2  
ATOM   1904  C CB   . SER A 1 38 ? 14.385  5.486   2.214   1.00 1.00 ? 38  SER A CB   2  
ATOM   1905  H H    . SER A 1 38 ? 13.868  3.930   -0.317  1.00 1.00 ? 38  SER A H    2  
ATOM   1906  H HA   . SER A 1 38 ? 12.803  4.058   2.391   1.00 1.00 ? 38  SER A HA   2  
ATOM   1907  H HB2  . SER A 1 38 ? 14.713  6.216   1.486   1.00 1.00 ? 38  SER A HB2  2  
ATOM   1908  H HB3  . SER A 1 38 ? 15.216  4.863   2.497   1.00 1.00 ? 38  SER A HB3  2  
ATOM   1909  N N    . LEU A 1 39 ? 11.259  5.951   1.707   1.00 1.00 ? 39  LEU A N    2  
ATOM   1910  C CA   . LEU A 1 39 ? 10.210  6.812   1.172   1.00 1.00 ? 39  LEU A CA   2  
ATOM   1911  C C    . LEU A 1 39 ? 9.527   6.146   -0.015  1.00 1.00 ? 39  LEU A C    2  
ATOM   1912  O O    . LEU A 1 39 ? 8.720   5.232   0.158   1.00 1.00 ? 39  LEU A O    2  
ATOM   1913  C CB   . LEU A 1 39 ? 10.808  8.156   0.746   1.00 1.00 ? 39  LEU A CB   2  
ATOM   1914  C CG   . LEU A 1 39 ? 11.519  8.806   1.936   1.00 1.00 ? 39  LEU A CG   2  
ATOM   1915  C CD1  . LEU A 1 39 ? 12.189  10.104  1.475   1.00 1.00 ? 39  LEU A CD1  2  
ATOM   1916  C CD2  . LEU A 1 39 ? 10.503  9.116   3.055   1.00 1.00 ? 39  LEU A CD2  2  
ATOM   1917  H H    . LEU A 1 39 ? 11.238  5.695   2.653   1.00 1.00 ? 39  LEU A H    2  
ATOM   1918  H HA   . LEU A 1 39 ? 9.473   6.985   1.940   1.00 1.00 ? 39  LEU A HA   2  
ATOM   1919  H HB2  . LEU A 1 39 ? 11.522  7.996   -0.049  1.00 1.00 ? 39  LEU A HB2  2  
ATOM   1920  H HB3  . LEU A 1 39 ? 10.021  8.808   0.398   1.00 1.00 ? 39  LEU A HB3  2  
ATOM   1921  H HG   . LEU A 1 39 ? 12.272  8.130   2.311   1.00 1.00 ? 39  LEU A HG   2  
ATOM   1922  H HD11 . LEU A 1 39 ? 11.434  10.813  1.173   1.00 1.00 ? 39  LEU A HD11 2  
ATOM   1923  H HD12 . LEU A 1 39 ? 12.845  9.896   0.641   1.00 1.00 ? 39  LEU A HD12 2  
ATOM   1924  H HD13 . LEU A 1 39 ? 12.765  10.518  2.289   1.00 1.00 ? 39  LEU A HD13 2  
ATOM   1925  H HD21 . LEU A 1 39 ? 10.875  9.922   3.675   1.00 1.00 ? 39  LEU A HD21 2  
ATOM   1926  H HD22 . LEU A 1 39 ? 10.364  8.238   3.665   1.00 1.00 ? 39  LEU A HD22 2  
ATOM   1927  H HD23 . LEU A 1 39 ? 9.554   9.407   2.622   1.00 1.00 ? 39  LEU A HD23 2  
ATOM   1928  N N    . ASP A 1 40 ? 9.850   6.611   -1.216  1.00 1.00 ? 40  ASP A N    2  
ATOM   1929  C CA   . ASP A 1 40 ? 9.265   6.058   -2.426  1.00 1.00 ? 40  ASP A CA   2  
ATOM   1930  C C    . ASP A 1 40 ? 7.742   6.109   -2.356  1.00 1.00 ? 40  ASP A C    2  
ATOM   1931  O O    . ASP A 1 40 ? 7.057   5.274   -2.941  1.00 1.00 ? 40  ASP A O    2  
ATOM   1932  C CB   . ASP A 1 40 ? 9.727   4.611   -2.606  1.00 1.00 ? 40  ASP A CB   2  
ATOM   1933  C CG   . ASP A 1 40 ? 11.198  4.577   -3.010  1.00 1.00 ? 40  ASP A CG   2  
ATOM   1934  O OD1  . ASP A 1 40 ? 11.699  5.603   -3.442  1.00 1.00 ? 40  ASP A OD1  2  
ATOM   1935  O OD2  . ASP A 1 40 ? 11.802  3.525   -2.883  1.00 1.00 ? 40  ASP A OD2  2  
ATOM   1936  H H    . ASP A 1 40 ? 10.496  7.341   -1.291  1.00 1.00 ? 40  ASP A H    2  
ATOM   1937  H HA   . ASP A 1 40 ? 9.595   6.639   -3.272  1.00 1.00 ? 40  ASP A HA   2  
ATOM   1938  H HB2  . ASP A 1 40 ? 9.599   4.073   -1.677  1.00 1.00 ? 40  ASP A HB2  2  
ATOM   1939  H HB3  . ASP A 1 40 ? 9.137   4.141   -3.377  1.00 1.00 ? 40  ASP A HB3  2  
ATOM   1940  N N    . THR A 1 41 ? 7.221   7.099   -1.643  1.00 1.00 ? 41  THR A N    2  
ATOM   1941  C CA   . THR A 1 41 ? 5.776   7.251   -1.507  1.00 1.00 ? 41  THR A CA   2  
ATOM   1942  C C    . THR A 1 41 ? 5.136   7.492   -2.869  1.00 1.00 ? 41  THR A C    2  
ATOM   1943  O O    . THR A 1 41 ? 4.094   6.917   -3.181  1.00 1.00 ? 41  THR A O    2  
ATOM   1944  C CB   . THR A 1 41 ? 5.455   8.421   -0.575  1.00 1.00 ? 41  THR A CB   2  
ATOM   1945  O OG1  . THR A 1 41 ? 5.984   8.152   0.715   1.00 1.00 ? 41  THR A OG1  2  
ATOM   1946  C CG2  . THR A 1 41 ? 3.937   8.600   -0.484  1.00 1.00 ? 41  THR A CG2  2  
ATOM   1947  H H    . THR A 1 41 ? 7.815   7.741   -1.203  1.00 1.00 ? 41  THR A H    2  
ATOM   1948  H HA   . THR A 1 41 ? 5.368   6.345   -1.084  1.00 1.00 ? 41  THR A HA   2  
ATOM   1949  H HB   . THR A 1 41 ? 5.897   9.323   -0.967  1.00 1.00 ? 41  THR A HB   2  
ATOM   1950  H HG1  . THR A 1 41 ? 6.680   7.497   0.621   1.00 1.00 ? 41  THR A HG1  2  
ATOM   1951  H HG21 . THR A 1 41 ? 3.698   9.257   0.345   1.00 1.00 ? 41  THR A HG21 2  
ATOM   1952  H HG22 . THR A 1 41 ? 3.472   7.637   -0.329  1.00 1.00 ? 41  THR A HG22 2  
ATOM   1953  H HG23 . THR A 1 41 ? 3.570   9.031   -1.402  1.00 1.00 ? 41  THR A HG23 2  
ATOM   1954  N N    . VAL A 1 42 ? 5.765   8.349   -3.667  1.00 1.00 ? 42  VAL A N    2  
ATOM   1955  C CA   . VAL A 1 42 ? 5.257   8.667   -4.996  1.00 1.00 ? 42  VAL A CA   2  
ATOM   1956  C C    . VAL A 1 42 ? 5.252   7.421   -5.873  1.00 1.00 ? 42  VAL A C    2  
ATOM   1957  O O    . VAL A 1 42 ? 4.357   7.237   -6.690  1.00 1.00 ? 42  VAL A O    2  
ATOM   1958  C CB   . VAL A 1 42 ? 6.108   9.755   -5.645  1.00 1.00 ? 42  VAL A CB   2  
ATOM   1959  C CG1  . VAL A 1 42 ? 5.600   10.021  -7.065  1.00 1.00 ? 42  VAL A CG1  2  
ATOM   1960  C CG2  . VAL A 1 42 ? 6.008   11.038  -4.819  1.00 1.00 ? 42  VAL A CG2  2  
ATOM   1961  H H    . VAL A 1 42 ? 6.589   8.775   -3.355  1.00 1.00 ? 42  VAL A H    2  
ATOM   1962  H HA   . VAL A 1 42 ? 4.244   9.031   -4.900  1.00 1.00 ? 42  VAL A HA   2  
ATOM   1963  H HB   . VAL A 1 42 ? 7.136   9.426   -5.686  1.00 1.00 ? 42  VAL A HB   2  
ATOM   1964  H HG11 . VAL A 1 42 ? 6.055   10.923  -7.445  1.00 1.00 ? 42  VAL A HG11 2  
ATOM   1965  H HG12 . VAL A 1 42 ? 4.526   10.139  -7.046  1.00 1.00 ? 42  VAL A HG12 2  
ATOM   1966  H HG13 . VAL A 1 42 ? 5.860   9.190   -7.702  1.00 1.00 ? 42  VAL A HG13 2  
ATOM   1967  H HG21 . VAL A 1 42 ? 6.440   10.872  -3.844  1.00 1.00 ? 42  VAL A HG21 2  
ATOM   1968  H HG22 . VAL A 1 42 ? 4.969   11.316  -4.710  1.00 1.00 ? 42  VAL A HG22 2  
ATOM   1969  H HG23 . VAL A 1 42 ? 6.543   11.830  -5.320  1.00 1.00 ? 42  VAL A HG23 2  
ATOM   1970  N N    . GLU A 1 43 ? 6.266   6.590   -5.722  1.00 1.00 ? 43  GLU A N    2  
ATOM   1971  C CA   . GLU A 1 43 ? 6.362   5.362   -6.505  1.00 1.00 ? 43  GLU A CA   2  
ATOM   1972  C C    . GLU A 1 43 ? 5.371   4.312   -6.011  1.00 1.00 ? 43  GLU A C    2  
ATOM   1973  O O    . GLU A 1 43 ? 4.660   3.688   -6.802  1.00 1.00 ? 43  GLU A O    2  
ATOM   1974  C CB   . GLU A 1 43 ? 7.779   4.807   -6.429  1.00 1.00 ? 43  GLU A CB   2  
ATOM   1975  C CG   . GLU A 1 43 ? 8.734   5.752   -7.158  1.00 1.00 ? 43  GLU A CG   2  
ATOM   1976  C CD   . GLU A 1 43 ? 10.172  5.280   -6.981  1.00 1.00 ? 43  GLU A CD   2  
ATOM   1977  O OE1  . GLU A 1 43 ? 10.367  4.283   -6.304  1.00 1.00 ? 43  GLU A OE1  2  
ATOM   1978  O OE2  . GLU A 1 43 ? 11.054  5.918   -7.527  1.00 1.00 ? 43  GLU A OE2  2  
ATOM   1979  H H    . GLU A 1 43 ? 6.962   6.798   -5.064  1.00 1.00 ? 43  GLU A H    2  
ATOM   1980  H HA   . GLU A 1 43 ? 6.134   5.592   -7.535  1.00 1.00 ? 43  GLU A HA   2  
ATOM   1981  H HB2  . GLU A 1 43 ? 8.074   4.718   -5.392  1.00 1.00 ? 43  GLU A HB2  2  
ATOM   1982  H HB3  . GLU A 1 43 ? 7.808   3.836   -6.898  1.00 1.00 ? 43  GLU A HB3  2  
ATOM   1983  H HG2  . GLU A 1 43 ? 8.486   5.770   -8.208  1.00 1.00 ? 43  GLU A HG2  2  
ATOM   1984  H HG3  . GLU A 1 43 ? 8.631   6.748   -6.749  1.00 1.00 ? 43  GLU A HG3  2  
ATOM   1985  N N    . ILE A 1 44 ? 5.354   4.094   -4.701  1.00 1.00 ? 44  ILE A N    2  
ATOM   1986  C CA   . ILE A 1 44 ? 4.466   3.095   -4.111  1.00 1.00 ? 44  ILE A CA   2  
ATOM   1987  C C    . ILE A 1 44 ? 3.006   3.463   -4.294  1.00 1.00 ? 44  ILE A C    2  
ATOM   1988  O O    . ILE A 1 44 ? 2.187   2.615   -4.652  1.00 1.00 ? 44  ILE A O    2  
ATOM   1989  C CB   . ILE A 1 44 ? 4.770   2.957   -2.610  1.00 1.00 ? 44  ILE A CB   2  
ATOM   1990  C CG1  . ILE A 1 44 ? 6.165   2.333   -2.414  1.00 1.00 ? 44  ILE A CG1  2  
ATOM   1991  C CG2  . ILE A 1 44 ? 3.725   2.062   -1.942  1.00 1.00 ? 44  ILE A CG2  2  
ATOM   1992  C CD1  . ILE A 1 44 ? 6.227   0.910   -2.992  1.00 1.00 ? 44  ILE A CD1  2  
ATOM   1993  H H    . ILE A 1 44 ? 5.966   4.599   -4.123  1.00 1.00 ? 44  ILE A H    2  
ATOM   1994  H HA   . ILE A 1 44 ? 4.639   2.152   -4.597  1.00 1.00 ? 44  ILE A HA   2  
ATOM   1995  H HB   . ILE A 1 44 ? 4.744   3.937   -2.148  1.00 1.00 ? 44  ILE A HB   2  
ATOM   1996  H HG12 . ILE A 1 44 ? 6.900   2.944   -2.908  1.00 1.00 ? 44  ILE A HG12 2  
ATOM   1997  H HG13 . ILE A 1 44 ? 6.380   2.292   -1.360  1.00 1.00 ? 44  ILE A HG13 2  
ATOM   1998  H HG21 . ILE A 1 44 ? 2.789   2.590   -1.855  1.00 1.00 ? 44  ILE A HG21 2  
ATOM   1999  H HG22 . ILE A 1 44 ? 4.078   1.772   -0.962  1.00 1.00 ? 44  ILE A HG22 2  
ATOM   2000  H HG23 . ILE A 1 44 ? 3.592   1.181   -2.553  1.00 1.00 ? 44  ILE A HG23 2  
ATOM   2001  H HD11 . ILE A 1 44 ? 6.591   0.954   -4.005  1.00 1.00 ? 44  ILE A HD11 2  
ATOM   2002  H HD12 . ILE A 1 44 ? 5.248   0.454   -2.984  1.00 1.00 ? 44  ILE A HD12 2  
ATOM   2003  H HD13 . ILE A 1 44 ? 6.899   0.315   -2.398  1.00 1.00 ? 44  ILE A HD13 2  
ATOM   2004  N N    . VAL A 1 45 ? 2.678   4.715   -4.035  1.00 1.00 ? 45  VAL A N    2  
ATOM   2005  C CA   . VAL A 1 45 ? 1.300   5.165   -4.156  1.00 1.00 ? 45  VAL A CA   2  
ATOM   2006  C C    . VAL A 1 45 ? 0.807   4.980   -5.587  1.00 1.00 ? 45  VAL A C    2  
ATOM   2007  O O    . VAL A 1 45 ? -0.343  4.606   -5.814  1.00 1.00 ? 45  VAL A O    2  
ATOM   2008  C CB   . VAL A 1 45 ? 1.199   6.641   -3.759  1.00 1.00 ? 45  VAL A CB   2  
ATOM   2009  C CG1  . VAL A 1 45 ? 1.854   7.511   -4.822  1.00 1.00 ? 45  VAL A CG1  2  
ATOM   2010  C CG2  . VAL A 1 45 ? -0.268  7.030   -3.612  1.00 1.00 ? 45  VAL A CG2  2  
ATOM   2011  H H    . VAL A 1 45 ? 3.368   5.342   -3.733  1.00 1.00 ? 45  VAL A H    2  
ATOM   2012  H HA   . VAL A 1 45 ? 0.683   4.581   -3.495  1.00 1.00 ? 45  VAL A HA   2  
ATOM   2013  H HB   . VAL A 1 45 ? 1.707   6.791   -2.819  1.00 1.00 ? 45  VAL A HB   2  
ATOM   2014  H HG11 . VAL A 1 45 ? 2.789   7.071   -5.103  1.00 1.00 ? 45  VAL A HG11 2  
ATOM   2015  H HG12 . VAL A 1 45 ? 2.022   8.501   -4.429  1.00 1.00 ? 45  VAL A HG12 2  
ATOM   2016  H HG13 . VAL A 1 45 ? 1.209   7.570   -5.690  1.00 1.00 ? 45  VAL A HG13 2  
ATOM   2017  H HG21 . VAL A 1 45 ? -0.720  6.424   -2.846  1.00 1.00 ? 45  VAL A HG21 2  
ATOM   2018  H HG22 . VAL A 1 45 ? -0.777  6.869   -4.552  1.00 1.00 ? 45  VAL A HG22 2  
ATOM   2019  H HG23 . VAL A 1 45 ? -0.336  8.072   -3.337  1.00 1.00 ? 45  VAL A HG23 2  
ATOM   2020  N N    . MET A 1 46 ? 1.685   5.246   -6.546  1.00 1.00 ? 46  MET A N    2  
ATOM   2021  C CA   . MET A 1 46 ? 1.319   5.109   -7.948  1.00 1.00 ? 46  MET A CA   2  
ATOM   2022  C C    . MET A 1 46 ? 0.930   3.664   -8.258  1.00 1.00 ? 46  MET A C    2  
ATOM   2023  O O    . MET A 1 46 ? -0.024  3.416   -8.991  1.00 1.00 ? 46  MET A O    2  
ATOM   2024  C CB   . MET A 1 46 ? 2.501   5.540   -8.847  1.00 1.00 ? 46  MET A CB   2  
ATOM   2025  C CG   . MET A 1 46 ? 1.984   6.230   -10.107 1.00 1.00 ? 46  MET A CG   2  
ATOM   2026  S SD   . MET A 1 46 ? 0.802   5.135   -10.942 1.00 1.00 ? 46  MET A SD   2  
ATOM   2027  C CE   . MET A 1 46 ? -0.602  6.276   -10.988 1.00 1.00 ? 46  MET A CE   2  
ATOM   2028  H H    . MET A 1 46 ? 2.587   5.543   -6.310  1.00 1.00 ? 46  MET A H    2  
ATOM   2029  H HA   . MET A 1 46 ? 0.469   5.750   -8.141  1.00 1.00 ? 46  MET A HA   2  
ATOM   2030  H HB2  . MET A 1 46 ? 3.122   6.229   -8.306  1.00 1.00 ? 46  MET A HB2  2  
ATOM   2031  H HB3  . MET A 1 46 ? 3.091   4.678   -9.132  1.00 1.00 ? 46  MET A HB3  2  
ATOM   2032  H HG2  . MET A 1 46 ? 1.500   7.154   -9.827  1.00 1.00 ? 46  MET A HG2  2  
ATOM   2033  H HG3  . MET A 1 46 ? 2.811   6.442   -10.769 1.00 1.00 ? 46  MET A HG3  2  
ATOM   2034  H HE1  . MET A 1 46 ? -0.870  6.554   -9.978  1.00 1.00 ? 46  MET A HE1  2  
ATOM   2035  H HE2  . MET A 1 46 ? -1.442  5.800   -11.466 1.00 1.00 ? 46  MET A HE2  2  
ATOM   2036  H HE3  . MET A 1 46 ? -0.321  7.159   -11.544 1.00 1.00 ? 46  MET A HE3  2  
ATOM   2037  N N    . ASN A 1 47 ? 1.681   2.719   -7.698  1.00 1.00 ? 47  ASN A N    2  
ATOM   2038  C CA   . ASN A 1 47 ? 1.406   1.309   -7.926  1.00 1.00 ? 47  ASN A CA   2  
ATOM   2039  C C    . ASN A 1 47 ? 0.023   0.952   -7.400  1.00 1.00 ? 47  ASN A C    2  
ATOM   2040  O O    . ASN A 1 47 ? -0.742  0.258   -8.067  1.00 1.00 ? 47  ASN A O    2  
ATOM   2041  C CB   . ASN A 1 47 ? 2.488   0.465   -7.220  1.00 1.00 ? 47  ASN A CB   2  
ATOM   2042  C CG   . ASN A 1 47 ? 3.722   0.345   -8.101  1.00 1.00 ? 47  ASN A CG   2  
ATOM   2043  O OD1  . ASN A 1 47 ? 4.540   1.264   -8.163  1.00 1.00 ? 47  ASN A OD1  2  
ATOM   2044  N ND2  . ASN A 1 47 ? 3.901   -0.745  -8.794  1.00 1.00 ? 47  ASN A ND2  2  
ATOM   2045  H H    . ASN A 1 47 ? 2.432   2.976   -7.122  1.00 1.00 ? 47  ASN A H    2  
ATOM   2046  H HA   . ASN A 1 47 ? 1.432   1.106   -8.987  1.00 1.00 ? 47  ASN A HA   2  
ATOM   2047  H HB2  . ASN A 1 47 ? 2.762   0.943   -6.291  1.00 1.00 ? 47  ASN A HB2  2  
ATOM   2048  H HB3  . ASN A 1 47 ? 2.115   -0.521  -7.006  1.00 1.00 ? 47  ASN A HB3  2  
ATOM   2049  H HD21 . ASN A 1 47 ? 3.242   -1.471  -8.741  1.00 1.00 ? 47  ASN A HD21 2  
ATOM   2050  H HD22 . ASN A 1 47 ? 4.692   -0.843  -9.362  1.00 1.00 ? 47  ASN A HD22 2  
ATOM   2051  N N    . LEU A 1 48 ? -0.298  1.441   -6.211  1.00 1.00 ? 48  LEU A N    2  
ATOM   2052  C CA   . LEU A 1 48 ? -1.600  1.169   -5.613  1.00 1.00 ? 48  LEU A CA   2  
ATOM   2053  C C    . LEU A 1 48 ? -2.702  1.870   -6.395  1.00 1.00 ? 48  LEU A C    2  
ATOM   2054  O O    . LEU A 1 48 ? -3.765  1.298   -6.630  1.00 1.00 ? 48  LEU A O    2  
ATOM   2055  C CB   . LEU A 1 48 ? -1.614  1.654   -4.162  1.00 1.00 ? 48  LEU A CB   2  
ATOM   2056  C CG   . LEU A 1 48 ? -0.593  0.847   -3.352  1.00 1.00 ? 48  LEU A CG   2  
ATOM   2057  C CD1  . LEU A 1 48 ? -0.337  1.539   -2.017  1.00 1.00 ? 48  LEU A CD1  2  
ATOM   2058  C CD2  . LEU A 1 48 ? -1.110  -0.577  -3.089  1.00 1.00 ? 48  LEU A CD2  2  
ATOM   2059  H H    . LEU A 1 48 ? 0.351   1.998   -5.731  1.00 1.00 ? 48  LEU A H    2  
ATOM   2060  H HA   . LEU A 1 48 ? -1.783  0.107   -5.634  1.00 1.00 ? 48  LEU A HA   2  
ATOM   2061  H HB2  . LEU A 1 48 ? -1.355  2.702   -4.131  1.00 1.00 ? 48  LEU A HB2  2  
ATOM   2062  H HB3  . LEU A 1 48 ? -2.604  1.515   -3.740  1.00 1.00 ? 48  LEU A HB3  2  
ATOM   2063  H HG   . LEU A 1 48 ? 0.329   0.801   -3.901  1.00 1.00 ? 48  LEU A HG   2  
ATOM   2064  H HD11 . LEU A 1 48 ? 0.458   1.027   -1.497  1.00 1.00 ? 48  LEU A HD11 2  
ATOM   2065  H HD12 . LEU A 1 48 ? -1.235  1.516   -1.421  1.00 1.00 ? 48  LEU A HD12 2  
ATOM   2066  H HD13 . LEU A 1 48 ? -0.048  2.562   -2.199  1.00 1.00 ? 48  LEU A HD13 2  
ATOM   2067  H HD21 . LEU A 1 48 ? -2.161  -0.550  -2.854  1.00 1.00 ? 48  LEU A HD21 2  
ATOM   2068  H HD22 . LEU A 1 48 ? -0.568  -0.998  -2.259  1.00 1.00 ? 48  LEU A HD22 2  
ATOM   2069  H HD23 . LEU A 1 48 ? -0.951  -1.189  -3.957  1.00 1.00 ? 48  LEU A HD23 2  
ATOM   2070  N N    . GLU A 1 49 ? -2.439  3.110   -6.783  1.00 1.00 ? 49  GLU A N    2  
ATOM   2071  C CA   . GLU A 1 49 ? -3.411  3.893   -7.529  1.00 1.00 ? 49  GLU A CA   2  
ATOM   2072  C C    . GLU A 1 49 ? -3.611  3.298   -8.916  1.00 1.00 ? 49  GLU A C    2  
ATOM   2073  O O    . GLU A 1 49 ? -4.723  3.292   -9.435  1.00 1.00 ? 49  GLU A O    2  
ATOM   2074  C CB   . GLU A 1 49 ? -2.932  5.337   -7.668  1.00 1.00 ? 49  GLU A CB   2  
ATOM   2075  C CG   . GLU A 1 49 ? -4.078  6.209   -8.191  1.00 1.00 ? 49  GLU A CG   2  
ATOM   2076  C CD   . GLU A 1 49 ? -3.605  7.646   -8.375  1.00 1.00 ? 49  GLU A CD   2  
ATOM   2077  O OE1  . GLU A 1 49 ? -2.528  7.960   -7.893  1.00 1.00 ? 49  GLU A OE1  2  
ATOM   2078  O OE2  . GLU A 1 49 ? -4.329  8.413   -8.986  1.00 1.00 ? 49  GLU A OE2  2  
ATOM   2079  H H    . GLU A 1 49 ? -1.572  3.509   -6.556  1.00 1.00 ? 49  GLU A H    2  
ATOM   2080  H HA   . GLU A 1 49 ? -4.354  3.880   -6.999  1.00 1.00 ? 49  GLU A HA   2  
ATOM   2081  H HB2  . GLU A 1 49 ? -2.605  5.704   -6.708  1.00 1.00 ? 49  GLU A HB2  2  
ATOM   2082  H HB3  . GLU A 1 49 ? -2.108  5.377   -8.364  1.00 1.00 ? 49  GLU A HB3  2  
ATOM   2083  H HG2  . GLU A 1 49 ? -4.424  5.819   -9.137  1.00 1.00 ? 49  GLU A HG2  2  
ATOM   2084  H HG3  . GLU A 1 49 ? -4.888  6.193   -7.478  1.00 1.00 ? 49  GLU A HG3  2  
ATOM   2085  N N    . GLU A 1 50 ? -2.528  2.821   -9.518  1.00 1.00 ? 50  GLU A N    2  
ATOM   2086  C CA   . GLU A 1 50 ? -2.599  2.237   -10.856 1.00 1.00 ? 50  GLU A CA   2  
ATOM   2087  C C    . GLU A 1 50 ? -3.396  0.938   -10.846 1.00 1.00 ? 50  GLU A C    2  
ATOM   2088  O O    . GLU A 1 50 ? -4.316  0.762   -11.648 1.00 1.00 ? 50  GLU A O    2  
ATOM   2089  C CB   . GLU A 1 50 ? -1.190  1.966   -11.381 1.00 1.00 ? 50  GLU A CB   2  
ATOM   2090  C CG   . GLU A 1 50 ? -1.265  1.429   -12.813 1.00 1.00 ? 50  GLU A CG   2  
ATOM   2091  C CD   . GLU A 1 50 ? 0.138   1.246   -13.379 1.00 1.00 ? 50  GLU A CD   2  
ATOM   2092  O OE1  . GLU A 1 50 ? 1.064   1.790   -12.801 1.00 1.00 ? 50  GLU A OE1  2  
ATOM   2093  O OE2  . GLU A 1 50 ? 0.263   0.565   -14.383 1.00 1.00 ? 50  GLU A OE2  2  
ATOM   2094  H H    . GLU A 1 50 ? -1.665  2.869   -9.058  1.00 1.00 ? 50  GLU A H    2  
ATOM   2095  H HA   . GLU A 1 50 ? -3.087  2.941   -11.514 1.00 1.00 ? 50  GLU A HA   2  
ATOM   2096  H HB2  . GLU A 1 50 ? -0.619  2.881   -11.368 1.00 1.00 ? 50  GLU A HB2  2  
ATOM   2097  H HB3  . GLU A 1 50 ? -0.708  1.232   -10.750 1.00 1.00 ? 50  GLU A HB3  2  
ATOM   2098  H HG2  . GLU A 1 50 ? -1.775  0.476   -12.813 1.00 1.00 ? 50  GLU A HG2  2  
ATOM   2099  H HG3  . GLU A 1 50 ? -1.811  2.128   -13.427 1.00 1.00 ? 50  GLU A HG3  2  
ATOM   2100  N N    . GLU A 1 51 ? -3.033  0.031   -9.950  1.00 1.00 ? 51  GLU A N    2  
ATOM   2101  C CA   . GLU A 1 51 ? -3.720  -1.248  -9.866  1.00 1.00 ? 51  GLU A CA   2  
ATOM   2102  C C    . GLU A 1 51 ? -5.204  -1.049  -9.585  1.00 1.00 ? 51  GLU A C    2  
ATOM   2103  O O    . GLU A 1 51 ? -6.058  -1.541  -10.325 1.00 1.00 ? 51  GLU A O    2  
ATOM   2104  C CB   . GLU A 1 51 ? -3.104  -2.094  -8.751  1.00 1.00 ? 51  GLU A CB   2  
ATOM   2105  C CG   . GLU A 1 51 ? -3.686  -3.511  -8.789  1.00 1.00 ? 51  GLU A CG   2  
ATOM   2106  C CD   . GLU A 1 51 ? -5.118  -3.503  -8.266  1.00 1.00 ? 51  GLU A CD   2  
ATOM   2107  O OE1  . GLU A 1 51 ? -5.389  -2.743  -7.350  1.00 1.00 ? 51  GLU A OE1  2  
ATOM   2108  O OE2  . GLU A 1 51 ? -5.923  -4.257  -8.787  1.00 1.00 ? 51  GLU A OE2  2  
ATOM   2109  H H    . GLU A 1 51 ? -2.282  0.213   -9.343  1.00 1.00 ? 51  GLU A H    2  
ATOM   2110  H HA   . GLU A 1 51 ? -3.610  -1.766  -10.803 1.00 1.00 ? 51  GLU A HA   2  
ATOM   2111  H HB2  . GLU A 1 51 ? -2.033  -2.140  -8.889  1.00 1.00 ? 51  GLU A HB2  2  
ATOM   2112  H HB3  . GLU A 1 51 ? -3.323  -1.642  -7.794  1.00 1.00 ? 51  GLU A HB3  2  
ATOM   2113  H HG2  . GLU A 1 51 ? -3.682  -3.873  -9.804  1.00 1.00 ? 51  GLU A HG2  2  
ATOM   2114  H HG3  . GLU A 1 51 ? -3.086  -4.160  -8.172  1.00 1.00 ? 51  GLU A HG3  2  
ATOM   2115  N N    . PHE A 1 52 ? -5.507  -0.345  -8.500  1.00 1.00 ? 52  PHE A N    2  
ATOM   2116  C CA   . PHE A 1 52 ? -6.896  -0.112  -8.127  1.00 1.00 ? 52  PHE A CA   2  
ATOM   2117  C C    . PHE A 1 52 ? -7.512  0.986   -8.987  1.00 1.00 ? 52  PHE A C    2  
ATOM   2118  O O    . PHE A 1 52 ? -8.723  1.212   -8.947  1.00 1.00 ? 52  PHE A O    2  
ATOM   2119  C CB   . PHE A 1 52 ? -6.977  0.276   -6.647  1.00 1.00 ? 52  PHE A CB   2  
ATOM   2120  C CG   . PHE A 1 52 ? -6.727  -0.948  -5.792  1.00 1.00 ? 52  PHE A CG   2  
ATOM   2121  C CD1  . PHE A 1 52 ? -7.634  -2.022  -5.818  1.00 1.00 ? 52  PHE A CD1  2  
ATOM   2122  C CD2  . PHE A 1 52 ? -5.599  -1.008  -4.963  1.00 1.00 ? 52  PHE A CD2  2  
ATOM   2123  C CE1  . PHE A 1 52 ? -7.406  -3.146  -5.025  1.00 1.00 ? 52  PHE A CE1  2  
ATOM   2124  C CE2  . PHE A 1 52 ? -5.378  -2.140  -4.175  1.00 1.00 ? 52  PHE A CE2  2  
ATOM   2125  C CZ   . PHE A 1 52 ? -6.288  -3.199  -4.204  1.00 1.00 ? 52  PHE A CZ   2  
ATOM   2126  H H    . PHE A 1 52 ? -4.787  0.005   -7.932  1.00 1.00 ? 52  PHE A H    2  
ATOM   2127  H HA   . PHE A 1 52 ? -7.453  -1.021  -8.277  1.00 1.00 ? 52  PHE A HA   2  
ATOM   2128  H HB2  . PHE A 1 52 ? -6.233  1.027   -6.431  1.00 1.00 ? 52  PHE A HB2  2  
ATOM   2129  H HB3  . PHE A 1 52 ? -7.957  0.668   -6.428  1.00 1.00 ? 52  PHE A HB3  2  
ATOM   2130  H HD1  . PHE A 1 52 ? -8.505  -1.982  -6.451  1.00 1.00 ? 52  PHE A HD1  2  
ATOM   2131  H HD2  . PHE A 1 52 ? -4.898  -0.187  -4.939  1.00 1.00 ? 52  PHE A HD2  2  
ATOM   2132  H HE1  . PHE A 1 52 ? -8.095  -3.980  -5.043  1.00 1.00 ? 52  PHE A HE1  2  
ATOM   2133  H HE2  . PHE A 1 52 ? -4.509  -2.195  -3.535  1.00 1.00 ? 52  PHE A HE2  2  
ATOM   2134  H HZ   . PHE A 1 52 ? -6.125  -4.061  -3.591  1.00 1.00 ? 52  PHE A HZ   2  
ATOM   2135  N N    . GLY A 1 53 ? -6.677  1.649   -9.775  1.00 1.00 ? 53  GLY A N    2  
ATOM   2136  C CA   . GLY A 1 53 ? -7.160  2.711   -10.653 1.00 1.00 ? 53  GLY A CA   2  
ATOM   2137  C C    . GLY A 1 53 ? -8.017  3.707   -9.883  1.00 1.00 ? 53  GLY A C    2  
ATOM   2138  O O    . GLY A 1 53 ? -9.086  4.095   -10.343 1.00 1.00 ? 53  GLY A O    2  
ATOM   2139  H H    . GLY A 1 53 ? -5.726  1.416   -9.779  1.00 1.00 ? 53  GLY A H    2  
ATOM   2140  H HA2  . GLY A 1 53 ? -6.319  3.227   -11.091 1.00 1.00 ? 53  GLY A HA2  2  
ATOM   2141  H HA3  . GLY A 1 53 ? -7.754  2.276   -11.440 1.00 1.00 ? 53  GLY A HA3  2  
ATOM   2142  N N    . ILE A 1 54 ? -7.543  4.116   -8.706  1.00 1.00 ? 54  ILE A N    2  
ATOM   2143  C CA   . ILE A 1 54 ? -8.278  5.075   -7.877  1.00 1.00 ? 54  ILE A CA   2  
ATOM   2144  C C    . ILE A 1 54 ? -7.603  6.436   -7.922  1.00 1.00 ? 54  ILE A C    2  
ATOM   2145  O O    . ILE A 1 54 ? -6.744  6.678   -8.767  1.00 1.00 ? 54  ILE A O    2  
ATOM   2146  C CB   . ILE A 1 54 ? -8.344  4.569   -6.436  1.00 1.00 ? 54  ILE A CB   2  
ATOM   2147  C CG1  . ILE A 1 54 ? -6.938  4.167   -5.970  1.00 1.00 ? 54  ILE A CG1  2  
ATOM   2148  C CG2  . ILE A 1 54 ? -9.284  3.367   -6.366  1.00 1.00 ? 54  ILE A CG2  2  
ATOM   2149  C CD1  . ILE A 1 54 ? -6.962  3.797   -4.484  1.00 1.00 ? 54  ILE A CD1  2  
ATOM   2150  H H    . ILE A 1 54 ? -6.678  3.773   -8.391  1.00 1.00 ? 54  ILE A H    2  
ATOM   2151  H HA   . ILE A 1 54 ? -9.288  5.178   -8.252  1.00 1.00 ? 54  ILE A HA   2  
ATOM   2152  H HB   . ILE A 1 54 ? -8.719  5.356   -5.803  1.00 1.00 ? 54  ILE A HB   2  
ATOM   2153  H HG12 . ILE A 1 54 ? -6.592  3.325   -6.550  1.00 1.00 ? 54  ILE A HG12 2  
ATOM   2154  H HG13 . ILE A 1 54 ? -6.271  4.997   -6.111  1.00 1.00 ? 54  ILE A HG13 2  
ATOM   2155  H HG21 . ILE A 1 54 ? -8.976  2.632   -7.090  1.00 1.00 ? 54  ILE A HG21 2  
ATOM   2156  H HG22 . ILE A 1 54 ? -10.295 3.684   -6.579  1.00 1.00 ? 54  ILE A HG22 2  
ATOM   2157  H HG23 . ILE A 1 54 ? -9.247  2.935   -5.376  1.00 1.00 ? 54  ILE A HG23 2  
ATOM   2158  H HD11 . ILE A 1 54 ? -6.061  3.254   -4.234  1.00 1.00 ? 54  ILE A HD11 2  
ATOM   2159  H HD12 . ILE A 1 54 ? -7.822  3.183   -4.276  1.00 1.00 ? 54  ILE A HD12 2  
ATOM   2160  H HD13 . ILE A 1 54 ? -7.013  4.692   -3.894  1.00 1.00 ? 54  ILE A HD13 2  
ATOM   2161  N N    . ASN A 1 55 ? -8.000  7.321   -7.013  1.00 1.00 ? 55  ASN A N    2  
ATOM   2162  C CA   . ASN A 1 55 ? -7.430  8.670   -6.948  1.00 1.00 ? 55  ASN A CA   2  
ATOM   2163  C C    . ASN A 1 55 ? -6.880  8.937   -5.555  1.00 1.00 ? 55  ASN A C    2  
ATOM   2164  O O    . ASN A 1 55 ? -7.620  9.318   -4.653  1.00 1.00 ? 55  ASN A O    2  
ATOM   2165  C CB   . ASN A 1 55 ? -8.502  9.706   -7.285  1.00 1.00 ? 55  ASN A CB   2  
ATOM   2166  C CG   . ASN A 1 55 ? -9.805  9.367   -6.568  1.00 1.00 ? 55  ASN A CG   2  
ATOM   2167  O OD1  . ASN A 1 55 ? -10.871 9.836   -6.966  1.00 1.00 ? 55  ASN A OD1  2  
ATOM   2168  N ND2  . ASN A 1 55 ? -9.784  8.575   -5.531  1.00 1.00 ? 55  ASN A ND2  2  
ATOM   2169  H H    . ASN A 1 55 ? -8.697  7.062   -6.372  1.00 1.00 ? 55  ASN A H    2  
ATOM   2170  H HA   . ASN A 1 55 ? -6.623  8.760   -7.663  1.00 1.00 ? 55  ASN A HA   2  
ATOM   2171  H HB2  . ASN A 1 55 ? -8.166  10.684  -6.975  1.00 1.00 ? 55  ASN A HB2  2  
ATOM   2172  H HB3  . ASN A 1 55 ? -8.673  9.709   -8.351  1.00 1.00 ? 55  ASN A HB3  2  
ATOM   2173  H HD21 . ASN A 1 55 ? -8.934  8.202   -5.216  1.00 1.00 ? 55  ASN A HD21 2  
ATOM   2174  H HD22 . ASN A 1 55 ? -10.618 8.356   -5.066  1.00 1.00 ? 55  ASN A HD22 2  
ATOM   2175  N N    . VAL A 1 56 ? -5.576  8.733   -5.388  1.00 1.00 ? 56  VAL A N    2  
ATOM   2176  C CA   . VAL A 1 56 ? -4.931  8.954   -4.094  1.00 1.00 ? 56  VAL A CA   2  
ATOM   2177  C C    . VAL A 1 56 ? -4.173  10.275  -4.098  1.00 1.00 ? 56  VAL A C    2  
ATOM   2178  O O    . VAL A 1 56 ? -3.363  10.538  -4.984  1.00 1.00 ? 56  VAL A O    2  
ATOM   2179  C CB   . VAL A 1 56 ? -3.958  7.805   -3.792  1.00 1.00 ? 56  VAL A CB   2  
ATOM   2180  C CG1  . VAL A 1 56 ? -3.655  7.781   -2.290  1.00 1.00 ? 56  VAL A CG1  2  
ATOM   2181  C CG2  . VAL A 1 56 ? -4.587  6.459   -4.230  1.00 1.00 ? 56  VAL A CG2  2  
ATOM   2182  H H    . VAL A 1 56 ? -5.036  8.425   -6.150  1.00 1.00 ? 56  VAL A H    2  
ATOM   2183  H HA   . VAL A 1 56 ? -5.685  8.991   -3.317  1.00 1.00 ? 56  VAL A HA   2  
ATOM   2184  H HB   . VAL A 1 56 ? -3.034  7.967   -4.336  1.00 1.00 ? 56  VAL A HB   2  
ATOM   2185  H HG11 . VAL A 1 56 ? -3.427  8.783   -1.951  1.00 1.00 ? 56  VAL A HG11 2  
ATOM   2186  H HG12 . VAL A 1 56 ? -2.809  7.140   -2.109  1.00 1.00 ? 56  VAL A HG12 2  
ATOM   2187  H HG13 . VAL A 1 56 ? -4.515  7.407   -1.759  1.00 1.00 ? 56  VAL A HG13 2  
ATOM   2188  H HG21 . VAL A 1 56 ? -4.285  6.237   -5.237  1.00 1.00 ? 56  VAL A HG21 2  
ATOM   2189  H HG22 . VAL A 1 56 ? -5.661  6.528   -4.196  1.00 1.00 ? 56  VAL A HG22 2  
ATOM   2190  H HG23 . VAL A 1 56 ? -4.258  5.661   -3.576  1.00 1.00 ? 56  VAL A HG23 2  
ATOM   2191  N N    . ASP A 1 57 ? -4.444  11.102  -3.094  1.00 1.00 ? 57  ASP A N    2  
ATOM   2192  C CA   . ASP A 1 57 ? -3.780  12.395  -2.979  1.00 1.00 ? 57  ASP A CA   2  
ATOM   2193  C C    . ASP A 1 57 ? -2.424  12.238  -2.299  1.00 1.00 ? 57  ASP A C    2  
ATOM   2194  O O    . ASP A 1 57 ? -2.273  11.449  -1.367  1.00 1.00 ? 57  ASP A O    2  
ATOM   2195  C CB   . ASP A 1 57 ? -4.650  13.361  -2.178  1.00 1.00 ? 57  ASP A CB   2  
ATOM   2196  C CG   . ASP A 1 57 ? -5.880  13.750  -2.991  1.00 1.00 ? 57  ASP A CG   2  
ATOM   2197  O OD1  . ASP A 1 57 ? -5.884  13.490  -4.184  1.00 1.00 ? 57  ASP A OD1  2  
ATOM   2198  O OD2  . ASP A 1 57 ? -6.800  14.304  -2.411  1.00 1.00 ? 57  ASP A OD2  2  
ATOM   2199  H H    . ASP A 1 57 ? -5.095  10.834  -2.413  1.00 1.00 ? 57  ASP A H    2  
ATOM   2200  H HA   . ASP A 1 57 ? -3.630  12.805  -3.968  1.00 1.00 ? 57  ASP A HA   2  
ATOM   2201  H HB2  . ASP A 1 57 ? -4.962  12.883  -1.262  1.00 1.00 ? 57  ASP A HB2  2  
ATOM   2202  H HB3  . ASP A 1 57 ? -4.081  14.247  -1.944  1.00 1.00 ? 57  ASP A HB3  2  
ATOM   2203  N N    . GLU A 1 58 ? -1.446  12.996  -2.769  1.00 1.00 ? 58  GLU A N    2  
ATOM   2204  C CA   . GLU A 1 58 ? -0.104  12.939  -2.199  1.00 1.00 ? 58  GLU A CA   2  
ATOM   2205  C C    . GLU A 1 58 ? -0.146  13.219  -0.704  1.00 1.00 ? 58  GLU A C    2  
ATOM   2206  O O    . GLU A 1 58 ? 0.785   12.876  0.024   1.00 1.00 ? 58  GLU A O    2  
ATOM   2207  C CB   . GLU A 1 58 ? 0.805   13.961  -2.886  1.00 1.00 ? 58  GLU A CB   2  
ATOM   2208  C CG   . GLU A 1 58 ? 1.077   13.520  -4.325  1.00 1.00 ? 58  GLU A CG   2  
ATOM   2209  C CD   . GLU A 1 58 ? 1.916   14.573  -5.043  1.00 1.00 ? 58  GLU A CD   2  
ATOM   2210  O OE1  . GLU A 1 58 ? 2.216   15.584  -4.430  1.00 1.00 ? 58  GLU A OE1  2  
ATOM   2211  O OE2  . GLU A 1 58 ? 2.248   14.349  -6.196  1.00 1.00 ? 58  GLU A OE2  2  
ATOM   2212  H H    . GLU A 1 58 ? -1.628  13.605  -3.512  1.00 1.00 ? 58  GLU A H    2  
ATOM   2213  H HA   . GLU A 1 58 ? 0.303   11.952  -2.356  1.00 1.00 ? 58  GLU A HA   2  
ATOM   2214  H HB2  . GLU A 1 58 ? 0.319   14.927  -2.890  1.00 1.00 ? 58  GLU A HB2  2  
ATOM   2215  H HB3  . GLU A 1 58 ? 1.740   14.031  -2.350  1.00 1.00 ? 58  GLU A HB3  2  
ATOM   2216  H HG2  . GLU A 1 58 ? 1.610   12.582  -4.316  1.00 1.00 ? 58  GLU A HG2  2  
ATOM   2217  H HG3  . GLU A 1 58 ? 0.137   13.397  -4.844  1.00 1.00 ? 58  GLU A HG3  2  
ATOM   2218  N N    . ASP A 1 59 ? -1.226  13.846  -0.252  1.00 1.00 ? 59  ASP A N    2  
ATOM   2219  C CA   . ASP A 1 59 ? -1.377  14.168  1.164   1.00 1.00 ? 59  ASP A CA   2  
ATOM   2220  C C    . ASP A 1 59 ? -2.025  13.016  1.913   1.00 1.00 ? 59  ASP A C    2  
ATOM   2221  O O    . ASP A 1 59 ? -1.879  12.886  3.128   1.00 1.00 ? 59  ASP A O    2  
ATOM   2222  C CB   . ASP A 1 59 ? -2.233  15.427  1.321   1.00 1.00 ? 59  ASP A CB   2  
ATOM   2223  C CG   . ASP A 1 59 ? -1.465  16.647  0.818   1.00 1.00 ? 59  ASP A CG   2  
ATOM   2224  O OD1  . ASP A 1 59 ? -0.285  16.507  0.540   1.00 1.00 ? 59  ASP A OD1  2  
ATOM   2225  O OD2  . ASP A 1 59 ? -2.067  17.703  0.723   1.00 1.00 ? 59  ASP A OD2  2  
ATOM   2226  H H    . ASP A 1 59 ? -1.935  14.093  -0.881  1.00 1.00 ? 59  ASP A H    2  
ATOM   2227  H HA   . ASP A 1 59 ? -0.410  14.348  1.591   1.00 1.00 ? 59  ASP A HA   2  
ATOM   2228  H HB2  . ASP A 1 59 ? -3.141  15.315  0.747   1.00 1.00 ? 59  ASP A HB2  2  
ATOM   2229  H HB3  . ASP A 1 59 ? -2.480  15.563  2.361   1.00 1.00 ? 59  ASP A HB3  2  
ATOM   2230  N N    . LYS A 1 60 ? -2.743  12.183  1.180   1.00 1.00 ? 60  LYS A N    2  
ATOM   2231  C CA   . LYS A 1 60 ? -3.416  11.045  1.784   1.00 1.00 ? 60  LYS A CA   2  
ATOM   2232  C C    . LYS A 1 60 ? -2.432  9.924   2.056   1.00 1.00 ? 60  LYS A C    2  
ATOM   2233  O O    . LYS A 1 60 ? -2.485  9.283   3.099   1.00 1.00 ? 60  LYS A O    2  
ATOM   2234  C CB   . LYS A 1 60 ? -4.537  10.536  0.865   1.00 1.00 ? 60  LYS A CB   2  
ATOM   2235  C CG   . LYS A 1 60 ? -5.321  9.402   1.550   1.00 1.00 ? 60  LYS A CG   2  
ATOM   2236  C CD   . LYS A 1 60 ? -6.137  9.959   2.731   1.00 1.00 ? 60  LYS A CD   2  
ATOM   2237  C CE   . LYS A 1 60 ? -7.223  8.968   3.114   1.00 1.00 ? 60  LYS A CE   2  
ATOM   2238  N NZ   . LYS A 1 60 ? -8.043  9.543   4.215   1.00 1.00 ? 60  LYS A NZ   2  
ATOM   2239  H H    . LYS A 1 60 ? -2.812  12.333  0.219   1.00 1.00 ? 60  LYS A H    2  
ATOM   2240  H HA   . LYS A 1 60 ? -3.846  11.357  2.715   1.00 1.00 ? 60  LYS A HA   2  
ATOM   2241  H HB2  . LYS A 1 60 ? -5.207  11.352  0.639   1.00 1.00 ? 60  LYS A HB2  2  
ATOM   2242  H HB3  . LYS A 1 60 ? -4.107  10.167  -0.054  1.00 1.00 ? 60  LYS A HB3  2  
ATOM   2243  H HG2  . LYS A 1 60 ? -5.989  8.946   0.831   1.00 1.00 ? 60  LYS A HG2  2  
ATOM   2244  H HG3  . LYS A 1 60 ? -4.637  8.651   1.917   1.00 1.00 ? 60  LYS A HG3  2  
ATOM   2245  H HD2  . LYS A 1 60 ? -5.492  10.104  3.583   1.00 1.00 ? 60  LYS A HD2  2  
ATOM   2246  H HD3  . LYS A 1 60 ? -6.591  10.898  2.455   1.00 1.00 ? 60  LYS A HD3  2  
ATOM   2247  H HE2  . LYS A 1 60 ? -7.848  8.770   2.258   1.00 1.00 ? 60  LYS A HE2  2  
ATOM   2248  H HE3  . LYS A 1 60 ? -6.764  8.051   3.450   1.00 1.00 ? 60  LYS A HE3  2  
ATOM   2249  H HZ1  . LYS A 1 60 ? -9.031  9.246   4.099   1.00 1.00 ? 60  LYS A HZ1  2  
ATOM   2250  H HZ2  . LYS A 1 60 ? -7.986  10.583  4.181   1.00 1.00 ? 60  LYS A HZ2  2  
ATOM   2251  H HZ3  . LYS A 1 60 ? -7.683  9.205   5.128   1.00 1.00 ? 60  LYS A HZ3  2  
ATOM   2252  N N    . ALA A 1 61 ? -1.541  9.692   1.110   1.00 1.00 ? 61  ALA A N    2  
ATOM   2253  C CA   . ALA A 1 61 ? -0.541  8.629   1.244   1.00 1.00 ? 61  ALA A CA   2  
ATOM   2254  C C    . ALA A 1 61 ? 0.722   9.179   1.886   1.00 1.00 ? 61  ALA A C    2  
ATOM   2255  O O    . ALA A 1 61 ? 1.818   8.687   1.627   1.00 1.00 ? 61  ALA A O    2  
ATOM   2256  C CB   . ALA A 1 61 ? -0.210  8.047   -0.130  1.00 1.00 ? 61  ALA A CB   2  
ATOM   2257  H H    . ALA A 1 61 ? -1.549  10.253  0.302   1.00 1.00 ? 61  ALA A H    2  
ATOM   2258  H HA   . ALA A 1 61 ? -0.940  7.835   1.866   1.00 1.00 ? 61  ALA A HA   2  
ATOM   2259  H HB1  . ALA A 1 61 ? 0.703   7.473   -0.069  1.00 1.00 ? 61  ALA A HB1  2  
ATOM   2260  H HB2  . ALA A 1 61 ? -0.079  8.855   -0.836  1.00 1.00 ? 61  ALA A HB2  2  
ATOM   2261  H HB3  . ALA A 1 61 ? -1.017  7.411   -0.457  1.00 1.00 ? 61  ALA A HB3  2  
ATOM   2262  N N    . GLN A 1 62 ? 0.562   10.206  2.706   1.00 1.00 ? 62  GLN A N    2  
ATOM   2263  C CA   . GLN A 1 62 ? 1.703   10.819  3.361   1.00 1.00 ? 62  GLN A CA   2  
ATOM   2264  C C    . GLN A 1 62 ? 2.301   9.900   4.403   1.00 1.00 ? 62  GLN A C    2  
ATOM   2265  O O    . GLN A 1 62 ? 3.407   9.393   4.232   1.00 1.00 ? 62  GLN A O    2  
ATOM   2266  C CB   . GLN A 1 62 ? 1.265   12.147  4.028   1.00 1.00 ? 62  GLN A CB   2  
ATOM   2267  C CG   . GLN A 1 62 ? 1.836   13.313  3.259   1.00 1.00 ? 62  GLN A CG   2  
ATOM   2268  C CD   . GLN A 1 62 ? 1.355   14.636  3.855   1.00 1.00 ? 62  GLN A CD   2  
ATOM   2269  O OE1  . GLN A 1 62 ? 0.150   14.879  3.941   1.00 1.00 ? 62  GLN A OE1  2  
ATOM   2270  N NE2  . GLN A 1 62 ? 2.229   15.517  4.269   1.00 1.00 ? 62  GLN A NE2  2  
ATOM   2271  H H    . GLN A 1 62 ? -0.335  10.567  2.863   1.00 1.00 ? 62  GLN A H    2  
ATOM   2272  H HA   . GLN A 1 62 ? 2.457   11.013  2.610   1.00 1.00 ? 62  GLN A HA   2  
ATOM   2273  H HB2  . GLN A 1 62 ? 0.193   12.213  4.015   1.00 1.00 ? 62  GLN A HB2  2  
ATOM   2274  H HB3  . GLN A 1 62 ? 1.616   12.198  5.049   1.00 1.00 ? 62  GLN A HB3  2  
ATOM   2275  H HG2  . GLN A 1 62 ? 2.907   13.249  3.324   1.00 1.00 ? 62  GLN A HG2  2  
ATOM   2276  H HG3  . GLN A 1 62 ? 1.519   13.230  2.233   1.00 1.00 ? 62  GLN A HG3  2  
ATOM   2277  H HE21 . GLN A 1 62 ? 3.187   15.335  4.196   1.00 1.00 ? 62  GLN A HE21 2  
ATOM   2278  H HE22 . GLN A 1 62 ? 1.922   16.369  4.655   1.00 1.00 ? 62  GLN A HE22 2  
ATOM   2279  N N    . ASP A 1 63 ? 1.580   9.723   5.498   1.00 1.00 ? 63  ASP A N    2  
ATOM   2280  C CA   . ASP A 1 63 ? 2.060   8.888   6.598   1.00 1.00 ? 63  ASP A CA   2  
ATOM   2281  C C    . ASP A 1 63 ? 1.051   7.803   6.944   1.00 1.00 ? 63  ASP A C    2  
ATOM   2282  O O    . ASP A 1 63 ? 0.360   7.881   7.957   1.00 1.00 ? 63  ASP A O    2  
ATOM   2283  C CB   . ASP A 1 63 ? 2.316   9.752   7.823   1.00 1.00 ? 63  ASP A CB   2  
ATOM   2284  C CG   . ASP A 1 63 ? 3.027   8.929   8.904   1.00 1.00 ? 63  ASP A CG   2  
ATOM   2285  O OD1  . ASP A 1 63 ? 2.885   7.713   8.882   1.00 1.00 ? 63  ASP A OD1  2  
ATOM   2286  O OD2  . ASP A 1 63 ? 3.692   9.518   9.736   1.00 1.00 ? 63  ASP A OD2  2  
ATOM   2287  H H    . ASP A 1 63 ? 0.719   10.176  5.580   1.00 1.00 ? 63  ASP A H    2  
ATOM   2288  H HA   . ASP A 1 63 ? 2.989   8.424   6.307   1.00 1.00 ? 63  ASP A HA   2  
ATOM   2289  H HB2  . ASP A 1 63 ? 2.930   10.597  7.537   1.00 1.00 ? 63  ASP A HB2  2  
ATOM   2290  H HB3  . ASP A 1 63 ? 1.372   10.113  8.208   1.00 1.00 ? 63  ASP A HB3  2  
ATOM   2291  N N    . ILE A 1 64 ? 0.976   6.792   6.095   1.00 1.00 ? 64  ILE A N    2  
ATOM   2292  C CA   . ILE A 1 64 ? 0.051   5.679   6.311   1.00 1.00 ? 64  ILE A CA   2  
ATOM   2293  C C    . ILE A 1 64 ? 0.711   4.582   7.135   1.00 1.00 ? 64  ILE A C    2  
ATOM   2294  O O    . ILE A 1 64 ? 1.845   4.189   6.870   1.00 1.00 ? 64  ILE A O    2  
ATOM   2295  C CB   . ILE A 1 64 ? -0.410  5.104   4.969   1.00 1.00 ? 64  ILE A CB   2  
ATOM   2296  C CG1  . ILE A 1 64 ? -1.024  6.231   4.119   1.00 1.00 ? 64  ILE A CG1  2  
ATOM   2297  C CG2  . ILE A 1 64 ? -1.462  3.980   5.206   1.00 1.00 ? 64  ILE A CG2  2  
ATOM   2298  C CD1  . ILE A 1 64 ? -2.199  6.890   4.857   1.00 1.00 ? 64  ILE A CD1  2  
ATOM   2299  H H    . ILE A 1 64 ? 1.557   6.788   5.305   1.00 1.00 ? 64  ILE A H    2  
ATOM   2300  H HA   . ILE A 1 64 ? -0.812  6.032   6.853   1.00 1.00 ? 64  ILE A HA   2  
ATOM   2301  H HB   . ILE A 1 64 ? 0.451   4.701   4.446   1.00 1.00 ? 64  ILE A HB   2  
ATOM   2302  H HG12 . ILE A 1 64 ? -0.268  6.977   3.915   1.00 1.00 ? 64  ILE A HG12 2  
ATOM   2303  H HG13 . ILE A 1 64 ? -1.376  5.817   3.188   1.00 1.00 ? 64  ILE A HG13 2  
ATOM   2304  H HG21 . ILE A 1 64 ? -1.656  3.865   6.267   1.00 1.00 ? 64  ILE A HG21 2  
ATOM   2305  H HG22 . ILE A 1 64 ? -1.097  3.051   4.812   1.00 1.00 ? 64  ILE A HG22 2  
ATOM   2306  H HG23 . ILE A 1 64 ? -2.388  4.241   4.708   1.00 1.00 ? 64  ILE A HG23 2  
ATOM   2307  H HD11 . ILE A 1 64 ? -1.826  7.692   5.475   1.00 1.00 ? 64  ILE A HD11 2  
ATOM   2308  H HD12 . ILE A 1 64 ? -2.708  6.161   5.481   1.00 1.00 ? 64  ILE A HD12 2  
ATOM   2309  H HD13 . ILE A 1 64 ? -2.892  7.286   4.138   1.00 1.00 ? 64  ILE A HD13 2  
ATOM   2310  N N    . SER A 1 65 ? -0.016  4.101   8.137   1.00 1.00 ? 65  SER A N    2  
ATOM   2311  C CA   . SER A 1 65 ? 0.493   3.043   9.002   1.00 1.00 ? 65  SER A CA   2  
ATOM   2312  C C    . SER A 1 65 ? 0.713   1.779   8.197   1.00 1.00 ? 65  SER A C    2  
ATOM   2313  O O    . SER A 1 65 ? 0.661   1.811   6.976   1.00 1.00 ? 65  SER A O    2  
ATOM   2314  C CB   . SER A 1 65 ? -0.492  2.762   10.151  1.00 1.00 ? 65  SER A CB   2  
ATOM   2315  O OG   . SER A 1 65 ? -1.131  1.510   9.941   1.00 1.00 ? 65  SER A OG   2  
ATOM   2316  H H    . SER A 1 65 ? -0.917  4.461   8.288   1.00 1.00 ? 65  SER A H    2  
ATOM   2317  H HA   . SER A 1 65 ? 1.441   3.354   9.409   1.00 1.00 ? 65  SER A HA   2  
ATOM   2318  H HB2  . SER A 1 65 ? 0.031   2.734   11.095  1.00 1.00 ? 65  SER A HB2  2  
ATOM   2319  H HB3  . SER A 1 65 ? -1.231  3.548   10.177  1.00 1.00 ? 65  SER A HB3  2  
ATOM   2320  H HG   . SER A 1 65 ? -0.807  0.894   10.602  1.00 1.00 ? 65  SER A HG   2  
ATOM   2321  N N    . THR A 1 66 ? 0.983   0.677   8.896   1.00 1.00 ? 66  THR A N    2  
ATOM   2322  C CA   . THR A 1 66 ? 1.223   -0.602  8.242   1.00 1.00 ? 66  THR A CA   2  
ATOM   2323  C C    . THR A 1 66 ? 0.210   -0.855  7.119   1.00 1.00 ? 66  THR A C    2  
ATOM   2324  O O    . THR A 1 66 ? -0.597  0.005   6.769   1.00 1.00 ? 66  THR A O    2  
ATOM   2325  C CB   . THR A 1 66 ? 1.157   -1.737  9.279   1.00 1.00 ? 66  THR A CB   2  
ATOM   2326  O OG1  . THR A 1 66 ? 1.822   -2.884  8.762   1.00 1.00 ? 66  THR A OG1  2  
ATOM   2327  C CG2  . THR A 1 66 ? -0.292  -2.103  9.574   1.00 1.00 ? 66  THR A CG2  2  
ATOM   2328  H H    . THR A 1 66 ? 1.018   0.727   9.873   1.00 1.00 ? 66  THR A H    2  
ATOM   2329  H HA   . THR A 1 66 ? 2.213   -0.586  7.818   1.00 1.00 ? 66  THR A HA   2  
ATOM   2330  H HB   . THR A 1 66 ? 1.636   -1.422  10.192  1.00 1.00 ? 66  THR A HB   2  
ATOM   2331  H HG1  . THR A 1 66 ? 1.806   -3.570  9.438   1.00 1.00 ? 66  THR A HG1  2  
ATOM   2332  H HG21 . THR A 1 66 ? -0.927  -1.227  9.470   1.00 1.00 ? 66  THR A HG21 2  
ATOM   2333  H HG22 . THR A 1 66 ? -0.371  -2.500  10.575  1.00 1.00 ? 66  THR A HG22 2  
ATOM   2334  H HG23 . THR A 1 66 ? -0.598  -2.850  8.869   1.00 1.00 ? 66  THR A HG23 2  
ATOM   2335  N N    . ILE A 1 67 ? 0.257   -2.047  6.548   1.00 1.00 ? 67  ILE A N    2  
ATOM   2336  C CA   . ILE A 1 67 ? -0.645  -2.384  5.459   1.00 1.00 ? 67  ILE A CA   2  
ATOM   2337  C C    . ILE A 1 67 ? -2.099  -2.282  5.910   1.00 1.00 ? 67  ILE A C    2  
ATOM   2338  O O    . ILE A 1 67 ? -2.947  -1.765  5.185   1.00 1.00 ? 67  ILE A O    2  
ATOM   2339  C CB   . ILE A 1 67 ? -0.362  -3.807  4.969   1.00 1.00 ? 67  ILE A CB   2  
ATOM   2340  C CG1  . ILE A 1 67 ? 1.041   -3.853  4.356   1.00 1.00 ? 67  ILE A CG1  2  
ATOM   2341  C CG2  . ILE A 1 67 ? -1.388  -4.186  3.899   1.00 1.00 ? 67  ILE A CG2  2  
ATOM   2342  C CD1  . ILE A 1 67 ? 1.482   -5.311  4.207   1.00 1.00 ? 67  ILE A CD1  2  
ATOM   2343  H H    . ILE A 1 67 ? 0.918   -2.701  6.851   1.00 1.00 ? 67  ILE A H    2  
ATOM   2344  H HA   . ILE A 1 67 ? -0.478  -1.693  4.649   1.00 1.00 ? 67  ILE A HA   2  
ATOM   2345  H HB   . ILE A 1 67 ? -0.429  -4.506  5.796   1.00 1.00 ? 67  ILE A HB   2  
ATOM   2346  H HG12 . ILE A 1 67 ? 1.026   -3.376  3.387   1.00 1.00 ? 67  ILE A HG12 2  
ATOM   2347  H HG13 . ILE A 1 67 ? 1.734   -3.333  5.002   1.00 1.00 ? 67  ILE A HG13 2  
ATOM   2348  H HG21 . ILE A 1 67 ? -1.068  -5.085  3.399   1.00 1.00 ? 67  ILE A HG21 2  
ATOM   2349  H HG22 . ILE A 1 67 ? -1.471  -3.383  3.179   1.00 1.00 ? 67  ILE A HG22 2  
ATOM   2350  H HG23 . ILE A 1 67 ? -2.350  -4.351  4.361   1.00 1.00 ? 67  ILE A HG23 2  
ATOM   2351  H HD11 . ILE A 1 67 ? 1.760   -5.700  5.177   1.00 1.00 ? 67  ILE A HD11 2  
ATOM   2352  H HD12 . ILE A 1 67 ? 2.330   -5.365  3.541   1.00 1.00 ? 67  ILE A HD12 2  
ATOM   2353  H HD13 . ILE A 1 67 ? 0.668   -5.893  3.807   1.00 1.00 ? 67  ILE A HD13 2  
ATOM   2354  N N    . GLN A 1 68 ? -2.385  -2.785  7.103   1.00 1.00 ? 68  GLN A N    2  
ATOM   2355  C CA   . GLN A 1 68 ? -3.749  -2.747  7.630   1.00 1.00 ? 68  GLN A CA   2  
ATOM   2356  C C    . GLN A 1 68 ? -4.406  -1.402  7.327   1.00 1.00 ? 68  GLN A C    2  
ATOM   2357  O O    . GLN A 1 68 ? -5.477  -1.352  6.719   1.00 1.00 ? 68  GLN A O    2  
ATOM   2358  C CB   . GLN A 1 68 ? -3.719  -2.986  9.156   1.00 1.00 ? 68  GLN A CB   2  
ATOM   2359  C CG   . GLN A 1 68 ? -3.760  -4.479  9.464   1.00 1.00 ? 68  GLN A CG   2  
ATOM   2360  C CD   . GLN A 1 68 ? -5.190  -4.994  9.264   1.00 1.00 ? 68  GLN A CD   2  
ATOM   2361  O OE1  . GLN A 1 68 ? -6.150  -4.285  9.565   1.00 1.00 ? 68  GLN A OE1  2  
ATOM   2362  N NE2  . GLN A 1 68 ? -5.390  -6.182  8.774   1.00 1.00 ? 68  GLN A NE2  2  
ATOM   2363  H H    . GLN A 1 68 ? -1.674  -3.190  7.635   1.00 1.00 ? 68  GLN A H    2  
ATOM   2364  H HA   . GLN A 1 68 ? -4.327  -3.529  7.156   1.00 1.00 ? 68  GLN A HA   2  
ATOM   2365  H HB2  . GLN A 1 68 ? -2.818  -2.566  9.563   1.00 1.00 ? 68  GLN A HB2  2  
ATOM   2366  H HB3  . GLN A 1 68 ? -4.563  -2.514  9.621   1.00 1.00 ? 68  GLN A HB3  2  
ATOM   2367  H HG2  . GLN A 1 68 ? -3.086  -4.992  8.797   1.00 1.00 ? 68  GLN A HG2  2  
ATOM   2368  H HG3  . GLN A 1 68 ? -3.456  -4.646  10.486  1.00 1.00 ? 68  GLN A HG3  2  
ATOM   2369  H HE21 . GLN A 1 68 ? -4.632  -6.743  8.535   1.00 1.00 ? 68  GLN A HE21 2  
ATOM   2370  H HE22 . GLN A 1 68 ? -6.304  -6.512  8.648   1.00 1.00 ? 68  GLN A HE22 2  
ATOM   2371  N N    . GLN A 1 69 ? -3.765  -0.316  7.750   1.00 1.00 ? 69  GLN A N    2  
ATOM   2372  C CA   . GLN A 1 69 ? -4.308  1.006   7.513   1.00 1.00 ? 69  GLN A CA   2  
ATOM   2373  C C    . GLN A 1 69 ? -4.280  1.335   6.024   1.00 1.00 ? 69  GLN A C    2  
ATOM   2374  O O    . GLN A 1 69 ? -5.230  1.905   5.488   1.00 1.00 ? 69  GLN A O    2  
ATOM   2375  C CB   . GLN A 1 69 ? -3.488  2.045   8.279   1.00 1.00 ? 69  GLN A CB   2  
ATOM   2376  C CG   . GLN A 1 69 ? -4.265  3.343   8.356   1.00 1.00 ? 69  GLN A CG   2  
ATOM   2377  C CD   . GLN A 1 69 ? -3.483  4.381   9.158   1.00 1.00 ? 69  GLN A CD   2  
ATOM   2378  O OE1  . GLN A 1 69 ? -3.436  4.313   10.387  1.00 1.00 ? 69  GLN A OE1  2  
ATOM   2379  N NE2  . GLN A 1 69 ? -2.869  5.350   8.534   1.00 1.00 ? 69  GLN A NE2  2  
ATOM   2380  H H    . GLN A 1 69 ? -2.916  -0.403  8.230   1.00 1.00 ? 69  GLN A H    2  
ATOM   2381  H HA   . GLN A 1 69 ? -5.327  1.030   7.864   1.00 1.00 ? 69  GLN A HA   2  
ATOM   2382  H HB2  . GLN A 1 69 ? -3.303  1.687   9.275   1.00 1.00 ? 69  GLN A HB2  2  
ATOM   2383  H HB3  . GLN A 1 69 ? -2.555  2.217   7.768   1.00 1.00 ? 69  GLN A HB3  2  
ATOM   2384  H HG2  . GLN A 1 69 ? -4.434  3.708   7.359   1.00 1.00 ? 69  GLN A HG2  2  
ATOM   2385  H HG3  . GLN A 1 69 ? -5.205  3.152   8.838   1.00 1.00 ? 69  GLN A HG3  2  
ATOM   2386  H HE21 . GLN A 1 69 ? -2.912  5.410   7.557   1.00 1.00 ? 69  GLN A HE21 2  
ATOM   2387  H HE22 . GLN A 1 69 ? -2.362  6.019   9.043   1.00 1.00 ? 69  GLN A HE22 2  
ATOM   2388  N N    . ALA A 1 70 ? -3.183  0.975   5.362   1.00 1.00 ? 70  ALA A N    2  
ATOM   2389  C CA   . ALA A 1 70 ? -3.043  1.244   3.936   1.00 1.00 ? 70  ALA A CA   2  
ATOM   2390  C C    . ALA A 1 70 ? -4.197  0.616   3.158   1.00 1.00 ? 70  ALA A C    2  
ATOM   2391  O O    . ALA A 1 70 ? -4.788  1.253   2.285   1.00 1.00 ? 70  ALA A O    2  
ATOM   2392  C CB   . ALA A 1 70 ? -1.716  0.674   3.428   1.00 1.00 ? 70  ALA A CB   2  
ATOM   2393  H H    . ALA A 1 70 ? -2.448  0.526   5.844   1.00 1.00 ? 70  ALA A H    2  
ATOM   2394  H HA   . ALA A 1 70 ? -3.055  2.309   3.773   1.00 1.00 ? 70  ALA A HA   2  
ATOM   2395  H HB1  . ALA A 1 70 ? -0.937  0.861   4.153   1.00 1.00 ? 70  ALA A HB1  2  
ATOM   2396  H HB2  . ALA A 1 70 ? -1.455  1.143   2.492   1.00 1.00 ? 70  ALA A HB2  2  
ATOM   2397  H HB3  . ALA A 1 70 ? -1.819  -0.388  3.281   1.00 1.00 ? 70  ALA A HB3  2  
ATOM   2398  N N    . ALA A 1 71 ? -4.509  -0.632  3.479   1.00 1.00 ? 71  ALA A N    2  
ATOM   2399  C CA   . ALA A 1 71 ? -5.592  -1.331  2.801   1.00 1.00 ? 71  ALA A CA   2  
ATOM   2400  C C    . ALA A 1 71 ? -6.923  -0.639  3.059   1.00 1.00 ? 71  ALA A C    2  
ATOM   2401  O O    . ALA A 1 71 ? -7.759  -0.532  2.163   1.00 1.00 ? 71  ALA A O    2  
ATOM   2402  C CB   . ALA A 1 71 ? -5.666  -2.776  3.297   1.00 1.00 ? 71  ALA A CB   2  
ATOM   2403  H H    . ALA A 1 71 ? -4.002  -1.091  4.181   1.00 1.00 ? 71  ALA A H    2  
ATOM   2404  H HA   . ALA A 1 71 ? -5.400  -1.336  1.741   1.00 1.00 ? 71  ALA A HA   2  
ATOM   2405  H HB1  . ALA A 1 71 ? -5.749  -2.783  4.373   1.00 1.00 ? 71  ALA A HB1  2  
ATOM   2406  H HB2  . ALA A 1 71 ? -4.772  -3.301  3.002   1.00 1.00 ? 71  ALA A HB2  2  
ATOM   2407  H HB3  . ALA A 1 71 ? -6.529  -3.264  2.867   1.00 1.00 ? 71  ALA A HB3  2  
ATOM   2408  N N    . ASP A 1 72 ? -7.122  -0.183  4.289   1.00 1.00 ? 72  ASP A N    2  
ATOM   2409  C CA   . ASP A 1 72 ? -8.362  0.491   4.648   1.00 1.00 ? 72  ASP A CA   2  
ATOM   2410  C C    . ASP A 1 72 ? -8.509  1.800   3.875   1.00 1.00 ? 72  ASP A C    2  
ATOM   2411  O O    . ASP A 1 72 ? -9.607  2.161   3.449   1.00 1.00 ? 72  ASP A O    2  
ATOM   2412  C CB   . ASP A 1 72 ? -8.379  0.774   6.161   1.00 1.00 ? 72  ASP A CB   2  
ATOM   2413  C CG   . ASP A 1 72 ? -8.877  -0.450  6.925   1.00 1.00 ? 72  ASP A CG   2  
ATOM   2414  O OD1  . ASP A 1 72 ? -9.861  -1.029  6.493   1.00 1.00 ? 72  ASP A OD1  2  
ATOM   2415  O OD2  . ASP A 1 72 ? -8.270  -0.791  7.925   1.00 1.00 ? 72  ASP A OD2  2  
ATOM   2416  H H    . ASP A 1 72 ? -6.425  -0.304  4.966   1.00 1.00 ? 72  ASP A H    2  
ATOM   2417  H HA   . ASP A 1 72 ? -9.193  -0.157  4.396   1.00 1.00 ? 72  ASP A HA   2  
ATOM   2418  H HB2  . ASP A 1 72 ? -7.378  1.012   6.490   1.00 1.00 ? 72  ASP A HB2  2  
ATOM   2419  H HB3  . ASP A 1 72 ? -9.031  1.613   6.375   1.00 1.00 ? 72  ASP A HB3  2  
ATOM   2420  N N    . VAL A 1 73 ? -7.396  2.504   3.702   1.00 1.00 ? 73  VAL A N    2  
ATOM   2421  C CA   . VAL A 1 73 ? -7.417  3.772   2.982   1.00 1.00 ? 73  VAL A CA   2  
ATOM   2422  C C    . VAL A 1 73 ? -7.878  3.557   1.543   1.00 1.00 ? 73  VAL A C    2  
ATOM   2423  O O    . VAL A 1 73 ? -8.698  4.315   1.019   1.00 1.00 ? 73  VAL A O    2  
ATOM   2424  C CB   . VAL A 1 73 ? -6.022  4.411   2.999   1.00 1.00 ? 73  VAL A CB   2  
ATOM   2425  C CG1  . VAL A 1 73 ? -5.979  5.584   2.013   1.00 1.00 ? 73  VAL A CG1  2  
ATOM   2426  C CG2  . VAL A 1 73 ? -5.709  4.916   4.409   1.00 1.00 ? 73  VAL A CG2  2  
ATOM   2427  H H    . VAL A 1 73 ? -6.546  2.169   4.065   1.00 1.00 ? 73  VAL A H    2  
ATOM   2428  H HA   . VAL A 1 73 ? -8.110  4.440   3.474   1.00 1.00 ? 73  VAL A HA   2  
ATOM   2429  H HB   . VAL A 1 73 ? -5.286  3.674   2.713   1.00 1.00 ? 73  VAL A HB   2  
ATOM   2430  H HG11 . VAL A 1 73 ? -5.900  5.200   1.008   1.00 1.00 ? 73  VAL A HG11 2  
ATOM   2431  H HG12 . VAL A 1 73 ? -5.125  6.210   2.228   1.00 1.00 ? 73  VAL A HG12 2  
ATOM   2432  H HG13 . VAL A 1 73 ? -6.885  6.164   2.105   1.00 1.00 ? 73  VAL A HG13 2  
ATOM   2433  H HG21 . VAL A 1 73 ? -5.974  4.157   5.131   1.00 1.00 ? 73  VAL A HG21 2  
ATOM   2434  H HG22 . VAL A 1 73 ? -6.274  5.815   4.603   1.00 1.00 ? 73  VAL A HG22 2  
ATOM   2435  H HG23 . VAL A 1 73 ? -4.653  5.131   4.485   1.00 1.00 ? 73  VAL A HG23 2  
ATOM   2436  N N    . ILE A 1 74 ? -7.353  2.514   0.912   1.00 1.00 ? 74  ILE A N    2  
ATOM   2437  C CA   . ILE A 1 74 ? -7.720  2.204   -0.467  1.00 1.00 ? 74  ILE A CA   2  
ATOM   2438  C C    . ILE A 1 74 ? -9.203  1.871   -0.565  1.00 1.00 ? 74  ILE A C    2  
ATOM   2439  O O    . ILE A 1 74 ? -9.885  2.317   -1.489  1.00 1.00 ? 74  ILE A O    2  
ATOM   2440  C CB   . ILE A 1 74 ? -6.881  1.027   -0.986  1.00 1.00 ? 74  ILE A CB   2  
ATOM   2441  C CG1  . ILE A 1 74 ? -5.438  1.488   -1.202  1.00 1.00 ? 74  ILE A CG1  2  
ATOM   2442  C CG2  . ILE A 1 74 ? -7.462  0.506   -2.304  1.00 1.00 ? 74  ILE A CG2  2  
ATOM   2443  C CD1  . ILE A 1 74 ? -4.519  0.276   -1.276  1.00 1.00 ? 74  ILE A CD1  2  
ATOM   2444  H H    . ILE A 1 74 ? -6.709  1.944   1.380   1.00 1.00 ? 74  ILE A H    2  
ATOM   2445  H HA   . ILE A 1 74 ? -7.517  3.065   -1.075  1.00 1.00 ? 74  ILE A HA   2  
ATOM   2446  H HB   . ILE A 1 74 ? -6.896  0.234   -0.254  1.00 1.00 ? 74  ILE A HB   2  
ATOM   2447  H HG12 . ILE A 1 74 ? -5.373  2.040   -2.128  1.00 1.00 ? 74  ILE A HG12 2  
ATOM   2448  H HG13 . ILE A 1 74 ? -5.135  2.112   -0.385  1.00 1.00 ? 74  ILE A HG13 2  
ATOM   2449  H HG21 . ILE A 1 74 ? -6.724  -0.085  -2.821  1.00 1.00 ? 74  ILE A HG21 2  
ATOM   2450  H HG22 . ILE A 1 74 ? -7.759  1.336   -2.919  1.00 1.00 ? 74  ILE A HG22 2  
ATOM   2451  H HG23 . ILE A 1 74 ? -8.322  -0.104  -2.086  1.00 1.00 ? 74  ILE A HG23 2  
ATOM   2452  H HD11 . ILE A 1 74 ? -4.633  -0.311  -0.377  1.00 1.00 ? 74  ILE A HD11 2  
ATOM   2453  H HD12 . ILE A 1 74 ? -3.500  0.611   -1.365  1.00 1.00 ? 74  ILE A HD12 2  
ATOM   2454  H HD13 . ILE A 1 74 ? -4.782  -0.325  -2.135  1.00 1.00 ? 74  ILE A HD13 2  
ATOM   2455  N N    . GLU A 1 75 ? -9.694  1.091   0.384   1.00 1.00 ? 75  GLU A N    2  
ATOM   2456  C CA   . GLU A 1 75 ? -11.097 0.705   0.385   1.00 1.00 ? 75  GLU A CA   2  
ATOM   2457  C C    . GLU A 1 75 ? -11.993 1.929   0.244   1.00 1.00 ? 75  GLU A C    2  
ATOM   2458  O O    . GLU A 1 75 ? -12.983 1.902   -0.487  1.00 1.00 ? 75  GLU A O    2  
ATOM   2459  C CB   . GLU A 1 75 ? -11.434 -0.041  1.680   1.00 1.00 ? 75  GLU A CB   2  
ATOM   2460  C CG   . GLU A 1 75 ? -10.881 -1.462  1.615   1.00 1.00 ? 75  GLU A CG   2  
ATOM   2461  C CD   . GLU A 1 75 ? -11.203 -2.196  2.907   1.00 1.00 ? 75  GLU A CD   2  
ATOM   2462  O OE1  . GLU A 1 75 ? -11.721 -1.566  3.815   1.00 1.00 ? 75  GLU A OE1  2  
ATOM   2463  O OE2  . GLU A 1 75 ? -10.923 -3.375  2.969   1.00 1.00 ? 75  GLU A OE2  2  
ATOM   2464  H H    . GLU A 1 75 ? -9.104  0.765   1.094   1.00 1.00 ? 75  GLU A H    2  
ATOM   2465  H HA   . GLU A 1 75 ? -11.277 0.051   -0.449  1.00 1.00 ? 75  GLU A HA   2  
ATOM   2466  H HB2  . GLU A 1 75 ? -10.986 0.474   2.518   1.00 1.00 ? 75  GLU A HB2  2  
ATOM   2467  H HB3  . GLU A 1 75 ? -12.504 -0.080  1.813   1.00 1.00 ? 75  GLU A HB3  2  
ATOM   2468  H HG2  . GLU A 1 75 ? -11.330 -1.985  0.783   1.00 1.00 ? 75  GLU A HG2  2  
ATOM   2469  H HG3  . GLU A 1 75 ? -9.812  -1.428  1.482   1.00 1.00 ? 75  GLU A HG3  2  
ATOM   2470  N N    . GLY A 1 76 ? -11.638 2.997   0.942   1.00 1.00 ? 76  GLY A N    2  
ATOM   2471  C CA   . GLY A 1 76 ? -12.415 4.227   0.881   1.00 1.00 ? 76  GLY A CA   2  
ATOM   2472  C C    . GLY A 1 76 ? -12.223 4.932   -0.457  1.00 1.00 ? 76  GLY A C    2  
ATOM   2473  O O    . GLY A 1 76 ? -13.081 5.696   -0.893  1.00 1.00 ? 76  GLY A O    2  
ATOM   2474  H H    . GLY A 1 76 ? -10.835 2.961   1.501   1.00 1.00 ? 76  GLY A H    2  
ATOM   2475  H HA2  . GLY A 1 76 ? -13.461 3.986   1.008   1.00 1.00 ? 76  GLY A HA2  2  
ATOM   2476  H HA3  . GLY A 1 76 ? -12.102 4.886   1.676   1.00 1.00 ? 76  GLY A HA3  2  
ATOM   2477  N N    . LEU A 1 77 ? -11.082 4.677   -1.097  1.00 1.00 ? 77  LEU A N    2  
ATOM   2478  C CA   . LEU A 1 77 ? -10.776 5.298   -2.385  1.00 1.00 ? 77  LEU A CA   2  
ATOM   2479  C C    . LEU A 1 77 ? -11.309 4.462   -3.527  1.00 1.00 ? 77  LEU A C    2  
ATOM   2480  O O    . LEU A 1 77 ? -11.161 4.831   -4.687  1.00 1.00 ? 77  LEU A O    2  
ATOM   2481  C CB   . LEU A 1 77 ? -9.266  5.465   -2.531  1.00 1.00 ? 77  LEU A CB   2  
ATOM   2482  C CG   . LEU A 1 77 ? -8.773  6.522   -1.518  1.00 1.00 ? 77  LEU A CG   2  
ATOM   2483  C CD1  . LEU A 1 77 ? -7.270  6.356   -1.292  1.00 1.00 ? 77  LEU A CD1  2  
ATOM   2484  C CD2  . LEU A 1 77 ? -9.043  7.941   -2.054  1.00 1.00 ? 77  LEU A CD2  2  
ATOM   2485  H H    . LEU A 1 77 ? -10.433 4.064   -0.692  1.00 1.00 ? 77  LEU A H    2  
ATOM   2486  H HA   . LEU A 1 77 ? -11.242 6.265   -2.433  1.00 1.00 ? 77  LEU A HA   2  
ATOM   2487  H HB2  . LEU A 1 77 ? -8.790  4.517   -2.341  1.00 1.00 ? 77  LEU A HB2  2  
ATOM   2488  H HB3  . LEU A 1 77 ? -9.033  5.789   -3.540  1.00 1.00 ? 77  LEU A HB3  2  
ATOM   2489  H HG   . LEU A 1 77 ? -9.289  6.389   -0.576  1.00 1.00 ? 77  LEU A HG   2  
ATOM   2490  H HD11 . LEU A 1 77 ? -6.947  7.018   -0.500  1.00 1.00 ? 77  LEU A HD11 2  
ATOM   2491  H HD12 . LEU A 1 77 ? -6.743  6.598   -2.195  1.00 1.00 ? 77  LEU A HD12 2  
ATOM   2492  H HD13 . LEU A 1 77 ? -7.056  5.336   -1.013  1.00 1.00 ? 77  LEU A HD13 2  
ATOM   2493  H HD21 . LEU A 1 77 ? -8.467  8.656   -1.482  1.00 1.00 ? 77  LEU A HD21 2  
ATOM   2494  H HD22 . LEU A 1 77 ? -10.091 8.176   -1.960  1.00 1.00 ? 77  LEU A HD22 2  
ATOM   2495  H HD23 . LEU A 1 77 ? -8.752  8.003   -3.092  1.00 1.00 ? 77  LEU A HD23 2  
ATOM   2496  N N    . LEU A 1 78 ? -11.928 3.336   -3.190  1.00 1.00 ? 78  LEU A N    2  
ATOM   2497  C CA   . LEU A 1 78 ? -12.511 2.452   -4.200  1.00 1.00 ? 78  LEU A CA   2  
ATOM   2498  C C    . LEU A 1 78 ? -14.000 2.708   -4.353  1.00 1.00 ? 78  LEU A C    2  
ATOM   2499  O O    . LEU A 1 78 ? -14.642 2.139   -5.226  1.00 1.00 ? 78  LEU A O    2  
ATOM   2500  C CB   . LEU A 1 78 ? -12.267 0.992   -3.819  1.00 1.00 ? 78  LEU A CB   2  
ATOM   2501  C CG   . LEU A 1 78 ? -10.873 0.546   -4.280  1.00 1.00 ? 78  LEU A CG   2  
ATOM   2502  C CD1  . LEU A 1 78 ? -10.495 -0.762  -3.582  1.00 1.00 ? 78  LEU A CD1  2  
ATOM   2503  C CD2  . LEU A 1 78 ? -10.862 0.325   -5.805  1.00 1.00 ? 78  LEU A CD2  2  
ATOM   2504  H H    . LEU A 1 78 ? -12.010 3.101   -2.245  1.00 1.00 ? 78  LEU A H    2  
ATOM   2505  H HA   . LEU A 1 78 ? -12.045 2.653   -5.150  1.00 1.00 ? 78  LEU A HA   2  
ATOM   2506  H HB2  . LEU A 1 78 ? -12.326 0.906   -2.747  1.00 1.00 ? 78  LEU A HB2  2  
ATOM   2507  H HB3  . LEU A 1 78 ? -13.015 0.365   -4.271  1.00 1.00 ? 78  LEU A HB3  2  
ATOM   2508  H HG   . LEU A 1 78 ? -10.152 1.303   -4.016  1.00 1.00 ? 78  LEU A HG   2  
ATOM   2509  H HD11 . LEU A 1 78 ? -9.491  -1.040  -3.866  1.00 1.00 ? 78  LEU A HD11 2  
ATOM   2510  H HD12 . LEU A 1 78 ? -11.180 -1.540  -3.881  1.00 1.00 ? 78  LEU A HD12 2  
ATOM   2511  H HD13 . LEU A 1 78 ? -10.544 -0.631  -2.515  1.00 1.00 ? 78  LEU A HD13 2  
ATOM   2512  H HD21 . LEU A 1 78 ? -10.038 -0.318  -6.068  1.00 1.00 ? 78  LEU A HD21 2  
ATOM   2513  H HD22 . LEU A 1 78 ? -10.747 1.263   -6.313  1.00 1.00 ? 78  LEU A HD22 2  
ATOM   2514  H HD23 . LEU A 1 78 ? -11.785 -0.141  -6.120  1.00 1.00 ? 78  LEU A HD23 2  
ATOM   2515  N N    . GLU A 1 79 ? -14.546 3.542   -3.478  1.00 1.00 ? 79  GLU A N    2  
ATOM   2516  C CA   . GLU A 1 79 ? -15.964 3.865   -3.509  1.00 1.00 ? 79  GLU A CA   2  
ATOM   2517  C C    . GLU A 1 79 ? -16.215 5.260   -4.003  1.00 1.00 ? 79  GLU A C    2  
ATOM   2518  O O    . GLU A 1 79 ? -17.361 5.630   -4.223  1.00 1.00 ? 79  GLU A O    2  
ATOM   2519  C CB   . GLU A 1 79 ? -16.543 3.733   -2.123  1.00 1.00 ? 79  GLU A CB   2  
ATOM   2520  C CG   . GLU A 1 79 ? -16.143 2.384   -1.538  1.00 1.00 ? 79  GLU A CG   2  
ATOM   2521  C CD   . GLU A 1 79 ? -16.695 2.230   -0.111  1.00 1.00 ? 79  GLU A CD   2  
ATOM   2522  O OE1  . GLU A 1 79 ? -17.388 3.128   0.336   1.00 1.00 ? 79  GLU A OE1  2  
ATOM   2523  O OE2  . GLU A 1 79 ? -16.420 1.213   0.515   1.00 1.00 ? 79  GLU A OE2  2  
ATOM   2524  H H    . GLU A 1 79 ? -13.985 3.939   -2.800  1.00 1.00 ? 79  GLU A H    2  
ATOM   2525  H HA   . GLU A 1 79 ? -16.470 3.201   -4.171  1.00 1.00 ? 79  GLU A HA   2  
ATOM   2526  H HB2  . GLU A 1 79 ? -16.162 4.534   -1.512  1.00 1.00 ? 79  GLU A HB2  2  
ATOM   2527  H HB3  . GLU A 1 79 ? -17.613 3.794   -2.188  1.00 1.00 ? 79  GLU A HB3  2  
ATOM   2528  H HG2  . GLU A 1 79 ? -16.529 1.604   -2.168  1.00 1.00 ? 79  GLU A HG2  2  
ATOM   2529  H HG3  . GLU A 1 79 ? -15.066 2.317   -1.518  1.00 1.00 ? 79  GLU A HG3  2  
ATOM   2530  N N    . LYS A 1 80 ? -15.146 6.015   -4.163  1.00 1.00 ? 80  LYS A N    2  
ATOM   2531  C CA   . LYS A 1 80 ? -15.231 7.399   -4.650  1.00 1.00 ? 80  LYS A CA   2  
ATOM   2532  C C    . LYS A 1 80 ? -16.402 7.556   -5.613  1.00 1.00 ? 80  LYS A C    2  
ATOM   2533  O O    . LYS A 1 80 ? -17.023 8.623   -5.716  1.00 1.00 ? 80  LYS A O    2  
ATOM   2534  C CB   . LYS A 1 80 ? -13.928 7.782   -5.366  1.00 1.00 ? 80  LYS A CB   2  
ATOM   2535  C CG   . LYS A 1 80 ? -13.744 6.924   -6.636  1.00 1.00 ? 80  LYS A CG   2  
ATOM   2536  C CD   . LYS A 1 80 ? -13.305 5.476   -6.272  1.00 1.00 ? 80  LYS A CD   2  
ATOM   2537  C CE   . LYS A 1 80 ? -14.286 4.429   -6.797  1.00 1.00 ? 80  LYS A CE   2  
ATOM   2538  N NZ   . LYS A 1 80 ? -13.548 3.176   -7.055  1.00 1.00 ? 80  LYS A NZ   2  
ATOM   2539  H H    . LYS A 1 80 ? -14.275 5.632   -3.951  1.00 1.00 ? 80  LYS A H    2  
ATOM   2540  H HA   . LYS A 1 80 ? -15.376 8.057   -3.812  1.00 1.00 ? 80  LYS A HA   2  
ATOM   2541  H HB2  . LYS A 1 80 ? -13.958 8.836   -5.649  1.00 1.00 ? 80  LYS A HB2  2  
ATOM   2542  H HB3  . LYS A 1 80 ? -13.104 7.613   -4.697  1.00 1.00 ? 80  LYS A HB3  2  
ATOM   2543  H HG2  . LYS A 1 80 ? -14.648 6.920   -7.213  1.00 1.00 ? 80  LYS A HG2  2  
ATOM   2544  H HG3  . LYS A 1 80 ? -12.987 7.365   -7.225  1.00 1.00 ? 80  LYS A HG3  2  
ATOM   2545  H HD2  . LYS A 1 80 ? -12.338 5.280   -6.705  1.00 1.00 ? 80  LYS A HD2  2  
ATOM   2546  H HD3  . LYS A 1 80 ? -13.237 5.372   -5.215  1.00 1.00 ? 80  LYS A HD3  2  
ATOM   2547  H HE2  . LYS A 1 80 ? -15.058 4.248   -6.056  1.00 1.00 ? 80  LYS A HE2  2  
ATOM   2548  H HE3  . LYS A 1 80 ? -14.731 4.766   -7.711  1.00 1.00 ? 80  LYS A HE3  2  
ATOM   2549  H HZ1  . LYS A 1 80 ? -12.538 3.315   -6.842  1.00 1.00 ? 80  LYS A HZ1  2  
ATOM   2550  H HZ2  . LYS A 1 80 ? -13.665 2.918   -8.051  1.00 1.00 ? 80  LYS A HZ2  2  
ATOM   2551  H HZ3  . LYS A 1 80 ? -13.931 2.425   -6.449  1.00 1.00 ? 80  LYS A HZ3  2  
ATOM   2552  N N    . LYS A 1 81 ? -16.675 6.474   -6.337  1.00 1.00 ? 81  LYS A N    2  
ATOM   2553  C CA   . LYS A 1 81 ? -17.754 6.476   -7.316  1.00 1.00 ? 81  LYS A CA   2  
ATOM   2554  C C    . LYS A 1 81 ? -19.092 6.756   -6.644  1.00 1.00 ? 81  LYS A C    2  
ATOM   2555  O O    . LYS A 1 81 ? -19.910 7.533   -7.141  1.00 1.00 ? 81  LYS A O    2  
ATOM   2556  C CB   . LYS A 1 81 ? -17.822 5.141   -8.057  1.00 1.00 ? 81  LYS A CB   2  
ATOM   2557  C CG   . LYS A 1 81 ? -18.884 5.220   -9.167  1.00 1.00 ? 81  LYS A CG   2  
ATOM   2558  C CD   . LYS A 1 81 ? -18.890 3.916   -9.968  1.00 1.00 ? 81  LYS A CD   2  
ATOM   2559  C CE   . LYS A 1 81 ? -19.912 4.014   -11.104 1.00 1.00 ? 81  LYS A CE   2  
ATOM   2560  N NZ   . LYS A 1 81 ? -21.269 4.258   -10.535 1.00 1.00 ? 81  LYS A NZ   2  
ATOM   2561  H H    . LYS A 1 81 ? -16.109 5.674   -6.223  1.00 1.00 ? 81  LYS A H    2  
ATOM   2562  H HA   . LYS A 1 81 ? -17.561 7.247   -8.011  1.00 1.00 ? 81  LYS A HA   2  
ATOM   2563  H HB2  . LYS A 1 81 ? -16.857 4.928   -8.495  1.00 1.00 ? 81  LYS A HB2  2  
ATOM   2564  H HB3  . LYS A 1 81 ? -18.083 4.356   -7.367  1.00 1.00 ? 81  LYS A HB3  2  
ATOM   2565  H HG2  . LYS A 1 81 ? -19.859 5.372   -8.722  1.00 1.00 ? 81  LYS A HG2  2  
ATOM   2566  H HG3  . LYS A 1 81 ? -18.659 6.044   -9.828  1.00 1.00 ? 81  LYS A HG3  2  
ATOM   2567  H HD2  . LYS A 1 81 ? -17.908 3.743   -10.381 1.00 1.00 ? 81  LYS A HD2  2  
ATOM   2568  H HD3  . LYS A 1 81 ? -19.158 3.096   -9.319  1.00 1.00 ? 81  LYS A HD3  2  
ATOM   2569  H HE2  . LYS A 1 81 ? -19.646 4.831   -11.758 1.00 1.00 ? 81  LYS A HE2  2  
ATOM   2570  H HE3  . LYS A 1 81 ? -19.917 3.091   -11.665 1.00 1.00 ? 81  LYS A HE3  2  
ATOM   2571  H HZ1  . LYS A 1 81 ? -21.932 3.549   -10.906 1.00 1.00 ? 81  LYS A HZ1  2  
ATOM   2572  H HZ2  . LYS A 1 81 ? -21.591 5.209   -10.804 1.00 1.00 ? 81  LYS A HZ2  2  
ATOM   2573  H HZ3  . LYS A 1 81 ? -21.228 4.184   -9.498  1.00 1.00 ? 81  LYS A HZ3  2  
ATOM   2574  N N    . ALA A 1 82 ? -19.293 6.126   -5.514  1.00 1.00 ? 82  ALA A N    2  
ATOM   2575  C CA   . ALA A 1 82 ? -20.525 6.302   -4.748  1.00 1.00 ? 82  ALA A CA   2  
ATOM   2576  C C    . ALA A 1 82 ? -20.342 5.839   -3.301  1.00 1.00 ? 82  ALA A C    2  
ATOM   2577  O O    . ALA A 1 82 ? -20.199 6.693   -2.438  1.00 1.00 ? 82  ALA A O    2  
ATOM   2578  C CB   . ALA A 1 82 ? -21.658 5.510   -5.396  1.00 1.00 ? 82  ALA A CB   2  
ATOM   2579  O OXT  . ALA A 1 82 ? -20.359 4.641   -3.075  1.00 1.00 ? 82  ALA A OXT  2  
ATOM   2580  H H    . ALA A 1 82 ? -18.593 5.536   -5.183  1.00 1.00 ? 82  ALA A H    2  
ATOM   2581  H HA   . ALA A 1 82 ? -20.786 7.348   -4.749  1.00 1.00 ? 82  ALA A HA   2  
ATOM   2582  H HB1  . ALA A 1 82 ? -21.475 4.452   -5.273  1.00 1.00 ? 82  ALA A HB1  2  
ATOM   2583  H HB2  . ALA A 1 82 ? -21.704 5.747   -6.449  1.00 1.00 ? 82  ALA A HB2  2  
ATOM   2584  H HB3  . ALA A 1 82 ? -22.597 5.770   -4.927  1.00 1.00 ? 82  ALA A HB3  2  
HETATM 2585  O O23  . PNS B 2 .  ? 13.879  6.144   3.364   1.00 1.00 ? 101 PNS A O23  2  
HETATM 2586  P P24  . PNS B 2 .  ? 14.734  7.301   4.083   1.00 1.00 ? 101 PNS A P24  2  
HETATM 2587  O O25  . PNS B 2 .  ? 14.015  8.580   3.917   1.00 1.00 ? 101 PNS A O25  2  
HETATM 2588  O O26  . PNS B 2 .  ? 16.143  7.179   3.646   1.00 1.00 ? 101 PNS A O26  2  
HETATM 2589  O O27  . PNS B 2 .  ? 14.647  6.882   5.637   1.00 1.00 ? 101 PNS A O27  2  
HETATM 2590  C C28  . PNS B 2 .  ? 13.390  6.784   6.298   1.00 1.00 ? 101 PNS A C28  2  
HETATM 2591  C C29  . PNS B 2 .  ? 13.495  7.459   7.670   1.00 1.00 ? 101 PNS A C29  2  
HETATM 2592  C C30  . PNS B 2 .  ? 14.718  6.936   8.416   1.00 1.00 ? 101 PNS A C30  2  
HETATM 2593  C C31  . PNS B 2 .  ? 12.223  7.151   8.472   1.00 1.00 ? 101 PNS A C31  2  
HETATM 2594  C C32  . PNS B 2 .  ? 13.650  8.965   7.498   1.00 1.00 ? 101 PNS A C32  2  
HETATM 2595  O O33  . PNS B 2 .  ? 12.500  9.449   6.823   1.00 1.00 ? 101 PNS A O33  2  
HETATM 2596  C C34  . PNS B 2 .  ? 13.766  9.648   8.858   1.00 1.00 ? 101 PNS A C34  2  
HETATM 2597  O O35  . PNS B 2 .  ? 14.858  9.757   9.416   1.00 1.00 ? 101 PNS A O35  2  
HETATM 2598  N N36  . PNS B 2 .  ? 12.635  10.105  9.387   1.00 1.00 ? 101 PNS A N36  2  
HETATM 2599  C C37  . PNS B 2 .  ? 12.626  10.773  10.683  1.00 1.00 ? 101 PNS A C37  2  
HETATM 2600  C C38  . PNS B 2 .  ? 11.192  11.095  11.107  1.00 1.00 ? 101 PNS A C38  2  
HETATM 2601  C C39  . PNS B 2 .  ? 10.422  9.804   11.360  1.00 1.00 ? 101 PNS A C39  2  
HETATM 2602  O O40  . PNS B 2 .  ? 10.477  9.242   12.454  1.00 1.00 ? 101 PNS A O40  2  
HETATM 2603  N N41  . PNS B 2 .  ? 9.703   9.339   10.344  1.00 1.00 ? 101 PNS A N41  2  
HETATM 2604  C C42  . PNS B 2 .  ? 8.925   8.113   10.469  1.00 1.00 ? 101 PNS A C42  2  
HETATM 2605  C C43  . PNS B 2 .  ? 7.619   8.387   11.216  1.00 1.00 ? 101 PNS A C43  2  
HETATM 2606  S S44  . PNS B 2 .  ? 6.530   9.349   10.174  1.00 1.00 ? 101 PNS A S44  2  
HETATM 2607  H H282 . PNS B 2 .  ? 13.133  5.744   6.424   1.00 1.00 ? 101 PNS A H282 2  
HETATM 2608  H H281 . PNS B 2 .  ? 12.622  7.276   5.715   1.00 1.00 ? 101 PNS A H281 2  
HETATM 2609  H H303 . PNS B 2 .  ? 14.699  5.855   8.418   1.00 1.00 ? 101 PNS A H303 2  
HETATM 2610  H H302 . PNS B 2 .  ? 15.615  7.279   7.926   1.00 1.00 ? 101 PNS A H302 2  
HETATM 2611  H H301 . PNS B 2 .  ? 14.702  7.294   9.435   1.00 1.00 ? 101 PNS A H301 2  
HETATM 2612  H H313 . PNS B 2 .  ? 12.058  6.083   8.491   1.00 1.00 ? 101 PNS A H313 2  
HETATM 2613  H H312 . PNS B 2 .  ? 12.337  7.513   9.481   1.00 1.00 ? 101 PNS A H312 2  
HETATM 2614  H H311 . PNS B 2 .  ? 11.377  7.638   8.007   1.00 1.00 ? 101 PNS A H311 2  
HETATM 2615  H H32  . PNS B 2 .  ? 14.539  9.182   6.914   1.00 1.00 ? 101 PNS A H32  2  
HETATM 2616  H H33  . PNS B 2 .  ? 12.783  9.842   5.996   1.00 1.00 ? 101 PNS A H33  2  
HETATM 2617  H H36  . PNS B 2 .  ? 11.794  9.992   8.898   1.00 1.00 ? 101 PNS A H36  2  
HETATM 2618  H H372 . PNS B 2 .  ? 13.194  11.688  10.615  1.00 1.00 ? 101 PNS A H372 2  
HETATM 2619  H H371 . PNS B 2 .  ? 13.080  10.127  11.423  1.00 1.00 ? 101 PNS A H371 2  
HETATM 2620  H H382 . PNS B 2 .  ? 11.210  11.686  12.010  1.00 1.00 ? 101 PNS A H382 2  
HETATM 2621  H H381 . PNS B 2 .  ? 10.704  11.654  10.321  1.00 1.00 ? 101 PNS A H381 2  
HETATM 2622  H H41  . PNS B 2 .  ? 9.696   9.830   9.495   1.00 1.00 ? 101 PNS A H41  2  
HETATM 2623  H H422 . PNS B 2 .  ? 9.502   7.380   11.011  1.00 1.00 ? 101 PNS A H422 2  
HETATM 2624  H H421 . PNS B 2 .  ? 8.698   7.729   9.484   1.00 1.00 ? 101 PNS A H421 2  
HETATM 2625  H H431 . PNS B 2 .  ? 7.832   8.935   12.122  1.00 1.00 ? 101 PNS A H431 2  
HETATM 2626  H H432 . PNS B 2 .  ? 7.145   7.449   11.466  1.00 1.00 ? 101 PNS A H432 2  
HETATM 2627  C C1   . STE C 3 .  ? 7.050   10.972  9.817   1.00 1.00 ? 102 STE A C1   2  
HETATM 2628  O O1   . STE C 3 .  ? 8.084   11.442  10.237  1.00 1.00 ? 102 STE A O1   2  
HETATM 2629  C C2   . STE C 3 .  ? 6.072   11.696  8.938   1.00 1.00 ? 102 STE A C2   2  
HETATM 2630  C C3   . STE C 3 .  ? 6.437   11.484  7.468   1.00 1.00 ? 102 STE A C3   2  
HETATM 2631  C C4   . STE C 3 .  ? 6.307   10.000  7.116   1.00 1.00 ? 102 STE A C4   2  
HETATM 2632  C C5   . STE C 3 .  ? 6.287   9.839   5.597   1.00 1.00 ? 102 STE A C5   2  
HETATM 2633  C C6   . STE C 3 .  ? 6.391   8.361   5.248   1.00 1.00 ? 102 STE A C6   2  
HETATM 2634  C C7   . STE C 3 .  ? 6.331   8.194   3.730   1.00 1.00 ? 102 STE A C7   2  
HETATM 2635  C C8   . STE C 3 .  ? 6.285   6.692   3.376   1.00 1.00 ? 102 STE A C8   2  
HETATM 2636  C C9   . STE C 3 .  ? 4.824   6.201   3.368   1.00 1.00 ? 102 STE A C9   2  
HETATM 2637  C C10  . STE C 3 .  ? 4.174   6.527   2.023   1.00 1.00 ? 102 STE A C10  2  
HETATM 2638  C C11  . STE C 3 .  ? 2.827   5.829   1.938   1.00 1.00 ? 102 STE A C11  2  
HETATM 2639  C C12  . STE C 3 .  ? 3.018   4.286   1.863   1.00 1.00 ? 102 STE A C12  2  
HETATM 2640  C C13  . STE C 3 .  ? 1.933   3.664   0.993   1.00 1.00 ? 102 STE A C13  2  
HETATM 2641  C C14  . STE C 3 .  ? 0.566   3.872   1.655   1.00 1.00 ? 102 STE A C14  2  
HETATM 2642  C C15  . STE C 3 .  ? -0.534  3.450   0.688   1.00 1.00 ? 102 STE A C15  2  
HETATM 2643  C C16  . STE C 3 .  ? -1.871  4.018   1.157   1.00 1.00 ? 102 STE A C16  2  
HETATM 2644  C C17  . STE C 3 .  ? -3.005  3.417   0.328   1.00 1.00 ? 102 STE A C17  2  
HETATM 2645  C C18  . STE C 3 .  ? -3.011  4.027   -1.080  1.00 1.00 ? 102 STE A C18  2  
HETATM 2646  H H21  . STE C 3 .  ? 5.074   11.320  9.117   1.00 1.00 ? 102 STE A H21  2  
HETATM 2647  H H22  . STE C 3 .  ? 6.101   12.752  9.163   1.00 1.00 ? 102 STE A H22  2  
HETATM 2648  H H31  . STE C 3 .  ? 7.454   11.804  7.301   1.00 1.00 ? 102 STE A H31  2  
HETATM 2649  H H32  . STE C 3 .  ? 5.769   12.063  6.846   1.00 1.00 ? 102 STE A H32  2  
HETATM 2650  H H41  . STE C 3 .  ? 5.390   9.609   7.530   1.00 1.00 ? 102 STE A H41  2  
HETATM 2651  H H42  . STE C 3 .  ? 7.147   9.459   7.525   1.00 1.00 ? 102 STE A H42  2  
HETATM 2652  H H51  . STE C 3 .  ? 7.122   10.367  5.166   1.00 1.00 ? 102 STE A H51  2  
HETATM 2653  H H52  . STE C 3 .  ? 5.365   10.239  5.206   1.00 1.00 ? 102 STE A H52  2  
HETATM 2654  H H61  . STE C 3 .  ? 5.570   7.825   5.701   1.00 1.00 ? 102 STE A H61  2  
HETATM 2655  H H62  . STE C 3 .  ? 7.327   7.966   5.616   1.00 1.00 ? 102 STE A H62  2  
HETATM 2656  H H71  . STE C 3 .  ? 7.207   8.642   3.286   1.00 1.00 ? 102 STE A H71  2  
HETATM 2657  H H72  . STE C 3 .  ? 5.451   8.692   3.356   1.00 1.00 ? 102 STE A H72  2  
HETATM 2658  H H81  . STE C 3 .  ? 6.844   6.126   4.109   1.00 1.00 ? 102 STE A H81  2  
HETATM 2659  H H82  . STE C 3 .  ? 6.729   6.541   2.402   1.00 1.00 ? 102 STE A H82  2  
HETATM 2660  H H91  . STE C 3 .  ? 4.267   6.687   4.156   1.00 1.00 ? 102 STE A H91  2  
HETATM 2661  H H92  . STE C 3 .  ? 4.807   5.136   3.525   1.00 1.00 ? 102 STE A H92  2  
HETATM 2662  H H101 . STE C 3 .  ? 4.802   6.185   1.214   1.00 1.00 ? 102 STE A H101 2  
HETATM 2663  H H102 . STE C 3 .  ? 4.026   7.591   1.940   1.00 1.00 ? 102 STE A H102 2  
HETATM 2664  H H111 . STE C 3 .  ? 2.309   6.179   1.059   1.00 1.00 ? 102 STE A H111 2  
HETATM 2665  H H112 . STE C 3 .  ? 2.249   6.083   2.817   1.00 1.00 ? 102 STE A H112 2  
HETATM 2666  H H121 . STE C 3 .  ? 2.952   3.869   2.856   1.00 1.00 ? 102 STE A H121 2  
HETATM 2667  H H122 . STE C 3 .  ? 3.985   4.044   1.439   1.00 1.00 ? 102 STE A H122 2  
HETATM 2668  H H131 . STE C 3 .  ? 2.123   2.606   0.887   1.00 1.00 ? 102 STE A H131 2  
HETATM 2669  H H132 . STE C 3 .  ? 1.947   4.131   0.019   1.00 1.00 ? 102 STE A H132 2  
HETATM 2670  H H141 . STE C 3 .  ? 0.436   4.914   1.910   1.00 1.00 ? 102 STE A H141 2  
HETATM 2671  H H142 . STE C 3 .  ? 0.505   3.273   2.551   1.00 1.00 ? 102 STE A H142 2  
HETATM 2672  H H151 . STE C 3 .  ? -0.589  2.373   0.657   1.00 1.00 ? 102 STE A H151 2  
HETATM 2673  H H152 . STE C 3 .  ? -0.313  3.832   -0.294  1.00 1.00 ? 102 STE A H152 2  
HETATM 2674  H H161 . STE C 3 .  ? -1.865  5.088   1.034   1.00 1.00 ? 102 STE A H161 2  
HETATM 2675  H H162 . STE C 3 .  ? -2.018  3.775   2.201   1.00 1.00 ? 102 STE A H162 2  
HETATM 2676  H H171 . STE C 3 .  ? -3.939  3.637   0.815   1.00 1.00 ? 102 STE A H171 2  
HETATM 2677  H H172 . STE C 3 .  ? -2.878  2.346   0.258   1.00 1.00 ? 102 STE A H172 2  
HETATM 2678  H H181 . STE C 3 .  ? -2.185  3.637   -1.651  1.00 1.00 ? 102 STE A H181 2  
HETATM 2679  H H182 . STE C 3 .  ? -2.928  5.100   -1.010  1.00 1.00 ? 102 STE A H182 2  
HETATM 2680  H H183 . STE C 3 .  ? -3.937  3.775   -1.575  1.00 1.00 ? 102 STE A H183 2  
ATOM   2681  N N    . ALA A 1 1  ? -10.307 -3.631  7.257   1.00 1.00 ? 1   ALA A N    3  
ATOM   2682  C CA   . ALA A 1 1  ? -10.297 -3.775  5.773   1.00 1.00 ? 1   ALA A CA   3  
ATOM   2683  C C    . ALA A 1 1  ? -10.494 -5.247  5.408   1.00 1.00 ? 1   ALA A C    3  
ATOM   2684  O O    . ALA A 1 1  ? -10.305 -6.135  6.239   1.00 1.00 ? 1   ALA A O    3  
ATOM   2685  C CB   . ALA A 1 1  ? -8.959  -3.262  5.222   1.00 1.00 ? 1   ALA A CB   3  
ATOM   2686  H H1   . ALA A 1 1  ? -10.789 -4.448  7.681   1.00 1.00 ? 1   ALA A H1   3  
ATOM   2687  H H2   . ALA A 1 1  ? -10.807 -2.757  7.517   1.00 1.00 ? 1   ALA A H2   3  
ATOM   2688  H H3   . ALA A 1 1  ? -9.329  -3.588  7.607   1.00 1.00 ? 1   ALA A H3   3  
ATOM   2689  H HA   . ALA A 1 1  ? -11.100 -3.191  5.352   1.00 1.00 ? 1   ALA A HA   3  
ATOM   2690  H HB1  . ALA A 1 1  ? -8.642  -2.394  5.785   1.00 1.00 ? 1   ALA A HB1  3  
ATOM   2691  H HB2  . ALA A 1 1  ? -9.079  -2.988  4.183   1.00 1.00 ? 1   ALA A HB2  3  
ATOM   2692  H HB3  . ALA A 1 1  ? -8.214  -4.037  5.307   1.00 1.00 ? 1   ALA A HB3  3  
ATOM   2693  N N    . LYS A 1 2  ? -10.875 -5.495  4.160   1.00 1.00 ? 2   LYS A N    3  
ATOM   2694  C CA   . LYS A 1 2  ? -11.095 -6.858  3.689   1.00 1.00 ? 2   LYS A CA   3  
ATOM   2695  C C    . LYS A 1 2  ? -9.765  -7.556  3.444   1.00 1.00 ? 2   LYS A C    3  
ATOM   2696  O O    . LYS A 1 2  ? -8.779  -6.921  3.087   1.00 1.00 ? 2   LYS A O    3  
ATOM   2697  C CB   . LYS A 1 2  ? -11.911 -6.841  2.397   1.00 1.00 ? 2   LYS A CB   3  
ATOM   2698  C CG   . LYS A 1 2  ? -13.308 -6.288  2.686   1.00 1.00 ? 2   LYS A CG   3  
ATOM   2699  C CD   . LYS A 1 2  ? -14.135 -6.298  1.398   1.00 1.00 ? 2   LYS A CD   3  
ATOM   2700  C CE   . LYS A 1 2  ? -15.551 -5.806  1.697   1.00 1.00 ? 2   LYS A CE   3  
ATOM   2701  N NZ   . LYS A 1 2  ? -15.501 -4.382  2.136   1.00 1.00 ? 2   LYS A NZ   3  
ATOM   2702  H H    . LYS A 1 2  ? -11.010 -4.747  3.542   1.00 1.00 ? 2   LYS A H    3  
ATOM   2703  H HA   . LYS A 1 2  ? -11.646 -7.404  4.441   1.00 1.00 ? 2   LYS A HA   3  
ATOM   2704  H HB2  . LYS A 1 2  ? -11.418 -6.215  1.668   1.00 1.00 ? 2   LYS A HB2  3  
ATOM   2705  H HB3  . LYS A 1 2  ? -11.998 -7.845  2.015   1.00 1.00 ? 2   LYS A HB3  3  
ATOM   2706  H HG2  . LYS A 1 2  ? -13.792 -6.904  3.430   1.00 1.00 ? 2   LYS A HG2  3  
ATOM   2707  H HG3  . LYS A 1 2  ? -13.228 -5.276  3.052   1.00 1.00 ? 2   LYS A HG3  3  
ATOM   2708  H HD2  . LYS A 1 2  ? -13.673 -5.647  0.670   1.00 1.00 ? 2   LYS A HD2  3  
ATOM   2709  H HD3  . LYS A 1 2  ? -14.180 -7.303  1.007   1.00 1.00 ? 2   LYS A HD3  3  
ATOM   2710  H HE2  . LYS A 1 2  ? -16.157 -5.886  0.807   1.00 1.00 ? 2   LYS A HE2  3  
ATOM   2711  H HE3  . LYS A 1 2  ? -15.984 -6.408  2.483   1.00 1.00 ? 2   LYS A HE3  3  
ATOM   2712  H HZ1  . LYS A 1 2  ? -15.888 -3.775  1.387   1.00 1.00 ? 2   LYS A HZ1  3  
ATOM   2713  H HZ2  . LYS A 1 2  ? -14.515 -4.114  2.328   1.00 1.00 ? 2   LYS A HZ2  3  
ATOM   2714  H HZ3  . LYS A 1 2  ? -16.067 -4.265  3.001   1.00 1.00 ? 2   LYS A HZ3  3  
ATOM   2715  N N    . LYS A 1 3  ? -9.743  -8.866  3.641   1.00 1.00 ? 3   LYS A N    3  
ATOM   2716  C CA   . LYS A 1 3  ? -8.520  -9.636  3.446   1.00 1.00 ? 3   LYS A CA   3  
ATOM   2717  C C    . LYS A 1 3  ? -8.035  -9.533  2.005   1.00 1.00 ? 3   LYS A C    3  
ATOM   2718  O O    . LYS A 1 3  ? -6.834  -9.431  1.751   1.00 1.00 ? 3   LYS A O    3  
ATOM   2719  C CB   . LYS A 1 3  ? -8.771  -11.102 3.785   1.00 1.00 ? 3   LYS A CB   3  
ATOM   2720  C CG   . LYS A 1 3  ? -9.108  -11.237 5.272   1.00 1.00 ? 3   LYS A CG   3  
ATOM   2721  C CD   . LYS A 1 3  ? -9.151  -12.718 5.661   1.00 1.00 ? 3   LYS A CD   3  
ATOM   2722  C CE   . LYS A 1 3  ? -10.307 -13.416 4.934   1.00 1.00 ? 3   LYS A CE   3  
ATOM   2723  N NZ   . LYS A 1 3  ? -10.600 -14.714 5.601   1.00 1.00 ? 3   LYS A NZ   3  
ATOM   2724  H H    . LYS A 1 3  ? -10.560 -9.323  3.930   1.00 1.00 ? 3   LYS A H    3  
ATOM   2725  H HA   . LYS A 1 3  ? -7.754  -9.254  4.102   1.00 1.00 ? 3   LYS A HA   3  
ATOM   2726  H HB2  . LYS A 1 3  ? -9.598  -11.460 3.192   1.00 1.00 ? 3   LYS A HB2  3  
ATOM   2727  H HB3  . LYS A 1 3  ? -7.890  -11.682 3.560   1.00 1.00 ? 3   LYS A HB3  3  
ATOM   2728  H HG2  . LYS A 1 3  ? -8.352  -10.732 5.858   1.00 1.00 ? 3   LYS A HG2  3  
ATOM   2729  H HG3  . LYS A 1 3  ? -10.070 -10.787 5.464   1.00 1.00 ? 3   LYS A HG3  3  
ATOM   2730  H HD2  . LYS A 1 3  ? -8.219  -13.188 5.385   1.00 1.00 ? 3   LYS A HD2  3  
ATOM   2731  H HD3  . LYS A 1 3  ? -9.295  -12.805 6.726   1.00 1.00 ? 3   LYS A HD3  3  
ATOM   2732  H HE2  . LYS A 1 3  ? -11.187 -12.790 4.964   1.00 1.00 ? 3   LYS A HE2  3  
ATOM   2733  H HE3  . LYS A 1 3  ? -10.029 -13.599 3.907   1.00 1.00 ? 3   LYS A HE3  3  
ATOM   2734  H HZ1  . LYS A 1 3  ? -11.619 -14.908 5.549   1.00 1.00 ? 3   LYS A HZ1  3  
ATOM   2735  H HZ2  . LYS A 1 3  ? -10.303 -14.668 6.596   1.00 1.00 ? 3   LYS A HZ2  3  
ATOM   2736  H HZ3  . LYS A 1 3  ? -10.080 -15.475 5.117   1.00 1.00 ? 3   LYS A HZ3  3  
ATOM   2737  N N    . GLU A 1 4  ? -8.970  -9.565  1.065   1.00 1.00 ? 4   GLU A N    3  
ATOM   2738  C CA   . GLU A 1 4  ? -8.615  -9.480  -0.344  1.00 1.00 ? 4   GLU A CA   3  
ATOM   2739  C C    . GLU A 1 4  ? -7.814  -8.210  -0.623  1.00 1.00 ? 4   GLU A C    3  
ATOM   2740  O O    . GLU A 1 4  ? -6.773  -8.254  -1.281  1.00 1.00 ? 4   GLU A O    3  
ATOM   2741  C CB   . GLU A 1 4  ? -9.893  -9.481  -1.195  1.00 1.00 ? 4   GLU A CB   3  
ATOM   2742  C CG   . GLU A 1 4  ? -10.679 -8.184  -0.959  1.00 1.00 ? 4   GLU A CG   3  
ATOM   2743  C CD   . GLU A 1 4  ? -12.113 -8.340  -1.447  1.00 1.00 ? 4   GLU A CD   3  
ATOM   2744  O OE1  . GLU A 1 4  ? -12.663 -9.415  -1.279  1.00 1.00 ? 4   GLU A OE1  3  
ATOM   2745  O OE2  . GLU A 1 4  ? -12.642 -7.377  -1.977  1.00 1.00 ? 4   GLU A OE2  3  
ATOM   2746  H H    . GLU A 1 4  ? -9.911  -9.657  1.322   1.00 1.00 ? 4   GLU A H    3  
ATOM   2747  H HA   . GLU A 1 4  ? -8.021  -10.342 -0.607  1.00 1.00 ? 4   GLU A HA   3  
ATOM   2748  H HB2  . GLU A 1 4  ? -9.627  -9.552  -2.240  1.00 1.00 ? 4   GLU A HB2  3  
ATOM   2749  H HB3  . GLU A 1 4  ? -10.505 -10.327 -0.922  1.00 1.00 ? 4   GLU A HB3  3  
ATOM   2750  H HG2  . GLU A 1 4  ? -10.685 -7.952  0.094   1.00 1.00 ? 4   GLU A HG2  3  
ATOM   2751  H HG3  . GLU A 1 4  ? -10.210 -7.378  -1.501  1.00 1.00 ? 4   GLU A HG3  3  
ATOM   2752  N N    . THR A 1 5  ? -8.309  -7.080  -0.127  1.00 1.00 ? 5   THR A N    3  
ATOM   2753  C CA   . THR A 1 5  ? -7.641  -5.804  -0.331  1.00 1.00 ? 5   THR A CA   3  
ATOM   2754  C C    . THR A 1 5  ? -6.307  -5.775  0.404   1.00 1.00 ? 5   THR A C    3  
ATOM   2755  O O    . THR A 1 5  ? -5.306  -5.307  -0.126  1.00 1.00 ? 5   THR A O    3  
ATOM   2756  C CB   . THR A 1 5  ? -8.526  -4.653  0.158   1.00 1.00 ? 5   THR A CB   3  
ATOM   2757  O OG1  . THR A 1 5  ? -9.857  -4.869  -0.283  1.00 1.00 ? 5   THR A OG1  3  
ATOM   2758  C CG2  . THR A 1 5  ? -8.021  -3.334  -0.438  1.00 1.00 ? 5   THR A CG2  3  
ATOM   2759  H H    . THR A 1 5  ? -9.140  -7.105  0.387   1.00 1.00 ? 5   THR A H    3  
ATOM   2760  H HA   . THR A 1 5  ? -7.457  -5.677  -1.389  1.00 1.00 ? 5   THR A HA   3  
ATOM   2761  H HB   . THR A 1 5  ? -8.497  -4.593  1.240   1.00 1.00 ? 5   THR A HB   3  
ATOM   2762  H HG1  . THR A 1 5  ? -10.454 -4.510  0.377   1.00 1.00 ? 5   THR A HG1  3  
ATOM   2763  H HG21 . THR A 1 5  ? -8.390  -2.510  0.153   1.00 1.00 ? 5   THR A HG21 3  
ATOM   2764  H HG22 . THR A 1 5  ? -8.381  -3.238  -1.454  1.00 1.00 ? 5   THR A HG22 3  
ATOM   2765  H HG23 . THR A 1 5  ? -6.939  -3.323  -0.438  1.00 1.00 ? 5   THR A HG23 3  
ATOM   2766  N N    . ILE A 1 6  ? -6.309  -6.276  1.631   1.00 1.00 ? 6   ILE A N    3  
ATOM   2767  C CA   . ILE A 1 6  ? -5.100  -6.296  2.443   1.00 1.00 ? 6   ILE A CA   3  
ATOM   2768  C C    . ILE A 1 6  ? -4.008  -7.107  1.755   1.00 1.00 ? 6   ILE A C    3  
ATOM   2769  O O    . ILE A 1 6  ? -2.850  -6.696  1.724   1.00 1.00 ? 6   ILE A O    3  
ATOM   2770  C CB   . ILE A 1 6  ? -5.409  -6.910  3.818   1.00 1.00 ? 6   ILE A CB   3  
ATOM   2771  C CG1  . ILE A 1 6  ? -6.317  -5.964  4.613   1.00 1.00 ? 6   ILE A CG1  3  
ATOM   2772  C CG2  . ILE A 1 6  ? -4.110  -7.127  4.595   1.00 1.00 ? 6   ILE A CG2  3  
ATOM   2773  C CD1  . ILE A 1 6  ? -6.883  -6.700  5.831   1.00 1.00 ? 6   ILE A CD1  3  
ATOM   2774  H H    . ILE A 1 6  ? -7.143  -6.635  2.003   1.00 1.00 ? 6   ILE A H    3  
ATOM   2775  H HA   . ILE A 1 6  ? -4.754  -5.286  2.579   1.00 1.00 ? 6   ILE A HA   3  
ATOM   2776  H HB   . ILE A 1 6  ? -5.905  -7.858  3.682   1.00 1.00 ? 6   ILE A HB   3  
ATOM   2777  H HG12 . ILE A 1 6  ? -5.741  -5.114  4.946   1.00 1.00 ? 6   ILE A HG12 3  
ATOM   2778  H HG13 . ILE A 1 6  ? -7.124  -5.627  3.987   1.00 1.00 ? 6   ILE A HG13 3  
ATOM   2779  H HG21 . ILE A 1 6  ? -3.595  -7.993  4.204   1.00 1.00 ? 6   ILE A HG21 3  
ATOM   2780  H HG22 . ILE A 1 6  ? -4.343  -7.288  5.636   1.00 1.00 ? 6   ILE A HG22 3  
ATOM   2781  H HG23 . ILE A 1 6  ? -3.480  -6.257  4.495   1.00 1.00 ? 6   ILE A HG23 3  
ATOM   2782  H HD11 . ILE A 1 6  ? -7.643  -7.397  5.512   1.00 1.00 ? 6   ILE A HD11 3  
ATOM   2783  H HD12 . ILE A 1 6  ? -7.315  -5.984  6.517   1.00 1.00 ? 6   ILE A HD12 3  
ATOM   2784  H HD13 . ILE A 1 6  ? -6.088  -7.238  6.329   1.00 1.00 ? 6   ILE A HD13 3  
ATOM   2785  N N    . ASP A 1 7  ? -4.378  -8.252  1.207   1.00 1.00 ? 7   ASP A N    3  
ATOM   2786  C CA   . ASP A 1 7  ? -3.412  -9.103  0.528   1.00 1.00 ? 7   ASP A CA   3  
ATOM   2787  C C    . ASP A 1 7  ? -2.852  -8.383  -0.694  1.00 1.00 ? 7   ASP A C    3  
ATOM   2788  O O    . ASP A 1 7  ? -1.675  -8.520  -1.022  1.00 1.00 ? 7   ASP A O    3  
ATOM   2789  C CB   . ASP A 1 7  ? -4.095  -10.416 0.106   1.00 1.00 ? 7   ASP A CB   3  
ATOM   2790  C CG   . ASP A 1 7  ? -4.140  -11.404 1.274   1.00 1.00 ? 7   ASP A CG   3  
ATOM   2791  O OD1  . ASP A 1 7  ? -3.380  -11.230 2.215   1.00 1.00 ? 7   ASP A OD1  3  
ATOM   2792  O OD2  . ASP A 1 7  ? -4.939  -12.324 1.211   1.00 1.00 ? 7   ASP A OD2  3  
ATOM   2793  H H    . ASP A 1 7  ? -5.315  -8.534  1.258   1.00 1.00 ? 7   ASP A H    3  
ATOM   2794  H HA   . ASP A 1 7  ? -2.591  -9.322  1.198   1.00 1.00 ? 7   ASP A HA   3  
ATOM   2795  H HB2  . ASP A 1 7  ? -5.103  -10.203 -0.218  1.00 1.00 ? 7   ASP A HB2  3  
ATOM   2796  H HB3  . ASP A 1 7  ? -3.547  -10.863 -0.712  1.00 1.00 ? 7   ASP A HB3  3  
ATOM   2797  N N    . LYS A 1 8  ? -3.696  -7.615  -1.363  1.00 1.00 ? 8   LYS A N    3  
ATOM   2798  C CA   . LYS A 1 8  ? -3.264  -6.881  -2.543  1.00 1.00 ? 8   LYS A CA   3  
ATOM   2799  C C    . LYS A 1 8  ? -2.251  -5.812  -2.168  1.00 1.00 ? 8   LYS A C    3  
ATOM   2800  O O    . LYS A 1 8  ? -1.234  -5.652  -2.834  1.00 1.00 ? 8   LYS A O    3  
ATOM   2801  C CB   . LYS A 1 8  ? -4.481  -6.229  -3.202  1.00 1.00 ? 8   LYS A CB   3  
ATOM   2802  C CG   . LYS A 1 8  ? -5.300  -7.277  -3.968  1.00 1.00 ? 8   LYS A CG   3  
ATOM   2803  C CD   . LYS A 1 8  ? -4.743  -7.456  -5.397  1.00 1.00 ? 8   LYS A CD   3  
ATOM   2804  C CE   . LYS A 1 8  ? -5.337  -6.393  -6.331  1.00 1.00 ? 8   LYS A CE   3  
ATOM   2805  N NZ   . LYS A 1 8  ? -4.860  -6.634  -7.714  1.00 1.00 ? 8   LYS A NZ   3  
ATOM   2806  H H    . LYS A 1 8  ? -4.623  -7.532  -1.053  1.00 1.00 ? 8   LYS A H    3  
ATOM   2807  H HA   . LYS A 1 8  ? -2.800  -7.565  -3.239  1.00 1.00 ? 8   LYS A HA   3  
ATOM   2808  H HB2  . LYS A 1 8  ? -5.098  -5.797  -2.428  1.00 1.00 ? 8   LYS A HB2  3  
ATOM   2809  H HB3  . LYS A 1 8  ? -4.156  -5.454  -3.878  1.00 1.00 ? 8   LYS A HB3  3  
ATOM   2810  H HG2  . LYS A 1 8  ? -5.259  -8.219  -3.440  1.00 1.00 ? 8   LYS A HG2  3  
ATOM   2811  H HG3  . LYS A 1 8  ? -6.330  -6.953  -4.023  1.00 1.00 ? 8   LYS A HG3  3  
ATOM   2812  H HD2  . LYS A 1 8  ? -3.667  -7.355  -5.385  1.00 1.00 ? 8   LYS A HD2  3  
ATOM   2813  H HD3  . LYS A 1 8  ? -5.006  -8.437  -5.765  1.00 1.00 ? 8   LYS A HD3  3  
ATOM   2814  H HE2  . LYS A 1 8  ? -6.414  -6.455  -6.310  1.00 1.00 ? 8   LYS A HE2  3  
ATOM   2815  H HE3  . LYS A 1 8  ? -5.025  -5.410  -6.015  1.00 1.00 ? 8   LYS A HE3  3  
ATOM   2816  H HZ1  . LYS A 1 8  ? -4.268  -7.488  -7.733  1.00 1.00 ? 8   LYS A HZ1  3  
ATOM   2817  H HZ2  . LYS A 1 8  ? -4.303  -5.815  -8.031  1.00 1.00 ? 8   LYS A HZ2  3  
ATOM   2818  H HZ3  . LYS A 1 8  ? -5.676  -6.764  -8.342  1.00 1.00 ? 8   LYS A HZ3  3  
ATOM   2819  N N    . VAL A 1 9  ? -2.539  -5.079  -1.106  1.00 1.00 ? 9   VAL A N    3  
ATOM   2820  C CA   . VAL A 1 9  ? -1.641  -4.022  -0.673  1.00 1.00 ? 9   VAL A CA   3  
ATOM   2821  C C    . VAL A 1 9  ? -0.275  -4.598  -0.326  1.00 1.00 ? 9   VAL A C    3  
ATOM   2822  O O    . VAL A 1 9  ? 0.758   -4.075  -0.737  1.00 1.00 ? 9   VAL A O    3  
ATOM   2823  C CB   . VAL A 1 9  ? -2.225  -3.308  0.545   1.00 1.00 ? 9   VAL A CB   3  
ATOM   2824  C CG1  . VAL A 1 9  ? -1.261  -2.220  1.013   1.00 1.00 ? 9   VAL A CG1  3  
ATOM   2825  C CG2  . VAL A 1 9  ? -3.567  -2.674  0.174   1.00 1.00 ? 9   VAL A CG2  3  
ATOM   2826  H H    . VAL A 1 9  ? -3.372  -5.245  -0.617  1.00 1.00 ? 9   VAL A H    3  
ATOM   2827  H HA   . VAL A 1 9  ? -1.530  -3.310  -1.474  1.00 1.00 ? 9   VAL A HA   3  
ATOM   2828  H HB   . VAL A 1 9  ? -2.372  -4.021  1.344   1.00 1.00 ? 9   VAL A HB   3  
ATOM   2829  H HG11 . VAL A 1 9  ? -1.773  -1.572  1.706   1.00 1.00 ? 9   VAL A HG11 3  
ATOM   2830  H HG12 . VAL A 1 9  ? -0.923  -1.648  0.162   1.00 1.00 ? 9   VAL A HG12 3  
ATOM   2831  H HG13 . VAL A 1 9  ? -0.412  -2.675  1.503   1.00 1.00 ? 9   VAL A HG13 3  
ATOM   2832  H HG21 . VAL A 1 9  ? -4.131  -3.349  -0.448  1.00 1.00 ? 9   VAL A HG21 3  
ATOM   2833  H HG22 . VAL A 1 9  ? -3.394  -1.757  -0.362  1.00 1.00 ? 9   VAL A HG22 3  
ATOM   2834  H HG23 . VAL A 1 9  ? -4.125  -2.467  1.073   1.00 1.00 ? 9   VAL A HG23 3  
ATOM   2835  N N    . SER A 1 10 ? -0.280  -5.688  0.424   1.00 1.00 ? 10  SER A N    3  
ATOM   2836  C CA   . SER A 1 10 ? 0.960   -6.336  0.813   1.00 1.00 ? 10  SER A CA   3  
ATOM   2837  C C    . SER A 1 10 ? 1.719   -6.803  -0.422  1.00 1.00 ? 10  SER A C    3  
ATOM   2838  O O    . SER A 1 10 ? 2.940   -6.748  -0.455  1.00 1.00 ? 10  SER A O    3  
ATOM   2839  C CB   . SER A 1 10 ? 0.667   -7.547  1.710   1.00 1.00 ? 10  SER A CB   3  
ATOM   2840  O OG   . SER A 1 10 ? -0.156  -8.464  1.003   1.00 1.00 ? 10  SER A OG   3  
ATOM   2841  H H    . SER A 1 10 ? -1.131  -6.062  0.719   1.00 1.00 ? 10  SER A H    3  
ATOM   2842  H HA   . SER A 1 10 ? 1.573   -5.632  1.359   1.00 1.00 ? 10  SER A HA   3  
ATOM   2843  H HB2  . SER A 1 10 ? 1.591   -8.040  1.980   1.00 1.00 ? 10  SER A HB2  3  
ATOM   2844  H HB3  . SER A 1 10 ? 0.163   -7.220  2.607   1.00 1.00 ? 10  SER A HB3  3  
ATOM   2845  H HG   . SER A 1 10 ? -0.838  -7.963  0.552   1.00 1.00 ? 10  SER A HG   3  
ATOM   2846  N N    . ASP A 1 11 ? 0.985   -7.274  -1.431  1.00 1.00 ? 11  ASP A N    3  
ATOM   2847  C CA   . ASP A 1 11 ? 1.600   -7.772  -2.653  1.00 1.00 ? 11  ASP A CA   3  
ATOM   2848  C C    . ASP A 1 11 ? 2.393   -6.672  -3.336  1.00 1.00 ? 11  ASP A C    3  
ATOM   2849  O O    . ASP A 1 11 ? 3.482   -6.909  -3.846  1.00 1.00 ? 11  ASP A O    3  
ATOM   2850  C CB   . ASP A 1 11 ? 0.500   -8.301  -3.598  1.00 1.00 ? 11  ASP A CB   3  
ATOM   2851  C CG   . ASP A 1 11 ? 0.134   -9.747  -3.264  1.00 1.00 ? 11  ASP A CG   3  
ATOM   2852  O OD1  . ASP A 1 11 ? 0.764   -10.319 -2.392  1.00 1.00 ? 11  ASP A OD1  3  
ATOM   2853  O OD2  . ASP A 1 11 ? -0.773  -10.260 -3.899  1.00 1.00 ? 11  ASP A OD2  3  
ATOM   2854  H H    . ASP A 1 11 ? 0.012   -7.293  -1.352  1.00 1.00 ? 11  ASP A H    3  
ATOM   2855  H HA   . ASP A 1 11 ? 2.278   -8.574  -2.408  1.00 1.00 ? 11  ASP A HA   3  
ATOM   2856  H HB2  . ASP A 1 11 ? -0.377  -7.688  -3.495  1.00 1.00 ? 11  ASP A HB2  3  
ATOM   2857  H HB3  . ASP A 1 11 ? 0.839   -8.255  -4.615  1.00 1.00 ? 11  ASP A HB3  3  
ATOM   2858  N N    . ILE A 1 12 ? 1.855   -5.471  -3.339  1.00 1.00 ? 12  ILE A N    3  
ATOM   2859  C CA   . ILE A 1 12 ? 2.544   -4.365  -3.976  1.00 1.00 ? 12  ILE A CA   3  
ATOM   2860  C C    . ILE A 1 12 ? 3.943   -4.209  -3.410  1.00 1.00 ? 12  ILE A C    3  
ATOM   2861  O O    . ILE A 1 12 ? 4.893   -4.031  -4.162  1.00 1.00 ? 12  ILE A O    3  
ATOM   2862  C CB   . ILE A 1 12 ? 1.738   -3.056  -3.765  1.00 1.00 ? 12  ILE A CB   3  
ATOM   2863  C CG1  . ILE A 1 12 ? 0.718   -2.847  -4.899  1.00 1.00 ? 12  ILE A CG1  3  
ATOM   2864  C CG2  . ILE A 1 12 ? 2.670   -1.835  -3.687  1.00 1.00 ? 12  ILE A CG2  3  
ATOM   2865  C CD1  . ILE A 1 12 ? -0.427  -3.837  -4.763  1.00 1.00 ? 12  ILE A CD1  3  
ATOM   2866  H H    . ILE A 1 12 ? 0.983   -5.325  -2.916  1.00 1.00 ? 12  ILE A H    3  
ATOM   2867  H HA   . ILE A 1 12 ? 2.628   -4.576  -5.029  1.00 1.00 ? 12  ILE A HA   3  
ATOM   2868  H HB   . ILE A 1 12 ? 1.206   -3.135  -2.832  1.00 1.00 ? 12  ILE A HB   3  
ATOM   2869  H HG12 . ILE A 1 12 ? 0.322   -1.843  -4.839  1.00 1.00 ? 12  ILE A HG12 3  
ATOM   2870  H HG13 . ILE A 1 12 ? 1.196   -2.986  -5.856  1.00 1.00 ? 12  ILE A HG13 3  
ATOM   2871  H HG21 . ILE A 1 12 ? 3.203   -1.845  -2.745  1.00 1.00 ? 12  ILE A HG21 3  
ATOM   2872  H HG22 . ILE A 1 12 ? 2.088   -0.937  -3.752  1.00 1.00 ? 12  ILE A HG22 3  
ATOM   2873  H HG23 . ILE A 1 12 ? 3.375   -1.870  -4.497  1.00 1.00 ? 12  ILE A HG23 3  
ATOM   2874  H HD11 . ILE A 1 12 ? -0.986  -3.610  -3.870  1.00 1.00 ? 12  ILE A HD11 3  
ATOM   2875  H HD12 . ILE A 1 12 ? -0.033  -4.839  -4.703  1.00 1.00 ? 12  ILE A HD12 3  
ATOM   2876  H HD13 . ILE A 1 12 ? -1.074  -3.751  -5.624  1.00 1.00 ? 12  ILE A HD13 3  
ATOM   2877  N N    . VAL A 1 13 ? 4.056   -4.245  -2.094  1.00 1.00 ? 13  VAL A N    3  
ATOM   2878  C CA   . VAL A 1 13 ? 5.347   -4.070  -1.453  1.00 1.00 ? 13  VAL A CA   3  
ATOM   2879  C C    . VAL A 1 13 ? 6.312   -5.157  -1.898  1.00 1.00 ? 13  VAL A C    3  
ATOM   2880  O O    . VAL A 1 13 ? 7.473   -4.885  -2.203  1.00 1.00 ? 13  VAL A O    3  
ATOM   2881  C CB   . VAL A 1 13 ? 5.179   -4.114  0.066   1.00 1.00 ? 13  VAL A CB   3  
ATOM   2882  C CG1  . VAL A 1 13 ? 6.537   -3.905  0.738   1.00 1.00 ? 13  VAL A CG1  3  
ATOM   2883  C CG2  . VAL A 1 13 ? 4.214   -3.011  0.510   1.00 1.00 ? 13  VAL A CG2  3  
ATOM   2884  H H    . VAL A 1 13 ? 3.256   -4.371  -1.544  1.00 1.00 ? 13  VAL A H    3  
ATOM   2885  H HA   . VAL A 1 13 ? 5.751   -3.111  -1.734  1.00 1.00 ? 13  VAL A HA   3  
ATOM   2886  H HB   . VAL A 1 13 ? 4.783   -5.079  0.354   1.00 1.00 ? 13  VAL A HB   3  
ATOM   2887  H HG11 . VAL A 1 13 ? 6.397   -3.806  1.805   1.00 1.00 ? 13  VAL A HG11 3  
ATOM   2888  H HG12 . VAL A 1 13 ? 6.995   -3.009  0.350   1.00 1.00 ? 13  VAL A HG12 3  
ATOM   2889  H HG13 . VAL A 1 13 ? 7.173   -4.754  0.536   1.00 1.00 ? 13  VAL A HG13 3  
ATOM   2890  H HG21 . VAL A 1 13 ? 4.486   -2.081  0.035   1.00 1.00 ? 13  VAL A HG21 3  
ATOM   2891  H HG22 . VAL A 1 13 ? 4.268   -2.894  1.582   1.00 1.00 ? 13  VAL A HG22 3  
ATOM   2892  H HG23 . VAL A 1 13 ? 3.206   -3.279  0.228   1.00 1.00 ? 13  VAL A HG23 3  
ATOM   2893  N N    . LYS A 1 14 ? 5.827   -6.387  -1.927  1.00 1.00 ? 14  LYS A N    3  
ATOM   2894  C CA   . LYS A 1 14 ? 6.657   -7.507  -2.336  1.00 1.00 ? 14  LYS A CA   3  
ATOM   2895  C C    . LYS A 1 14 ? 7.064   -7.383  -3.799  1.00 1.00 ? 14  LYS A C    3  
ATOM   2896  O O    . LYS A 1 14 ? 8.186   -7.717  -4.176  1.00 1.00 ? 14  LYS A O    3  
ATOM   2897  C CB   . LYS A 1 14 ? 5.907   -8.806  -2.148  1.00 1.00 ? 14  LYS A CB   3  
ATOM   2898  C CG   . LYS A 1 14 ? 5.343   -8.859  -0.711  1.00 1.00 ? 14  LYS A CG   3  
ATOM   2899  C CD   . LYS A 1 14 ? 5.304   -10.308 -0.155  1.00 1.00 ? 14  LYS A CD   3  
ATOM   2900  C CE   . LYS A 1 14 ? 6.075   -10.379 1.163   1.00 1.00 ? 14  LYS A CE   3  
ATOM   2901  N NZ   . LYS A 1 14 ? 5.334   -9.627  2.206   1.00 1.00 ? 14  LYS A NZ   3  
ATOM   2902  H H    . LYS A 1 14 ? 4.896   -6.544  -1.669  1.00 1.00 ? 14  LYS A H    3  
ATOM   2903  H HA   . LYS A 1 14 ? 7.534   -7.534  -1.711  1.00 1.00 ? 14  LYS A HA   3  
ATOM   2904  H HB2  . LYS A 1 14 ? 5.103   -8.866  -2.874  1.00 1.00 ? 14  LYS A HB2  3  
ATOM   2905  H HB3  . LYS A 1 14 ? 6.595   -9.615  -2.310  1.00 1.00 ? 14  LYS A HB3  3  
ATOM   2906  H HG2  . LYS A 1 14 ? 5.934   -8.226  -0.056  1.00 1.00 ? 14  LYS A HG2  3  
ATOM   2907  H HG3  . LYS A 1 14 ? 4.342   -8.476  -0.740  1.00 1.00 ? 14  LYS A HG3  3  
ATOM   2908  H HD2  . LYS A 1 14 ? 4.280   -10.588 0.023   1.00 1.00 ? 14  LYS A HD2  3  
ATOM   2909  H HD3  . LYS A 1 14 ? 5.737   -10.997 -0.852  1.00 1.00 ? 14  LYS A HD3  3  
ATOM   2910  H HE2  . LYS A 1 14 ? 6.181   -11.401 1.458   1.00 1.00 ? 14  LYS A HE2  3  
ATOM   2911  H HE3  . LYS A 1 14 ? 7.051   -9.941  1.032   1.00 1.00 ? 14  LYS A HE3  3  
ATOM   2912  H HZ1  . LYS A 1 14 ? 5.230   -10.217 3.052   1.00 1.00 ? 14  LYS A HZ1  3  
ATOM   2913  H HZ2  . LYS A 1 14 ? 4.396   -9.365  1.842   1.00 1.00 ? 14  LYS A HZ2  3  
ATOM   2914  H HZ3  . LYS A 1 14 ? 5.863   -8.766  2.449   1.00 1.00 ? 14  LYS A HZ3  3  
ATOM   2915  N N    . GLU A 1 15 ? 6.136   -6.923  -4.623  1.00 1.00 ? 15  GLU A N    3  
ATOM   2916  C CA   . GLU A 1 15 ? 6.402   -6.770  -6.048  1.00 1.00 ? 15  GLU A CA   3  
ATOM   2917  C C    . GLU A 1 15 ? 7.593   -5.847  -6.272  1.00 1.00 ? 15  GLU A C    3  
ATOM   2918  O O    . GLU A 1 15 ? 8.220   -5.875  -7.330  1.00 1.00 ? 15  GLU A O    3  
ATOM   2919  C CB   . GLU A 1 15 ? 5.166   -6.199  -6.749  1.00 1.00 ? 15  GLU A CB   3  
ATOM   2920  C CG   . GLU A 1 15 ? 4.101   -7.290  -6.887  1.00 1.00 ? 15  GLU A CG   3  
ATOM   2921  C CD   . GLU A 1 15 ? 2.802   -6.687  -7.413  1.00 1.00 ? 15  GLU A CD   3  
ATOM   2922  O OE1  . GLU A 1 15 ? 2.797   -5.501  -7.700  1.00 1.00 ? 15  GLU A OE1  3  
ATOM   2923  O OE2  . GLU A 1 15 ? 1.833   -7.419  -7.521  1.00 1.00 ? 15  GLU A OE2  3  
ATOM   2924  H H    . GLU A 1 15 ? 5.252   -6.689  -4.269  1.00 1.00 ? 15  GLU A H    3  
ATOM   2925  H HA   . GLU A 1 15 ? 6.628   -7.739  -6.467  1.00 1.00 ? 15  GLU A HA   3  
ATOM   2926  H HB2  . GLU A 1 15 ? 4.769   -5.381  -6.164  1.00 1.00 ? 15  GLU A HB2  3  
ATOM   2927  H HB3  . GLU A 1 15 ? 5.439   -5.840  -7.730  1.00 1.00 ? 15  GLU A HB3  3  
ATOM   2928  H HG2  . GLU A 1 15 ? 4.451   -8.039  -7.580  1.00 1.00 ? 15  GLU A HG2  3  
ATOM   2929  H HG3  . GLU A 1 15 ? 3.923   -7.749  -5.927  1.00 1.00 ? 15  GLU A HG3  3  
ATOM   2930  N N    . LYS A 1 16 ? 7.898   -5.031  -5.275  1.00 1.00 ? 16  LYS A N    3  
ATOM   2931  C CA   . LYS A 1 16 ? 9.011   -4.105  -5.387  1.00 1.00 ? 16  LYS A CA   3  
ATOM   2932  C C    . LYS A 1 16 ? 10.320  -4.862  -5.547  1.00 1.00 ? 16  LYS A C    3  
ATOM   2933  O O    . LYS A 1 16 ? 11.168  -4.483  -6.351  1.00 1.00 ? 16  LYS A O    3  
ATOM   2934  C CB   . LYS A 1 16 ? 9.079   -3.220  -4.137  1.00 1.00 ? 16  LYS A CB   3  
ATOM   2935  C CG   . LYS A 1 16 ? 7.750   -2.489  -3.941  1.00 1.00 ? 16  LYS A CG   3  
ATOM   2936  C CD   . LYS A 1 16 ? 7.413   -1.637  -5.178  1.00 1.00 ? 16  LYS A CD   3  
ATOM   2937  C CE   . LYS A 1 16 ? 6.431   -0.541  -4.816  1.00 1.00 ? 16  LYS A CE   3  
ATOM   2938  N NZ   . LYS A 1 16 ? 6.178   0.298   -6.019  1.00 1.00 ? 16  LYS A NZ   3  
ATOM   2939  H H    . LYS A 1 16 ? 7.366   -5.050  -4.453  1.00 1.00 ? 16  LYS A H    3  
ATOM   2940  H HA   . LYS A 1 16 ? 8.871   -3.482  -6.254  1.00 1.00 ? 16  LYS A HA   3  
ATOM   2941  H HB2  . LYS A 1 16 ? 9.273   -3.834  -3.271  1.00 1.00 ? 16  LYS A HB2  3  
ATOM   2942  H HB3  . LYS A 1 16 ? 9.871   -2.496  -4.247  1.00 1.00 ? 16  LYS A HB3  3  
ATOM   2943  H HG2  . LYS A 1 16 ? 6.976   -3.220  -3.790  1.00 1.00 ? 16  LYS A HG2  3  
ATOM   2944  H HG3  . LYS A 1 16 ? 7.818   -1.857  -3.072  1.00 1.00 ? 16  LYS A HG3  3  
ATOM   2945  H HD2  . LYS A 1 16 ? 8.304   -1.188  -5.573  1.00 1.00 ? 16  LYS A HD2  3  
ATOM   2946  H HD3  . LYS A 1 16 ? 6.956   -2.260  -5.928  1.00 1.00 ? 16  LYS A HD3  3  
ATOM   2947  H HE2  . LYS A 1 16 ? 5.511   -0.985  -4.485  1.00 1.00 ? 16  LYS A HE2  3  
ATOM   2948  H HE3  . LYS A 1 16 ? 6.850   0.068   -4.031  1.00 1.00 ? 16  LYS A HE3  3  
ATOM   2949  H HZ1  . LYS A 1 16 ? 6.368   1.292   -5.792  1.00 1.00 ? 16  LYS A HZ1  3  
ATOM   2950  H HZ2  . LYS A 1 16 ? 5.186   0.191   -6.312  1.00 1.00 ? 16  LYS A HZ2  3  
ATOM   2951  H HZ3  . LYS A 1 16 ? 6.804   -0.005  -6.793  1.00 1.00 ? 16  LYS A HZ3  3  
ATOM   2952  N N    . LEU A 1 17 ? 10.484  -5.927  -4.766  1.00 1.00 ? 17  LEU A N    3  
ATOM   2953  C CA   . LEU A 1 17 ? 11.712  -6.740  -4.805  1.00 1.00 ? 17  LEU A CA   3  
ATOM   2954  C C    . LEU A 1 17 ? 11.358  -8.198  -5.085  1.00 1.00 ? 17  LEU A C    3  
ATOM   2955  O O    . LEU A 1 17 ? 12.130  -9.107  -4.780  1.00 1.00 ? 17  LEU A O    3  
ATOM   2956  C CB   . LEU A 1 17 ? 12.482  -6.611  -3.453  1.00 1.00 ? 17  LEU A CB   3  
ATOM   2957  C CG   . LEU A 1 17 ? 11.576  -5.992  -2.382  1.00 1.00 ? 17  LEU A CG   3  
ATOM   2958  C CD1  . LEU A 1 17 ? 10.473  -6.966  -2.001  1.00 1.00 ? 17  LEU A CD1  3  
ATOM   2959  C CD2  . LEU A 1 17 ? 12.409  -5.638  -1.157  1.00 1.00 ? 17  LEU A CD2  3  
ATOM   2960  H H    . LEU A 1 17 ? 9.766   -6.171  -4.137  1.00 1.00 ? 17  LEU A H    3  
ATOM   2961  H HA   . LEU A 1 17 ? 12.349  -6.389  -5.609  1.00 1.00 ? 17  LEU A HA   3  
ATOM   2962  H HB2  . LEU A 1 17 ? 12.814  -7.585  -3.110  1.00 1.00 ? 17  LEU A HB2  3  
ATOM   2963  H HB3  . LEU A 1 17 ? 13.345  -5.973  -3.584  1.00 1.00 ? 17  LEU A HB3  3  
ATOM   2964  H HG   . LEU A 1 17 ? 11.127  -5.109  -2.761  1.00 1.00 ? 17  LEU A HG   3  
ATOM   2965  H HD11 . LEU A 1 17 ? 10.867  -7.709  -1.334  1.00 1.00 ? 17  LEU A HD11 3  
ATOM   2966  H HD12 . LEU A 1 17 ? 10.094  -7.442  -2.891  1.00 1.00 ? 17  LEU A HD12 3  
ATOM   2967  H HD13 . LEU A 1 17 ? 9.673   -6.429  -1.514  1.00 1.00 ? 17  LEU A HD13 3  
ATOM   2968  H HD21 . LEU A 1 17 ? 12.784  -6.542  -0.703  1.00 1.00 ? 17  LEU A HD21 3  
ATOM   2969  H HD22 . LEU A 1 17 ? 11.791  -5.106  -0.451  1.00 1.00 ? 17  LEU A HD22 3  
ATOM   2970  H HD23 . LEU A 1 17 ? 13.237  -5.013  -1.458  1.00 1.00 ? 17  LEU A HD23 3  
ATOM   2971  N N    . ALA A 1 18 ? 10.190  -8.416  -5.671  1.00 1.00 ? 18  ALA A N    3  
ATOM   2972  C CA   . ALA A 1 18 ? 9.758   -9.769  -5.983  1.00 1.00 ? 18  ALA A CA   3  
ATOM   2973  C C    . ALA A 1 18 ? 9.832   -10.654 -4.745  1.00 1.00 ? 18  ALA A C    3  
ATOM   2974  O O    . ALA A 1 18 ? 10.804  -11.383 -4.552  1.00 1.00 ? 18  ALA A O    3  
ATOM   2975  C CB   . ALA A 1 18 ? 10.646  -10.360 -7.075  1.00 1.00 ? 18  ALA A CB   3  
ATOM   2976  H H    . ALA A 1 18 ? 9.612   -7.656  -5.899  1.00 1.00 ? 18  ALA A H    3  
ATOM   2977  H HA   . ALA A 1 18 ? 8.739   -9.740  -6.336  1.00 1.00 ? 18  ALA A HA   3  
ATOM   2978  H HB1  . ALA A 1 18 ? 10.366  -11.388 -7.248  1.00 1.00 ? 18  ALA A HB1  3  
ATOM   2979  H HB2  . ALA A 1 18 ? 11.680  -10.316 -6.763  1.00 1.00 ? 18  ALA A HB2  3  
ATOM   2980  H HB3  . ALA A 1 18 ? 10.522  -9.793  -7.986  1.00 1.00 ? 18  ALA A HB3  3  
ATOM   2981  N N    . LEU A 1 19 ? 8.800   -10.582 -3.905  1.00 1.00 ? 19  LEU A N    3  
ATOM   2982  C CA   . LEU A 1 19 ? 8.747   -11.380 -2.675  1.00 1.00 ? 19  LEU A CA   3  
ATOM   2983  C C    . LEU A 1 19 ? 7.413   -12.112 -2.573  1.00 1.00 ? 19  LEU A C    3  
ATOM   2984  O O    . LEU A 1 19 ? 6.609   -12.099 -3.505  1.00 1.00 ? 19  LEU A O    3  
ATOM   2985  C CB   . LEU A 1 19 ? 8.957   -10.461 -1.449  1.00 1.00 ? 19  LEU A CB   3  
ATOM   2986  C CG   . LEU A 1 19 ? 10.370  -10.629 -0.881  1.00 1.00 ? 19  LEU A CG   3  
ATOM   2987  C CD1  . LEU A 1 19 ? 11.421  -10.194 -1.940  1.00 1.00 ? 19  LEU A CD1  3  
ATOM   2988  C CD2  . LEU A 1 19 ? 10.501  -9.794  0.410   1.00 1.00 ? 19  LEU A CD2  3  
ATOM   2989  H H    . LEU A 1 19 ? 8.058   -9.975  -4.113  1.00 1.00 ? 19  LEU A H    3  
ATOM   2990  H HA   . LEU A 1 19 ? 9.525   -12.127 -2.694  1.00 1.00 ? 19  LEU A HA   3  
ATOM   2991  H HB2  . LEU A 1 19 ? 8.832   -9.432  -1.750  1.00 1.00 ? 19  LEU A HB2  3  
ATOM   2992  H HB3  . LEU A 1 19 ? 8.240   -10.701 -0.683  1.00 1.00 ? 19  LEU A HB3  3  
ATOM   2993  H HG   . LEU A 1 19 ? 10.524  -11.672 -0.642  1.00 1.00 ? 19  LEU A HG   3  
ATOM   2994  H HD11 . LEU A 1 19 ? 10.966  -9.552  -2.689  1.00 1.00 ? 19  LEU A HD11 3  
ATOM   2995  H HD12 . LEU A 1 19 ? 11.811  -11.073 -2.428  1.00 1.00 ? 19  LEU A HD12 3  
ATOM   2996  H HD13 . LEU A 1 19 ? 12.235  -9.662  -1.465  1.00 1.00 ? 19  LEU A HD13 3  
ATOM   2997  H HD21 . LEU A 1 19 ? 10.149  -10.379 1.247   1.00 1.00 ? 19  LEU A HD21 3  
ATOM   2998  H HD22 . LEU A 1 19 ? 9.906   -8.892  0.335   1.00 1.00 ? 19  LEU A HD22 3  
ATOM   2999  H HD23 . LEU A 1 19 ? 11.535  -9.532  0.569   1.00 1.00 ? 19  LEU A HD23 3  
ATOM   3000  N N    . GLY A 1 20 ? 7.200   -12.759 -1.426  1.00 1.00 ? 20  GLY A N    3  
ATOM   3001  C CA   . GLY A 1 20 ? 5.969   -13.513 -1.188  1.00 1.00 ? 20  GLY A CA   3  
ATOM   3002  C C    . GLY A 1 20 ? 6.189   -15.000 -1.432  1.00 1.00 ? 20  GLY A C    3  
ATOM   3003  O O    . GLY A 1 20 ? 5.366   -15.827 -1.046  1.00 1.00 ? 20  GLY A O    3  
ATOM   3004  H H    . GLY A 1 20 ? 7.891   -12.735 -0.729  1.00 1.00 ? 20  GLY A H    3  
ATOM   3005  H HA2  . GLY A 1 20 ? 5.640   -13.363 -0.166  1.00 1.00 ? 20  GLY A HA2  3  
ATOM   3006  H HA3  . GLY A 1 20 ? 5.198   -13.161 -1.858  1.00 1.00 ? 20  GLY A HA3  3  
ATOM   3007  N N    . ALA A 1 21 ? 7.307   -15.333 -2.076  1.00 1.00 ? 21  ALA A N    3  
ATOM   3008  C CA   . ALA A 1 21 ? 7.618   -16.726 -2.367  1.00 1.00 ? 21  ALA A CA   3  
ATOM   3009  C C    . ALA A 1 21 ? 8.214   -17.403 -1.141  1.00 1.00 ? 21  ALA A C    3  
ATOM   3010  O O    . ALA A 1 21 ? 7.586   -18.270 -0.535  1.00 1.00 ? 21  ALA A O    3  
ATOM   3011  C CB   . ALA A 1 21 ? 8.609   -16.810 -3.529  1.00 1.00 ? 21  ALA A CB   3  
ATOM   3012  H H    . ALA A 1 21 ? 7.931   -14.633 -2.358  1.00 1.00 ? 21  ALA A H    3  
ATOM   3013  H HA   . ALA A 1 21 ? 6.711   -17.241 -2.646  1.00 1.00 ? 21  ALA A HA   3  
ATOM   3014  H HB1  . ALA A 1 21 ? 8.152   -16.407 -4.421  1.00 1.00 ? 21  ALA A HB1  3  
ATOM   3015  H HB2  . ALA A 1 21 ? 8.879   -17.842 -3.697  1.00 1.00 ? 21  ALA A HB2  3  
ATOM   3016  H HB3  . ALA A 1 21 ? 9.496   -16.241 -3.289  1.00 1.00 ? 21  ALA A HB3  3  
ATOM   3017  N N    . ASP A 1 22 ? 9.430   -17.001 -0.780  1.00 1.00 ? 22  ASP A N    3  
ATOM   3018  C CA   . ASP A 1 22 ? 10.109  -17.575 0.380   1.00 1.00 ? 22  ASP A CA   3  
ATOM   3019  C C    . ASP A 1 22 ? 9.907   -16.701 1.609   1.00 1.00 ? 22  ASP A C    3  
ATOM   3020  O O    . ASP A 1 22 ? 10.498  -16.950 2.658   1.00 1.00 ? 22  ASP A O    3  
ATOM   3021  C CB   . ASP A 1 22 ? 11.605  -17.711 0.099   1.00 1.00 ? 22  ASP A CB   3  
ATOM   3022  C CG   . ASP A 1 22 ? 12.290  -18.415 1.265   1.00 1.00 ? 22  ASP A CG   3  
ATOM   3023  O OD1  . ASP A 1 22 ? 11.589  -18.998 2.075   1.00 1.00 ? 22  ASP A OD1  3  
ATOM   3024  O OD2  . ASP A 1 22 ? 13.507  -18.363 1.328   1.00 1.00 ? 22  ASP A OD2  3  
ATOM   3025  H H    . ASP A 1 22 ? 9.880   -16.304 -1.302  1.00 1.00 ? 22  ASP A H    3  
ATOM   3026  H HA   . ASP A 1 22 ? 9.705   -18.556 0.579   1.00 1.00 ? 22  ASP A HA   3  
ATOM   3027  H HB2  . ASP A 1 22 ? 11.748  -18.289 -0.803  1.00 1.00 ? 22  ASP A HB2  3  
ATOM   3028  H HB3  . ASP A 1 22 ? 12.035  -16.730 -0.031  1.00 1.00 ? 22  ASP A HB3  3  
ATOM   3029  N N    . VAL A 1 23 ? 9.072   -15.670 1.473   1.00 1.00 ? 23  VAL A N    3  
ATOM   3030  C CA   . VAL A 1 23 ? 8.794   -14.751 2.582   1.00 1.00 ? 23  VAL A CA   3  
ATOM   3031  C C    . VAL A 1 23 ? 7.303   -14.726 2.893   1.00 1.00 ? 23  VAL A C    3  
ATOM   3032  O O    . VAL A 1 23 ? 6.471   -14.595 1.995   1.00 1.00 ? 23  VAL A O    3  
ATOM   3033  C CB   . VAL A 1 23 ? 9.266   -13.345 2.215   1.00 1.00 ? 23  VAL A CB   3  
ATOM   3034  C CG1  . VAL A 1 23 ? 8.997   -12.399 3.384   1.00 1.00 ? 23  VAL A CG1  3  
ATOM   3035  C CG2  . VAL A 1 23 ? 10.769  -13.377 1.914   1.00 1.00 ? 23  VAL A CG2  3  
ATOM   3036  H H    . VAL A 1 23 ? 8.634   -15.521 0.608   1.00 1.00 ? 23  VAL A H    3  
ATOM   3037  H HA   . VAL A 1 23 ? 9.325   -15.073 3.469   1.00 1.00 ? 23  VAL A HA   3  
ATOM   3038  H HB   . VAL A 1 23 ? 8.728   -13.001 1.343   1.00 1.00 ? 23  VAL A HB   3  
ATOM   3039  H HG11 . VAL A 1 23 ? 9.508   -11.465 3.216   1.00 1.00 ? 23  VAL A HG11 3  
ATOM   3040  H HG12 . VAL A 1 23 ? 9.356   -12.849 4.298   1.00 1.00 ? 23  VAL A HG12 3  
ATOM   3041  H HG13 . VAL A 1 23 ? 7.934   -12.221 3.463   1.00 1.00 ? 23  VAL A HG13 3  
ATOM   3042  H HG21 . VAL A 1 23 ? 11.159  -12.369 1.918   1.00 1.00 ? 23  VAL A HG21 3  
ATOM   3043  H HG22 . VAL A 1 23 ? 10.932  -13.820 0.943   1.00 1.00 ? 23  VAL A HG22 3  
ATOM   3044  H HG23 . VAL A 1 23 ? 11.276  -13.962 2.667   1.00 1.00 ? 23  VAL A HG23 3  
ATOM   3045  N N    . VAL A 1 24 ? 6.973   -14.858 4.173   1.00 1.00 ? 24  VAL A N    3  
ATOM   3046  C CA   . VAL A 1 24 ? 5.580   -14.854 4.599   1.00 1.00 ? 24  VAL A CA   3  
ATOM   3047  C C    . VAL A 1 24 ? 4.991   -13.453 4.472   1.00 1.00 ? 24  VAL A C    3  
ATOM   3048  O O    . VAL A 1 24 ? 5.577   -12.479 4.941   1.00 1.00 ? 24  VAL A O    3  
ATOM   3049  C CB   . VAL A 1 24 ? 5.477   -15.322 6.052   1.00 1.00 ? 24  VAL A CB   3  
ATOM   3050  C CG1  . VAL A 1 24 ? 6.148   -14.295 6.971   1.00 1.00 ? 24  VAL A CG1  3  
ATOM   3051  C CG2  . VAL A 1 24 ? 4.001   -15.465 6.436   1.00 1.00 ? 24  VAL A CG2  3  
ATOM   3052  H H    . VAL A 1 24 ? 7.682   -14.963 4.843   1.00 1.00 ? 24  VAL A H    3  
ATOM   3053  H HA   . VAL A 1 24 ? 5.018   -15.531 3.974   1.00 1.00 ? 24  VAL A HA   3  
ATOM   3054  H HB   . VAL A 1 24 ? 5.973   -16.276 6.156   1.00 1.00 ? 24  VAL A HB   3  
ATOM   3055  H HG11 . VAL A 1 24 ? 6.332   -14.744 7.936   1.00 1.00 ? 24  VAL A HG11 3  
ATOM   3056  H HG12 . VAL A 1 24 ? 5.501   -13.438 7.092   1.00 1.00 ? 24  VAL A HG12 3  
ATOM   3057  H HG13 . VAL A 1 24 ? 7.086   -13.978 6.537   1.00 1.00 ? 24  VAL A HG13 3  
ATOM   3058  H HG21 . VAL A 1 24 ? 3.497   -16.081 5.705   1.00 1.00 ? 24  VAL A HG21 3  
ATOM   3059  H HG22 . VAL A 1 24 ? 3.541   -14.488 6.465   1.00 1.00 ? 24  VAL A HG22 3  
ATOM   3060  H HG23 . VAL A 1 24 ? 3.928   -15.928 7.409   1.00 1.00 ? 24  VAL A HG23 3  
ATOM   3061  N N    . VAL A 1 25 ? 3.827   -13.361 3.838   1.00 1.00 ? 25  VAL A N    3  
ATOM   3062  C CA   . VAL A 1 25 ? 3.166   -12.071 3.653   1.00 1.00 ? 25  VAL A CA   3  
ATOM   3063  C C    . VAL A 1 25 ? 2.261   -11.765 4.838   1.00 1.00 ? 25  VAL A C    3  
ATOM   3064  O O    . VAL A 1 25 ? 1.460   -12.603 5.252   1.00 1.00 ? 25  VAL A O    3  
ATOM   3065  C CB   . VAL A 1 25 ? 2.338   -12.090 2.366   1.00 1.00 ? 25  VAL A CB   3  
ATOM   3066  C CG1  . VAL A 1 25 ? 1.901   -10.667 2.016   1.00 1.00 ? 25  VAL A CG1  3  
ATOM   3067  C CG2  . VAL A 1 25 ? 3.157   -12.706 1.224   1.00 1.00 ? 25  VAL A CG2  3  
ATOM   3068  H H    . VAL A 1 25 ? 3.404   -14.173 3.486   1.00 1.00 ? 25  VAL A H    3  
ATOM   3069  H HA   . VAL A 1 25 ? 3.912   -11.293 3.575   1.00 1.00 ? 25  VAL A HA   3  
ATOM   3070  H HB   . VAL A 1 25 ? 1.471   -12.685 2.524   1.00 1.00 ? 25  VAL A HB   3  
ATOM   3071  H HG11 . VAL A 1 25 ? 1.169   -10.698 1.222   1.00 1.00 ? 25  VAL A HG11 3  
ATOM   3072  H HG12 . VAL A 1 25 ? 2.757   -10.096 1.697   1.00 1.00 ? 25  VAL A HG12 3  
ATOM   3073  H HG13 . VAL A 1 25 ? 1.465   -10.203 2.891   1.00 1.00 ? 25  VAL A HG13 3  
ATOM   3074  H HG21 . VAL A 1 25 ? 3.073   -13.784 1.261   1.00 1.00 ? 25  VAL A HG21 3  
ATOM   3075  H HG22 . VAL A 1 25 ? 4.186   -12.434 1.336   1.00 1.00 ? 25  VAL A HG22 3  
ATOM   3076  H HG23 . VAL A 1 25 ? 2.786   -12.354 0.272   1.00 1.00 ? 25  VAL A HG23 3  
ATOM   3077  N N    . THR A 1 26 ? 2.400   -10.559 5.390   1.00 1.00 ? 26  THR A N    3  
ATOM   3078  C CA   . THR A 1 26 ? 1.595   -10.144 6.535   1.00 1.00 ? 26  THR A CA   3  
ATOM   3079  C C    . THR A 1 26 ? 1.126   -8.708  6.363   1.00 1.00 ? 26  THR A C    3  
ATOM   3080  O O    . THR A 1 26 ? 1.749   -7.923  5.649   1.00 1.00 ? 26  THR A O    3  
ATOM   3081  C CB   . THR A 1 26 ? 2.422   -10.258 7.815   1.00 1.00 ? 26  THR A CB   3  
ATOM   3082  O OG1  . THR A 1 26 ? 3.594   -9.464  7.695   1.00 1.00 ? 26  THR A OG1  3  
ATOM   3083  C CG2  . THR A 1 26 ? 2.810   -11.712 8.040   1.00 1.00 ? 26  THR A CG2  3  
ATOM   3084  H H    . THR A 1 26 ? 3.060   -9.935  5.021   1.00 1.00 ? 26  THR A H    3  
ATOM   3085  H HA   . THR A 1 26 ? 0.727   -10.786 6.624   1.00 1.00 ? 26  THR A HA   3  
ATOM   3086  H HB   . THR A 1 26 ? 1.837   -9.916  8.653   1.00 1.00 ? 26  THR A HB   3  
ATOM   3087  H HG1  . THR A 1 26 ? 4.313   -10.037 7.414   1.00 1.00 ? 26  THR A HG1  3  
ATOM   3088  H HG21 . THR A 1 26 ? 3.261   -11.815 9.017   1.00 1.00 ? 26  THR A HG21 3  
ATOM   3089  H HG22 . THR A 1 26 ? 3.515   -12.019 7.281   1.00 1.00 ? 26  THR A HG22 3  
ATOM   3090  H HG23 . THR A 1 26 ? 1.926   -12.328 7.985   1.00 1.00 ? 26  THR A HG23 3  
ATOM   3091  N N    . ALA A 1 27 ? 0.024   -8.370  7.023   1.00 1.00 ? 27  ALA A N    3  
ATOM   3092  C CA   . ALA A 1 27 ? -0.529  -7.023  6.945   1.00 1.00 ? 27  ALA A CA   3  
ATOM   3093  C C    . ALA A 1 27 ? 0.055   -6.149  8.049   1.00 1.00 ? 27  ALA A C    3  
ATOM   3094  O O    . ALA A 1 27 ? 0.038   -4.924  7.967   1.00 1.00 ? 27  ALA A O    3  
ATOM   3095  C CB   . ALA A 1 27 ? -2.052  -7.089  7.087   1.00 1.00 ? 27  ALA A CB   3  
ATOM   3096  H H    . ALA A 1 27 ? -0.422  -9.039  7.575   1.00 1.00 ? 27  ALA A H    3  
ATOM   3097  H HA   . ALA A 1 27 ? -0.287  -6.591  5.984   1.00 1.00 ? 27  ALA A HA   3  
ATOM   3098  H HB1  . ALA A 1 27 ? -2.409  -7.990  6.616   1.00 1.00 ? 27  ALA A HB1  3  
ATOM   3099  H HB2  . ALA A 1 27 ? -2.496  -6.229  6.607   1.00 1.00 ? 27  ALA A HB2  3  
ATOM   3100  H HB3  . ALA A 1 27 ? -2.328  -7.099  8.133   1.00 1.00 ? 27  ALA A HB3  3  
ATOM   3101  N N    . ASP A 1 28 ? 0.565   -6.784  9.091   1.00 1.00 ? 28  ASP A N    3  
ATOM   3102  C CA   . ASP A 1 28 ? 1.140   -6.042  10.204  1.00 1.00 ? 28  ASP A CA   3  
ATOM   3103  C C    . ASP A 1 28 ? 2.569   -5.636  9.879   1.00 1.00 ? 28  ASP A C    3  
ATOM   3104  O O    . ASP A 1 28 ? 3.238   -4.985  10.685  1.00 1.00 ? 28  ASP A O    3  
ATOM   3105  C CB   . ASP A 1 28 ? 1.129   -6.903  11.470  1.00 1.00 ? 28  ASP A CB   3  
ATOM   3106  C CG   . ASP A 1 28 ? 1.872   -8.210  11.218  1.00 1.00 ? 28  ASP A CG   3  
ATOM   3107  O OD1  . ASP A 1 28 ? 2.543   -8.299  10.202  1.00 1.00 ? 28  ASP A OD1  3  
ATOM   3108  O OD2  . ASP A 1 28 ? 1.765   -9.101  12.045  1.00 1.00 ? 28  ASP A OD2  3  
ATOM   3109  H H    . ASP A 1 28 ? 0.551   -7.763  9.117   1.00 1.00 ? 28  ASP A H    3  
ATOM   3110  H HA   . ASP A 1 28 ? 0.549   -5.152  10.373  1.00 1.00 ? 28  ASP A HA   3  
ATOM   3111  H HB2  . ASP A 1 28 ? 1.610   -6.367  12.275  1.00 1.00 ? 28  ASP A HB2  3  
ATOM   3112  H HB3  . ASP A 1 28 ? 0.108   -7.123  11.745  1.00 1.00 ? 28  ASP A HB3  3  
ATOM   3113  N N    . SER A 1 29 ? 3.038   -6.026  8.695   1.00 1.00 ? 29  SER A N    3  
ATOM   3114  C CA   . SER A 1 29 ? 4.395   -5.696  8.283   1.00 1.00 ? 29  SER A CA   3  
ATOM   3115  C C    . SER A 1 29 ? 4.454   -4.270  7.753   1.00 1.00 ? 29  SER A C    3  
ATOM   3116  O O    . SER A 1 29 ? 4.196   -4.028  6.573   1.00 1.00 ? 29  SER A O    3  
ATOM   3117  C CB   . SER A 1 29 ? 4.860   -6.666  7.197   1.00 1.00 ? 29  SER A CB   3  
ATOM   3118  O OG   . SER A 1 29 ? 5.983   -6.114  6.522   1.00 1.00 ? 29  SER A OG   3  
ATOM   3119  H H    . SER A 1 29 ? 2.462   -6.543  8.090   1.00 1.00 ? 29  SER A H    3  
ATOM   3120  H HA   . SER A 1 29 ? 5.052   -5.785  9.135   1.00 1.00 ? 29  SER A HA   3  
ATOM   3121  H HB2  . SER A 1 29 ? 5.142   -7.604  7.647   1.00 1.00 ? 29  SER A HB2  3  
ATOM   3122  H HB3  . SER A 1 29 ? 4.051   -6.832  6.497   1.00 1.00 ? 29  SER A HB3  3  
ATOM   3123  H HG   . SER A 1 29 ? 5.744   -5.234  6.217   1.00 1.00 ? 29  SER A HG   3  
ATOM   3124  N N    . GLU A 1 30 ? 4.796   -3.330  8.630   1.00 1.00 ? 30  GLU A N    3  
ATOM   3125  C CA   . GLU A 1 30 ? 4.882   -1.926  8.241   1.00 1.00 ? 30  GLU A CA   3  
ATOM   3126  C C    . GLU A 1 30 ? 5.543   -1.797  6.872   1.00 1.00 ? 30  GLU A C    3  
ATOM   3127  O O    . GLU A 1 30 ? 6.474   -2.537  6.555   1.00 1.00 ? 30  GLU A O    3  
ATOM   3128  C CB   . GLU A 1 30 ? 5.699   -1.153  9.276   1.00 1.00 ? 30  GLU A CB   3  
ATOM   3129  C CG   . GLU A 1 30 ? 5.048   -1.291  10.652  1.00 1.00 ? 30  GLU A CG   3  
ATOM   3130  C CD   . GLU A 1 30 ? 5.917   -0.624  11.711  1.00 1.00 ? 30  GLU A CD   3  
ATOM   3131  O OE1  . GLU A 1 30 ? 6.943   -0.072  11.349  1.00 1.00 ? 30  GLU A OE1  3  
ATOM   3132  O OE2  . GLU A 1 30 ? 5.544   -0.676  12.872  1.00 1.00 ? 30  GLU A OE2  3  
ATOM   3133  H H    . GLU A 1 30 ? 4.988   -3.583  9.555   1.00 1.00 ? 30  GLU A H    3  
ATOM   3134  H HA   . GLU A 1 30 ? 3.890   -1.505  8.194   1.00 1.00 ? 30  GLU A HA   3  
ATOM   3135  H HB2  . GLU A 1 30 ? 6.708   -1.540  9.308   1.00 1.00 ? 30  GLU A HB2  3  
ATOM   3136  H HB3  . GLU A 1 30 ? 5.722   -0.111  9.001   1.00 1.00 ? 30  GLU A HB3  3  
ATOM   3137  H HG2  . GLU A 1 30 ? 4.078   -0.819  10.637  1.00 1.00 ? 30  GLU A HG2  3  
ATOM   3138  H HG3  . GLU A 1 30 ? 4.934   -2.338  10.892  1.00 1.00 ? 30  GLU A HG3  3  
ATOM   3139  N N    . PHE A 1 31 ? 5.050   -0.860  6.068   1.00 1.00 ? 31  PHE A N    3  
ATOM   3140  C CA   . PHE A 1 31 ? 5.597   -0.646  4.736   1.00 1.00 ? 31  PHE A CA   3  
ATOM   3141  C C    . PHE A 1 31 ? 7.112   -0.480  4.801   1.00 1.00 ? 31  PHE A C    3  
ATOM   3142  O O    . PHE A 1 31 ? 7.726   -0.711  5.842   1.00 1.00 ? 31  PHE A O    3  
ATOM   3143  C CB   . PHE A 1 31 ? 4.972   0.600   4.113   1.00 1.00 ? 31  PHE A CB   3  
ATOM   3144  C CG   . PHE A 1 31 ? 3.550   0.327   3.727   1.00 1.00 ? 31  PHE A CG   3  
ATOM   3145  C CD1  . PHE A 1 31 ? 3.272   -0.276  2.497   1.00 1.00 ? 31  PHE A CD1  3  
ATOM   3146  C CD2  . PHE A 1 31 ? 2.511   0.686   4.587   1.00 1.00 ? 31  PHE A CD2  3  
ATOM   3147  C CE1  . PHE A 1 31 ? 1.950   -0.528  2.132   1.00 1.00 ? 31  PHE A CE1  3  
ATOM   3148  C CE2  . PHE A 1 31 ? 1.194   0.436   4.225   1.00 1.00 ? 31  PHE A CE2  3  
ATOM   3149  C CZ   . PHE A 1 31 ? 0.911   -0.169  2.996   1.00 1.00 ? 31  PHE A CZ   3  
ATOM   3150  H H    . PHE A 1 31 ? 4.305   -0.304  6.376   1.00 1.00 ? 31  PHE A H    3  
ATOM   3151  H HA   . PHE A 1 31 ? 5.363   -1.500  4.117   1.00 1.00 ? 31  PHE A HA   3  
ATOM   3152  H HB2  . PHE A 1 31 ? 4.992   1.402   4.825   1.00 1.00 ? 31  PHE A HB2  3  
ATOM   3153  H HB3  . PHE A 1 31 ? 5.525   0.877   3.236   1.00 1.00 ? 31  PHE A HB3  3  
ATOM   3154  H HD1  . PHE A 1 31 ? 4.078   -0.547  1.833   1.00 1.00 ? 31  PHE A HD1  3  
ATOM   3155  H HD2  . PHE A 1 31 ? 2.727   1.155   5.535   1.00 1.00 ? 31  PHE A HD2  3  
ATOM   3156  H HE1  . PHE A 1 31 ? 1.731   -0.995  1.184   1.00 1.00 ? 31  PHE A HE1  3  
ATOM   3157  H HE2  . PHE A 1 31 ? 0.396   0.713   4.891   1.00 1.00 ? 31  PHE A HE2  3  
ATOM   3158  H HZ   . PHE A 1 31 ? -0.106  -0.360  2.716   1.00 1.00 ? 31  PHE A HZ   3  
ATOM   3159  N N    . SER A 1 32 ? 7.716   -0.080  3.685   1.00 1.00 ? 32  SER A N    3  
ATOM   3160  C CA   . SER A 1 32 ? 9.169   0.109   3.624   1.00 1.00 ? 32  SER A CA   3  
ATOM   3161  C C    . SER A 1 32 ? 9.504   1.488   3.080   1.00 1.00 ? 32  SER A C    3  
ATOM   3162  O O    . SER A 1 32 ? 8.970   1.909   2.055   1.00 1.00 ? 32  SER A O    3  
ATOM   3163  C CB   . SER A 1 32 ? 9.791   -0.963  2.729   1.00 1.00 ? 32  SER A CB   3  
ATOM   3164  O OG   . SER A 1 32 ? 11.190  -0.742  2.640   1.00 1.00 ? 32  SER A OG   3  
ATOM   3165  H H    . SER A 1 32 ? 7.176   0.092   2.885   1.00 1.00 ? 32  SER A H    3  
ATOM   3166  H HA   . SER A 1 32 ? 9.593   0.019   4.615   1.00 1.00 ? 32  SER A HA   3  
ATOM   3167  H HB2  . SER A 1 32 ? 9.610   -1.938  3.155   1.00 1.00 ? 32  SER A HB2  3  
ATOM   3168  H HB3  . SER A 1 32 ? 9.344   -0.914  1.745   1.00 1.00 ? 32  SER A HB3  3  
ATOM   3169  H HG   . SER A 1 32 ? 11.398  0.045   3.149   1.00 1.00 ? 32  SER A HG   3  
ATOM   3170  N N    . LYS A 1 33 ? 10.393  2.188   3.776   1.00 1.00 ? 33  LYS A N    3  
ATOM   3171  C CA   . LYS A 1 33 ? 10.793  3.524   3.354   1.00 1.00 ? 33  LYS A CA   3  
ATOM   3172  C C    . LYS A 1 33 ? 12.091  3.934   4.043   1.00 1.00 ? 33  LYS A C    3  
ATOM   3173  O O    . LYS A 1 33 ? 12.089  4.770   4.945   1.00 1.00 ? 33  LYS A O    3  
ATOM   3174  C CB   . LYS A 1 33 ? 9.696   4.532   3.695   1.00 1.00 ? 33  LYS A CB   3  
ATOM   3175  C CG   . LYS A 1 33 ? 10.051  5.895   3.094   1.00 1.00 ? 33  LYS A CG   3  
ATOM   3176  C CD   . LYS A 1 33 ? 8.909   6.879   3.354   1.00 1.00 ? 33  LYS A CD   3  
ATOM   3177  C CE   . LYS A 1 33 ? 9.247   8.231   2.723   1.00 1.00 ? 33  LYS A CE   3  
ATOM   3178  N NZ   . LYS A 1 33 ? 10.405  8.839   3.441   1.00 1.00 ? 33  LYS A NZ   3  
ATOM   3179  H H    . LYS A 1 33 ? 10.784  1.800   4.587   1.00 1.00 ? 33  LYS A H    3  
ATOM   3180  H HA   . LYS A 1 33 ? 10.946  3.522   2.287   1.00 1.00 ? 33  LYS A HA   3  
ATOM   3181  H HB2  . LYS A 1 33 ? 8.754   4.192   3.289   1.00 1.00 ? 33  LYS A HB2  3  
ATOM   3182  H HB3  . LYS A 1 33 ? 9.614   4.627   4.767   1.00 1.00 ? 33  LYS A HB3  3  
ATOM   3183  H HG2  . LYS A 1 33 ? 10.957  6.267   3.547   1.00 1.00 ? 33  LYS A HG2  3  
ATOM   3184  H HG3  . LYS A 1 33 ? 10.195  5.792   2.029   1.00 1.00 ? 33  LYS A HG3  3  
ATOM   3185  H HD2  . LYS A 1 33 ? 7.997   6.497   2.919   1.00 1.00 ? 33  LYS A HD2  3  
ATOM   3186  H HD3  . LYS A 1 33 ? 8.777   7.004   4.417   1.00 1.00 ? 33  LYS A HD3  3  
ATOM   3187  H HE2  . LYS A 1 33 ? 9.501   8.090   1.684   1.00 1.00 ? 33  LYS A HE2  3  
ATOM   3188  H HE3  . LYS A 1 33 ? 8.393   8.887   2.798   1.00 1.00 ? 33  LYS A HE3  3  
ATOM   3189  H HZ1  . LYS A 1 33 ? 10.149  9.003   4.434   1.00 1.00 ? 33  LYS A HZ1  3  
ATOM   3190  H HZ2  . LYS A 1 33 ? 10.654  9.744   2.991   1.00 1.00 ? 33  LYS A HZ2  3  
ATOM   3191  H HZ3  . LYS A 1 33 ? 11.218  8.193   3.397   1.00 1.00 ? 33  LYS A HZ3  3  
ATOM   3192  N N    . LEU A 1 34 ? 13.201  3.343   3.610   1.00 1.00 ? 34  LEU A N    3  
ATOM   3193  C CA   . LEU A 1 34 ? 14.509  3.657   4.189   1.00 1.00 ? 34  LEU A CA   3  
ATOM   3194  C C    . LEU A 1 34 ? 15.208  4.726   3.361   1.00 1.00 ? 34  LEU A C    3  
ATOM   3195  O O    . LEU A 1 34 ? 15.185  4.686   2.131   1.00 1.00 ? 34  LEU A O    3  
ATOM   3196  C CB   . LEU A 1 34 ? 15.374  2.388   4.241   1.00 1.00 ? 34  LEU A CB   3  
ATOM   3197  C CG   . LEU A 1 34 ? 14.997  1.558   5.469   1.00 1.00 ? 34  LEU A CG   3  
ATOM   3198  C CD1  . LEU A 1 34 ? 13.505  1.212   5.417   1.00 1.00 ? 34  LEU A CD1  3  
ATOM   3199  C CD2  . LEU A 1 34 ? 15.824  0.270   5.486   1.00 1.00 ? 34  LEU A CD2  3  
ATOM   3200  H H    . LEU A 1 34 ? 13.141  2.684   2.888   1.00 1.00 ? 34  LEU A H    3  
ATOM   3201  H HA   . LEU A 1 34 ? 14.377  4.034   5.197   1.00 1.00 ? 34  LEU A HA   3  
ATOM   3202  H HB2  . LEU A 1 34 ? 15.207  1.804   3.347   1.00 1.00 ? 34  LEU A HB2  3  
ATOM   3203  H HB3  . LEU A 1 34 ? 16.420  2.658   4.303   1.00 1.00 ? 34  LEU A HB3  3  
ATOM   3204  H HG   . LEU A 1 34 ? 15.200  2.130   6.362   1.00 1.00 ? 34  LEU A HG   3  
ATOM   3205  H HD11 . LEU A 1 34 ? 13.234  0.920   4.413   1.00 1.00 ? 34  LEU A HD11 3  
ATOM   3206  H HD12 . LEU A 1 34 ? 12.926  2.076   5.708   1.00 1.00 ? 34  LEU A HD12 3  
ATOM   3207  H HD13 . LEU A 1 34 ? 13.299  0.398   6.096   1.00 1.00 ? 34  LEU A HD13 3  
ATOM   3208  H HD21 . LEU A 1 34 ? 16.855  0.500   5.252   1.00 1.00 ? 34  LEU A HD21 3  
ATOM   3209  H HD22 . LEU A 1 34 ? 15.435  -0.419  4.754   1.00 1.00 ? 34  LEU A HD22 3  
ATOM   3210  H HD23 . LEU A 1 34 ? 15.770  -0.179  6.468   1.00 1.00 ? 34  LEU A HD23 3  
ATOM   3211  N N    . GLY A 1 35 ? 15.827  5.681   4.044   1.00 1.00 ? 35  GLY A N    3  
ATOM   3212  C CA   . GLY A 1 35 ? 16.536  6.761   3.367   1.00 1.00 ? 35  GLY A CA   3  
ATOM   3213  C C    . GLY A 1 35 ? 15.595  7.923   3.073   1.00 1.00 ? 35  GLY A C    3  
ATOM   3214  O O    . GLY A 1 35 ? 14.619  7.772   2.339   1.00 1.00 ? 35  GLY A O    3  
ATOM   3215  H H    . GLY A 1 35 ? 15.808  5.658   5.024   1.00 1.00 ? 35  GLY A H    3  
ATOM   3216  H HA2  . GLY A 1 35 ? 17.340  7.107   4.001   1.00 1.00 ? 35  GLY A HA2  3  
ATOM   3217  H HA3  . GLY A 1 35 ? 16.947  6.397   2.437   1.00 1.00 ? 35  GLY A HA3  3  
ATOM   3218  N N    . ALA A 1 36 ? 15.896  9.080   3.650   1.00 1.00 ? 36  ALA A N    3  
ATOM   3219  C CA   . ALA A 1 36 ? 15.070  10.263  3.442   1.00 1.00 ? 36  ALA A CA   3  
ATOM   3220  C C    . ALA A 1 36 ? 15.098  10.683  1.976   1.00 1.00 ? 36  ALA A C    3  
ATOM   3221  O O    . ALA A 1 36 ? 14.089  11.125  1.428   1.00 1.00 ? 36  ALA A O    3  
ATOM   3222  C CB   . ALA A 1 36 ? 15.575  11.414  4.314   1.00 1.00 ? 36  ALA A CB   3  
ATOM   3223  H H    . ALA A 1 36 ? 16.688  9.141   4.224   1.00 1.00 ? 36  ALA A H    3  
ATOM   3224  H HA   . ALA A 1 36 ? 14.053  10.033  3.722   1.00 1.00 ? 36  ALA A HA   3  
ATOM   3225  H HB1  . ALA A 1 36 ? 15.788  11.045  5.307   1.00 1.00 ? 36  ALA A HB1  3  
ATOM   3226  H HB2  . ALA A 1 36 ? 14.819  12.182  4.369   1.00 1.00 ? 36  ALA A HB2  3  
ATOM   3227  H HB3  . ALA A 1 36 ? 16.476  11.824  3.881   1.00 1.00 ? 36  ALA A HB3  3  
ATOM   3228  N N    . ASP A 1 37 ? 16.261  10.544  1.348   1.00 1.00 ? 37  ASP A N    3  
ATOM   3229  C CA   . ASP A 1 37 ? 16.408  10.915  -0.054  1.00 1.00 ? 37  ASP A CA   3  
ATOM   3230  C C    . ASP A 1 37 ? 15.500  10.065  -0.935  1.00 1.00 ? 37  ASP A C    3  
ATOM   3231  O O    . ASP A 1 37 ? 14.841  10.578  -1.840  1.00 1.00 ? 37  ASP A O    3  
ATOM   3232  C CB   . ASP A 1 37 ? 17.862  10.726  -0.494  1.00 1.00 ? 37  ASP A CB   3  
ATOM   3233  C CG   . ASP A 1 37 ? 18.740  11.804  0.130   1.00 1.00 ? 37  ASP A CG   3  
ATOM   3234  O OD1  . ASP A 1 37 ? 18.190  12.748  0.673   1.00 1.00 ? 37  ASP A OD1  3  
ATOM   3235  O OD2  . ASP A 1 37 ? 19.951  11.672  0.052   1.00 1.00 ? 37  ASP A OD2  3  
ATOM   3236  H H    . ASP A 1 37 ? 17.033  10.188  1.836   1.00 1.00 ? 37  ASP A H    3  
ATOM   3237  H HA   . ASP A 1 37 ? 16.140  11.953  -0.173  1.00 1.00 ? 37  ASP A HA   3  
ATOM   3238  H HB2  . ASP A 1 37 ? 18.207  9.753   -0.177  1.00 1.00 ? 37  ASP A HB2  3  
ATOM   3239  H HB3  . ASP A 1 37 ? 17.923  10.795  -1.570  1.00 1.00 ? 37  ASP A HB3  3  
ATOM   3240  N N    . SER A 1 38 ? 15.469  8.763   -0.666  1.00 1.00 ? 38  SER A N    3  
ATOM   3241  C CA   . SER A 1 38 ? 14.635  7.851   -1.444  1.00 1.00 ? 38  SER A CA   3  
ATOM   3242  C C    . SER A 1 38 ? 13.211  7.844   -0.904  1.00 1.00 ? 38  SER A C    3  
ATOM   3243  O O    . SER A 1 38 ? 12.983  7.517   0.260   1.00 1.00 ? 38  SER A O    3  
ATOM   3244  C CB   . SER A 1 38 ? 15.210  6.437   -1.379  1.00 1.00 ? 38  SER A CB   3  
ATOM   3245  H H    . SER A 1 38 ? 16.016  8.410   0.066   1.00 1.00 ? 38  SER A H    3  
ATOM   3246  H HA   . SER A 1 38 ? 14.620  8.172   -2.475  1.00 1.00 ? 38  SER A HA   3  
ATOM   3247  H HB2  . SER A 1 38 ? 14.518  5.746   -1.842  1.00 1.00 ? 38  SER A HB2  3  
ATOM   3248  H HB3  . SER A 1 38 ? 15.363  6.155   -0.350  1.00 1.00 ? 38  SER A HB3  3  
ATOM   3249  N N    . LEU A 1 39 ? 12.253  8.202   -1.757  1.00 1.00 ? 39  LEU A N    3  
ATOM   3250  C CA   . LEU A 1 39 ? 10.846  8.232   -1.356  1.00 1.00 ? 39  LEU A CA   3  
ATOM   3251  C C    . LEU A 1 39 ? 10.119  7.009   -1.897  1.00 1.00 ? 39  LEU A C    3  
ATOM   3252  O O    . LEU A 1 39 ? 9.782   6.944   -3.079  1.00 1.00 ? 39  LEU A O    3  
ATOM   3253  C CB   . LEU A 1 39 ? 10.184  9.502   -1.898  1.00 1.00 ? 39  LEU A CB   3  
ATOM   3254  C CG   . LEU A 1 39 ? 11.011  10.726  -1.488  1.00 1.00 ? 39  LEU A CG   3  
ATOM   3255  C CD1  . LEU A 1 39 ? 10.381  11.988  -2.085  1.00 1.00 ? 39  LEU A CD1  3  
ATOM   3256  C CD2  . LEU A 1 39 ? 11.052  10.843  0.046   1.00 1.00 ? 39  LEU A CD2  3  
ATOM   3257  H H    . LEU A 1 39 ? 12.497  8.452   -2.674  1.00 1.00 ? 39  LEU A H    3  
ATOM   3258  H HA   . LEU A 1 39 ? 10.770  8.234   -0.279  1.00 1.00 ? 39  LEU A HA   3  
ATOM   3259  H HB2  . LEU A 1 39 ? 10.128  9.445   -2.977  1.00 1.00 ? 39  LEU A HB2  3  
ATOM   3260  H HB3  . LEU A 1 39 ? 9.189   9.589   -1.490  1.00 1.00 ? 39  LEU A HB3  3  
ATOM   3261  H HG   . LEU A 1 39 ? 12.018  10.618  -1.868  1.00 1.00 ? 39  LEU A HG   3  
ATOM   3262  H HD11 . LEU A 1 39 ? 9.355   12.065  -1.760  1.00 1.00 ? 39  LEU A HD11 3  
ATOM   3263  H HD12 . LEU A 1 39 ? 10.417  11.934  -3.163  1.00 1.00 ? 39  LEU A HD12 3  
ATOM   3264  H HD13 . LEU A 1 39 ? 10.931  12.856  -1.749  1.00 1.00 ? 39  LEU A HD13 3  
ATOM   3265  H HD21 . LEU A 1 39 ? 10.091  10.566  0.460   1.00 1.00 ? 39  LEU A HD21 3  
ATOM   3266  H HD22 . LEU A 1 39 ? 11.285  11.861  0.330   1.00 1.00 ? 39  LEU A HD22 3  
ATOM   3267  H HD23 . LEU A 1 39 ? 11.812  10.184  0.438   1.00 1.00 ? 39  LEU A HD23 3  
ATOM   3268  N N    . ASP A 1 40 ? 9.878   6.039   -1.019  1.00 1.00 ? 40  ASP A N    3  
ATOM   3269  C CA   . ASP A 1 40 ? 9.186   4.818   -1.414  1.00 1.00 ? 40  ASP A CA   3  
ATOM   3270  C C    . ASP A 1 40 ? 7.680   5.046   -1.447  1.00 1.00 ? 40  ASP A C    3  
ATOM   3271  O O    . ASP A 1 40 ? 6.946   4.324   -2.118  1.00 1.00 ? 40  ASP A O    3  
ATOM   3272  C CB   . ASP A 1 40 ? 9.512   3.694   -0.429  1.00 1.00 ? 40  ASP A CB   3  
ATOM   3273  C CG   . ASP A 1 40 ? 10.964  3.262   -0.591  1.00 1.00 ? 40  ASP A CG   3  
ATOM   3274  O OD1  . ASP A 1 40 ? 11.596  3.720   -1.529  1.00 1.00 ? 40  ASP A OD1  3  
ATOM   3275  O OD2  . ASP A 1 40 ? 11.424  2.479   0.224   1.00 1.00 ? 40  ASP A OD2  3  
ATOM   3276  H H    . ASP A 1 40 ? 10.172  6.149   -0.090  1.00 1.00 ? 40  ASP A H    3  
ATOM   3277  H HA   . ASP A 1 40 ? 9.519   4.525   -2.397  1.00 1.00 ? 40  ASP A HA   3  
ATOM   3278  H HB2  . ASP A 1 40 ? 9.352   4.044   0.581   1.00 1.00 ? 40  ASP A HB2  3  
ATOM   3279  H HB3  . ASP A 1 40 ? 8.865   2.851   -0.621  1.00 1.00 ? 40  ASP A HB3  3  
ATOM   3280  N N    . THR A 1 41 ? 7.222   6.058   -0.721  1.00 1.00 ? 41  THR A N    3  
ATOM   3281  C CA   . THR A 1 41 ? 5.798   6.370   -0.673  1.00 1.00 ? 41  THR A CA   3  
ATOM   3282  C C    . THR A 1 41 ? 5.281   6.713   -2.063  1.00 1.00 ? 41  THR A C    3  
ATOM   3283  O O    . THR A 1 41 ? 4.206   6.268   -2.459  1.00 1.00 ? 41  THR A O    3  
ATOM   3284  C CB   . THR A 1 41 ? 5.546   7.544   0.274   1.00 1.00 ? 41  THR A CB   3  
ATOM   3285  O OG1  . THR A 1 41 ? 5.984   7.195   1.580   1.00 1.00 ? 41  THR A OG1  3  
ATOM   3286  C CG2  . THR A 1 41 ? 4.051   7.869   0.310   1.00 1.00 ? 41  THR A CG2  3  
ATOM   3287  H H    . THR A 1 41 ? 7.852   6.603   -0.205  1.00 1.00 ? 41  THR A H    3  
ATOM   3288  H HA   . THR A 1 41 ? 5.265   5.505   -0.306  1.00 1.00 ? 41  THR A HA   3  
ATOM   3289  H HB   . THR A 1 41 ? 6.091   8.409   -0.072  1.00 1.00 ? 41  THR A HB   3  
ATOM   3290  H HG1  . THR A 1 41 ? 6.596   7.871   1.879   1.00 1.00 ? 41  THR A HG1  3  
ATOM   3291  H HG21 . THR A 1 41 ? 3.481   6.952   0.369   1.00 1.00 ? 41  THR A HG21 3  
ATOM   3292  H HG22 . THR A 1 41 ? 3.775   8.406   -0.588  1.00 1.00 ? 41  THR A HG22 3  
ATOM   3293  H HG23 . THR A 1 41 ? 3.839   8.481   1.174   1.00 1.00 ? 41  THR A HG23 3  
ATOM   3294  N N    . VAL A 1 42 ? 6.055   7.506   -2.800  1.00 1.00 ? 42  VAL A N    3  
ATOM   3295  C CA   . VAL A 1 42 ? 5.669   7.905   -4.151  1.00 1.00 ? 42  VAL A CA   3  
ATOM   3296  C C    . VAL A 1 42 ? 5.574   6.680   -5.062  1.00 1.00 ? 42  VAL A C    3  
ATOM   3297  O O    . VAL A 1 42 ? 4.657   6.552   -5.868  1.00 1.00 ? 42  VAL A O    3  
ATOM   3298  C CB   . VAL A 1 42 ? 6.692   8.888   -4.719  1.00 1.00 ? 42  VAL A CB   3  
ATOM   3299  C CG1  . VAL A 1 42 ? 6.343   9.205   -6.174  1.00 1.00 ? 42  VAL A CG1  3  
ATOM   3300  C CG2  . VAL A 1 42 ? 6.670   10.178  -3.896  1.00 1.00 ? 42  VAL A CG2  3  
ATOM   3301  H H    . VAL A 1 42 ? 6.902   7.827   -2.428  1.00 1.00 ? 42  VAL A H    3  
ATOM   3302  H HA   . VAL A 1 42 ? 4.703   8.391   -4.110  1.00 1.00 ? 42  VAL A HA   3  
ATOM   3303  H HB   . VAL A 1 42 ? 7.677   8.447   -4.673  1.00 1.00 ? 42  VAL A HB   3  
ATOM   3304  H HG11 . VAL A 1 42 ? 6.905   10.067  -6.500  1.00 1.00 ? 42  VAL A HG11 3  
ATOM   3305  H HG12 . VAL A 1 42 ? 5.286   9.413   -6.253  1.00 1.00 ? 42  VAL A HG12 3  
ATOM   3306  H HG13 . VAL A 1 42 ? 6.590   8.357   -6.795  1.00 1.00 ? 42  VAL A HG13 3  
ATOM   3307  H HG21 . VAL A 1 42 ? 5.654   10.542  -3.823  1.00 1.00 ? 42  VAL A HG21 3  
ATOM   3308  H HG22 . VAL A 1 42 ? 7.283   10.923  -4.380  1.00 1.00 ? 42  VAL A HG22 3  
ATOM   3309  H HG23 . VAL A 1 42 ? 7.053   9.982   -2.906  1.00 1.00 ? 42  VAL A HG23 3  
ATOM   3310  N N    . GLU A 1 43 ? 6.542   5.789   -4.943  1.00 1.00 ? 43  GLU A N    3  
ATOM   3311  C CA   . GLU A 1 43 ? 6.546   4.581   -5.755  1.00 1.00 ? 43  GLU A CA   3  
ATOM   3312  C C    . GLU A 1 43 ? 5.479   3.600   -5.274  1.00 1.00 ? 43  GLU A C    3  
ATOM   3313  O O    . GLU A 1 43 ? 4.765   2.998   -6.076  1.00 1.00 ? 43  GLU A O    3  
ATOM   3314  C CB   . GLU A 1 43 ? 7.918   3.916   -5.698  1.00 1.00 ? 43  GLU A CB   3  
ATOM   3315  C CG   . GLU A 1 43 ? 8.943   4.803   -6.402  1.00 1.00 ? 43  GLU A CG   3  
ATOM   3316  C CD   . GLU A 1 43 ? 10.332  4.187   -6.289  1.00 1.00 ? 43  GLU A CD   3  
ATOM   3317  O OE1  . GLU A 1 43 ? 10.446  3.136   -5.680  1.00 1.00 ? 43  GLU A OE1  3  
ATOM   3318  O OE2  . GLU A 1 43 ? 11.263  4.775   -6.815  1.00 1.00 ? 43  GLU A OE2  3  
ATOM   3319  H H    . GLU A 1 43 ? 7.262   5.941   -4.296  1.00 1.00 ? 43  GLU A H    3  
ATOM   3320  H HA   . GLU A 1 43 ? 6.334   4.850   -6.779  1.00 1.00 ? 43  GLU A HA   3  
ATOM   3321  H HB2  . GLU A 1 43 ? 8.206   3.776   -4.665  1.00 1.00 ? 43  GLU A HB2  3  
ATOM   3322  H HB3  . GLU A 1 43 ? 7.874   2.955   -6.191  1.00 1.00 ? 43  GLU A HB3  3  
ATOM   3323  H HG2  . GLU A 1 43 ? 8.676   4.899   -7.444  1.00 1.00 ? 43  GLU A HG2  3  
ATOM   3324  H HG3  . GLU A 1 43 ? 8.946   5.779   -5.941  1.00 1.00 ? 43  GLU A HG3  3  
ATOM   3325  N N    . ILE A 1 44 ? 5.400   3.423   -3.959  1.00 1.00 ? 44  ILE A N    3  
ATOM   3326  C CA   . ILE A 1 44 ? 4.435   2.492   -3.383  1.00 1.00 ? 44  ILE A CA   3  
ATOM   3327  C C    . ILE A 1 44 ? 3.002   2.947   -3.630  1.00 1.00 ? 44  ILE A C    3  
ATOM   3328  O O    . ILE A 1 44 ? 2.149   2.155   -4.031  1.00 1.00 ? 44  ILE A O    3  
ATOM   3329  C CB   . ILE A 1 44 ? 4.670   2.375   -1.871  1.00 1.00 ? 44  ILE A CB   3  
ATOM   3330  C CG1  . ILE A 1 44 ? 6.051   1.729   -1.599  1.00 1.00 ? 44  ILE A CG1  3  
ATOM   3331  C CG2  . ILE A 1 44 ? 3.560   1.515   -1.252  1.00 1.00 ? 44  ILE A CG2  3  
ATOM   3332  C CD1  . ILE A 1 44 ? 5.945   0.199   -1.570  1.00 1.00 ? 44  ILE A CD1  3  
ATOM   3333  H H    . ILE A 1 44 ? 6.010   3.912   -3.368  1.00 1.00 ? 44  ILE A H    3  
ATOM   3334  H HA   . ILE A 1 44 ? 4.576   1.526   -3.832  1.00 1.00 ? 44  ILE A HA   3  
ATOM   3335  H HB   . ILE A 1 44 ? 4.641   3.366   -1.432  1.00 1.00 ? 44  ILE A HB   3  
ATOM   3336  H HG12 . ILE A 1 44 ? 6.751   2.020   -2.372  1.00 1.00 ? 44  ILE A HG12 3  
ATOM   3337  H HG13 . ILE A 1 44 ? 6.417   2.070   -0.646  1.00 1.00 ? 44  ILE A HG13 3  
ATOM   3338  H HG21 . ILE A 1 44 ? 3.870   1.185   -0.272  1.00 1.00 ? 44  ILE A HG21 3  
ATOM   3339  H HG22 . ILE A 1 44 ? 3.388   0.650   -1.883  1.00 1.00 ? 44  ILE A HG22 3  
ATOM   3340  H HG23 . ILE A 1 44 ? 2.648   2.092   -1.170  1.00 1.00 ? 44  ILE A HG23 3  
ATOM   3341  H HD11 . ILE A 1 44 ? 5.553   -0.108  -0.614  1.00 1.00 ? 44  ILE A HD11 3  
ATOM   3342  H HD12 . ILE A 1 44 ? 6.923   -0.234  -1.713  1.00 1.00 ? 44  ILE A HD12 3  
ATOM   3343  H HD13 . ILE A 1 44 ? 5.280   -0.133  -2.351  1.00 1.00 ? 44  ILE A HD13 3  
ATOM   3344  N N    . VAL A 1 45 ? 2.739   4.219   -3.371  1.00 1.00 ? 45  VAL A N    3  
ATOM   3345  C CA   . VAL A 1 45 ? 1.399   4.758   -3.552  1.00 1.00 ? 45  VAL A CA   3  
ATOM   3346  C C    . VAL A 1 45 ? 0.967   4.646   -5.009  1.00 1.00 ? 45  VAL A C    3  
ATOM   3347  O O    . VAL A 1 45 ? -0.175  4.297   -5.306  1.00 1.00 ? 45  VAL A O    3  
ATOM   3348  C CB   . VAL A 1 45 ? 1.364   6.230   -3.125  1.00 1.00 ? 45  VAL A CB   3  
ATOM   3349  C CG1  . VAL A 1 45 ? 2.097   7.087   -4.161  1.00 1.00 ? 45  VAL A CG1  3  
ATOM   3350  C CG2  . VAL A 1 45 ? -0.084  6.698   -3.011  1.00 1.00 ? 45  VAL A CG2  3  
ATOM   3351  H H    . VAL A 1 45 ? 3.453   4.800   -3.034  1.00 1.00 ? 45  VAL A H    3  
ATOM   3352  H HA   . VAL A 1 45 ? 0.714   4.200   -2.939  1.00 1.00 ? 45  VAL A HA   3  
ATOM   3353  H HB   . VAL A 1 45 ? 1.852   6.334   -2.166  1.00 1.00 ? 45  VAL A HB   3  
ATOM   3354  H HG11 . VAL A 1 45 ? 1.482   7.201   -5.046  1.00 1.00 ? 45  VAL A HG11 3  
ATOM   3355  H HG12 . VAL A 1 45 ? 3.011   6.597   -4.427  1.00 1.00 ? 45  VAL A HG12 3  
ATOM   3356  H HG13 . VAL A 1 45 ? 2.314   8.058   -3.742  1.00 1.00 ? 45  VAL A HG13 3  
ATOM   3357  H HG21 . VAL A 1 45 ? -0.537  6.707   -3.991  1.00 1.00 ? 45  VAL A HG21 3  
ATOM   3358  H HG22 . VAL A 1 45 ? -0.108  7.692   -2.591  1.00 1.00 ? 45  VAL A HG22 3  
ATOM   3359  H HG23 . VAL A 1 45 ? -0.628  6.021   -2.370  1.00 1.00 ? 45  VAL A HG23 3  
ATOM   3360  N N    . MET A 1 46 ? 1.887   4.964   -5.912  1.00 1.00 ? 46  MET A N    3  
ATOM   3361  C CA   . MET A 1 46 ? 1.588   4.916   -7.331  1.00 1.00 ? 46  MET A CA   3  
ATOM   3362  C C    . MET A 1 46 ? 1.158   3.510   -7.738  1.00 1.00 ? 46  MET A C    3  
ATOM   3363  O O    . MET A 1 46 ? 0.237   3.340   -8.536  1.00 1.00 ? 46  MET A O    3  
ATOM   3364  C CB   . MET A 1 46 ? 2.820   5.331   -8.135  1.00 1.00 ? 46  MET A CB   3  
ATOM   3365  C CG   . MET A 1 46 ? 2.420   5.584   -9.579  1.00 1.00 ? 46  MET A CG   3  
ATOM   3366  S SD   . MET A 1 46 ? 1.427   7.099   -9.686  1.00 1.00 ? 46  MET A SD   3  
ATOM   3367  C CE   . MET A 1 46 ? -0.123  6.346   -10.236 1.00 1.00 ? 46  MET A CE   3  
ATOM   3368  H H    . MET A 1 46 ? 2.775   5.250   -5.617  1.00 1.00 ? 46  MET A H    3  
ATOM   3369  H HA   . MET A 1 46 ? 0.785   5.605   -7.541  1.00 1.00 ? 46  MET A HA   3  
ATOM   3370  H HB2  . MET A 1 46 ? 3.245   6.229   -7.716  1.00 1.00 ? 46  MET A HB2  3  
ATOM   3371  H HB3  . MET A 1 46 ? 3.551   4.536   -8.107  1.00 1.00 ? 46  MET A HB3  3  
ATOM   3372  H HG2  . MET A 1 46 ? 3.311   5.698   -10.171 1.00 1.00 ? 46  MET A HG2  3  
ATOM   3373  H HG3  . MET A 1 46 ? 1.850   4.746   -9.937  1.00 1.00 ? 46  MET A HG3  3  
ATOM   3374  H HE1  . MET A 1 46 ? 0.013   5.919   -11.220 1.00 1.00 ? 46  MET A HE1  3  
ATOM   3375  H HE2  . MET A 1 46 ? -0.898  7.097   -10.274 1.00 1.00 ? 46  MET A HE2  3  
ATOM   3376  H HE3  . MET A 1 46 ? -0.410  5.571   -9.540  1.00 1.00 ? 46  MET A HE3  3  
ATOM   3377  N N    . ASN A 1 47 ? 1.825   2.506   -7.180  1.00 1.00 ? 47  ASN A N    3  
ATOM   3378  C CA   . ASN A 1 47 ? 1.494   1.121   -7.491  1.00 1.00 ? 47  ASN A CA   3  
ATOM   3379  C C    . ASN A 1 47 ? 0.073   0.793   -7.039  1.00 1.00 ? 47  ASN A C    3  
ATOM   3380  O O    . ASN A 1 47 ? -0.707  0.216   -7.794  1.00 1.00 ? 47  ASN A O    3  
ATOM   3381  C CB   . ASN A 1 47 ? 2.481   0.187   -6.791  1.00 1.00 ? 47  ASN A CB   3  
ATOM   3382  C CG   . ASN A 1 47 ? 2.345   -1.221  -7.351  1.00 1.00 ? 47  ASN A CG   3  
ATOM   3383  O OD1  . ASN A 1 47 ? 1.370   -1.528  -8.035  1.00 1.00 ? 47  ASN A OD1  3  
ATOM   3384  N ND2  . ASN A 1 47 ? 3.264   -2.107  -7.093  1.00 1.00 ? 47  ASN A ND2  3  
ATOM   3385  H H    . ASN A 1 47 ? 2.547   2.699   -6.547  1.00 1.00 ? 47  ASN A H    3  
ATOM   3386  H HA   . ASN A 1 47 ? 1.561   0.962   -8.554  1.00 1.00 ? 47  ASN A HA   3  
ATOM   3387  H HB2  . ASN A 1 47 ? 3.489   0.543   -6.938  1.00 1.00 ? 47  ASN A HB2  3  
ATOM   3388  H HB3  . ASN A 1 47 ? 2.264   0.170   -5.741  1.00 1.00 ? 47  ASN A HB3  3  
ATOM   3389  H HD21 . ASN A 1 47 ? 4.037   -1.864  -6.544  1.00 1.00 ? 47  ASN A HD21 3  
ATOM   3390  H HD22 . ASN A 1 47 ? 3.178   -3.015  -7.448  1.00 1.00 ? 47  ASN A HD22 3  
ATOM   3391  N N    . LEU A 1 48 ? -0.259  1.165   -5.809  1.00 1.00 ? 48  LEU A N    3  
ATOM   3392  C CA   . LEU A 1 48 ? -1.595  0.894   -5.281  1.00 1.00 ? 48  LEU A CA   3  
ATOM   3393  C C    . LEU A 1 48 ? -2.643  1.661   -6.068  1.00 1.00 ? 48  LEU A C    3  
ATOM   3394  O O    . LEU A 1 48 ? -3.676  1.110   -6.440  1.00 1.00 ? 48  LEU A O    3  
ATOM   3395  C CB   . LEU A 1 48 ? -1.653  1.314   -3.805  1.00 1.00 ? 48  LEU A CB   3  
ATOM   3396  C CG   . LEU A 1 48 ? -0.617  0.503   -2.998  1.00 1.00 ? 48  LEU A CG   3  
ATOM   3397  C CD1  . LEU A 1 48 ? -0.263  1.233   -1.704  1.00 1.00 ? 48  LEU A CD1  3  
ATOM   3398  C CD2  . LEU A 1 48 ? -1.177  -0.875  -2.631  1.00 1.00 ? 48  LEU A CD2  3  
ATOM   3399  H H    . LEU A 1 48 ? 0.401   1.621   -5.244  1.00 1.00 ? 48  LEU A H    3  
ATOM   3400  H HA   . LEU A 1 48 ? -1.807  -0.153  -5.365  1.00 1.00 ? 48  LEU A HA   3  
ATOM   3401  H HB2  . LEU A 1 48 ? -1.433  2.369   -3.736  1.00 1.00 ? 48  LEU A HB2  3  
ATOM   3402  H HB3  . LEU A 1 48 ? -2.648  1.128   -3.409  1.00 1.00 ? 48  LEU A HB3  3  
ATOM   3403  H HG   . LEU A 1 48 ? 0.277   0.386   -3.587  1.00 1.00 ? 48  LEU A HG   3  
ATOM   3404  H HD11 . LEU A 1 48 ? 0.606   0.770   -1.253  1.00 1.00 ? 48  LEU A HD11 3  
ATOM   3405  H HD12 . LEU A 1 48 ? -1.095  1.170   -1.023  1.00 1.00 ? 48  LEU A HD12 3  
ATOM   3406  H HD13 . LEU A 1 48 ? -0.048  2.264   -1.920  1.00 1.00 ? 48  LEU A HD13 3  
ATOM   3407  H HD21 . LEU A 1 48 ? -1.909  -0.764  -1.845  1.00 1.00 ? 48  LEU A HD21 3  
ATOM   3408  H HD22 . LEU A 1 48 ? -0.371  -1.499  -2.283  1.00 1.00 ? 48  LEU A HD22 3  
ATOM   3409  H HD23 . LEU A 1 48 ? -1.640  -1.334  -3.490  1.00 1.00 ? 48  LEU A HD23 3  
ATOM   3410  N N    . GLU A 1 49 ? -2.369  2.929   -6.325  1.00 1.00 ? 49  GLU A N    3  
ATOM   3411  C CA   . GLU A 1 49 ? -3.303  3.756   -7.066  1.00 1.00 ? 49  GLU A CA   3  
ATOM   3412  C C    . GLU A 1 49 ? -3.486  3.196   -8.472  1.00 1.00 ? 49  GLU A C    3  
ATOM   3413  O O    . GLU A 1 49 ? -4.575  3.263   -9.042  1.00 1.00 ? 49  GLU A O    3  
ATOM   3414  C CB   . GLU A 1 49 ? -2.782  5.192   -7.148  1.00 1.00 ? 49  GLU A CB   3  
ATOM   3415  C CG   . GLU A 1 49 ? -3.869  6.101   -7.723  1.00 1.00 ? 49  GLU A CG   3  
ATOM   3416  C CD   . GLU A 1 49 ? -3.339  7.526   -7.856  1.00 1.00 ? 49  GLU A CD   3  
ATOM   3417  O OE1  . GLU A 1 49 ? -2.325  7.819   -7.245  1.00 1.00 ? 49  GLU A OE1  3  
ATOM   3418  O OE2  . GLU A 1 49 ? -3.956  8.302   -8.565  1.00 1.00 ? 49  GLU A OE2  3  
ATOM   3419  H H    . GLU A 1 49 ? -1.527  3.313   -6.009  1.00 1.00 ? 49  GLU A H    3  
ATOM   3420  H HA   . GLU A 1 49 ? -4.257  3.757   -6.557  1.00 1.00 ? 49  GLU A HA   3  
ATOM   3421  H HB2  . GLU A 1 49 ? -2.510  5.533   -6.158  1.00 1.00 ? 49  GLU A HB2  3  
ATOM   3422  H HB3  . GLU A 1 49 ? -1.916  5.219   -7.788  1.00 1.00 ? 49  GLU A HB3  3  
ATOM   3423  H HG2  . GLU A 1 49 ? -4.163  5.735   -8.697  1.00 1.00 ? 49  GLU A HG2  3  
ATOM   3424  H HG3  . GLU A 1 49 ? -4.728  6.101   -7.062  1.00 1.00 ? 49  GLU A HG3  3  
ATOM   3425  N N    . GLU A 1 50 ? -2.411  2.640   -9.025  1.00 1.00 ? 50  GLU A N    3  
ATOM   3426  C CA   . GLU A 1 50 ? -2.466  2.068   -10.365 1.00 1.00 ? 50  GLU A CA   3  
ATOM   3427  C C    . GLU A 1 50 ? -3.136  0.697   -10.329 1.00 1.00 ? 50  GLU A C    3  
ATOM   3428  O O    . GLU A 1 50 ? -4.052  0.426   -11.107 1.00 1.00 ? 50  GLU A O    3  
ATOM   3429  C CB   . GLU A 1 50 ? -1.054  1.933   -10.939 1.00 1.00 ? 50  GLU A CB   3  
ATOM   3430  C CG   . GLU A 1 50 ? -1.127  1.526   -12.415 1.00 1.00 ? 50  GLU A CG   3  
ATOM   3431  C CD   . GLU A 1 50 ? -1.668  2.683   -13.247 1.00 1.00 ? 50  GLU A CD   3  
ATOM   3432  O OE1  . GLU A 1 50 ? -1.804  3.766   -12.704 1.00 1.00 ? 50  GLU A OE1  3  
ATOM   3433  O OE2  . GLU A 1 50 ? -1.942  2.467   -14.417 1.00 1.00 ? 50  GLU A OE2  3  
ATOM   3434  H H    . GLU A 1 50 ? -1.569  2.611   -8.524  1.00 1.00 ? 50  GLU A H    3  
ATOM   3435  H HA   . GLU A 1 50 ? -3.042  2.724   -11.001 1.00 1.00 ? 50  GLU A HA   3  
ATOM   3436  H HB2  . GLU A 1 50 ? -0.538  2.879   -10.853 1.00 1.00 ? 50  GLU A HB2  3  
ATOM   3437  H HB3  . GLU A 1 50 ? -0.513  1.178   -10.387 1.00 1.00 ? 50  GLU A HB3  3  
ATOM   3438  H HG2  . GLU A 1 50 ? -0.137  1.269   -12.762 1.00 1.00 ? 50  GLU A HG2  3  
ATOM   3439  H HG3  . GLU A 1 50 ? -1.778  0.671   -12.526 1.00 1.00 ? 50  GLU A HG3  3  
ATOM   3440  N N    . GLU A 1 51 ? -2.670  -0.170  -9.426  1.00 1.00 ? 51  GLU A N    3  
ATOM   3441  C CA   . GLU A 1 51 ? -3.240  -1.509  -9.318  1.00 1.00 ? 51  GLU A CA   3  
ATOM   3442  C C    . GLU A 1 51 ? -4.740  -1.435  -9.048  1.00 1.00 ? 51  GLU A C    3  
ATOM   3443  O O    . GLU A 1 51 ? -5.543  -1.998  -9.792  1.00 1.00 ? 51  GLU A O    3  
ATOM   3444  C CB   . GLU A 1 51 ? -2.551  -2.264  -8.181  1.00 1.00 ? 51  GLU A CB   3  
ATOM   3445  C CG   . GLU A 1 51 ? -2.979  -3.733  -8.205  1.00 1.00 ? 51  GLU A CG   3  
ATOM   3446  C CD   . GLU A 1 51 ? -2.379  -4.425  -9.424  1.00 1.00 ? 51  GLU A CD   3  
ATOM   3447  O OE1  . GLU A 1 51 ? -1.529  -3.826  -10.063 1.00 1.00 ? 51  GLU A OE1  3  
ATOM   3448  O OE2  . GLU A 1 51 ? -2.788  -5.539  -9.708  1.00 1.00 ? 51  GLU A OE2  3  
ATOM   3449  H H    . GLU A 1 51 ? -1.928  0.093   -8.830  1.00 1.00 ? 51  GLU A H    3  
ATOM   3450  H HA   . GLU A 1 51 ? -3.074  -2.044  -10.239 1.00 1.00 ? 51  GLU A HA   3  
ATOM   3451  H HB2  . GLU A 1 51 ? -1.479  -2.197  -8.304  1.00 1.00 ? 51  GLU A HB2  3  
ATOM   3452  H HB3  . GLU A 1 51 ? -2.833  -1.825  -7.236  1.00 1.00 ? 51  GLU A HB3  3  
ATOM   3453  H HG2  . GLU A 1 51 ? -2.631  -4.220  -7.307  1.00 1.00 ? 51  GLU A HG2  3  
ATOM   3454  H HG3  . GLU A 1 51 ? -4.055  -3.797  -8.252  1.00 1.00 ? 51  GLU A HG3  3  
ATOM   3455  N N    . PHE A 1 52 ? -5.110  -0.729  -7.986  1.00 1.00 ? 52  PHE A N    3  
ATOM   3456  C CA   . PHE A 1 52 ? -6.516  -0.574  -7.629  1.00 1.00 ? 52  PHE A CA   3  
ATOM   3457  C C    . PHE A 1 52 ? -7.242  0.278   -8.660  1.00 1.00 ? 52  PHE A C    3  
ATOM   3458  O O    . PHE A 1 52 ? -8.411  0.038   -8.963  1.00 1.00 ? 52  PHE A O    3  
ATOM   3459  C CB   . PHE A 1 52 ? -6.644  0.059   -6.242  1.00 1.00 ? 52  PHE A CB   3  
ATOM   3460  C CG   . PHE A 1 52 ? -6.256  -0.954  -5.186  1.00 1.00 ? 52  PHE A CG   3  
ATOM   3461  C CD1  . PHE A 1 52 ? -7.024  -2.118  -5.012  1.00 1.00 ? 52  PHE A CD1  3  
ATOM   3462  C CD2  . PHE A 1 52 ? -5.131  -0.737  -4.382  1.00 1.00 ? 52  PHE A CD2  3  
ATOM   3463  C CE1  . PHE A 1 52 ? -6.663  -3.051  -4.033  1.00 1.00 ? 52  PHE A CE1  3  
ATOM   3464  C CE2  . PHE A 1 52 ? -4.777  -1.671  -3.410  1.00 1.00 ? 52  PHE A CE2  3  
ATOM   3465  C CZ   . PHE A 1 52 ? -5.539  -2.825  -3.237  1.00 1.00 ? 52  PHE A CZ   3  
ATOM   3466  H H    . PHE A 1 52 ? -4.423  -0.296  -7.436  1.00 1.00 ? 52  PHE A H    3  
ATOM   3467  H HA   . PHE A 1 52 ? -6.976  -1.548  -7.606  1.00 1.00 ? 52  PHE A HA   3  
ATOM   3468  H HB2  . PHE A 1 52 ? -5.993  0.917   -6.179  1.00 1.00 ? 52  PHE A HB2  3  
ATOM   3469  H HB3  . PHE A 1 52 ? -7.661  0.371   -6.082  1.00 1.00 ? 52  PHE A HB3  3  
ATOM   3470  H HD1  . PHE A 1 52 ? -7.894  -2.293  -5.625  1.00 1.00 ? 52  PHE A HD1  3  
ATOM   3471  H HD2  . PHE A 1 52 ? -4.538  0.154   -4.508  1.00 1.00 ? 52  PHE A HD2  3  
ATOM   3472  H HE1  . PHE A 1 52 ? -7.247  -3.953  -3.899  1.00 1.00 ? 52  PHE A HE1  3  
ATOM   3473  H HE2  . PHE A 1 52 ? -3.906  -1.508  -2.798  1.00 1.00 ? 52  PHE A HE2  3  
ATOM   3474  H HZ   . PHE A 1 52 ? -5.264  -3.531  -2.480  1.00 1.00 ? 52  PHE A HZ   3  
ATOM   3475  N N    . GLY A 1 53 ? -6.545  1.275   -9.192  1.00 1.00 ? 53  GLY A N    3  
ATOM   3476  C CA   . GLY A 1 53 ? -7.137  2.161   -10.186 1.00 1.00 ? 53  GLY A CA   3  
ATOM   3477  C C    . GLY A 1 53 ? -7.951  3.255   -9.512  1.00 1.00 ? 53  GLY A C    3  
ATOM   3478  O O    . GLY A 1 53 ? -9.057  3.570   -9.943  1.00 1.00 ? 53  GLY A O    3  
ATOM   3479  H H    . GLY A 1 53 ? -5.618  1.420   -8.907  1.00 1.00 ? 53  GLY A H    3  
ATOM   3480  H HA2  . GLY A 1 53 ? -6.348  2.613   -10.774 1.00 1.00 ? 53  GLY A HA2  3  
ATOM   3481  H HA3  . GLY A 1 53 ? -7.784  1.592   -10.838 1.00 1.00 ? 53  GLY A HA3  3  
ATOM   3482  N N    . ILE A 1 54 ? -7.397  3.831   -8.442  1.00 1.00 ? 54  ILE A N    3  
ATOM   3483  C CA   . ILE A 1 54 ? -8.078  4.895   -7.702  1.00 1.00 ? 54  ILE A CA   3  
ATOM   3484  C C    . ILE A 1 54 ? -7.289  6.195   -7.790  1.00 1.00 ? 54  ILE A C    3  
ATOM   3485  O O    . ILE A 1 54 ? -6.426  6.346   -8.654  1.00 1.00 ? 54  ILE A O    3  
ATOM   3486  C CB   . ILE A 1 54 ? -8.241  4.479   -6.244  1.00 1.00 ? 54  ILE A CB   3  
ATOM   3487  C CG1  . ILE A 1 54 ? -6.880  4.054   -5.679  1.00 1.00 ? 54  ILE A CG1  3  
ATOM   3488  C CG2  . ILE A 1 54 ? -9.234  3.320   -6.138  1.00 1.00 ? 54  ILE A CG2  3  
ATOM   3489  C CD1  . ILE A 1 54 ? -6.998  3.710   -4.191  1.00 1.00 ? 54  ILE A CD1  3  
ATOM   3490  H H    . ILE A 1 54 ? -6.513  3.532   -8.142  1.00 1.00 ? 54  ILE A H    3  
ATOM   3491  H HA   . ILE A 1 54 ? -9.060  5.066   -8.124  1.00 1.00 ? 54  ILE A HA   3  
ATOM   3492  H HB   . ILE A 1 54 ? -8.612  5.317   -5.688  1.00 1.00 ? 54  ILE A HB   3  
ATOM   3493  H HG12 . ILE A 1 54 ? -6.517  3.192   -6.217  1.00 1.00 ? 54  ILE A HG12 3  
ATOM   3494  H HG13 . ILE A 1 54 ? -6.186  4.866   -5.791  1.00 1.00 ? 54  ILE A HG13 3  
ATOM   3495  H HG21 . ILE A 1 54 ? -10.107 3.525   -6.742  1.00 1.00 ? 54  ILE A HG21 3  
ATOM   3496  H HG22 . ILE A 1 54 ? -9.534  3.203   -5.107  1.00 1.00 ? 54  ILE A HG22 3  
ATOM   3497  H HG23 . ILE A 1 54 ? -8.763  2.412   -6.481  1.00 1.00 ? 54  ILE A HG23 3  
ATOM   3498  H HD11 . ILE A 1 54 ? -7.156  4.615   -3.630  1.00 1.00 ? 54  ILE A HD11 3  
ATOM   3499  H HD12 . ILE A 1 54 ? -6.083  3.236   -3.859  1.00 1.00 ? 54  ILE A HD12 3  
ATOM   3500  H HD13 . ILE A 1 54 ? -7.826  3.039   -4.033  1.00 1.00 ? 54  ILE A HD13 3  
ATOM   3501  N N    . ASN A 1 55 ? -7.602  7.140   -6.904  1.00 1.00 ? 55  ASN A N    3  
ATOM   3502  C CA   . ASN A 1 55 ? -6.928  8.436   -6.890  1.00 1.00 ? 55  ASN A CA   3  
ATOM   3503  C C    . ASN A 1 55 ? -6.488  8.781   -5.475  1.00 1.00 ? 55  ASN A C    3  
ATOM   3504  O O    . ASN A 1 55 ? -7.233  9.399   -4.715  1.00 1.00 ? 55  ASN A O    3  
ATOM   3505  C CB   . ASN A 1 55 ? -7.873  9.519   -7.409  1.00 1.00 ? 55  ASN A CB   3  
ATOM   3506  C CG   . ASN A 1 55 ? -9.181  9.497   -6.625  1.00 1.00 ? 55  ASN A CG   3  
ATOM   3507  O OD1  . ASN A 1 55 ? -10.068 10.312  -6.875  1.00 1.00 ? 55  ASN A OD1  3  
ATOM   3508  N ND2  . ASN A 1 55 ? -9.354  8.608   -5.684  1.00 1.00 ? 55  ASN A ND2  3  
ATOM   3509  H H    . ASN A 1 55 ? -8.310  6.967   -6.252  1.00 1.00 ? 55  ASN A H    3  
ATOM   3510  H HA   . ASN A 1 55 ? -6.056  8.403   -7.527  1.00 1.00 ? 55  ASN A HA   3  
ATOM   3511  H HB2  . ASN A 1 55 ? -7.405  10.484  -7.297  1.00 1.00 ? 55  ASN A HB2  3  
ATOM   3512  H HB3  . ASN A 1 55 ? -8.082  9.340   -8.454  1.00 1.00 ? 55  ASN A HB3  3  
ATOM   3513  H HD21 . ASN A 1 55 ? -8.647  7.960   -5.486  1.00 1.00 ? 55  ASN A HD21 3  
ATOM   3514  H HD22 . ASN A 1 55 ? -10.192 8.591   -5.176  1.00 1.00 ? 55  ASN A HD22 3  
ATOM   3515  N N    . VAL A 1 56 ? -5.271  8.374   -5.128  1.00 1.00 ? 56  VAL A N    3  
ATOM   3516  C CA   . VAL A 1 56 ? -4.732  8.641   -3.798  1.00 1.00 ? 56  VAL A CA   3  
ATOM   3517  C C    . VAL A 1 56 ? -4.068  10.012  -3.755  1.00 1.00 ? 56  VAL A C    3  
ATOM   3518  O O    . VAL A 1 56 ? -3.265  10.354  -4.624  1.00 1.00 ? 56  VAL A O    3  
ATOM   3519  C CB   . VAL A 1 56 ? -3.705  7.570   -3.424  1.00 1.00 ? 56  VAL A CB   3  
ATOM   3520  C CG1  . VAL A 1 56 ? -3.062  7.930   -2.076  1.00 1.00 ? 56  VAL A CG1  3  
ATOM   3521  C CG2  . VAL A 1 56 ? -4.398  6.197   -3.323  1.00 1.00 ? 56  VAL A CG2  3  
ATOM   3522  H H    . VAL A 1 56 ? -4.727  7.880   -5.779  1.00 1.00 ? 56  VAL A H    3  
ATOM   3523  H HA   . VAL A 1 56 ? -5.536  8.618   -3.077  1.00 1.00 ? 56  VAL A HA   3  
ATOM   3524  H HB   . VAL A 1 56 ? -2.938  7.531   -4.185  1.00 1.00 ? 56  VAL A HB   3  
ATOM   3525  H HG11 . VAL A 1 56 ? -3.820  8.285   -1.394  1.00 1.00 ? 56  VAL A HG11 3  
ATOM   3526  H HG12 . VAL A 1 56 ? -2.321  8.702   -2.223  1.00 1.00 ? 56  VAL A HG12 3  
ATOM   3527  H HG13 . VAL A 1 56 ? -2.588  7.056   -1.661  1.00 1.00 ? 56  VAL A HG13 3  
ATOM   3528  H HG21 . VAL A 1 56 ? -3.664  5.416   -3.467  1.00 1.00 ? 56  VAL A HG21 3  
ATOM   3529  H HG22 . VAL A 1 56 ? -5.162  6.114   -4.084  1.00 1.00 ? 56  VAL A HG22 3  
ATOM   3530  H HG23 . VAL A 1 56 ? -4.847  6.086   -2.347  1.00 1.00 ? 56  VAL A HG23 3  
ATOM   3531  N N    . ASP A 1 57 ? -4.405  10.791  -2.733  1.00 1.00 ? 57  ASP A N    3  
ATOM   3532  C CA   . ASP A 1 57 ? -3.834  12.127  -2.571  1.00 1.00 ? 57  ASP A CA   3  
ATOM   3533  C C    . ASP A 1 57 ? -2.566  12.061  -1.729  1.00 1.00 ? 57  ASP A C    3  
ATOM   3534  O O    . ASP A 1 57 ? -2.397  11.154  -0.915  1.00 1.00 ? 57  ASP A O    3  
ATOM   3535  C CB   . ASP A 1 57 ? -4.850  13.053  -1.899  1.00 1.00 ? 57  ASP A CB   3  
ATOM   3536  C CG   . ASP A 1 57 ? -5.984  13.370  -2.871  1.00 1.00 ? 57  ASP A CG   3  
ATOM   3537  O OD1  . ASP A 1 57 ? -5.823  13.098  -4.049  1.00 1.00 ? 57  ASP A OD1  3  
ATOM   3538  O OD2  . ASP A 1 57 ? -6.995  13.881  -2.420  1.00 1.00 ? 57  ASP A OD2  3  
ATOM   3539  H H    . ASP A 1 57 ? -5.044  10.459  -2.067  1.00 1.00 ? 57  ASP A H    3  
ATOM   3540  H HA   . ASP A 1 57 ? -3.590  12.531  -3.543  1.00 1.00 ? 57  ASP A HA   3  
ATOM   3541  H HB2  . ASP A 1 57 ? -5.252  12.568  -1.022  1.00 1.00 ? 57  ASP A HB2  3  
ATOM   3542  H HB3  . ASP A 1 57 ? -4.360  13.970  -1.611  1.00 1.00 ? 57  ASP A HB3  3  
ATOM   3543  N N    . GLU A 1 58 ? -1.678  13.027  -1.930  1.00 1.00 ? 58  GLU A N    3  
ATOM   3544  C CA   . GLU A 1 58 ? -0.425  13.070  -1.184  1.00 1.00 ? 58  GLU A CA   3  
ATOM   3545  C C    . GLU A 1 58 ? -0.701  13.240  0.307   1.00 1.00 ? 58  GLU A C    3  
ATOM   3546  O O    . GLU A 1 58 ? 0.022   12.702  1.146   1.00 1.00 ? 58  GLU A O    3  
ATOM   3547  C CB   . GLU A 1 58 ? 0.433   14.237  -1.681  1.00 1.00 ? 58  GLU A CB   3  
ATOM   3548  C CG   . GLU A 1 58 ? 0.797   14.015  -3.152  1.00 1.00 ? 58  GLU A CG   3  
ATOM   3549  C CD   . GLU A 1 58 ? 1.695   12.790  -3.290  1.00 1.00 ? 58  GLU A CD   3  
ATOM   3550  O OE1  . GLU A 1 58 ? 2.292   12.405  -2.300  1.00 1.00 ? 58  GLU A OE1  3  
ATOM   3551  O OE2  . GLU A 1 58 ? 1.774   12.258  -4.385  1.00 1.00 ? 58  GLU A OE2  3  
ATOM   3552  H H    . GLU A 1 58 ? -1.868  13.725  -2.591  1.00 1.00 ? 58  GLU A H    3  
ATOM   3553  H HA   . GLU A 1 58 ? 0.114   12.145  -1.334  1.00 1.00 ? 58  GLU A HA   3  
ATOM   3554  H HB2  . GLU A 1 58 ? -0.121  15.160  -1.583  1.00 1.00 ? 58  GLU A HB2  3  
ATOM   3555  H HB3  . GLU A 1 58 ? 1.337   14.295  -1.094  1.00 1.00 ? 58  GLU A HB3  3  
ATOM   3556  H HG2  . GLU A 1 58 ? -0.106  13.863  -3.725  1.00 1.00 ? 58  GLU A HG2  3  
ATOM   3557  H HG3  . GLU A 1 58 ? 1.317   14.884  -3.527  1.00 1.00 ? 58  GLU A HG3  3  
ATOM   3558  N N    . ASP A 1 59 ? -1.747  13.990  0.629   1.00 1.00 ? 59  ASP A N    3  
ATOM   3559  C CA   . ASP A 1 59 ? -2.103  14.223  2.023   1.00 1.00 ? 59  ASP A CA   3  
ATOM   3560  C C    . ASP A 1 59 ? -2.685  12.962  2.643   1.00 1.00 ? 59  ASP A C    3  
ATOM   3561  O O    . ASP A 1 59 ? -2.698  12.807  3.863   1.00 1.00 ? 59  ASP A O    3  
ATOM   3562  C CB   . ASP A 1 59 ? -3.124  15.360  2.119   1.00 1.00 ? 59  ASP A CB   3  
ATOM   3563  C CG   . ASP A 1 59 ? -2.463  16.683  1.750   1.00 1.00 ? 59  ASP A CG   3  
ATOM   3564  O OD1  . ASP A 1 59 ? -1.248  16.704  1.637   1.00 1.00 ? 59  ASP A OD1  3  
ATOM   3565  O OD2  . ASP A 1 59 ? -3.181  17.655  1.582   1.00 1.00 ? 59  ASP A OD2  3  
ATOM   3566  H H    . ASP A 1 59 ? -2.288  14.393  -0.081  1.00 1.00 ? 59  ASP A H    3  
ATOM   3567  H HA   . ASP A 1 59 ? -1.218  14.500  2.567   1.00 1.00 ? 59  ASP A HA   3  
ATOM   3568  H HB2  . ASP A 1 59 ? -3.943  15.166  1.441   1.00 1.00 ? 59  ASP A HB2  3  
ATOM   3569  H HB3  . ASP A 1 59 ? -3.501  15.419  3.129   1.00 1.00 ? 59  ASP A HB3  3  
ATOM   3570  N N    . LYS A 1 60 ? -3.170  12.063  1.795   1.00 1.00 ? 60  LYS A N    3  
ATOM   3571  C CA   . LYS A 1 60 ? -3.756  10.815  2.268   1.00 1.00 ? 60  LYS A CA   3  
ATOM   3572  C C    . LYS A 1 60 ? -2.684  9.754   2.462   1.00 1.00 ? 60  LYS A C    3  
ATOM   3573  O O    . LYS A 1 60 ? -2.804  8.893   3.331   1.00 1.00 ? 60  LYS A O    3  
ATOM   3574  C CB   . LYS A 1 60 ? -4.802  10.310  1.265   1.00 1.00 ? 60  LYS A CB   3  
ATOM   3575  C CG   . LYS A 1 60 ? -5.749  9.307   1.959   1.00 1.00 ? 60  LYS A CG   3  
ATOM   3576  C CD   . LYS A 1 60 ? -6.907  10.060  2.624   1.00 1.00 ? 60  LYS A CD   3  
ATOM   3577  C CE   . LYS A 1 60 ? -7.852  9.063   3.283   1.00 1.00 ? 60  LYS A CE   3  
ATOM   3578  N NZ   . LYS A 1 60 ? -8.966  9.803   3.936   1.00 1.00 ? 60  LYS A NZ   3  
ATOM   3579  H H    . LYS A 1 60 ? -3.133  12.242  0.831   1.00 1.00 ? 60  LYS A H    3  
ATOM   3580  H HA   . LYS A 1 60 ? -4.238  10.993  3.217   1.00 1.00 ? 60  LYS A HA   3  
ATOM   3581  H HB2  . LYS A 1 60 ? -5.368  11.152  0.885   1.00 1.00 ? 60  LYS A HB2  3  
ATOM   3582  H HB3  . LYS A 1 60 ? -4.301  9.819   0.442   1.00 1.00 ? 60  LYS A HB3  3  
ATOM   3583  H HG2  . LYS A 1 60 ? -6.146  8.619   1.225   1.00 1.00 ? 60  LYS A HG2  3  
ATOM   3584  H HG3  . LYS A 1 60 ? -5.208  8.749   2.713   1.00 1.00 ? 60  LYS A HG3  3  
ATOM   3585  H HD2  . LYS A 1 60 ? -6.523  10.735  3.373   1.00 1.00 ? 60  LYS A HD2  3  
ATOM   3586  H HD3  . LYS A 1 60 ? -7.447  10.620  1.877   1.00 1.00 ? 60  LYS A HD3  3  
ATOM   3587  H HE2  . LYS A 1 60 ? -8.250  8.396   2.534   1.00 1.00 ? 60  LYS A HE2  3  
ATOM   3588  H HE3  . LYS A 1 60 ? -7.311  8.493   4.026   1.00 1.00 ? 60  LYS A HE3  3  
ATOM   3589  H HZ1  . LYS A 1 60 ? -8.582  10.428  4.675   1.00 1.00 ? 60  LYS A HZ1  3  
ATOM   3590  H HZ2  . LYS A 1 60 ? -9.628  9.124   4.365   1.00 1.00 ? 60  LYS A HZ2  3  
ATOM   3591  H HZ3  . LYS A 1 60 ? -9.465  10.374  3.226   1.00 1.00 ? 60  LYS A HZ3  3  
ATOM   3592  N N    . ALA A 1 61 ? -1.643  9.819   1.640   1.00 1.00 ? 61  ALA A N    3  
ATOM   3593  C CA   . ALA A 1 61 ? -0.544  8.851   1.709   1.00 1.00 ? 61  ALA A CA   3  
ATOM   3594  C C    . ALA A 1 61 ? 0.710   9.513   2.248   1.00 1.00 ? 61  ALA A C    3  
ATOM   3595  O O    . ALA A 1 61 ? 1.775   9.417   1.647   1.00 1.00 ? 61  ALA A O    3  
ATOM   3596  C CB   . ALA A 1 61 ? -0.263  8.280   0.315   1.00 1.00 ? 61  ALA A CB   3  
ATOM   3597  H H    . ALA A 1 61 ? -1.611  10.535  0.972   1.00 1.00 ? 61  ALA A H    3  
ATOM   3598  H HA   . ALA A 1 61 ? -0.817  8.035   2.364   1.00 1.00 ? 61  ALA A HA   3  
ATOM   3599  H HB1  . ALA A 1 61 ? -0.270  9.081   -0.410  1.00 1.00 ? 61  ALA A HB1  3  
ATOM   3600  H HB2  . ALA A 1 61 ? -1.026  7.562   0.065   1.00 1.00 ? 61  ALA A HB2  3  
ATOM   3601  H HB3  . ALA A 1 61 ? 0.703   7.795   0.308   1.00 1.00 ? 61  ALA A HB3  3  
ATOM   3602  N N    . GLN A 1 62 ? 0.578   10.186  3.388   1.00 1.00 ? 62  GLN A N    3  
ATOM   3603  C CA   . GLN A 1 62 ? 1.718   10.868  4.017   1.00 1.00 ? 62  GLN A CA   3  
ATOM   3604  C C    . GLN A 1 62 ? 2.009   10.280  5.392   1.00 1.00 ? 62  GLN A C    3  
ATOM   3605  O O    . GLN A 1 62 ? 3.167   10.146  5.786   1.00 1.00 ? 62  GLN A O    3  
ATOM   3606  C CB   . GLN A 1 62 ? 1.419   12.358  4.152   1.00 1.00 ? 62  GLN A CB   3  
ATOM   3607  C CG   . GLN A 1 62 ? 0.161   12.554  4.994   1.00 1.00 ? 62  GLN A CG   3  
ATOM   3608  C CD   . GLN A 1 62 ? -0.251  14.024  4.979   1.00 1.00 ? 62  GLN A CD   3  
ATOM   3609  O OE1  . GLN A 1 62 ? 0.360   14.831  4.279   1.00 1.00 ? 62  GLN A OE1  3  
ATOM   3610  N NE2  . GLN A 1 62 ? -1.257  14.418  5.710   1.00 1.00 ? 62  GLN A NE2  3  
ATOM   3611  H H    . GLN A 1 62 ? -0.304  10.227  3.815   1.00 1.00 ? 62  GLN A H    3  
ATOM   3612  H HA   . GLN A 1 62 ? 2.599   10.749  3.399   1.00 1.00 ? 62  GLN A HA   3  
ATOM   3613  H HB2  . GLN A 1 62 ? 2.255   12.848  4.630   1.00 1.00 ? 62  GLN A HB2  3  
ATOM   3614  H HB3  . GLN A 1 62 ? 1.264   12.783  3.173   1.00 1.00 ? 62  GLN A HB3  3  
ATOM   3615  H HG2  . GLN A 1 62 ? -0.639  11.951  4.593   1.00 1.00 ? 62  GLN A HG2  3  
ATOM   3616  H HG3  . GLN A 1 62 ? 0.361   12.253  6.011   1.00 1.00 ? 62  GLN A HG3  3  
ATOM   3617  H HE21 . GLN A 1 62 ? -1.742  13.772  6.264   1.00 1.00 ? 62  GLN A HE21 3  
ATOM   3618  H HE22 . GLN A 1 62 ? -1.528  15.359  5.702   1.00 1.00 ? 62  GLN A HE22 3  
ATOM   3619  N N    . ASP A 1 63 ? 0.953   9.933   6.124   1.00 1.00 ? 63  ASP A N    3  
ATOM   3620  C CA   . ASP A 1 63 ? 1.098   9.366   7.464   1.00 1.00 ? 63  ASP A CA   3  
ATOM   3621  C C    . ASP A 1 63 ? 0.160   8.181   7.663   1.00 1.00 ? 63  ASP A C    3  
ATOM   3622  O O    . ASP A 1 63 ? -0.574  8.119   8.649   1.00 1.00 ? 63  ASP A O    3  
ATOM   3623  C CB   . ASP A 1 63 ? 0.795   10.438  8.508   1.00 1.00 ? 63  ASP A CB   3  
ATOM   3624  C CG   . ASP A 1 63 ? -0.637  10.936  8.350   1.00 1.00 ? 63  ASP A CG   3  
ATOM   3625  O OD1  . ASP A 1 63 ? -1.287  10.525  7.404   1.00 1.00 ? 63  ASP A OD1  3  
ATOM   3626  O OD2  . ASP A 1 63 ? -1.062  11.722  9.181   1.00 1.00 ? 63  ASP A OD2  3  
ATOM   3627  H H    . ASP A 1 63 ? 0.057   10.070  5.760   1.00 1.00 ? 63  ASP A H    3  
ATOM   3628  H HA   . ASP A 1 63 ? 2.114   9.024   7.606   1.00 1.00 ? 63  ASP A HA   3  
ATOM   3629  H HB2  . ASP A 1 63 ? 0.922   10.018  9.489   1.00 1.00 ? 63  ASP A HB2  3  
ATOM   3630  H HB3  . ASP A 1 63 ? 1.477   11.265  8.379   1.00 1.00 ? 63  ASP A HB3  3  
ATOM   3631  N N    . ILE A 1 64 ? 0.194   7.240   6.726   1.00 1.00 ? 64  ILE A N    3  
ATOM   3632  C CA   . ILE A 1 64 ? -0.648  6.047   6.808   1.00 1.00 ? 64  ILE A CA   3  
ATOM   3633  C C    . ILE A 1 64 ? 0.061   4.937   7.570   1.00 1.00 ? 64  ILE A C    3  
ATOM   3634  O O    . ILE A 1 64 ? 1.208   4.601   7.275   1.00 1.00 ? 64  ILE A O    3  
ATOM   3635  C CB   . ILE A 1 64 ? -1.006  5.562   5.402   1.00 1.00 ? 64  ILE A CB   3  
ATOM   3636  C CG1  . ILE A 1 64 ? -1.799  6.658   4.671   1.00 1.00 ? 64  ILE A CG1  3  
ATOM   3637  C CG2  . ILE A 1 64 ? -1.848  4.292   5.491   1.00 1.00 ? 64  ILE A CG2  3  
ATOM   3638  C CD1  . ILE A 1 64 ? -3.116  6.988   5.407   1.00 1.00 ? 64  ILE A CD1  3  
ATOM   3639  H H    . ILE A 1 64 ? 0.807   7.344   5.968   1.00 1.00 ? 64  ILE A H    3  
ATOM   3640  H HA   . ILE A 1 64 ? -1.561  6.285   7.335   1.00 1.00 ? 64  ILE A HA   3  
ATOM   3641  H HB   . ILE A 1 64 ? -0.096  5.349   4.856   1.00 1.00 ? 64  ILE A HB   3  
ATOM   3642  H HG12 . ILE A 1 64 ? -1.195  7.551   4.617   1.00 1.00 ? 64  ILE A HG12 3  
ATOM   3643  H HG13 . ILE A 1 64 ? -2.028  6.326   3.672   1.00 1.00 ? 64  ILE A HG13 3  
ATOM   3644  H HG21 . ILE A 1 64 ? -2.245  4.060   4.514   1.00 1.00 ? 64  ILE A HG21 3  
ATOM   3645  H HG22 . ILE A 1 64 ? -2.662  4.456   6.180   1.00 1.00 ? 64  ILE A HG22 3  
ATOM   3646  H HG23 . ILE A 1 64 ? -1.239  3.471   5.840   1.00 1.00 ? 64  ILE A HG23 3  
ATOM   3647  H HD11 . ILE A 1 64 ? -2.938  7.778   6.119   1.00 1.00 ? 64  ILE A HD11 3  
ATOM   3648  H HD12 . ILE A 1 64 ? -3.494  6.116   5.927   1.00 1.00 ? 64  ILE A HD12 3  
ATOM   3649  H HD13 . ILE A 1 64 ? -3.852  7.316   4.690   1.00 1.00 ? 64  ILE A HD13 3  
ATOM   3650  N N    . SER A 1 65 ? -0.641  4.370   8.545   1.00 1.00 ? 65  SER A N    3  
ATOM   3651  C CA   . SER A 1 65 ? -0.088  3.289   9.347   1.00 1.00 ? 65  SER A CA   3  
ATOM   3652  C C    . SER A 1 65 ? 0.330   2.131   8.443   1.00 1.00 ? 65  SER A C    3  
ATOM   3653  O O    . SER A 1 65 ? 0.338   2.257   7.217   1.00 1.00 ? 65  SER A O    3  
ATOM   3654  C CB   . SER A 1 65 ? -1.120  2.822   10.393  1.00 1.00 ? 65  SER A CB   3  
ATOM   3655  O OG   . SER A 1 65 ? -0.703  3.263   11.676  1.00 1.00 ? 65  SER A OG   3  
ATOM   3656  H H    . SER A 1 65 ? -1.554  4.680   8.720   1.00 1.00 ? 65  SER A H    3  
ATOM   3657  H HA   . SER A 1 65 ? 0.787   3.656   9.865   1.00 1.00 ? 65  SER A HA   3  
ATOM   3658  H HB2  . SER A 1 65 ? -2.078  3.255   10.171  1.00 1.00 ? 65  SER A HB2  3  
ATOM   3659  H HB3  . SER A 1 65 ? -1.206  1.739   10.389  1.00 1.00 ? 65  SER A HB3  3  
ATOM   3660  H HG   . SER A 1 65 ? -0.316  2.512   12.133  1.00 1.00 ? 65  SER A HG   3  
ATOM   3661  N N    . THR A 1 66 ? 0.681   1.014   9.067   1.00 1.00 ? 66  THR A N    3  
ATOM   3662  C CA   . THR A 1 66 ? 1.095   -0.177  8.337   1.00 1.00 ? 66  THR A CA   3  
ATOM   3663  C C    . THR A 1 66 ? 0.082   -0.515  7.245   1.00 1.00 ? 66  THR A C    3  
ATOM   3664  O O    . THR A 1 66 ? -0.820  0.267   6.949   1.00 1.00 ? 66  THR A O    3  
ATOM   3665  C CB   . THR A 1 66 ? 1.237   -1.362  9.293   1.00 1.00 ? 66  THR A CB   3  
ATOM   3666  O OG1  . THR A 1 66 ? 1.791   -2.467  8.596   1.00 1.00 ? 66  THR A OG1  3  
ATOM   3667  C CG2  . THR A 1 66 ? -0.122  -1.756  9.846   1.00 1.00 ? 66  THR A CG2  3  
ATOM   3668  H H    . THR A 1 66 ? 0.655   0.989   10.045  1.00 1.00 ? 66  THR A H    3  
ATOM   3669  H HA   . THR A 1 66 ? 2.051   0.008   7.876   1.00 1.00 ? 66  THR A HA   3  
ATOM   3670  H HB   . THR A 1 66 ? 1.878   -1.092  10.106  1.00 1.00 ? 66  THR A HB   3  
ATOM   3671  H HG1  . THR A 1 66 ? 1.074   -2.941  8.165   1.00 1.00 ? 66  THR A HG1  3  
ATOM   3672  H HG21 . THR A 1 66 ? -0.636  -2.346  9.109   1.00 1.00 ? 66  THR A HG21 3  
ATOM   3673  H HG22 . THR A 1 66 ? -0.694  -0.868  10.070  1.00 1.00 ? 66  THR A HG22 3  
ATOM   3674  H HG23 . THR A 1 66 ? 0.019   -2.337  10.743  1.00 1.00 ? 66  THR A HG23 3  
ATOM   3675  N N    . ILE A 1 67 ? 0.253   -1.680  6.635   1.00 1.00 ? 67  ILE A N    3  
ATOM   3676  C CA   . ILE A 1 67 ? -0.637  -2.102  5.562   1.00 1.00 ? 67  ILE A CA   3  
ATOM   3677  C C    . ILE A 1 67 ? -2.077  -2.203  6.052   1.00 1.00 ? 67  ILE A C    3  
ATOM   3678  O O    . ILE A 1 67 ? -3.006  -1.786  5.361   1.00 1.00 ? 67  ILE A O    3  
ATOM   3679  C CB   . ILE A 1 67 ? -0.187  -3.457  5.006   1.00 1.00 ? 67  ILE A CB   3  
ATOM   3680  C CG1  . ILE A 1 67 ? 1.165   -3.286  4.293   1.00 1.00 ? 67  ILE A CG1  3  
ATOM   3681  C CG2  . ILE A 1 67 ? -1.240  -3.989  4.024   1.00 1.00 ? 67  ILE A CG2  3  
ATOM   3682  C CD1  . ILE A 1 67 ? 1.760   -4.672  4.026   1.00 1.00 ? 67  ILE A CD1  3  
ATOM   3683  H H    . ILE A 1 67 ? 1.002   -2.260  6.901   1.00 1.00 ? 67  ILE A H    3  
ATOM   3684  H HA   . ILE A 1 67 ? -0.591  -1.375  4.772   1.00 1.00 ? 67  ILE A HA   3  
ATOM   3685  H HB   . ILE A 1 67 ? -0.081  -4.168  5.815   1.00 1.00 ? 67  ILE A HB   3  
ATOM   3686  H HG12 . ILE A 1 67 ? 1.023   -2.757  3.356   1.00 1.00 ? 67  ILE A HG12 3  
ATOM   3687  H HG13 . ILE A 1 67 ? 1.841   -2.718  4.922   1.00 1.00 ? 67  ILE A HG13 3  
ATOM   3688  H HG21 . ILE A 1 67 ? -2.049  -4.433  4.582   1.00 1.00 ? 67  ILE A HG21 3  
ATOM   3689  H HG22 . ILE A 1 67 ? -0.795  -4.736  3.384   1.00 1.00 ? 67  ILE A HG22 3  
ATOM   3690  H HG23 . ILE A 1 67 ? -1.621  -3.178  3.422   1.00 1.00 ? 67  ILE A HG23 3  
ATOM   3691  H HD11 . ILE A 1 67 ? 0.986   -5.327  3.654   1.00 1.00 ? 67  ILE A HD11 3  
ATOM   3692  H HD12 . ILE A 1 67 ? 2.160   -5.077  4.945   1.00 1.00 ? 67  ILE A HD12 3  
ATOM   3693  H HD13 . ILE A 1 67 ? 2.548   -4.595  3.293   1.00 1.00 ? 67  ILE A HD13 3  
ATOM   3694  N N    . GLN A 1 68 ? -2.259  -2.760  7.237   1.00 1.00 ? 68  GLN A N    3  
ATOM   3695  C CA   . GLN A 1 68 ? -3.598  -2.912  7.798   1.00 1.00 ? 68  GLN A CA   3  
ATOM   3696  C C    . GLN A 1 68 ? -4.434  -1.654  7.583   1.00 1.00 ? 68  GLN A C    3  
ATOM   3697  O O    . GLN A 1 68 ? -5.549  -1.722  7.064   1.00 1.00 ? 68  GLN A O    3  
ATOM   3698  C CB   . GLN A 1 68 ? -3.506  -3.207  9.297   1.00 1.00 ? 68  GLN A CB   3  
ATOM   3699  C CG   . GLN A 1 68 ? -2.996  -4.636  9.511   1.00 1.00 ? 68  GLN A CG   3  
ATOM   3700  C CD   . GLN A 1 68 ? -4.145  -5.628  9.335   1.00 1.00 ? 68  GLN A CD   3  
ATOM   3701  O OE1  . GLN A 1 68 ? -4.767  -6.036  10.314  1.00 1.00 ? 68  GLN A OE1  3  
ATOM   3702  N NE2  . GLN A 1 68 ? -4.483  -6.021  8.138   1.00 1.00 ? 68  GLN A NE2  3  
ATOM   3703  H H    . GLN A 1 68 ? -1.480  -3.079  7.741   1.00 1.00 ? 68  GLN A H    3  
ATOM   3704  H HA   . GLN A 1 68 ? -4.086  -3.740  7.311   1.00 1.00 ? 68  GLN A HA   3  
ATOM   3705  H HB2  . GLN A 1 68 ? -2.829  -2.506  9.760   1.00 1.00 ? 68  GLN A HB2  3  
ATOM   3706  H HB3  . GLN A 1 68 ? -4.485  -3.105  9.743   1.00 1.00 ? 68  GLN A HB3  3  
ATOM   3707  H HG2  . GLN A 1 68 ? -2.216  -4.856  8.795   1.00 1.00 ? 68  GLN A HG2  3  
ATOM   3708  H HG3  . GLN A 1 68 ? -2.598  -4.727  10.510  1.00 1.00 ? 68  GLN A HG3  3  
ATOM   3709  H HE21 . GLN A 1 68 ? -4.002  -5.678  7.358   1.00 1.00 ? 68  GLN A HE21 3  
ATOM   3710  H HE22 . GLN A 1 68 ? -5.217  -6.659  8.021   1.00 1.00 ? 68  GLN A HE22 3  
ATOM   3711  N N    . GLN A 1 69 ? -3.905  -0.511  7.998   1.00 1.00 ? 69  GLN A N    3  
ATOM   3712  C CA   . GLN A 1 69 ? -4.623  0.744   7.851   1.00 1.00 ? 69  GLN A CA   3  
ATOM   3713  C C    . GLN A 1 69 ? -4.763  1.139   6.384   1.00 1.00 ? 69  GLN A C    3  
ATOM   3714  O O    . GLN A 1 69 ? -5.817  1.606   5.956   1.00 1.00 ? 69  GLN A O    3  
ATOM   3715  C CB   . GLN A 1 69 ? -3.881  1.856   8.621   1.00 1.00 ? 69  GLN A CB   3  
ATOM   3716  C CG   . GLN A 1 69 ? -4.884  2.785   9.301   1.00 1.00 ? 69  GLN A CG   3  
ATOM   3717  C CD   . GLN A 1 69 ? -5.808  3.401   8.256   1.00 1.00 ? 69  GLN A CD   3  
ATOM   3718  O OE1  . GLN A 1 69 ? -6.754  2.756   7.808   1.00 1.00 ? 69  GLN A OE1  3  
ATOM   3719  N NE2  . GLN A 1 69 ? -5.583  4.615   7.836   1.00 1.00 ? 69  GLN A NE2  3  
ATOM   3720  H H    . GLN A 1 69 ? -3.022  -0.512  8.427   1.00 1.00 ? 69  GLN A H    3  
ATOM   3721  H HA   . GLN A 1 69 ? -5.608  0.614   8.268   1.00 1.00 ? 69  GLN A HA   3  
ATOM   3722  H HB2  . GLN A 1 69 ? -3.258  1.400   9.370   1.00 1.00 ? 69  GLN A HB2  3  
ATOM   3723  H HB3  . GLN A 1 69 ? -3.258  2.434   7.945   1.00 1.00 ? 69  GLN A HB3  3  
ATOM   3724  H HG2  . GLN A 1 69 ? -5.468  2.214   10.008  1.00 1.00 ? 69  GLN A HG2  3  
ATOM   3725  H HG3  . GLN A 1 69 ? -4.356  3.570   9.821   1.00 1.00 ? 69  GLN A HG3  3  
ATOM   3726  H HE21 . GLN A 1 69 ? -4.826  5.125   8.192   1.00 1.00 ? 69  GLN A HE21 3  
ATOM   3727  H HE22 . GLN A 1 69 ? -6.172  5.016   7.162   1.00 1.00 ? 69  GLN A HE22 3  
ATOM   3728  N N    . ALA A 1 70 ? -3.693  0.967   5.629   1.00 1.00 ? 70  ALA A N    3  
ATOM   3729  C CA   . ALA A 1 70 ? -3.704  1.336   4.222   1.00 1.00 ? 70  ALA A CA   3  
ATOM   3730  C C    . ALA A 1 70 ? -4.841  0.638   3.492   1.00 1.00 ? 70  ALA A C    3  
ATOM   3731  O O    . ALA A 1 70 ? -5.500  1.234   2.640   1.00 1.00 ? 70  ALA A O    3  
ATOM   3732  C CB   . ALA A 1 70 ? -2.374  0.958   3.572   1.00 1.00 ? 70  ALA A CB   3  
ATOM   3733  H H    . ALA A 1 70 ? -2.877  0.602   6.030   1.00 1.00 ? 70  ALA A H    3  
ATOM   3734  H HA   . ALA A 1 70 ? -3.841  2.407   4.143   1.00 1.00 ? 70  ALA A HA   3  
ATOM   3735  H HB1  . ALA A 1 70 ? -1.580  1.535   4.021   1.00 1.00 ? 70  ALA A HB1  3  
ATOM   3736  H HB2  . ALA A 1 70 ? -2.415  1.167   2.514   1.00 1.00 ? 70  ALA A HB2  3  
ATOM   3737  H HB3  . ALA A 1 70 ? -2.185  -0.093  3.725   1.00 1.00 ? 70  ALA A HB3  3  
ATOM   3738  N N    . ALA A 1 71 ? -5.066  -0.622  3.827   1.00 1.00 ? 71  ALA A N    3  
ATOM   3739  C CA   . ALA A 1 71 ? -6.128  -1.386  3.194   1.00 1.00 ? 71  ALA A CA   3  
ATOM   3740  C C    . ALA A 1 71 ? -7.476  -0.709  3.403   1.00 1.00 ? 71  ALA A C    3  
ATOM   3741  O O    . ALA A 1 71 ? -8.250  -0.552  2.463   1.00 1.00 ? 71  ALA A O    3  
ATOM   3742  C CB   . ALA A 1 71 ? -6.171  -2.789  3.786   1.00 1.00 ? 71  ALA A CB   3  
ATOM   3743  H H    . ALA A 1 71 ? -4.508  -1.046  4.513   1.00 1.00 ? 71  ALA A H    3  
ATOM   3744  H HA   . ALA A 1 71 ? -5.933  -1.455  2.138   1.00 1.00 ? 71  ALA A HA   3  
ATOM   3745  H HB1  . ALA A 1 71 ? -6.948  -3.366  3.300   1.00 1.00 ? 71  ALA A HB1  3  
ATOM   3746  H HB2  . ALA A 1 71 ? -6.378  -2.725  4.843   1.00 1.00 ? 71  ALA A HB2  3  
ATOM   3747  H HB3  . ALA A 1 71 ? -5.217  -3.267  3.633   1.00 1.00 ? 71  ALA A HB3  3  
ATOM   3748  N N    . ASP A 1 72 ? -7.754  -0.319  4.641   1.00 1.00 ? 72  ASP A N    3  
ATOM   3749  C CA   . ASP A 1 72 ? -9.018  0.333   4.956   1.00 1.00 ? 72  ASP A CA   3  
ATOM   3750  C C    . ASP A 1 72 ? -9.148  1.660   4.212   1.00 1.00 ? 72  ASP A C    3  
ATOM   3751  O O    . ASP A 1 72 ? -10.225 2.012   3.732   1.00 1.00 ? 72  ASP A O    3  
ATOM   3752  C CB   . ASP A 1 72 ? -9.113  0.584   6.462   1.00 1.00 ? 72  ASP A CB   3  
ATOM   3753  C CG   . ASP A 1 72 ? -10.452 1.231   6.801   1.00 1.00 ? 72  ASP A CG   3  
ATOM   3754  O OD1  . ASP A 1 72 ? -11.182 1.557   5.880   1.00 1.00 ? 72  ASP A OD1  3  
ATOM   3755  O OD2  . ASP A 1 72 ? -10.728 1.390   7.981   1.00 1.00 ? 72  ASP A OD2  3  
ATOM   3756  H H    . ASP A 1 72 ? -7.100  -0.476  5.354   1.00 1.00 ? 72  ASP A H    3  
ATOM   3757  H HA   . ASP A 1 72 ? -9.826  -0.318  4.657   1.00 1.00 ? 72  ASP A HA   3  
ATOM   3758  H HB2  . ASP A 1 72 ? -9.024  -0.354  6.988   1.00 1.00 ? 72  ASP A HB2  3  
ATOM   3759  H HB3  . ASP A 1 72 ? -8.312  1.243   6.766   1.00 1.00 ? 72  ASP A HB3  3  
ATOM   3760  N N    . VAL A 1 73 ? -8.045  2.396   4.128   1.00 1.00 ? 73  VAL A N    3  
ATOM   3761  C CA   . VAL A 1 73 ? -8.047  3.685   3.446   1.00 1.00 ? 73  VAL A CA   3  
ATOM   3762  C C    . VAL A 1 73 ? -8.363  3.506   1.964   1.00 1.00 ? 73  VAL A C    3  
ATOM   3763  O O    . VAL A 1 73 ? -9.144  4.265   1.388   1.00 1.00 ? 73  VAL A O    3  
ATOM   3764  C CB   . VAL A 1 73 ? -6.684  4.366   3.607   1.00 1.00 ? 73  VAL A CB   3  
ATOM   3765  C CG1  . VAL A 1 73 ? -6.634  5.630   2.745   1.00 1.00 ? 73  VAL A CG1  3  
ATOM   3766  C CG2  . VAL A 1 73 ? -6.474  4.748   5.075   1.00 1.00 ? 73  VAL A CG2  3  
ATOM   3767  H H    . VAL A 1 73 ? -7.215  2.066   4.532   1.00 1.00 ? 73  VAL A H    3  
ATOM   3768  H HA   . VAL A 1 73 ? -8.805  4.312   3.889   1.00 1.00 ? 73  VAL A HA   3  
ATOM   3769  H HB   . VAL A 1 73 ? -5.903  3.688   3.295   1.00 1.00 ? 73  VAL A HB   3  
ATOM   3770  H HG11 . VAL A 1 73 ? -6.527  5.353   1.707   1.00 1.00 ? 73  VAL A HG11 3  
ATOM   3771  H HG12 . VAL A 1 73 ? -5.794  6.238   3.045   1.00 1.00 ? 73  VAL A HG12 3  
ATOM   3772  H HG13 . VAL A 1 73 ? -7.548  6.188   2.876   1.00 1.00 ? 73  VAL A HG13 3  
ATOM   3773  H HG21 . VAL A 1 73 ? -7.339  5.285   5.435   1.00 1.00 ? 73  VAL A HG21 3  
ATOM   3774  H HG22 . VAL A 1 73 ? -5.599  5.375   5.163   1.00 1.00 ? 73  VAL A HG22 3  
ATOM   3775  H HG23 . VAL A 1 73 ? -6.333  3.855   5.663   1.00 1.00 ? 73  VAL A HG23 3  
ATOM   3776  N N    . ILE A 1 74 ? -7.749  2.504   1.352   1.00 1.00 ? 74  ILE A N    3  
ATOM   3777  C CA   . ILE A 1 74 ? -7.968  2.240   -0.065  1.00 1.00 ? 74  ILE A CA   3  
ATOM   3778  C C    . ILE A 1 74 ? -9.424  1.860   -0.313  1.00 1.00 ? 74  ILE A C    3  
ATOM   3779  O O    . ILE A 1 74 ? -10.035 2.316   -1.281  1.00 1.00 ? 74  ILE A O    3  
ATOM   3780  C CB   . ILE A 1 74 ? -7.035  1.111   -0.538  1.00 1.00 ? 74  ILE A CB   3  
ATOM   3781  C CG1  . ILE A 1 74 ? -5.615  1.663   -0.729  1.00 1.00 ? 74  ILE A CG1  3  
ATOM   3782  C CG2  . ILE A 1 74 ? -7.538  0.526   -1.870  1.00 1.00 ? 74  ILE A CG2  3  
ATOM   3783  C CD1  . ILE A 1 74 ? -4.611  0.509   -0.711  1.00 1.00 ? 74  ILE A CD1  3  
ATOM   3784  H H    . ILE A 1 74 ? -7.134  1.935   1.859   1.00 1.00 ? 74  ILE A H    3  
ATOM   3785  H HA   . ILE A 1 74 ? -7.747  3.136   -0.621  1.00 1.00 ? 74  ILE A HA   3  
ATOM   3786  H HB   . ILE A 1 74 ? -7.015  0.329   0.205   1.00 1.00 ? 74  ILE A HB   3  
ATOM   3787  H HG12 . ILE A 1 74 ? -5.553  2.180   -1.676  1.00 1.00 ? 74  ILE A HG12 3  
ATOM   3788  H HG13 . ILE A 1 74 ? -5.386  2.349   0.074   1.00 1.00 ? 74  ILE A HG13 3  
ATOM   3789  H HG21 . ILE A 1 74 ? -6.735  0.003   -2.373  1.00 1.00 ? 74  ILE A HG21 3  
ATOM   3790  H HG22 . ILE A 1 74 ? -7.897  1.323   -2.500  1.00 1.00 ? 74  ILE A HG22 3  
ATOM   3791  H HG23 . ILE A 1 74 ? -8.343  -0.160  -1.671  1.00 1.00 ? 74  ILE A HG23 3  
ATOM   3792  H HD11 . ILE A 1 74 ? -3.730  0.783   -1.272  1.00 1.00 ? 74  ILE A HD11 3  
ATOM   3793  H HD12 . ILE A 1 74 ? -5.060  -0.367  -1.157  1.00 1.00 ? 74  ILE A HD12 3  
ATOM   3794  H HD13 . ILE A 1 74 ? -4.336  0.289   0.310   1.00 1.00 ? 74  ILE A HD13 3  
ATOM   3795  N N    . GLU A 1 75 ? -9.968  1.019   0.551   1.00 1.00 ? 75  GLU A N    3  
ATOM   3796  C CA   . GLU A 1 75 ? -11.348 0.582   0.398   1.00 1.00 ? 75  GLU A CA   3  
ATOM   3797  C C    . GLU A 1 75 ? -12.263 1.774   0.136   1.00 1.00 ? 75  GLU A C    3  
ATOM   3798  O O    . GLU A 1 75 ? -13.121 1.724   -0.745  1.00 1.00 ? 75  GLU A O    3  
ATOM   3799  C CB   . GLU A 1 75 ? -11.806 -0.160  1.662   1.00 1.00 ? 75  GLU A CB   3  
ATOM   3800  C CG   . GLU A 1 75 ? -11.255 -1.584  1.658   1.00 1.00 ? 75  GLU A CG   3  
ATOM   3801  C CD   . GLU A 1 75 ? -11.719 -2.316  2.908   1.00 1.00 ? 75  GLU A CD   3  
ATOM   3802  O OE1  . GLU A 1 75 ? -12.390 -1.700  3.721   1.00 1.00 ? 75  GLU A OE1  3  
ATOM   3803  O OE2  . GLU A 1 75 ? -11.396 -3.480  3.031   1.00 1.00 ? 75  GLU A OE2  3  
ATOM   3804  H H    . GLU A 1 75 ? -9.434  0.682   1.301   1.00 1.00 ? 75  GLU A H    3  
ATOM   3805  H HA   . GLU A 1 75 ? -11.404 -0.090  -0.445  1.00 1.00 ? 75  GLU A HA   3  
ATOM   3806  H HB2  . GLU A 1 75 ? -11.433 0.358   2.534   1.00 1.00 ? 75  GLU A HB2  3  
ATOM   3807  H HB3  . GLU A 1 75 ? -12.885 -0.195  1.700   1.00 1.00 ? 75  GLU A HB3  3  
ATOM   3808  H HG2  . GLU A 1 75 ? -11.614 -2.105  0.784   1.00 1.00 ? 75  GLU A HG2  3  
ATOM   3809  H HG3  . GLU A 1 75 ? -10.178 -1.554  1.642   1.00 1.00 ? 75  GLU A HG3  3  
ATOM   3810  N N    . GLY A 1 76 ? -12.073 2.842   0.898   1.00 1.00 ? 76  GLY A N    3  
ATOM   3811  C CA   . GLY A 1 76 ? -12.889 4.038   0.726   1.00 1.00 ? 76  GLY A CA   3  
ATOM   3812  C C    . GLY A 1 76 ? -12.654 4.654   -0.648  1.00 1.00 ? 76  GLY A C    3  
ATOM   3813  O O    . GLY A 1 76 ? -13.583 5.163   -1.274  1.00 1.00 ? 76  GLY A O    3  
ATOM   3814  H H    . GLY A 1 76 ? -11.367 2.829   1.579   1.00 1.00 ? 76  GLY A H    3  
ATOM   3815  H HA2  . GLY A 1 76 ? -13.937 3.775   0.819   1.00 1.00 ? 76  GLY A HA2  3  
ATOM   3816  H HA3  . GLY A 1 76 ? -12.630 4.760   1.486   1.00 1.00 ? 76  GLY A HA3  3  
ATOM   3817  N N    . LEU A 1 77 ? -11.410 4.594   -1.114  1.00 1.00 ? 77  LEU A N    3  
ATOM   3818  C CA   . LEU A 1 77 ? -11.067 5.145   -2.421  1.00 1.00 ? 77  LEU A CA   3  
ATOM   3819  C C    . LEU A 1 77 ? -11.621 4.270   -3.525  1.00 1.00 ? 77  LEU A C    3  
ATOM   3820  O O    . LEU A 1 77 ? -11.669 4.679   -4.683  1.00 1.00 ? 77  LEU A O    3  
ATOM   3821  C CB   . LEU A 1 77 ? -9.551  5.268   -2.561  1.00 1.00 ? 77  LEU A CB   3  
ATOM   3822  C CG   . LEU A 1 77 ? -9.034  6.361   -1.614  1.00 1.00 ? 77  LEU A CG   3  
ATOM   3823  C CD1  . LEU A 1 77 ? -7.508  6.287   -1.538  1.00 1.00 ? 77  LEU A CD1  3  
ATOM   3824  C CD2  . LEU A 1 77 ? -9.451  7.761   -2.127  1.00 1.00 ? 77  LEU A CD2  3  
ATOM   3825  H H    . LEU A 1 77 ? -10.712 4.168   -0.574  1.00 1.00 ? 77  LEU A H    3  
ATOM   3826  H HA   . LEU A 1 77 ? -11.508 6.123   -2.513  1.00 1.00 ? 77  LEU A HA   3  
ATOM   3827  H HB2  . LEU A 1 77 ? -9.095  4.320   -2.308  1.00 1.00 ? 77  LEU A HB2  3  
ATOM   3828  H HB3  . LEU A 1 77 ? -9.300  5.525   -3.576  1.00 1.00 ? 77  LEU A HB3  3  
ATOM   3829  H HG   . LEU A 1 77 ? -9.448  6.200   -0.628  1.00 1.00 ? 77  LEU A HG   3  
ATOM   3830  H HD11 . LEU A 1 77 ? -7.158  6.909   -0.727  1.00 1.00 ? 77  LEU A HD11 3  
ATOM   3831  H HD12 . LEU A 1 77 ? -7.091  6.644   -2.467  1.00 1.00 ? 77  LEU A HD12 3  
ATOM   3832  H HD13 . LEU A 1 77 ? -7.196  5.266   -1.371  1.00 1.00 ? 77  LEU A HD13 3  
ATOM   3833  H HD21 . LEU A 1 77 ? -9.431  7.783   -3.210  1.00 1.00 ? 77  LEU A HD21 3  
ATOM   3834  H HD22 . LEU A 1 77 ? -8.767  8.508   -1.746  1.00 1.00 ? 77  LEU A HD22 3  
ATOM   3835  H HD23 . LEU A 1 77 ? -10.447 7.994   -1.784  1.00 1.00 ? 77  LEU A HD23 3  
ATOM   3836  N N    . LEU A 1 78 ? -12.051 3.070   -3.156  1.00 1.00 ? 78  LEU A N    3  
ATOM   3837  C CA   . LEU A 1 78 ? -12.634 2.139   -4.116  1.00 1.00 ? 78  LEU A CA   3  
ATOM   3838  C C    . LEU A 1 78 ? -14.162 2.235   -4.111  1.00 1.00 ? 78  LEU A C    3  
ATOM   3839  O O    . LEU A 1 78 ? -14.823 1.617   -4.940  1.00 1.00 ? 78  LEU A O    3  
ATOM   3840  C CB   . LEU A 1 78 ? -12.212 0.717   -3.779  1.00 1.00 ? 78  LEU A CB   3  
ATOM   3841  C CG   . LEU A 1 78 ? -10.773 0.455   -4.262  1.00 1.00 ? 78  LEU A CG   3  
ATOM   3842  C CD1  . LEU A 1 78 ? -10.220 -0.799  -3.584  1.00 1.00 ? 78  LEU A CD1  3  
ATOM   3843  C CD2  . LEU A 1 78 ? -10.747 0.256   -5.797  1.00 1.00 ? 78  LEU A CD2  3  
ATOM   3844  H H    . LEU A 1 78 ? -11.994 2.811   -2.214  1.00 1.00 ? 78  LEU A H    3  
ATOM   3845  H HA   . LEU A 1 78 ? -12.277 2.378   -5.104  1.00 1.00 ? 78  LEU A HA   3  
ATOM   3846  H HB2  . LEU A 1 78 ? -12.262 0.595   -2.712  1.00 1.00 ? 78  LEU A HB2  3  
ATOM   3847  H HB3  . LEU A 1 78 ? -12.887 0.027   -4.252  1.00 1.00 ? 78  LEU A HB3  3  
ATOM   3848  H HG   . LEU A 1 78 ? -10.153 1.294   -3.999  1.00 1.00 ? 78  LEU A HG   3  
ATOM   3849  H HD11 . LEU A 1 78 ? -9.154  -0.855  -3.759  1.00 1.00 ? 78  LEU A HD11 3  
ATOM   3850  H HD12 . LEU A 1 78 ? -10.697 -1.674  -3.998  1.00 1.00 ? 78  LEU A HD12 3  
ATOM   3851  H HD13 . LEU A 1 78 ? -10.408 -0.755  -2.522  1.00 1.00 ? 78  LEU A HD13 3  
ATOM   3852  H HD21 . LEU A 1 78 ? -9.858  -0.290  -6.073  1.00 1.00 ? 78  LEU A HD21 3  
ATOM   3853  H HD22 . LEU A 1 78 ? -10.738 1.213   -6.289  1.00 1.00 ? 78  LEU A HD22 3  
ATOM   3854  H HD23 . LEU A 1 78 ? -11.617 -0.299  -6.116  1.00 1.00 ? 78  LEU A HD23 3  
ATOM   3855  N N    . GLU A 1 79 ? -14.721 2.990   -3.156  1.00 1.00 ? 79  GLU A N    3  
ATOM   3856  C CA   . GLU A 1 79 ? -16.149 3.154   -3.030  1.00 1.00 ? 79  GLU A CA   3  
ATOM   3857  C C    . GLU A 1 79 ? -16.615 4.500   -3.543  1.00 1.00 ? 79  GLU A C    3  
ATOM   3858  O O    . GLU A 1 79 ? -17.781 4.656   -3.898  1.00 1.00 ? 79  GLU A O    3  
ATOM   3859  C CB   . GLU A 1 79 ? -16.492 3.026   -1.568  1.00 1.00 ? 79  GLU A CB   3  
ATOM   3860  C CG   . GLU A 1 79 ? -17.890 3.567   -1.336  1.00 1.00 ? 79  GLU A CG   3  
ATOM   3861  C CD   . GLU A 1 79 ? -18.515 3.019   -0.049  1.00 1.00 ? 79  GLU A CD   3  
ATOM   3862  O OE1  . GLU A 1 79 ? -17.791 2.430   0.733   1.00 1.00 ? 79  GLU A OE1  3  
ATOM   3863  O OE2  . GLU A 1 79 ? -19.709 3.204   0.130   1.00 1.00 ? 79  GLU A OE2  3  
ATOM   3864  H H    . GLU A 1 79 ? -14.167 3.439   -2.507  1.00 1.00 ? 79  GLU A H    3  
ATOM   3865  H HA   . GLU A 1 79 ? -16.659 2.387   -3.576  1.00 1.00 ? 79  GLU A HA   3  
ATOM   3866  H HB2  . GLU A 1 79 ? -16.440 1.995   -1.283  1.00 1.00 ? 79  GLU A HB2  3  
ATOM   3867  H HB3  . GLU A 1 79 ? -15.774 3.612   -1.012  1.00 1.00 ? 79  GLU A HB3  3  
ATOM   3868  H HG2  . GLU A 1 79 ? -17.824 4.640   -1.279  1.00 1.00 ? 79  GLU A HG2  3  
ATOM   3869  H HG3  . GLU A 1 79 ? -18.486 3.293   -2.179  1.00 1.00 ? 79  GLU A HG3  3  
ATOM   3870  N N    . LYS A 1 80 ? -15.721 5.462   -3.558  1.00 1.00 ? 80  LYS A N    3  
ATOM   3871  C CA   . LYS A 1 80 ? -16.048 6.803   -4.025  1.00 1.00 ? 80  LYS A CA   3  
ATOM   3872  C C    . LYS A 1 80 ? -16.985 6.743   -5.240  1.00 1.00 ? 80  LYS A C    3  
ATOM   3873  O O    . LYS A 1 80 ? -17.665 7.716   -5.563  1.00 1.00 ? 80  LYS A O    3  
ATOM   3874  C CB   . LYS A 1 80 ? -14.745 7.558   -4.393  1.00 1.00 ? 80  LYS A CB   3  
ATOM   3875  C CG   . LYS A 1 80 ? -13.680 6.584   -4.923  1.00 1.00 ? 80  LYS A CG   3  
ATOM   3876  C CD   . LYS A 1 80 ? -14.065 6.028   -6.330  1.00 1.00 ? 80  LYS A CD   3  
ATOM   3877  C CE   . LYS A 1 80 ? -14.296 4.516   -6.277  1.00 1.00 ? 80  LYS A CE   3  
ATOM   3878  N NZ   . LYS A 1 80 ? -14.921 4.072   -7.548  1.00 1.00 ? 80  LYS A NZ   3  
ATOM   3879  H H    . LYS A 1 80 ? -14.819 5.272   -3.231  1.00 1.00 ? 80  LYS A H    3  
ATOM   3880  H HA   . LYS A 1 80 ? -16.547 7.330   -3.231  1.00 1.00 ? 80  LYS A HA   3  
ATOM   3881  H HB2  . LYS A 1 80 ? -14.943 8.308   -5.152  1.00 1.00 ? 80  LYS A HB2  3  
ATOM   3882  H HB3  . LYS A 1 80 ? -14.363 8.036   -3.504  1.00 1.00 ? 80  LYS A HB3  3  
ATOM   3883  H HG2  . LYS A 1 80 ? -12.730 7.110   -4.988  1.00 1.00 ? 80  LYS A HG2  3  
ATOM   3884  H HG3  . LYS A 1 80 ? -13.577 5.778   -4.226  1.00 1.00 ? 80  LYS A HG3  3  
ATOM   3885  H HD2  . LYS A 1 80 ? -14.958 6.506   -6.692  1.00 1.00 ? 80  LYS A HD2  3  
ATOM   3886  H HD3  . LYS A 1 80 ? -13.260 6.220   -7.025  1.00 1.00 ? 80  LYS A HD3  3  
ATOM   3887  H HE2  . LYS A 1 80 ? -13.350 4.027   -6.168  1.00 1.00 ? 80  LYS A HE2  3  
ATOM   3888  H HE3  . LYS A 1 80 ? -14.940 4.262   -5.442  1.00 1.00 ? 80  LYS A HE3  3  
ATOM   3889  H HZ1  . LYS A 1 80 ? -14.448 3.207   -7.878  1.00 1.00 ? 80  LYS A HZ1  3  
ATOM   3890  H HZ2  . LYS A 1 80 ? -14.815 4.820   -8.264  1.00 1.00 ? 80  LYS A HZ2  3  
ATOM   3891  H HZ3  . LYS A 1 80 ? -15.928 3.878   -7.390  1.00 1.00 ? 80  LYS A HZ3  3  
ATOM   3892  N N    . LYS A 1 81 ? -17.020 5.583   -5.897  1.00 1.00 ? 81  LYS A N    3  
ATOM   3893  C CA   . LYS A 1 81 ? -17.869 5.393   -7.055  1.00 1.00 ? 81  LYS A CA   3  
ATOM   3894  C C    . LYS A 1 81 ? -18.035 3.907   -7.354  1.00 1.00 ? 81  LYS A C    3  
ATOM   3895  O O    . LYS A 1 81 ? -17.105 3.118   -7.190  1.00 1.00 ? 81  LYS A O    3  
ATOM   3896  C CB   . LYS A 1 81 ? -17.267 6.098   -8.270  1.00 1.00 ? 81  LYS A CB   3  
ATOM   3897  C CG   . LYS A 1 81 ? -18.338 6.258   -9.346  1.00 1.00 ? 81  LYS A CG   3  
ATOM   3898  C CD   . LYS A 1 81 ? -17.765 7.053   -10.518 1.00 1.00 ? 81  LYS A CD   3  
ATOM   3899  C CE   . LYS A 1 81 ? -18.842 7.225   -11.588 1.00 1.00 ? 81  LYS A CE   3  
ATOM   3900  N NZ   . LYS A 1 81 ? -18.287 8.002   -12.731 1.00 1.00 ? 81  LYS A NZ   3  
ATOM   3901  H H    . LYS A 1 81 ? -16.469 4.837   -5.583  1.00 1.00 ? 81  LYS A H    3  
ATOM   3902  H HA   . LYS A 1 81 ? -18.839 5.819   -6.844  1.00 1.00 ? 81  LYS A HA   3  
ATOM   3903  H HB2  . LYS A 1 81 ? -16.900 7.071   -7.976  1.00 1.00 ? 81  LYS A HB2  3  
ATOM   3904  H HB3  . LYS A 1 81 ? -16.454 5.509   -8.663  1.00 1.00 ? 81  LYS A HB3  3  
ATOM   3905  H HG2  . LYS A 1 81 ? -18.651 5.283   -9.688  1.00 1.00 ? 81  LYS A HG2  3  
ATOM   3906  H HG3  . LYS A 1 81 ? -19.185 6.786   -8.936  1.00 1.00 ? 81  LYS A HG3  3  
ATOM   3907  H HD2  . LYS A 1 81 ? -17.440 8.023   -10.170 1.00 1.00 ? 81  LYS A HD2  3  
ATOM   3908  H HD3  . LYS A 1 81 ? -16.924 6.520   -10.938 1.00 1.00 ? 81  LYS A HD3  3  
ATOM   3909  H HE2  . LYS A 1 81 ? -19.166 6.254   -11.933 1.00 1.00 ? 81  LYS A HE2  3  
ATOM   3910  H HE3  . LYS A 1 81 ? -19.684 7.756   -11.167 1.00 1.00 ? 81  LYS A HE3  3  
ATOM   3911  H HZ1  . LYS A 1 81 ? -17.745 8.812   -12.369 1.00 1.00 ? 81  LYS A HZ1  3  
ATOM   3912  H HZ2  . LYS A 1 81 ? -19.067 8.344   -13.329 1.00 1.00 ? 81  LYS A HZ2  3  
ATOM   3913  H HZ3  . LYS A 1 81 ? -17.660 7.392   -13.293 1.00 1.00 ? 81  LYS A HZ3  3  
ATOM   3914  N N    . ALA A 1 82 ? -19.225 3.532   -7.795  1.00 1.00 ? 82  ALA A N    3  
ATOM   3915  C CA   . ALA A 1 82 ? -19.504 2.141   -8.120  1.00 1.00 ? 82  ALA A CA   3  
ATOM   3916  C C    . ALA A 1 82 ? -18.956 1.211   -7.041  1.00 1.00 ? 82  ALA A C    3  
ATOM   3917  O O    . ALA A 1 82 ? -18.740 1.680   -5.936  1.00 1.00 ? 82  ALA A O    3  
ATOM   3918  C CB   . ALA A 1 82 ? -18.883 1.780   -9.471  1.00 1.00 ? 82  ALA A CB   3  
ATOM   3919  O OXT  . ALA A 1 82 ? -18.765 0.042   -7.334  1.00 1.00 ? 82  ALA A OXT  3  
ATOM   3920  H H    . ALA A 1 82 ? -19.929 4.203   -7.908  1.00 1.00 ? 82  ALA A H    3  
ATOM   3921  H HA   . ALA A 1 82 ? -20.568 2.013   -8.181  1.00 1.00 ? 82  ALA A HA   3  
ATOM   3922  H HB1  . ALA A 1 82 ? -19.223 0.800   -9.773  1.00 1.00 ? 82  ALA A HB1  3  
ATOM   3923  H HB2  . ALA A 1 82 ? -17.807 1.776   -9.383  1.00 1.00 ? 82  ALA A HB2  3  
ATOM   3924  H HB3  . ALA A 1 82 ? -19.180 2.510   -10.209 1.00 1.00 ? 82  ALA A HB3  3  
HETATM 3925  O O23  . PNS B 2 .  ? 16.457  6.406   -2.063  1.00 1.00 ? 101 PNS A O23  3  
HETATM 3926  P P24  . PNS B 2 .  ? 17.603  5.364   -1.628  1.00 1.00 ? 101 PNS A P24  3  
HETATM 3927  O O25  . PNS B 2 .  ? 18.280  5.891   -0.421  1.00 1.00 ? 101 PNS A O25  3  
HETATM 3928  O O26  . PNS B 2 .  ? 18.400  5.026   -2.829  1.00 1.00 ? 101 PNS A O26  3  
HETATM 3929  O O27  . PNS B 2 .  ? 16.750  4.066   -1.201  1.00 1.00 ? 101 PNS A O27  3  
HETATM 3930  C C28  . PNS B 2 .  ? 16.238  3.176   -2.187  1.00 1.00 ? 101 PNS A C28  3  
HETATM 3931  C C29  . PNS B 2 .  ? 16.174  1.760   -1.601  1.00 1.00 ? 101 PNS A C29  3  
HETATM 3932  C C30  . PNS B 2 .  ? 17.455  1.459   -0.829  1.00 1.00 ? 101 PNS A C30  3  
HETATM 3933  C C31  . PNS B 2 .  ? 16.007  0.753   -2.749  1.00 1.00 ? 101 PNS A C31  3  
HETATM 3934  C C32  . PNS B 2 .  ? 14.999  1.652   -0.635  1.00 1.00 ? 101 PNS A C32  3  
HETATM 3935  O O33  . PNS B 2 .  ? 13.812  1.923   -1.357  1.00 1.00 ? 101 PNS A O33  3  
HETATM 3936  C C34  . PNS B 2 .  ? 14.925  0.247   -0.043  1.00 1.00 ? 101 PNS A C34  3  
HETATM 3937  O O35  . PNS B 2 .  ? 14.403  -0.676  -0.668  1.00 1.00 ? 101 PNS A O35  3  
HETATM 3938  N N36  . PNS B 2 .  ? 15.453  0.097   1.164   1.00 1.00 ? 101 PNS A N36  3  
HETATM 3939  C C37  . PNS B 2 .  ? 15.445  -1.195  1.833   1.00 1.00 ? 101 PNS A C37  3  
HETATM 3940  C C38  . PNS B 2 .  ? 14.039  -1.508  2.367   1.00 1.00 ? 101 PNS A C38  3  
HETATM 3941  C C39  . PNS B 2 .  ? 14.125  -2.430  3.580   1.00 1.00 ? 101 PNS A C39  3  
HETATM 3942  O O40  . PNS B 2 .  ? 14.988  -3.304  3.647   1.00 1.00 ? 101 PNS A O40  3  
HETATM 3943  N N41  . PNS B 2 .  ? 13.228  -2.229  4.538   1.00 1.00 ? 101 PNS A N41  3  
HETATM 3944  C C42  . PNS B 2 .  ? 13.219  -3.049  5.744   1.00 1.00 ? 101 PNS A C42  3  
HETATM 3945  C C43  . PNS B 2 .  ? 11.855  -2.973  6.427   1.00 1.00 ? 101 PNS A C43  3  
HETATM 3946  S S44  . PNS B 2 .  ? 11.213  -1.311  6.279   1.00 1.00 ? 101 PNS A S44  3  
HETATM 3947  H H282 . PNS B 2 .  ? 16.889  3.185   -3.046  1.00 1.00 ? 101 PNS A H282 3  
HETATM 3948  H H281 . PNS B 2 .  ? 15.246  3.488   -2.486  1.00 1.00 ? 101 PNS A H281 3  
HETATM 3949  H H303 . PNS B 2 .  ? 17.473  0.415   -0.552  1.00 1.00 ? 101 PNS A H303 3  
HETATM 3950  H H302 . PNS B 2 .  ? 18.307  1.680   -1.452  1.00 1.00 ? 101 PNS A H302 3  
HETATM 3951  H H301 . PNS B 2 .  ? 17.491  2.068   0.063   1.00 1.00 ? 101 PNS A H301 3  
HETATM 3952  H H313 . PNS B 2 .  ? 15.066  0.927   -3.248  1.00 1.00 ? 101 PNS A H313 3  
HETATM 3953  H H312 . PNS B 2 .  ? 16.815  0.875   -3.454  1.00 1.00 ? 101 PNS A H312 3  
HETATM 3954  H H311 . PNS B 2 .  ? 16.025  -0.252  -2.354  1.00 1.00 ? 101 PNS A H311 3  
HETATM 3955  H H32  . PNS B 2 .  ? 15.116  2.370   0.170   1.00 1.00 ? 101 PNS A H32  3  
HETATM 3956  H H33  . PNS B 2 .  ? 13.217  2.405   -0.779  1.00 1.00 ? 101 PNS A H33  3  
HETATM 3957  H H36  . PNS B 2 .  ? 15.853  0.868   1.613   1.00 1.00 ? 101 PNS A H36  3  
HETATM 3958  H H372 . PNS B 2 .  ? 16.154  -1.168  2.651   1.00 1.00 ? 101 PNS A H372 3  
HETATM 3959  H H371 . PNS B 2 .  ? 15.743  -1.963  1.131   1.00 1.00 ? 101 PNS A H371 3  
HETATM 3960  H H382 . PNS B 2 .  ? 13.555  -0.587  2.654   1.00 1.00 ? 101 PNS A H382 3  
HETATM 3961  H H381 . PNS B 2 .  ? 13.458  -1.989  1.594   1.00 1.00 ? 101 PNS A H381 3  
HETATM 3962  H H41  . PNS B 2 .  ? 12.562  -1.516  4.434   1.00 1.00 ? 101 PNS A H41  3  
HETATM 3963  H H422 . PNS B 2 .  ? 13.979  -2.687  6.420   1.00 1.00 ? 101 PNS A H422 3  
HETATM 3964  H H421 . PNS B 2 .  ? 13.435  -4.076  5.484   1.00 1.00 ? 101 PNS A H421 3  
HETATM 3965  H H431 . PNS B 2 .  ? 11.957  -3.231  7.473   1.00 1.00 ? 101 PNS A H431 3  
HETATM 3966  H H432 . PNS B 2 .  ? 11.174  -3.665  5.952   1.00 1.00 ? 101 PNS A H432 3  
HETATM 3967  C C1   . STE C 3 .  ? 11.368  -0.301  7.688   1.00 1.00 ? 102 STE A C1   3  
HETATM 3968  O O1   . STE C 3 .  ? 11.875  -0.680  8.720   1.00 1.00 ? 102 STE A O1   3  
HETATM 3969  C C2   . STE C 3 .  ? 10.800  1.073   7.465   1.00 1.00 ? 102 STE A C2   3  
HETATM 3970  C C3   . STE C 3 .  ? 9.393   1.156   8.059   1.00 1.00 ? 102 STE A C3   3  
HETATM 3971  C C4   . STE C 3 .  ? 8.688   2.395   7.511   1.00 1.00 ? 102 STE A C4   3  
HETATM 3972  C C5   . STE C 3 .  ? 7.469   2.716   8.378   1.00 1.00 ? 102 STE A C5   3  
HETATM 3973  C C6   . STE C 3 .  ? 6.792   4.003   7.869   1.00 1.00 ? 102 STE A C6   3  
HETATM 3974  C C7   . STE C 3 .  ? 5.858   3.665   6.714   1.00 1.00 ? 102 STE A C7   3  
HETATM 3975  C C8   . STE C 3 .  ? 5.130   4.928   6.259   1.00 1.00 ? 102 STE A C8   3  
HETATM 3976  C C9   . STE C 3 .  ? 3.974   4.560   5.319   1.00 1.00 ? 102 STE A C9   3  
HETATM 3977  C C10  . STE C 3 .  ? 4.513   4.321   3.903   1.00 1.00 ? 102 STE A C10  3  
HETATM 3978  C C11  . STE C 3 .  ? 3.386   3.814   3.005   1.00 1.00 ? 102 STE A C11  3  
HETATM 3979  C C12  . STE C 3 .  ? 2.433   4.960   2.669   1.00 1.00 ? 102 STE A C12  3  
HETATM 3980  C C13  . STE C 3 .  ? 1.532   4.539   1.521   1.00 1.00 ? 102 STE A C13  3  
HETATM 3981  C C14  . STE C 3 .  ? 0.632   3.378   1.970   1.00 1.00 ? 102 STE A C14  3  
HETATM 3982  C C15  . STE C 3 .  ? -0.552  3.246   1.001   1.00 1.00 ? 102 STE A C15  3  
HETATM 3983  C C16  . STE C 3 .  ? -1.691  4.205   1.412   1.00 1.00 ? 102 STE A C16  3  
HETATM 3984  C C17  . STE C 3 .  ? -2.460  4.658   0.172   1.00 1.00 ? 102 STE A C17  3  
HETATM 3985  C C18  . STE C 3 .  ? -2.941  3.434   -0.631  1.00 1.00 ? 102 STE A C18  3  
HETATM 3986  H H21  . STE C 3 .  ? 11.431  1.802   7.950   1.00 1.00 ? 102 STE A H21  3  
HETATM 3987  H H22  . STE C 3 .  ? 10.759  1.287   6.404   1.00 1.00 ? 102 STE A H22  3  
HETATM 3988  H H31  . STE C 3 .  ? 9.459   1.226   9.134   1.00 1.00 ? 102 STE A H31  3  
HETATM 3989  H H32  . STE C 3 .  ? 8.832   0.272   7.787   1.00 1.00 ? 102 STE A H32  3  
HETATM 3990  H H41  . STE C 3 .  ? 8.371   2.200   6.500   1.00 1.00 ? 102 STE A H41  3  
HETATM 3991  H H42  . STE C 3 .  ? 9.369   3.234   7.522   1.00 1.00 ? 102 STE A H42  3  
HETATM 3992  H H51  . STE C 3 .  ? 7.785   2.859   9.398   1.00 1.00 ? 102 STE A H51  3  
HETATM 3993  H H52  . STE C 3 .  ? 6.771   1.889   8.335   1.00 1.00 ? 102 STE A H52  3  
HETATM 3994  H H61  . STE C 3 .  ? 7.541   4.705   7.531   1.00 1.00 ? 102 STE A H61  3  
HETATM 3995  H H62  . STE C 3 .  ? 6.218   4.448   8.671   1.00 1.00 ? 102 STE A H62  3  
HETATM 3996  H H71  . STE C 3 .  ? 5.140   2.933   7.043   1.00 1.00 ? 102 STE A H71  3  
HETATM 3997  H H72  . STE C 3 .  ? 6.434   3.266   5.895   1.00 1.00 ? 102 STE A H72  3  
HETATM 3998  H H81  . STE C 3 .  ? 5.824   5.573   5.739   1.00 1.00 ? 102 STE A H81  3  
HETATM 3999  H H82  . STE C 3 .  ? 4.740   5.446   7.124   1.00 1.00 ? 102 STE A H82  3  
HETATM 4000  H H91  . STE C 3 .  ? 3.270   5.375   5.298   1.00 1.00 ? 102 STE A H91  3  
HETATM 4001  H H92  . STE C 3 .  ? 3.476   3.667   5.673   1.00 1.00 ? 102 STE A H92  3  
HETATM 4002  H H101 . STE C 3 .  ? 5.299   3.585   3.931   1.00 1.00 ? 102 STE A H101 3  
HETATM 4003  H H102 . STE C 3 .  ? 4.906   5.246   3.507   1.00 1.00 ? 102 STE A H102 3  
HETATM 4004  H H111 . STE C 3 .  ? 2.843   3.039   3.521   1.00 1.00 ? 102 STE A H111 3  
HETATM 4005  H H112 . STE C 3 .  ? 3.808   3.411   2.096   1.00 1.00 ? 102 STE A H112 3  
HETATM 4006  H H121 . STE C 3 .  ? 2.995   5.834   2.375   1.00 1.00 ? 102 STE A H121 3  
HETATM 4007  H H122 . STE C 3 .  ? 1.826   5.191   3.528   1.00 1.00 ? 102 STE A H122 3  
HETATM 4008  H H131 . STE C 3 .  ? 2.139   4.219   0.687   1.00 1.00 ? 102 STE A H131 3  
HETATM 4009  H H132 . STE C 3 .  ? 0.924   5.379   1.222   1.00 1.00 ? 102 STE A H132 3  
HETATM 4010  H H141 . STE C 3 .  ? 0.259   3.567   2.968   1.00 1.00 ? 102 STE A H141 3  
HETATM 4011  H H142 . STE C 3 .  ? 1.203   2.459   1.969   1.00 1.00 ? 102 STE A H142 3  
HETATM 4012  H H151 . STE C 3 .  ? -0.915  2.229   1.023   1.00 1.00 ? 102 STE A H151 3  
HETATM 4013  H H152 . STE C 3 .  ? -0.218  3.482   0.001   1.00 1.00 ? 102 STE A H152 3  
HETATM 4014  H H161 . STE C 3 .  ? -1.280  5.072   1.906   1.00 1.00 ? 102 STE A H161 3  
HETATM 4015  H H162 . STE C 3 .  ? -2.368  3.697   2.084   1.00 1.00 ? 102 STE A H162 3  
HETATM 4016  H H171 . STE C 3 .  ? -1.805  5.255   -0.445  1.00 1.00 ? 102 STE A H171 3  
HETATM 4017  H H172 . STE C 3 .  ? -3.309  5.256   0.475   1.00 1.00 ? 102 STE A H172 3  
HETATM 4018  H H181 . STE C 3 .  ? -3.873  3.670   -1.122  1.00 1.00 ? 102 STE A H181 3  
HETATM 4019  H H182 . STE C 3 .  ? -3.088  2.590   0.031   1.00 1.00 ? 102 STE A H182 3  
HETATM 4020  H H183 . STE C 3 .  ? -2.203  3.177   -1.375  1.00 1.00 ? 102 STE A H183 3  
ATOM   4021  N N    . ALA A 1 1  ? -9.857  -4.086  7.081   1.00 1.00 ? 1   ALA A N    4  
ATOM   4022  C CA   . ALA A 1 1  ? -9.964  -4.200  5.599   1.00 1.00 ? 1   ALA A CA   4  
ATOM   4023  C C    . ALA A 1 1  ? -10.180 -5.668  5.219   1.00 1.00 ? 1   ALA A C    4  
ATOM   4024  O O    . ALA A 1 1  ? -9.993  -6.564  6.042   1.00 1.00 ? 1   ALA A O    4  
ATOM   4025  C CB   . ALA A 1 1  ? -8.679  -3.661  4.954   1.00 1.00 ? 1   ALA A CB   4  
ATOM   4026  H H1   . ALA A 1 1  ? -9.580  -5.005  7.480   1.00 1.00 ? 1   ALA A H1   4  
ATOM   4027  H H2   . ALA A 1 1  ? -10.778 -3.801  7.472   1.00 1.00 ? 1   ALA A H2   4  
ATOM   4028  H H3   . ALA A 1 1  ? -9.140  -3.374  7.324   1.00 1.00 ? 1   ALA A H3   4  
ATOM   4029  H HA   . ALA A 1 1  ? -10.805 -3.617  5.256   1.00 1.00 ? 1   ALA A HA   4  
ATOM   4030  H HB1  . ALA A 1 1  ? -8.895  -3.324  3.948   1.00 1.00 ? 1   ALA A HB1  4  
ATOM   4031  H HB2  . ALA A 1 1  ? -7.935  -4.442  4.922   1.00 1.00 ? 1   ALA A HB2  4  
ATOM   4032  H HB3  . ALA A 1 1  ? -8.303  -2.829  5.536   1.00 1.00 ? 1   ALA A HB3  4  
ATOM   4033  N N    . LYS A 1 2  ? -10.572 -5.898  3.971   1.00 1.00 ? 2   LYS A N    4  
ATOM   4034  C CA   . LYS A 1 2  ? -10.809 -7.252  3.486   1.00 1.00 ? 2   LYS A CA   4  
ATOM   4035  C C    . LYS A 1 2  ? -9.489  -7.942  3.172   1.00 1.00 ? 2   LYS A C    4  
ATOM   4036  O O    . LYS A 1 2  ? -8.511  -7.293  2.815   1.00 1.00 ? 2   LYS A O    4  
ATOM   4037  C CB   . LYS A 1 2  ? -11.679 -7.215  2.230   1.00 1.00 ? 2   LYS A CB   4  
ATOM   4038  C CG   . LYS A 1 2  ? -13.083 -6.733  2.592   1.00 1.00 ? 2   LYS A CG   4  
ATOM   4039  C CD   . LYS A 1 2  ? -13.941 -6.664  1.327   1.00 1.00 ? 2   LYS A CD   4  
ATOM   4040  C CE   . LYS A 1 2  ? -15.334 -6.144  1.683   1.00 1.00 ? 2   LYS A CE   4  
ATOM   4041  N NZ   . LYS A 1 2  ? -16.035 -7.146  2.535   1.00 1.00 ? 2   LYS A NZ   4  
ATOM   4042  H H    . LYS A 1 2  ? -10.702 -5.141  3.362   1.00 1.00 ? 2   LYS A H    4  
ATOM   4043  H HA   . LYS A 1 2  ? -11.325 -7.813  4.251   1.00 1.00 ? 2   LYS A HA   4  
ATOM   4044  H HB2  . LYS A 1 2  ? -11.241 -6.542  1.508   1.00 1.00 ? 2   LYS A HB2  4  
ATOM   4045  H HB3  . LYS A 1 2  ? -11.741 -8.207  1.805   1.00 1.00 ? 2   LYS A HB3  4  
ATOM   4046  H HG2  . LYS A 1 2  ? -13.530 -7.421  3.295   1.00 1.00 ? 2   LYS A HG2  4  
ATOM   4047  H HG3  . LYS A 1 2  ? -13.024 -5.752  3.038   1.00 1.00 ? 2   LYS A HG3  4  
ATOM   4048  H HD2  . LYS A 1 2  ? -13.477 -5.999  0.614   1.00 1.00 ? 2   LYS A HD2  4  
ATOM   4049  H HD3  . LYS A 1 2  ? -14.028 -7.650  0.897   1.00 1.00 ? 2   LYS A HD3  4  
ATOM   4050  H HE2  . LYS A 1 2  ? -15.243 -5.213  2.224   1.00 1.00 ? 2   LYS A HE2  4  
ATOM   4051  H HE3  . LYS A 1 2  ? -15.901 -5.981  0.778   1.00 1.00 ? 2   LYS A HE3  4  
ATOM   4052  H HZ1  . LYS A 1 2  ? -15.850 -8.102  2.169   1.00 1.00 ? 2   LYS A HZ1  4  
ATOM   4053  H HZ2  . LYS A 1 2  ? -17.058 -6.959  2.520   1.00 1.00 ? 2   LYS A HZ2  4  
ATOM   4054  H HZ3  . LYS A 1 2  ? -15.683 -7.077  3.511   1.00 1.00 ? 2   LYS A HZ3  4  
ATOM   4055  N N    . LYS A 1 3  ? -9.470  -9.260  3.308   1.00 1.00 ? 3   LYS A N    4  
ATOM   4056  C CA   . LYS A 1 3  ? -8.260  -10.026 3.044   1.00 1.00 ? 3   LYS A CA   4  
ATOM   4057  C C    . LYS A 1 3  ? -7.826  -9.867  1.594   1.00 1.00 ? 3   LYS A C    4  
ATOM   4058  O O    . LYS A 1 3  ? -6.634  -9.773  1.298   1.00 1.00 ? 3   LYS A O    4  
ATOM   4059  C CB   . LYS A 1 3  ? -8.508  -11.504 3.334   1.00 1.00 ? 3   LYS A CB   4  
ATOM   4060  C CG   . LYS A 1 3  ? -8.813  -11.688 4.820   1.00 1.00 ? 3   LYS A CG   4  
ATOM   4061  C CD   . LYS A 1 3  ? -8.890  -13.182 5.154   1.00 1.00 ? 3   LYS A CD   4  
ATOM   4062  C CE   . LYS A 1 3  ? -10.099 -13.818 4.462   1.00 1.00 ? 3   LYS A CE   4  
ATOM   4063  N NZ   . LYS A 1 3  ? -10.404 -15.128 5.108   1.00 1.00 ? 3   LYS A NZ   4  
ATOM   4064  H H    . LYS A 1 3  ? -10.281 -9.727  3.598   1.00 1.00 ? 3   LYS A H    4  
ATOM   4065  H HA   . LYS A 1 3  ? -7.470  -9.672  3.689   1.00 1.00 ? 3   LYS A HA   4  
ATOM   4066  H HB2  . LYS A 1 3  ? -9.346  -11.844 2.745   1.00 1.00 ? 3   LYS A HB2  4  
ATOM   4067  H HB3  . LYS A 1 3  ? -7.629  -12.075 3.075   1.00 1.00 ? 3   LYS A HB3  4  
ATOM   4068  H HG2  . LYS A 1 3  ? -8.029  -11.229 5.407   1.00 1.00 ? 3   LYS A HG2  4  
ATOM   4069  H HG3  . LYS A 1 3  ? -9.757  -11.219 5.054   1.00 1.00 ? 3   LYS A HG3  4  
ATOM   4070  H HD2  . LYS A 1 3  ? -7.987  -13.670 4.819   1.00 1.00 ? 3   LYS A HD2  4  
ATOM   4071  H HD3  . LYS A 1 3  ? -8.987  -13.305 6.222   1.00 1.00 ? 3   LYS A HD3  4  
ATOM   4072  H HE2  . LYS A 1 3  ? -10.953 -13.164 4.548   1.00 1.00 ? 3   LYS A HE2  4  
ATOM   4073  H HE3  . LYS A 1 3  ? -9.873  -13.980 3.417   1.00 1.00 ? 3   LYS A HE3  4  
ATOM   4074  H HZ1  . LYS A 1 3  ? -9.555  -15.727 5.096   1.00 1.00 ? 3   LYS A HZ1  4  
ATOM   4075  H HZ2  . LYS A 1 3  ? -11.170 -15.602 4.589   1.00 1.00 ? 3   LYS A HZ2  4  
ATOM   4076  H HZ3  . LYS A 1 3  ? -10.699 -14.968 6.092   1.00 1.00 ? 3   LYS A HZ3  4  
ATOM   4077  N N    . GLU A 1 4  ? -8.798  -9.847  0.690   1.00 1.00 ? 4   GLU A N    4  
ATOM   4078  C CA   . GLU A 1 4  ? -8.499  -9.711  -0.727  1.00 1.00 ? 4   GLU A CA   4  
ATOM   4079  C C    . GLU A 1 4  ? -7.693  -8.440  -0.986  1.00 1.00 ? 4   GLU A C    4  
ATOM   4080  O O    . GLU A 1 4  ? -6.697  -8.462  -1.709  1.00 1.00 ? 4   GLU A O    4  
ATOM   4081  C CB   . GLU A 1 4  ? -9.808  -9.671  -1.530  1.00 1.00 ? 4   GLU A CB   4  
ATOM   4082  C CG   . GLU A 1 4  ? -10.544 -8.352  -1.262  1.00 1.00 ? 4   GLU A CG   4  
ATOM   4083  C CD   . GLU A 1 4  ? -11.982 -8.439  -1.761  1.00 1.00 ? 4   GLU A CD   4  
ATOM   4084  O OE1  . GLU A 1 4  ? -12.306 -9.417  -2.414  1.00 1.00 ? 4   GLU A OE1  4  
ATOM   4085  O OE2  . GLU A 1 4  ? -12.742 -7.525  -1.481  1.00 1.00 ? 4   GLU A OE2  4  
ATOM   4086  H H    . GLU A 1 4  ? -9.729  -9.932  0.981   1.00 1.00 ? 4   GLU A H    4  
ATOM   4087  H HA   . GLU A 1 4  ? -7.923  -10.568 -1.045  1.00 1.00 ? 4   GLU A HA   4  
ATOM   4088  H HB2  . GLU A 1 4  ? -9.584  -9.747  -2.585  1.00 1.00 ? 4   GLU A HB2  4  
ATOM   4089  H HB3  . GLU A 1 4  ? -10.436 -10.497 -1.237  1.00 1.00 ? 4   GLU A HB3  4  
ATOM   4090  H HG2  . GLU A 1 4  ? -10.542 -8.150  -0.202  1.00 1.00 ? 4   GLU A HG2  4  
ATOM   4091  H HG3  . GLU A 1 4  ? -10.041 -7.550  -1.781  1.00 1.00 ? 4   GLU A HG3  4  
ATOM   4092  N N    . THR A 1 5  ? -8.139  -7.333  -0.399  1.00 1.00 ? 5   THR A N    4  
ATOM   4093  C CA   . THR A 1 5  ? -7.460  -6.056  -0.577  1.00 1.00 ? 5   THR A CA   4  
ATOM   4094  C C    . THR A 1 5  ? -6.093  -6.071  0.099   1.00 1.00 ? 5   THR A C    4  
ATOM   4095  O O    . THR A 1 5  ? -5.109  -5.588  -0.454  1.00 1.00 ? 5   THR A O    4  
ATOM   4096  C CB   . THR A 1 5  ? -8.310  -4.918  -0.007  1.00 1.00 ? 5   THR A CB   4  
ATOM   4097  O OG1  . THR A 1 5  ? -9.665  -5.104  -0.395  1.00 1.00 ? 5   THR A OG1  4  
ATOM   4098  C CG2  . THR A 1 5  ? -7.811  -3.591  -0.580  1.00 1.00 ? 5   THR A CG2  4  
ATOM   4099  H H    . THR A 1 5  ? -8.941  -7.376  0.162   1.00 1.00 ? 5   THR A H    4  
ATOM   4100  H HA   . THR A 1 5  ? -7.319  -5.891  -1.636  1.00 1.00 ? 5   THR A HA   4  
ATOM   4101  H HB   . THR A 1 5  ? -8.232  -4.897  1.072   1.00 1.00 ? 5   THR A HB   4  
ATOM   4102  H HG1  . THR A 1 5  ? -9.681  -5.278  -1.339  1.00 1.00 ? 5   THR A HG1  4  
ATOM   4103  H HG21 . THR A 1 5  ? -8.251  -2.771  -0.035  1.00 1.00 ? 5   THR A HG21 4  
ATOM   4104  H HG22 . THR A 1 5  ? -8.096  -3.525  -1.623  1.00 1.00 ? 5   THR A HG22 4  
ATOM   4105  H HG23 . THR A 1 5  ? -6.736  -3.547  -0.499  1.00 1.00 ? 5   THR A HG23 4  
ATOM   4106  N N    . ILE A 1 6  ? -6.047  -6.632  1.302   1.00 1.00 ? 6   ILE A N    4  
ATOM   4107  C CA   . ILE A 1 6  ? -4.805  -6.709  2.060   1.00 1.00 ? 6   ILE A CA   4  
ATOM   4108  C C    . ILE A 1 6  ? -3.758  -7.516  1.299   1.00 1.00 ? 6   ILE A C    4  
ATOM   4109  O O    . ILE A 1 6  ? -2.594  -7.125  1.230   1.00 1.00 ? 6   ILE A O    4  
ATOM   4110  C CB   . ILE A 1 6  ? -5.073  -7.376  3.418   1.00 1.00 ? 6   ILE A CB   4  
ATOM   4111  C CG1  . ILE A 1 6  ? -5.916  -6.440  4.293   1.00 1.00 ? 6   ILE A CG1  4  
ATOM   4112  C CG2  . ILE A 1 6  ? -3.747  -7.688  4.122   1.00 1.00 ? 6   ILE A CG2  4  
ATOM   4113  C CD1  . ILE A 1 6  ? -6.416  -7.203  5.526   1.00 1.00 ? 6   ILE A CD1  4  
ATOM   4114  H H    . ILE A 1 6  ? -6.869  -7.000  1.690   1.00 1.00 ? 6   ILE A H    4  
ATOM   4115  H HA   . ILE A 1 6  ? -4.429  -5.712  2.229   1.00 1.00 ? 6   ILE A HA   4  
ATOM   4116  H HB   . ILE A 1 6  ? -5.613  -8.299  3.258   1.00 1.00 ? 6   ILE A HB   4  
ATOM   4117  H HG12 . ILE A 1 6  ? -5.312  -5.602  4.607   1.00 1.00 ? 6   ILE A HG12 4  
ATOM   4118  H HG13 . ILE A 1 6  ? -6.759  -6.082  3.727   1.00 1.00 ? 6   ILE A HG13 4  
ATOM   4119  H HG21 . ILE A 1 6  ? -3.304  -8.567  3.679   1.00 1.00 ? 6   ILE A HG21 4  
ATOM   4120  H HG22 . ILE A 1 6  ? -3.927  -7.867  5.169   1.00 1.00 ? 6   ILE A HG22 4  
ATOM   4121  H HG23 . ILE A 1 6  ? -3.076  -6.855  4.010   1.00 1.00 ? 6   ILE A HG23 4  
ATOM   4122  H HD11 . ILE A 1 6  ? -6.834  -6.504  6.237   1.00 1.00 ? 6   ILE A HD11 4  
ATOM   4123  H HD12 . ILE A 1 6  ? -5.591  -7.730  5.983   1.00 1.00 ? 6   ILE A HD12 4  
ATOM   4124  H HD13 . ILE A 1 6  ? -7.175  -7.911  5.228   1.00 1.00 ? 6   ILE A HD13 4  
ATOM   4125  N N    . ASP A 1 7  ? -4.173  -8.638  0.733   1.00 1.00 ? 7   ASP A N    4  
ATOM   4126  C CA   . ASP A 1 7  ? -3.247  -9.477  -0.012  1.00 1.00 ? 7   ASP A CA   4  
ATOM   4127  C C    . ASP A 1 7  ? -2.703  -8.717  -1.211  1.00 1.00 ? 7   ASP A C    4  
ATOM   4128  O O    . ASP A 1 7  ? -1.533  -8.849  -1.569  1.00 1.00 ? 7   ASP A O    4  
ATOM   4129  C CB   . ASP A 1 7  ? -3.964  -10.739 -0.490  1.00 1.00 ? 7   ASP A CB   4  
ATOM   4130  C CG   . ASP A 1 7  ? -2.949  -11.779 -0.951  1.00 1.00 ? 7   ASP A CG   4  
ATOM   4131  O OD1  . ASP A 1 7  ? -1.795  -11.661 -0.576  1.00 1.00 ? 7   ASP A OD1  4  
ATOM   4132  O OD2  . ASP A 1 7  ? -3.343  -12.681 -1.672  1.00 1.00 ? 7   ASP A OD2  4  
ATOM   4133  H H    . ASP A 1 7  ? -5.112  -8.907  0.817   1.00 1.00 ? 7   ASP A H    4  
ATOM   4134  H HA   . ASP A 1 7  ? -2.430  -9.757  0.632   1.00 1.00 ? 7   ASP A HA   4  
ATOM   4135  H HB2  . ASP A 1 7  ? -4.551  -11.136 0.318   1.00 1.00 ? 7   ASP A HB2  4  
ATOM   4136  H HB3  . ASP A 1 7  ? -4.617  -10.488 -1.313  1.00 1.00 ? 7   ASP A HB3  4  
ATOM   4137  N N    . LYS A 1 8  ? -3.567  -7.928  -1.827  1.00 1.00 ? 8   LYS A N    4  
ATOM   4138  C CA   . LYS A 1 8  ? -3.175  -7.144  -2.993  1.00 1.00 ? 8   LYS A CA   4  
ATOM   4139  C C    . LYS A 1 8  ? -2.158  -6.073  -2.618  1.00 1.00 ? 8   LYS A C    4  
ATOM   4140  O O    . LYS A 1 8  ? -1.147  -5.901  -3.295  1.00 1.00 ? 8   LYS A O    4  
ATOM   4141  C CB   . LYS A 1 8  ? -4.414  -6.474  -3.603  1.00 1.00 ? 8   LYS A CB   4  
ATOM   4142  C CG   . LYS A 1 8  ? -5.259  -7.503  -4.369  1.00 1.00 ? 8   LYS A CG   4  
ATOM   4143  C CD   . LYS A 1 8  ? -4.729  -7.679  -5.810  1.00 1.00 ? 8   LYS A CD   4  
ATOM   4144  C CE   . LYS A 1 8  ? -5.368  -6.640  -6.741  1.00 1.00 ? 8   LYS A CE   4  
ATOM   4145  N NZ   . LYS A 1 8  ? -4.885  -6.858  -8.136  1.00 1.00 ? 8   LYS A NZ   4  
ATOM   4146  H H    . LYS A 1 8  ? -4.485  -7.871  -1.488  1.00 1.00 ? 8   LYS A H    4  
ATOM   4147  H HA   . LYS A 1 8  ? -2.739  -7.802  -3.723  1.00 1.00 ? 8   LYS A HA   4  
ATOM   4148  H HB2  . LYS A 1 8  ? -5.009  -6.059  -2.804  1.00 1.00 ? 8   LYS A HB2  4  
ATOM   4149  H HB3  . LYS A 1 8  ? -4.107  -5.683  -4.273  1.00 1.00 ? 8   LYS A HB3  4  
ATOM   4150  H HG2  . LYS A 1 8  ? -5.219  -8.449  -3.852  1.00 1.00 ? 8   LYS A HG2  4  
ATOM   4151  H HG3  . LYS A 1 8  ? -6.283  -7.165  -4.403  1.00 1.00 ? 8   LYS A HG3  4  
ATOM   4152  H HD2  . LYS A 1 8  ? -3.657  -7.554  -5.825  1.00 1.00 ? 8   LYS A HD2  4  
ATOM   4153  H HD3  . LYS A 1 8  ? -4.979  -8.667  -6.161  1.00 1.00 ? 8   LYS A HD3  4  
ATOM   4154  H HE2  . LYS A 1 8  ? -6.443  -6.746  -6.712  1.00 1.00 ? 8   LYS A HE2  4  
ATOM   4155  H HE3  . LYS A 1 8  ? -5.095  -5.645  -6.418  1.00 1.00 ? 8   LYS A HE3  4  
ATOM   4156  H HZ1  . LYS A 1 8  ? -5.550  -7.476  -8.642  1.00 1.00 ? 8   LYS A HZ1  4  
ATOM   4157  H HZ2  . LYS A 1 8  ? -3.946  -7.307  -8.111  1.00 1.00 ? 8   LYS A HZ2  4  
ATOM   4158  H HZ3  . LYS A 1 8  ? -4.821  -5.944  -8.628  1.00 1.00 ? 8   LYS A HZ3  4  
ATOM   4159  N N    . VAL A 1 9  ? -2.436  -5.354  -1.537  1.00 1.00 ? 9   VAL A N    4  
ATOM   4160  C CA   . VAL A 1 9  ? -1.544  -4.291  -1.092  1.00 1.00 ? 9   VAL A CA   4  
ATOM   4161  C C    . VAL A 1 9  ? -0.168  -4.851  -0.765  1.00 1.00 ? 9   VAL A C    4  
ATOM   4162  O O    . VAL A 1 9  ? 0.854   -4.292  -1.165  1.00 1.00 ? 9   VAL A O    4  
ATOM   4163  C CB   . VAL A 1 9  ? -2.123  -3.613  0.152   1.00 1.00 ? 9   VAL A CB   4  
ATOM   4164  C CG1  . VAL A 1 9  ? -1.124  -2.587  0.691   1.00 1.00 ? 9   VAL A CG1  4  
ATOM   4165  C CG2  . VAL A 1 9  ? -3.430  -2.908  -0.212  1.00 1.00 ? 9   VAL A CG2  4  
ATOM   4166  H H    . VAL A 1 9  ? -3.262  -5.532  -1.040  1.00 1.00 ? 9   VAL A H    4  
ATOM   4167  H HA   . VAL A 1 9  ? -1.448  -3.557  -1.878  1.00 1.00 ? 9   VAL A HA   4  
ATOM   4168  H HB   . VAL A 1 9  ? -2.314  -4.359  0.909   1.00 1.00 ? 9   VAL A HB   4  
ATOM   4169  H HG11 . VAL A 1 9  ? -0.729  -2.003  -0.129  1.00 1.00 ? 9   VAL A HG11 4  
ATOM   4170  H HG12 . VAL A 1 9  ? -0.315  -3.100  1.188   1.00 1.00 ? 9   VAL A HG12 4  
ATOM   4171  H HG13 . VAL A 1 9  ? -1.619  -1.932  1.391   1.00 1.00 ? 9   VAL A HG13 4  
ATOM   4172  H HG21 . VAL A 1 9  ? -3.212  -2.010  -0.763  1.00 1.00 ? 9   VAL A HG21 4  
ATOM   4173  H HG22 . VAL A 1 9  ? -3.965  -2.655  0.690   1.00 1.00 ? 9   VAL A HG22 4  
ATOM   4174  H HG23 . VAL A 1 9  ? -4.034  -3.563  -0.816  1.00 1.00 ? 9   VAL A HG23 4  
ATOM   4175  N N    . SER A 1 10 ? -0.147  -5.952  -0.030  1.00 1.00 ? 10  SER A N    4  
ATOM   4176  C CA   . SER A 1 10 ? 1.111   -6.573  0.350   1.00 1.00 ? 10  SER A CA   4  
ATOM   4177  C C    . SER A 1 10 ? 1.908   -6.989  -0.882  1.00 1.00 ? 10  SER A C    4  
ATOM   4178  O O    . SER A 1 10 ? 3.117   -6.788  -0.941  1.00 1.00 ? 10  SER A O    4  
ATOM   4179  C CB   . SER A 1 10 ? 0.843   -7.811  1.207   1.00 1.00 ? 10  SER A CB   4  
ATOM   4180  O OG   . SER A 1 10 ? -0.023  -7.464  2.277   1.00 1.00 ? 10  SER A OG   4  
ATOM   4181  H H    . SER A 1 10 ? -0.992  -6.352  0.264   1.00 1.00 ? 10  SER A H    4  
ATOM   4182  H HA   . SER A 1 10 ? 1.691   -5.867  0.930   1.00 1.00 ? 10  SER A HA   4  
ATOM   4183  H HB2  . SER A 1 10 ? 0.377   -8.572  0.606   1.00 1.00 ? 10  SER A HB2  4  
ATOM   4184  H HB3  . SER A 1 10 ? 1.781   -8.188  1.595   1.00 1.00 ? 10  SER A HB3  4  
ATOM   4185  H HG   . SER A 1 10 ? -0.695  -6.875  1.935   1.00 1.00 ? 10  SER A HG   4  
ATOM   4186  N N    . ASP A 1 11 ? 1.218   -7.571  -1.859  1.00 1.00 ? 11  ASP A N    4  
ATOM   4187  C CA   . ASP A 1 11 ? 1.870   -8.036  -3.081  1.00 1.00 ? 11  ASP A CA   4  
ATOM   4188  C C    . ASP A 1 11 ? 2.660   -6.916  -3.735  1.00 1.00 ? 11  ASP A C    4  
ATOM   4189  O O    . ASP A 1 11 ? 3.807   -7.107  -4.135  1.00 1.00 ? 11  ASP A O    4  
ATOM   4190  C CB   . ASP A 1 11 ? 0.823   -8.554  -4.069  1.00 1.00 ? 11  ASP A CB   4  
ATOM   4191  C CG   . ASP A 1 11 ? 1.503   -9.314  -5.204  1.00 1.00 ? 11  ASP A CG   4  
ATOM   4192  O OD1  . ASP A 1 11 ? 2.495   -9.974  -4.941  1.00 1.00 ? 11  ASP A OD1  4  
ATOM   4193  O OD2  . ASP A 1 11 ? 1.021   -9.226  -6.322  1.00 1.00 ? 11  ASP A OD2  4  
ATOM   4194  H H    . ASP A 1 11 ? 0.256   -7.697  -1.753  1.00 1.00 ? 11  ASP A H    4  
ATOM   4195  H HA   . ASP A 1 11 ? 2.542   -8.842  -2.832  1.00 1.00 ? 11  ASP A HA   4  
ATOM   4196  H HB2  . ASP A 1 11 ? 0.141   -9.215  -3.555  1.00 1.00 ? 11  ASP A HB2  4  
ATOM   4197  H HB3  . ASP A 1 11 ? 0.274   -7.719  -4.478  1.00 1.00 ? 11  ASP A HB3  4  
ATOM   4198  N N    . ILE A 1 12 ? 2.054   -5.744  -3.834  1.00 1.00 ? 12  ILE A N    4  
ATOM   4199  C CA   . ILE A 1 12 ? 2.728   -4.615  -4.447  1.00 1.00 ? 12  ILE A CA   4  
ATOM   4200  C C    . ILE A 1 12 ? 4.098   -4.425  -3.807  1.00 1.00 ? 12  ILE A C    4  
ATOM   4201  O O    . ILE A 1 12 ? 5.092   -4.212  -4.502  1.00 1.00 ? 12  ILE A O    4  
ATOM   4202  C CB   . ILE A 1 12 ? 1.862   -3.339  -4.269  1.00 1.00 ? 12  ILE A CB   4  
ATOM   4203  C CG1  . ILE A 1 12 ? 0.866   -3.180  -5.433  1.00 1.00 ? 12  ILE A CG1  4  
ATOM   4204  C CG2  . ILE A 1 12 ? 2.738   -2.084  -4.190  1.00 1.00 ? 12  ILE A CG2  4  
ATOM   4205  C CD1  . ILE A 1 12 ? -0.278  -4.179  -5.289  1.00 1.00 ? 12  ILE A CD1  4  
ATOM   4206  H H    . ILE A 1 12 ? 1.142   -5.640  -3.491  1.00 1.00 ? 12  ILE A H    4  
ATOM   4207  H HA   . ILE A 1 12 ? 2.867   -4.818  -5.495  1.00 1.00 ? 12  ILE A HA   4  
ATOM   4208  H HB   . ILE A 1 12 ? 1.307   -3.429  -3.345  1.00 1.00 ? 12  ILE A HB   4  
ATOM   4209  H HG12 . ILE A 1 12 ? 0.461   -2.178  -5.418  1.00 1.00 ? 12  ILE A HG12 4  
ATOM   4210  H HG13 . ILE A 1 12 ? 1.369   -3.343  -6.375  1.00 1.00 ? 12  ILE A HG13 4  
ATOM   4211  H HG21 . ILE A 1 12 ? 3.491   -2.130  -4.958  1.00 1.00 ? 12  ILE A HG21 4  
ATOM   4212  H HG22 . ILE A 1 12 ? 3.215   -2.042  -3.221  1.00 1.00 ? 12  ILE A HG22 4  
ATOM   4213  H HG23 . ILE A 1 12 ? 2.129   -1.204  -4.329  1.00 1.00 ? 12  ILE A HG23 4  
ATOM   4214  H HD11 . ILE A 1 12 ? -0.890  -3.900  -4.445  1.00 1.00 ? 12  ILE A HD11 4  
ATOM   4215  H HD12 . ILE A 1 12 ? 0.121   -5.169  -5.135  1.00 1.00 ? 12  ILE A HD12 4  
ATOM   4216  H HD13 . ILE A 1 12 ? -0.879  -4.169  -6.186  1.00 1.00 ? 12  ILE A HD13 4  
ATOM   4217  N N    . VAL A 1 13 ? 4.147   -4.487  -2.494  1.00 1.00 ? 13  VAL A N    4  
ATOM   4218  C CA   . VAL A 1 13 ? 5.408   -4.303  -1.807  1.00 1.00 ? 13  VAL A CA   4  
ATOM   4219  C C    . VAL A 1 13 ? 6.383   -5.418  -2.151  1.00 1.00 ? 13  VAL A C    4  
ATOM   4220  O O    . VAL A 1 13 ? 7.526   -5.155  -2.471  1.00 1.00 ? 13  VAL A O    4  
ATOM   4221  C CB   . VAL A 1 13 ? 5.172   -4.285  -0.297  1.00 1.00 ? 13  VAL A CB   4  
ATOM   4222  C CG1  . VAL A 1 13 ? 6.502   -4.086  0.429   1.00 1.00 ? 13  VAL A CG1  4  
ATOM   4223  C CG2  . VAL A 1 13 ? 4.220   -3.143  0.054   1.00 1.00 ? 13  VAL A CG2  4  
ATOM   4224  H H    . VAL A 1 13 ? 3.329   -4.649  -1.979  1.00 1.00 ? 13  VAL A H    4  
ATOM   4225  H HA   . VAL A 1 13 ? 5.838   -3.359  -2.110  1.00 1.00 ? 13  VAL A HA   4  
ATOM   4226  H HB   . VAL A 1 13 ? 4.737   -5.226  0.007   1.00 1.00 ? 13  VAL A HB   4  
ATOM   4227  H HG11 . VAL A 1 13 ? 6.313   -3.879  1.472   1.00 1.00 ? 13  VAL A HG11 4  
ATOM   4228  H HG12 . VAL A 1 13 ? 7.034   -3.255  -0.012  1.00 1.00 ? 13  VAL A HG12 4  
ATOM   4229  H HG13 . VAL A 1 13 ? 7.098   -4.981  0.342   1.00 1.00 ? 13  VAL A HG13 4  
ATOM   4230  H HG21 . VAL A 1 13 ? 4.732   -2.202  -0.053  1.00 1.00 ? 13  VAL A HG21 4  
ATOM   4231  H HG22 . VAL A 1 13 ? 3.887   -3.258  1.074   1.00 1.00 ? 13  VAL A HG22 4  
ATOM   4232  H HG23 . VAL A 1 13 ? 3.368   -3.169  -0.609  1.00 1.00 ? 13  VAL A HG23 4  
ATOM   4233  N N    . LYS A 1 14 ? 5.924   -6.660  -2.074  1.00 1.00 ? 14  LYS A N    4  
ATOM   4234  C CA   . LYS A 1 14 ? 6.786   -7.803  -2.367  1.00 1.00 ? 14  LYS A CA   4  
ATOM   4235  C C    . LYS A 1 14 ? 7.199   -7.814  -3.833  1.00 1.00 ? 14  LYS A C    4  
ATOM   4236  O O    . LYS A 1 14 ? 8.347   -8.109  -4.167  1.00 1.00 ? 14  LYS A O    4  
ATOM   4237  C CB   . LYS A 1 14 ? 6.050   -9.106  -2.035  1.00 1.00 ? 14  LYS A CB   4  
ATOM   4238  C CG   . LYS A 1 14 ? 5.394   -8.996  -0.641  1.00 1.00 ? 14  LYS A CG   4  
ATOM   4239  C CD   . LYS A 1 14 ? 5.371   -10.364 0.066   1.00 1.00 ? 14  LYS A CD   4  
ATOM   4240  C CE   . LYS A 1 14 ? 6.701   -10.609 0.801   1.00 1.00 ? 14  LYS A CE   4  
ATOM   4241  N NZ   . LYS A 1 14 ? 6.532   -10.276 2.242   1.00 1.00 ? 14  LYS A NZ   4  
ATOM   4242  H H    . LYS A 1 14 ? 4.993   -6.813  -1.811  1.00 1.00 ? 14  LYS A H    4  
ATOM   4243  H HA   . LYS A 1 14 ? 7.674   -7.741  -1.751  1.00 1.00 ? 14  LYS A HA   4  
ATOM   4244  H HB2  . LYS A 1 14 ? 5.289   -9.286  -2.784  1.00 1.00 ? 14  LYS A HB2  4  
ATOM   4245  H HB3  . LYS A 1 14 ? 6.755   -9.925  -2.041  1.00 1.00 ? 14  LYS A HB3  4  
ATOM   4246  H HG2  . LYS A 1 14 ? 5.935   -8.285  -0.031  1.00 1.00 ? 14  LYS A HG2  4  
ATOM   4247  H HG3  . LYS A 1 14 ? 4.381   -8.655  -0.759  1.00 1.00 ? 14  LYS A HG3  4  
ATOM   4248  H HD2  . LYS A 1 14 ? 4.563   -10.378 0.784   1.00 1.00 ? 14  LYS A HD2  4  
ATOM   4249  H HD3  . LYS A 1 14 ? 5.210   -11.144 -0.665  1.00 1.00 ? 14  LYS A HD3  4  
ATOM   4250  H HE2  . LYS A 1 14 ? 6.980   -11.647 0.707   1.00 1.00 ? 14  LYS A HE2  4  
ATOM   4251  H HE3  . LYS A 1 14 ? 7.479   -9.988  0.384   1.00 1.00 ? 14  LYS A HE3  4  
ATOM   4252  H HZ1  . LYS A 1 14 ? 5.910   -9.448  2.336   1.00 1.00 ? 14  LYS A HZ1  4  
ATOM   4253  H HZ2  . LYS A 1 14 ? 7.460   -10.060 2.657   1.00 1.00 ? 14  LYS A HZ2  4  
ATOM   4254  H HZ3  . LYS A 1 14 ? 6.107   -11.084 2.739   1.00 1.00 ? 14  LYS A HZ3  4  
ATOM   4255  N N    . GLU A 1 15 ? 6.247   -7.497  -4.703  1.00 1.00 ? 15  GLU A N    4  
ATOM   4256  C CA   . GLU A 1 15 ? 6.505   -7.483  -6.136  1.00 1.00 ? 15  GLU A CA   4  
ATOM   4257  C C    . GLU A 1 15 ? 7.690   -6.595  -6.468  1.00 1.00 ? 15  GLU A C    4  
ATOM   4258  O O    . GLU A 1 15 ? 8.500   -6.921  -7.338  1.00 1.00 ? 15  GLU A O    4  
ATOM   4259  C CB   . GLU A 1 15 ? 5.261   -6.999  -6.893  1.00 1.00 ? 15  GLU A CB   4  
ATOM   4260  C CG   . GLU A 1 15 ? 4.194   -8.105  -6.915  1.00 1.00 ? 15  GLU A CG   4  
ATOM   4261  C CD   . GLU A 1 15 ? 4.623   -9.236  -7.843  1.00 1.00 ? 15  GLU A CD   4  
ATOM   4262  O OE1  . GLU A 1 15 ? 5.448   -8.989  -8.705  1.00 1.00 ? 15  GLU A OE1  4  
ATOM   4263  O OE2  . GLU A 1 15 ? 4.111   -10.333 -7.681  1.00 1.00 ? 15  GLU A OE2  4  
ATOM   4264  H H    . GLU A 1 15 ? 5.356   -7.283  -4.374  1.00 1.00 ? 15  GLU A H    4  
ATOM   4265  H HA   . GLU A 1 15 ? 6.735   -8.474  -6.444  1.00 1.00 ? 15  GLU A HA   4  
ATOM   4266  H HB2  . GLU A 1 15 ? 4.865   -6.125  -6.399  1.00 1.00 ? 15  GLU A HB2  4  
ATOM   4267  H HB3  . GLU A 1 15 ? 5.535   -6.749  -7.906  1.00 1.00 ? 15  GLU A HB3  4  
ATOM   4268  H HG2  . GLU A 1 15 ? 4.059   -8.499  -5.924  1.00 1.00 ? 15  GLU A HG2  4  
ATOM   4269  H HG3  . GLU A 1 15 ? 3.259   -7.690  -7.267  1.00 1.00 ? 15  GLU A HG3  4  
ATOM   4270  N N    . LYS A 1 16 ? 7.802   -5.486  -5.769  1.00 1.00 ? 16  LYS A N    4  
ATOM   4271  C CA   . LYS A 1 16 ? 8.903   -4.571  -6.000  1.00 1.00 ? 16  LYS A CA   4  
ATOM   4272  C C    . LYS A 1 16 ? 10.239  -5.274  -5.770  1.00 1.00 ? 16  LYS A C    4  
ATOM   4273  O O    . LYS A 1 16 ? 11.183  -5.099  -6.537  1.00 1.00 ? 16  LYS A O    4  
ATOM   4274  C CB   . LYS A 1 16 ? 8.744   -3.395  -5.064  1.00 1.00 ? 16  LYS A CB   4  
ATOM   4275  C CG   . LYS A 1 16 ? 7.611   -2.516  -5.596  1.00 1.00 ? 16  LYS A CG   4  
ATOM   4276  C CD   . LYS A 1 16 ? 7.181   -1.535  -4.514  1.00 1.00 ? 16  LYS A CD   4  
ATOM   4277  C CE   . LYS A 1 16 ? 6.571   -0.269  -5.134  1.00 1.00 ? 16  LYS A CE   4  
ATOM   4278  N NZ   . LYS A 1 16 ? 5.131   -0.501  -5.415  1.00 1.00 ? 16  LYS A NZ   4  
ATOM   4279  H H    . LYS A 1 16 ? 7.133   -5.279  -5.082  1.00 1.00 ? 16  LYS A H    4  
ATOM   4280  H HA   . LYS A 1 16 ? 8.854   -4.205  -7.008  1.00 1.00 ? 16  LYS A HA   4  
ATOM   4281  H HB2  . LYS A 1 16 ? 8.500   -3.749  -4.075  1.00 1.00 ? 16  LYS A HB2  4  
ATOM   4282  H HB3  . LYS A 1 16 ? 9.662   -2.827  -5.034  1.00 1.00 ? 16  LYS A HB3  4  
ATOM   4283  H HG2  . LYS A 1 16 ? 7.967   -1.986  -6.457  1.00 1.00 ? 16  LYS A HG2  4  
ATOM   4284  H HG3  . LYS A 1 16 ? 6.770   -3.130  -5.879  1.00 1.00 ? 16  LYS A HG3  4  
ATOM   4285  H HD2  . LYS A 1 16 ? 6.441   -2.023  -3.900  1.00 1.00 ? 16  LYS A HD2  4  
ATOM   4286  H HD3  . LYS A 1 16 ? 8.033   -1.270  -3.914  1.00 1.00 ? 16  LYS A HD3  4  
ATOM   4287  H HE2  . LYS A 1 16 ? 6.671   0.549   -4.440  1.00 1.00 ? 16  LYS A HE2  4  
ATOM   4288  H HE3  . LYS A 1 16 ? 7.083   -0.022  -6.051  1.00 1.00 ? 16  LYS A HE3  4  
ATOM   4289  H HZ1  . LYS A 1 16 ? 4.624   -0.649  -4.519  1.00 1.00 ? 16  LYS A HZ1  4  
ATOM   4290  H HZ2  . LYS A 1 16 ? 5.026   -1.343  -6.018  1.00 1.00 ? 16  LYS A HZ2  4  
ATOM   4291  H HZ3  . LYS A 1 16 ? 4.735   0.328   -5.901  1.00 1.00 ? 16  LYS A HZ3  4  
ATOM   4292  N N    . LEU A 1 17 ? 10.298  -6.074  -4.709  1.00 1.00 ? 17  LEU A N    4  
ATOM   4293  C CA   . LEU A 1 17 ? 11.507  -6.814  -4.366  1.00 1.00 ? 17  LEU A CA   4  
ATOM   4294  C C    . LEU A 1 17 ? 11.492  -8.183  -5.024  1.00 1.00 ? 17  LEU A C    4  
ATOM   4295  O O    . LEU A 1 17 ? 12.437  -8.958  -4.881  1.00 1.00 ? 17  LEU A O    4  
ATOM   4296  C CB   . LEU A 1 17 ? 11.583  -7.001  -2.849  1.00 1.00 ? 17  LEU A CB   4  
ATOM   4297  C CG   . LEU A 1 17 ? 11.782  -5.651  -2.192  1.00 1.00 ? 17  LEU A CG   4  
ATOM   4298  C CD1  . LEU A 1 17 ? 10.576  -4.737  -2.453  1.00 1.00 ? 17  LEU A CD1  4  
ATOM   4299  C CD2  . LEU A 1 17 ? 11.996  -5.837  -0.688  1.00 1.00 ? 17  LEU A CD2  4  
ATOM   4300  H H    . LEU A 1 17 ? 9.515   -6.165  -4.134  1.00 1.00 ? 17  LEU A H    4  
ATOM   4301  H HA   . LEU A 1 17 ? 12.375  -6.270  -4.698  1.00 1.00 ? 17  LEU A HA   4  
ATOM   4302  H HB2  . LEU A 1 17 ? 10.667  -7.446  -2.485  1.00 1.00 ? 17  LEU A HB2  4  
ATOM   4303  H HB3  . LEU A 1 17 ? 12.422  -7.633  -2.605  1.00 1.00 ? 17  LEU A HB3  4  
ATOM   4304  H HG   . LEU A 1 17 ? 12.640  -5.221  -2.623  1.00 1.00 ? 17  LEU A HG   4  
ATOM   4305  H HD11 . LEU A 1 17 ? 9.689   -5.337  -2.533  1.00 1.00 ? 17  LEU A HD11 4  
ATOM   4306  H HD12 . LEU A 1 17 ? 10.727  -4.197  -3.376  1.00 1.00 ? 17  LEU A HD12 4  
ATOM   4307  H HD13 . LEU A 1 17 ? 10.461  -4.031  -1.643  1.00 1.00 ? 17  LEU A HD13 4  
ATOM   4308  H HD21 . LEU A 1 17 ? 11.277  -6.548  -0.306  1.00 1.00 ? 17  LEU A HD21 4  
ATOM   4309  H HD22 . LEU A 1 17 ? 11.868  -4.889  -0.186  1.00 1.00 ? 17  LEU A HD22 4  
ATOM   4310  H HD23 . LEU A 1 17 ? 12.994  -6.204  -0.514  1.00 1.00 ? 17  LEU A HD23 4  
ATOM   4311  N N    . ALA A 1 18 ? 10.406  -8.481  -5.720  1.00 1.00 ? 18  ALA A N    4  
ATOM   4312  C CA   . ALA A 1 18 ? 10.264  -9.772  -6.376  1.00 1.00 ? 18  ALA A CA   4  
ATOM   4313  C C    . ALA A 1 18 ? 10.087  -10.867 -5.341  1.00 1.00 ? 18  ALA A C    4  
ATOM   4314  O O    . ALA A 1 18 ? 10.461  -12.022 -5.559  1.00 1.00 ? 18  ALA A O    4  
ATOM   4315  C CB   . ALA A 1 18 ? 11.493  -10.061 -7.236  1.00 1.00 ? 18  ALA A CB   4  
ATOM   4316  H H    . ALA A 1 18 ? 9.680   -7.827  -5.783  1.00 1.00 ? 18  ALA A H    4  
ATOM   4317  H HA   . ALA A 1 18 ? 9.391   -9.748  -6.998  1.00 1.00 ? 18  ALA A HA   4  
ATOM   4318  H HB1  . ALA A 1 18 ? 11.238  -10.776 -8.001  1.00 1.00 ? 18  ALA A HB1  4  
ATOM   4319  H HB2  . ALA A 1 18 ? 12.286  -10.460 -6.619  1.00 1.00 ? 18  ALA A HB2  4  
ATOM   4320  H HB3  . ALA A 1 18 ? 11.827  -9.141  -7.697  1.00 1.00 ? 18  ALA A HB3  4  
ATOM   4321  N N    . LEU A 1 19 ? 9.512   -10.493 -4.210  1.00 1.00 ? 19  LEU A N    4  
ATOM   4322  C CA   . LEU A 1 19 ? 9.281   -11.433 -3.125  1.00 1.00 ? 19  LEU A CA   4  
ATOM   4323  C C    . LEU A 1 19 ? 7.908   -12.097 -3.274  1.00 1.00 ? 19  LEU A C    4  
ATOM   4324  O O    . LEU A 1 19 ? 7.279   -12.015 -4.329  1.00 1.00 ? 19  LEU A O    4  
ATOM   4325  C CB   . LEU A 1 19 ? 9.395   -10.667 -1.798  1.00 1.00 ? 19  LEU A CB   4  
ATOM   4326  C CG   . LEU A 1 19 ? 10.814  -10.791 -1.226  1.00 1.00 ? 19  LEU A CG   4  
ATOM   4327  C CD1  . LEU A 1 19 ? 11.827  -10.299 -2.275  1.00 1.00 ? 19  LEU A CD1  4  
ATOM   4328  C CD2  . LEU A 1 19 ? 10.906  -9.937  0.046   1.00 1.00 ? 19  LEU A CD2  4  
ATOM   4329  H H    . LEU A 1 19 ? 9.233   -9.556  -4.098  1.00 1.00 ? 19  LEU A H    4  
ATOM   4330  H HA   . LEU A 1 19 ? 10.034  -12.203 -3.155  1.00 1.00 ? 19  LEU A HA   4  
ATOM   4331  H HB2  . LEU A 1 19 ? 9.191   -9.615  -1.989  1.00 1.00 ? 19  LEU A HB2  4  
ATOM   4332  H HB3  . LEU A 1 19 ? 8.695   -11.059 -1.088  1.00 1.00 ? 19  LEU A HB3  4  
ATOM   4333  H HG   . LEU A 1 19 ? 11.019  -11.827 -0.988  1.00 1.00 ? 19  LEU A HG   4  
ATOM   4334  H HD11 . LEU A 1 19 ? 12.164  -11.137 -2.869  1.00 1.00 ? 19  LEU A HD11 4  
ATOM   4335  H HD12 . LEU A 1 19 ? 12.676  -9.837  -1.790  1.00 1.00 ? 19  LEU A HD12 4  
ATOM   4336  H HD13 . LEU A 1 19 ? 11.353  -9.583  -2.915  1.00 1.00 ? 19  LEU A HD13 4  
ATOM   4337  H HD21 . LEU A 1 19 ? 10.504  -8.953  -0.154  1.00 1.00 ? 19  LEU A HD21 4  
ATOM   4338  H HD22 . LEU A 1 19 ? 11.940  -9.849  0.352   1.00 1.00 ? 19  LEU A HD22 4  
ATOM   4339  H HD23 . LEU A 1 19 ? 10.338  -10.407 0.833   1.00 1.00 ? 19  LEU A HD23 4  
ATOM   4340  N N    . GLY A 1 20 ? 7.463   -12.764 -2.211  1.00 1.00 ? 20  GLY A N    4  
ATOM   4341  C CA   . GLY A 1 20 ? 6.178   -13.460 -2.218  1.00 1.00 ? 20  GLY A CA   4  
ATOM   4342  C C    . GLY A 1 20 ? 6.367   -14.938 -2.552  1.00 1.00 ? 20  GLY A C    4  
ATOM   4343  O O    . GLY A 1 20 ? 5.407   -15.708 -2.567  1.00 1.00 ? 20  GLY A O    4  
ATOM   4344  H H    . GLY A 1 20 ? 8.019   -12.796 -1.405  1.00 1.00 ? 20  GLY A H    4  
ATOM   4345  H HA2  . GLY A 1 20 ? 5.727   -13.373 -1.238  1.00 1.00 ? 20  GLY A HA2  4  
ATOM   4346  H HA3  . GLY A 1 20 ? 5.525   -13.013 -2.950  1.00 1.00 ? 20  GLY A HA3  4  
ATOM   4347  N N    . ALA A 1 21 ? 7.613   -15.331 -2.811  1.00 1.00 ? 21  ALA A N    4  
ATOM   4348  C CA   . ALA A 1 21 ? 7.914   -16.722 -3.139  1.00 1.00 ? 21  ALA A CA   4  
ATOM   4349  C C    . ALA A 1 21 ? 8.072   -17.548 -1.867  1.00 1.00 ? 21  ALA A C    4  
ATOM   4350  O O    . ALA A 1 21 ? 7.231   -18.392 -1.554  1.00 1.00 ? 21  ALA A O    4  
ATOM   4351  C CB   . ALA A 1 21 ? 9.203   -16.800 -3.962  1.00 1.00 ? 21  ALA A CB   4  
ATOM   4352  H H    . ALA A 1 21 ? 8.340   -14.676 -2.780  1.00 1.00 ? 21  ALA A H    4  
ATOM   4353  H HA   . ALA A 1 21 ? 7.103   -17.131 -3.724  1.00 1.00 ? 21  ALA A HA   4  
ATOM   4354  H HB1  . ALA A 1 21 ? 10.027  -16.421 -3.377  1.00 1.00 ? 21  ALA A HB1  4  
ATOM   4355  H HB2  . ALA A 1 21 ? 9.093   -16.209 -4.859  1.00 1.00 ? 21  ALA A HB2  4  
ATOM   4356  H HB3  . ALA A 1 21 ? 9.396   -17.829 -4.229  1.00 1.00 ? 21  ALA A HB3  4  
ATOM   4357  N N    . ASP A 1 22 ? 9.162   -17.304 -1.136  1.00 1.00 ? 22  ASP A N    4  
ATOM   4358  C CA   . ASP A 1 22 ? 9.437   -18.032 0.107   1.00 1.00 ? 22  ASP A CA   4  
ATOM   4359  C C    . ASP A 1 22 ? 9.445   -17.080 1.299   1.00 1.00 ? 22  ASP A C    4  
ATOM   4360  O O    . ASP A 1 22 ? 10.115  -17.332 2.301   1.00 1.00 ? 22  ASP A O    4  
ATOM   4361  C CB   . ASP A 1 22 ? 10.794  -18.731 0.014   1.00 1.00 ? 22  ASP A CB   4  
ATOM   4362  C CG   . ASP A 1 22 ? 10.998  -19.629 1.230   1.00 1.00 ? 22  ASP A CG   4  
ATOM   4363  O OD1  . ASP A 1 22 ? 10.039  -19.832 1.957   1.00 1.00 ? 22  ASP A OD1  4  
ATOM   4364  O OD2  . ASP A 1 22 ? 12.106  -20.101 1.414   1.00 1.00 ? 22  ASP A OD2  4  
ATOM   4365  H H    . ASP A 1 22 ? 9.797   -16.621 -1.440  1.00 1.00 ? 22  ASP A H    4  
ATOM   4366  H HA   . ASP A 1 22 ? 8.674   -18.780 0.266   1.00 1.00 ? 22  ASP A HA   4  
ATOM   4367  H HB2  . ASP A 1 22 ? 10.830  -19.329 -0.886  1.00 1.00 ? 22  ASP A HB2  4  
ATOM   4368  H HB3  . ASP A 1 22 ? 11.578  -17.988 -0.017  1.00 1.00 ? 22  ASP A HB3  4  
ATOM   4369  N N    . VAL A 1 23 ? 8.698   -15.983 1.186   1.00 1.00 ? 23  VAL A N    4  
ATOM   4370  C CA   . VAL A 1 23 ? 8.622   -14.990 2.260   1.00 1.00 ? 23  VAL A CA   4  
ATOM   4371  C C    . VAL A 1 23 ? 7.193   -14.893 2.786   1.00 1.00 ? 23  VAL A C    4  
ATOM   4372  O O    . VAL A 1 23 ? 6.239   -14.813 2.013   1.00 1.00 ? 23  VAL A O    4  
ATOM   4373  C CB   . VAL A 1 23 ? 9.068   -13.620 1.738   1.00 1.00 ? 23  VAL A CB   4  
ATOM   4374  C CG1  . VAL A 1 23 ? 8.805   -12.547 2.800   1.00 1.00 ? 23  VAL A CG1  4  
ATOM   4375  C CG2  . VAL A 1 23 ? 10.561  -13.659 1.405   1.00 1.00 ? 23  VAL A CG2  4  
ATOM   4376  H H    . VAL A 1 23 ? 8.187   -15.834 0.362   1.00 1.00 ? 23  VAL A H    4  
ATOM   4377  H HA   . VAL A 1 23 ? 9.274   -15.279 3.074   1.00 1.00 ? 23  VAL A HA   4  
ATOM   4378  H HB   . VAL A 1 23 ? 8.509   -13.384 0.846   1.00 1.00 ? 23  VAL A HB   4  
ATOM   4379  H HG11 . VAL A 1 23 ? 7.746   -12.338 2.848   1.00 1.00 ? 23  VAL A HG11 4  
ATOM   4380  H HG12 . VAL A 1 23 ? 9.338   -11.644 2.541   1.00 1.00 ? 23  VAL A HG12 4  
ATOM   4381  H HG13 . VAL A 1 23 ? 9.145   -12.901 3.762   1.00 1.00 ? 23  VAL A HG13 4  
ATOM   4382  H HG21 . VAL A 1 23 ? 11.105  -14.085 2.235   1.00 1.00 ? 23  VAL A HG21 4  
ATOM   4383  H HG22 . VAL A 1 23 ? 10.913  -12.654 1.221   1.00 1.00 ? 23  VAL A HG22 4  
ATOM   4384  H HG23 . VAL A 1 23 ? 10.717  -14.262 0.523   1.00 1.00 ? 23  VAL A HG23 4  
ATOM   4385  N N    . VAL A 1 24 ? 7.062   -14.899 4.105   1.00 1.00 ? 24  VAL A N    4  
ATOM   4386  C CA   . VAL A 1 24 ? 5.755   -14.810 4.740   1.00 1.00 ? 24  VAL A CA   4  
ATOM   4387  C C    . VAL A 1 24 ? 5.148   -13.431 4.516   1.00 1.00 ? 24  VAL A C    4  
ATOM   4388  O O    . VAL A 1 24 ? 5.868   -12.434 4.420   1.00 1.00 ? 24  VAL A O    4  
ATOM   4389  C CB   . VAL A 1 24 ? 5.880   -15.073 6.240   1.00 1.00 ? 24  VAL A CB   4  
ATOM   4390  C CG1  . VAL A 1 24 ? 4.499   -14.975 6.893   1.00 1.00 ? 24  VAL A CG1  4  
ATOM   4391  C CG2  . VAL A 1 24 ? 6.454   -16.473 6.466   1.00 1.00 ? 24  VAL A CG2  4  
ATOM   4392  H H    . VAL A 1 24 ? 7.864   -14.964 4.664   1.00 1.00 ? 24  VAL A H    4  
ATOM   4393  H HA   . VAL A 1 24 ? 5.103   -15.553 4.309   1.00 1.00 ? 24  VAL A HA   4  
ATOM   4394  H HB   . VAL A 1 24 ? 6.538   -14.337 6.680   1.00 1.00 ? 24  VAL A HB   4  
ATOM   4395  H HG11 . VAL A 1 24 ? 3.799   -15.585 6.342   1.00 1.00 ? 24  VAL A HG11 4  
ATOM   4396  H HG12 . VAL A 1 24 ? 4.167   -13.947 6.880   1.00 1.00 ? 24  VAL A HG12 4  
ATOM   4397  H HG13 . VAL A 1 24 ? 4.556   -15.323 7.914   1.00 1.00 ? 24  VAL A HG13 4  
ATOM   4398  H HG21 . VAL A 1 24 ? 7.331   -16.606 5.851   1.00 1.00 ? 24  VAL A HG21 4  
ATOM   4399  H HG22 . VAL A 1 24 ? 5.713   -17.213 6.201   1.00 1.00 ? 24  VAL A HG22 4  
ATOM   4400  H HG23 . VAL A 1 24 ? 6.722   -16.589 7.507   1.00 1.00 ? 24  VAL A HG23 4  
ATOM   4401  N N    . VAL A 1 25 ? 3.820   -13.378 4.431   1.00 1.00 ? 25  VAL A N    4  
ATOM   4402  C CA   . VAL A 1 25 ? 3.111   -12.114 4.216   1.00 1.00 ? 25  VAL A CA   4  
ATOM   4403  C C    . VAL A 1 25 ? 2.086   -11.889 5.322   1.00 1.00 ? 25  VAL A C    4  
ATOM   4404  O O    . VAL A 1 25 ? 1.306   -12.784 5.653   1.00 1.00 ? 25  VAL A O    4  
ATOM   4405  C CB   . VAL A 1 25 ? 2.401   -12.138 2.857   1.00 1.00 ? 25  VAL A CB   4  
ATOM   4406  C CG1  . VAL A 1 25 ? 1.512   -13.383 2.761   1.00 1.00 ? 25  VAL A CG1  4  
ATOM   4407  C CG2  . VAL A 1 25 ? 1.540   -10.880 2.703   1.00 1.00 ? 25  VAL A CG2  4  
ATOM   4408  H H    . VAL A 1 25 ? 3.303   -14.207 4.514   1.00 1.00 ? 25  VAL A H    4  
ATOM   4409  H HA   . VAL A 1 25 ? 3.817   -11.292 4.223   1.00 1.00 ? 25  VAL A HA   4  
ATOM   4410  H HB   . VAL A 1 25 ? 3.140   -12.168 2.069   1.00 1.00 ? 25  VAL A HB   4  
ATOM   4411  H HG11 . VAL A 1 25 ? 2.087   -14.258 3.021   1.00 1.00 ? 25  VAL A HG11 4  
ATOM   4412  H HG12 . VAL A 1 25 ? 1.143   -13.484 1.751   1.00 1.00 ? 25  VAL A HG12 4  
ATOM   4413  H HG13 . VAL A 1 25 ? 0.680   -13.284 3.441   1.00 1.00 ? 25  VAL A HG13 4  
ATOM   4414  H HG21 . VAL A 1 25 ? 2.103   -10.017 3.028   1.00 1.00 ? 25  VAL A HG21 4  
ATOM   4415  H HG22 . VAL A 1 25 ? 0.648   -10.976 3.303   1.00 1.00 ? 25  VAL A HG22 4  
ATOM   4416  H HG23 . VAL A 1 25 ? 1.264   -10.758 1.665   1.00 1.00 ? 25  VAL A HG23 4  
ATOM   4417  N N    . THR A 1 26 ? 2.096   -10.684 5.889   1.00 1.00 ? 26  THR A N    4  
ATOM   4418  C CA   . THR A 1 26 ? 1.165   -10.324 6.960   1.00 1.00 ? 26  THR A CA   4  
ATOM   4419  C C    . THR A 1 26 ? 0.570   -8.946  6.708   1.00 1.00 ? 26  THR A C    4  
ATOM   4420  O O    . THR A 1 26 ? 1.119   -8.147  5.949   1.00 1.00 ? 26  THR A O    4  
ATOM   4421  C CB   . THR A 1 26 ? 1.886   -10.338 8.312   1.00 1.00 ? 26  THR A CB   4  
ATOM   4422  O OG1  . THR A 1 26 ? 3.068   -9.558  8.226   1.00 1.00 ? 26  THR A OG1  4  
ATOM   4423  C CG2  . THR A 1 26 ? 2.243   -11.773 8.688   1.00 1.00 ? 26  THR A CG2  4  
ATOM   4424  H H    . THR A 1 26 ? 2.742   -10.016 5.578   1.00 1.00 ? 26  THR A H    4  
ATOM   4425  H HA   . THR A 1 26 ? 0.360   -11.047 6.991   1.00 1.00 ? 26  THR A HA   4  
ATOM   4426  H HB   . THR A 1 26 ? 1.237   -9.924  9.068   1.00 1.00 ? 26  THR A HB   4  
ATOM   4427  H HG1  . THR A 1 26 ? 2.957   -8.787  8.787   1.00 1.00 ? 26  THR A HG1  4  
ATOM   4428  H HG21 . THR A 1 26 ? 2.929   -12.177 7.961   1.00 1.00 ? 26  THR A HG21 4  
ATOM   4429  H HG22 . THR A 1 26 ? 1.344   -12.372 8.707   1.00 1.00 ? 26  THR A HG22 4  
ATOM   4430  H HG23 . THR A 1 26 ? 2.704   -11.784 9.666   1.00 1.00 ? 26  THR A HG23 4  
ATOM   4431  N N    . ALA A 1 27 ? -0.562  -8.678  7.350   1.00 1.00 ? 27  ALA A N    4  
ATOM   4432  C CA   . ALA A 1 27 ? -1.242  -7.400  7.200   1.00 1.00 ? 27  ALA A CA   4  
ATOM   4433  C C    . ALA A 1 27 ? -0.596  -6.345  8.089   1.00 1.00 ? 27  ALA A C    4  
ATOM   4434  O O    . ALA A 1 27 ? -0.979  -5.181  8.064   1.00 1.00 ? 27  ALA A O    4  
ATOM   4435  C CB   . ALA A 1 27 ? -2.719  -7.554  7.577   1.00 1.00 ? 27  ALA A CB   4  
ATOM   4436  H H    . ALA A 1 27 ? -0.949  -9.354  7.935   1.00 1.00 ? 27  ALA A H    4  
ATOM   4437  H HA   . ALA A 1 27 ? -1.176  -7.082  6.171   1.00 1.00 ? 27  ALA A HA   4  
ATOM   4438  H HB1  . ALA A 1 27 ? -3.079  -8.509  7.222   1.00 1.00 ? 27  ALA A HB1  4  
ATOM   4439  H HB2  . ALA A 1 27 ? -3.293  -6.760  7.125   1.00 1.00 ? 27  ALA A HB2  4  
ATOM   4440  H HB3  . ALA A 1 27 ? -2.826  -7.509  8.653   1.00 1.00 ? 27  ALA A HB3  4  
ATOM   4441  N N    . ASP A 1 28 ? 0.380   -6.764  8.885   1.00 1.00 ? 28  ASP A N    4  
ATOM   4442  C CA   . ASP A 1 28 ? 1.076   -5.850  9.795   1.00 1.00 ? 28  ASP A CA   4  
ATOM   4443  C C    . ASP A 1 28 ? 2.563   -5.798  9.454   1.00 1.00 ? 28  ASP A C    4  
ATOM   4444  O O    . ASP A 1 28 ? 3.381   -5.384  10.274  1.00 1.00 ? 28  ASP A O    4  
ATOM   4445  C CB   . ASP A 1 28 ? 0.895   -6.322  11.240  1.00 1.00 ? 28  ASP A CB   4  
ATOM   4446  C CG   . ASP A 1 28 ? 1.511   -7.704  11.435  1.00 1.00 ? 28  ASP A CG   4  
ATOM   4447  O OD1  . ASP A 1 28 ? 2.202   -8.158  10.539  1.00 1.00 ? 28  ASP A OD1  4  
ATOM   4448  O OD2  . ASP A 1 28 ? 1.283   -8.286  12.483  1.00 1.00 ? 28  ASP A OD2  4  
ATOM   4449  H H    . ASP A 1 28 ? 0.639   -7.710  8.869   1.00 1.00 ? 28  ASP A H    4  
ATOM   4450  H HA   . ASP A 1 28 ? 0.654   -4.852  9.702   1.00 1.00 ? 28  ASP A HA   4  
ATOM   4451  H HB2  . ASP A 1 28 ? 1.375   -5.622  11.906  1.00 1.00 ? 28  ASP A HB2  4  
ATOM   4452  H HB3  . ASP A 1 28 ? -0.159  -6.369  11.470  1.00 1.00 ? 28  ASP A HB3  4  
ATOM   4453  N N    . SER A 1 29 ? 2.908   -6.240  8.248   1.00 1.00 ? 29  SER A N    4  
ATOM   4454  C CA   . SER A 1 29 ? 4.303   -6.257  7.823   1.00 1.00 ? 29  SER A CA   4  
ATOM   4455  C C    . SER A 1 29 ? 4.828   -4.846  7.601   1.00 1.00 ? 29  SER A C    4  
ATOM   4456  O O    . SER A 1 29 ? 6.036   -4.632  7.509   1.00 1.00 ? 29  SER A O    4  
ATOM   4457  C CB   . SER A 1 29 ? 4.462   -7.085  6.538   1.00 1.00 ? 29  SER A CB   4  
ATOM   4458  O OG   . SER A 1 29 ? 4.628   -8.454  6.880   1.00 1.00 ? 29  SER A OG   4  
ATOM   4459  H H    . SER A 1 29 ? 2.215   -6.573  7.640   1.00 1.00 ? 29  SER A H    4  
ATOM   4460  H HA   . SER A 1 29 ? 4.880   -6.712  8.603   1.00 1.00 ? 29  SER A HA   4  
ATOM   4461  H HB2  . SER A 1 29 ? 3.582   -6.979  5.927   1.00 1.00 ? 29  SER A HB2  4  
ATOM   4462  H HB3  . SER A 1 29 ? 5.327   -6.741  5.981   1.00 1.00 ? 29  SER A HB3  4  
ATOM   4463  H HG   . SER A 1 29 ? 5.124   -8.877  6.176   1.00 1.00 ? 29  SER A HG   4  
ATOM   4464  N N    . GLU A 1 30 ? 3.918   -3.896  7.506   1.00 1.00 ? 30  GLU A N    4  
ATOM   4465  C CA   . GLU A 1 30 ? 4.301   -2.513  7.291   1.00 1.00 ? 30  GLU A CA   4  
ATOM   4466  C C    . GLU A 1 30 ? 5.121   -2.378  6.014   1.00 1.00 ? 30  GLU A C    4  
ATOM   4467  O O    . GLU A 1 30 ? 5.702   -3.350  5.528   1.00 1.00 ? 30  GLU A O    4  
ATOM   4468  C CB   . GLU A 1 30 ? 5.120   -1.999  8.480   1.00 1.00 ? 30  GLU A CB   4  
ATOM   4469  C CG   . GLU A 1 30 ? 4.306   -2.139  9.762   1.00 1.00 ? 30  GLU A CG   4  
ATOM   4470  C CD   . GLU A 1 30 ? 5.171   -1.815  10.972  1.00 1.00 ? 30  GLU A CD   4  
ATOM   4471  O OE1  . GLU A 1 30 ? 6.320   -1.462  10.774  1.00 1.00 ? 30  GLU A OE1  4  
ATOM   4472  O OE2  . GLU A 1 30 ? 4.672   -1.925  12.082  1.00 1.00 ? 30  GLU A OE2  4  
ATOM   4473  H H    . GLU A 1 30 ? 2.969   -4.127  7.583   1.00 1.00 ? 30  GLU A H    4  
ATOM   4474  H HA   . GLU A 1 30 ? 3.417   -1.920  7.196   1.00 1.00 ? 30  GLU A HA   4  
ATOM   4475  H HB2  . GLU A 1 30 ? 6.037   -2.560  8.569   1.00 1.00 ? 30  GLU A HB2  4  
ATOM   4476  H HB3  . GLU A 1 30 ? 5.349   -0.956  8.326   1.00 1.00 ? 30  GLU A HB3  4  
ATOM   4477  H HG2  . GLU A 1 30 ? 3.481   -1.454  9.726   1.00 1.00 ? 30  GLU A HG2  4  
ATOM   4478  H HG3  . GLU A 1 30 ? 3.934   -3.147  9.847   1.00 1.00 ? 30  GLU A HG3  4  
ATOM   4479  N N    . PHE A 1 31 ? 5.160   -1.162  5.476   1.00 1.00 ? 31  PHE A N    4  
ATOM   4480  C CA   . PHE A 1 31 ? 5.906   -0.881  4.249   1.00 1.00 ? 31  PHE A CA   4  
ATOM   4481  C C    . PHE A 1 31 ? 6.790   0.348   4.442   1.00 1.00 ? 31  PHE A C    4  
ATOM   4482  O O    . PHE A 1 31 ? 6.439   1.449   4.016   1.00 1.00 ? 31  PHE A O    4  
ATOM   4483  C CB   . PHE A 1 31 ? 4.928   -0.655  3.077   1.00 1.00 ? 31  PHE A CB   4  
ATOM   4484  C CG   . PHE A 1 31 ? 3.571   -0.212  3.596   1.00 1.00 ? 31  PHE A CG   4  
ATOM   4485  C CD1  . PHE A 1 31 ? 3.472   0.726   4.636   1.00 1.00 ? 31  PHE A CD1  4  
ATOM   4486  C CD2  . PHE A 1 31 ? 2.406   -0.741  3.028   1.00 1.00 ? 31  PHE A CD2  4  
ATOM   4487  C CE1  . PHE A 1 31 ? 2.222   1.122   5.099   1.00 1.00 ? 31  PHE A CE1  4  
ATOM   4488  C CE2  . PHE A 1 31 ? 1.159   -0.341  3.492   1.00 1.00 ? 31  PHE A CE2  4  
ATOM   4489  C CZ   . PHE A 1 31 ? 1.062   0.590   4.525   1.00 1.00 ? 31  PHE A CZ   4  
ATOM   4490  H H    . PHE A 1 31 ? 4.675   -0.434  5.913   1.00 1.00 ? 31  PHE A H    4  
ATOM   4491  H HA   . PHE A 1 31 ? 6.544   -1.726  4.015   1.00 1.00 ? 31  PHE A HA   4  
ATOM   4492  H HB2  . PHE A 1 31 ? 5.317   0.103   2.410   1.00 1.00 ? 31  PHE A HB2  4  
ATOM   4493  H HB3  . PHE A 1 31 ? 4.810   -1.580  2.525   1.00 1.00 ? 31  PHE A HB3  4  
ATOM   4494  H HD1  . PHE A 1 31 ? 4.352   1.139   5.088   1.00 1.00 ? 31  PHE A HD1  4  
ATOM   4495  H HD2  . PHE A 1 31 ? 2.469   -1.458  2.237   1.00 1.00 ? 31  PHE A HD2  4  
ATOM   4496  H HE1  . PHE A 1 31 ? 2.157   1.846   5.892   1.00 1.00 ? 31  PHE A HE1  4  
ATOM   4497  H HE2  . PHE A 1 31 ? 0.267   -0.745  3.043   1.00 1.00 ? 31  PHE A HE2  4  
ATOM   4498  H HZ   . PHE A 1 31 ? 0.096   0.886   4.883   1.00 1.00 ? 31  PHE A HZ   4  
ATOM   4499  N N    . SER A 1 32 ? 7.938   0.151   5.078   1.00 1.00 ? 32  SER A N    4  
ATOM   4500  C CA   . SER A 1 32 ? 8.867   1.247   5.313   1.00 1.00 ? 32  SER A CA   4  
ATOM   4501  C C    . SER A 1 32 ? 10.269  0.706   5.566   1.00 1.00 ? 32  SER A C    4  
ATOM   4502  O O    . SER A 1 32 ? 10.442  -0.473  5.878   1.00 1.00 ? 32  SER A O    4  
ATOM   4503  C CB   . SER A 1 32 ? 8.410   2.069   6.518   1.00 1.00 ? 32  SER A CB   4  
ATOM   4504  O OG   . SER A 1 32 ? 8.253   1.208   7.639   1.00 1.00 ? 32  SER A OG   4  
ATOM   4505  H H    . SER A 1 32 ? 8.166   -0.749  5.389   1.00 1.00 ? 32  SER A H    4  
ATOM   4506  H HA   . SER A 1 32 ? 8.889   1.886   4.445   1.00 1.00 ? 32  SER A HA   4  
ATOM   4507  H HB2  . SER A 1 32 ? 9.148   2.818   6.748   1.00 1.00 ? 32  SER A HB2  4  
ATOM   4508  H HB3  . SER A 1 32 ? 7.468   2.550   6.287   1.00 1.00 ? 32  SER A HB3  4  
ATOM   4509  H HG   . SER A 1 32 ? 9.121   0.886   7.889   1.00 1.00 ? 32  SER A HG   4  
ATOM   4510  N N    . LYS A 1 33 ? 11.265  1.576   5.434   1.00 1.00 ? 33  LYS A N    4  
ATOM   4511  C CA   . LYS A 1 33 ? 12.654  1.182   5.652   1.00 1.00 ? 33  LYS A CA   4  
ATOM   4512  C C    . LYS A 1 33 ? 13.452  2.350   6.217   1.00 1.00 ? 33  LYS A C    4  
ATOM   4513  O O    . LYS A 1 33 ? 13.278  3.494   5.797   1.00 1.00 ? 33  LYS A O    4  
ATOM   4514  C CB   . LYS A 1 33 ? 13.280  0.718   4.337   1.00 1.00 ? 33  LYS A CB   4  
ATOM   4515  C CG   . LYS A 1 33 ? 14.691  0.190   4.606   1.00 1.00 ? 33  LYS A CG   4  
ATOM   4516  C CD   . LYS A 1 33 ? 15.293  -0.343  3.307   1.00 1.00 ? 33  LYS A CD   4  
ATOM   4517  C CE   . LYS A 1 33 ? 16.696  -0.886  3.581   1.00 1.00 ? 33  LYS A CE   4  
ATOM   4518  N NZ   . LYS A 1 33 ? 17.270  -1.434  2.320   1.00 1.00 ? 33  LYS A NZ   4  
ATOM   4519  H H    . LYS A 1 33 ? 11.062  2.502   5.186   1.00 1.00 ? 33  LYS A H    4  
ATOM   4520  H HA   . LYS A 1 33 ? 12.686  0.366   6.359   1.00 1.00 ? 33  LYS A HA   4  
ATOM   4521  H HB2  . LYS A 1 33 ? 12.675  -0.066  3.906   1.00 1.00 ? 33  LYS A HB2  4  
ATOM   4522  H HB3  . LYS A 1 33 ? 13.335  1.550   3.651   1.00 1.00 ? 33  LYS A HB3  4  
ATOM   4523  H HG2  . LYS A 1 33 ? 15.308  0.990   4.988   1.00 1.00 ? 33  LYS A HG2  4  
ATOM   4524  H HG3  . LYS A 1 33 ? 14.644  -0.607  5.332   1.00 1.00 ? 33  LYS A HG3  4  
ATOM   4525  H HD2  . LYS A 1 33 ? 14.668  -1.136  2.918   1.00 1.00 ? 33  LYS A HD2  4  
ATOM   4526  H HD3  . LYS A 1 33 ? 15.353  0.456   2.583   1.00 1.00 ? 33  LYS A HD3  4  
ATOM   4527  H HE2  . LYS A 1 33 ? 17.326  -0.087  3.946   1.00 1.00 ? 33  LYS A HE2  4  
ATOM   4528  H HE3  . LYS A 1 33 ? 16.641  -1.669  4.323   1.00 1.00 ? 33  LYS A HE3  4  
ATOM   4529  H HZ1  . LYS A 1 33 ? 16.570  -1.352  1.556   1.00 1.00 ? 33  LYS A HZ1  4  
ATOM   4530  H HZ2  . LYS A 1 33 ? 17.516  -2.436  2.460   1.00 1.00 ? 33  LYS A HZ2  4  
ATOM   4531  H HZ3  . LYS A 1 33 ? 18.125  -0.899  2.066   1.00 1.00 ? 33  LYS A HZ3  4  
ATOM   4532  N N    . LEU A 1 34 ? 14.326  2.054   7.176   1.00 1.00 ? 34  LEU A N    4  
ATOM   4533  C CA   . LEU A 1 34 ? 15.155  3.082   7.802   1.00 1.00 ? 34  LEU A CA   4  
ATOM   4534  C C    . LEU A 1 34 ? 16.539  3.112   7.162   1.00 1.00 ? 34  LEU A C    4  
ATOM   4535  O O    . LEU A 1 34 ? 17.135  2.068   6.892   1.00 1.00 ? 34  LEU A O    4  
ATOM   4536  C CB   . LEU A 1 34 ? 15.289  2.798   9.300   1.00 1.00 ? 34  LEU A CB   4  
ATOM   4537  C CG   . LEU A 1 34 ? 13.897  2.721   9.941   1.00 1.00 ? 34  LEU A CG   4  
ATOM   4538  C CD1  . LEU A 1 34 ? 14.047  2.384   11.429  1.00 1.00 ? 34  LEU A CD1  4  
ATOM   4539  C CD2  . LEU A 1 34 ? 13.163  4.065   9.781   1.00 1.00 ? 34  LEU A CD2  4  
ATOM   4540  H H    . LEU A 1 34 ? 14.417  1.123   7.468   1.00 1.00 ? 34  LEU A H    4  
ATOM   4541  H HA   . LEU A 1 34 ? 14.691  4.050   7.669   1.00 1.00 ? 34  LEU A HA   4  
ATOM   4542  H HB2  . LEU A 1 34 ? 15.803  1.859   9.442   1.00 1.00 ? 34  LEU A HB2  4  
ATOM   4543  H HB3  . LEU A 1 34 ? 15.854  3.592   9.767   1.00 1.00 ? 34  LEU A HB3  4  
ATOM   4544  H HG   . LEU A 1 34 ? 13.328  1.939   9.456   1.00 1.00 ? 34  LEU A HG   4  
ATOM   4545  H HD11 . LEU A 1 34 ? 13.089  2.481   11.917  1.00 1.00 ? 34  LEU A HD11 4  
ATOM   4546  H HD12 . LEU A 1 34 ? 14.754  3.063   11.883  1.00 1.00 ? 34  LEU A HD12 4  
ATOM   4547  H HD13 . LEU A 1 34 ? 14.404  1.370   11.532  1.00 1.00 ? 34  LEU A HD13 4  
ATOM   4548  H HD21 . LEU A 1 34 ? 13.868  4.880   9.850   1.00 1.00 ? 34  LEU A HD21 4  
ATOM   4549  H HD22 . LEU A 1 34 ? 12.418  4.168   10.559  1.00 1.00 ? 34  LEU A HD22 4  
ATOM   4550  H HD23 . LEU A 1 34 ? 12.675  4.093   8.819   1.00 1.00 ? 34  LEU A HD23 4  
ATOM   4551  N N    . GLY A 1 35 ? 17.041  4.318   6.917   1.00 1.00 ? 35  GLY A N    4  
ATOM   4552  C CA   . GLY A 1 35 ? 18.354  4.485   6.304   1.00 1.00 ? 35  GLY A CA   4  
ATOM   4553  C C    . GLY A 1 35 ? 18.254  4.415   4.784   1.00 1.00 ? 35  GLY A C    4  
ATOM   4554  O O    . GLY A 1 35 ? 19.267  4.413   4.085   1.00 1.00 ? 35  GLY A O    4  
ATOM   4555  H H    . GLY A 1 35 ? 16.518  5.111   7.152   1.00 1.00 ? 35  GLY A H    4  
ATOM   4556  H HA2  . GLY A 1 35 ? 18.757  5.446   6.590   1.00 1.00 ? 35  GLY A HA2  4  
ATOM   4557  H HA3  . GLY A 1 35 ? 19.016  3.705   6.650   1.00 1.00 ? 35  GLY A HA3  4  
ATOM   4558  N N    . ALA A 1 36 ? 17.027  4.361   4.278   1.00 1.00 ? 36  ALA A N    4  
ATOM   4559  C CA   . ALA A 1 36 ? 16.804  4.292   2.837   1.00 1.00 ? 36  ALA A CA   4  
ATOM   4560  C C    . ALA A 1 36 ? 17.200  5.606   2.171   1.00 1.00 ? 36  ALA A C    4  
ATOM   4561  O O    . ALA A 1 36 ? 17.057  6.678   2.757   1.00 1.00 ? 36  ALA A O    4  
ATOM   4562  C CB   . ALA A 1 36 ? 15.332  3.996   2.547   1.00 1.00 ? 36  ALA A CB   4  
ATOM   4563  H H    . ALA A 1 36 ? 16.255  4.366   4.884   1.00 1.00 ? 36  ALA A H    4  
ATOM   4564  H HA   . ALA A 1 36 ? 17.407  3.496   2.427   1.00 1.00 ? 36  ALA A HA   4  
ATOM   4565  H HB1  . ALA A 1 36 ? 15.206  3.790   1.494   1.00 1.00 ? 36  ALA A HB1  4  
ATOM   4566  H HB2  . ALA A 1 36 ? 14.731  4.850   2.820   1.00 1.00 ? 36  ALA A HB2  4  
ATOM   4567  H HB3  . ALA A 1 36 ? 15.018  3.136   3.120   1.00 1.00 ? 36  ALA A HB3  4  
ATOM   4568  N N    . ASP A 1 37 ? 17.699  5.512   0.943   1.00 1.00 ? 37  ASP A N    4  
ATOM   4569  C CA   . ASP A 1 37 ? 18.116  6.700   0.206   1.00 1.00 ? 37  ASP A CA   4  
ATOM   4570  C C    . ASP A 1 37 ? 16.925  7.623   -0.040  1.00 1.00 ? 37  ASP A C    4  
ATOM   4571  O O    . ASP A 1 37 ? 17.038  8.844   0.083   1.00 1.00 ? 37  ASP A O    4  
ATOM   4572  C CB   . ASP A 1 37 ? 18.731  6.292   -1.135  1.00 1.00 ? 37  ASP A CB   4  
ATOM   4573  C CG   . ASP A 1 37 ? 20.100  5.657   -0.909  1.00 1.00 ? 37  ASP A CG   4  
ATOM   4574  O OD1  . ASP A 1 37 ? 20.626  5.800   0.183   1.00 1.00 ? 37  ASP A OD1  4  
ATOM   4575  O OD2  . ASP A 1 37 ? 20.602  5.036   -1.832  1.00 1.00 ? 37  ASP A OD2  4  
ATOM   4576  H H    . ASP A 1 37 ? 17.792  4.630   0.526   1.00 1.00 ? 37  ASP A H    4  
ATOM   4577  H HA   . ASP A 1 37 ? 18.856  7.229   0.783   1.00 1.00 ? 37  ASP A HA   4  
ATOM   4578  H HB2  . ASP A 1 37 ? 18.083  5.584   -1.626  1.00 1.00 ? 37  ASP A HB2  4  
ATOM   4579  H HB3  . ASP A 1 37 ? 18.842  7.168   -1.757  1.00 1.00 ? 37  ASP A HB3  4  
ATOM   4580  N N    . SER A 1 38 ? 15.784  7.033   -0.387  1.00 1.00 ? 38  SER A N    4  
ATOM   4581  C CA   . SER A 1 38 ? 14.574  7.809   -0.650  1.00 1.00 ? 38  SER A CA   4  
ATOM   4582  C C    . SER A 1 38 ? 13.331  6.977   -0.352  1.00 1.00 ? 38  SER A C    4  
ATOM   4583  O O    . SER A 1 38 ? 13.368  5.747   -0.406  1.00 1.00 ? 38  SER A O    4  
ATOM   4584  C CB   . SER A 1 38 ? 14.549  8.261   -2.110  1.00 1.00 ? 38  SER A CB   4  
ATOM   4585  H H    . SER A 1 38 ? 15.755  6.057   -0.469  1.00 1.00 ? 38  SER A H    4  
ATOM   4586  H HA   . SER A 1 38 ? 14.568  8.683   -0.014  1.00 1.00 ? 38  SER A HA   4  
ATOM   4587  H HB2  . SER A 1 38 ? 13.562  8.631   -2.356  1.00 1.00 ? 38  SER A HB2  4  
ATOM   4588  H HB3  . SER A 1 38 ? 14.788  7.428   -2.751  1.00 1.00 ? 38  SER A HB3  4  
ATOM   4589  N N    . LEU A 1 39 ? 12.235  7.656   -0.033  1.00 1.00 ? 39  LEU A N    4  
ATOM   4590  C CA   . LEU A 1 39 ? 10.988  6.970   0.276   1.00 1.00 ? 39  LEU A CA   4  
ATOM   4591  C C    . LEU A 1 39 ? 10.353  6.421   -0.996  1.00 1.00 ? 39  LEU A C    4  
ATOM   4592  O O    . LEU A 1 39 ? 10.374  7.069   -2.043  1.00 1.00 ? 39  LEU A O    4  
ATOM   4593  C CB   . LEU A 1 39 ? 10.020  7.939   0.957   1.00 1.00 ? 39  LEU A CB   4  
ATOM   4594  C CG   . LEU A 1 39 ? 10.694  8.572   2.181   1.00 1.00 ? 39  LEU A CG   4  
ATOM   4595  C CD1  . LEU A 1 39 ? 9.728   9.566   2.833   1.00 1.00 ? 39  LEU A CD1  4  
ATOM   4596  C CD2  . LEU A 1 39 ? 11.084  7.482   3.195   1.00 1.00 ? 39  LEU A CD2  4  
ATOM   4597  H H    . LEU A 1 39 ? 12.267  8.634   -0.002  1.00 1.00 ? 39  LEU A H    4  
ATOM   4598  H HA   . LEU A 1 39 ? 11.193  6.149   0.946   1.00 1.00 ? 39  LEU A HA   4  
ATOM   4599  H HB2  . LEU A 1 39 ? 9.740   8.715   0.260   1.00 1.00 ? 39  LEU A HB2  4  
ATOM   4600  H HB3  . LEU A 1 39 ? 9.137   7.403   1.273   1.00 1.00 ? 39  LEU A HB3  4  
ATOM   4601  H HG   . LEU A 1 39 ? 11.582  9.100   1.861   1.00 1.00 ? 39  LEU A HG   4  
ATOM   4602  H HD11 . LEU A 1 39 ? 9.405   10.288  2.098   1.00 1.00 ? 39  LEU A HD11 4  
ATOM   4603  H HD12 . LEU A 1 39 ? 10.229  10.077  3.643   1.00 1.00 ? 39  LEU A HD12 4  
ATOM   4604  H HD13 . LEU A 1 39 ? 8.869   9.036   3.219   1.00 1.00 ? 39  LEU A HD13 4  
ATOM   4605  H HD21 . LEU A 1 39 ? 11.175  7.917   4.181   1.00 1.00 ? 39  LEU A HD21 4  
ATOM   4606  H HD22 . LEU A 1 39 ? 12.033  7.051   2.911   1.00 1.00 ? 39  LEU A HD22 4  
ATOM   4607  H HD23 . LEU A 1 39 ? 10.328  6.710   3.211   1.00 1.00 ? 39  LEU A HD23 4  
ATOM   4608  N N    . ASP A 1 40 ? 9.787   5.220   -0.897  1.00 1.00 ? 40  ASP A N    4  
ATOM   4609  C CA   . ASP A 1 40 ? 9.143   4.580   -2.043  1.00 1.00 ? 40  ASP A CA   4  
ATOM   4610  C C    . ASP A 1 40 ? 7.651   4.895   -2.057  1.00 1.00 ? 40  ASP A C    4  
ATOM   4611  O O    . ASP A 1 40 ? 6.898   4.346   -2.858  1.00 1.00 ? 40  ASP A O    4  
ATOM   4612  C CB   . ASP A 1 40 ? 9.346   3.064   -1.976  1.00 1.00 ? 40  ASP A CB   4  
ATOM   4613  C CG   . ASP A 1 40 ? 10.831  2.734   -2.065  1.00 1.00 ? 40  ASP A CG   4  
ATOM   4614  O OD1  . ASP A 1 40 ? 11.569  3.551   -2.591  1.00 1.00 ? 40  ASP A OD1  4  
ATOM   4615  O OD2  . ASP A 1 40 ? 11.210  1.669   -1.607  1.00 1.00 ? 40  ASP A OD2  4  
ATOM   4616  H H    . ASP A 1 40 ? 9.803   4.754   -0.036  1.00 1.00 ? 40  ASP A H    4  
ATOM   4617  H HA   . ASP A 1 40 ? 9.588   4.949   -2.957  1.00 1.00 ? 40  ASP A HA   4  
ATOM   4618  H HB2  . ASP A 1 40 ? 8.949   2.690   -1.044  1.00 1.00 ? 40  ASP A HB2  4  
ATOM   4619  H HB3  . ASP A 1 40 ? 8.827   2.598   -2.799  1.00 1.00 ? 40  ASP A HB3  4  
ATOM   4620  N N    . THR A 1 41 ? 7.234   5.788   -1.165  1.00 1.00 ? 41  THR A N    4  
ATOM   4621  C CA   . THR A 1 41 ? 5.830   6.173   -1.085  1.00 1.00 ? 41  THR A CA   4  
ATOM   4622  C C    . THR A 1 41 ? 5.312   6.570   -2.460  1.00 1.00 ? 41  THR A C    4  
ATOM   4623  O O    . THR A 1 41 ? 4.195   6.224   -2.827  1.00 1.00 ? 41  THR A O    4  
ATOM   4624  C CB   . THR A 1 41 ? 5.657   7.343   -0.111  1.00 1.00 ? 41  THR A CB   4  
ATOM   4625  O OG1  . THR A 1 41 ? 6.307   7.035   1.114   1.00 1.00 ? 41  THR A OG1  4  
ATOM   4626  C CG2  . THR A 1 41 ? 4.168   7.590   0.147   1.00 1.00 ? 41  THR A CG2  4  
ATOM   4627  H H    . THR A 1 41 ? 7.881   6.196   -0.552  1.00 1.00 ? 41  THR A H    4  
ATOM   4628  H HA   . THR A 1 41 ? 5.258   5.331   -0.724  1.00 1.00 ? 41  THR A HA   4  
ATOM   4629  H HB   . THR A 1 41 ? 6.095   8.232   -0.535  1.00 1.00 ? 41  THR A HB   4  
ATOM   4630  H HG1  . THR A 1 41 ? 7.222   6.825   0.920   1.00 1.00 ? 41  THR A HG1  4  
ATOM   4631  H HG21 . THR A 1 41 ? 3.678   6.655   0.377   1.00 1.00 ? 41  THR A HG21 4  
ATOM   4632  H HG22 . THR A 1 41 ? 3.714   8.027   -0.732  1.00 1.00 ? 41  THR A HG22 4  
ATOM   4633  H HG23 . THR A 1 41 ? 4.059   8.267   0.980   1.00 1.00 ? 41  THR A HG23 4  
ATOM   4634  N N    . VAL A 1 42 ? 6.134   7.298   -3.215  1.00 1.00 ? 42  VAL A N    4  
ATOM   4635  C CA   . VAL A 1 42 ? 5.749   7.736   -4.554  1.00 1.00 ? 42  VAL A CA   4  
ATOM   4636  C C    . VAL A 1 42 ? 5.545   6.535   -5.476  1.00 1.00 ? 42  VAL A C    4  
ATOM   4637  O O    . VAL A 1 42 ? 4.600   6.489   -6.258  1.00 1.00 ? 42  VAL A O    4  
ATOM   4638  C CB   . VAL A 1 42 ? 6.833   8.644   -5.137  1.00 1.00 ? 42  VAL A CB   4  
ATOM   4639  C CG1  . VAL A 1 42 ? 6.464   9.027   -6.571  1.00 1.00 ? 42  VAL A CG1  4  
ATOM   4640  C CG2  . VAL A 1 42 ? 6.948   9.909   -4.283  1.00 1.00 ? 42  VAL A CG2  4  
ATOM   4641  H H    . VAL A 1 42 ? 7.015   7.543   -2.865  1.00 1.00 ? 42  VAL A H    4  
ATOM   4642  H HA   . VAL A 1 42 ? 4.826   8.293   -4.491  1.00 1.00 ? 42  VAL A HA   4  
ATOM   4643  H HB   . VAL A 1 42 ? 7.779   8.121   -5.136  1.00 1.00 ? 42  VAL A HB   4  
ATOM   4644  H HG11 . VAL A 1 42 ? 6.589   8.171   -7.217  1.00 1.00 ? 42  VAL A HG11 4  
ATOM   4645  H HG12 . VAL A 1 42 ? 7.106   9.828   -6.907  1.00 1.00 ? 42  VAL A HG12 4  
ATOM   4646  H HG13 . VAL A 1 42 ? 5.435   9.354   -6.603  1.00 1.00 ? 42  VAL A HG13 4  
ATOM   4647  H HG21 . VAL A 1 42 ? 7.684   10.571  -4.717  1.00 1.00 ? 42  VAL A HG21 4  
ATOM   4648  H HG22 . VAL A 1 42 ? 7.249   9.641   -3.282  1.00 1.00 ? 42  VAL A HG22 4  
ATOM   4649  H HG23 . VAL A 1 42 ? 5.991   10.409  -4.249  1.00 1.00 ? 42  VAL A HG23 4  
ATOM   4650  N N    . GLU A 1 43 ? 6.450   5.573   -5.395  1.00 1.00 ? 43  GLU A N    4  
ATOM   4651  C CA   . GLU A 1 43 ? 6.345   4.383   -6.223  1.00 1.00 ? 43  GLU A CA   4  
ATOM   4652  C C    . GLU A 1 43 ? 5.251   3.447   -5.695  1.00 1.00 ? 43  GLU A C    4  
ATOM   4653  O O    . GLU A 1 43 ? 4.511   2.843   -6.470  1.00 1.00 ? 43  GLU A O    4  
ATOM   4654  C CB   . GLU A 1 43 ? 7.682   3.640   -6.253  1.00 1.00 ? 43  GLU A CB   4  
ATOM   4655  C CG   . GLU A 1 43 ? 7.641   2.556   -7.334  1.00 1.00 ? 43  GLU A CG   4  
ATOM   4656  C CD   . GLU A 1 43 ? 7.675   3.202   -8.717  1.00 1.00 ? 43  GLU A CD   4  
ATOM   4657  O OE1  . GLU A 1 43 ? 7.858   4.405   -8.784  1.00 1.00 ? 43  GLU A OE1  4  
ATOM   4658  O OE2  . GLU A 1 43 ? 7.515   2.480   -9.688  1.00 1.00 ? 43  GLU A OE2  4  
ATOM   4659  H H    . GLU A 1 43 ? 7.197   5.663   -4.770  1.00 1.00 ? 43  GLU A H    4  
ATOM   4660  H HA   . GLU A 1 43 ? 6.091   4.679   -7.230  1.00 1.00 ? 43  GLU A HA   4  
ATOM   4661  H HB2  . GLU A 1 43 ? 8.477   4.339   -6.472  1.00 1.00 ? 43  GLU A HB2  4  
ATOM   4662  H HB3  . GLU A 1 43 ? 7.862   3.181   -5.293  1.00 1.00 ? 43  GLU A HB3  4  
ATOM   4663  H HG2  . GLU A 1 43 ? 8.494   1.904   -7.223  1.00 1.00 ? 43  GLU A HG2  4  
ATOM   4664  H HG3  . GLU A 1 43 ? 6.734   1.978   -7.232  1.00 1.00 ? 43  GLU A HG3  4  
ATOM   4665  N N    . ILE A 1 44 ? 5.191   3.305   -4.368  1.00 1.00 ? 44  ILE A N    4  
ATOM   4666  C CA   . ILE A 1 44 ? 4.220   2.406   -3.738  1.00 1.00 ? 44  ILE A CA   4  
ATOM   4667  C C    . ILE A 1 44 ? 2.784   2.875   -3.968  1.00 1.00 ? 44  ILE A C    4  
ATOM   4668  O O    . ILE A 1 44 ? 1.908   2.073   -4.286  1.00 1.00 ? 44  ILE A O    4  
ATOM   4669  C CB   . ILE A 1 44 ? 4.484   2.330   -2.223  1.00 1.00 ? 44  ILE A CB   4  
ATOM   4670  C CG1  . ILE A 1 44 ? 5.855   1.673   -1.946  1.00 1.00 ? 44  ILE A CG1  4  
ATOM   4671  C CG2  . ILE A 1 44 ? 3.373   1.520   -1.539  1.00 1.00 ? 44  ILE A CG2  4  
ATOM   4672  C CD1  . ILE A 1 44 ? 5.780   0.138   -2.013  1.00 1.00 ? 44  ILE A CD1  4  
ATOM   4673  H H    . ILE A 1 44 ? 5.828   3.793   -3.804  1.00 1.00 ? 44  ILE A H    4  
ATOM   4674  H HA   . ILE A 1 44 ? 4.332   1.425   -4.164  1.00 1.00 ? 44  ILE A HA   4  
ATOM   4675  H HB   . ILE A 1 44 ? 4.484   3.333   -1.818  1.00 1.00 ? 44  ILE A HB   4  
ATOM   4676  H HG12 . ILE A 1 44 ? 6.568   2.023   -2.673  1.00 1.00 ? 44  ILE A HG12 4  
ATOM   4677  H HG13 . ILE A 1 44 ? 6.187   1.961   -0.963  1.00 1.00 ? 44  ILE A HG13 4  
ATOM   4678  H HG21 . ILE A 1 44 ? 3.144   0.647   -2.134  1.00 1.00 ? 44  ILE A HG21 4  
ATOM   4679  H HG22 . ILE A 1 44 ? 2.492   2.132   -1.446  1.00 1.00 ? 44  ILE A HG22 4  
ATOM   4680  H HG23 . ILE A 1 44 ? 3.702   1.209   -0.558  1.00 1.00 ? 44  ILE A HG23 4  
ATOM   4681  H HD11 . ILE A 1 44 ? 5.113   -0.172  -2.800  1.00 1.00 ? 44  ILE A HD11 4  
ATOM   4682  H HD12 . ILE A 1 44 ? 5.418   -0.241  -1.071  1.00 1.00 ? 44  ILE A HD12 4  
ATOM   4683  H HD13 . ILE A 1 44 ? 6.767   -0.260  -2.200  1.00 1.00 ? 44  ILE A HD13 4  
ATOM   4684  N N    . VAL A 1 45 ? 2.544   4.168   -3.799  1.00 1.00 ? 45  VAL A N    4  
ATOM   4685  C CA   . VAL A 1 45 ? 1.205   4.707   -3.982  1.00 1.00 ? 45  VAL A CA   4  
ATOM   4686  C C    . VAL A 1 45 ? 0.732   4.480   -5.407  1.00 1.00 ? 45  VAL A C    4  
ATOM   4687  O O    . VAL A 1 45 ? -0.423  4.128   -5.643  1.00 1.00 ? 45  VAL A O    4  
ATOM   4688  C CB   . VAL A 1 45 ? 1.199   6.206   -3.674  1.00 1.00 ? 45  VAL A CB   4  
ATOM   4689  C CG1  . VAL A 1 45 ? 2.166   6.927   -4.620  1.00 1.00 ? 45  VAL A CG1  4  
ATOM   4690  C CG2  . VAL A 1 45 ? -0.214  6.764   -3.862  1.00 1.00 ? 45  VAL A CG2  4  
ATOM   4691  H H    . VAL A 1 45 ? 3.278   4.767   -3.536  1.00 1.00 ? 45  VAL A H    4  
ATOM   4692  H HA   . VAL A 1 45 ? 0.529   4.208   -3.302  1.00 1.00 ? 45  VAL A HA   4  
ATOM   4693  H HB   . VAL A 1 45 ? 1.517   6.361   -2.652  1.00 1.00 ? 45  VAL A HB   4  
ATOM   4694  H HG11 . VAL A 1 45 ? 3.020   6.305   -4.787  1.00 1.00 ? 45  VAL A HG11 4  
ATOM   4695  H HG12 . VAL A 1 45 ? 2.482   7.858   -4.174  1.00 1.00 ? 45  VAL A HG12 4  
ATOM   4696  H HG13 . VAL A 1 45 ? 1.677   7.128   -5.565  1.00 1.00 ? 45  VAL A HG13 4  
ATOM   4697  H HG21 . VAL A 1 45 ? -0.415  6.890   -4.919  1.00 1.00 ? 45  VAL A HG21 4  
ATOM   4698  H HG22 . VAL A 1 45 ? -0.290  7.720   -3.365  1.00 1.00 ? 45  VAL A HG22 4  
ATOM   4699  H HG23 . VAL A 1 45 ? -0.931  6.080   -3.438  1.00 1.00 ? 45  VAL A HG23 4  
ATOM   4700  N N    . MET A 1 46 ? 1.632   4.688   -6.354  1.00 1.00 ? 46  MET A N    4  
ATOM   4701  C CA   . MET A 1 46 ? 1.294   4.508   -7.756  1.00 1.00 ? 46  MET A CA   4  
ATOM   4702  C C    . MET A 1 46 ? 0.954   3.049   -8.046  1.00 1.00 ? 46  MET A C    4  
ATOM   4703  O O    . MET A 1 46 ? 0.032   2.758   -8.806  1.00 1.00 ? 46  MET A O    4  
ATOM   4704  C CB   . MET A 1 46 ? 2.461   4.961   -8.644  1.00 1.00 ? 46  MET A CB   4  
ATOM   4705  C CG   . MET A 1 46 ? 2.559   6.501   -8.705  1.00 1.00 ? 46  MET A CG   4  
ATOM   4706  S SD   . MET A 1 46 ? 1.006   7.247   -9.283  1.00 1.00 ? 46  MET A SD   4  
ATOM   4707  C CE   . MET A 1 46 ? 0.840   6.316   -10.823 1.00 1.00 ? 46  MET A CE   4  
ATOM   4708  H H    . MET A 1 46 ? 2.539   4.969   -6.107  1.00 1.00 ? 46  MET A H    4  
ATOM   4709  H HA   . MET A 1 46 ? 0.427   5.103   -7.975  1.00 1.00 ? 46  MET A HA   4  
ATOM   4710  H HB2  . MET A 1 46 ? 3.381   4.571   -8.231  1.00 1.00 ? 46  MET A HB2  4  
ATOM   4711  H HB3  . MET A 1 46 ? 2.332   4.568   -9.639  1.00 1.00 ? 46  MET A HB3  4  
ATOM   4712  H HG2  . MET A 1 46 ? 2.783   6.882   -7.722  1.00 1.00 ? 46  MET A HG2  4  
ATOM   4713  H HG3  . MET A 1 46 ? 3.357   6.774   -9.379  1.00 1.00 ? 46  MET A HG3  4  
ATOM   4714  H HE1  . MET A 1 46 ? 0.218   6.867   -11.511 1.00 1.00 ? 46  MET A HE1  4  
ATOM   4715  H HE2  . MET A 1 46 ? 0.381   5.357   -10.614 1.00 1.00 ? 46  MET A HE2  4  
ATOM   4716  H HE3  . MET A 1 46 ? 1.818   6.160   -11.256 1.00 1.00 ? 46  MET A HE3  4  
ATOM   4717  N N    . ASN A 1 47 ? 1.696   2.133   -7.443  1.00 1.00 ? 47  ASN A N    4  
ATOM   4718  C CA   . ASN A 1 47 ? 1.444   0.721   -7.661  1.00 1.00 ? 47  ASN A CA   4  
ATOM   4719  C C    . ASN A 1 47 ? 0.031   0.364   -7.199  1.00 1.00 ? 47  ASN A C    4  
ATOM   4720  O O    . ASN A 1 47 ? -0.703  -0.333  -7.899  1.00 1.00 ? 47  ASN A O    4  
ATOM   4721  C CB   . ASN A 1 47 ? 2.488   -0.090  -6.880  1.00 1.00 ? 47  ASN A CB   4  
ATOM   4722  C CG   . ASN A 1 47 ? 3.780   -0.200  -7.682  1.00 1.00 ? 47  ASN A CG   4  
ATOM   4723  O OD1  . ASN A 1 47 ? 4.615   0.706   -7.653  1.00 1.00 ? 47  ASN A OD1  4  
ATOM   4724  N ND2  . ASN A 1 47 ? 3.993   -1.267  -8.395  1.00 1.00 ? 47  ASN A ND2  4  
ATOM   4725  H H    . ASN A 1 47 ? 2.421   2.408   -6.844  1.00 1.00 ? 47  ASN A H    4  
ATOM   4726  H HA   . ASN A 1 47 ? 1.532   0.504   -8.716  1.00 1.00 ? 47  ASN A HA   4  
ATOM   4727  H HB2  . ASN A 1 47 ? 2.694   0.411   -5.943  1.00 1.00 ? 47  ASN A HB2  4  
ATOM   4728  H HB3  . ASN A 1 47 ? 2.114   -1.077  -6.676  1.00 1.00 ? 47  ASN A HB3  4  
ATOM   4729  H HD21 . ASN A 1 47 ? 3.326   -1.985  -8.409  1.00 1.00 ? 47  ASN A HD21 4  
ATOM   4730  H HD22 . ASN A 1 47 ? 4.819   -1.353  -8.914  1.00 1.00 ? 47  ASN A HD22 4  
ATOM   4731  N N    . LEU A 1 48 ? -0.347  0.858   -6.030  1.00 1.00 ? 48  LEU A N    4  
ATOM   4732  C CA   . LEU A 1 48 ? -1.679  0.598   -5.492  1.00 1.00 ? 48  LEU A CA   4  
ATOM   4733  C C    . LEU A 1 48 ? -2.733  1.355   -6.294  1.00 1.00 ? 48  LEU A C    4  
ATOM   4734  O O    . LEU A 1 48 ? -3.768  0.803   -6.664  1.00 1.00 ? 48  LEU A O    4  
ATOM   4735  C CB   . LEU A 1 48 ? -1.735  1.024   -4.019  1.00 1.00 ? 48  LEU A CB   4  
ATOM   4736  C CG   . LEU A 1 48 ? -0.563  0.386   -3.244  1.00 1.00 ? 48  LEU A CG   4  
ATOM   4737  C CD1  . LEU A 1 48 ? -0.312  1.162   -1.955  1.00 1.00 ? 48  LEU A CD1  4  
ATOM   4738  C CD2  . LEU A 1 48 ? -0.902  -1.060  -2.881  1.00 1.00 ? 48  LEU A CD2  4  
ATOM   4739  H H    . LEU A 1 48 ? 0.277   1.415   -5.520  1.00 1.00 ? 48  LEU A H    4  
ATOM   4740  H HA   . LEU A 1 48 ? -1.888  -0.454  -5.562  1.00 1.00 ? 48  LEU A HA   4  
ATOM   4741  H HB2  . LEU A 1 48 ? -1.665  2.101   -3.960  1.00 1.00 ? 48  LEU A HB2  4  
ATOM   4742  H HB3  . LEU A 1 48 ? -2.676  0.701   -3.584  1.00 1.00 ? 48  LEU A HB3  4  
ATOM   4743  H HG   . LEU A 1 48 ? 0.331   0.403   -3.847  1.00 1.00 ? 48  LEU A HG   4  
ATOM   4744  H HD11 . LEU A 1 48 ? -0.153  2.204   -2.184  1.00 1.00 ? 48  LEU A HD11 4  
ATOM   4745  H HD12 . LEU A 1 48 ? 0.562   0.765   -1.461  1.00 1.00 ? 48  LEU A HD12 4  
ATOM   4746  H HD13 . LEU A 1 48 ? -1.165  1.060   -1.309  1.00 1.00 ? 48  LEU A HD13 4  
ATOM   4747  H HD21 . LEU A 1 48 ? -0.091  -1.481  -2.309  1.00 1.00 ? 48  LEU A HD21 4  
ATOM   4748  H HD22 . LEU A 1 48 ? -1.049  -1.640  -3.775  1.00 1.00 ? 48  LEU A HD22 4  
ATOM   4749  H HD23 . LEU A 1 48 ? -1.801  -1.075  -2.293  1.00 1.00 ? 48  LEU A HD23 4  
ATOM   4750  N N    . GLU A 1 49 ? -2.457  2.622   -6.569  1.00 1.00 ? 49  GLU A N    4  
ATOM   4751  C CA   . GLU A 1 49 ? -3.391  3.438   -7.327  1.00 1.00 ? 49  GLU A CA   4  
ATOM   4752  C C    . GLU A 1 49 ? -3.549  2.870   -8.733  1.00 1.00 ? 49  GLU A C    4  
ATOM   4753  O O    . GLU A 1 49 ? -4.655  2.816   -9.271  1.00 1.00 ? 49  GLU A O    4  
ATOM   4754  C CB   . GLU A 1 49 ? -2.880  4.876   -7.403  1.00 1.00 ? 49  GLU A CB   4  
ATOM   4755  C CG   . GLU A 1 49 ? -3.969  5.773   -7.993  1.00 1.00 ? 49  GLU A CG   4  
ATOM   4756  C CD   . GLU A 1 49 ? -3.449  7.200   -8.130  1.00 1.00 ? 49  GLU A CD   4  
ATOM   4757  O OE1  . GLU A 1 49 ? -2.443  7.504   -7.510  1.00 1.00 ? 49  GLU A OE1  4  
ATOM   4758  O OE2  . GLU A 1 49 ? -4.059  7.964   -8.858  1.00 1.00 ? 49  GLU A OE2  4  
ATOM   4759  H H    . GLU A 1 49 ? -1.618  3.013   -6.256  1.00 1.00 ? 49  GLU A H    4  
ATOM   4760  H HA   . GLU A 1 49 ? -4.349  3.432   -6.834  1.00 1.00 ? 49  GLU A HA   4  
ATOM   4761  H HB2  . GLU A 1 49 ? -2.628  5.219   -6.410  1.00 1.00 ? 49  GLU A HB2  4  
ATOM   4762  H HB3  . GLU A 1 49 ? -2.004  4.916   -8.032  1.00 1.00 ? 49  GLU A HB3  4  
ATOM   4763  H HG2  . GLU A 1 49 ? -4.258  5.397   -8.964  1.00 1.00 ? 49  GLU A HG2  4  
ATOM   4764  H HG3  . GLU A 1 49 ? -4.830  5.769   -7.333  1.00 1.00 ? 49  GLU A HG3  4  
ATOM   4765  N N    . GLU A 1 50 ? -2.436  2.444   -9.322  1.00 1.00 ? 50  GLU A N    4  
ATOM   4766  C CA   . GLU A 1 50 ? -2.463  1.877   -10.665 1.00 1.00 ? 50  GLU A CA   4  
ATOM   4767  C C    . GLU A 1 50 ? -3.129  0.499   -10.660 1.00 1.00 ? 50  GLU A C    4  
ATOM   4768  O O    . GLU A 1 50 ? -3.948  0.195   -11.527 1.00 1.00 ? 50  GLU A O    4  
ATOM   4769  C CB   . GLU A 1 50 ? -1.040  1.758   -11.217 1.00 1.00 ? 50  GLU A CB   4  
ATOM   4770  C CG   . GLU A 1 50 ? -1.093  1.414   -12.708 1.00 1.00 ? 50  GLU A CG   4  
ATOM   4771  C CD   . GLU A 1 50 ? -1.610  2.611   -13.502 1.00 1.00 ? 50  GLU A CD   4  
ATOM   4772  O OE1  . GLU A 1 50 ? -1.749  3.670   -12.914 1.00 1.00 ? 50  GLU A OE1  4  
ATOM   4773  O OE2  . GLU A 1 50 ? -1.861  2.449   -14.685 1.00 1.00 ? 50  GLU A OE2  4  
ATOM   4774  H H    . GLU A 1 50 ? -1.583  2.511   -8.845  1.00 1.00 ? 50  GLU A H    4  
ATOM   4775  H HA   . GLU A 1 50 ? -3.028  2.531   -11.306 1.00 1.00 ? 50  GLU A HA   4  
ATOM   4776  H HB2  . GLU A 1 50 ? -0.523  2.697   -11.083 1.00 1.00 ? 50  GLU A HB2  4  
ATOM   4777  H HB3  . GLU A 1 50 ? -0.512  0.978   -10.689 1.00 1.00 ? 50  GLU A HB3  4  
ATOM   4778  H HG2  . GLU A 1 50 ? -0.100  1.162   -13.053 1.00 1.00 ? 50  GLU A HG2  4  
ATOM   4779  H HG3  . GLU A 1 50 ? -1.750  0.573   -12.863 1.00 1.00 ? 50  GLU A HG3  4  
ATOM   4780  N N    . GLU A 1 51 ? -2.768  -0.332  -9.683  1.00 1.00 ? 51  GLU A N    4  
ATOM   4781  C CA   . GLU A 1 51 ? -3.336  -1.675  -9.586  1.00 1.00 ? 51  GLU A CA   4  
ATOM   4782  C C    . GLU A 1 51 ? -4.837  -1.604  -9.328  1.00 1.00 ? 51  GLU A C    4  
ATOM   4783  O O    . GLU A 1 51 ? -5.637  -2.119  -10.110 1.00 1.00 ? 51  GLU A O    4  
ATOM   4784  C CB   . GLU A 1 51 ? -2.658  -2.442  -8.445  1.00 1.00 ? 51  GLU A CB   4  
ATOM   4785  C CG   . GLU A 1 51 ? -3.108  -3.905  -8.454  1.00 1.00 ? 51  GLU A CG   4  
ATOM   4786  C CD   . GLU A 1 51 ? -2.512  -4.623  -9.659  1.00 1.00 ? 51  GLU A CD   4  
ATOM   4787  O OE1  . GLU A 1 51 ? -1.682  -4.027  -10.325 1.00 1.00 ? 51  GLU A OE1  4  
ATOM   4788  O OE2  . GLU A 1 51 ? -2.891  -5.758  -9.896  1.00 1.00 ? 51  GLU A OE2  4  
ATOM   4789  H H    . GLU A 1 51 ? -2.105  -0.042  -9.020  1.00 1.00 ? 51  GLU A H    4  
ATOM   4790  H HA   . GLU A 1 51 ? -3.163  -2.201  -10.512 1.00 1.00 ? 51  GLU A HA   4  
ATOM   4791  H HB2  . GLU A 1 51 ? -1.586  -2.398  -8.574  1.00 1.00 ? 51  GLU A HB2  4  
ATOM   4792  H HB3  . GLU A 1 51 ? -2.925  -1.991  -7.502  1.00 1.00 ? 51  GLU A HB3  4  
ATOM   4793  H HG2  . GLU A 1 51 ? -2.771  -4.387  -7.548  1.00 1.00 ? 51  GLU A HG2  4  
ATOM   4794  H HG3  . GLU A 1 51 ? -4.186  -3.956  -8.504  1.00 1.00 ? 51  GLU A HG3  4  
ATOM   4795  N N    . PHE A 1 52 ? -5.211  -0.958  -8.231  1.00 1.00 ? 52  PHE A N    4  
ATOM   4796  C CA   . PHE A 1 52 ? -6.619  -0.820  -7.881  1.00 1.00 ? 52  PHE A CA   4  
ATOM   4797  C C    . PHE A 1 52 ? -7.345  0.039   -8.909  1.00 1.00 ? 52  PHE A C    4  
ATOM   4798  O O    . PHE A 1 52 ? -8.512  -0.198  -9.217  1.00 1.00 ? 52  PHE A O    4  
ATOM   4799  C CB   . PHE A 1 52 ? -6.766  -0.205  -6.486  1.00 1.00 ? 52  PHE A CB   4  
ATOM   4800  C CG   . PHE A 1 52 ? -6.351  -1.218  -5.438  1.00 1.00 ? 52  PHE A CG   4  
ATOM   4801  C CD1  . PHE A 1 52 ? -7.082  -2.408  -5.279  1.00 1.00 ? 52  PHE A CD1  4  
ATOM   4802  C CD2  . PHE A 1 52 ? -5.240  -0.970  -4.622  1.00 1.00 ? 52  PHE A CD2  4  
ATOM   4803  C CE1  . PHE A 1 52 ? -6.691  -3.343  -4.313  1.00 1.00 ? 52  PHE A CE1  4  
ATOM   4804  C CE2  . PHE A 1 52 ? -4.853  -1.905  -3.660  1.00 1.00 ? 52  PHE A CE2  4  
ATOM   4805  C CZ   . PHE A 1 52 ? -5.581  -3.088  -3.502  1.00 1.00 ? 52  PHE A CZ   4  
ATOM   4806  H H    . PHE A 1 52 ? -4.528  -0.563  -7.647  1.00 1.00 ? 52  PHE A H    4  
ATOM   4807  H HA   . PHE A 1 52 ? -7.069  -1.799  -7.876  1.00 1.00 ? 52  PHE A HA   4  
ATOM   4808  H HB2  . PHE A 1 52 ? -6.133  0.667   -6.417  1.00 1.00 ? 52  PHE A HB2  4  
ATOM   4809  H HB3  . PHE A 1 52 ? -7.792  0.083   -6.322  1.00 1.00 ? 52  PHE A HB3  4  
ATOM   4810  H HD1  . PHE A 1 52 ? -7.941  -2.605  -5.901  1.00 1.00 ? 52  PHE A HD1  4  
ATOM   4811  H HD2  . PHE A 1 52 ? -4.680  -0.057  -4.735  1.00 1.00 ? 52  PHE A HD2  4  
ATOM   4812  H HE1  . PHE A 1 52 ? -7.250  -4.261  -4.192  1.00 1.00 ? 52  PHE A HE1  4  
ATOM   4813  H HE2  . PHE A 1 52 ? -3.993  -1.713  -3.036  1.00 1.00 ? 52  PHE A HE2  4  
ATOM   4814  H HZ   . PHE A 1 52 ? -5.283  -3.803  -2.758  1.00 1.00 ? 52  PHE A HZ   4  
ATOM   4815  N N    . GLY A 1 53 ? -6.646  1.040   -9.433  1.00 1.00 ? 53  GLY A N    4  
ATOM   4816  C CA   . GLY A 1 53 ? -7.237  1.932   -10.425 1.00 1.00 ? 53  GLY A CA   4  
ATOM   4817  C C    . GLY A 1 53 ? -8.029  3.041   -9.747  1.00 1.00 ? 53  GLY A C    4  
ATOM   4818  O O    . GLY A 1 53 ? -9.070  3.473   -10.247 1.00 1.00 ? 53  GLY A O    4  
ATOM   4819  H H    . GLY A 1 53 ? -5.718  1.184   -9.148  1.00 1.00 ? 53  GLY A H    4  
ATOM   4820  H HA2  . GLY A 1 53 ? -6.449  2.369   -11.021 1.00 1.00 ? 53  GLY A HA2  4  
ATOM   4821  H HA3  . GLY A 1 53 ? -7.896  1.367   -11.068 1.00 1.00 ? 53  GLY A HA3  4  
ATOM   4822  N N    . ILE A 1 54 ? -7.528  3.500   -8.602  1.00 1.00 ? 54  ILE A N    4  
ATOM   4823  C CA   . ILE A 1 54 ? -8.184  4.566   -7.840  1.00 1.00 ? 54  ILE A CA   4  
ATOM   4824  C C    . ILE A 1 54 ? -7.378  5.859   -7.929  1.00 1.00 ? 54  ILE A C    4  
ATOM   4825  O O    . ILE A 1 54 ? -6.583  6.043   -8.851  1.00 1.00 ? 54  ILE A O    4  
ATOM   4826  C CB   . ILE A 1 54 ? -8.329  4.137   -6.378  1.00 1.00 ? 54  ILE A CB   4  
ATOM   4827  C CG1  . ILE A 1 54 ? -6.941  3.798   -5.804  1.00 1.00 ? 54  ILE A CG1  4  
ATOM   4828  C CG2  . ILE A 1 54 ? -9.249  2.914   -6.298  1.00 1.00 ? 54  ILE A CG2  4  
ATOM   4829  C CD1  . ILE A 1 54 ? -7.029  3.494   -4.305  1.00 1.00 ? 54  ILE A CD1  4  
ATOM   4830  H H    . ILE A 1 54 ? -6.695  3.113   -8.258  1.00 1.00 ? 54  ILE A H    4  
ATOM   4831  H HA   . ILE A 1 54 ? -9.172  4.743   -8.245  1.00 1.00 ? 54  ILE A HA   4  
ATOM   4832  H HB   . ILE A 1 54 ? -8.763  4.942   -5.818  1.00 1.00 ? 54  ILE A HB   4  
ATOM   4833  H HG12 . ILE A 1 54 ? -6.542  2.941   -6.320  1.00 1.00 ? 54  ILE A HG12 4  
ATOM   4834  H HG13 . ILE A 1 54 ? -6.283  4.638   -5.945  1.00 1.00 ? 54  ILE A HG13 4  
ATOM   4835  H HG21 . ILE A 1 54 ? -9.334  2.584   -5.271  1.00 1.00 ? 54  ILE A HG21 4  
ATOM   4836  H HG22 . ILE A 1 54 ? -8.837  2.118   -6.897  1.00 1.00 ? 54  ILE A HG22 4  
ATOM   4837  H HG23 . ILE A 1 54 ? -10.229 3.176   -6.672  1.00 1.00 ? 54  ILE A HG23 4  
ATOM   4838  H HD11 . ILE A 1 54 ? -7.920  2.930   -4.102  1.00 1.00 ? 54  ILE A HD11 4  
ATOM   4839  H HD12 . ILE A 1 54 ? -7.052  4.418   -3.750  1.00 1.00 ? 54  ILE A HD12 4  
ATOM   4840  H HD13 . ILE A 1 54 ? -6.160  2.916   -4.007  1.00 1.00 ? 54  ILE A HD13 4  
ATOM   4841  N N    . ASN A 1 55 ? -7.593  6.758   -6.965  1.00 1.00 ? 55  ASN A N    4  
ATOM   4842  C CA   . ASN A 1 55 ? -6.888  8.037   -6.930  1.00 1.00 ? 55  ASN A CA   4  
ATOM   4843  C C    . ASN A 1 55 ? -6.417  8.337   -5.512  1.00 1.00 ? 55  ASN A C    4  
ATOM   4844  O O    . ASN A 1 55 ? -7.219  8.641   -4.628  1.00 1.00 ? 55  ASN A O    4  
ATOM   4845  C CB   . ASN A 1 55 ? -7.820  9.149   -7.414  1.00 1.00 ? 55  ASN A CB   4  
ATOM   4846  C CG   . ASN A 1 55 ? -8.965  9.343   -6.424  1.00 1.00 ? 55  ASN A CG   4  
ATOM   4847  O OD1  . ASN A 1 55 ? -9.357  10.475  -6.141  1.00 1.00 ? 55  ASN A OD1  4  
ATOM   4848  N ND2  . ASN A 1 55 ? -9.523  8.301   -5.872  1.00 1.00 ? 55  ASN A ND2  4  
ATOM   4849  H H    . ASN A 1 55 ? -8.240  6.557   -6.262  1.00 1.00 ? 55  ASN A H    4  
ATOM   4850  H HA   . ASN A 1 55 ? -6.026  7.995   -7.581  1.00 1.00 ? 55  ASN A HA   4  
ATOM   4851  H HB2  . ASN A 1 55 ? -7.264  10.068  -7.501  1.00 1.00 ? 55  ASN A HB2  4  
ATOM   4852  H HB3  . ASN A 1 55 ? -8.225  8.883   -8.378  1.00 1.00 ? 55  ASN A HB3  4  
ATOM   4853  H HD21 . ASN A 1 55 ? -9.206  7.399   -6.094  1.00 1.00 ? 55  ASN A HD21 4  
ATOM   4854  H HD22 . ASN A 1 55 ? -10.259 8.417   -5.236  1.00 1.00 ? 55  ASN A HD22 4  
ATOM   4855  N N    . VAL A 1 56 ? -5.105  8.248   -5.294  1.00 1.00 ? 56  VAL A N    4  
ATOM   4856  C CA   . VAL A 1 56 ? -4.533  8.510   -3.974  1.00 1.00 ? 56  VAL A CA   4  
ATOM   4857  C C    . VAL A 1 56 ? -3.840  9.865   -3.960  1.00 1.00 ? 56  VAL A C    4  
ATOM   4858  O O    . VAL A 1 56 ? -3.014  10.161  -4.824  1.00 1.00 ? 56  VAL A O    4  
ATOM   4859  C CB   . VAL A 1 56 ? -3.514  7.424   -3.617  1.00 1.00 ? 56  VAL A CB   4  
ATOM   4860  C CG1  . VAL A 1 56 ? -2.959  7.693   -2.217  1.00 1.00 ? 56  VAL A CG1  4  
ATOM   4861  C CG2  . VAL A 1 56 ? -4.188  6.050   -3.652  1.00 1.00 ? 56  VAL A CG2  4  
ATOM   4862  H H    . VAL A 1 56 ? -4.511  7.999   -6.033  1.00 1.00 ? 56  VAL A H    4  
ATOM   4863  H HA   . VAL A 1 56 ? -5.318  8.508   -3.229  1.00 1.00 ? 56  VAL A HA   4  
ATOM   4864  H HB   . VAL A 1 56 ? -2.703  7.447   -4.333  1.00 1.00 ? 56  VAL A HB   4  
ATOM   4865  H HG11 . VAL A 1 56 ? -3.773  7.941   -1.548  1.00 1.00 ? 56  VAL A HG11 4  
ATOM   4866  H HG12 . VAL A 1 56 ? -2.264  8.518   -2.257  1.00 1.00 ? 56  VAL A HG12 4  
ATOM   4867  H HG13 . VAL A 1 56 ? -2.455  6.813   -1.854  1.00 1.00 ? 56  VAL A HG13 4  
ATOM   4868  H HG21 . VAL A 1 56 ? -4.807  5.972   -4.533  1.00 1.00 ? 56  VAL A HG21 4  
ATOM   4869  H HG22 . VAL A 1 56 ? -4.798  5.925   -2.772  1.00 1.00 ? 56  VAL A HG22 4  
ATOM   4870  H HG23 . VAL A 1 56 ? -3.432  5.278   -3.675  1.00 1.00 ? 56  VAL A HG23 4  
ATOM   4871  N N    . ASP A 1 57 ? -4.182  10.687  -2.972  1.00 1.00 ? 57  ASP A N    4  
ATOM   4872  C CA   . ASP A 1 57 ? -3.590  12.016  -2.842  1.00 1.00 ? 57  ASP A CA   4  
ATOM   4873  C C    . ASP A 1 57 ? -2.351  11.962  -1.953  1.00 1.00 ? 57  ASP A C    4  
ATOM   4874  O O    . ASP A 1 57 ? -2.218  11.073  -1.112  1.00 1.00 ? 57  ASP A O    4  
ATOM   4875  C CB   . ASP A 1 57 ? -4.614  12.986  -2.244  1.00 1.00 ? 57  ASP A CB   4  
ATOM   4876  C CG   . ASP A 1 57 ? -5.702  13.290  -3.268  1.00 1.00 ? 57  ASP A CG   4  
ATOM   4877  O OD1  . ASP A 1 57 ? -5.492  12.993  -4.433  1.00 1.00 ? 57  ASP A OD1  4  
ATOM   4878  O OD2  . ASP A 1 57 ? -6.731  13.815  -2.874  1.00 1.00 ? 57  ASP A OD2  4  
ATOM   4879  H H    . ASP A 1 57 ? -4.846  10.393  -2.314  1.00 1.00 ? 57  ASP A H    4  
ATOM   4880  H HA   . ASP A 1 57 ? -3.301  12.376  -3.820  1.00 1.00 ? 57  ASP A HA   4  
ATOM   4881  H HB2  . ASP A 1 57 ? -5.059  12.540  -1.368  1.00 1.00 ? 57  ASP A HB2  4  
ATOM   4882  H HB3  . ASP A 1 57 ? -4.118  13.904  -1.968  1.00 1.00 ? 57  ASP A HB3  4  
ATOM   4883  N N    . GLU A 1 58 ? -1.449  12.917  -2.146  1.00 1.00 ? 58  GLU A N    4  
ATOM   4884  C CA   . GLU A 1 58 ? -0.226  12.970  -1.355  1.00 1.00 ? 58  GLU A CA   4  
ATOM   4885  C C    . GLU A 1 58 ? -0.552  13.094  0.129   1.00 1.00 ? 58  GLU A C    4  
ATOM   4886  O O    . GLU A 1 58 ? 0.142   12.529  0.974   1.00 1.00 ? 58  GLU A O    4  
ATOM   4887  C CB   . GLU A 1 58 ? 0.622   14.166  -1.799  1.00 1.00 ? 58  GLU A CB   4  
ATOM   4888  C CG   . GLU A 1 58 ? -0.160  15.464  -1.572  1.00 1.00 ? 58  GLU A CG   4  
ATOM   4889  C CD   . GLU A 1 58 ? 0.620   16.650  -2.131  1.00 1.00 ? 58  GLU A CD   4  
ATOM   4890  O OE1  . GLU A 1 58 ? 1.167   16.517  -3.213  1.00 1.00 ? 58  GLU A OE1  4  
ATOM   4891  O OE2  . GLU A 1 58 ? 0.658   17.673  -1.467  1.00 1.00 ? 58  GLU A OE2  4  
ATOM   4892  H H    . GLU A 1 58 ? -1.610  13.599  -2.830  1.00 1.00 ? 58  GLU A H    4  
ATOM   4893  H HA   . GLU A 1 58 ? 0.340   12.061  -1.517  1.00 1.00 ? 58  GLU A HA   4  
ATOM   4894  H HB2  . GLU A 1 58 ? 1.536   14.191  -1.224  1.00 1.00 ? 58  GLU A HB2  4  
ATOM   4895  H HB3  . GLU A 1 58 ? 0.859   14.071  -2.848  1.00 1.00 ? 58  GLU A HB3  4  
ATOM   4896  H HG2  . GLU A 1 58 ? -1.116  15.398  -2.070  1.00 1.00 ? 58  GLU A HG2  4  
ATOM   4897  H HG3  . GLU A 1 58 ? -0.316  15.610  -0.514  1.00 1.00 ? 58  GLU A HG3  4  
ATOM   4898  N N    . ASP A 1 59 ? -1.608  13.837  0.439   1.00 1.00 ? 59  ASP A N    4  
ATOM   4899  C CA   . ASP A 1 59 ? -2.009  14.028  1.827   1.00 1.00 ? 59  ASP A CA   4  
ATOM   4900  C C    . ASP A 1 59 ? -2.553  12.730  2.409   1.00 1.00 ? 59  ASP A C    4  
ATOM   4901  O O    . ASP A 1 59 ? -2.565  12.541  3.624   1.00 1.00 ? 59  ASP A O    4  
ATOM   4902  C CB   . ASP A 1 59 ? -3.080  15.114  1.917   1.00 1.00 ? 59  ASP A CB   4  
ATOM   4903  C CG   . ASP A 1 59 ? -2.465  16.478  1.627   1.00 1.00 ? 59  ASP A CG   4  
ATOM   4904  O OD1  . ASP A 1 59 ? -1.251  16.548  1.528   1.00 1.00 ? 59  ASP A OD1  4  
ATOM   4905  O OD2  . ASP A 1 59 ? -3.215  17.432  1.509   1.00 1.00 ? 59  ASP A OD2  4  
ATOM   4906  H H    . ASP A 1 59 ? -2.122  14.266  -0.275  1.00 1.00 ? 59  ASP A H    4  
ATOM   4907  H HA   . ASP A 1 59 ? -1.149  14.335  2.399   1.00 1.00 ? 59  ASP A HA   4  
ATOM   4908  H HB2  . ASP A 1 59 ? -3.858  14.911  1.196   1.00 1.00 ? 59  ASP A HB2  4  
ATOM   4909  H HB3  . ASP A 1 59 ? -3.504  15.117  2.910   1.00 1.00 ? 59  ASP A HB3  4  
ATOM   4910  N N    . LYS A 1 60 ? -3.005  11.838  1.533   1.00 1.00 ? 60  LYS A N    4  
ATOM   4911  C CA   . LYS A 1 60 ? -3.552  10.556  1.969   1.00 1.00 ? 60  LYS A CA   4  
ATOM   4912  C C    . LYS A 1 60 ? -2.442  9.520   2.094   1.00 1.00 ? 60  LYS A C    4  
ATOM   4913  O O    . LYS A 1 60 ? -2.529  8.596   2.902   1.00 1.00 ? 60  LYS A O    4  
ATOM   4914  C CB   . LYS A 1 60 ? -4.607  10.064  0.965   1.00 1.00 ? 60  LYS A CB   4  
ATOM   4915  C CG   . LYS A 1 60 ? -5.517  9.013   1.628   1.00 1.00 ? 60  LYS A CG   4  
ATOM   4916  C CD   . LYS A 1 60 ? -6.668  9.705   2.370   1.00 1.00 ? 60  LYS A CD   4  
ATOM   4917  C CE   . LYS A 1 60 ? -7.607  8.652   2.958   1.00 1.00 ? 60  LYS A CE   4  
ATOM   4918  N NZ   . LYS A 1 60 ? -8.713  9.335   3.683   1.00 1.00 ? 60  LYS A NZ   4  
ATOM   4919  H H    . LYS A 1 60 ? -2.970  12.045  0.577   1.00 1.00 ? 60  LYS A H    4  
ATOM   4920  H HA   . LYS A 1 60 ? -4.016  10.679  2.935   1.00 1.00 ? 60  LYS A HA   4  
ATOM   4921  H HB2  . LYS A 1 60 ? -5.200  10.902  0.631   1.00 1.00 ? 60  LYS A HB2  4  
ATOM   4922  H HB3  . LYS A 1 60 ? -4.112  9.619   0.114   1.00 1.00 ? 60  LYS A HB3  4  
ATOM   4923  H HG2  . LYS A 1 60 ? -5.925  8.363   0.868   1.00 1.00 ? 60  LYS A HG2  4  
ATOM   4924  H HG3  . LYS A 1 60 ? -4.945  8.424   2.330   1.00 1.00 ? 60  LYS A HG3  4  
ATOM   4925  H HD2  . LYS A 1 60 ? -6.273  10.318  3.166   1.00 1.00 ? 60  LYS A HD2  4  
ATOM   4926  H HD3  . LYS A 1 60 ? -7.218  10.327  1.679   1.00 1.00 ? 60  LYS A HD3  4  
ATOM   4927  H HE2  . LYS A 1 60 ? -8.015  8.047   2.162   1.00 1.00 ? 60  LYS A HE2  4  
ATOM   4928  H HE3  . LYS A 1 60 ? -7.059  8.024   3.646   1.00 1.00 ? 60  LYS A HE3  4  
ATOM   4929  H HZ1  . LYS A 1 60 ? -8.989  8.768   4.510   1.00 1.00 ? 60  LYS A HZ1  4  
ATOM   4930  H HZ2  . LYS A 1 60 ? -9.529  9.443   3.047   1.00 1.00 ? 60  LYS A HZ2  4  
ATOM   4931  H HZ3  . LYS A 1 60 ? -8.392  10.272  3.998   1.00 1.00 ? 60  LYS A HZ3  4  
ATOM   4932  N N    . ALA A 1 61 ? -1.400  9.674   1.279   1.00 1.00 ? 61  ALA A N    4  
ATOM   4933  C CA   . ALA A 1 61 ? -0.271  8.744   1.291   1.00 1.00 ? 61  ALA A CA   4  
ATOM   4934  C C    . ALA A 1 61 ? 0.958   9.400   1.904   1.00 1.00 ? 61  ALA A C    4  
ATOM   4935  O O    . ALA A 1 61 ? 2.047   9.339   1.342   1.00 1.00 ? 61  ALA A O    4  
ATOM   4936  C CB   . ALA A 1 61 ? 0.050   8.302   -0.138  1.00 1.00 ? 61  ALA A CB   4  
ATOM   4937  H H    . ALA A 1 61 ? -1.392  10.430  0.659   1.00 1.00 ? 61  ALA A H    4  
ATOM   4938  H HA   . ALA A 1 61 ? -0.524  7.869   1.871   1.00 1.00 ? 61  ALA A HA   4  
ATOM   4939  H HB1  . ALA A 1 61 ? 0.975   7.744   -0.144  1.00 1.00 ? 61  ALA A HB1  4  
ATOM   4940  H HB2  . ALA A 1 61 ? 0.152   9.173   -0.771  1.00 1.00 ? 61  ALA A HB2  4  
ATOM   4941  H HB3  . ALA A 1 61 ? -0.749  7.680   -0.510  1.00 1.00 ? 61  ALA A HB3  4  
ATOM   4942  N N    . GLN A 1 62 ? 0.774   10.035  3.061   1.00 1.00 ? 62  GLN A N    4  
ATOM   4943  C CA   . GLN A 1 62 ? 1.877   10.707  3.755   1.00 1.00 ? 62  GLN A CA   4  
ATOM   4944  C C    . GLN A 1 62 ? 2.130   10.065  5.117   1.00 1.00 ? 62  GLN A C    4  
ATOM   4945  O O    . GLN A 1 62 ? 3.276   9.929   5.545   1.00 1.00 ? 62  GLN A O    4  
ATOM   4946  C CB   . GLN A 1 62 ? 1.546   12.191  3.941   1.00 1.00 ? 62  GLN A CB   4  
ATOM   4947  C CG   . GLN A 1 62 ? 0.292   12.333  4.803   1.00 1.00 ? 62  GLN A CG   4  
ATOM   4948  C CD   . GLN A 1 62 ? -0.143  13.794  4.848   1.00 1.00 ? 62  GLN A CD   4  
ATOM   4949  O OE1  . GLN A 1 62 ? 0.424   14.633  4.152   1.00 1.00 ? 62  GLN A OE1  4  
ATOM   4950  N NE2  . GLN A 1 62 ? -1.125  14.147  5.631   1.00 1.00 ? 62  GLN A NE2  4  
ATOM   4951  H H    . GLN A 1 62 ? -0.121  10.052  3.457   1.00 1.00 ? 62  GLN A H    4  
ATOM   4952  H HA   . GLN A 1 62 ? 2.781   10.628  3.164   1.00 1.00 ? 62  GLN A HA   4  
ATOM   4953  H HB2  . GLN A 1 62 ? 2.375   12.685  4.427   1.00 1.00 ? 62  GLN A HB2  4  
ATOM   4954  H HB3  . GLN A 1 62 ? 1.371   12.646  2.977   1.00 1.00 ? 62  GLN A HB3  4  
ATOM   4955  H HG2  . GLN A 1 62 ? -0.500  11.732  4.383   1.00 1.00 ? 62  GLN A HG2  4  
ATOM   4956  H HG3  . GLN A 1 62 ? 0.507   11.996  5.805   1.00 1.00 ? 62  GLN A HG3  4  
ATOM   4957  H HE21 . GLN A 1 62 ? -1.577  13.476  6.183   1.00 1.00 ? 62  GLN A HE21 4  
ATOM   4958  H HE22 . GLN A 1 62 ? -1.411  15.084  5.667   1.00 1.00 ? 62  GLN A HE22 4  
ATOM   4959  N N    . ASP A 1 63 ? 1.052   9.673   5.802   1.00 1.00 ? 63  ASP A N    4  
ATOM   4960  C CA   . ASP A 1 63 ? 1.162   9.053   7.122   1.00 1.00 ? 63  ASP A CA   4  
ATOM   4961  C C    . ASP A 1 63 ? 0.242   7.838   7.233   1.00 1.00 ? 63  ASP A C    4  
ATOM   4962  O O    . ASP A 1 63 ? -0.589  7.760   8.138   1.00 1.00 ? 63  ASP A O    4  
ATOM   4963  C CB   . ASP A 1 63 ? 0.796   10.076  8.200   1.00 1.00 ? 63  ASP A CB   4  
ATOM   4964  C CG   . ASP A 1 63 ? 1.914   11.104  8.350   1.00 1.00 ? 63  ASP A CG   4  
ATOM   4965  O OD1  . ASP A 1 63 ? 3.000   10.847  7.859   1.00 1.00 ? 63  ASP A OD1  4  
ATOM   4966  O OD2  . ASP A 1 63 ? 1.666   12.135  8.952   1.00 1.00 ? 63  ASP A OD2  4  
ATOM   4967  H H    . ASP A 1 63 ? 0.163   9.812   5.413   1.00 1.00 ? 63  ASP A H    4  
ATOM   4968  H HA   . ASP A 1 63 ? 2.182   8.728   7.285   1.00 1.00 ? 63  ASP A HA   4  
ATOM   4969  H HB2  . ASP A 1 63 ? -0.118  10.579  7.920   1.00 1.00 ? 63  ASP A HB2  4  
ATOM   4970  H HB3  . ASP A 1 63 ? 0.649   9.568   9.140   1.00 1.00 ? 63  ASP A HB3  4  
ATOM   4971  N N    . ILE A 1 64 ? 0.402   6.891   6.313   1.00 1.00 ? 64  ILE A N    4  
ATOM   4972  C CA   . ILE A 1 64 ? -0.410  5.678   6.321   1.00 1.00 ? 64  ILE A CA   4  
ATOM   4973  C C    . ILE A 1 64 ? 0.241   4.602   7.181   1.00 1.00 ? 64  ILE A C    4  
ATOM   4974  O O    . ILE A 1 64 ? 1.417   4.271   7.007   1.00 1.00 ? 64  ILE A O    4  
ATOM   4975  C CB   . ILE A 1 64 ? -0.593  5.162   4.891   1.00 1.00 ? 64  ILE A CB   4  
ATOM   4976  C CG1  . ILE A 1 64 ? -1.384  6.194   4.059   1.00 1.00 ? 64  ILE A CG1  4  
ATOM   4977  C CG2  . ILE A 1 64 ? -1.316  3.812   4.909   1.00 1.00 ? 64  ILE A CG2  4  
ATOM   4978  C CD1  . ILE A 1 64 ? -2.786  6.442   4.641   1.00 1.00 ? 64  ILE A CD1  4  
ATOM   4979  H H    . ILE A 1 64 ? 1.085   7.006   5.619   1.00 1.00 ? 64  ILE A H    4  
ATOM   4980  H HA   . ILE A 1 64 ? -1.382  5.898   6.738   1.00 1.00 ? 64  ILE A HA   4  
ATOM   4981  H HB   . ILE A 1 64 ? 0.381   5.023   4.444   1.00 1.00 ? 64  ILE A HB   4  
ATOM   4982  H HG12 . ILE A 1 64 ? -0.839  7.124   4.051   1.00 1.00 ? 64  ILE A HG12 4  
ATOM   4983  H HG13 . ILE A 1 64 ? -1.481  5.832   3.045   1.00 1.00 ? 64  ILE A HG13 4  
ATOM   4984  H HG21 . ILE A 1 64 ? -0.618  3.041   5.186   1.00 1.00 ? 64  ILE A HG21 4  
ATOM   4985  H HG22 . ILE A 1 64 ? -1.715  3.602   3.930   1.00 1.00 ? 64  ILE A HG22 4  
ATOM   4986  H HG23 . ILE A 1 64 ? -2.125  3.839   5.625   1.00 1.00 ? 64  ILE A HG23 4  
ATOM   4987  H HD11 . ILE A 1 64 ? -3.471  6.676   3.837   1.00 1.00 ? 64  ILE A HD11 4  
ATOM   4988  H HD12 . ILE A 1 64 ? -2.751  7.275   5.327   1.00 1.00 ? 64  ILE A HD12 4  
ATOM   4989  H HD13 . ILE A 1 64 ? -3.139  5.567   5.164   1.00 1.00 ? 64  ILE A HD13 4  
ATOM   4990  N N    . SER A 1 65 ? -0.542  4.057   8.104   1.00 1.00 ? 65  SER A N    4  
ATOM   4991  C CA   . SER A 1 65 ? -0.056  3.010   8.989   1.00 1.00 ? 65  SER A CA   4  
ATOM   4992  C C    . SER A 1 65 ? 0.223   1.763   8.180   1.00 1.00 ? 65  SER A C    4  
ATOM   4993  O O    . SER A 1 65 ? 0.175   1.795   6.967   1.00 1.00 ? 65  SER A O    4  
ATOM   4994  C CB   . SER A 1 65 ? -1.088  2.723   10.097  1.00 1.00 ? 65  SER A CB   4  
ATOM   4995  O OG   . SER A 1 65 ? -1.371  1.329   10.155  1.00 1.00 ? 65  SER A OG   4  
ATOM   4996  H H    . SER A 1 65 ? -1.468  4.360   8.183   1.00 1.00 ? 65  SER A H    4  
ATOM   4997  H HA   . SER A 1 65 ? 0.877   3.332   9.430   1.00 1.00 ? 65  SER A HA   4  
ATOM   4998  H HB2  . SER A 1 65 ? -0.703  3.039   11.054  1.00 1.00 ? 65  SER A HB2  4  
ATOM   4999  H HB3  . SER A 1 65 ? -1.996  3.272   9.885   1.00 1.00 ? 65  SER A HB3  4  
ATOM   5000  H HG   . SER A 1 65 ? -0.697  0.909   10.690  1.00 1.00 ? 65  SER A HG   4  
ATOM   5001  N N    . THR A 1 66 ? 0.535   0.681   8.868   1.00 1.00 ? 66  THR A N    4  
ATOM   5002  C CA   . THR A 1 66 ? 0.849   -0.576  8.215   1.00 1.00 ? 66  THR A CA   4  
ATOM   5003  C C    . THR A 1 66 ? -0.162  -0.914  7.116   1.00 1.00 ? 66  THR A C    4  
ATOM   5004  O O    . THR A 1 66 ? -1.023  -0.107  6.774   1.00 1.00 ? 66  THR A O    4  
ATOM   5005  C CB   . THR A 1 66 ? 0.910   -1.694  9.268   1.00 1.00 ? 66  THR A CB   4  
ATOM   5006  O OG1  . THR A 1 66 ? 1.756   -2.733  8.804   1.00 1.00 ? 66  THR A OG1  4  
ATOM   5007  C CG2  . THR A 1 66 ? -0.478  -2.258  9.528   1.00 1.00 ? 66  THR A CG2  4  
ATOM   5008  H H    . THR A 1 66 ? 0.565   0.733   9.840   1.00 1.00 ? 66  THR A H    4  
ATOM   5009  H HA   . THR A 1 66 ? 1.818   -0.481  7.765   1.00 1.00 ? 66  THR A HA   4  
ATOM   5010  H HB   . THR A 1 66 ? 1.296   -1.297  10.191  1.00 1.00 ? 66  THR A HB   4  
ATOM   5011  H HG1  . THR A 1 66 ? 1.468   -2.980  7.921   1.00 1.00 ? 66  THR A HG1  4  
ATOM   5012  H HG21 . THR A 1 66 ? -0.699  -2.983  8.767   1.00 1.00 ? 66  THR A HG21 4  
ATOM   5013  H HG22 . THR A 1 66 ? -1.203  -1.455  9.494   1.00 1.00 ? 66  THR A HG22 4  
ATOM   5014  H HG23 . THR A 1 66 ? -0.500  -2.733  10.498  1.00 1.00 ? 66  THR A HG23 4  
ATOM   5015  N N    . ILE A 1 67 ? -0.049  -2.118  6.566   1.00 1.00 ? 67  ILE A N    4  
ATOM   5016  C CA   . ILE A 1 67 ? -0.954  -2.535  5.504   1.00 1.00 ? 67  ILE A CA   4  
ATOM   5017  C C    . ILE A 1 67 ? -2.399  -2.487  5.986   1.00 1.00 ? 67  ILE A C    4  
ATOM   5018  O O    . ILE A 1 67 ? -3.281  -1.998  5.280   1.00 1.00 ? 67  ILE A O    4  
ATOM   5019  C CB   . ILE A 1 67 ? -0.612  -3.959  5.046   1.00 1.00 ? 67  ILE A CB   4  
ATOM   5020  C CG1  . ILE A 1 67 ? 0.743   -3.959  4.330   1.00 1.00 ? 67  ILE A CG1  4  
ATOM   5021  C CG2  . ILE A 1 67 ? -1.688  -4.465  4.082   1.00 1.00 ? 67  ILE A CG2  4  
ATOM   5022  C CD1  . ILE A 1 67 ? 1.259   -5.399  4.197   1.00 1.00 ? 67  ILE A CD1  4  
ATOM   5023  H H    . ILE A 1 67 ? 0.657   -2.725  6.866   1.00 1.00 ? 67  ILE A H    4  
ATOM   5024  H HA   . ILE A 1 67 ? -0.841  -1.871  4.674   1.00 1.00 ? 67  ILE A HA   4  
ATOM   5025  H HB   . ILE A 1 67 ? -0.564  -4.615  5.901   1.00 1.00 ? 67  ILE A HB   4  
ATOM   5026  H HG12 . ILE A 1 67 ? 0.629   -3.526  3.345   1.00 1.00 ? 67  ILE A HG12 4  
ATOM   5027  H HG13 . ILE A 1 67 ? 1.451   -3.378  4.895   1.00 1.00 ? 67  ILE A HG13 4  
ATOM   5028  H HG21 . ILE A 1 67 ? -2.586  -4.692  4.634   1.00 1.00 ? 67  ILE A HG21 4  
ATOM   5029  H HG22 . ILE A 1 67 ? -1.337  -5.356  3.581   1.00 1.00 ? 67  ILE A HG22 4  
ATOM   5030  H HG23 . ILE A 1 67 ? -1.902  -3.702  3.347   1.00 1.00 ? 67  ILE A HG23 4  
ATOM   5031  H HD11 . ILE A 1 67 ? 0.427   -6.079  4.089   1.00 1.00 ? 67  ILE A HD11 4  
ATOM   5032  H HD12 . ILE A 1 67 ? 1.821   -5.661  5.082   1.00 1.00 ? 67  ILE A HD12 4  
ATOM   5033  H HD13 . ILE A 1 67 ? 1.898   -5.472  3.331   1.00 1.00 ? 67  ILE A HD13 4  
ATOM   5034  N N    . GLN A 1 68 ? -2.636  -2.985  7.191   1.00 1.00 ? 68  GLN A N    4  
ATOM   5035  C CA   . GLN A 1 68 ? -3.981  -2.986  7.753   1.00 1.00 ? 68  GLN A CA   4  
ATOM   5036  C C    . GLN A 1 68 ? -4.666  -1.643  7.496   1.00 1.00 ? 68  GLN A C    4  
ATOM   5037  O O    . GLN A 1 68 ? -5.872  -1.587  7.267   1.00 1.00 ? 68  GLN A O    4  
ATOM   5038  C CB   . GLN A 1 68 ? -3.911  -3.269  9.262   1.00 1.00 ? 68  GLN A CB   4  
ATOM   5039  C CG   . GLN A 1 68 ? -3.862  -4.777  9.513   1.00 1.00 ? 68  GLN A CG   4  
ATOM   5040  C CD   . GLN A 1 68 ? -5.238  -5.386  9.267   1.00 1.00 ? 68  GLN A CD   4  
ATOM   5041  O OE1  . GLN A 1 68 ? -6.252  -4.786  9.623   1.00 1.00 ? 68  GLN A OE1  4  
ATOM   5042  N NE2  . GLN A 1 68 ? -5.341  -6.545  8.678   1.00 1.00 ? 68  GLN A NE2  4  
ATOM   5043  H H    . GLN A 1 68 ? -1.897  -3.353  7.709   1.00 1.00 ? 68  GLN A H    4  
ATOM   5044  H HA   . GLN A 1 68 ? -4.560  -3.761  7.272   1.00 1.00 ? 68  GLN A HA   4  
ATOM   5045  H HB2  . GLN A 1 68 ? -3.031  -2.808  9.670   1.00 1.00 ? 68  GLN A HB2  4  
ATOM   5046  H HB3  . GLN A 1 68 ? -4.773  -2.864  9.746   1.00 1.00 ? 68  GLN A HB3  4  
ATOM   5047  H HG2  . GLN A 1 68 ? -3.146  -5.222  8.847   1.00 1.00 ? 68  GLN A HG2  4  
ATOM   5048  H HG3  . GLN A 1 68 ? -3.566  -4.962  10.535  1.00 1.00 ? 68  GLN A HG3  4  
ATOM   5049  H HE21 . GLN A 1 68 ? -4.536  -7.024  8.396   1.00 1.00 ? 68  GLN A HE21 4  
ATOM   5050  H HE22 . GLN A 1 68 ? -6.226  -6.937  8.519   1.00 1.00 ? 68  GLN A HE22 4  
ATOM   5051  N N    . GLN A 1 69 ? -3.890  -0.567  7.534   1.00 1.00 ? 69  GLN A N    4  
ATOM   5052  C CA   . GLN A 1 69 ? -4.432  0.754   7.298   1.00 1.00 ? 69  GLN A CA   4  
ATOM   5053  C C    . GLN A 1 69 ? -4.562  1.030   5.804   1.00 1.00 ? 69  GLN A C    4  
ATOM   5054  O O    . GLN A 1 69 ? -5.588  1.533   5.344   1.00 1.00 ? 69  GLN A O    4  
ATOM   5055  C CB   . GLN A 1 69 ? -3.511  1.795   7.925   1.00 1.00 ? 69  GLN A CB   4  
ATOM   5056  C CG   . GLN A 1 69 ? -4.132  3.179   7.812   1.00 1.00 ? 69  GLN A CG   4  
ATOM   5057  C CD   . GLN A 1 69 ? -5.407  3.255   8.645   1.00 1.00 ? 69  GLN A CD   4  
ATOM   5058  O OE1  . GLN A 1 69 ? -5.457  2.725   9.755   1.00 1.00 ? 69  GLN A OE1  4  
ATOM   5059  N NE2  . GLN A 1 69 ? -6.447  3.883   8.170   1.00 1.00 ? 69  GLN A NE2  4  
ATOM   5060  H H    . GLN A 1 69 ? -2.938  -0.663  7.722   1.00 1.00 ? 69  GLN A H    4  
ATOM   5061  H HA   . GLN A 1 69 ? -5.404  0.822   7.760   1.00 1.00 ? 69  GLN A HA   4  
ATOM   5062  H HB2  . GLN A 1 69 ? -3.352  1.555   8.962   1.00 1.00 ? 69  GLN A HB2  4  
ATOM   5063  H HB3  . GLN A 1 69 ? -2.566  1.792   7.401   1.00 1.00 ? 69  GLN A HB3  4  
ATOM   5064  H HG2  . GLN A 1 69 ? -3.425  3.906   8.167   1.00 1.00 ? 69  GLN A HG2  4  
ATOM   5065  H HG3  . GLN A 1 69 ? -4.365  3.381   6.782   1.00 1.00 ? 69  GLN A HG3  4  
ATOM   5066  H HE21 . GLN A 1 69 ? -6.404  4.301   7.286   1.00 1.00 ? 69  GLN A HE21 4  
ATOM   5067  H HE22 . GLN A 1 69 ? -7.270  3.935   8.698   1.00 1.00 ? 69  GLN A HE22 4  
ATOM   5068  N N    . ALA A 1 70 ? -3.512  0.716   5.045   1.00 1.00 ? 70  ALA A N    4  
ATOM   5069  C CA   . ALA A 1 70 ? -3.545  0.967   3.607   1.00 1.00 ? 70  ALA A CA   4  
ATOM   5070  C C    . ALA A 1 70 ? -4.723  0.255   2.961   1.00 1.00 ? 70  ALA A C    4  
ATOM   5071  O O    . ALA A 1 70 ? -5.424  0.826   2.126   1.00 1.00 ? 70  ALA A O    4  
ATOM   5072  C CB   . ALA A 1 70 ? -2.250  0.482   2.958   1.00 1.00 ? 70  ALA A CB   4  
ATOM   5073  H H    . ALA A 1 70 ? -2.701  0.323   5.457   1.00 1.00 ? 70  ALA A H    4  
ATOM   5074  H HA   . ALA A 1 70 ? -3.641  2.028   3.438   1.00 1.00 ? 70  ALA A HA   4  
ATOM   5075  H HB1  . ALA A 1 70 ? -2.365  0.472   1.886   1.00 1.00 ? 70  ALA A HB1  4  
ATOM   5076  H HB2  . ALA A 1 70 ? -2.034  -0.513  3.300   1.00 1.00 ? 70  ALA A HB2  4  
ATOM   5077  H HB3  . ALA A 1 70 ? -1.443  1.142   3.226   1.00 1.00 ? 70  ALA A HB3  4  
ATOM   5078  N N    . ALA A 1 71 ? -4.932  -0.994  3.348   1.00 1.00 ? 71  ALA A N    4  
ATOM   5079  C CA   . ALA A 1 71 ? -6.027  -1.775  2.795   1.00 1.00 ? 71  ALA A CA   4  
ATOM   5080  C C    . ALA A 1 71 ? -7.366  -1.113  3.100   1.00 1.00 ? 71  ALA A C    4  
ATOM   5081  O O    . ALA A 1 71 ? -8.210  -0.967  2.219   1.00 1.00 ? 71  ALA A O    4  
ATOM   5082  C CB   . ALA A 1 71 ? -6.005  -3.180  3.390   1.00 1.00 ? 71  ALA A CB   4  
ATOM   5083  H H    . ALA A 1 71 ? -4.339  -1.400  4.014   1.00 1.00 ? 71  ALA A H    4  
ATOM   5084  H HA   . ALA A 1 71 ? -5.904  -1.847  1.725   1.00 1.00 ? 71  ALA A HA   4  
ATOM   5085  H HB1  . ALA A 1 71 ? -5.069  -3.659  3.148   1.00 1.00 ? 71  ALA A HB1  4  
ATOM   5086  H HB2  . ALA A 1 71 ? -6.823  -3.758  2.984   1.00 1.00 ? 71  ALA A HB2  4  
ATOM   5087  H HB3  . ALA A 1 71 ? -6.107  -3.114  4.464   1.00 1.00 ? 71  ALA A HB3  4  
ATOM   5088  N N    . ASP A 1 72 ? -7.551  -0.713  4.353   1.00 1.00 ? 72  ASP A N    4  
ATOM   5089  C CA   . ASP A 1 72 ? -8.794  -0.067  4.758   1.00 1.00 ? 72  ASP A CA   4  
ATOM   5090  C C    . ASP A 1 72 ? -8.974  1.261   4.031   1.00 1.00 ? 72  ASP A C    4  
ATOM   5091  O O    . ASP A 1 72 ? -10.075 1.593   3.590   1.00 1.00 ? 72  ASP A O    4  
ATOM   5092  C CB   . ASP A 1 72 ? -8.791  0.173   6.269   1.00 1.00 ? 72  ASP A CB   4  
ATOM   5093  C CG   . ASP A 1 72 ? -10.098 0.834   6.697   1.00 1.00 ? 72  ASP A CG   4  
ATOM   5094  O OD1  . ASP A 1 72 ? -10.881 1.175   5.826   1.00 1.00 ? 72  ASP A OD1  4  
ATOM   5095  O OD2  . ASP A 1 72 ? -10.297 0.991   7.891   1.00 1.00 ? 72  ASP A OD2  4  
ATOM   5096  H H    . ASP A 1 72 ? -6.843  -0.853  5.015   1.00 1.00 ? 72  ASP A H    4  
ATOM   5097  H HA   . ASP A 1 72 ? -9.620  -0.718  4.510   1.00 1.00 ? 72  ASP A HA   4  
ATOM   5098  H HB2  . ASP A 1 72 ? -8.683  -0.771  6.782   1.00 1.00 ? 72  ASP A HB2  4  
ATOM   5099  H HB3  . ASP A 1 72 ? -7.965  0.818   6.527   1.00 1.00 ? 72  ASP A HB3  4  
ATOM   5100  N N    . VAL A 1 73 ? -7.888  2.019   3.906   1.00 1.00 ? 73  VAL A N    4  
ATOM   5101  C CA   . VAL A 1 73 ? -7.946  3.311   3.228   1.00 1.00 ? 73  VAL A CA   4  
ATOM   5102  C C    . VAL A 1 73 ? -8.355  3.127   1.765   1.00 1.00 ? 73  VAL A C    4  
ATOM   5103  O O    . VAL A 1 73 ? -9.189  3.870   1.249   1.00 1.00 ? 73  VAL A O    4  
ATOM   5104  C CB   . VAL A 1 73 ? -6.582  4.004   3.315   1.00 1.00 ? 73  VAL A CB   4  
ATOM   5105  C CG1  . VAL A 1 73 ? -6.542  5.211   2.369   1.00 1.00 ? 73  VAL A CG1  4  
ATOM   5106  C CG2  . VAL A 1 73 ? -6.345  4.482   4.750   1.00 1.00 ? 73  VAL A CG2  4  
ATOM   5107  H H    . VAL A 1 73 ? -7.031  1.707   4.279   1.00 1.00 ? 73  VAL A H    4  
ATOM   5108  H HA   . VAL A 1 73 ? -8.682  3.929   3.720   1.00 1.00 ? 73  VAL A HA   4  
ATOM   5109  H HB   . VAL A 1 73 ? -5.811  3.305   3.041   1.00 1.00 ? 73  VAL A HB   4  
ATOM   5110  H HG11 . VAL A 1 73 ? -7.462  5.769   2.456   1.00 1.00 ? 73  VAL A HG11 4  
ATOM   5111  H HG12 . VAL A 1 73 ? -6.426  4.866   1.351   1.00 1.00 ? 73  VAL A HG12 4  
ATOM   5112  H HG13 . VAL A 1 73 ? -5.708  5.848   2.627   1.00 1.00 ? 73  VAL A HG13 4  
ATOM   5113  H HG21 . VAL A 1 73 ? -6.949  5.358   4.943   1.00 1.00 ? 73  VAL A HG21 4  
ATOM   5114  H HG22 . VAL A 1 73 ? -5.303  4.733   4.876   1.00 1.00 ? 73  VAL A HG22 4  
ATOM   5115  H HG23 . VAL A 1 73 ? -6.613  3.698   5.439   1.00 1.00 ? 73  VAL A HG23 4  
ATOM   5116  N N    . ILE A 1 74 ? -7.762  2.137   1.104   1.00 1.00 ? 74  ILE A N    4  
ATOM   5117  C CA   . ILE A 1 74 ? -8.075  1.869   -0.296  1.00 1.00 ? 74  ILE A CA   4  
ATOM   5118  C C    . ILE A 1 74 ? -9.545  1.494   -0.458  1.00 1.00 ? 74  ILE A C    4  
ATOM   5119  O O    . ILE A 1 74 ? -10.217 1.970   -1.374  1.00 1.00 ? 74  ILE A O    4  
ATOM   5120  C CB   . ILE A 1 74 ? -7.181  0.733   -0.818  1.00 1.00 ? 74  ILE A CB   4  
ATOM   5121  C CG1  . ILE A 1 74 ? -5.739  1.238   -0.960  1.00 1.00 ? 74  ILE A CG1  4  
ATOM   5122  C CG2  . ILE A 1 74 ? -7.690  0.232   -2.175  1.00 1.00 ? 74  ILE A CG2  4  
ATOM   5123  C CD1  . ILE A 1 74 ? -4.765  0.053   -1.004  1.00 1.00 ? 74  ILE A CD1  4  
ATOM   5124  H H    . ILE A 1 74 ? -7.104  1.576   1.567   1.00 1.00 ? 74  ILE A H    4  
ATOM   5125  H HA   . ILE A 1 74 ? -7.873  2.758   -0.871  1.00 1.00 ? 74  ILE A HA   4  
ATOM   5126  H HB   . ILE A 1 74 ? -7.198  -0.085  -0.117  1.00 1.00 ? 74  ILE A HB   4  
ATOM   5127  H HG12 . ILE A 1 74 ? -5.652  1.806   -1.876  1.00 1.00 ? 74  ILE A HG12 4  
ATOM   5128  H HG13 . ILE A 1 74 ? -5.493  1.870   -0.122  1.00 1.00 ? 74  ILE A HG13 4  
ATOM   5129  H HG21 . ILE A 1 74 ? -6.914  -0.332  -2.671  1.00 1.00 ? 74  ILE A HG21 4  
ATOM   5130  H HG22 . ILE A 1 74 ? -7.969  1.072   -2.785  1.00 1.00 ? 74  ILE A HG22 4  
ATOM   5131  H HG23 . ILE A 1 74 ? -8.550  -0.399  -2.021  1.00 1.00 ? 74  ILE A HG23 4  
ATOM   5132  H HD11 . ILE A 1 74 ? -5.283  -0.842  -1.319  1.00 1.00 ? 74  ILE A HD11 4  
ATOM   5133  H HD12 . ILE A 1 74 ? -4.350  -0.102  -0.020  1.00 1.00 ? 74  ILE A HD12 4  
ATOM   5134  H HD13 . ILE A 1 74 ? -3.969  0.270   -1.697  1.00 1.00 ? 74  ILE A HD13 4  
ATOM   5135  N N    . GLU A 1 75 ? -10.040 0.649   0.431   1.00 1.00 ? 75  GLU A N    4  
ATOM   5136  C CA   . GLU A 1 75 ? -11.433 0.231   0.364   1.00 1.00 ? 75  GLU A CA   4  
ATOM   5137  C C    . GLU A 1 75 ? -12.350 1.440   0.208   1.00 1.00 ? 75  GLU A C    4  
ATOM   5138  O O    . GLU A 1 75 ? -13.396 1.357   -0.434  1.00 1.00 ? 75  GLU A O    4  
ATOM   5139  C CB   . GLU A 1 75 ? -11.805 -0.553  1.627   1.00 1.00 ? 75  GLU A CB   4  
ATOM   5140  C CG   . GLU A 1 75 ? -11.239 -1.969  1.536   1.00 1.00 ? 75  GLU A CG   4  
ATOM   5141  C CD   . GLU A 1 75 ? -11.533 -2.717  2.827   1.00 1.00 ? 75  GLU A CD   4  
ATOM   5142  O OE1  . GLU A 1 75 ? -12.092 -2.111  3.727   1.00 1.00 ? 75  GLU A OE1  4  
ATOM   5143  O OE2  . GLU A 1 75 ? -11.192 -3.881  2.899   1.00 1.00 ? 75  GLU A OE2  4  
ATOM   5144  H H    . GLU A 1 75 ? -9.464  0.302   1.145   1.00 1.00 ? 75  GLU A H    4  
ATOM   5145  H HA   . GLU A 1 75 ? -11.561 -0.412  -0.493  1.00 1.00 ? 75  GLU A HA   4  
ATOM   5146  H HB2  . GLU A 1 75 ? -11.388 -0.058  2.492   1.00 1.00 ? 75  GLU A HB2  4  
ATOM   5147  H HB3  . GLU A 1 75 ? -12.879 -0.602  1.722   1.00 1.00 ? 75  GLU A HB3  4  
ATOM   5148  H HG2  . GLU A 1 75 ? -11.701 -2.486  0.707   1.00 1.00 ? 75  GLU A HG2  4  
ATOM   5149  H HG3  . GLU A 1 75 ? -10.173 -1.924  1.381   1.00 1.00 ? 75  GLU A HG3  4  
ATOM   5150  N N    . GLY A 1 76 ? -11.949 2.562   0.792   1.00 1.00 ? 76  GLY A N    4  
ATOM   5151  C CA   . GLY A 1 76 ? -12.745 3.781   0.702   1.00 1.00 ? 76  GLY A CA   4  
ATOM   5152  C C    . GLY A 1 76 ? -12.516 4.493   -0.629  1.00 1.00 ? 76  GLY A C    4  
ATOM   5153  O O    . GLY A 1 76 ? -13.366 5.256   -1.089  1.00 1.00 ? 76  GLY A O    4  
ATOM   5154  H H    . GLY A 1 76 ? -11.104 2.572   1.289   1.00 1.00 ? 76  GLY A H    4  
ATOM   5155  H HA2  . GLY A 1 76 ? -13.791 3.529   0.795   1.00 1.00 ? 76  GLY A HA2  4  
ATOM   5156  H HA3  . GLY A 1 76 ? -12.467 4.444   1.507   1.00 1.00 ? 76  GLY A HA3  4  
ATOM   5157  N N    . LEU A 1 77 ? -11.360 4.245   -1.240  1.00 1.00 ? 77  LEU A N    4  
ATOM   5158  C CA   . LEU A 1 77 ? -11.023 4.872   -2.520  1.00 1.00 ? 77  LEU A CA   4  
ATOM   5159  C C    . LEU A 1 77 ? -11.548 4.043   -3.683  1.00 1.00 ? 77  LEU A C    4  
ATOM   5160  O O    . LEU A 1 77 ? -11.580 4.504   -4.823  1.00 1.00 ? 77  LEU A O    4  
ATOM   5161  C CB   . LEU A 1 77 ? -9.505  5.014   -2.628  1.00 1.00 ? 77  LEU A CB   4  
ATOM   5162  C CG   . LEU A 1 77 ? -9.008  6.073   -1.631  1.00 1.00 ? 77  LEU A CG   4  
ATOM   5163  C CD1  . LEU A 1 77 ? -7.487  5.982   -1.504  1.00 1.00 ? 77  LEU A CD1  4  
ATOM   5164  C CD2  . LEU A 1 77 ? -9.393  7.488   -2.114  1.00 1.00 ? 77  LEU A CD2  4  
ATOM   5165  H H    . LEU A 1 77 ? -10.721 3.632   -0.825  1.00 1.00 ? 77  LEU A H    4  
ATOM   5166  H HA   . LEU A 1 77 ? -11.471 5.852   -2.564  1.00 1.00 ? 77  LEU A HA   4  
ATOM   5167  H HB2  . LEU A 1 77 ? -9.055  4.062   -2.398  1.00 1.00 ? 77  LEU A HB2  4  
ATOM   5168  H HB3  . LEU A 1 77 ? -9.230  5.303   -3.631  1.00 1.00 ? 77  LEU A HB3  4  
ATOM   5169  H HG   . LEU A 1 77 ? -9.460  5.889   -0.666  1.00 1.00 ? 77  LEU A HG   4  
ATOM   5170  H HD11 . LEU A 1 77 ? -7.193  4.949   -1.418  1.00 1.00 ? 77  LEU A HD11 4  
ATOM   5171  H HD12 . LEU A 1 77 ? -7.169  6.519   -0.623  1.00 1.00 ? 77  LEU A HD12 4  
ATOM   5172  H HD13 . LEU A 1 77 ? -7.029  6.418   -2.376  1.00 1.00 ? 77  LEU A HD13 4  
ATOM   5173  H HD21 . LEU A 1 77 ? -10.398 7.718   -1.798  1.00 1.00 ? 77  LEU A HD21 4  
ATOM   5174  H HD22 . LEU A 1 77 ? -9.332  7.541   -3.192  1.00 1.00 ? 77  LEU A HD22 4  
ATOM   5175  H HD23 . LEU A 1 77 ? -8.715  8.214   -1.686  1.00 1.00 ? 77  LEU A HD23 4  
ATOM   5176  N N    . LEU A 1 78 ? -11.963 2.819   -3.387  1.00 1.00 ? 78  LEU A N    4  
ATOM   5177  C CA   . LEU A 1 78 ? -12.493 1.932   -4.416  1.00 1.00 ? 78  LEU A CA   4  
ATOM   5178  C C    . LEU A 1 78 ? -13.983 2.189   -4.634  1.00 1.00 ? 78  LEU A C    4  
ATOM   5179  O O    . LEU A 1 78 ? -14.589 1.623   -5.543  1.00 1.00 ? 78  LEU A O    4  
ATOM   5180  C CB   . LEU A 1 78 ? -12.274 0.470   -4.003  1.00 1.00 ? 78  LEU A CB   4  
ATOM   5181  C CG   . LEU A 1 78 ? -10.848 0.000   -4.348  1.00 1.00 ? 78  LEU A CG   4  
ATOM   5182  C CD1  . LEU A 1 78 ? -10.547 -1.297  -3.590  1.00 1.00 ? 78  LEU A CD1  4  
ATOM   5183  C CD2  . LEU A 1 78 ? -10.717 -0.272  -5.859  1.00 1.00 ? 78  LEU A CD2  4  
ATOM   5184  H H    . LEU A 1 78 ? -11.917 2.506   -2.459  1.00 1.00 ? 78  LEU A H    4  
ATOM   5185  H HA   . LEU A 1 78 ? -11.975 2.116   -5.342  1.00 1.00 ? 78  LEU A HA   4  
ATOM   5186  H HB2  . LEU A 1 78 ? -12.417 0.397   -2.937  1.00 1.00 ? 78  LEU A HB2  4  
ATOM   5187  H HB3  . LEU A 1 78 ? -12.993 -0.159  -4.498  1.00 1.00 ? 78  LEU A HB3  4  
ATOM   5188  H HG   . LEU A 1 78 ? -10.135 0.760   -4.055  1.00 1.00 ? 78  LEU A HG   4  
ATOM   5189  H HD11 . LEU A 1 78 ? -11.206 -2.078  -3.939  1.00 1.00 ? 78  LEU A HD11 4  
ATOM   5190  H HD12 . LEU A 1 78 ? -10.701 -1.141  -2.535  1.00 1.00 ? 78  LEU A HD12 4  
ATOM   5191  H HD13 . LEU A 1 78 ? -9.522  -1.588  -3.766  1.00 1.00 ? 78  LEU A HD13 4  
ATOM   5192  H HD21 . LEU A 1 78 ? -10.558 0.655   -6.384  1.00 1.00 ? 78  LEU A HD21 4  
ATOM   5193  H HD22 . LEU A 1 78 ? -11.615 -0.742  -6.226  1.00 1.00 ? 78  LEU A HD22 4  
ATOM   5194  H HD23 . LEU A 1 78 ? -9.875  -0.928  -6.036  1.00 1.00 ? 78  LEU A HD23 4  
ATOM   5195  N N    . GLU A 1 79 ? -14.576 3.032   -3.794  1.00 1.00 ? 79  GLU A N    4  
ATOM   5196  C CA   . GLU A 1 79 ? -15.990 3.346   -3.903  1.00 1.00 ? 79  GLU A CA   4  
ATOM   5197  C C    . GLU A 1 79 ? -16.175 4.708   -4.510  1.00 1.00 ? 79  GLU A C    4  
ATOM   5198  O O    . GLU A 1 79 ? -16.755 4.829   -5.583  1.00 1.00 ? 79  GLU A O    4  
ATOM   5199  C CB   . GLU A 1 79 ? -16.596 3.350   -2.527  1.00 1.00 ? 79  GLU A CB   4  
ATOM   5200  C CG   . GLU A 1 79 ? -16.307 1.997   -1.888  1.00 1.00 ? 79  GLU A CG   4  
ATOM   5201  C CD   . GLU A 1 79 ? -16.878 1.937   -0.479  1.00 1.00 ? 79  GLU A CD   4  
ATOM   5202  O OE1  . GLU A 1 79 ? -17.521 2.892   -0.080  1.00 1.00 ? 79  GLU A OE1  4  
ATOM   5203  O OE2  . GLU A 1 79 ? -16.664 0.932   0.180   1.00 1.00 ? 79  GLU A OE2  4  
ATOM   5204  H H    . GLU A 1 79 ? -14.061 3.443   -3.081  1.00 1.00 ? 79  GLU A H    4  
ATOM   5205  H HA   . GLU A 1 79 ? -16.494 2.622   -4.507  1.00 1.00 ? 79  GLU A HA   4  
ATOM   5206  H HB2  . GLU A 1 79 ? -16.151 4.153   -1.955  1.00 1.00 ? 79  GLU A HB2  4  
ATOM   5207  H HB3  . GLU A 1 79 ? -17.661 3.500   -2.606  1.00 1.00 ? 79  GLU A HB3  4  
ATOM   5208  H HG2  . GLU A 1 79 ? -16.746 1.218   -2.488  1.00 1.00 ? 79  GLU A HG2  4  
ATOM   5209  H HG3  . GLU A 1 79 ? -15.238 1.853   -1.851  1.00 1.00 ? 79  GLU A HG3  4  
ATOM   5210  N N    . LYS A 1 80 ? -15.658 5.720   -3.807  1.00 1.00 ? 80  LYS A N    4  
ATOM   5211  C CA   . LYS A 1 80 ? -15.723 7.115   -4.247  1.00 1.00 ? 80  LYS A CA   4  
ATOM   5212  C C    . LYS A 1 80 ? -16.953 7.376   -5.106  1.00 1.00 ? 80  LYS A C    4  
ATOM   5213  O O    . LYS A 1 80 ? -16.980 8.280   -5.941  1.00 1.00 ? 80  LYS A O    4  
ATOM   5214  C CB   . LYS A 1 80 ? -14.424 7.507   -4.987  1.00 1.00 ? 80  LYS A CB   4  
ATOM   5215  C CG   . LYS A 1 80 ? -13.697 6.259   -5.522  1.00 1.00 ? 80  LYS A CG   4  
ATOM   5216  C CD   . LYS A 1 80 ? -14.361 5.750   -6.819  1.00 1.00 ? 80  LYS A CD   4  
ATOM   5217  C CE   . LYS A 1 80 ? -14.170 4.223   -6.953  1.00 1.00 ? 80  LYS A CE   4  
ATOM   5218  N NZ   . LYS A 1 80 ? -14.138 3.858   -8.399  1.00 1.00 ? 80  LYS A NZ   4  
ATOM   5219  H H    . LYS A 1 80 ? -15.202 5.517   -2.966  1.00 1.00 ? 80  LYS A H    4  
ATOM   5220  H HA   . LYS A 1 80 ? -15.813 7.717   -3.363  1.00 1.00 ? 80  LYS A HA   4  
ATOM   5221  H HB2  . LYS A 1 80 ? -14.645 8.172   -5.810  1.00 1.00 ? 80  LYS A HB2  4  
ATOM   5222  H HB3  . LYS A 1 80 ? -13.773 8.008   -4.291  1.00 1.00 ? 80  LYS A HB3  4  
ATOM   5223  H HG2  . LYS A 1 80 ? -12.667 6.520   -5.731  1.00 1.00 ? 80  LYS A HG2  4  
ATOM   5224  H HG3  . LYS A 1 80 ? -13.718 5.481   -4.778  1.00 1.00 ? 80  LYS A HG3  4  
ATOM   5225  H HD2  . LYS A 1 80 ? -15.415 5.989   -6.807  1.00 1.00 ? 80  LYS A HD2  4  
ATOM   5226  H HD3  . LYS A 1 80 ? -13.904 6.235   -7.669  1.00 1.00 ? 80  LYS A HD3  4  
ATOM   5227  H HE2  . LYS A 1 80 ? -13.244 3.921   -6.481  1.00 1.00 ? 80  LYS A HE2  4  
ATOM   5228  H HE3  . LYS A 1 80 ? -14.990 3.708   -6.476  1.00 1.00 ? 80  LYS A HE3  4  
ATOM   5229  H HZ1  . LYS A 1 80 ? -14.875 4.388   -8.906  1.00 1.00 ? 80  LYS A HZ1  4  
ATOM   5230  H HZ2  . LYS A 1 80 ? -14.309 2.836   -8.504  1.00 1.00 ? 80  LYS A HZ2  4  
ATOM   5231  H HZ3  . LYS A 1 80 ? -13.208 4.096   -8.797  1.00 1.00 ? 80  LYS A HZ3  4  
ATOM   5232  N N    . LYS A 1 81 ? -17.956 6.546   -4.889  1.00 1.00 ? 81  LYS A N    4  
ATOM   5233  C CA   . LYS A 1 81 ? -19.212 6.626   -5.627  1.00 1.00 ? 81  LYS A CA   4  
ATOM   5234  C C    . LYS A 1 81 ? -20.389 6.802   -4.676  1.00 1.00 ? 81  LYS A C    4  
ATOM   5235  O O    . LYS A 1 81 ? -20.878 5.844   -4.075  1.00 1.00 ? 81  LYS A O    4  
ATOM   5236  C CB   . LYS A 1 81 ? -19.404 5.353   -6.465  1.00 1.00 ? 81  LYS A CB   4  
ATOM   5237  C CG   . LYS A 1 81 ? -18.641 5.479   -7.789  1.00 1.00 ? 81  LYS A CG   4  
ATOM   5238  C CD   . LYS A 1 81 ? -18.733 4.164   -8.565  1.00 1.00 ? 81  LYS A CD   4  
ATOM   5239  C CE   . LYS A 1 81 ? -17.888 4.259   -9.836  1.00 1.00 ? 81  LYS A CE   4  
ATOM   5240  N NZ   . LYS A 1 81 ? -18.412 5.357   -10.697 1.00 1.00 ? 81  LYS A NZ   4  
ATOM   5241  H H    . LYS A 1 81 ? -17.824 5.835   -4.214  1.00 1.00 ? 81  LYS A H    4  
ATOM   5242  H HA   . LYS A 1 81 ? -19.183 7.478   -6.291  1.00 1.00 ? 81  LYS A HA   4  
ATOM   5243  H HB2  . LYS A 1 81 ? -19.027 4.505   -5.912  1.00 1.00 ? 81  LYS A HB2  4  
ATOM   5244  H HB3  . LYS A 1 81 ? -20.454 5.207   -6.671  1.00 1.00 ? 81  LYS A HB3  4  
ATOM   5245  H HG2  . LYS A 1 81 ? -19.074 6.276   -8.376  1.00 1.00 ? 81  LYS A HG2  4  
ATOM   5246  H HG3  . LYS A 1 81 ? -17.604 5.705   -7.588  1.00 1.00 ? 81  LYS A HG3  4  
ATOM   5247  H HD2  . LYS A 1 81 ? -18.368 3.356   -7.947  1.00 1.00 ? 81  LYS A HD2  4  
ATOM   5248  H HD3  . LYS A 1 81 ? -19.762 3.974   -8.832  1.00 1.00 ? 81  LYS A HD3  4  
ATOM   5249  H HE2  . LYS A 1 81 ? -16.862 4.467   -9.572  1.00 1.00 ? 81  LYS A HE2  4  
ATOM   5250  H HE3  . LYS A 1 81 ? -17.940 3.324   -10.374 1.00 1.00 ? 81  LYS A HE3  4  
ATOM   5251  H HZ1  . LYS A 1 81 ? -19.084 5.935   -10.153 1.00 1.00 ? 81  LYS A HZ1  4  
ATOM   5252  H HZ2  . LYS A 1 81 ? -18.896 4.949   -11.524 1.00 1.00 ? 81  LYS A HZ2  4  
ATOM   5253  H HZ3  . LYS A 1 81 ? -17.624 5.955   -11.017 1.00 1.00 ? 81  LYS A HZ3  4  
ATOM   5254  N N    . ALA A 1 82 ? -20.837 8.037   -4.566  1.00 1.00 ? 82  ALA A N    4  
ATOM   5255  C CA   . ALA A 1 82 ? -21.966 8.354   -3.707  1.00 1.00 ? 82  ALA A CA   4  
ATOM   5256  C C    . ALA A 1 82 ? -21.752 7.781   -2.311  1.00 1.00 ? 82  ALA A C    4  
ATOM   5257  O O    . ALA A 1 82 ? -22.452 6.843   -1.965  1.00 1.00 ? 82  ALA A O    4  
ATOM   5258  C CB   . ALA A 1 82 ? -23.251 7.783   -4.310  1.00 1.00 ? 82  ALA A CB   4  
ATOM   5259  O OXT  . ALA A 1 82 ? -20.891 8.286   -1.609  1.00 1.00 ? 82  ALA A OXT  4  
ATOM   5260  H H    . ALA A 1 82 ? -20.403 8.749   -5.079  1.00 1.00 ? 82  ALA A H    4  
ATOM   5261  H HA   . ALA A 1 82 ? -22.057 9.423   -3.638  1.00 1.00 ? 82  ALA A HA   4  
ATOM   5262  H HB1  . ALA A 1 82 ? -23.283 8.012   -5.366  1.00 1.00 ? 82  ALA A HB1  4  
ATOM   5263  H HB2  . ALA A 1 82 ? -24.105 8.221   -3.820  1.00 1.00 ? 82  ALA A HB2  4  
ATOM   5264  H HB3  . ALA A 1 82 ? -23.265 6.712   -4.175  1.00 1.00 ? 82  ALA A HB3  4  
HETATM 5265  O O23  . PNS B 2 .  ? 15.514  9.287   -2.299  1.00 1.00 ? 101 PNS A O23  4  
HETATM 5266  P P24  . PNS B 2 .  ? 15.266  10.449  -3.385  1.00 1.00 ? 101 PNS A P24  4  
HETATM 5267  O O25  . PNS B 2 .  ? 16.583  10.908  -3.879  1.00 1.00 ? 101 PNS A O25  4  
HETATM 5268  O O26  . PNS B 2 .  ? 14.243  9.977   -4.343  1.00 1.00 ? 101 PNS A O26  4  
HETATM 5269  O O27  . PNS B 2 .  ? 14.620  11.628  -2.498  1.00 1.00 ? 101 PNS A O27  4  
HETATM 5270  C C28  . PNS B 2 .  ? 15.109  11.898  -1.191  1.00 1.00 ? 101 PNS A C28  4  
HETATM 5271  C C29  . PNS B 2 .  ? 14.313  13.060  -0.586  1.00 1.00 ? 101 PNS A C29  4  
HETATM 5272  C C30  . PNS B 2 .  ? 14.553  14.333  -1.391  1.00 1.00 ? 101 PNS A C30  4  
HETATM 5273  C C31  . PNS B 2 .  ? 14.757  13.266  0.868   1.00 1.00 ? 101 PNS A C31  4  
HETATM 5274  C C32  . PNS B 2 .  ? 12.822  12.752  -0.637  1.00 1.00 ? 101 PNS A C32  4  
HETATM 5275  O O33  . PNS B 2 .  ? 12.608  11.496  -0.012  1.00 1.00 ? 101 PNS A O33  4  
HETATM 5276  C C34  . PNS B 2 .  ? 12.031  13.832  0.098   1.00 1.00 ? 101 PNS A C34  4  
HETATM 5277  O O35  . PNS B 2 .  ? 11.775  14.905  -0.447  1.00 1.00 ? 101 PNS A O35  4  
HETATM 5278  N N36  . PNS B 2 .  ? 11.646  13.539  1.335   1.00 1.00 ? 101 PNS A N36  4  
HETATM 5279  C C37  . PNS B 2 .  ? 10.884  14.494  2.134   1.00 1.00 ? 101 PNS A C37  4  
HETATM 5280  C C38  . PNS B 2 .  ? 10.159  13.774  3.274   1.00 1.00 ? 101 PNS A C38  4  
HETATM 5281  C C39  . PNS B 2 .  ? 11.114  12.822  3.984   1.00 1.00 ? 101 PNS A C39  4  
HETATM 5282  O O40  . PNS B 2 .  ? 11.981  12.212  3.355   1.00 1.00 ? 101 PNS A O40  4  
HETATM 5283  N N41  . PNS B 2 .  ? 10.952  12.698  5.297   1.00 1.00 ? 101 PNS A N41  4  
HETATM 5284  C C42  . PNS B 2 .  ? 11.806  11.816  6.084   1.00 1.00 ? 101 PNS A C42  4  
HETATM 5285  C C43  . PNS B 2 .  ? 11.752  12.206  7.562   1.00 1.00 ? 101 PNS A C43  4  
HETATM 5286  S S44  . PNS B 2 .  ? 10.196  11.674  8.266   1.00 1.00 ? 101 PNS A S44  4  
HETATM 5287  H H282 . PNS B 2 .  ? 16.151  12.167  -1.250  1.00 1.00 ? 101 PNS A H282 4  
HETATM 5288  H H281 . PNS B 2 .  ? 14.998  11.023  -0.566  1.00 1.00 ? 101 PNS A H281 4  
HETATM 5289  H H303 . PNS B 2 .  ? 15.615  14.525  -1.455  1.00 1.00 ? 101 PNS A H303 4  
HETATM 5290  H H302 . PNS B 2 .  ? 14.150  14.210  -2.385  1.00 1.00 ? 101 PNS A H302 4  
HETATM 5291  H H301 . PNS B 2 .  ? 14.068  15.165  -0.905  1.00 1.00 ? 101 PNS A H301 4  
HETATM 5292  H H313 . PNS B 2 .  ? 14.376  14.210  1.230   1.00 1.00 ? 101 PNS A H313 4  
HETATM 5293  H H312 . PNS B 2 .  ? 14.370  12.463  1.479   1.00 1.00 ? 101 PNS A H312 4  
HETATM 5294  H H311 . PNS B 2 .  ? 15.835  13.270  0.919   1.00 1.00 ? 101 PNS A H311 4  
HETATM 5295  H H32  . PNS B 2 .  ? 12.494  12.708  -1.670  1.00 1.00 ? 101 PNS A H32  4  
HETATM 5296  H H33  . PNS B 2 .  ? 11.666  11.407  0.156   1.00 1.00 ? 101 PNS A H33  4  
HETATM 5297  H H36  . PNS B 2 .  ? 11.878  12.668  1.719   1.00 1.00 ? 101 PNS A H36  4  
HETATM 5298  H H372 . PNS B 2 .  ? 10.158  14.987  1.505   1.00 1.00 ? 101 PNS A H372 4  
HETATM 5299  H H371 . PNS B 2 .  ? 11.556  15.232  2.550   1.00 1.00 ? 101 PNS A H371 4  
HETATM 5300  H H382 . PNS B 2 .  ? 9.790   14.502  3.980   1.00 1.00 ? 101 PNS A H382 4  
HETATM 5301  H H381 . PNS B 2 .  ? 9.330   13.212  2.872   1.00 1.00 ? 101 PNS A H381 4  
HETATM 5302  H H41  . PNS B 2 .  ? 10.243  13.208  5.744   1.00 1.00 ? 101 PNS A H41  4  
HETATM 5303  H H422 . PNS B 2 .  ? 12.822  11.898  5.729   1.00 1.00 ? 101 PNS A H422 4  
HETATM 5304  H H421 . PNS B 2 .  ? 11.472  10.795  5.971   1.00 1.00 ? 101 PNS A H421 4  
HETATM 5305  H H431 . PNS B 2 .  ? 11.841  13.279  7.654   1.00 1.00 ? 101 PNS A H431 4  
HETATM 5306  H H432 . PNS B 2 .  ? 12.564  11.730  8.090   1.00 1.00 ? 101 PNS A H432 4  
HETATM 5307  C C1   . STE C 3 .  ? 9.859   9.973   8.162   1.00 1.00 ? 102 STE A C1   4  
HETATM 5308  O O1   . STE C 3 .  ? 10.613  9.177   7.649   1.00 1.00 ? 102 STE A O1   4  
HETATM 5309  C C2   . STE C 3 .  ? 8.538   9.628   8.783   1.00 1.00 ? 102 STE A C2   4  
HETATM 5310  C C3   . STE C 3 .  ? 8.240   8.139   8.584   1.00 1.00 ? 102 STE A C3   4  
HETATM 5311  C C4   . STE C 3 .  ? 7.766   7.903   7.146   1.00 1.00 ? 102 STE A C4   4  
HETATM 5312  C C5   . STE C 3 .  ? 7.841   6.408   6.815   1.00 1.00 ? 102 STE A C5   4  
HETATM 5313  C C6   . STE C 3 .  ? 6.990   6.100   5.573   1.00 1.00 ? 102 STE A C6   4  
HETATM 5314  C C7   . STE C 3 .  ? 5.524   5.864   5.978   1.00 1.00 ? 102 STE A C7   4  
HETATM 5315  C C8   . STE C 3 .  ? 4.695   5.455   4.747   1.00 1.00 ? 102 STE A C8   4  
HETATM 5316  C C9   . STE C 3 .  ? 4.775   3.940   4.541   1.00 1.00 ? 102 STE A C9   4  
HETATM 5317  C C10  . STE C 3 .  ? 4.241   3.582   3.155   1.00 1.00 ? 102 STE A C10  4  
HETATM 5318  C C11  . STE C 3 .  ? 2.755   3.927   3.078   1.00 1.00 ? 102 STE A C11  4  
HETATM 5319  C C12  . STE C 3 .  ? 2.129   3.218   1.882   1.00 1.00 ? 102 STE A C12  4  
HETATM 5320  C C13  . STE C 3 .  ? 0.732   3.785   1.642   1.00 1.00 ? 102 STE A C13  4  
HETATM 5321  C C14  . STE C 3 .  ? 0.171   3.214   0.338   1.00 1.00 ? 102 STE A C14  4  
HETATM 5322  C C15  . STE C 3 .  ? -1.205  3.830   0.040   1.00 1.00 ? 102 STE A C15  4  
HETATM 5323  C C16  . STE C 3 .  ? -2.304  3.041   0.758   1.00 1.00 ? 102 STE A C16  4  
HETATM 5324  C C17  . STE C 3 .  ? -3.598  3.848   0.732   1.00 1.00 ? 102 STE A C17  4  
HETATM 5325  C C18  . STE C 3 .  ? -4.051  4.039   -0.718  1.00 1.00 ? 102 STE A C18  4  
HETATM 5326  H H21  . STE C 3 .  ? 8.570   9.849   9.840   1.00 1.00 ? 102 STE A H21  4  
HETATM 5327  H H22  . STE C 3 .  ? 7.760   10.217  8.319   1.00 1.00 ? 102 STE A H22  4  
HETATM 5328  H H31  . STE C 3 .  ? 7.465   7.831   9.271   1.00 1.00 ? 102 STE A H31  4  
HETATM 5329  H H32  . STE C 3 .  ? 9.135   7.561   8.769   1.00 1.00 ? 102 STE A H32  4  
HETATM 5330  H H41  . STE C 3 .  ? 8.398   8.451   6.464   1.00 1.00 ? 102 STE A H41  4  
HETATM 5331  H H42  . STE C 3 .  ? 6.749   8.247   7.047   1.00 1.00 ? 102 STE A H42  4  
HETATM 5332  H H51  . STE C 3 .  ? 7.480   5.833   7.655   1.00 1.00 ? 102 STE A H51  4  
HETATM 5333  H H52  . STE C 3 .  ? 8.871   6.142   6.618   1.00 1.00 ? 102 STE A H52  4  
HETATM 5334  H H61  . STE C 3 .  ? 7.374   5.216   5.090   1.00 1.00 ? 102 STE A H61  4  
HETATM 5335  H H62  . STE C 3 .  ? 7.040   6.931   4.881   1.00 1.00 ? 102 STE A H62  4  
HETATM 5336  H H71  . STE C 3 .  ? 5.114   6.771   6.393   1.00 1.00 ? 102 STE A H71  4  
HETATM 5337  H H72  . STE C 3 .  ? 5.479   5.081   6.724   1.00 1.00 ? 102 STE A H72  4  
HETATM 5338  H H81  . STE C 3 .  ? 5.072   5.957   3.867   1.00 1.00 ? 102 STE A H81  4  
HETATM 5339  H H82  . STE C 3 .  ? 3.663   5.740   4.905   1.00 1.00 ? 102 STE A H82  4  
HETATM 5340  H H91  . STE C 3 .  ? 4.178   3.446   5.293   1.00 1.00 ? 102 STE A H91  4  
HETATM 5341  H H92  . STE C 3 .  ? 5.798   3.616   4.627   1.00 1.00 ? 102 STE A H92  4  
HETATM 5342  H H101 . STE C 3 .  ? 4.376   2.525   2.977   1.00 1.00 ? 102 STE A H101 4  
HETATM 5343  H H102 . STE C 3 .  ? 4.781   4.145   2.406   1.00 1.00 ? 102 STE A H102 4  
HETATM 5344  H H111 . STE C 3 .  ? 2.640   4.993   2.960   1.00 1.00 ? 102 STE A H111 4  
HETATM 5345  H H112 . STE C 3 .  ? 2.258   3.608   3.984   1.00 1.00 ? 102 STE A H112 4  
HETATM 5346  H H121 . STE C 3 .  ? 2.055   2.160   2.086   1.00 1.00 ? 102 STE A H121 4  
HETATM 5347  H H122 . STE C 3 .  ? 2.742   3.376   1.007   1.00 1.00 ? 102 STE A H122 4  
HETATM 5348  H H131 . STE C 3 .  ? 0.785   4.861   1.566   1.00 1.00 ? 102 STE A H131 4  
HETATM 5349  H H132 . STE C 3 .  ? 0.091   3.513   2.464   1.00 1.00 ? 102 STE A H132 4  
HETATM 5350  H H141 . STE C 3 .  ? 0.079   2.142   0.426   1.00 1.00 ? 102 STE A H141 4  
HETATM 5351  H H142 . STE C 3 .  ? 0.849   3.451   -0.468  1.00 1.00 ? 102 STE A H142 4  
HETATM 5352  H H151 . STE C 3 .  ? -1.388  3.799   -1.024  1.00 1.00 ? 102 STE A H151 4  
HETATM 5353  H H152 . STE C 3 .  ? -1.225  4.859   0.373   1.00 1.00 ? 102 STE A H152 4  
HETATM 5354  H H161 . STE C 3 .  ? -2.017  2.861   1.777   1.00 1.00 ? 102 STE A H161 4  
HETATM 5355  H H162 . STE C 3 .  ? -2.459  2.100   0.259   1.00 1.00 ? 102 STE A H162 4  
HETATM 5356  H H171 . STE C 3 .  ? -3.432  4.813   1.186   1.00 1.00 ? 102 STE A H171 4  
HETATM 5357  H H172 . STE C 3 .  ? -4.358  3.318   1.280   1.00 1.00 ? 102 STE A H172 4  
HETATM 5358  H H181 . STE C 3 .  ? -3.860  3.139   -1.284  1.00 1.00 ? 102 STE A H181 4  
HETATM 5359  H H182 . STE C 3 .  ? -3.507  4.858   -1.156  1.00 1.00 ? 102 STE A H182 4  
HETATM 5360  H H183 . STE C 3 .  ? -5.106  4.257   -0.737  1.00 1.00 ? 102 STE A H183 4  
ATOM   5361  N N    . ALA A 1 1  ? -10.974 -3.125  6.950   1.00 1.00 ? 1   ALA A N    5  
ATOM   5362  C CA   . ALA A 1 1  ? -10.712 -3.296  5.493   1.00 1.00 ? 1   ALA A CA   5  
ATOM   5363  C C    . ALA A 1 1  ? -10.927 -4.758  5.108   1.00 1.00 ? 1   ALA A C    5  
ATOM   5364  O O    . ALA A 1 1  ? -10.832 -5.651  5.949   1.00 1.00 ? 1   ALA A O    5  
ATOM   5365  C CB   . ALA A 1 1  ? -9.273  -2.875  5.180   1.00 1.00 ? 1   ALA A CB   5  
ATOM   5366  H H1   . ALA A 1 1  ? -11.836 -3.645  7.210   1.00 1.00 ? 1   ALA A H1   5  
ATOM   5367  H H2   . ALA A 1 1  ? -11.099 -2.115  7.163   1.00 1.00 ? 1   ALA A H2   5  
ATOM   5368  H H3   . ALA A 1 1  ? -10.170 -3.500  7.493   1.00 1.00 ? 1   ALA A H3   5  
ATOM   5369  H HA   . ALA A 1 1  ? -11.394 -2.676  4.931   1.00 1.00 ? 1   ALA A HA   5  
ATOM   5370  H HB1  . ALA A 1 1  ? -8.594  -3.673  5.440   1.00 1.00 ? 1   ALA A HB1  5  
ATOM   5371  H HB2  . ALA A 1 1  ? -9.019  -1.995  5.751   1.00 1.00 ? 1   ALA A HB2  5  
ATOM   5372  H HB3  . ALA A 1 1  ? -9.183  -2.655  4.127   1.00 1.00 ? 1   ALA A HB3  5  
ATOM   5373  N N    . LYS A 1 2  ? -11.209 -4.997  3.830   1.00 1.00 ? 2   LYS A N    5  
ATOM   5374  C CA   . LYS A 1 2  ? -11.428 -6.357  3.349   1.00 1.00 ? 2   LYS A CA   5  
ATOM   5375  C C    . LYS A 1 2  ? -10.096 -7.083  3.209   1.00 1.00 ? 2   LYS A C    5  
ATOM   5376  O O    . LYS A 1 2  ? -9.075  -6.469  2.911   1.00 1.00 ? 2   LYS A O    5  
ATOM   5377  C CB   . LYS A 1 2  ? -12.144 -6.334  1.998   1.00 1.00 ? 2   LYS A CB   5  
ATOM   5378  C CG   . LYS A 1 2  ? -13.543 -5.743  2.169   1.00 1.00 ? 2   LYS A CG   5  
ATOM   5379  C CD   . LYS A 1 2  ? -14.249 -5.709  0.813   1.00 1.00 ? 2   LYS A CD   5  
ATOM   5380  C CE   . LYS A 1 2  ? -15.616 -5.040  0.968   1.00 1.00 ? 2   LYS A CE   5  
ATOM   5381  N NZ   . LYS A 1 2  ? -16.494 -5.896  1.814   1.00 1.00 ? 2   LYS A NZ   5  
ATOM   5382  H H    . LYS A 1 2  ? -11.270 -4.246  3.201   1.00 1.00 ? 2   LYS A H    5  
ATOM   5383  H HA   . LYS A 1 2  ? -12.043 -6.886  4.062   1.00 1.00 ? 2   LYS A HA   5  
ATOM   5384  H HB2  . LYS A 1 2  ? -11.579 -5.732  1.302   1.00 1.00 ? 2   LYS A HB2  5  
ATOM   5385  H HB3  . LYS A 1 2  ? -12.226 -7.341  1.619   1.00 1.00 ? 2   LYS A HB3  5  
ATOM   5386  H HG2  . LYS A 1 2  ? -14.111 -6.355  2.857   1.00 1.00 ? 2   LYS A HG2  5  
ATOM   5387  H HG3  . LYS A 1 2  ? -13.466 -4.739  2.558   1.00 1.00 ? 2   LYS A HG3  5  
ATOM   5388  H HD2  . LYS A 1 2  ? -13.651 -5.149  0.109   1.00 1.00 ? 2   LYS A HD2  5  
ATOM   5389  H HD3  . LYS A 1 2  ? -14.385 -6.717  0.451   1.00 1.00 ? 2   LYS A HD3  5  
ATOM   5390  H HE2  . LYS A 1 2  ? -15.494 -4.075  1.439   1.00 1.00 ? 2   LYS A HE2  5  
ATOM   5391  H HE3  . LYS A 1 2  ? -16.068 -4.913  -0.004  1.00 1.00 ? 2   LYS A HE3  5  
ATOM   5392  H HZ1  . LYS A 1 2  ? -16.151 -5.881  2.795   1.00 1.00 ? 2   LYS A HZ1  5  
ATOM   5393  H HZ2  . LYS A 1 2  ? -16.476 -6.873  1.455   1.00 1.00 ? 2   LYS A HZ2  5  
ATOM   5394  H HZ3  . LYS A 1 2  ? -17.467 -5.534  1.785   1.00 1.00 ? 2   LYS A HZ3  5  
ATOM   5395  N N    . LYS A 1 3  ? -10.111 -8.390  3.430   1.00 1.00 ? 3   LYS A N    5  
ATOM   5396  C CA   . LYS A 1 3  ? -8.888  -9.181  3.335   1.00 1.00 ? 3   LYS A CA   5  
ATOM   5397  C C    . LYS A 1 3  ? -8.299  -9.092  1.936   1.00 1.00 ? 3   LYS A C    5  
ATOM   5398  O O    . LYS A 1 3  ? -7.084  -9.004  1.768   1.00 1.00 ? 3   LYS A O    5  
ATOM   5399  C CB   . LYS A 1 3  ? -9.181  -10.643 3.659   1.00 1.00 ? 3   LYS A CB   5  
ATOM   5400  C CG   . LYS A 1 3  ? -9.645  -10.765 5.111   1.00 1.00 ? 3   LYS A CG   5  
ATOM   5401  C CD   . LYS A 1 3  ? -9.743  -12.242 5.502   1.00 1.00 ? 3   LYS A CD   5  
ATOM   5402  C CE   . LYS A 1 3  ? -10.860 -12.925 4.709   1.00 1.00 ? 3   LYS A CE   5  
ATOM   5403  N NZ   . LYS A 1 3  ? -11.214 -14.213 5.368   1.00 1.00 ? 3   LYS A NZ   5  
ATOM   5404  H H    . LYS A 1 3  ? -10.953 -8.829  3.668   1.00 1.00 ? 3   LYS A H    5  
ATOM   5405  H HA   . LYS A 1 3  ? -8.167  -8.802  4.044   1.00 1.00 ? 3   LYS A HA   5  
ATOM   5406  H HB2  . LYS A 1 3  ? -9.955  -10.999 2.999   1.00 1.00 ? 3   LYS A HB2  5  
ATOM   5407  H HB3  . LYS A 1 3  ? -8.287  -11.231 3.516   1.00 1.00 ? 3   LYS A HB3  5  
ATOM   5408  H HG2  . LYS A 1 3  ? -8.935  -10.268 5.756   1.00 1.00 ? 3   LYS A HG2  5  
ATOM   5409  H HG3  . LYS A 1 3  ? -10.614 -10.301 5.217   1.00 1.00 ? 3   LYS A HG3  5  
ATOM   5410  H HD2  . LYS A 1 3  ? -8.804  -12.733 5.293   1.00 1.00 ? 3   LYS A HD2  5  
ATOM   5411  H HD3  . LYS A 1 3  ? -9.960  -12.318 6.557   1.00 1.00 ? 3   LYS A HD3  5  
ATOM   5412  H HE2  . LYS A 1 3  ? -11.727 -12.284 4.676   1.00 1.00 ? 3   LYS A HE2  5  
ATOM   5413  H HE3  . LYS A 1 3  ? -10.519 -13.121 3.701   1.00 1.00 ? 3   LYS A HE3  5  
ATOM   5414  H HZ1  . LYS A 1 3  ? -11.531 -14.895 4.651   1.00 1.00 ? 3   LYS A HZ1  5  
ATOM   5415  H HZ2  . LYS A 1 3  ? -11.978 -14.050 6.056   1.00 1.00 ? 3   LYS A HZ2  5  
ATOM   5416  H HZ3  . LYS A 1 3  ? -10.379 -14.593 5.858   1.00 1.00 ? 3   LYS A HZ3  5  
ATOM   5417  N N    . GLU A 1 4  ? -9.165  -9.123  0.934   1.00 1.00 ? 4   GLU A N    5  
ATOM   5418  C CA   . GLU A 1 4  ? -8.706  -9.054  -0.442  1.00 1.00 ? 4   GLU A CA   5  
ATOM   5419  C C    . GLU A 1 4  ? -7.921  -7.762  -0.674  1.00 1.00 ? 4   GLU A C    5  
ATOM   5420  O O    . GLU A 1 4  ? -6.853  -7.776  -1.285  1.00 1.00 ? 4   GLU A O    5  
ATOM   5421  C CB   . GLU A 1 4  ? -9.907  -9.120  -1.394  1.00 1.00 ? 4   GLU A CB   5  
ATOM   5422  C CG   . GLU A 1 4  ? -10.716 -7.824  -1.298  1.00 1.00 ? 4   GLU A CG   5  
ATOM   5423  C CD   . GLU A 1 4  ? -12.077 -8.004  -1.960  1.00 1.00 ? 4   GLU A CD   5  
ATOM   5424  O OE1  . GLU A 1 4  ? -12.286 -9.038  -2.572  1.00 1.00 ? 4   GLU A OE1  5  
ATOM   5425  O OE2  . GLU A 1 4  ? -12.892 -7.103  -1.846  1.00 1.00 ? 4   GLU A OE2  5  
ATOM   5426  H H    . GLU A 1 4  ? -10.124 -9.201  1.122   1.00 1.00 ? 4   GLU A H    5  
ATOM   5427  H HA   . GLU A 1 4  ? -8.061  -9.898  -0.636  1.00 1.00 ? 4   GLU A HA   5  
ATOM   5428  H HB2  . GLU A 1 4  ? -9.555  -9.249  -2.407  1.00 1.00 ? 4   GLU A HB2  5  
ATOM   5429  H HB3  . GLU A 1 4  ? -10.535 -9.955  -1.122  1.00 1.00 ? 4   GLU A HB3  5  
ATOM   5430  H HG2  . GLU A 1 4  ? -10.853 -7.563  -0.259  1.00 1.00 ? 4   GLU A HG2  5  
ATOM   5431  H HG3  . GLU A 1 4  ? -10.181 -7.031  -1.799  1.00 1.00 ? 4   GLU A HG3  5  
ATOM   5432  N N    . THR A 1 5  ? -8.459  -6.647  -0.183  1.00 1.00 ? 5   THR A N    5  
ATOM   5433  C CA   . THR A 1 5  ? -7.801  -5.356  -0.342  1.00 1.00 ? 5   THR A CA   5  
ATOM   5434  C C    . THR A 1 5  ? -6.497  -5.309  0.448   1.00 1.00 ? 5   THR A C    5  
ATOM   5435  O O    . THR A 1 5  ? -5.485  -4.829  -0.042  1.00 1.00 ? 5   THR A O    5  
ATOM   5436  C CB   . THR A 1 5  ? -8.734  -4.226  0.114   1.00 1.00 ? 5   THR A CB   5  
ATOM   5437  O OG1  . THR A 1 5  ? -10.032 -4.471  -0.405  1.00 1.00 ? 5   THR A OG1  5  
ATOM   5438  C CG2  . THR A 1 5  ? -8.223  -2.894  -0.445  1.00 1.00 ? 5   THR A CG2  5  
ATOM   5439  H H    . THR A 1 5  ? -9.312  -6.694  0.297   1.00 1.00 ? 5   THR A H    5  
ATOM   5440  H HA   . THR A 1 5  ? -7.572  -5.213  -1.389  1.00 1.00 ? 5   THR A HA   5  
ATOM   5441  H HB   . THR A 1 5  ? -8.764  -4.171  1.198   1.00 1.00 ? 5   THR A HB   5  
ATOM   5442  H HG1  . THR A 1 5  ? -10.398 -3.632  -0.695  1.00 1.00 ? 5   THR A HG1  5  
ATOM   5443  H HG21 . THR A 1 5  ? -8.697  -2.078  0.079   1.00 1.00 ? 5   THR A HG21 5  
ATOM   5444  H HG22 . THR A 1 5  ? -8.462  -2.834  -1.499  1.00 1.00 ? 5   THR A HG22 5  
ATOM   5445  H HG23 . THR A 1 5  ? -7.153  -2.835  -0.314  1.00 1.00 ? 5   THR A HG23 5  
ATOM   5446  N N    . ILE A 1 6  ? -6.536  -5.812  1.679   1.00 1.00 ? 6   ILE A N    5  
ATOM   5447  C CA   . ILE A 1 6  ? -5.360  -5.815  2.543   1.00 1.00 ? 6   ILE A CA   5  
ATOM   5448  C C    . ILE A 1 6  ? -4.218  -6.605  1.910   1.00 1.00 ? 6   ILE A C    5  
ATOM   5449  O O    . ILE A 1 6  ? -3.071  -6.157  1.914   1.00 1.00 ? 6   ILE A O    5  
ATOM   5450  C CB   . ILE A 1 6  ? -5.732  -6.437  3.896   1.00 1.00 ? 6   ILE A CB   5  
ATOM   5451  C CG1  . ILE A 1 6  ? -6.695  -5.509  4.641   1.00 1.00 ? 6   ILE A CG1  5  
ATOM   5452  C CG2  . ILE A 1 6  ? -4.474  -6.638  4.746   1.00 1.00 ? 6   ILE A CG2  5  
ATOM   5453  C CD1  . ILE A 1 6  ? -7.313  -6.259  5.825   1.00 1.00 ? 6   ILE A CD1  5  
ATOM   5454  H H    . ILE A 1 6  ? -7.379  -6.182  2.017   1.00 1.00 ? 6   ILE A H    5  
ATOM   5455  H HA   . ILE A 1 6  ? -5.039  -4.801  2.703   1.00 1.00 ? 6   ILE A HA   5  
ATOM   5456  H HB   . ILE A 1 6  ? -6.208  -7.393  3.731   1.00 1.00 ? 6   ILE A HB   5  
ATOM   5457  H HG12 . ILE A 1 6  ? -6.156  -4.649  5.004   1.00 1.00 ? 6   ILE A HG12 5  
ATOM   5458  H HG13 . ILE A 1 6  ? -7.477  -5.187  3.972   1.00 1.00 ? 6   ILE A HG13 5  
ATOM   5459  H HG21 . ILE A 1 6  ? -3.919  -7.484  4.372   1.00 1.00 ? 6   ILE A HG21 5  
ATOM   5460  H HG22 . ILE A 1 6  ? -4.761  -6.819  5.772   1.00 1.00 ? 6   ILE A HG22 5  
ATOM   5461  H HG23 . ILE A 1 6  ? -3.859  -5.751  4.695   1.00 1.00 ? 6   ILE A HG23 5  
ATOM   5462  H HD11 . ILE A 1 6  ? -8.085  -6.923  5.467   1.00 1.00 ? 6   ILE A HD11 5  
ATOM   5463  H HD12 . ILE A 1 6  ? -7.740  -5.549  6.517   1.00 1.00 ? 6   ILE A HD12 5  
ATOM   5464  H HD13 . ILE A 1 6  ? -6.549  -6.832  6.328   1.00 1.00 ? 6   ILE A HD13 5  
ATOM   5465  N N    . ASP A 1 7  ? -4.534  -7.769  1.361   1.00 1.00 ? 7   ASP A N    5  
ATOM   5466  C CA   . ASP A 1 7  ? -3.519  -8.594  0.719   1.00 1.00 ? 7   ASP A CA   5  
ATOM   5467  C C    . ASP A 1 7  ? -2.943  -7.867  -0.496  1.00 1.00 ? 7   ASP A C    5  
ATOM   5468  O O    . ASP A 1 7  ? -1.742  -7.934  -0.761  1.00 1.00 ? 7   ASP A O    5  
ATOM   5469  C CB   . ASP A 1 7  ? -4.138  -9.926  0.291   1.00 1.00 ? 7   ASP A CB   5  
ATOM   5470  C CG   . ASP A 1 7  ? -4.382  -10.808 1.512   1.00 1.00 ? 7   ASP A CG   5  
ATOM   5471  O OD1  . ASP A 1 7  ? -3.855  -10.490 2.566   1.00 1.00 ? 7   ASP A OD1  5  
ATOM   5472  O OD2  . ASP A 1 7  ? -5.097  -11.789 1.379   1.00 1.00 ? 7   ASP A OD2  5  
ATOM   5473  H H    . ASP A 1 7  ? -5.464  -8.075  1.378   1.00 1.00 ? 7   ASP A H    5  
ATOM   5474  H HA   . ASP A 1 7  ? -2.721  -8.787  1.422   1.00 1.00 ? 7   ASP A HA   5  
ATOM   5475  H HB2  . ASP A 1 7  ? -5.079  -9.740  -0.209  1.00 1.00 ? 7   ASP A HB2  5  
ATOM   5476  H HB3  . ASP A 1 7  ? -3.470  -10.429 -0.387  1.00 1.00 ? 7   ASP A HB3  5  
ATOM   5477  N N    . LYS A 1 8  ? -3.812  -7.166  -1.223  1.00 1.00 ? 8   LYS A N    5  
ATOM   5478  C CA   . LYS A 1 8  ? -3.392  -6.416  -2.409  1.00 1.00 ? 8   LYS A CA   5  
ATOM   5479  C C    . LYS A 1 8  ? -2.414  -5.306  -2.037  1.00 1.00 ? 8   LYS A C    5  
ATOM   5480  O O    . LYS A 1 8  ? -1.397  -5.118  -2.702  1.00 1.00 ? 8   LYS A O    5  
ATOM   5481  C CB   . LYS A 1 8  ? -4.624  -5.789  -3.080  1.00 1.00 ? 8   LYS A CB   5  
ATOM   5482  C CG   . LYS A 1 8  ? -5.407  -6.841  -3.878  1.00 1.00 ? 8   LYS A CG   5  
ATOM   5483  C CD   . LYS A 1 8  ? -4.807  -7.001  -5.293  1.00 1.00 ? 8   LYS A CD   5  
ATOM   5484  C CE   . LYS A 1 8  ? -5.413  -5.965  -6.250  1.00 1.00 ? 8   LYS A CE   5  
ATOM   5485  N NZ   . LYS A 1 8  ? -4.820  -6.133  -7.607  1.00 1.00 ? 8   LYS A NZ   5  
ATOM   5486  H H    . LYS A 1 8  ? -4.753  -7.149  -0.954  1.00 1.00 ? 8   LYS A H    5  
ATOM   5487  H HA   . LYS A 1 8  ? -2.911  -7.089  -3.106  1.00 1.00 ? 8   LYS A HA   5  
ATOM   5488  H HB2  . LYS A 1 8  ? -5.266  -5.387  -2.311  1.00 1.00 ? 8   LYS A HB2  5  
ATOM   5489  H HB3  . LYS A 1 8  ? -4.314  -4.991  -3.740  1.00 1.00 ? 8   LYS A HB3  5  
ATOM   5490  H HG2  . LYS A 1 8  ? -5.370  -7.784  -3.358  1.00 1.00 ? 8   LYS A HG2  5  
ATOM   5491  H HG3  . LYS A 1 8  ? -6.437  -6.526  -3.960  1.00 1.00 ? 8   LYS A HG3  5  
ATOM   5492  H HD2  . LYS A 1 8  ? -3.735  -6.861  -5.254  1.00 1.00 ? 8   LYS A HD2  5  
ATOM   5493  H HD3  . LYS A 1 8  ? -5.021  -7.994  -5.662  1.00 1.00 ? 8   LYS A HD3  5  
ATOM   5494  H HE2  . LYS A 1 8  ? -6.482  -6.109  -6.307  1.00 1.00 ? 8   LYS A HE2  5  
ATOM   5495  H HE3  . LYS A 1 8  ? -5.203  -4.969  -5.889  1.00 1.00 ? 8   LYS A HE3  5  
ATOM   5496  H HZ1  . LYS A 1 8  ? -5.245  -5.445  -8.259  1.00 1.00 ? 8   LYS A HZ1  5  
ATOM   5497  H HZ2  . LYS A 1 8  ? -5.004  -7.099  -7.949  1.00 1.00 ? 8   LYS A HZ2  5  
ATOM   5498  H HZ3  . LYS A 1 8  ? -3.794  -5.970  -7.559  1.00 1.00 ? 8   LYS A HZ3  5  
ATOM   5499  N N    . VAL A 1 9  ? -2.727  -4.565  -0.981  1.00 1.00 ? 9   VAL A N    5  
ATOM   5500  C CA   . VAL A 1 9  ? -1.851  -3.476  -0.564  1.00 1.00 ? 9   VAL A CA   5  
ATOM   5501  C C    . VAL A 1 9  ? -0.479  -4.027  -0.210  1.00 1.00 ? 9   VAL A C    5  
ATOM   5502  O O    . VAL A 1 9  ? 0.547   -3.503  -0.647  1.00 1.00 ? 9   VAL A O    5  
ATOM   5503  C CB   . VAL A 1 9  ? -2.436  -2.744  0.646   1.00 1.00 ? 9   VAL A CB   5  
ATOM   5504  C CG1  . VAL A 1 9  ? -1.441  -1.684  1.131   1.00 1.00 ? 9   VAL A CG1  5  
ATOM   5505  C CG2  . VAL A 1 9  ? -3.745  -2.056  0.252   1.00 1.00 ? 9   VAL A CG2  5  
ATOM   5506  H H    . VAL A 1 9  ? -3.555  -4.747  -0.488  1.00 1.00 ? 9   VAL A H    5  
ATOM   5507  H HA   . VAL A 1 9  ? -1.747  -2.778  -1.381  1.00 1.00 ? 9   VAL A HA   5  
ATOM   5508  H HB   . VAL A 1 9  ? -2.624  -3.452  1.439   1.00 1.00 ? 9   VAL A HB   5  
ATOM   5509  H HG11 . VAL A 1 9  ? -1.924  -1.046  1.854   1.00 1.00 ? 9   VAL A HG11 5  
ATOM   5510  H HG12 . VAL A 1 9  ? -1.113  -1.089  0.293   1.00 1.00 ? 9   VAL A HG12 5  
ATOM   5511  H HG13 . VAL A 1 9  ? -0.588  -2.163  1.585   1.00 1.00 ? 9   VAL A HG13 5  
ATOM   5512  H HG21 . VAL A 1 9  ? -4.011  -1.323  0.999   1.00 1.00 ? 9   VAL A HG21 5  
ATOM   5513  H HG22 . VAL A 1 9  ? -4.530  -2.787  0.176   1.00 1.00 ? 9   VAL A HG22 5  
ATOM   5514  H HG23 . VAL A 1 9  ? -3.618  -1.571  -0.697  1.00 1.00 ? 9   VAL A HG23 5  
ATOM   5515  N N    . SER A 1 10 ? -0.469  -5.090  0.579   1.00 1.00 ? 10  SER A N    5  
ATOM   5516  C CA   . SER A 1 10 ? 0.782   -5.711  0.977   1.00 1.00 ? 10  SER A CA   5  
ATOM   5517  C C    . SER A 1 10 ? 1.535   -6.195  -0.257  1.00 1.00 ? 10  SER A C    5  
ATOM   5518  O O    . SER A 1 10 ? 2.744   -6.023  -0.357  1.00 1.00 ? 10  SER A O    5  
ATOM   5519  C CB   . SER A 1 10 ? 0.500   -6.901  1.905   1.00 1.00 ? 10  SER A CB   5  
ATOM   5520  O OG   . SER A 1 10 ? -0.581  -6.575  2.771   1.00 1.00 ? 10  SER A OG   5  
ATOM   5521  H H    . SER A 1 10 ? -1.315  -5.464  0.894   1.00 1.00 ? 10  SER A H    5  
ATOM   5522  H HA   . SER A 1 10 ? 1.386   -4.987  1.502   1.00 1.00 ? 10  SER A HA   5  
ATOM   5523  H HB2  . SER A 1 10 ? 0.236   -7.771  1.324   1.00 1.00 ? 10  SER A HB2  5  
ATOM   5524  H HB3  . SER A 1 10 ? 1.386   -7.118  2.489   1.00 1.00 ? 10  SER A HB3  5  
ATOM   5525  H HG   . SER A 1 10 ? -1.310  -7.162  2.562   1.00 1.00 ? 10  SER A HG   5  
ATOM   5526  N N    . ASP A 1 11 ? 0.800   -6.794  -1.192  1.00 1.00 ? 11  ASP A N    5  
ATOM   5527  C CA   . ASP A 1 11 ? 1.391   -7.319  -2.414  1.00 1.00 ? 11  ASP A CA   5  
ATOM   5528  C C    . ASP A 1 11 ? 2.156   -6.236  -3.160  1.00 1.00 ? 11  ASP A C    5  
ATOM   5529  O O    . ASP A 1 11 ? 3.289   -6.453  -3.578  1.00 1.00 ? 11  ASP A O    5  
ATOM   5530  C CB   . ASP A 1 11 ? 0.277   -7.887  -3.302  1.00 1.00 ? 11  ASP A CB   5  
ATOM   5531  C CG   . ASP A 1 11 ? -0.217  -9.222  -2.753  1.00 1.00 ? 11  ASP A CG   5  
ATOM   5532  O OD1  . ASP A 1 11 ? 0.455   -9.780  -1.900  1.00 1.00 ? 11  ASP A OD1  5  
ATOM   5533  O OD2  . ASP A 1 11 ? -1.259  -9.671  -3.199  1.00 1.00 ? 11  ASP A OD2  5  
ATOM   5534  H H    . ASP A 1 11 ? -0.161  -6.888  -1.058  1.00 1.00 ? 11  ASP A H    5  
ATOM   5535  H HA   . ASP A 1 11 ? 2.075   -8.113  -2.158  1.00 1.00 ? 11  ASP A HA   5  
ATOM   5536  H HB2  . ASP A 1 11 ? -0.545  -7.192  -3.326  1.00 1.00 ? 11  ASP A HB2  5  
ATOM   5537  H HB3  . ASP A 1 11 ? 0.647   -8.026  -4.298  1.00 1.00 ? 11  ASP A HB3  5  
ATOM   5538  N N    . ILE A 1 12 ? 1.555   -5.067  -3.305  1.00 1.00 ? 12  ILE A N    5  
ATOM   5539  C CA   . ILE A 1 12 ? 2.226   -3.975  -3.996  1.00 1.00 ? 12  ILE A CA   5  
ATOM   5540  C C    . ILE A 1 12 ? 3.601   -3.720  -3.381  1.00 1.00 ? 12  ILE A C    5  
ATOM   5541  O O    . ILE A 1 12 ? 4.578   -3.548  -4.102  1.00 1.00 ? 12  ILE A O    5  
ATOM   5542  C CB   . ILE A 1 12 ? 1.350   -2.692  -3.922  1.00 1.00 ? 12  ILE A CB   5  
ATOM   5543  C CG1  . ILE A 1 12 ? 0.455   -2.565  -5.165  1.00 1.00 ? 12  ILE A CG1  5  
ATOM   5544  C CG2  . ILE A 1 12 ? 2.217   -1.433  -3.815  1.00 1.00 ? 12  ILE A CG2  5  
ATOM   5545  C CD1  . ILE A 1 12 ? -0.543  -3.715  -5.235  1.00 1.00 ? 12  ILE A CD1  5  
ATOM   5546  H H    . ILE A 1 12 ? 0.657   -4.932  -2.935  1.00 1.00 ? 12  ILE A H    5  
ATOM   5547  H HA   . ILE A 1 12 ? 2.360   -4.252  -5.032  1.00 1.00 ? 12  ILE A HA   5  
ATOM   5548  H HB   . ILE A 1 12 ? 0.721   -2.753  -3.042  1.00 1.00 ? 12  ILE A HB   5  
ATOM   5549  H HG12 . ILE A 1 12 ? -0.084  -1.629  -5.116  1.00 1.00 ? 12  ILE A HG12 5  
ATOM   5550  H HG13 . ILE A 1 12 ? 1.073   -2.574  -6.052  1.00 1.00 ? 12  ILE A HG13 5  
ATOM   5551  H HG21 . ILE A 1 12 ? 2.994   -1.475  -4.558  1.00 1.00 ? 12  ILE A HG21 5  
ATOM   5552  H HG22 . ILE A 1 12 ? 2.658   -1.382  -2.829  1.00 1.00 ? 12  ILE A HG22 5  
ATOM   5553  H HG23 . ILE A 1 12 ? 1.611   -0.562  -3.984  1.00 1.00 ? 12  ILE A HG23 5  
ATOM   5554  H HD11 . ILE A 1 12 ? -1.284  -3.591  -4.462  1.00 1.00 ? 12  ILE A HD11 5  
ATOM   5555  H HD12 . ILE A 1 12 ? -0.026  -4.652  -5.102  1.00 1.00 ? 12  ILE A HD12 5  
ATOM   5556  H HD13 . ILE A 1 12 ? -1.028  -3.702  -6.202  1.00 1.00 ? 12  ILE A HD13 5  
ATOM   5557  N N    . VAL A 1 13 ? 3.664   -3.680  -2.061  1.00 1.00 ? 13  VAL A N    5  
ATOM   5558  C CA   . VAL A 1 13 ? 4.923   -3.415  -1.377  1.00 1.00 ? 13  VAL A CA   5  
ATOM   5559  C C    . VAL A 1 13 ? 5.945   -4.516  -1.665  1.00 1.00 ? 13  VAL A C    5  
ATOM   5560  O O    . VAL A 1 13 ? 7.113   -4.233  -1.912  1.00 1.00 ? 13  VAL A O    5  
ATOM   5561  C CB   . VAL A 1 13 ? 4.677   -3.320  0.126   1.00 1.00 ? 13  VAL A CB   5  
ATOM   5562  C CG1  . VAL A 1 13 ? 5.988   -2.980  0.836   1.00 1.00 ? 13  VAL A CG1  5  
ATOM   5563  C CG2  . VAL A 1 13 ? 3.630   -2.238  0.405   1.00 1.00 ? 13  VAL A CG2  5  
ATOM   5564  H H    . VAL A 1 13 ? 2.846   -3.807  -1.535  1.00 1.00 ? 13  VAL A H    5  
ATOM   5565  H HA   . VAL A 1 13 ? 5.318   -2.473  -1.726  1.00 1.00 ? 13  VAL A HA   5  
ATOM   5566  H HB   . VAL A 1 13 ? 4.313   -4.273  0.486   1.00 1.00 ? 13  VAL A HB   5  
ATOM   5567  H HG11 . VAL A 1 13 ? 5.799   -2.808  1.885   1.00 1.00 ? 13  VAL A HG11 5  
ATOM   5568  H HG12 . VAL A 1 13 ? 6.416   -2.089  0.396   1.00 1.00 ? 13  VAL A HG12 5  
ATOM   5569  H HG13 . VAL A 1 13 ? 6.680   -3.800  0.726   1.00 1.00 ? 13  VAL A HG13 5  
ATOM   5570  H HG21 . VAL A 1 13 ? 4.050   -1.265  0.194   1.00 1.00 ? 13  VAL A HG21 5  
ATOM   5571  H HG22 . VAL A 1 13 ? 3.330   -2.288  1.440   1.00 1.00 ? 13  VAL A HG22 5  
ATOM   5572  H HG23 . VAL A 1 13 ? 2.768   -2.400  -0.226  1.00 1.00 ? 13  VAL A HG23 5  
ATOM   5573  N N    . LYS A 1 14 ? 5.500   -5.768  -1.618  1.00 1.00 ? 14  LYS A N    5  
ATOM   5574  C CA   . LYS A 1 14 ? 6.393   -6.907  -1.864  1.00 1.00 ? 14  LYS A CA   5  
ATOM   5575  C C    . LYS A 1 14 ? 6.923   -6.895  -3.294  1.00 1.00 ? 14  LYS A C    5  
ATOM   5576  O O    . LYS A 1 14 ? 8.099   -7.168  -3.535  1.00 1.00 ? 14  LYS A O    5  
ATOM   5577  C CB   . LYS A 1 14 ? 5.641   -8.208  -1.631  1.00 1.00 ? 14  LYS A CB   5  
ATOM   5578  C CG   . LYS A 1 14 ? 5.076   -8.215  -0.195  1.00 1.00 ? 14  LYS A CG   5  
ATOM   5579  C CD   . LYS A 1 14 ? 4.987   -9.656  0.376   1.00 1.00 ? 14  LYS A CD   5  
ATOM   5580  C CE   . LYS A 1 14 ? 5.754   -9.746  1.699   1.00 1.00 ? 14  LYS A CE   5  
ATOM   5581  N NZ   . LYS A 1 14 ? 5.011   -9.010  2.762   1.00 1.00 ? 14  LYS A NZ   5  
ATOM   5582  H H    . LYS A 1 14 ? 4.558   -5.936  -1.406  1.00 1.00 ? 14  LYS A H    5  
ATOM   5583  H HA   . LYS A 1 14 ? 7.224   -6.870  -1.171  1.00 1.00 ? 14  LYS A HA   5  
ATOM   5584  H HB2  . LYS A 1 14 ? 4.835   -8.292  -2.350  1.00 1.00 ? 14  LYS A HB2  5  
ATOM   5585  H HB3  . LYS A 1 14 ? 6.327   -9.025  -1.761  1.00 1.00 ? 14  LYS A HB3  5  
ATOM   5586  H HG2  . LYS A 1 14 ? 5.694   -7.599  0.445   1.00 1.00 ? 14  LYS A HG2  5  
ATOM   5587  H HG3  . LYS A 1 14 ? 4.087   -7.792  -0.223  1.00 1.00 ? 14  LYS A HG3  5  
ATOM   5588  H HD2  . LYS A 1 14 ? 3.952   -9.902  0.552   1.00 1.00 ? 14  LYS A HD2  5  
ATOM   5589  H HD3  . LYS A 1 14 ? 5.399   -10.371 -0.314  1.00 1.00 ? 14  LYS A HD3  5  
ATOM   5590  H HE2  . LYS A 1 14 ? 5.856   -10.773 1.973   1.00 1.00 ? 14  LYS A HE2  5  
ATOM   5591  H HE3  . LYS A 1 14 ? 6.735   -9.312  1.582   1.00 1.00 ? 14  LYS A HE3  5  
ATOM   5592  H HZ1  . LYS A 1 14 ? 4.833   -9.646  3.563   1.00 1.00 ? 14  LYS A HZ1  5  
ATOM   5593  H HZ2  . LYS A 1 14 ? 4.106   -8.669  2.379   1.00 1.00 ? 14  LYS A HZ2  5  
ATOM   5594  H HZ3  . LYS A 1 14 ? 5.580   -8.202  3.083   1.00 1.00 ? 14  LYS A HZ3  5  
ATOM   5595  N N    . GLU A 1 15 ? 6.040   -6.588  -4.239  1.00 1.00 ? 15  GLU A N    5  
ATOM   5596  C CA   . GLU A 1 15 ? 6.412   -6.549  -5.651  1.00 1.00 ? 15  GLU A CA   5  
ATOM   5597  C C    . GLU A 1 15 ? 7.656   -5.690  -5.861  1.00 1.00 ? 15  GLU A C    5  
ATOM   5598  O O    . GLU A 1 15 ? 8.432   -5.922  -6.788  1.00 1.00 ? 15  GLU A O    5  
ATOM   5599  C CB   . GLU A 1 15 ? 5.255   -5.974  -6.473  1.00 1.00 ? 15  GLU A CB   5  
ATOM   5600  C CG   . GLU A 1 15 ? 4.116   -6.991  -6.562  1.00 1.00 ? 15  GLU A CG   5  
ATOM   5601  C CD   . GLU A 1 15 ? 2.892   -6.335  -7.196  1.00 1.00 ? 15  GLU A CD   5  
ATOM   5602  O OE1  . GLU A 1 15 ? 2.994   -5.181  -7.580  1.00 1.00 ? 15  GLU A OE1  5  
ATOM   5603  O OE2  . GLU A 1 15 ? 1.869   -6.994  -7.288  1.00 1.00 ? 15  GLU A OE2  5  
ATOM   5604  H H    . GLU A 1 15 ? 5.115   -6.391  -3.981  1.00 1.00 ? 15  GLU A H    5  
ATOM   5605  H HA   . GLU A 1 15 ? 6.616   -7.551  -5.988  1.00 1.00 ? 15  GLU A HA   5  
ATOM   5606  H HB2  . GLU A 1 15 ? 4.892   -5.072  -5.999  1.00 1.00 ? 15  GLU A HB2  5  
ATOM   5607  H HB3  . GLU A 1 15 ? 5.601   -5.739  -7.468  1.00 1.00 ? 15  GLU A HB3  5  
ATOM   5608  H HG2  . GLU A 1 15 ? 4.430   -7.824  -7.171  1.00 1.00 ? 15  GLU A HG2  5  
ATOM   5609  H HG3  . GLU A 1 15 ? 3.866   -7.346  -5.575  1.00 1.00 ? 15  GLU A HG3  5  
ATOM   5610  N N    . LYS A 1 16 ? 7.835   -4.697  -4.999  1.00 1.00 ? 16  LYS A N    5  
ATOM   5611  C CA   . LYS A 1 16 ? 8.986   -3.806  -5.102  1.00 1.00 ? 16  LYS A CA   5  
ATOM   5612  C C    . LYS A 1 16 ? 10.270  -4.593  -4.861  1.00 1.00 ? 16  LYS A C    5  
ATOM   5613  O O    . LYS A 1 16 ? 11.236  -4.476  -5.617  1.00 1.00 ? 16  LYS A O    5  
ATOM   5614  C CB   . LYS A 1 16 ? 8.882   -2.673  -4.063  1.00 1.00 ? 16  LYS A CB   5  
ATOM   5615  C CG   . LYS A 1 16 ? 7.444   -2.135  -3.976  1.00 1.00 ? 16  LYS A CG   5  
ATOM   5616  C CD   . LYS A 1 16 ? 7.047   -1.380  -5.257  1.00 1.00 ? 16  LYS A CD   5  
ATOM   5617  C CE   . LYS A 1 16 ? 5.566   -0.975  -5.198  1.00 1.00 ? 16  LYS A CE   5  
ATOM   5618  N NZ   . LYS A 1 16 ? 5.414   0.397   -5.759  1.00 1.00 ? 16  LYS A NZ   5  
ATOM   5619  H H    . LYS A 1 16 ? 7.183   -4.562  -4.284  1.00 1.00 ? 16  LYS A H    5  
ATOM   5620  H HA   . LYS A 1 16 ? 9.022   -3.383  -6.090  1.00 1.00 ? 16  LYS A HA   5  
ATOM   5621  H HB2  . LYS A 1 16 ? 9.173   -3.051  -3.093  1.00 1.00 ? 16  LYS A HB2  5  
ATOM   5622  H HB3  . LYS A 1 16 ? 9.547   -1.869  -4.343  1.00 1.00 ? 16  LYS A HB3  5  
ATOM   5623  H HG2  . LYS A 1 16 ? 6.767   -2.950  -3.820  1.00 1.00 ? 16  LYS A HG2  5  
ATOM   5624  H HG3  . LYS A 1 16 ? 7.376   -1.458  -3.137  1.00 1.00 ? 16  LYS A HG3  5  
ATOM   5625  H HD2  . LYS A 1 16 ? 7.647   -0.490  -5.345  1.00 1.00 ? 16  LYS A HD2  5  
ATOM   5626  H HD3  . LYS A 1 16 ? 7.204   -2.008  -6.117  1.00 1.00 ? 16  LYS A HD3  5  
ATOM   5627  H HE2  . LYS A 1 16 ? 4.974   -1.666  -5.783  1.00 1.00 ? 16  LYS A HE2  5  
ATOM   5628  H HE3  . LYS A 1 16 ? 5.218   -0.985  -4.178  1.00 1.00 ? 16  LYS A HE3  5  
ATOM   5629  H HZ1  . LYS A 1 16 ? 6.196   0.996   -5.428  1.00 1.00 ? 16  LYS A HZ1  5  
ATOM   5630  H HZ2  . LYS A 1 16 ? 4.508   0.802   -5.441  1.00 1.00 ? 16  LYS A HZ2  5  
ATOM   5631  H HZ3  . LYS A 1 16 ? 5.431   0.352   -6.795  1.00 1.00 ? 16  LYS A HZ3  5  
ATOM   5632  N N    . LEU A 1 17 ? 10.263  -5.392  -3.794  1.00 1.00 ? 17  LEU A N    5  
ATOM   5633  C CA   . LEU A 1 17 ? 11.408  -6.205  -3.430  1.00 1.00 ? 17  LEU A CA   5  
ATOM   5634  C C    . LEU A 1 17 ? 11.287  -7.589  -4.057  1.00 1.00 ? 17  LEU A C    5  
ATOM   5635  O O    . LEU A 1 17 ? 12.179  -8.426  -3.906  1.00 1.00 ? 17  LEU A O    5  
ATOM   5636  C CB   . LEU A 1 17 ? 11.467  -6.378  -1.904  1.00 1.00 ? 17  LEU A CB   5  
ATOM   5637  C CG   . LEU A 1 17 ? 11.331  -5.038  -1.146  1.00 1.00 ? 17  LEU A CG   5  
ATOM   5638  C CD1  . LEU A 1 17 ? 12.028  -3.894  -1.902  1.00 1.00 ? 17  LEU A CD1  5  
ATOM   5639  C CD2  . LEU A 1 17 ? 9.844   -4.691  -0.912  1.00 1.00 ? 17  LEU A CD2  5  
ATOM   5640  H H    . LEU A 1 17 ? 9.470   -5.434  -3.233  1.00 1.00 ? 17  LEU A H    5  
ATOM   5641  H HA   . LEU A 1 17 ? 12.317  -5.735  -3.772  1.00 1.00 ? 17  LEU A HA   5  
ATOM   5642  H HB2  . LEU A 1 17 ? 10.661  -7.028  -1.601  1.00 1.00 ? 17  LEU A HB2  5  
ATOM   5643  H HB3  . LEU A 1 17 ? 12.408  -6.839  -1.644  1.00 1.00 ? 17  LEU A HB3  5  
ATOM   5644  H HG   . LEU A 1 17 ? 11.799  -5.156  -0.194  1.00 1.00 ? 17  LEU A HG   5  
ATOM   5645  H HD11 . LEU A 1 17 ? 12.099  -3.030  -1.254  1.00 1.00 ? 17  LEU A HD11 5  
ATOM   5646  H HD12 . LEU A 1 17 ? 11.454  -3.636  -2.774  1.00 1.00 ? 17  LEU A HD12 5  
ATOM   5647  H HD13 . LEU A 1 17 ? 13.017  -4.202  -2.197  1.00 1.00 ? 17  LEU A HD13 5  
ATOM   5648  H HD21 . LEU A 1 17 ? 9.713   -3.618  -0.884  1.00 1.00 ? 17  LEU A HD21 5  
ATOM   5649  H HD22 . LEU A 1 17 ? 9.528   -5.108  0.030   1.00 1.00 ? 17  LEU A HD22 5  
ATOM   5650  H HD23 . LEU A 1 17 ? 9.243   -5.105  -1.695  1.00 1.00 ? 17  LEU A HD23 5  
ATOM   5651  N N    . ALA A 1 18 ? 10.172  -7.832  -4.736  1.00 1.00 ? 18  ALA A N    5  
ATOM   5652  C CA   . ALA A 1 18 ? 9.935   -9.130  -5.357  1.00 1.00 ? 18  ALA A CA   5  
ATOM   5653  C C    . ALA A 1 18 ? 9.690   -10.186 -4.286  1.00 1.00 ? 18  ALA A C    5  
ATOM   5654  O O    . ALA A 1 18 ? 10.144  -11.325 -4.398  1.00 1.00 ? 18  ALA A O    5  
ATOM   5655  C CB   . ALA A 1 18 ? 11.141  -9.525  -6.223  1.00 1.00 ? 18  ALA A CB   5  
ATOM   5656  H H    . ALA A 1 18 ? 9.489   -7.130  -4.807  1.00 1.00 ? 18  ALA A H    5  
ATOM   5657  H HA   . ALA A 1 18 ? 9.060   -9.063  -5.977  1.00 1.00 ? 18  ALA A HA   5  
ATOM   5658  H HB1  . ALA A 1 18 ? 10.816  -10.183 -7.015  1.00 1.00 ? 18  ALA A HB1  5  
ATOM   5659  H HB2  . ALA A 1 18 ? 11.880  -10.028 -5.616  1.00 1.00 ? 18  ALA A HB2  5  
ATOM   5660  H HB3  . ALA A 1 18 ? 11.579  -8.635  -6.653  1.00 1.00 ? 18  ALA A HB3  5  
ATOM   5661  N N    . LEU A 1 19 ? 8.972   -9.783  -3.248  1.00 1.00 ? 19  LEU A N    5  
ATOM   5662  C CA   . LEU A 1 19 ? 8.655   -10.663 -2.129  1.00 1.00 ? 19  LEU A CA   5  
ATOM   5663  C C    . LEU A 1 19 ? 7.294   -11.336 -2.342  1.00 1.00 ? 19  LEU A C    5  
ATOM   5664  O O    . LEU A 1 19 ? 6.696   -11.225 -3.410  1.00 1.00 ? 19  LEU A O    5  
ATOM   5665  C CB   . LEU A 1 19 ? 8.652   -9.812  -0.844  1.00 1.00 ? 19  LEU A CB   5  
ATOM   5666  C CG   . LEU A 1 19 ? 9.939   -10.037 -0.038  1.00 1.00 ? 19  LEU A CG   5  
ATOM   5667  C CD1  . LEU A 1 19 ? 11.184  -9.574  -0.840  1.00 1.00 ? 19  LEU A CD1  5  
ATOM   5668  C CD2  . LEU A 1 19 ? 9.826   -9.250  1.270   1.00 1.00 ? 19  LEU A CD2  5  
ATOM   5669  H H    . LEU A 1 19 ? 8.646   -8.860  -3.226  1.00 1.00 ? 19  LEU A H    5  
ATOM   5670  H HA   . LEU A 1 19 ? 9.406   -11.428 -2.046  1.00 1.00 ? 19  LEU A HA   5  
ATOM   5671  H HB2  . LEU A 1 19 ? 8.593   -8.765  -1.118  1.00 1.00 ? 19  LEU A HB2  5  
ATOM   5672  H HB3  . LEU A 1 19 ? 7.806   -10.067 -0.236  1.00 1.00 ? 19  LEU A HB3  5  
ATOM   5673  H HG   . LEU A 1 19 ? 10.036  -11.091 0.188   1.00 1.00 ? 19  LEU A HG   5  
ATOM   5674  H HD11 . LEU A 1 19 ? 10.905  -9.331  -1.856  1.00 1.00 ? 19  LEU A HD11 5  
ATOM   5675  H HD12 . LEU A 1 19 ? 11.912  -10.371 -0.855  1.00 1.00 ? 19  LEU A HD12 5  
ATOM   5676  H HD13 . LEU A 1 19 ? 11.627  -8.701  -0.375  1.00 1.00 ? 19  LEU A HD13 5  
ATOM   5677  H HD21 . LEU A 1 19 ? 10.774  -9.274  1.788   1.00 1.00 ? 19  LEU A HD21 5  
ATOM   5678  H HD22 . LEU A 1 19 ? 9.064   -9.692  1.891   1.00 1.00 ? 19  LEU A HD22 5  
ATOM   5679  H HD23 . LEU A 1 19 ? 9.560   -8.224  1.044   1.00 1.00 ? 19  LEU A HD23 5  
ATOM   5680  N N    . GLY A 1 20 ? 6.811   -12.037 -1.312  1.00 1.00 ? 20  GLY A N    5  
ATOM   5681  C CA   . GLY A 1 20 ? 5.519   -12.725 -1.396  1.00 1.00 ? 20  GLY A CA   5  
ATOM   5682  C C    . GLY A 1 20 ? 5.699   -14.149 -1.910  1.00 1.00 ? 20  GLY A C    5  
ATOM   5683  O O    . GLY A 1 20 ? 4.736   -14.913 -1.995  1.00 1.00 ? 20  GLY A O    5  
ATOM   5684  H H    . GLY A 1 20 ? 7.331   -12.092 -0.480  1.00 1.00 ? 20  GLY A H    5  
ATOM   5685  H HA2  . GLY A 1 20 ? 5.060   -12.753 -0.414  1.00 1.00 ? 20  GLY A HA2  5  
ATOM   5686  H HA3  . GLY A 1 20 ? 4.873   -12.186 -2.070  1.00 1.00 ? 20  GLY A HA3  5  
ATOM   5687  N N    . ALA A 1 21 ? 6.939   -14.498 -2.247  1.00 1.00 ? 21  ALA A N    5  
ATOM   5688  C CA   . ALA A 1 21 ? 7.243   -15.835 -2.749  1.00 1.00 ? 21  ALA A CA   5  
ATOM   5689  C C    . ALA A 1 21 ? 7.578   -16.769 -1.593  1.00 1.00 ? 21  ALA A C    5  
ATOM   5690  O O    . ALA A 1 21 ? 6.749   -17.575 -1.173  1.00 1.00 ? 21  ALA A O    5  
ATOM   5691  C CB   . ALA A 1 21 ? 8.435   -15.771 -3.711  1.00 1.00 ? 21  ALA A CB   5  
ATOM   5692  H H    . ALA A 1 21 ? 7.663   -13.846 -2.154  1.00 1.00 ? 21  ALA A H    5  
ATOM   5693  H HA   . ALA A 1 21 ? 6.388   -16.224 -3.282  1.00 1.00 ? 21  ALA A HA   5  
ATOM   5694  H HB1  . ALA A 1 21 ? 9.234   -15.202 -3.257  1.00 1.00 ? 21  ALA A HB1  5  
ATOM   5695  H HB2  . ALA A 1 21 ? 8.132   -15.295 -4.631  1.00 1.00 ? 21  ALA A HB2  5  
ATOM   5696  H HB3  . ALA A 1 21 ? 8.783   -16.772 -3.921  1.00 1.00 ? 21  ALA A HB3  5  
ATOM   5697  N N    . ASP A 1 22 ? 8.802   -16.649 -1.074  1.00 1.00 ? 22  ASP A N    5  
ATOM   5698  C CA   . ASP A 1 22 ? 9.250   -17.483 0.043   1.00 1.00 ? 22  ASP A CA   5  
ATOM   5699  C C    . ASP A 1 22 ? 9.131   -16.722 1.362   1.00 1.00 ? 22  ASP A C    5  
ATOM   5700  O O    . ASP A 1 22 ? 9.671   -17.145 2.384   1.00 1.00 ? 22  ASP A O    5  
ATOM   5701  C CB   . ASP A 1 22 ? 10.703  -17.910 -0.173  1.00 1.00 ? 22  ASP A CB   5  
ATOM   5702  C CG   . ASP A 1 22 ? 10.795  -18.870 -1.353  1.00 1.00 ? 22  ASP A CG   5  
ATOM   5703  O OD1  . ASP A 1 22 ? 9.761   -19.367 -1.770  1.00 1.00 ? 22  ASP A OD1  5  
ATOM   5704  O OD2  . ASP A 1 22 ? 11.898  -19.097 -1.823  1.00 1.00 ? 22  ASP A OD2  5  
ATOM   5705  H H    . ASP A 1 22 ? 9.417   -15.985 -1.451  1.00 1.00 ? 22  ASP A H    5  
ATOM   5706  H HA   . ASP A 1 22 ? 8.633   -18.367 0.097   1.00 1.00 ? 22  ASP A HA   5  
ATOM   5707  H HB2  . ASP A 1 22 ? 11.307  -17.036 -0.374  1.00 1.00 ? 22  ASP A HB2  5  
ATOM   5708  H HB3  . ASP A 1 22 ? 11.067  -18.400 0.716   1.00 1.00 ? 22  ASP A HB3  5  
ATOM   5709  N N    . VAL A 1 23 ? 8.431   -15.588 1.328   1.00 1.00 ? 23  VAL A N    5  
ATOM   5710  C CA   . VAL A 1 23 ? 8.251   -14.752 2.520   1.00 1.00 ? 23  VAL A CA   5  
ATOM   5711  C C    . VAL A 1 23 ? 6.772   -14.632 2.871   1.00 1.00 ? 23  VAL A C    5  
ATOM   5712  O O    . VAL A 1 23 ? 5.930   -14.414 2.001   1.00 1.00 ? 23  VAL A O    5  
ATOM   5713  C CB   . VAL A 1 23 ? 8.826   -13.355 2.260   1.00 1.00 ? 23  VAL A CB   5  
ATOM   5714  C CG1  . VAL A 1 23 ? 8.439   -12.403 3.399   1.00 1.00 ? 23  VAL A CG1  5  
ATOM   5715  C CG2  . VAL A 1 23 ? 10.350  -13.443 2.158   1.00 1.00 ? 23  VAL A CG2  5  
ATOM   5716  H H    . VAL A 1 23 ? 8.034   -15.298 0.481   1.00 1.00 ? 23  VAL A H    5  
ATOM   5717  H HA   . VAL A 1 23 ? 8.774   -15.194 3.358   1.00 1.00 ? 23  VAL A HA   5  
ATOM   5718  H HB   . VAL A 1 23 ? 8.426   -12.977 1.332   1.00 1.00 ? 23  VAL A HB   5  
ATOM   5719  H HG11 . VAL A 1 23 ? 8.543   -12.912 4.346   1.00 1.00 ? 23  VAL A HG11 5  
ATOM   5720  H HG12 . VAL A 1 23 ? 7.413   -12.090 3.270   1.00 1.00 ? 23  VAL A HG12 5  
ATOM   5721  H HG13 . VAL A 1 23 ? 9.084   -11.537 3.381   1.00 1.00 ? 23  VAL A HG13 5  
ATOM   5722  H HG21 . VAL A 1 23 ? 10.739  -13.978 3.013   1.00 1.00 ? 23  VAL A HG21 5  
ATOM   5723  H HG22 . VAL A 1 23 ? 10.766  -12.448 2.137   1.00 1.00 ? 23  VAL A HG22 5  
ATOM   5724  H HG23 . VAL A 1 23 ? 10.619  -13.965 1.252   1.00 1.00 ? 23  VAL A HG23 5  
ATOM   5725  N N    . VAL A 1 24 ? 6.468   -14.772 4.156   1.00 1.00 ? 24  VAL A N    5  
ATOM   5726  C CA   . VAL A 1 24 ? 5.092   -14.673 4.622   1.00 1.00 ? 24  VAL A CA   5  
ATOM   5727  C C    . VAL A 1 24 ? 4.606   -13.232 4.516   1.00 1.00 ? 24  VAL A C    5  
ATOM   5728  O O    . VAL A 1 24 ? 5.292   -12.303 4.942   1.00 1.00 ? 24  VAL A O    5  
ATOM   5729  C CB   . VAL A 1 24 ? 5.000   -15.137 6.076   1.00 1.00 ? 24  VAL A CB   5  
ATOM   5730  C CG1  . VAL A 1 24 ? 3.563   -14.979 6.575   1.00 1.00 ? 24  VAL A CG1  5  
ATOM   5731  C CG2  . VAL A 1 24 ? 5.418   -16.606 6.173   1.00 1.00 ? 24  VAL A CG2  5  
ATOM   5732  H H    . VAL A 1 24 ? 7.183   -14.940 4.803   1.00 1.00 ? 24  VAL A H    5  
ATOM   5733  H HA   . VAL A 1 24 ? 4.465   -15.304 4.010   1.00 1.00 ? 24  VAL A HA   5  
ATOM   5734  H HB   . VAL A 1 24 ? 5.658   -14.534 6.683   1.00 1.00 ? 24  VAL A HB   5  
ATOM   5735  H HG11 . VAL A 1 24 ? 3.456   -15.482 7.524   1.00 1.00 ? 24  VAL A HG11 5  
ATOM   5736  H HG12 . VAL A 1 24 ? 2.882   -15.414 5.858   1.00 1.00 ? 24  VAL A HG12 5  
ATOM   5737  H HG13 . VAL A 1 24 ? 3.337   -13.929 6.696   1.00 1.00 ? 24  VAL A HG13 5  
ATOM   5738  H HG21 . VAL A 1 24 ? 4.741   -17.213 5.591   1.00 1.00 ? 24  VAL A HG21 5  
ATOM   5739  H HG22 . VAL A 1 24 ? 5.386   -16.920 7.206   1.00 1.00 ? 24  VAL A HG22 5  
ATOM   5740  H HG23 . VAL A 1 24 ? 6.422   -16.719 5.793   1.00 1.00 ? 24  VAL A HG23 5  
ATOM   5741  N N    . VAL A 1 25 ? 3.422   -13.051 3.938   1.00 1.00 ? 25  VAL A N    5  
ATOM   5742  C CA   . VAL A 1 25 ? 2.848   -11.714 3.769   1.00 1.00 ? 25  VAL A CA   5  
ATOM   5743  C C    . VAL A 1 25 ? 1.900   -11.382 4.909   1.00 1.00 ? 25  VAL A C    5  
ATOM   5744  O O    . VAL A 1 25 ? 0.983   -12.149 5.211   1.00 1.00 ? 25  VAL A O    5  
ATOM   5745  C CB   . VAL A 1 25 ? 2.084   -11.654 2.445   1.00 1.00 ? 25  VAL A CB   5  
ATOM   5746  C CG1  . VAL A 1 25 ? 1.685   -10.205 2.138   1.00 1.00 ? 25  VAL A CG1  5  
ATOM   5747  C CG2  . VAL A 1 25 ? 2.950   -12.230 1.313   1.00 1.00 ? 25  VAL A CG2  5  
ATOM   5748  H H    . VAL A 1 25 ? 2.924   -13.830 3.614   1.00 1.00 ? 25  VAL A H    5  
ATOM   5749  H HA   . VAL A 1 25 ? 3.642   -10.980 3.749   1.00 1.00 ? 25  VAL A HA   5  
ATOM   5750  H HB   . VAL A 1 25 ? 1.195   -12.242 2.533   1.00 1.00 ? 25  VAL A HB   5  
ATOM   5751  H HG11 . VAL A 1 25 ? 2.515   -9.547  2.341   1.00 1.00 ? 25  VAL A HG11 5  
ATOM   5752  H HG12 . VAL A 1 25 ? 0.846   -9.926  2.760   1.00 1.00 ? 25  VAL A HG12 5  
ATOM   5753  H HG13 . VAL A 1 25 ? 1.404   -10.124 1.098   1.00 1.00 ? 25  VAL A HG13 5  
ATOM   5754  H HG21 . VAL A 1 25 ? 2.647   -11.806 0.367   1.00 1.00 ? 25  VAL A HG21 5  
ATOM   5755  H HG22 . VAL A 1 25 ? 2.825   -13.302 1.278   1.00 1.00 ? 25  VAL A HG22 5  
ATOM   5756  H HG23 . VAL A 1 25 ? 3.986   -12.002 1.497   1.00 1.00 ? 25  VAL A HG23 5  
ATOM   5757  N N    . THR A 1 26 ? 2.111   -10.227 5.540   1.00 1.00 ? 26  THR A N    5  
ATOM   5758  C CA   . THR A 1 26 ? 1.257   -9.796  6.643   1.00 1.00 ? 26  THR A CA   5  
ATOM   5759  C C    . THR A 1 26 ? 0.980   -8.303  6.542   1.00 1.00 ? 26  THR A C    5  
ATOM   5760  O O    . THR A 1 26 ? 1.830   -7.526  6.105   1.00 1.00 ? 26  THR A O    5  
ATOM   5761  C CB   . THR A 1 26 ? 1.937   -10.122 7.977   1.00 1.00 ? 26  THR A CB   5  
ATOM   5762  O OG1  . THR A 1 26 ? 3.328   -9.853  7.879   1.00 1.00 ? 26  THR A OG1  5  
ATOM   5763  C CG2  . THR A 1 26 ? 1.732   -11.599 8.310   1.00 1.00 ? 26  THR A CG2  5  
ATOM   5764  H H    . THR A 1 26 ? 2.850   -9.649  5.256   1.00 1.00 ? 26  THR A H    5  
ATOM   5765  H HA   . THR A 1 26 ? 0.312   -10.322 6.592   1.00 1.00 ? 26  THR A HA   5  
ATOM   5766  H HB   . THR A 1 26 ? 1.506   -9.520  8.763   1.00 1.00 ? 26  THR A HB   5  
ATOM   5767  H HG1  . THR A 1 26 ? 3.585   -9.334  8.644   1.00 1.00 ? 26  THR A HG1  5  
ATOM   5768  H HG21 . THR A 1 26 ? 1.896   -12.193 7.420   1.00 1.00 ? 26  THR A HG21 5  
ATOM   5769  H HG22 . THR A 1 26 ? 0.723   -11.749 8.665   1.00 1.00 ? 26  THR A HG22 5  
ATOM   5770  H HG23 . THR A 1 26 ? 2.433   -11.895 9.076   1.00 1.00 ? 26  THR A HG23 5  
ATOM   5771  N N    . ALA A 1 27 ? -0.221  -7.913  6.947   1.00 1.00 ? 27  ALA A N    5  
ATOM   5772  C CA   . ALA A 1 27 ? -0.616  -6.516  6.898   1.00 1.00 ? 27  ALA A CA   5  
ATOM   5773  C C    . ALA A 1 27 ? 0.052   -5.719  8.013   1.00 1.00 ? 27  ALA A C    5  
ATOM   5774  O O    . ALA A 1 27 ? 0.522   -4.603  7.808   1.00 1.00 ? 27  ALA A O    5  
ATOM   5775  C CB   . ALA A 1 27 ? -2.135  -6.408  7.039   1.00 1.00 ? 27  ALA A CB   5  
ATOM   5776  H H    . ALA A 1 27 ? -0.853  -8.581  7.282   1.00 1.00 ? 27  ALA A H    5  
ATOM   5777  H HA   . ALA A 1 27 ? -0.325  -6.102  5.946   1.00 1.00 ? 27  ALA A HA   5  
ATOM   5778  H HB1  . ALA A 1 27 ? -2.409  -6.480  8.081   1.00 1.00 ? 27  ALA A HB1  5  
ATOM   5779  H HB2  . ALA A 1 27 ? -2.599  -7.212  6.490   1.00 1.00 ? 27  ALA A HB2  5  
ATOM   5780  H HB3  . ALA A 1 27 ? -2.467  -5.460  6.643   1.00 1.00 ? 27  ALA A HB3  5  
ATOM   5781  N N    . ASP A 1 28 ? 0.088   -6.293  9.200   1.00 1.00 ? 28  ASP A N    5  
ATOM   5782  C CA   . ASP A 1 28 ? 0.691   -5.601  10.321  1.00 1.00 ? 28  ASP A CA   5  
ATOM   5783  C C    . ASP A 1 28 ? 2.202   -5.562  10.155  1.00 1.00 ? 28  ASP A C    5  
ATOM   5784  O O    . ASP A 1 28 ? 2.930   -5.217  11.085  1.00 1.00 ? 28  ASP A O    5  
ATOM   5785  C CB   . ASP A 1 28 ? 0.330   -6.304  11.629  1.00 1.00 ? 28  ASP A CB   5  
ATOM   5786  C CG   . ASP A 1 28 ? -1.163  -6.157  11.903  1.00 1.00 ? 28  ASP A CG   5  
ATOM   5787  O OD1  . ASP A 1 28 ? -1.579  -5.060  12.231  1.00 1.00 ? 28  ASP A OD1  5  
ATOM   5788  O OD2  . ASP A 1 28 ? -1.869  -7.145  11.775  1.00 1.00 ? 28  ASP A OD2  5  
ATOM   5789  H H    . ASP A 1 28 ? -0.298  -7.187  9.324   1.00 1.00 ? 28  ASP A H    5  
ATOM   5790  H HA   . ASP A 1 28 ? 0.308   -4.587  10.347  1.00 1.00 ? 28  ASP A HA   5  
ATOM   5791  H HB2  . ASP A 1 28 ? 0.580   -7.353  11.552  1.00 1.00 ? 28  ASP A HB2  5  
ATOM   5792  H HB3  . ASP A 1 28 ? 0.887   -5.861  12.440  1.00 1.00 ? 28  ASP A HB3  5  
ATOM   5793  N N    . SER A 1 29 ? 2.671   -5.933  8.965   1.00 1.00 ? 29  SER A N    5  
ATOM   5794  C CA   . SER A 1 29 ? 4.099   -5.949  8.703   1.00 1.00 ? 29  SER A CA   5  
ATOM   5795  C C    . SER A 1 29 ? 4.661   -4.538  8.578   1.00 1.00 ? 29  SER A C    5  
ATOM   5796  O O    . SER A 1 29 ? 5.876   -4.358  8.503   1.00 1.00 ? 29  SER A O    5  
ATOM   5797  C CB   . SER A 1 29 ? 4.402   -6.731  7.424   1.00 1.00 ? 29  SER A CB   5  
ATOM   5798  O OG   . SER A 1 29 ? 5.784   -7.068  7.395   1.00 1.00 ? 29  SER A OG   5  
ATOM   5799  H H    . SER A 1 29 ? 2.047   -6.210  8.259   1.00 1.00 ? 29  SER A H    5  
ATOM   5800  H HA   . SER A 1 29 ? 4.580   -6.432  9.530   1.00 1.00 ? 29  SER A HA   5  
ATOM   5801  H HB2  . SER A 1 29 ? 3.814   -7.632  7.404   1.00 1.00 ? 29  SER A HB2  5  
ATOM   5802  H HB3  . SER A 1 29 ? 4.152   -6.123  6.565   1.00 1.00 ? 29  SER A HB3  5  
ATOM   5803  H HG   . SER A 1 29 ? 6.153   -6.737  6.575   1.00 1.00 ? 29  SER A HG   5  
ATOM   5804  N N    . GLU A 1 30 ? 3.777   -3.548  8.546   1.00 1.00 ? 30  GLU A N    5  
ATOM   5805  C CA   . GLU A 1 30 ? 4.202   -2.157  8.423   1.00 1.00 ? 30  GLU A CA   5  
ATOM   5806  C C    . GLU A 1 30 ? 4.974   -1.959  7.127   1.00 1.00 ? 30  GLU A C    5  
ATOM   5807  O O    . GLU A 1 30 ? 5.790   -2.794  6.741   1.00 1.00 ? 30  GLU A O    5  
ATOM   5808  C CB   . GLU A 1 30 ? 5.079   -1.759  9.613   1.00 1.00 ? 30  GLU A CB   5  
ATOM   5809  C CG   . GLU A 1 30 ? 4.313   -2.013  10.914  1.00 1.00 ? 30  GLU A CG   5  
ATOM   5810  C CD   . GLU A 1 30 ? 5.189   -1.666  12.113  1.00 1.00 ? 30  GLU A CD   5  
ATOM   5811  O OE1  . GLU A 1 30 ? 6.302   -1.214  11.898  1.00 1.00 ? 30  GLU A OE1  5  
ATOM   5812  O OE2  . GLU A 1 30 ? 4.734   -1.860  13.228  1.00 1.00 ? 30  GLU A OE2  5  
ATOM   5813  H H    . GLU A 1 30 ? 2.821   -3.754  8.602   1.00 1.00 ? 30  GLU A H    5  
ATOM   5814  H HA   . GLU A 1 30 ? 3.338   -1.519  8.402   1.00 1.00 ? 30  GLU A HA   5  
ATOM   5815  H HB2  . GLU A 1 30 ? 5.991   -2.331  9.607   1.00 1.00 ? 30  GLU A HB2  5  
ATOM   5816  H HB3  . GLU A 1 30 ? 5.311   -0.708  9.543   1.00 1.00 ? 30  GLU A HB3  5  
ATOM   5817  H HG2  . GLU A 1 30 ? 3.428   -1.401  10.932  1.00 1.00 ? 30  GLU A HG2  5  
ATOM   5818  H HG3  . GLU A 1 30 ? 4.033   -3.055  10.966  1.00 1.00 ? 30  GLU A HG3  5  
ATOM   5819  N N    . PHE A 1 31 ? 4.699   -0.851  6.455   1.00 1.00 ? 31  PHE A N    5  
ATOM   5820  C CA   . PHE A 1 31 ? 5.365   -0.552  5.200   1.00 1.00 ? 31  PHE A CA   5  
ATOM   5821  C C    . PHE A 1 31 ? 6.873   -0.429  5.407   1.00 1.00 ? 31  PHE A C    5  
ATOM   5822  O O    . PHE A 1 31 ? 7.661   -0.918  4.598   1.00 1.00 ? 31  PHE A O    5  
ATOM   5823  C CB   . PHE A 1 31 ? 4.820   0.752   4.623   1.00 1.00 ? 31  PHE A CB   5  
ATOM   5824  C CG   . PHE A 1 31 ? 3.399   0.573   4.165   1.00 1.00 ? 31  PHE A CG   5  
ATOM   5825  C CD1  . PHE A 1 31 ? 3.145   0.049   2.899   1.00 1.00 ? 31  PHE A CD1  5  
ATOM   5826  C CD2  . PHE A 1 31 ? 2.337   0.947   4.996   1.00 1.00 ? 31  PHE A CD2  5  
ATOM   5827  C CE1  . PHE A 1 31 ? 1.829   -0.113  2.458   1.00 1.00 ? 31  PHE A CE1  5  
ATOM   5828  C CE2  . PHE A 1 31 ? 1.024   0.788   4.559   1.00 1.00 ? 31  PHE A CE2  5  
ATOM   5829  C CZ   . PHE A 1 31 ? 0.767   0.258   3.289   1.00 1.00 ? 31  PHE A CZ   5  
ATOM   5830  H H    . PHE A 1 31 ? 4.035   -0.225  6.809   1.00 1.00 ? 31  PHE A H    5  
ATOM   5831  H HA   . PHE A 1 31 ? 5.170   -1.352  4.501   1.00 1.00 ? 31  PHE A HA   5  
ATOM   5832  H HB2  . PHE A 1 31 ? 4.852   1.515   5.379   1.00 1.00 ? 31  PHE A HB2  5  
ATOM   5833  H HB3  . PHE A 1 31 ? 5.425   1.048   3.783   1.00 1.00 ? 31  PHE A HB3  5  
ATOM   5834  H HD1  . PHE A 1 31 ? 3.968   -0.232  2.262   1.00 1.00 ? 31  PHE A HD1  5  
ATOM   5835  H HD2  . PHE A 1 31 ? 2.528   1.352   5.975   1.00 1.00 ? 31  PHE A HD2  5  
ATOM   5836  H HE1  . PHE A 1 31 ? 1.632   -0.524  1.478   1.00 1.00 ? 31  PHE A HE1  5  
ATOM   5837  H HE2  . PHE A 1 31 ? 0.207   1.079   5.201   1.00 1.00 ? 31  PHE A HE2  5  
ATOM   5838  H HZ   . PHE A 1 31 ? -0.249  0.137   2.952   1.00 1.00 ? 31  PHE A HZ   5  
ATOM   5839  N N    . SER A 1 32 ? 7.268   0.233   6.491   1.00 1.00 ? 32  SER A N    5  
ATOM   5840  C CA   . SER A 1 32 ? 8.686   0.416   6.783   1.00 1.00 ? 32  SER A CA   5  
ATOM   5841  C C    . SER A 1 32 ? 9.379   -0.933  6.938   1.00 1.00 ? 32  SER A C    5  
ATOM   5842  O O    . SER A 1 32 ? 8.848   -1.847  7.568   1.00 1.00 ? 32  SER A O    5  
ATOM   5843  C CB   . SER A 1 32 ? 8.855   1.229   8.067   1.00 1.00 ? 32  SER A CB   5  
ATOM   5844  O OG   . SER A 1 32 ? 8.029   2.384   8.004   1.00 1.00 ? 32  SER A OG   5  
ATOM   5845  H H    . SER A 1 32 ? 6.598   0.606   7.101   1.00 1.00 ? 32  SER A H    5  
ATOM   5846  H HA   . SER A 1 32 ? 9.147   0.954   5.968   1.00 1.00 ? 32  SER A HA   5  
ATOM   5847  H HB2  . SER A 1 32 ? 8.563   0.630   8.915   1.00 1.00 ? 32  SER A HB2  5  
ATOM   5848  H HB3  . SER A 1 32 ? 9.892   1.518   8.176   1.00 1.00 ? 32  SER A HB3  5  
ATOM   5849  H HG   . SER A 1 32 ? 8.480   3.040   7.470   1.00 1.00 ? 32  SER A HG   5  
ATOM   5850  N N    . LYS A 1 33 ? 10.569  -1.050  6.357   1.00 1.00 ? 33  LYS A N    5  
ATOM   5851  C CA   . LYS A 1 33 ? 11.336  -2.291  6.430   1.00 1.00 ? 33  LYS A CA   5  
ATOM   5852  C C    . LYS A 1 33 ? 12.830  -2.002  6.355   1.00 1.00 ? 33  LYS A C    5  
ATOM   5853  O O    . LYS A 1 33 ? 13.244  -0.917  5.942   1.00 1.00 ? 33  LYS A O    5  
ATOM   5854  C CB   . LYS A 1 33 ? 10.941  -3.233  5.291   1.00 1.00 ? 33  LYS A CB   5  
ATOM   5855  C CG   . LYS A 1 33 ? 9.508   -3.730  5.506   1.00 1.00 ? 33  LYS A CG   5  
ATOM   5856  C CD   . LYS A 1 33 ? 9.194   -4.862  4.521   1.00 1.00 ? 33  LYS A CD   5  
ATOM   5857  C CE   . LYS A 1 33 ? 9.119   -4.315  3.093   1.00 1.00 ? 33  LYS A CE   5  
ATOM   5858  N NZ   . LYS A 1 33 ? 8.488   -5.336  2.212   1.00 1.00 ? 33  LYS A NZ   5  
ATOM   5859  H H    . LYS A 1 33 ? 10.940  -0.286  5.868   1.00 1.00 ? 33  LYS A H    5  
ATOM   5860  H HA   . LYS A 1 33 ? 11.129  -2.779  7.371   1.00 1.00 ? 33  LYS A HA   5  
ATOM   5861  H HB2  . LYS A 1 33 ? 11.003  -2.701  4.354   1.00 1.00 ? 33  LYS A HB2  5  
ATOM   5862  H HB3  . LYS A 1 33 ? 11.615  -4.078  5.271   1.00 1.00 ? 33  LYS A HB3  5  
ATOM   5863  H HG2  . LYS A 1 33 ? 9.403   -4.097  6.516   1.00 1.00 ? 33  LYS A HG2  5  
ATOM   5864  H HG3  . LYS A 1 33 ? 8.817   -2.916  5.346   1.00 1.00 ? 33  LYS A HG3  5  
ATOM   5865  H HD2  . LYS A 1 33 ? 9.970   -5.611  4.578   1.00 1.00 ? 33  LYS A HD2  5  
ATOM   5866  H HD3  . LYS A 1 33 ? 8.246   -5.308  4.780   1.00 1.00 ? 33  LYS A HD3  5  
ATOM   5867  H HE2  . LYS A 1 33 ? 8.530   -3.411  3.079   1.00 1.00 ? 33  LYS A HE2  5  
ATOM   5868  H HE3  . LYS A 1 33 ? 10.115  -4.102  2.734   1.00 1.00 ? 33  LYS A HE3  5  
ATOM   5869  H HZ1  . LYS A 1 33 ? 8.016   -6.055  2.798   1.00 1.00 ? 33  LYS A HZ1  5  
ATOM   5870  H HZ2  . LYS A 1 33 ? 9.219   -5.790  1.629   1.00 1.00 ? 33  LYS A HZ2  5  
ATOM   5871  H HZ3  . LYS A 1 33 ? 7.786   -4.880  1.600   1.00 1.00 ? 33  LYS A HZ3  5  
ATOM   5872  N N    . LEU A 1 34 ? 13.636  -2.978  6.760   1.00 1.00 ? 34  LEU A N    5  
ATOM   5873  C CA   . LEU A 1 34 ? 15.084  -2.819  6.737   1.00 1.00 ? 34  LEU A CA   5  
ATOM   5874  C C    . LEU A 1 34 ? 15.587  -2.746  5.298   1.00 1.00 ? 34  LEU A C    5  
ATOM   5875  O O    . LEU A 1 34 ? 15.199  -3.556  4.454   1.00 1.00 ? 34  LEU A O    5  
ATOM   5876  C CB   . LEU A 1 34 ? 15.741  -4.005  7.447   1.00 1.00 ? 34  LEU A CB   5  
ATOM   5877  C CG   . LEU A 1 34 ? 15.166  -4.150  8.862   1.00 1.00 ? 34  LEU A CG   5  
ATOM   5878  C CD1  . LEU A 1 34 ? 15.769  -5.390  9.524   1.00 1.00 ? 34  LEU A CD1  5  
ATOM   5879  C CD2  . LEU A 1 34 ? 15.504  -2.903  9.696   1.00 1.00 ? 34  LEU A CD2  5  
ATOM   5880  H H    . LEU A 1 34 ? 13.249  -3.818  7.080   1.00 1.00 ? 34  LEU A H    5  
ATOM   5881  H HA   . LEU A 1 34 ? 15.352  -1.909  7.250   1.00 1.00 ? 34  LEU A HA   5  
ATOM   5882  H HB2  . LEU A 1 34 ? 15.549  -4.909  6.886   1.00 1.00 ? 34  LEU A HB2  5  
ATOM   5883  H HB3  . LEU A 1 34 ? 16.807  -3.841  7.511   1.00 1.00 ? 34  LEU A HB3  5  
ATOM   5884  H HG   . LEU A 1 34 ? 14.092  -4.263  8.800   1.00 1.00 ? 34  LEU A HG   5  
ATOM   5885  H HD11 . LEU A 1 34 ? 15.278  -5.567  10.471  1.00 1.00 ? 34  LEU A HD11 5  
ATOM   5886  H HD12 . LEU A 1 34 ? 16.824  -5.233  9.690   1.00 1.00 ? 34  LEU A HD12 5  
ATOM   5887  H HD13 . LEU A 1 34 ? 15.629  -6.247  8.882   1.00 1.00 ? 34  LEU A HD13 5  
ATOM   5888  H HD21 . LEU A 1 34 ? 15.463  -3.147  10.749  1.00 1.00 ? 34  LEU A HD21 5  
ATOM   5889  H HD22 . LEU A 1 34 ? 14.789  -2.123  9.486   1.00 1.00 ? 34  LEU A HD22 5  
ATOM   5890  H HD23 . LEU A 1 34 ? 16.499  -2.556  9.449   1.00 1.00 ? 34  LEU A HD23 5  
ATOM   5891  N N    . GLY A 1 35 ? 16.451  -1.770  5.024   1.00 1.00 ? 35  GLY A N    5  
ATOM   5892  C CA   . GLY A 1 35 ? 17.005  -1.590  3.680   1.00 1.00 ? 35  GLY A CA   5  
ATOM   5893  C C    . GLY A 1 35 ? 17.144  -0.108  3.350   1.00 1.00 ? 35  GLY A C    5  
ATOM   5894  O O    . GLY A 1 35 ? 17.766  0.647   4.099   1.00 1.00 ? 35  GLY A O    5  
ATOM   5895  H H    . GLY A 1 35 ? 16.721  -1.156  5.737   1.00 1.00 ? 35  GLY A H    5  
ATOM   5896  H HA2  . GLY A 1 35 ? 17.980  -2.057  3.633   1.00 1.00 ? 35  GLY A HA2  5  
ATOM   5897  H HA3  . GLY A 1 35 ? 16.354  -2.052  2.951   1.00 1.00 ? 35  GLY A HA3  5  
ATOM   5898  N N    . ALA A 1 36 ? 16.560  0.303   2.229   1.00 1.00 ? 36  ALA A N    5  
ATOM   5899  C CA   . ALA A 1 36 ? 16.624  1.701   1.814   1.00 1.00 ? 36  ALA A CA   5  
ATOM   5900  C C    . ALA A 1 36 ? 15.855  2.586   2.789   1.00 1.00 ? 36  ALA A C    5  
ATOM   5901  O O    . ALA A 1 36 ? 14.781  2.216   3.264   1.00 1.00 ? 36  ALA A O    5  
ATOM   5902  C CB   . ALA A 1 36 ? 16.036  1.852   0.410   1.00 1.00 ? 36  ALA A CB   5  
ATOM   5903  H H    . ALA A 1 36 ? 16.077  -0.342  1.674   1.00 1.00 ? 36  ALA A H    5  
ATOM   5904  H HA   . ALA A 1 36 ? 17.658  2.014   1.795   1.00 1.00 ? 36  ALA A HA   5  
ATOM   5905  H HB1  . ALA A 1 36 ? 15.068  1.372   0.373   1.00 1.00 ? 36  ALA A HB1  5  
ATOM   5906  H HB2  . ALA A 1 36 ? 16.694  1.390   -0.308  1.00 1.00 ? 36  ALA A HB2  5  
ATOM   5907  H HB3  . ALA A 1 36 ? 15.926  2.900   0.177   1.00 1.00 ? 36  ALA A HB3  5  
ATOM   5908  N N    . ASP A 1 37 ? 16.411  3.760   3.080   1.00 1.00 ? 37  ASP A N    5  
ATOM   5909  C CA   . ASP A 1 37 ? 15.772  4.700   3.999   1.00 1.00 ? 37  ASP A CA   5  
ATOM   5910  C C    . ASP A 1 37 ? 14.870  5.665   3.237   1.00 1.00 ? 37  ASP A C    5  
ATOM   5911  O O    . ASP A 1 37 ? 14.244  6.543   3.830   1.00 1.00 ? 37  ASP A O    5  
ATOM   5912  C CB   . ASP A 1 37 ? 16.839  5.492   4.761   1.00 1.00 ? 37  ASP A CB   5  
ATOM   5913  C CG   . ASP A 1 37 ? 17.796  6.156   3.778   1.00 1.00 ? 37  ASP A CG   5  
ATOM   5914  O OD1  . ASP A 1 37 ? 17.793  5.765   2.622   1.00 1.00 ? 37  ASP A OD1  5  
ATOM   5915  O OD2  . ASP A 1 37 ? 18.516  7.047   4.194   1.00 1.00 ? 37  ASP A OD2  5  
ATOM   5916  H H    . ASP A 1 37 ? 17.267  4.001   2.669   1.00 1.00 ? 37  ASP A H    5  
ATOM   5917  H HA   . ASP A 1 37 ? 15.173  4.151   4.714   1.00 1.00 ? 37  ASP A HA   5  
ATOM   5918  H HB2  . ASP A 1 37 ? 16.359  6.250   5.363   1.00 1.00 ? 37  ASP A HB2  5  
ATOM   5919  H HB3  . ASP A 1 37 ? 17.392  4.823   5.401   1.00 1.00 ? 37  ASP A HB3  5  
ATOM   5920  N N    . SER A 1 38 ? 14.811  5.497   1.919   1.00 1.00 ? 38  SER A N    5  
ATOM   5921  C CA   . SER A 1 38 ? 13.980  6.363   1.090   1.00 1.00 ? 38  SER A CA   5  
ATOM   5922  C C    . SER A 1 38 ? 12.507  6.006   1.256   1.00 1.00 ? 38  SER A C    5  
ATOM   5923  O O    . SER A 1 38 ? 12.126  4.838   1.183   1.00 1.00 ? 38  SER A O    5  
ATOM   5924  C CB   . SER A 1 38 ? 14.383  6.223   -0.380  1.00 1.00 ? 38  SER A CB   5  
ATOM   5925  H H    . SER A 1 38 ? 15.331  4.781   1.501   1.00 1.00 ? 38  SER A H    5  
ATOM   5926  H HA   . SER A 1 38 ? 14.129  7.387   1.396   1.00 1.00 ? 38  SER A HA   5  
ATOM   5927  H HB2  . SER A 1 38 ? 13.592  6.612   -1.010  1.00 1.00 ? 38  SER A HB2  5  
ATOM   5928  H HB3  . SER A 1 38 ? 14.543  5.183   -0.614  1.00 1.00 ? 38  SER A HB3  5  
ATOM   5929  N N    . LEU A 1 39 ? 11.682  7.024   1.477   1.00 1.00 ? 39  LEU A N    5  
ATOM   5930  C CA   . LEU A 1 39 ? 10.252  6.809   1.648   1.00 1.00 ? 39  LEU A CA   5  
ATOM   5931  C C    . LEU A 1 39 ? 9.642   6.246   0.368   1.00 1.00 ? 39  LEU A C    5  
ATOM   5932  O O    . LEU A 1 39 ? 8.821   5.334   0.411   1.00 1.00 ? 39  LEU A O    5  
ATOM   5933  C CB   . LEU A 1 39 ? 9.567   8.129   2.011   1.00 1.00 ? 39  LEU A CB   5  
ATOM   5934  C CG   . LEU A 1 39 ? 9.997   8.575   3.418   1.00 1.00 ? 39  LEU A CG   5  
ATOM   5935  C CD1  . LEU A 1 39 ? 9.511   10.008  3.659   1.00 1.00 ? 39  LEU A CD1  5  
ATOM   5936  C CD2  . LEU A 1 39 ? 9.399   7.637   4.491   1.00 1.00 ? 39  LEU A CD2  5  
ATOM   5937  H H    . LEU A 1 39 ? 12.043  7.934   1.523   1.00 1.00 ? 39  LEU A H    5  
ATOM   5938  H HA   . LEU A 1 39 ? 10.097  6.102   2.446   1.00 1.00 ? 39  LEU A HA   5  
ATOM   5939  H HB2  . LEU A 1 39 ? 9.850   8.887   1.293   1.00 1.00 ? 39  LEU A HB2  5  
ATOM   5940  H HB3  . LEU A 1 39 ? 8.496   7.997   1.985   1.00 1.00 ? 39  LEU A HB3  5  
ATOM   5941  H HG   . LEU A 1 39 ? 11.077  8.552   3.482   1.00 1.00 ? 39  LEU A HG   5  
ATOM   5942  H HD11 . LEU A 1 39 ? 9.858   10.644  2.858   1.00 1.00 ? 39  LEU A HD11 5  
ATOM   5943  H HD12 . LEU A 1 39 ? 9.900   10.367  4.599   1.00 1.00 ? 39  LEU A HD12 5  
ATOM   5944  H HD13 . LEU A 1 39 ? 8.431   10.020  3.686   1.00 1.00 ? 39  LEU A HD13 5  
ATOM   5945  H HD21 . LEU A 1 39 ? 8.431   7.280   4.171   1.00 1.00 ? 39  LEU A HD21 5  
ATOM   5946  H HD22 . LEU A 1 39 ? 9.289   8.171   5.424   1.00 1.00 ? 39  LEU A HD22 5  
ATOM   5947  H HD23 . LEU A 1 39 ? 10.059  6.797   4.644   1.00 1.00 ? 39  LEU A HD23 5  
ATOM   5948  N N    . ASP A 1 40 ? 10.050  6.795   -0.772  1.00 1.00 ? 40  ASP A N    5  
ATOM   5949  C CA   . ASP A 1 40 ? 9.534   6.329   -2.052  1.00 1.00 ? 40  ASP A CA   5  
ATOM   5950  C C    . ASP A 1 40 ? 8.014   6.212   -2.002  1.00 1.00 ? 40  ASP A C    5  
ATOM   5951  O O    . ASP A 1 40 ? 7.425   5.372   -2.681  1.00 1.00 ? 40  ASP A O    5  
ATOM   5952  C CB   . ASP A 1 40 ? 10.141  4.968   -2.399  1.00 1.00 ? 40  ASP A CB   5  
ATOM   5953  C CG   . ASP A 1 40 ? 11.611  5.128   -2.769  1.00 1.00 ? 40  ASP A CG   5  
ATOM   5954  O OD1  . ASP A 1 40 ? 12.021  6.250   -3.016  1.00 1.00 ? 40  ASP A OD1  5  
ATOM   5955  O OD2  . ASP A 1 40 ? 12.306  4.127   -2.802  1.00 1.00 ? 40  ASP A OD2  5  
ATOM   5956  H H    . ASP A 1 40 ? 10.709  7.521   -0.749  1.00 1.00 ? 40  ASP A H    5  
ATOM   5957  H HA   . ASP A 1 40 ? 9.806   7.040   -2.821  1.00 1.00 ? 40  ASP A HA   5  
ATOM   5958  H HB2  . ASP A 1 40 ? 10.056  4.312   -1.545  1.00 1.00 ? 40  ASP A HB2  5  
ATOM   5959  H HB3  . ASP A 1 40 ? 9.607   4.539   -3.234  1.00 1.00 ? 40  ASP A HB3  5  
ATOM   5960  N N    . THR A 1 41 ? 7.386   7.058   -1.193  1.00 1.00 ? 41  THR A N    5  
ATOM   5961  C CA   . THR A 1 41 ? 5.934   7.033   -1.056  1.00 1.00 ? 41  THR A CA   5  
ATOM   5962  C C    . THR A 1 41 ? 5.273   7.307   -2.400  1.00 1.00 ? 41  THR A C    5  
ATOM   5963  O O    . THR A 1 41 ? 4.182   6.814   -2.669  1.00 1.00 ? 41  THR A O    5  
ATOM   5964  C CB   . THR A 1 41 ? 5.489   8.078   -0.029  1.00 1.00 ? 41  THR A CB   5  
ATOM   5965  O OG1  . THR A 1 41 ? 6.239   7.913   1.164   1.00 1.00 ? 41  THR A OG1  5  
ATOM   5966  C CG2  . THR A 1 41 ? 3.997   7.911   0.282   1.00 1.00 ? 41  THR A CG2  5  
ATOM   5967  H H    . THR A 1 41 ? 7.907   7.706   -0.675  1.00 1.00 ? 41  THR A H    5  
ATOM   5968  H HA   . THR A 1 41 ? 5.635   6.055   -0.712  1.00 1.00 ? 41  THR A HA   5  
ATOM   5969  H HB   . THR A 1 41 ? 5.658   9.068   -0.426  1.00 1.00 ? 41  THR A HB   5  
ATOM   5970  H HG1  . THR A 1 41 ? 6.937   8.571   1.170   1.00 1.00 ? 41  THR A HG1  5  
ATOM   5971  H HG21 . THR A 1 41 ? 3.409   8.328   -0.525  1.00 1.00 ? 41  THR A HG21 5  
ATOM   5972  H HG22 . THR A 1 41 ? 3.765   8.428   1.200   1.00 1.00 ? 41  THR A HG22 5  
ATOM   5973  H HG23 . THR A 1 41 ? 3.764   6.863   0.395   1.00 1.00 ? 41  THR A HG23 5  
ATOM   5974  N N    . VAL A 1 42 ? 5.947   8.089   -3.236  1.00 1.00 ? 42  VAL A N    5  
ATOM   5975  C CA   . VAL A 1 42 ? 5.428   8.421   -4.559  1.00 1.00 ? 42  VAL A CA   5  
ATOM   5976  C C    . VAL A 1 42 ? 5.267   7.158   -5.404  1.00 1.00 ? 42  VAL A C    5  
ATOM   5977  O O    . VAL A 1 42 ? 4.300   7.013   -6.148  1.00 1.00 ? 42  VAL A O    5  
ATOM   5978  C CB   . VAL A 1 42 ? 6.371   9.398   -5.261  1.00 1.00 ? 42  VAL A CB   5  
ATOM   5979  C CG1  . VAL A 1 42 ? 5.852   9.687   -6.671  1.00 1.00 ? 42  VAL A CG1  5  
ATOM   5980  C CG2  . VAL A 1 42 ? 6.436   10.703  -4.465  1.00 1.00 ? 42  VAL A CG2  5  
ATOM   5981  H H    . VAL A 1 42 ? 6.817   8.445   -2.959  1.00 1.00 ? 42  VAL A H    5  
ATOM   5982  H HA   . VAL A 1 42 ? 4.462   8.891   -4.446  1.00 1.00 ? 42  VAL A HA   5  
ATOM   5983  H HB   . VAL A 1 42 ? 7.358   8.963   -5.325  1.00 1.00 ? 42  VAL A HB   5  
ATOM   5984  H HG11 . VAL A 1 42 ? 6.362   10.550  -7.073  1.00 1.00 ? 42  VAL A HG11 5  
ATOM   5985  H HG12 . VAL A 1 42 ? 4.790   9.886   -6.629  1.00 1.00 ? 42  VAL A HG12 5  
ATOM   5986  H HG13 . VAL A 1 42 ? 6.033   8.833   -7.305  1.00 1.00 ? 42  VAL A HG13 5  
ATOM   5987  H HG21 . VAL A 1 42 ? 5.436   11.011  -4.196  1.00 1.00 ? 42  VAL A HG21 5  
ATOM   5988  H HG22 . VAL A 1 42 ? 6.899   11.471  -5.068  1.00 1.00 ? 42  VAL A HG22 5  
ATOM   5989  H HG23 . VAL A 1 42 ? 7.019   10.550  -3.569  1.00 1.00 ? 42  VAL A HG23 5  
ATOM   5990  N N    . GLU A 1 43 ? 6.229   6.254   -5.307  1.00 1.00 ? 43  GLU A N    5  
ATOM   5991  C CA   . GLU A 1 43 ? 6.171   5.016   -6.078  1.00 1.00 ? 43  GLU A CA   5  
ATOM   5992  C C    . GLU A 1 43 ? 5.088   4.077   -5.532  1.00 1.00 ? 43  GLU A C    5  
ATOM   5993  O O    . GLU A 1 43 ? 4.301   3.512   -6.293  1.00 1.00 ? 43  GLU A O    5  
ATOM   5994  C CB   . GLU A 1 43 ? 7.524   4.308   -6.029  1.00 1.00 ? 43  GLU A CB   5  
ATOM   5995  C CG   . GLU A 1 43 ? 7.498   3.073   -6.936  1.00 1.00 ? 43  GLU A CG   5  
ATOM   5996  C CD   . GLU A 1 43 ? 8.859   2.385   -6.920  1.00 1.00 ? 43  GLU A CD   5  
ATOM   5997  O OE1  . GLU A 1 43 ? 9.386   2.183   -5.839  1.00 1.00 ? 43  GLU A OE1  5  
ATOM   5998  O OE2  . GLU A 1 43 ? 9.354   2.071   -7.990  1.00 1.00 ? 43  GLU A OE2  5  
ATOM   5999  H H    . GLU A 1 43 ? 6.993   6.418   -4.713  1.00 1.00 ? 43  GLU A H    5  
ATOM   6000  H HA   . GLU A 1 43 ? 5.939   5.254   -7.106  1.00 1.00 ? 43  GLU A HA   5  
ATOM   6001  H HB2  . GLU A 1 43 ? 8.296   4.986   -6.365  1.00 1.00 ? 43  GLU A HB2  5  
ATOM   6002  H HB3  . GLU A 1 43 ? 7.733   4.002   -5.014  1.00 1.00 ? 43  GLU A HB3  5  
ATOM   6003  H HG2  . GLU A 1 43 ? 6.745   2.383   -6.583  1.00 1.00 ? 43  GLU A HG2  5  
ATOM   6004  H HG3  . GLU A 1 43 ? 7.262   3.375   -7.945  1.00 1.00 ? 43  GLU A HG3  5  
ATOM   6005  N N    . ILE A 1 44 ? 5.078   3.891   -4.211  1.00 1.00 ? 44  ILE A N    5  
ATOM   6006  C CA   . ILE A 1 44 ? 4.114   2.986   -3.572  1.00 1.00 ? 44  ILE A CA   5  
ATOM   6007  C C    . ILE A 1 44 ? 2.674   3.478   -3.721  1.00 1.00 ? 44  ILE A C    5  
ATOM   6008  O O    . ILE A 1 44 ? 1.771   2.692   -4.014  1.00 1.00 ? 44  ILE A O    5  
ATOM   6009  C CB   . ILE A 1 44 ? 4.421   2.855   -2.077  1.00 1.00 ? 44  ILE A CB   5  
ATOM   6010  C CG1  . ILE A 1 44 ? 5.894   2.485   -1.854  1.00 1.00 ? 44  ILE A CG1  5  
ATOM   6011  C CG2  . ILE A 1 44 ? 3.533   1.762   -1.475  1.00 1.00 ? 44  ILE A CG2  5  
ATOM   6012  C CD1  . ILE A 1 44 ? 6.254   1.194   -2.591  1.00 1.00 ? 44  ILE A CD1  5  
ATOM   6013  H H    . ILE A 1 44 ? 5.743   4.352   -3.657  1.00 1.00 ? 44  ILE A H    5  
ATOM   6014  H HA   . ILE A 1 44 ? 4.195   2.012   -4.028  1.00 1.00 ? 44  ILE A HA   5  
ATOM   6015  H HB   . ILE A 1 44 ? 4.207   3.796   -1.589  1.00 1.00 ? 44  ILE A HB   5  
ATOM   6016  H HG12 . ILE A 1 44 ? 6.522   3.282   -2.215  1.00 1.00 ? 44  ILE A HG12 5  
ATOM   6017  H HG13 . ILE A 1 44 ? 6.066   2.346   -0.799  1.00 1.00 ? 44  ILE A HG13 5  
ATOM   6018  H HG21 . ILE A 1 44 ? 3.711   0.831   -2.003  1.00 1.00 ? 44  ILE A HG21 5  
ATOM   6019  H HG22 . ILE A 1 44 ? 2.495   2.039   -1.575  1.00 1.00 ? 44  ILE A HG22 5  
ATOM   6020  H HG23 . ILE A 1 44 ? 3.775   1.636   -0.432  1.00 1.00 ? 44  ILE A HG23 5  
ATOM   6021  H HD11 . ILE A 1 44 ? 7.174   0.797   -2.184  1.00 1.00 ? 44  ILE A HD11 5  
ATOM   6022  H HD12 . ILE A 1 44 ? 6.391   1.401   -3.641  1.00 1.00 ? 44  ILE A HD12 5  
ATOM   6023  H HD13 . ILE A 1 44 ? 5.470   0.471   -2.460  1.00 1.00 ? 44  ILE A HD13 5  
ATOM   6024  N N    . VAL A 1 45 ? 2.452   4.770   -3.490  1.00 1.00 ? 45  VAL A N    5  
ATOM   6025  C CA   . VAL A 1 45 ? 1.102   5.329   -3.574  1.00 1.00 ? 45  VAL A CA   5  
ATOM   6026  C C    . VAL A 1 45 ? 0.536   5.155   -4.973  1.00 1.00 ? 45  VAL A C    5  
ATOM   6027  O O    . VAL A 1 45 ? -0.629  4.796   -5.146  1.00 1.00 ? 45  VAL A O    5  
ATOM   6028  C CB   . VAL A 1 45 ? 1.122   6.817   -3.221  1.00 1.00 ? 45  VAL A CB   5  
ATOM   6029  C CG1  . VAL A 1 45 ? 1.925   7.578   -4.272  1.00 1.00 ? 45  VAL A CG1  5  
ATOM   6030  C CG2  . VAL A 1 45 ? -0.305  7.353   -3.196  1.00 1.00 ? 45  VAL A CG2  5  
ATOM   6031  H H    . VAL A 1 45 ? 3.201   5.351   -3.240  1.00 1.00 ? 45  VAL A H    5  
ATOM   6032  H HA   . VAL A 1 45 ? 0.464   4.814   -2.870  1.00 1.00 ? 45  VAL A HA   5  
ATOM   6033  H HB   . VAL A 1 45 ? 1.580   6.954   -2.251  1.00 1.00 ? 45  VAL A HB   5  
ATOM   6034  H HG11 . VAL A 1 45 ? 2.814   7.025   -4.501  1.00 1.00 ? 45  VAL A HG11 5  
ATOM   6035  H HG12 . VAL A 1 45 ? 2.192   8.551   -3.890  1.00 1.00 ? 45  VAL A HG12 5  
ATOM   6036  H HG13 . VAL A 1 45 ? 1.334   7.691   -5.172  1.00 1.00 ? 45  VAL A HG13 5  
ATOM   6037  H HG21 . VAL A 1 45 ? -0.710  7.343   -4.201  1.00 1.00 ? 45  VAL A HG21 5  
ATOM   6038  H HG22 . VAL A 1 45 ? -0.306  8.365   -2.818  1.00 1.00 ? 45  VAL A HG22 5  
ATOM   6039  H HG23 . VAL A 1 45 ? -0.912  6.729   -2.556  1.00 1.00 ? 45  VAL A HG23 5  
ATOM   6040  N N    . MET A 1 46 ? 1.373   5.410   -5.971  1.00 1.00 ? 46  MET A N    5  
ATOM   6041  C CA   . MET A 1 46 ? 0.951   5.278   -7.357  1.00 1.00 ? 46  MET A CA   5  
ATOM   6042  C C    . MET A 1 46 ? 0.611   3.828   -7.676  1.00 1.00 ? 46  MET A C    5  
ATOM   6043  O O    . MET A 1 46 ? -0.342  3.554   -8.406  1.00 1.00 ? 46  MET A O    5  
ATOM   6044  C CB   . MET A 1 46 ? 2.059   5.770   -8.303  1.00 1.00 ? 46  MET A CB   5  
ATOM   6045  C CG   . MET A 1 46 ? 2.117   7.309   -8.333  1.00 1.00 ? 46  MET A CG   5  
ATOM   6046  S SD   . MET A 1 46 ? 0.513   8.030   -8.802  1.00 1.00 ? 46  MET A SD   5  
ATOM   6047  C CE   . MET A 1 46 ? 0.202   7.060   -10.299 1.00 1.00 ? 46  MET A CE   5  
ATOM   6048  H H    . MET A 1 46 ? 2.289   5.691   -5.770  1.00 1.00 ? 46  MET A H    5  
ATOM   6049  H HA   . MET A 1 46 ? 0.067   5.868   -7.504  1.00 1.00 ? 46  MET A HA   5  
ATOM   6050  H HB2  . MET A 1 46 ? 3.010   5.392   -7.951  1.00 1.00 ? 46  MET A HB2  5  
ATOM   6051  H HB3  . MET A 1 46 ? 1.885   5.393   -9.296  1.00 1.00 ? 46  MET A HB3  5  
ATOM   6052  H HG2  . MET A 1 46 ? 2.390   7.670   -7.354  1.00 1.00 ? 46  MET A HG2  5  
ATOM   6053  H HG3  . MET A 1 46 ? 2.867   7.621   -9.044  1.00 1.00 ? 46  MET A HG3  5  
ATOM   6054  H HE1  . MET A 1 46 ? -0.516  7.581   -10.917 1.00 1.00 ? 46  MET A HE1  5  
ATOM   6055  H HE2  . MET A 1 46 ? -0.196  6.092   -10.030 1.00 1.00 ? 46  MET A HE2  5  
ATOM   6056  H HE3  . MET A 1 46 ? 1.128   6.930   -10.842 1.00 1.00 ? 46  MET A HE3  5  
ATOM   6057  N N    . ASN A 1 47 ? 1.389   2.902   -7.130  1.00 1.00 ? 47  ASN A N    5  
ATOM   6058  C CA   . ASN A 1 47 ? 1.148   1.490   -7.372  1.00 1.00 ? 47  ASN A CA   5  
ATOM   6059  C C    . ASN A 1 47 ? -0.235  1.098   -6.855  1.00 1.00 ? 47  ASN A C    5  
ATOM   6060  O O    . ASN A 1 47 ? -0.944  0.306   -7.472  1.00 1.00 ? 47  ASN A O    5  
ATOM   6061  C CB   . ASN A 1 47 ? 2.238   0.650   -6.697  1.00 1.00 ? 47  ASN A CB   5  
ATOM   6062  C CG   . ASN A 1 47 ? 3.473   0.591   -7.586  1.00 1.00 ? 47  ASN A CG   5  
ATOM   6063  O OD1  . ASN A 1 47 ? 4.298   1.504   -7.574  1.00 1.00 ? 47  ASN A OD1  5  
ATOM   6064  N ND2  . ASN A 1 47 ? 3.642   -0.442  -8.362  1.00 1.00 ? 47  ASN A ND2  5  
ATOM   6065  H H    . ASN A 1 47 ? 2.136   3.169   -6.555  1.00 1.00 ? 47  ASN A H    5  
ATOM   6066  H HA   . ASN A 1 47 ? 1.181   1.315   -8.438  1.00 1.00 ? 47  ASN A HA   5  
ATOM   6067  H HB2  . ASN A 1 47 ? 2.498   1.089   -5.746  1.00 1.00 ? 47  ASN A HB2  5  
ATOM   6068  H HB3  . ASN A 1 47 ? 1.876   -0.348  -6.542  1.00 1.00 ? 47  ASN A HB3  5  
ATOM   6069  H HD21 . ASN A 1 47 ? 2.976   -1.163  -8.364  1.00 1.00 ? 47  ASN A HD21 5  
ATOM   6070  H HD22 . ASN A 1 47 ? 4.427   -0.494  -8.945  1.00 1.00 ? 47  ASN A HD22 5  
ATOM   6071  N N    . LEU A 1 48 ? -0.613  1.649   -5.720  1.00 1.00 ? 48  LEU A N    5  
ATOM   6072  C CA   . LEU A 1 48 ? -1.920  1.355   -5.150  1.00 1.00 ? 48  LEU A CA   5  
ATOM   6073  C C    . LEU A 1 48 ? -3.011  2.065   -5.949  1.00 1.00 ? 48  LEU A C    5  
ATOM   6074  O O    . LEU A 1 48 ? -4.032  1.471   -6.292  1.00 1.00 ? 48  LEU A O    5  
ATOM   6075  C CB   . LEU A 1 48 ? -1.952  1.811   -3.690  1.00 1.00 ? 48  LEU A CB   5  
ATOM   6076  C CG   . LEU A 1 48 ? -0.860  1.067   -2.902  1.00 1.00 ? 48  LEU A CG   5  
ATOM   6077  C CD1  . LEU A 1 48 ? -0.565  1.816   -1.609  1.00 1.00 ? 48  LEU A CD1  5  
ATOM   6078  C CD2  . LEU A 1 48 ? -1.332  -0.344  -2.544  1.00 1.00 ? 48  LEU A CD2  5  
ATOM   6079  H H    . LEU A 1 48 ? -0.008  2.268   -5.262  1.00 1.00 ? 48  LEU A H    5  
ATOM   6080  H HA   . LEU A 1 48 ? -2.100  0.299   -5.199  1.00 1.00 ? 48  LEU A HA   5  
ATOM   6081  H HB2  . LEU A 1 48 ? -1.775  2.877   -3.642  1.00 1.00 ? 48  LEU A HB2  5  
ATOM   6082  H HB3  . LEU A 1 48 ? -2.921  1.588   -3.264  1.00 1.00 ? 48  LEU A HB3  5  
ATOM   6083  H HG   . LEU A 1 48 ? 0.038   1.014   -3.492  1.00 1.00 ? 48  LEU A HG   5  
ATOM   6084  H HD11 . LEU A 1 48 ? -0.119  2.770   -1.842  1.00 1.00 ? 48  LEU A HD11 5  
ATOM   6085  H HD12 . LEU A 1 48 ? 0.119   1.236   -1.006  1.00 1.00 ? 48  LEU A HD12 5  
ATOM   6086  H HD13 . LEU A 1 48 ? -1.485  1.964   -1.069  1.00 1.00 ? 48  LEU A HD13 5  
ATOM   6087  H HD21 . LEU A 1 48 ? -2.246  -0.279  -1.984  1.00 1.00 ? 48  LEU A HD21 5  
ATOM   6088  H HD22 . LEU A 1 48 ? -0.576  -0.831  -1.948  1.00 1.00 ? 48  LEU A HD22 5  
ATOM   6089  H HD23 . LEU A 1 48 ? -1.500  -0.918  -3.436  1.00 1.00 ? 48  LEU A HD23 5  
ATOM   6090  N N    . GLU A 1 49 ? -2.783  3.338   -6.251  1.00 1.00 ? 49  GLU A N    5  
ATOM   6091  C CA   . GLU A 1 49 ? -3.756  4.119   -7.004  1.00 1.00 ? 49  GLU A CA   5  
ATOM   6092  C C    . GLU A 1 49 ? -3.956  3.536   -8.401  1.00 1.00 ? 49  GLU A C    5  
ATOM   6093  O O    . GLU A 1 49 ? -5.079  3.467   -8.899  1.00 1.00 ? 49  GLU A O    5  
ATOM   6094  C CB   . GLU A 1 49 ? -3.282  5.569   -7.123  1.00 1.00 ? 49  GLU A CB   5  
ATOM   6095  C CG   . GLU A 1 49 ? -4.408  6.434   -7.696  1.00 1.00 ? 49  GLU A CG   5  
ATOM   6096  C CD   . GLU A 1 49 ? -3.924  7.871   -7.866  1.00 1.00 ? 49  GLU A CD   5  
ATOM   6097  O OE1  . GLU A 1 49 ? -2.901  8.201   -7.290  1.00 1.00 ? 49  GLU A OE1  5  
ATOM   6098  O OE2  . GLU A 1 49 ? -4.582  8.617   -8.572  1.00 1.00 ? 49  GLU A OE2  5  
ATOM   6099  H H    . GLU A 1 49 ? -1.953  3.760   -5.958  1.00 1.00 ? 49  GLU A H    5  
ATOM   6100  H HA   . GLU A 1 49 ? -4.699  4.108   -6.482  1.00 1.00 ? 49  GLU A HA   5  
ATOM   6101  H HB2  . GLU A 1 49 ? -3.005  5.936   -6.147  1.00 1.00 ? 49  GLU A HB2  5  
ATOM   6102  H HB3  . GLU A 1 49 ? -2.427  5.614   -7.781  1.00 1.00 ? 49  GLU A HB3  5  
ATOM   6103  H HG2  . GLU A 1 49 ? -4.711  6.041   -8.657  1.00 1.00 ? 49  GLU A HG2  5  
ATOM   6104  H HG3  . GLU A 1 49 ? -5.251  6.422   -7.018  1.00 1.00 ? 49  GLU A HG3  5  
ATOM   6105  N N    . GLU A 1 50 ? -2.860  3.123   -9.035  1.00 1.00 ? 50  GLU A N    5  
ATOM   6106  C CA   . GLU A 1 50 ? -2.940  2.557   -10.377 1.00 1.00 ? 50  GLU A CA   5  
ATOM   6107  C C    . GLU A 1 50 ? -3.612  1.181   -10.344 1.00 1.00 ? 50  GLU A C    5  
ATOM   6108  O O    . GLU A 1 50 ? -4.469  0.880   -11.177 1.00 1.00 ? 50  GLU A O    5  
ATOM   6109  C CB   . GLU A 1 50 ? -1.534  2.476   -11.011 1.00 1.00 ? 50  GLU A CB   5  
ATOM   6110  C CG   . GLU A 1 50 ? -0.787  1.249   -10.513 1.00 1.00 ? 50  GLU A CG   5  
ATOM   6111  C CD   . GLU A 1 50 ? 0.659   1.282   -10.993 1.00 1.00 ? 50  GLU A CD   5  
ATOM   6112  O OE1  . GLU A 1 50 ? 1.238   2.356   -10.990 1.00 1.00 ? 50  GLU A OE1  5  
ATOM   6113  O OE2  . GLU A 1 50 ? 1.168   0.235   -11.354 1.00 1.00 ? 50  GLU A OE2  5  
ATOM   6114  H H    . GLU A 1 50 ? -1.991  3.202   -8.592  1.00 1.00 ? 50  GLU A H    5  
ATOM   6115  H HA   . GLU A 1 50 ? -3.541  3.213   -10.982 1.00 1.00 ? 50  GLU A HA   5  
ATOM   6116  H HB2  . GLU A 1 50 ? -1.621  2.424   -12.082 1.00 1.00 ? 50  GLU A HB2  5  
ATOM   6117  H HB3  . GLU A 1 50 ? -0.970  3.356   -10.737 1.00 1.00 ? 50  GLU A HB3  5  
ATOM   6118  H HG2  . GLU A 1 50 ? -0.814  1.253   -9.449  1.00 1.00 ? 50  GLU A HG2  5  
ATOM   6119  H HG3  . GLU A 1 50 ? -1.259  0.353   -10.883 1.00 1.00 ? 50  GLU A HG3  5  
ATOM   6120  N N    . GLU A 1 51 ? -3.213  0.351   -9.380  1.00 1.00 ? 51  GLU A N    5  
ATOM   6121  C CA   . GLU A 1 51 ? -3.775  -0.990  -9.249  1.00 1.00 ? 51  GLU A CA   5  
ATOM   6122  C C    . GLU A 1 51 ? -5.277  -0.925  -8.994  1.00 1.00 ? 51  GLU A C    5  
ATOM   6123  O O    . GLU A 1 51 ? -6.070  -1.466  -9.765  1.00 1.00 ? 51  GLU A O    5  
ATOM   6124  C CB   . GLU A 1 51 ? -3.090  -1.717  -8.089  1.00 1.00 ? 51  GLU A CB   5  
ATOM   6125  C CG   . GLU A 1 51 ? -3.504  -3.189  -8.077  1.00 1.00 ? 51  GLU A CG   5  
ATOM   6126  C CD   . GLU A 1 51 ? -2.877  -3.913  -9.264  1.00 1.00 ? 51  GLU A CD   5  
ATOM   6127  O OE1  . GLU A 1 51 ? -2.057  -3.309  -9.933  1.00 1.00 ? 51  GLU A OE1  5  
ATOM   6128  O OE2  . GLU A 1 51 ? -3.223  -5.061  -9.482  1.00 1.00 ? 51  GLU A OE2  5  
ATOM   6129  H H    . GLU A 1 51 ? -2.522  0.642   -8.747  1.00 1.00 ? 51  GLU A H    5  
ATOM   6130  H HA   . GLU A 1 51 ? -3.597  -1.541  -10.160 1.00 1.00 ? 51  GLU A HA   5  
ATOM   6131  H HB2  . GLU A 1 51 ? -2.019  -1.648  -8.206  1.00 1.00 ? 51  GLU A HB2  5  
ATOM   6132  H HB3  . GLU A 1 51 ? -3.381  -1.256  -7.156  1.00 1.00 ? 51  GLU A HB3  5  
ATOM   6133  H HG2  . GLU A 1 51 ? -3.166  -3.647  -7.158  1.00 1.00 ? 51  GLU A HG2  5  
ATOM   6134  H HG3  . GLU A 1 51 ? -4.579  -3.265  -8.138  1.00 1.00 ? 51  GLU A HG3  5  
ATOM   6135  N N    . PHE A 1 52 ? -5.664  -0.256  -7.913  1.00 1.00 ? 52  PHE A N    5  
ATOM   6136  C CA   . PHE A 1 52 ? -7.078  -0.123  -7.578  1.00 1.00 ? 52  PHE A CA   5  
ATOM   6137  C C    . PHE A 1 52 ? -7.780  0.763   -8.598  1.00 1.00 ? 52  PHE A C    5  
ATOM   6138  O O    . PHE A 1 52 ? -8.948  0.548   -8.926  1.00 1.00 ? 52  PHE A O    5  
ATOM   6139  C CB   . PHE A 1 52 ? -7.241  0.455   -6.174  1.00 1.00 ? 52  PHE A CB   5  
ATOM   6140  C CG   . PHE A 1 52 ? -6.767  -0.555  -5.152  1.00 1.00 ? 52  PHE A CG   5  
ATOM   6141  C CD1  . PHE A 1 52 ? -7.440  -1.777  -5.008  1.00 1.00 ? 52  PHE A CD1  5  
ATOM   6142  C CD2  . PHE A 1 52 ? -5.642  -0.282  -4.364  1.00 1.00 ? 52  PHE A CD2  5  
ATOM   6143  C CE1  . PHE A 1 52 ? -6.992  -2.713  -4.069  1.00 1.00 ? 52  PHE A CE1  5  
ATOM   6144  C CE2  . PHE A 1 52 ? -5.196  -1.218  -3.433  1.00 1.00 ? 52  PHE A CE2  5  
ATOM   6145  C CZ   . PHE A 1 52 ? -5.868  -2.432  -3.285  1.00 1.00 ? 52  PHE A CZ   5  
ATOM   6146  H H    . PHE A 1 52 ? -4.988  0.161   -7.337  1.00 1.00 ? 52  PHE A H    5  
ATOM   6147  H HA   . PHE A 1 52 ? -7.533  -1.100  -7.604  1.00 1.00 ? 52  PHE A HA   5  
ATOM   6148  H HB2  . PHE A 1 52 ? -6.658  1.359   -6.089  1.00 1.00 ? 52  PHE A HB2  5  
ATOM   6149  H HB3  . PHE A 1 52 ? -8.279  0.681   -5.994  1.00 1.00 ? 52  PHE A HB3  5  
ATOM   6150  H HD1  . PHE A 1 52 ? -8.309  -1.993  -5.612  1.00 1.00 ? 52  PHE A HD1  5  
ATOM   6151  H HD2  . PHE A 1 52 ? -5.127  0.656   -4.468  1.00 1.00 ? 52  PHE A HD2  5  
ATOM   6152  H HE1  . PHE A 1 52 ? -7.509  -3.654  -3.952  1.00 1.00 ? 52  PHE A HE1  5  
ATOM   6153  H HE2  . PHE A 1 52 ? -4.328  -1.006  -2.832  1.00 1.00 ? 52  PHE A HE2  5  
ATOM   6154  H HZ   . PHE A 1 52 ? -5.522  -3.147  -2.561  1.00 1.00 ? 52  PHE A HZ   5  
ATOM   6155  N N    . GLY A 1 53 ? -7.060  1.765   -9.094  1.00 1.00 ? 53  GLY A N    5  
ATOM   6156  C CA   . GLY A 1 53 ? -7.620  2.686   -10.076 1.00 1.00 ? 53  GLY A CA   5  
ATOM   6157  C C    . GLY A 1 53 ? -8.393  3.803   -9.387  1.00 1.00 ? 53  GLY A C    5  
ATOM   6158  O O    . GLY A 1 53 ? -9.354  4.338   -9.940  1.00 1.00 ? 53  GLY A O    5  
ATOM   6159  H H    . GLY A 1 53 ? -6.136  1.887   -8.792  1.00 1.00 ? 53  GLY A H    5  
ATOM   6160  H HA2  . GLY A 1 53 ? -6.817  3.115   -10.657 1.00 1.00 ? 53  GLY A HA2  5  
ATOM   6161  H HA3  . GLY A 1 53 ? -8.287  2.148   -10.732 1.00 1.00 ? 53  GLY A HA3  5  
ATOM   6162  N N    . ILE A 1 54 ? -7.969  4.147   -8.170  1.00 1.00 ? 54  ILE A N    5  
ATOM   6163  C CA   . ILE A 1 54 ? -8.630  5.202   -7.408  1.00 1.00 ? 54  ILE A CA   5  
ATOM   6164  C C    . ILE A 1 54 ? -7.876  6.519   -7.554  1.00 1.00 ? 54  ILE A C    5  
ATOM   6165  O O    . ILE A 1 54 ? -7.068  6.684   -8.467  1.00 1.00 ? 54  ILE A O    5  
ATOM   6166  C CB   . ILE A 1 54 ? -8.692  4.805   -5.933  1.00 1.00 ? 54  ILE A CB   5  
ATOM   6167  C CG1  . ILE A 1 54 ? -7.276  4.486   -5.439  1.00 1.00 ? 54  ILE A CG1  5  
ATOM   6168  C CG2  . ILE A 1 54 ? -9.599  3.583   -5.765  1.00 1.00 ? 54  ILE A CG2  5  
ATOM   6169  C CD1  . ILE A 1 54 ? -7.283  4.129   -3.950  1.00 1.00 ? 54  ILE A CD1  5  
ATOM   6170  H H    . ILE A 1 54 ? -7.197  3.685   -7.781  1.00 1.00 ? 54  ILE A H    5  
ATOM   6171  H HA   . ILE A 1 54 ? -9.638  5.336   -7.773  1.00 1.00 ? 54  ILE A HA   5  
ATOM   6172  H HB   . ILE A 1 54 ? -9.090  5.625   -5.371  1.00 1.00 ? 54  ILE A HB   5  
ATOM   6173  H HG12 . ILE A 1 54 ? -6.883  3.661   -6.002  1.00 1.00 ? 54  ILE A HG12 5  
ATOM   6174  H HG13 . ILE A 1 54 ? -6.654  5.351   -5.581  1.00 1.00 ? 54  ILE A HG13 5  
ATOM   6175  H HG21 . ILE A 1 54 ? -10.603 3.830   -6.075  1.00 1.00 ? 54  ILE A HG21 5  
ATOM   6176  H HG22 . ILE A 1 54 ? -9.610  3.287   -4.729  1.00 1.00 ? 54  ILE A HG22 5  
ATOM   6177  H HG23 . ILE A 1 54 ? -9.226  2.773   -6.368  1.00 1.00 ? 54  ILE A HG23 5  
ATOM   6178  H HD11 . ILE A 1 54 ? -7.991  3.334   -3.766  1.00 1.00 ? 54  ILE A HD11 5  
ATOM   6179  H HD12 . ILE A 1 54 ? -7.556  4.999   -3.375  1.00 1.00 ? 54  ILE A HD12 5  
ATOM   6180  H HD13 . ILE A 1 54 ? -6.295  3.802   -3.660  1.00 1.00 ? 54  ILE A HD13 5  
ATOM   6181  N N    . ASN A 1 55 ? -8.148  7.455   -6.648  1.00 1.00 ? 55  ASN A N    5  
ATOM   6182  C CA   . ASN A 1 55 ? -7.498  8.762   -6.672  1.00 1.00 ? 55  ASN A CA   5  
ATOM   6183  C C    . ASN A 1 55 ? -7.100  9.170   -5.257  1.00 1.00 ? 55  ASN A C    5  
ATOM   6184  O O    . ASN A 1 55 ? -7.820  9.908   -4.584  1.00 1.00 ? 55  ASN A O    5  
ATOM   6185  C CB   . ASN A 1 55 ? -8.451  9.800   -7.261  1.00 1.00 ? 55  ASN A CB   5  
ATOM   6186  C CG   . ASN A 1 55 ? -9.694  9.929   -6.387  1.00 1.00 ? 55  ASN A CG   5  
ATOM   6187  O OD1  . ASN A 1 55 ? -10.184 11.035  -6.162  1.00 1.00 ? 55  ASN A OD1  5  
ATOM   6188  N ND2  . ASN A 1 55 ? -10.232 8.858   -5.871  1.00 1.00 ? 55  ASN A ND2  5  
ATOM   6189  H H    . ASN A 1 55 ? -8.804  7.268   -5.948  1.00 1.00 ? 55  ASN A H    5  
ATOM   6190  H HA   . ASN A 1 55 ? -6.607  8.714   -7.283  1.00 1.00 ? 55  ASN A HA   5  
ATOM   6191  H HB2  . ASN A 1 55 ? -7.950  10.754  -7.311  1.00 1.00 ? 55  ASN A HB2  5  
ATOM   6192  H HB3  . ASN A 1 55 ? -8.744  9.496   -8.255  1.00 1.00 ? 55  ASN A HB3  5  
ATOM   6193  H HD21 . ASN A 1 55 ? -9.838  7.978   -6.047  1.00 1.00 ? 55  ASN A HD21 5  
ATOM   6194  H HD22 . ASN A 1 55 ? -11.028 8.933   -5.306  1.00 1.00 ? 55  ASN A HD22 5  
ATOM   6195  N N    . VAL A 1 56 ? -5.947  8.682   -4.808  1.00 1.00 ? 56  VAL A N    5  
ATOM   6196  C CA   . VAL A 1 56 ? -5.459  8.999   -3.469  1.00 1.00 ? 56  VAL A CA   5  
ATOM   6197  C C    . VAL A 1 56 ? -4.535  10.212  -3.520  1.00 1.00 ? 56  VAL A C    5  
ATOM   6198  O O    . VAL A 1 56 ? -3.580  10.249  -4.297  1.00 1.00 ? 56  VAL A O    5  
ATOM   6199  C CB   . VAL A 1 56 ? -4.707  7.796   -2.894  1.00 1.00 ? 56  VAL A CB   5  
ATOM   6200  C CG1  . VAL A 1 56 ? -3.413  7.576   -3.673  1.00 1.00 ? 56  VAL A CG1  5  
ATOM   6201  C CG2  . VAL A 1 56 ? -4.380  8.050   -1.419  1.00 1.00 ? 56  VAL A CG2  5  
ATOM   6202  H H    . VAL A 1 56 ? -5.415  8.096   -5.385  1.00 1.00 ? 56  VAL A H    5  
ATOM   6203  H HA   . VAL A 1 56 ? -6.299  9.225   -2.824  1.00 1.00 ? 56  VAL A HA   5  
ATOM   6204  H HB   . VAL A 1 56 ? -5.321  6.914   -2.979  1.00 1.00 ? 56  VAL A HB   5  
ATOM   6205  H HG11 . VAL A 1 56 ? -2.681  8.304   -3.367  1.00 1.00 ? 56  VAL A HG11 5  
ATOM   6206  H HG12 . VAL A 1 56 ? -3.606  7.684   -4.730  1.00 1.00 ? 56  VAL A HG12 5  
ATOM   6207  H HG13 . VAL A 1 56 ? -3.040  6.580   -3.477  1.00 1.00 ? 56  VAL A HG13 5  
ATOM   6208  H HG21 . VAL A 1 56 ? -3.842  7.202   -1.019  1.00 1.00 ? 56  VAL A HG21 5  
ATOM   6209  H HG22 . VAL A 1 56 ? -5.295  8.187   -0.864  1.00 1.00 ? 56  VAL A HG22 5  
ATOM   6210  H HG23 . VAL A 1 56 ? -3.769  8.937   -1.333  1.00 1.00 ? 56  VAL A HG23 5  
ATOM   6211  N N    . ASP A 1 57 ? -4.832  11.208  -2.695  1.00 1.00 ? 57  ASP A N    5  
ATOM   6212  C CA   . ASP A 1 57 ? -4.030  12.425  -2.656  1.00 1.00 ? 57  ASP A CA   5  
ATOM   6213  C C    . ASP A 1 57 ? -2.799  12.234  -1.775  1.00 1.00 ? 57  ASP A C    5  
ATOM   6214  O O    . ASP A 1 57 ? -2.768  11.350  -0.919  1.00 1.00 ? 57  ASP A O    5  
ATOM   6215  C CB   . ASP A 1 57 ? -4.869  13.584  -2.121  1.00 1.00 ? 57  ASP A CB   5  
ATOM   6216  C CG   . ASP A 1 57 ? -4.132  14.903  -2.333  1.00 1.00 ? 57  ASP A CG   5  
ATOM   6217  O OD1  . ASP A 1 57 ? -3.164  14.905  -3.076  1.00 1.00 ? 57  ASP A OD1  5  
ATOM   6218  O OD2  . ASP A 1 57 ? -4.548  15.892  -1.753  1.00 1.00 ? 57  ASP A OD2  5  
ATOM   6219  H H    . ASP A 1 57 ? -5.609  11.127  -2.104  1.00 1.00 ? 57  ASP A H    5  
ATOM   6220  H HA   . ASP A 1 57 ? -3.706  12.665  -3.660  1.00 1.00 ? 57  ASP A HA   5  
ATOM   6221  H HB2  . ASP A 1 57 ? -5.814  13.612  -2.642  1.00 1.00 ? 57  ASP A HB2  5  
ATOM   6222  H HB3  . ASP A 1 57 ? -5.046  13.440  -1.064  1.00 1.00 ? 57  ASP A HB3  5  
ATOM   6223  N N    . GLU A 1 58 ? -1.790  13.070  -1.991  1.00 1.00 ? 58  GLU A N    5  
ATOM   6224  C CA   . GLU A 1 58 ? -0.563  12.990  -1.209  1.00 1.00 ? 58  GLU A CA   5  
ATOM   6225  C C    . GLU A 1 58 ? -0.857  13.232  0.268   1.00 1.00 ? 58  GLU A C    5  
ATOM   6226  O O    . GLU A 1 58 ? -0.127  12.766  1.138   1.00 1.00 ? 58  GLU A O    5  
ATOM   6227  C CB   . GLU A 1 58 ? 0.438   14.041  -1.700  1.00 1.00 ? 58  GLU A CB   5  
ATOM   6228  C CG   . GLU A 1 58 ? 0.859   13.727  -3.139  1.00 1.00 ? 58  GLU A CG   5  
ATOM   6229  C CD   . GLU A 1 58 ? 1.640   12.419  -3.186  1.00 1.00 ? 58  GLU A CD   5  
ATOM   6230  O OE1  . GLU A 1 58 ? 2.139   12.013  -2.150  1.00 1.00 ? 58  GLU A OE1  5  
ATOM   6231  O OE2  . GLU A 1 58 ? 1.726   11.842  -4.257  1.00 1.00 ? 58  GLU A OE2  5  
ATOM   6232  H H    . GLU A 1 58 ? -1.875  13.755  -2.686  1.00 1.00 ? 58  GLU A H    5  
ATOM   6233  H HA   . GLU A 1 58 ? -0.129  12.008  -1.326  1.00 1.00 ? 58  GLU A HA   5  
ATOM   6234  H HB2  . GLU A 1 58 ? -0.024  15.017  -1.665  1.00 1.00 ? 58  GLU A HB2  5  
ATOM   6235  H HB3  . GLU A 1 58 ? 1.309   14.032  -1.063  1.00 1.00 ? 58  GLU A HB3  5  
ATOM   6236  H HG2  . GLU A 1 58 ? -0.024  13.642  -3.758  1.00 1.00 ? 58  GLU A HG2  5  
ATOM   6237  H HG3  . GLU A 1 58 ? 1.480   14.528  -3.511  1.00 1.00 ? 58  GLU A HG3  5  
ATOM   6238  N N    . ASP A 1 59 ? -1.932  13.967  0.541   1.00 1.00 ? 59  ASP A N    5  
ATOM   6239  C CA   . ASP A 1 59 ? -2.311  14.265  1.917   1.00 1.00 ? 59  ASP A CA   5  
ATOM   6240  C C    . ASP A 1 59 ? -2.837  13.018  2.600   1.00 1.00 ? 59  ASP A C    5  
ATOM   6241  O O    . ASP A 1 59 ? -2.785  12.893  3.823   1.00 1.00 ? 59  ASP A O    5  
ATOM   6242  C CB   . ASP A 1 59 ? -3.392  15.347  1.944   1.00 1.00 ? 59  ASP A CB   5  
ATOM   6243  C CG   . ASP A 1 59 ? -2.795  16.695  1.550   1.00 1.00 ? 59  ASP A CG   5  
ATOM   6244  O OD1  . ASP A 1 59 ? -1.579  16.803  1.540   1.00 1.00 ? 59  ASP A OD1  5  
ATOM   6245  O OD2  . ASP A 1 59 ? -3.561  17.601  1.267   1.00 1.00 ? 59  ASP A OD2  5  
ATOM   6246  H H    . ASP A 1 59 ? -2.482  14.309  -0.194  1.00 1.00 ? 59  ASP A H    5  
ATOM   6247  H HA   . ASP A 1 59 ? -1.444  14.623  2.451   1.00 1.00 ? 59  ASP A HA   5  
ATOM   6248  H HB2  . ASP A 1 59 ? -4.175  15.084  1.248   1.00 1.00 ? 59  ASP A HB2  5  
ATOM   6249  H HB3  . ASP A 1 59 ? -3.805  15.415  2.940   1.00 1.00 ? 59  ASP A HB3  5  
ATOM   6250  N N    . LYS A 1 60 ? -3.353  12.093  1.796   1.00 1.00 ? 60  LYS A N    5  
ATOM   6251  C CA   . LYS A 1 60 ? -3.897  10.845  2.316   1.00 1.00 ? 60  LYS A CA   5  
ATOM   6252  C C    . LYS A 1 60 ? -2.822  9.755   2.327   1.00 1.00 ? 60  LYS A C    5  
ATOM   6253  O O    . LYS A 1 60 ? -3.011  8.696   2.919   1.00 1.00 ? 60  LYS A O    5  
ATOM   6254  C CB   . LYS A 1 60 ? -5.108  10.408  1.448   1.00 1.00 ? 60  LYS A CB   5  
ATOM   6255  C CG   . LYS A 1 60 ? -6.445  10.538  2.211   1.00 1.00 ? 60  LYS A CG   5  
ATOM   6256  C CD   . LYS A 1 60 ? -6.474  9.570   3.407   1.00 1.00 ? 60  LYS A CD   5  
ATOM   6257  C CE   . LYS A 1 60 ? -7.921  9.270   3.808   1.00 1.00 ? 60  LYS A CE   5  
ATOM   6258  N NZ   . LYS A 1 60 ? -7.943  8.668   5.171   1.00 1.00 ? 60  LYS A NZ   5  
ATOM   6259  H H    . LYS A 1 60 ? -3.369  12.256  0.830   1.00 1.00 ? 60  LYS A H    5  
ATOM   6260  H HA   . LYS A 1 60 ? -4.222  11.008  3.329   1.00 1.00 ? 60  LYS A HA   5  
ATOM   6261  H HB2  . LYS A 1 60 ? -5.150  11.044  0.575   1.00 1.00 ? 60  LYS A HB2  5  
ATOM   6262  H HB3  . LYS A 1 60 ? -4.984  9.389   1.124   1.00 1.00 ? 60  LYS A HB3  5  
ATOM   6263  H HG2  . LYS A 1 60 ? -6.562  11.549  2.567   1.00 1.00 ? 60  LYS A HG2  5  
ATOM   6264  H HG3  . LYS A 1 60 ? -7.257  10.297  1.540   1.00 1.00 ? 60  LYS A HG3  5  
ATOM   6265  H HD2  . LYS A 1 60 ? -5.981  8.651   3.138   1.00 1.00 ? 60  LYS A HD2  5  
ATOM   6266  H HD3  . LYS A 1 60 ? -5.970  10.017  4.249   1.00 1.00 ? 60  LYS A HD3  5  
ATOM   6267  H HE2  . LYS A 1 60 ? -8.493  10.186  3.809   1.00 1.00 ? 60  LYS A HE2  5  
ATOM   6268  H HE3  . LYS A 1 60 ? -8.353  8.576   3.102   1.00 1.00 ? 60  LYS A HE3  5  
ATOM   6269  H HZ1  . LYS A 1 60 ? -6.979  8.383   5.442   1.00 1.00 ? 60  LYS A HZ1  5  
ATOM   6270  H HZ2  . LYS A 1 60 ? -8.565  7.834   5.172   1.00 1.00 ? 60  LYS A HZ2  5  
ATOM   6271  H HZ3  . LYS A 1 60 ? -8.298  9.365   5.856   1.00 1.00 ? 60  LYS A HZ3  5  
ATOM   6272  N N    . ALA A 1 61 ? -1.693  10.021  1.667   1.00 1.00 ? 61  ALA A N    5  
ATOM   6273  C CA   . ALA A 1 61 ? -0.590  9.053   1.610   1.00 1.00 ? 61  ALA A CA   5  
ATOM   6274  C C    . ALA A 1 61 ? 0.692   9.678   2.147   1.00 1.00 ? 61  ALA A C    5  
ATOM   6275  O O    . ALA A 1 61 ? 1.762   9.506   1.571   1.00 1.00 ? 61  ALA A O    5  
ATOM   6276  C CB   . ALA A 1 61 ? -0.369  8.586   0.165   1.00 1.00 ? 61  ALA A CB   5  
ATOM   6277  H H    . ALA A 1 61 ? -1.596  10.884  1.212   1.00 1.00 ? 61  ALA A H    5  
ATOM   6278  H HA   . ALA A 1 61 ? -0.832  8.190   2.218   1.00 1.00 ? 61  ALA A HA   5  
ATOM   6279  H HB1  . ALA A 1 61 ? -1.245  8.055   -0.179  1.00 1.00 ? 61  ALA A HB1  5  
ATOM   6280  H HB2  . ALA A 1 61 ? 0.487   7.929   0.125   1.00 1.00 ? 61  ALA A HB2  5  
ATOM   6281  H HB3  . ALA A 1 61 ? -0.194  9.443   -0.470  1.00 1.00 ? 61  ALA A HB3  5  
ATOM   6282  N N    . GLN A 1 62 ? 0.574   10.410  3.255   1.00 1.00 ? 62  GLN A N    5  
ATOM   6283  C CA   . GLN A 1 62 ? 1.730   11.068  3.876   1.00 1.00 ? 62  GLN A CA   5  
ATOM   6284  C C    . GLN A 1 62 ? 1.971   10.531  5.286   1.00 1.00 ? 62  GLN A C    5  
ATOM   6285  O O    . GLN A 1 62 ? 3.113   10.422  5.732   1.00 1.00 ? 62  GLN A O    5  
ATOM   6286  C CB   . GLN A 1 62 ? 1.493   12.578  3.941   1.00 1.00 ? 62  GLN A CB   5  
ATOM   6287  C CG   . GLN A 1 62 ? 0.248   12.866  4.778   1.00 1.00 ? 62  GLN A CG   5  
ATOM   6288  C CD   . GLN A 1 62 ? -0.077  14.357  4.735   1.00 1.00 ? 62  GLN A CD   5  
ATOM   6289  O OE1  . GLN A 1 62 ? 0.437   15.080  3.882   1.00 1.00 ? 62  GLN A OE1  5  
ATOM   6290  N NE2  . GLN A 1 62 ? -0.901  14.862  5.613   1.00 1.00 ? 62  GLN A NE2  5  
ATOM   6291  H H    . GLN A 1 62 ? -0.309  10.513  3.666   1.00 1.00 ? 62  GLN A H    5  
ATOM   6292  H HA   . GLN A 1 62 ? 2.615   10.883  3.281   1.00 1.00 ? 62  GLN A HA   5  
ATOM   6293  H HB2  . GLN A 1 62 ? 2.350   13.056  4.394   1.00 1.00 ? 62  GLN A HB2  5  
ATOM   6294  H HB3  . GLN A 1 62 ? 1.352   12.963  2.944   1.00 1.00 ? 62  GLN A HB3  5  
ATOM   6295  H HG2  . GLN A 1 62 ? -0.585  12.305  4.382   1.00 1.00 ? 62  GLN A HG2  5  
ATOM   6296  H HG3  . GLN A 1 62 ? 0.426   12.569  5.801   1.00 1.00 ? 62  GLN A HG3  5  
ATOM   6297  H HE21 . GLN A 1 62 ? -1.307  14.286  6.294   1.00 1.00 ? 62  GLN A HE21 5  
ATOM   6298  H HE22 . GLN A 1 62 ? -1.113  15.819  5.591   1.00 1.00 ? 62  GLN A HE22 5  
ATOM   6299  N N    . ASP A 1 63 ? 0.885   10.204  5.991   1.00 1.00 ? 63  ASP A N    5  
ATOM   6300  C CA   . ASP A 1 63 ? 0.988   9.687   7.363   1.00 1.00 ? 63  ASP A CA   5  
ATOM   6301  C C    . ASP A 1 63 ? 0.046   8.505   7.580   1.00 1.00 ? 63  ASP A C    5  
ATOM   6302  O O    . ASP A 1 63 ? -0.706  8.471   8.554   1.00 1.00 ? 63  ASP A O    5  
ATOM   6303  C CB   . ASP A 1 63 ? 0.650   10.794  8.362   1.00 1.00 ? 63  ASP A CB   5  
ATOM   6304  C CG   . ASP A 1 63 ? 0.977   10.337  9.780   1.00 1.00 ? 63  ASP A CG   5  
ATOM   6305  O OD1  . ASP A 1 63 ? 2.089   9.883   9.994   1.00 1.00 ? 63  ASP A OD1  5  
ATOM   6306  O OD2  . ASP A 1 63 ? 0.113   10.452  10.635  1.00 1.00 ? 63  ASP A OD2  5  
ATOM   6307  H H    . ASP A 1 63 ? 0.001   10.318  5.586   1.00 1.00 ? 63  ASP A H    5  
ATOM   6308  H HA   . ASP A 1 63 ? 2.001   9.355   7.546   1.00 1.00 ? 63  ASP A HA   5  
ATOM   6309  H HB2  . ASP A 1 63 ? 1.225   11.677  8.127   1.00 1.00 ? 63  ASP A HB2  5  
ATOM   6310  H HB3  . ASP A 1 63 ? -0.403  11.024  8.295   1.00 1.00 ? 63  ASP A HB3  5  
ATOM   6311  N N    . ILE A 1 64 ? 0.098   7.535   6.671   1.00 1.00 ? 64  ILE A N    5  
ATOM   6312  C CA   . ILE A 1 64 ? -0.744  6.344   6.773   1.00 1.00 ? 64  ILE A CA   5  
ATOM   6313  C C    . ILE A 1 64 ? -0.055  5.272   7.602   1.00 1.00 ? 64  ILE A C    5  
ATOM   6314  O O    . ILE A 1 64 ? 1.105   4.935   7.367   1.00 1.00 ? 64  ILE A O    5  
ATOM   6315  C CB   . ILE A 1 64 ? -1.043  5.798   5.373   1.00 1.00 ? 64  ILE A CB   5  
ATOM   6316  C CG1  . ILE A 1 64 ? -1.867  6.827   4.575   1.00 1.00 ? 64  ILE A CG1  5  
ATOM   6317  C CG2  . ILE A 1 64 ? -1.808  4.477   5.476   1.00 1.00 ? 64  ILE A CG2  5  
ATOM   6318  C CD1  . ILE A 1 64 ? -3.204  7.142   5.278   1.00 1.00 ? 64  ILE A CD1  5  
ATOM   6319  H H    . ILE A 1 64 ? 0.722   7.616   5.920   1.00 1.00 ? 64  ILE A H    5  
ATOM   6320  H HA   . ILE A 1 64 ? -1.675  6.596   7.261   1.00 1.00 ? 64  ILE A HA   5  
ATOM   6321  H HB   . ILE A 1 64 ? -0.108  5.621   4.861   1.00 1.00 ? 64  ILE A HB   5  
ATOM   6322  H HG12 . ILE A 1 64 ? -1.295  7.738   4.480   1.00 1.00 ? 64  ILE A HG12 5  
ATOM   6323  H HG13 . ILE A 1 64 ? -2.070  6.432   3.590   1.00 1.00 ? 64  ILE A HG13 5  
ATOM   6324  H HG21 . ILE A 1 64 ? -1.134  3.690   5.778   1.00 1.00 ? 64  ILE A HG21 5  
ATOM   6325  H HG22 . ILE A 1 64 ? -2.235  4.235   4.516   1.00 1.00 ? 64  ILE A HG22 5  
ATOM   6326  H HG23 . ILE A 1 64 ? -2.600  4.573   6.206   1.00 1.00 ? 64  ILE A HG23 5  
ATOM   6327  H HD11 . ILE A 1 64 ? -3.518  6.309   5.888   1.00 1.00 ? 64  ILE A HD11 5  
ATOM   6328  H HD12 . ILE A 1 64 ? -3.960  7.339   4.536   1.00 1.00 ? 64  ILE A HD12 5  
ATOM   6329  H HD13 . ILE A 1 64 ? -3.082  8.017   5.899   1.00 1.00 ? 64  ILE A HD13 5  
ATOM   6330  N N    . SER A 1 65 ? -0.791  4.736   8.563   1.00 1.00 ? 65  SER A N    5  
ATOM   6331  C CA   . SER A 1 65 ? -0.274  3.689   9.431   1.00 1.00 ? 65  SER A CA   5  
ATOM   6332  C C    . SER A 1 65 ? 0.071   2.454   8.604   1.00 1.00 ? 65  SER A C    5  
ATOM   6333  O O    . SER A 1 65 ? 0.115   2.519   7.378   1.00 1.00 ? 65  SER A O    5  
ATOM   6334  C CB   . SER A 1 65 ? -1.293  3.353   10.518  1.00 1.00 ? 65  SER A CB   5  
ATOM   6335  O OG   . SER A 1 65 ? -1.172  4.299   11.570  1.00 1.00 ? 65  SER A OG   5  
ATOM   6336  H H    . SER A 1 65 ? -1.717  5.043   8.684   1.00 1.00 ? 65  SER A H    5  
ATOM   6337  H HA   . SER A 1 65 ? 0.630   4.048   9.903   1.00 1.00 ? 65  SER A HA   5  
ATOM   6338  H HB2  . SER A 1 65 ? -2.279  3.413   10.109  1.00 1.00 ? 65  SER A HB2  5  
ATOM   6339  H HB3  . SER A 1 65 ? -1.115  2.354   10.898  1.00 1.00 ? 65  SER A HB3  5  
ATOM   6340  H HG   . SER A 1 65 ? -1.546  5.129   11.265  1.00 1.00 ? 65  SER A HG   5  
ATOM   6341  N N    . THR A 1 66 ? 0.348   1.346   9.284   1.00 1.00 ? 66  THR A N    5  
ATOM   6342  C CA   . THR A 1 66 ? 0.710   0.108   8.603   1.00 1.00 ? 66  THR A CA   5  
ATOM   6343  C C    . THR A 1 66 ? -0.248  -0.183  7.453   1.00 1.00 ? 66  THR A C    5  
ATOM   6344  O O    . THR A 1 66 ? -1.112  0.627   7.121   1.00 1.00 ? 66  THR A O    5  
ATOM   6345  C CB   . THR A 1 66 ? 0.701   -1.058  9.603   1.00 1.00 ? 66  THR A CB   5  
ATOM   6346  O OG1  . THR A 1 66 ? 1.284   -2.205  9.003   1.00 1.00 ? 66  THR A OG1  5  
ATOM   6347  C CG2  . THR A 1 66 ? -0.726  -1.406  10.019  1.00 1.00 ? 66  THR A CG2  5  
ATOM   6348  H H    . THR A 1 66 ? 0.315   1.364   10.257  1.00 1.00 ? 66  THR A H    5  
ATOM   6349  H HA   . THR A 1 66 ? 1.708   0.211   8.205   1.00 1.00 ? 66  THR A HA   5  
ATOM   6350  H HB   . THR A 1 66 ? 1.265   -0.781  10.474  1.00 1.00 ? 66  THR A HB   5  
ATOM   6351  H HG1  . THR A 1 66 ? 0.581   -2.728  8.614   1.00 1.00 ? 66  THR A HG1  5  
ATOM   6352  H HG21 . THR A 1 66 ? -0.720  -1.795  11.027  1.00 1.00 ? 66  THR A HG21 5  
ATOM   6353  H HG22 . THR A 1 66 ? -1.105  -2.162  9.352   1.00 1.00 ? 66  THR A HG22 5  
ATOM   6354  H HG23 . THR A 1 66 ? -1.356  -0.527  9.972   1.00 1.00 ? 66  THR A HG23 5  
ATOM   6355  N N    . ILE A 1 67 ? -0.090  -1.344  6.844   1.00 1.00 ? 67  ILE A N    5  
ATOM   6356  C CA   . ILE A 1 67 ? -0.935  -1.720  5.721   1.00 1.00 ? 67  ILE A CA   5  
ATOM   6357  C C    . ILE A 1 67 ? -2.398  -1.783  6.150   1.00 1.00 ? 67  ILE A C    5  
ATOM   6358  O O    . ILE A 1 67 ? -3.284  -1.329  5.427   1.00 1.00 ? 67  ILE A O    5  
ATOM   6359  C CB   . ILE A 1 67 ? -0.485  -3.069  5.162   1.00 1.00 ? 67  ILE A CB   5  
ATOM   6360  C CG1  . ILE A 1 67 ? 0.906   -2.914  4.524   1.00 1.00 ? 67  ILE A CG1  5  
ATOM   6361  C CG2  . ILE A 1 67 ? -1.485  -3.562  4.113   1.00 1.00 ? 67  ILE A CG2  5  
ATOM   6362  C CD1  . ILE A 1 67 ? 1.489   -4.301  4.231   1.00 1.00 ? 67  ILE A CD1  5  
ATOM   6363  H H    . ILE A 1 67 ? 0.614   -1.958  7.145   1.00 1.00 ? 67  ILE A H    5  
ATOM   6364  H HA   . ILE A 1 67 ? -0.834  -0.979  4.949   1.00 1.00 ? 67  ILE A HA   5  
ATOM   6365  H HB   . ILE A 1 67 ? -0.438  -3.783  5.958   1.00 1.00 ? 67  ILE A HB   5  
ATOM   6366  H HG12 . ILE A 1 67 ? 0.826   -2.347  3.601   1.00 1.00 ? 67  ILE A HG12 5  
ATOM   6367  H HG13 . ILE A 1 67 ? 1.561   -2.386  5.204   1.00 1.00 ? 67  ILE A HG13 5  
ATOM   6368  H HG21 . ILE A 1 67 ? -1.792  -2.737  3.492   1.00 1.00 ? 67  ILE A HG21 5  
ATOM   6369  H HG22 . ILE A 1 67 ? -2.349  -3.976  4.612   1.00 1.00 ? 67  ILE A HG22 5  
ATOM   6370  H HG23 . ILE A 1 67 ? -1.025  -4.325  3.502   1.00 1.00 ? 67  ILE A HG23 5  
ATOM   6371  H HD11 . ILE A 1 67 ? 2.328   -4.206  3.556   1.00 1.00 ? 67  ILE A HD11 5  
ATOM   6372  H HD12 . ILE A 1 67 ? 0.732   -4.919  3.775   1.00 1.00 ? 67  ILE A HD12 5  
ATOM   6373  H HD13 . ILE A 1 67 ? 1.819   -4.757  5.153   1.00 1.00 ? 67  ILE A HD13 5  
ATOM   6374  N N    . GLN A 1 68 ? -2.642  -2.350  7.324   1.00 1.00 ? 68  GLN A N    5  
ATOM   6375  C CA   . GLN A 1 68 ? -4.005  -2.469  7.837   1.00 1.00 ? 68  GLN A CA   5  
ATOM   6376  C C    . GLN A 1 68 ? -4.806  -1.190  7.578   1.00 1.00 ? 68  GLN A C    5  
ATOM   6377  O O    . GLN A 1 68 ? -5.887  -1.239  6.991   1.00 1.00 ? 68  GLN A O    5  
ATOM   6378  C CB   . GLN A 1 68 ? -3.968  -2.755  9.342   1.00 1.00 ? 68  GLN A CB   5  
ATOM   6379  C CG   . GLN A 1 68 ? -3.384  -4.149  9.587   1.00 1.00 ? 68  GLN A CG   5  
ATOM   6380  C CD   . GLN A 1 68 ? -4.433  -5.215  9.278   1.00 1.00 ? 68  GLN A CD   5  
ATOM   6381  O OE1  . GLN A 1 68 ? -5.109  -5.702  10.185  1.00 1.00 ? 68  GLN A OE1  5  
ATOM   6382  N NE2  . GLN A 1 68 ? -4.625  -5.594  8.045   1.00 1.00 ? 68  GLN A NE2  5  
ATOM   6383  H H    . GLN A 1 68 ? -1.894  -2.692  7.856   1.00 1.00 ? 68  GLN A H    5  
ATOM   6384  H HA   . GLN A 1 68 ? -4.494  -3.292  7.340   1.00 1.00 ? 68  GLN A HA   5  
ATOM   6385  H HB2  . GLN A 1 68 ? -3.358  -2.013  9.835   1.00 1.00 ? 68  GLN A HB2  5  
ATOM   6386  H HB3  . GLN A 1 68 ? -4.966  -2.713  9.740   1.00 1.00 ? 68  GLN A HB3  5  
ATOM   6387  H HG2  . GLN A 1 68 ? -2.524  -4.296  8.951   1.00 1.00 ? 68  GLN A HG2  5  
ATOM   6388  H HG3  . GLN A 1 68 ? -3.083  -4.234  10.620  1.00 1.00 ? 68  GLN A HG3  5  
ATOM   6389  H HE21 . GLN A 1 68 ? -4.097  -5.192  7.323   1.00 1.00 ? 68  GLN A HE21 5  
ATOM   6390  H HE22 . GLN A 1 68 ? -5.294  -6.279  7.841   1.00 1.00 ? 68  GLN A HE22 5  
ATOM   6391  N N    . GLN A 1 69 ? -4.280  -0.050  8.021   1.00 1.00 ? 69  GLN A N    5  
ATOM   6392  C CA   . GLN A 1 69 ? -4.967  1.222   7.833   1.00 1.00 ? 69  GLN A CA   5  
ATOM   6393  C C    . GLN A 1 69 ? -5.025  1.606   6.357   1.00 1.00 ? 69  GLN A C    5  
ATOM   6394  O O    . GLN A 1 69 ? -6.026  2.149   5.887   1.00 1.00 ? 69  GLN A O    5  
ATOM   6395  C CB   . GLN A 1 69 ? -4.237  2.324   8.607   1.00 1.00 ? 69  GLN A CB   5  
ATOM   6396  C CG   . GLN A 1 69 ? -5.196  3.480   8.865   1.00 1.00 ? 69  GLN A CG   5  
ATOM   6397  C CD   . GLN A 1 69 ? -4.442  4.679   9.428   1.00 1.00 ? 69  GLN A CD   5  
ATOM   6398  O OE1  . GLN A 1 69 ? -4.157  4.730   10.626  1.00 1.00 ? 69  GLN A OE1  5  
ATOM   6399  N NE2  . GLN A 1 69 ? -4.089  5.650   8.629   1.00 1.00 ? 69  GLN A NE2  5  
ATOM   6400  H H    . GLN A 1 69 ? -3.419  -0.060  8.489   1.00 1.00 ? 69  GLN A H    5  
ATOM   6401  H HA   . GLN A 1 69 ? -5.976  1.132   8.212   1.00 1.00 ? 69  GLN A HA   5  
ATOM   6402  H HB2  . GLN A 1 69 ? -3.891  1.929   9.546   1.00 1.00 ? 69  GLN A HB2  5  
ATOM   6403  H HB3  . GLN A 1 69 ? -3.393  2.685   8.030   1.00 1.00 ? 69  GLN A HB3  5  
ATOM   6404  H HG2  . GLN A 1 69 ? -5.674  3.754   7.940   1.00 1.00 ? 69  GLN A HG2  5  
ATOM   6405  H HG3  . GLN A 1 69 ? -5.938  3.158   9.575   1.00 1.00 ? 69  GLN A HG3  5  
ATOM   6406  H HE21 . GLN A 1 69 ? -4.311  5.605   7.677   1.00 1.00 ? 69  GLN A HE21 5  
ATOM   6407  H HE22 . GLN A 1 69 ? -3.604  6.424   8.983   1.00 1.00 ? 69  GLN A HE22 5  
ATOM   6408  N N    . ALA A 1 70 ? -3.942  1.338   5.640   1.00 1.00 ? 70  ALA A N    5  
ATOM   6409  C CA   . ALA A 1 70 ? -3.878  1.683   4.223   1.00 1.00 ? 70  ALA A CA   5  
ATOM   6410  C C    . ALA A 1 70 ? -5.003  1.008   3.460   1.00 1.00 ? 70  ALA A C    5  
ATOM   6411  O O    . ALA A 1 70 ? -5.592  1.593   2.550   1.00 1.00 ? 70  ALA A O    5  
ATOM   6412  C CB   . ALA A 1 70 ? -2.537  1.243   3.640   1.00 1.00 ? 70  ALA A CB   5  
ATOM   6413  H H    . ALA A 1 70 ? -3.167  0.916   6.073   1.00 1.00 ? 70  ALA A H    5  
ATOM   6414  H HA   . ALA A 1 70 ? -3.974  2.752   4.115   1.00 1.00 ? 70  ALA A HA   5  
ATOM   6415  H HB1  . ALA A 1 70 ? -2.430  0.179   3.764   1.00 1.00 ? 70  ALA A HB1  5  
ATOM   6416  H HB2  . ALA A 1 70 ? -1.736  1.751   4.154   1.00 1.00 ? 70  ALA A HB2  5  
ATOM   6417  H HB3  . ALA A 1 70 ? -2.503  1.487   2.589   1.00 1.00 ? 70  ALA A HB3  5  
ATOM   6418  N N    . ALA A 1 71 ? -5.301  -0.222  3.842   1.00 1.00 ? 71  ALA A N    5  
ATOM   6419  C CA   . ALA A 1 71 ? -6.362  -0.970  3.195   1.00 1.00 ? 71  ALA A CA   5  
ATOM   6420  C C    . ALA A 1 71 ? -7.700  -0.275  3.411   1.00 1.00 ? 71  ALA A C    5  
ATOM   6421  O O    . ALA A 1 71 ? -8.523  -0.192  2.497   1.00 1.00 ? 71  ALA A O    5  
ATOM   6422  C CB   . ALA A 1 71 ? -6.417  -2.377  3.778   1.00 1.00 ? 71  ALA A CB   5  
ATOM   6423  H H    . ALA A 1 71 ? -4.799  -0.634  4.576   1.00 1.00 ? 71  ALA A H    5  
ATOM   6424  H HA   . ALA A 1 71 ? -6.160  -1.034  2.137   1.00 1.00 ? 71  ALA A HA   5  
ATOM   6425  H HB1  . ALA A 1 71 ? -6.782  -2.330  4.792   1.00 1.00 ? 71  ALA A HB1  5  
ATOM   6426  H HB2  . ALA A 1 71 ? -5.425  -2.800  3.776   1.00 1.00 ? 71  ALA A HB2  5  
ATOM   6427  H HB3  . ALA A 1 71 ? -7.075  -2.993  3.184   1.00 1.00 ? 71  ALA A HB3  5  
ATOM   6428  N N    . ASP A 1 72 ? -7.907  0.230   4.622   1.00 1.00 ? 72  ASP A N    5  
ATOM   6429  C CA   . ASP A 1 72 ? -9.146  0.921   4.949   1.00 1.00 ? 72  ASP A CA   5  
ATOM   6430  C C    . ASP A 1 72 ? -9.291  2.191   4.109   1.00 1.00 ? 72  ASP A C    5  
ATOM   6431  O O    . ASP A 1 72 ? -10.379 2.504   3.624   1.00 1.00 ? 72  ASP A O    5  
ATOM   6432  C CB   . ASP A 1 72 ? -9.169  1.294   6.437   1.00 1.00 ? 72  ASP A CB   5  
ATOM   6433  C CG   . ASP A 1 72 ? -9.379  0.052   7.296   1.00 1.00 ? 72  ASP A CG   5  
ATOM   6434  O OD1  . ASP A 1 72 ? -10.403 -0.591  7.134   1.00 1.00 ? 72  ASP A OD1  5  
ATOM   6435  O OD2  . ASP A 1 72 ? -8.514  -0.232  8.107   1.00 1.00 ? 72  ASP A OD2  5  
ATOM   6436  H H    . ASP A 1 72 ? -7.212  0.134   5.309   1.00 1.00 ? 72  ASP A H    5  
ATOM   6437  H HA   . ASP A 1 72 ? -9.974  0.257   4.735   1.00 1.00 ? 72  ASP A HA   5  
ATOM   6438  H HB2  . ASP A 1 72 ? -8.232  1.757   6.703   1.00 1.00 ? 72  ASP A HB2  5  
ATOM   6439  H HB3  . ASP A 1 72 ? -9.974  1.991   6.617   1.00 1.00 ? 72  ASP A HB3  5  
ATOM   6440  N N    . VAL A 1 73 ? -8.186  2.918   3.945   1.00 1.00 ? 73  VAL A N    5  
ATOM   6441  C CA   . VAL A 1 73 ? -8.205  4.155   3.166   1.00 1.00 ? 73  VAL A CA   5  
ATOM   6442  C C    . VAL A 1 73 ? -8.634  3.863   1.729   1.00 1.00 ? 73  VAL A C    5  
ATOM   6443  O O    . VAL A 1 73 ? -9.454  4.579   1.158   1.00 1.00 ? 73  VAL A O    5  
ATOM   6444  C CB   . VAL A 1 73 ? -6.809  4.806   3.183   1.00 1.00 ? 73  VAL A CB   5  
ATOM   6445  C CG1  . VAL A 1 73 ? -6.721  5.911   2.121   1.00 1.00 ? 73  VAL A CG1  5  
ATOM   6446  C CG2  . VAL A 1 73 ? -6.546  5.425   4.565   1.00 1.00 ? 73  VAL A CG2  5  
ATOM   6447  H H    . VAL A 1 73 ? -7.346  2.622   4.360   1.00 1.00 ? 73  VAL A H    5  
ATOM   6448  H HA   . VAL A 1 73 ? -8.915  4.838   3.609   1.00 1.00 ? 73  VAL A HA   5  
ATOM   6449  H HB   . VAL A 1 73 ? -6.062  4.055   2.979   1.00 1.00 ? 73  VAL A HB   5  
ATOM   6450  H HG11 . VAL A 1 73 ? -7.591  6.548   2.192   1.00 1.00 ? 73  VAL A HG11 5  
ATOM   6451  H HG12 . VAL A 1 73 ? -6.682  5.464   1.138   1.00 1.00 ? 73  VAL A HG12 5  
ATOM   6452  H HG13 . VAL A 1 73 ? -5.829  6.494   2.284   1.00 1.00 ? 73  VAL A HG13 5  
ATOM   6453  H HG21 . VAL A 1 73 ? -7.064  6.373   4.643   1.00 1.00 ? 73  VAL A HG21 5  
ATOM   6454  H HG22 . VAL A 1 73 ? -5.485  5.586   4.691   1.00 1.00 ? 73  VAL A HG22 5  
ATOM   6455  H HG23 . VAL A 1 73 ? -6.899  4.755   5.335   1.00 1.00 ? 73  VAL A HG23 5  
ATOM   6456  N N    . ILE A 1 74 ? -8.071  2.809   1.153   1.00 1.00 ? 74  ILE A N    5  
ATOM   6457  C CA   . ILE A 1 74 ? -8.398  2.435   -0.217  1.00 1.00 ? 74  ILE A CA   5  
ATOM   6458  C C    . ILE A 1 74 ? -9.873  2.062   -0.327  1.00 1.00 ? 74  ILE A C    5  
ATOM   6459  O O    . ILE A 1 74 ? -10.559 2.475   -1.261  1.00 1.00 ? 74  ILE A O    5  
ATOM   6460  C CB   . ILE A 1 74 ? -7.492  1.268   -0.651  1.00 1.00 ? 74  ILE A CB   5  
ATOM   6461  C CG1  . ILE A 1 74 ? -6.102  1.828   -1.031  1.00 1.00 ? 74  ILE A CG1  5  
ATOM   6462  C CG2  . ILE A 1 74 ? -8.100  0.531   -1.855  1.00 1.00 ? 74  ILE A CG2  5  
ATOM   6463  C CD1  . ILE A 1 74 ? -5.023  0.776   -0.792  1.00 1.00 ? 74  ILE A CD1  5  
ATOM   6464  H H    . ILE A 1 74 ? -7.423  2.274   1.656   1.00 1.00 ? 74  ILE A H    5  
ATOM   6465  H HA   . ILE A 1 74 ? -8.207  3.278   -0.857  1.00 1.00 ? 74  ILE A HA   5  
ATOM   6466  H HB   . ILE A 1 74 ? -7.386  0.576   0.169   1.00 1.00 ? 74  ILE A HB   5  
ATOM   6467  H HG12 . ILE A 1 74 ? -6.096  2.116   -2.071  1.00 1.00 ? 74  ILE A HG12 5  
ATOM   6468  H HG13 . ILE A 1 74 ? -5.888  2.693   -0.422  1.00 1.00 ? 74  ILE A HG13 5  
ATOM   6469  H HG21 . ILE A 1 74 ? -7.337  -0.056  -2.345  1.00 1.00 ? 74  ILE A HG21 5  
ATOM   6470  H HG22 . ILE A 1 74 ? -8.504  1.252   -2.552  1.00 1.00 ? 74  ILE A HG22 5  
ATOM   6471  H HG23 . ILE A 1 74 ? -8.892  -0.122  -1.513  1.00 1.00 ? 74  ILE A HG23 5  
ATOM   6472  H HD11 . ILE A 1 74 ? -4.202  0.951   -1.467  1.00 1.00 ? 74  ILE A HD11 5  
ATOM   6473  H HD12 . ILE A 1 74 ? -5.432  -0.207  -0.965  1.00 1.00 ? 74  ILE A HD12 5  
ATOM   6474  H HD13 . ILE A 1 74 ? -4.672  0.850   0.226   1.00 1.00 ? 74  ILE A HD13 5  
ATOM   6475  N N    . GLU A 1 75 ? -10.354 1.291   0.634   1.00 1.00 ? 75  GLU A N    5  
ATOM   6476  C CA   . GLU A 1 75 ? -11.746 0.880   0.637   1.00 1.00 ? 75  GLU A CA   5  
ATOM   6477  C C    . GLU A 1 75 ? -12.666 2.091   0.526   1.00 1.00 ? 75  GLU A C    5  
ATOM   6478  O O    . GLU A 1 75 ? -13.688 2.041   -0.158  1.00 1.00 ? 75  GLU A O    5  
ATOM   6479  C CB   . GLU A 1 75 ? -12.040 0.104   1.922   1.00 1.00 ? 75  GLU A CB   5  
ATOM   6480  C CG   . GLU A 1 75 ? -11.408 -1.284  1.818   1.00 1.00 ? 75  GLU A CG   5  
ATOM   6481  C CD   . GLU A 1 75 ? -12.215 -2.136  0.843   1.00 1.00 ? 75  GLU A CD   5  
ATOM   6482  O OE1  . GLU A 1 75 ? -13.280 -1.695  0.444   1.00 1.00 ? 75  GLU A OE1  5  
ATOM   6483  O OE2  . GLU A 1 75 ? -11.758 -3.213  0.510   1.00 1.00 ? 75  GLU A OE2  5  
ATOM   6484  H H    . GLU A 1 75 ? -9.761  0.995   1.356   1.00 1.00 ? 75  GLU A H    5  
ATOM   6485  H HA   . GLU A 1 75 ? -11.924 0.232   -0.206  1.00 1.00 ? 75  GLU A HA   5  
ATOM   6486  H HB2  . GLU A 1 75 ? -11.615 0.632   2.764   1.00 1.00 ? 75  GLU A HB2  5  
ATOM   6487  H HB3  . GLU A 1 75 ? -13.105 0.008   2.054   1.00 1.00 ? 75  GLU A HB3  5  
ATOM   6488  H HG2  . GLU A 1 75 ? -10.394 -1.194  1.460   1.00 1.00 ? 75  GLU A HG2  5  
ATOM   6489  H HG3  . GLU A 1 75 ? -11.406 -1.753  2.784   1.00 1.00 ? 75  GLU A HG3  5  
ATOM   6490  N N    . GLY A 1 76 ? -12.294 3.182   1.186   1.00 1.00 ? 76  GLY A N    5  
ATOM   6491  C CA   . GLY A 1 76 ? -13.096 4.401   1.131   1.00 1.00 ? 76  GLY A CA   5  
ATOM   6492  C C    . GLY A 1 76 ? -12.868 5.146   -0.177  1.00 1.00 ? 76  GLY A C    5  
ATOM   6493  O O    . GLY A 1 76 ? -13.691 5.962   -0.581  1.00 1.00 ? 76  GLY A O    5  
ATOM   6494  H H    . GLY A 1 76 ? -11.465 3.173   1.709   1.00 1.00 ? 76  GLY A H    5  
ATOM   6495  H HA2  . GLY A 1 76 ? -14.143 4.141   1.204   1.00 1.00 ? 76  GLY A HA2  5  
ATOM   6496  H HA3  . GLY A 1 76 ? -12.830 5.044   1.955   1.00 1.00 ? 76  GLY A HA3  5  
ATOM   6497  N N    . LEU A 1 77 ? -11.747 4.862   -0.841  1.00 1.00 ? 77  LEU A N    5  
ATOM   6498  C CA   . LEU A 1 77 ? -11.431 5.509   -2.116  1.00 1.00 ? 77  LEU A CA   5  
ATOM   6499  C C    . LEU A 1 77 ? -12.010 4.703   -3.280  1.00 1.00 ? 77  LEU A C    5  
ATOM   6500  O O    . LEU A 1 77 ? -12.029 5.167   -4.421  1.00 1.00 ? 77  LEU A O    5  
ATOM   6501  C CB   . LEU A 1 77 ? -9.914  5.650   -2.264  1.00 1.00 ? 77  LEU A CB   5  
ATOM   6502  C CG   . LEU A 1 77 ? -9.375  6.652   -1.227  1.00 1.00 ? 77  LEU A CG   5  
ATOM   6503  C CD1  . LEU A 1 77 ? -7.848  6.551   -1.168  1.00 1.00 ? 77  LEU A CD1  5  
ATOM   6504  C CD2  . LEU A 1 77 ? -9.764  8.092   -1.619  1.00 1.00 ? 77  LEU A CD2  5  
ATOM   6505  H H    . LEU A 1 77 ? -11.126 4.201   -0.469  1.00 1.00 ? 77  LEU A H    5  
ATOM   6506  H HA   . LEU A 1 77 ? -11.869 6.487   -2.131  1.00 1.00 ? 77  LEU A HA   5  
ATOM   6507  H HB2  . LEU A 1 77 ? -9.463  4.688   -2.107  1.00 1.00 ? 77  LEU A HB2  5  
ATOM   6508  H HB3  . LEU A 1 77 ? -9.674  5.997   -3.255  1.00 1.00 ? 77  LEU A HB3  5  
ATOM   6509  H HG   . LEU A 1 77 ? -9.788  6.419   -0.255  1.00 1.00 ? 77  LEU A HG   5  
ATOM   6510  H HD11 . LEU A 1 77 ? -7.555  5.516   -1.070  1.00 1.00 ? 77  LEU A HD11 5  
ATOM   6511  H HD12 . LEU A 1 77 ? -7.481  7.113   -0.323  1.00 1.00 ? 77  LEU A HD12 5  
ATOM   6512  H HD13 . LEU A 1 77 ? -7.433  6.957   -2.077  1.00 1.00 ? 77  LEU A HD13 5  
ATOM   6513  H HD21 . LEU A 1 77 ? -9.683  8.213   -2.690  1.00 1.00 ? 77  LEU A HD21 5  
ATOM   6514  H HD22 . LEU A 1 77 ? -9.101  8.793   -1.130  1.00 1.00 ? 77  LEU A HD22 5  
ATOM   6515  H HD23 . LEU A 1 77 ? -10.778 8.293   -1.310  1.00 1.00 ? 77  LEU A HD23 5  
ATOM   6516  N N    . LEU A 1 78 ? -12.493 3.497   -2.973  1.00 1.00 ? 78  LEU A N    5  
ATOM   6517  C CA   . LEU A 1 78 ? -13.091 2.617   -3.984  1.00 1.00 ? 78  LEU A CA   5  
ATOM   6518  C C    . LEU A 1 78 ? -14.608 2.815   -4.054  1.00 1.00 ? 78  LEU A C    5  
ATOM   6519  O O    . LEU A 1 78 ? -15.263 2.321   -4.973  1.00 1.00 ? 78  LEU A O    5  
ATOM   6520  C CB   . LEU A 1 78 ? -12.793 1.148   -3.634  1.00 1.00 ? 78  LEU A CB   5  
ATOM   6521  C CG   . LEU A 1 78 ? -11.366 0.753   -4.054  1.00 1.00 ? 78  LEU A CG   5  
ATOM   6522  C CD1  . LEU A 1 78 ? -10.971 -0.552  -3.352  1.00 1.00 ? 78  LEU A CD1  5  
ATOM   6523  C CD2  . LEU A 1 78 ? -11.290 0.543   -5.579  1.00 1.00 ? 78  LEU A CD2  5  
ATOM   6524  H H    . LEU A 1 78 ? -12.454 3.194   -2.044  1.00 1.00 ? 78  LEU A H    5  
ATOM   6525  H HA   . LEU A 1 78 ? -12.666 2.840   -4.949  1.00 1.00 ? 78  LEU A HA   5  
ATOM   6526  H HB2  . LEU A 1 78 ? -12.891 1.025   -2.569  1.00 1.00 ? 78  LEU A HB2  5  
ATOM   6527  H HB3  . LEU A 1 78 ? -13.503 0.509   -4.130  1.00 1.00 ? 78  LEU A HB3  5  
ATOM   6528  H HG   . LEU A 1 78 ? -10.678 1.528   -3.762  1.00 1.00 ? 78  LEU A HG   5  
ATOM   6529  H HD11 . LEU A 1 78 ? -11.583 -1.361  -3.725  1.00 1.00 ? 78  LEU A HD11 5  
ATOM   6530  H HD12 . LEU A 1 78 ? -11.116 -0.451  -2.289  1.00 1.00 ? 78  LEU A HD12 5  
ATOM   6531  H HD13 . LEU A 1 78 ? -9.931  -0.766  -3.553  1.00 1.00 ? 78  LEU A HD13 5  
ATOM   6532  H HD21 . LEU A 1 78 ? -12.195 0.073   -5.931  1.00 1.00 ? 78  LEU A HD21 5  
ATOM   6533  H HD22 . LEU A 1 78 ? -10.451 -0.094  -5.815  1.00 1.00 ? 78  LEU A HD22 5  
ATOM   6534  H HD23 . LEU A 1 78 ? -11.164 1.494   -6.071  1.00 1.00 ? 78  LEU A HD23 5  
ATOM   6535  N N    . GLU A 1 79 ? -15.164 3.528   -3.079  1.00 1.00 ? 79  GLU A N    5  
ATOM   6536  C CA   . GLU A 1 79 ? -16.606 3.765   -3.045  1.00 1.00 ? 79  GLU A CA   5  
ATOM   6537  C C    . GLU A 1 79 ? -17.033 4.577   -4.247  1.00 1.00 ? 79  GLU A C    5  
ATOM   6538  O O    . GLU A 1 79 ? -17.974 4.219   -4.959  1.00 1.00 ? 79  GLU A O    5  
ATOM   6539  C CB   . GLU A 1 79 ? -16.987 4.488   -1.749  1.00 1.00 ? 79  GLU A CB   5  
ATOM   6540  C CG   . GLU A 1 79 ? -16.372 5.882   -1.744  1.00 1.00 ? 79  GLU A CG   5  
ATOM   6541  C CD   . GLU A 1 79 ? -16.334 6.438   -0.323  1.00 1.00 ? 79  GLU A CD   5  
ATOM   6542  O OE1  . GLU A 1 79 ? -16.898 5.805   0.554   1.00 1.00 ? 79  GLU A OE1  5  
ATOM   6543  O OE2  . GLU A 1 79 ? -15.737 7.484   -0.135  1.00 1.00 ? 79  GLU A OE2  5  
ATOM   6544  H H    . GLU A 1 79 ? -14.601 3.893   -2.370  1.00 1.00 ? 79  GLU A H    5  
ATOM   6545  H HA   . GLU A 1 79 ? -17.109 2.833   -3.076  1.00 1.00 ? 79  GLU A HA   5  
ATOM   6546  H HB2  . GLU A 1 79 ? -18.060 4.571   -1.686  1.00 1.00 ? 79  GLU A HB2  5  
ATOM   6547  H HB3  . GLU A 1 79 ? -16.617 3.929   -0.904  1.00 1.00 ? 79  GLU A HB3  5  
ATOM   6548  H HG2  . GLU A 1 79 ? -15.373 5.828   -2.140  1.00 1.00 ? 79  GLU A HG2  5  
ATOM   6549  H HG3  . GLU A 1 79 ? -16.969 6.532   -2.360  1.00 1.00 ? 79  GLU A HG3  5  
ATOM   6550  N N    . LYS A 1 80 ? -16.323 5.661   -4.476  1.00 1.00 ? 80  LYS A N    5  
ATOM   6551  C CA   . LYS A 1 80 ? -16.604 6.534   -5.607  1.00 1.00 ? 80  LYS A CA   5  
ATOM   6552  C C    . LYS A 1 80 ? -15.704 6.187   -6.786  1.00 1.00 ? 80  LYS A C    5  
ATOM   6553  O O    . LYS A 1 80 ? -16.156 6.098   -7.929  1.00 1.00 ? 80  LYS A O    5  
ATOM   6554  C CB   . LYS A 1 80 ? -16.417 8.002   -5.184  1.00 1.00 ? 80  LYS A CB   5  
ATOM   6555  C CG   . LYS A 1 80 ? -14.938 8.461   -5.210  1.00 1.00 ? 80  LYS A CG   5  
ATOM   6556  C CD   . LYS A 1 80 ? -14.059 7.753   -4.157  1.00 1.00 ? 80  LYS A CD   5  
ATOM   6557  C CE   . LYS A 1 80 ? -14.309 8.345   -2.763  1.00 1.00 ? 80  LYS A CE   5  
ATOM   6558  N NZ   . LYS A 1 80 ? -14.056 9.817   -2.784  1.00 1.00 ? 80  LYS A NZ   5  
ATOM   6559  H H    . LYS A 1 80 ? -15.584 5.878   -3.871  1.00 1.00 ? 80  LYS A H    5  
ATOM   6560  H HA   . LYS A 1 80 ? -17.634 6.397   -5.912  1.00 1.00 ? 80  LYS A HA   5  
ATOM   6561  H HB2  . LYS A 1 80 ? -16.979 8.628   -5.861  1.00 1.00 ? 80  LYS A HB2  5  
ATOM   6562  H HB3  . LYS A 1 80 ? -16.811 8.129   -4.189  1.00 1.00 ? 80  LYS A HB3  5  
ATOM   6563  H HG2  . LYS A 1 80 ? -14.515 8.314   -6.189  1.00 1.00 ? 80  LYS A HG2  5  
ATOM   6564  H HG3  . LYS A 1 80 ? -14.925 9.501   -4.999  1.00 1.00 ? 80  LYS A HG3  5  
ATOM   6565  H HD2  . LYS A 1 80 ? -14.268 6.707   -4.138  1.00 1.00 ? 80  LYS A HD2  5  
ATOM   6566  H HD3  . LYS A 1 80 ? -13.018 7.899   -4.413  1.00 1.00 ? 80  LYS A HD3  5  
ATOM   6567  H HE2  . LYS A 1 80 ? -15.326 8.157   -2.468  1.00 1.00 ? 80  LYS A HE2  5  
ATOM   6568  H HE3  . LYS A 1 80 ? -13.647 7.881   -2.057  1.00 1.00 ? 80  LYS A HE3  5  
ATOM   6569  H HZ1  . LYS A 1 80 ? -14.914 10.315  -3.088  1.00 1.00 ? 80  LYS A HZ1  5  
ATOM   6570  H HZ2  . LYS A 1 80 ? -13.278 10.026  -3.445  1.00 1.00 ? 80  LYS A HZ2  5  
ATOM   6571  H HZ3  . LYS A 1 80 ? -13.794 10.137  -1.829  1.00 1.00 ? 80  LYS A HZ3  5  
ATOM   6572  N N    . LYS A 1 81 ? -14.425 5.997   -6.491  1.00 1.00 ? 81  LYS A N    5  
ATOM   6573  C CA   . LYS A 1 81 ? -13.450 5.667   -7.511  1.00 1.00 ? 81  LYS A CA   5  
ATOM   6574  C C    . LYS A 1 81 ? -13.620 6.574   -8.724  1.00 1.00 ? 81  LYS A C    5  
ATOM   6575  O O    . LYS A 1 81 ? -14.252 6.200   -9.712  1.00 1.00 ? 81  LYS A O    5  
ATOM   6576  C CB   . LYS A 1 81 ? -13.603 4.208   -7.909  1.00 1.00 ? 81  LYS A CB   5  
ATOM   6577  C CG   . LYS A 1 81 ? -12.486 3.827   -8.887  1.00 1.00 ? 81  LYS A CG   5  
ATOM   6578  C CD   . LYS A 1 81 ? -12.576 2.338   -9.234  1.00 1.00 ? 81  LYS A CD   5  
ATOM   6579  C CE   . LYS A 1 81 ? -11.437 1.965   -10.187 1.00 1.00 ? 81  LYS A CE   5  
ATOM   6580  N NZ   . LYS A 1 81 ? -11.581 2.720   -11.462 1.00 1.00 ? 81  LYS A NZ   5  
ATOM   6581  H H    . LYS A 1 81 ? -14.133 6.087   -5.568  1.00 1.00 ? 81  LYS A H    5  
ATOM   6582  H HA   . LYS A 1 81 ? -12.459 5.812   -7.105  1.00 1.00 ? 81  LYS A HA   5  
ATOM   6583  H HB2  . LYS A 1 81 ? -13.536 3.595   -7.016  1.00 1.00 ? 81  LYS A HB2  5  
ATOM   6584  H HB3  . LYS A 1 81 ? -14.561 4.061   -8.375  1.00 1.00 ? 81  LYS A HB3  5  
ATOM   6585  H HG2  . LYS A 1 81 ? -12.588 4.413   -9.789  1.00 1.00 ? 81  LYS A HG2  5  
ATOM   6586  H HG3  . LYS A 1 81 ? -11.528 4.031   -8.433  1.00 1.00 ? 81  LYS A HG3  5  
ATOM   6587  H HD2  . LYS A 1 81 ? -12.499 1.752   -8.330  1.00 1.00 ? 81  LYS A HD2  5  
ATOM   6588  H HD3  . LYS A 1 81 ? -13.522 2.137   -9.713  1.00 1.00 ? 81  LYS A HD3  5  
ATOM   6589  H HE2  . LYS A 1 81 ? -10.490 2.212   -9.729  1.00 1.00 ? 81  LYS A HE2  5  
ATOM   6590  H HE3  . LYS A 1 81 ? -11.469 0.904   -10.390 1.00 1.00 ? 81  LYS A HE3  5  
ATOM   6591  H HZ1  . LYS A 1 81 ? -11.055 3.614   -11.400 1.00 1.00 ? 81  LYS A HZ1  5  
ATOM   6592  H HZ2  . LYS A 1 81 ? -12.588 2.920   -11.636 1.00 1.00 ? 81  LYS A HZ2  5  
ATOM   6593  H HZ3  . LYS A 1 81 ? -11.200 2.153   -12.248 1.00 1.00 ? 81  LYS A HZ3  5  
ATOM   6594  N N    . ALA A 1 82 ? -13.053 7.771   -8.632  1.00 1.00 ? 82  ALA A N    5  
ATOM   6595  C CA   . ALA A 1 82 ? -13.143 8.736   -9.716  1.00 1.00 ? 82  ALA A CA   5  
ATOM   6596  C C    . ALA A 1 82 ? -12.365 8.246   -10.932 1.00 1.00 ? 82  ALA A C    5  
ATOM   6597  O O    . ALA A 1 82 ? -12.988 7.710   -11.832 1.00 1.00 ? 82  ALA A O    5  
ATOM   6598  C CB   . ALA A 1 82 ? -12.586 10.084  -9.255  1.00 1.00 ? 82  ALA A CB   5  
ATOM   6599  O OXT  . ALA A 1 82 ? -11.156 8.416   -10.946 1.00 1.00 ? 82  ALA A OXT  5  
ATOM   6600  H H    . ALA A 1 82 ? -12.565 8.009   -7.814  1.00 1.00 ? 82  ALA A H    5  
ATOM   6601  H HA   . ALA A 1 82 ? -14.180 8.862   -9.988  1.00 1.00 ? 82  ALA A HA   5  
ATOM   6602  H HB1  . ALA A 1 82 ? -12.989 10.327  -8.284  1.00 1.00 ? 82  ALA A HB1  5  
ATOM   6603  H HB2  . ALA A 1 82 ? -12.864 10.851  -9.963  1.00 1.00 ? 82  ALA A HB2  5  
ATOM   6604  H HB3  . ALA A 1 82 ? -11.509 10.025  -9.193  1.00 1.00 ? 82  ALA A HB3  5  
HETATM 6605  O O23  . PNS B 2 .  ? 15.588  6.951   -0.607  1.00 1.00 ? 101 PNS A O23  5  
HETATM 6606  P P24  . PNS B 2 .  ? 17.011  6.199   -0.656  1.00 1.00 ? 101 PNS A P24  5  
HETATM 6607  O O25  . PNS B 2 .  ? 18.077  7.220   -0.531  1.00 1.00 ? 101 PNS A O25  5  
HETATM 6608  O O26  . PNS B 2 .  ? 16.966  5.060   0.285   1.00 1.00 ? 101 PNS A O26  5  
HETATM 6609  O O27  . PNS B 2 .  ? 17.046  5.615   -2.156  1.00 1.00 ? 101 PNS A O27  5  
HETATM 6610  C C28  . PNS B 2 .  ? 18.286  5.314   -2.783  1.00 1.00 ? 101 PNS A C28  5  
HETATM 6611  C C29  . PNS B 2 .  ? 18.079  5.217   -4.299  1.00 1.00 ? 101 PNS A C29  5  
HETATM 6612  C C30  . PNS B 2 .  ? 19.385  4.810   -4.978  1.00 1.00 ? 101 PNS A C30  5  
HETATM 6613  C C31  . PNS B 2 .  ? 17.621  6.584   -4.828  1.00 1.00 ? 101 PNS A C31  5  
HETATM 6614  C C32  . PNS B 2 .  ? 17.031  4.155   -4.619  1.00 1.00 ? 101 PNS A C32  5  
HETATM 6615  O O33  . PNS B 2 .  ? 15.828  4.493   -3.947  1.00 1.00 ? 101 PNS A O33  5  
HETATM 6616  C C34  . PNS B 2 .  ? 16.778  4.096   -6.123  1.00 1.00 ? 101 PNS A C34  5  
HETATM 6617  O O35  . PNS B 2 .  ? 16.049  4.922   -6.673  1.00 1.00 ? 101 PNS A O35  5  
HETATM 6618  N N36  . PNS B 2 .  ? 17.385  3.114   -6.782  1.00 1.00 ? 101 PNS A N36  5  
HETATM 6619  C C37  . PNS B 2 .  ? 17.219  2.956   -8.223  1.00 1.00 ? 101 PNS A C37  5  
HETATM 6620  C C38  . PNS B 2 .  ? 15.817  2.432   -8.540  1.00 1.00 ? 101 PNS A C38  5  
HETATM 6621  C C39  . PNS B 2 .  ? 15.440  1.330   -7.558  1.00 1.00 ? 101 PNS A C39  5  
HETATM 6622  O O40  . PNS B 2 .  ? 16.229  0.420   -7.296  1.00 1.00 ? 101 PNS A O40  5  
HETATM 6623  N N41  . PNS B 2 .  ? 14.230  1.416   -7.016  1.00 1.00 ? 101 PNS A N41  5  
HETATM 6624  C C42  . PNS B 2 .  ? 13.758  0.419   -6.063  1.00 1.00 ? 101 PNS A C42  5  
HETATM 6625  C C43  . PNS B 2 .  ? 14.718  0.330   -4.872  1.00 1.00 ? 101 PNS A C43  5  
HETATM 6626  S S44  . PNS B 2 .  ? 13.833  -0.270  -3.437  1.00 1.00 ? 101 PNS A S44  5  
HETATM 6627  H H282 . PNS B 2 .  ? 18.654  4.374   -2.406  1.00 1.00 ? 101 PNS A H282 5  
HETATM 6628  H H281 . PNS B 2 .  ? 19.009  6.092   -2.568  1.00 1.00 ? 101 PNS A H281 5  
HETATM 6629  H H303 . PNS B 2 .  ? 20.187  5.439   -4.621  1.00 1.00 ? 101 PNS A H303 5  
HETATM 6630  H H302 . PNS B 2 .  ? 19.607  3.778   -4.747  1.00 1.00 ? 101 PNS A H302 5  
HETATM 6631  H H301 . PNS B 2 .  ? 19.287  4.926   -6.048  1.00 1.00 ? 101 PNS A H301 5  
HETATM 6632  H H313 . PNS B 2 .  ? 16.624  6.793   -4.471  1.00 1.00 ? 101 PNS A H313 5  
HETATM 6633  H H312 . PNS B 2 .  ? 18.298  7.349   -4.477  1.00 1.00 ? 101 PNS A H312 5  
HETATM 6634  H H311 . PNS B 2 .  ? 17.623  6.570   -5.908  1.00 1.00 ? 101 PNS A H311 5  
HETATM 6635  H H32  . PNS B 2 .  ? 17.378  3.184   -4.280  1.00 1.00 ? 101 PNS A H32  5  
HETATM 6636  H H33  . PNS B 2 .  ? 15.914  5.388   -3.612  1.00 1.00 ? 101 PNS A H33  5  
HETATM 6637  H H36  . PNS B 2 .  ? 17.955  2.485   -6.292  1.00 1.00 ? 101 PNS A H36  5  
HETATM 6638  H H372 . PNS B 2 .  ? 17.955  2.258   -8.591  1.00 1.00 ? 101 PNS A H372 5  
HETATM 6639  H H371 . PNS B 2 .  ? 17.360  3.912   -8.707  1.00 1.00 ? 101 PNS A H371 5  
HETATM 6640  H H382 . PNS B 2 .  ? 15.106  3.240   -8.461  1.00 1.00 ? 101 PNS A H382 5  
HETATM 6641  H H381 . PNS B 2 .  ? 15.802  2.036   -9.545  1.00 1.00 ? 101 PNS A H381 5  
HETATM 6642  H H41  . PNS B 2 .  ? 13.645  2.163   -7.263  1.00 1.00 ? 101 PNS A H41  5  
HETATM 6643  H H422 . PNS B 2 .  ? 13.700  -0.541  -6.551  1.00 1.00 ? 101 PNS A H422 5  
HETATM 6644  H H421 . PNS B 2 .  ? 12.775  0.699   -5.708  1.00 1.00 ? 101 PNS A H421 5  
HETATM 6645  H H431 . PNS B 2 .  ? 15.121  1.309   -4.661  1.00 1.00 ? 101 PNS A H431 5  
HETATM 6646  H H432 . PNS B 2 .  ? 15.524  -0.349  -5.108  1.00 1.00 ? 101 PNS A H432 5  
HETATM 6647  C C1   . STE C 3 .  ? 13.317  0.943   -2.302  1.00 1.00 ? 102 STE A C1   5  
HETATM 6648  O O1   . STE C 3 .  ? 13.532  2.125   -2.454  1.00 1.00 ? 102 STE A O1   5  
HETATM 6649  C C2   . STE C 3 .  ? 12.586  0.343   -1.140  1.00 1.00 ? 102 STE A C2   5  
HETATM 6650  C C3   . STE C 3 .  ? 11.655  1.385   -0.516  1.00 1.00 ? 102 STE A C3   5  
HETATM 6651  C C4   . STE C 3 .  ? 11.149  0.871   0.833   1.00 1.00 ? 102 STE A C4   5  
HETATM 6652  C C5   . STE C 3 .  ? 10.002  1.761   1.320   1.00 1.00 ? 102 STE A C5   5  
HETATM 6653  C C6   . STE C 3 .  ? 9.629   1.386   2.764   1.00 1.00 ? 102 STE A C6   5  
HETATM 6654  C C7   . STE C 3 .  ? 8.211   1.870   3.082   1.00 1.00 ? 102 STE A C7   5  
HETATM 6655  C C8   . STE C 3 .  ? 8.167   3.402   3.067   1.00 1.00 ? 102 STE A C8   5  
HETATM 6656  C C9   . STE C 3 .  ? 6.788   3.896   3.533   1.00 1.00 ? 102 STE A C9   5  
HETATM 6657  C C10  . STE C 3 .  ? 5.794   3.856   2.368   1.00 1.00 ? 102 STE A C10  5  
HETATM 6658  C C11  . STE C 3 .  ? 4.437   4.382   2.837   1.00 1.00 ? 102 STE A C11  5  
HETATM 6659  C C12  . STE C 3 .  ? 3.364   4.022   1.809   1.00 1.00 ? 102 STE A C12  5  
HETATM 6660  C C13  . STE C 3 .  ? 1.998   4.488   2.313   1.00 1.00 ? 102 STE A C13  5  
HETATM 6661  C C14  . STE C 3 .  ? 0.895   3.839   1.476   1.00 1.00 ? 102 STE A C14  5  
HETATM 6662  C C15  . STE C 3 .  ? -0.430  4.561   1.720   1.00 1.00 ? 102 STE A C15  5  
HETATM 6663  C C16  . STE C 3 .  ? -1.481  4.007   0.764   1.00 1.00 ? 102 STE A C16  5  
HETATM 6664  C C17  . STE C 3 .  ? -2.788  4.785   0.906   1.00 1.00 ? 102 STE A C17  5  
HETATM 6665  C C18  . STE C 3 .  ? -3.744  4.387   -0.224  1.00 1.00 ? 102 STE A C18  5  
HETATM 6666  H H21  . STE C 3 .  ? 12.002  -0.499  -1.481  1.00 1.00 ? 102 STE A H21  5  
HETATM 6667  H H22  . STE C 3 .  ? 13.298  0.010   -0.401  1.00 1.00 ? 102 STE A H22  5  
HETATM 6668  H H31  . STE C 3 .  ? 10.815  1.557   -1.172  1.00 1.00 ? 102 STE A H31  5  
HETATM 6669  H H32  . STE C 3 .  ? 12.197  2.309   -0.372  1.00 1.00 ? 102 STE A H32  5  
HETATM 6670  H H41  . STE C 3 .  ? 11.952  0.898   1.553   1.00 1.00 ? 102 STE A H41  5  
HETATM 6671  H H42  . STE C 3 .  ? 10.795  -0.145  0.722   1.00 1.00 ? 102 STE A H42  5  
HETATM 6672  H H51  . STE C 3 .  ? 9.146   1.622   0.676   1.00 1.00 ? 102 STE A H51  5  
HETATM 6673  H H52  . STE C 3 .  ? 10.316  2.793   1.284   1.00 1.00 ? 102 STE A H52  5  
HETATM 6674  H H61  . STE C 3 .  ? 10.327  1.849   3.446   1.00 1.00 ? 102 STE A H61  5  
HETATM 6675  H H62  . STE C 3 .  ? 9.673   0.312   2.881   1.00 1.00 ? 102 STE A H62  5  
HETATM 6676  H H71  . STE C 3 .  ? 7.927   1.516   4.059   1.00 1.00 ? 102 STE A H71  5  
HETATM 6677  H H72  . STE C 3 .  ? 7.526   1.479   2.346   1.00 1.00 ? 102 STE A H72  5  
HETATM 6678  H H81  . STE C 3 .  ? 8.355   3.756   2.067   1.00 1.00 ? 102 STE A H81  5  
HETATM 6679  H H82  . STE C 3 .  ? 8.929   3.787   3.732   1.00 1.00 ? 102 STE A H82  5  
HETATM 6680  H H91  . STE C 3 .  ? 6.875   4.912   3.889   1.00 1.00 ? 102 STE A H91  5  
HETATM 6681  H H92  . STE C 3 .  ? 6.427   3.268   4.336   1.00 1.00 ? 102 STE A H92  5  
HETATM 6682  H H101 . STE C 3 .  ? 5.681   2.840   2.021   1.00 1.00 ? 102 STE A H101 5  
HETATM 6683  H H102 . STE C 3 .  ? 6.161   4.472   1.560   1.00 1.00 ? 102 STE A H102 5  
HETATM 6684  H H111 . STE C 3 .  ? 4.485   5.456   2.942   1.00 1.00 ? 102 STE A H111 5  
HETATM 6685  H H112 . STE C 3 .  ? 4.189   3.937   3.789   1.00 1.00 ? 102 STE A H112 5  
HETATM 6686  H H121 . STE C 3 .  ? 3.346   2.952   1.665   1.00 1.00 ? 102 STE A H121 5  
HETATM 6687  H H122 . STE C 3 .  ? 3.587   4.507   0.869   1.00 1.00 ? 102 STE A H122 5  
HETATM 6688  H H131 . STE C 3 .  ? 1.930   5.562   2.227   1.00 1.00 ? 102 STE A H131 5  
HETATM 6689  H H132 . STE C 3 .  ? 1.882   4.202   3.349   1.00 1.00 ? 102 STE A H132 5  
HETATM 6690  H H141 . STE C 3 .  ? 0.794   2.801   1.757   1.00 1.00 ? 102 STE A H141 5  
HETATM 6691  H H142 . STE C 3 .  ? 1.153   3.904   0.429   1.00 1.00 ? 102 STE A H142 5  
HETATM 6692  H H151 . STE C 3 .  ? -0.307  5.617   1.541   1.00 1.00 ? 102 STE A H151 5  
HETATM 6693  H H152 . STE C 3 .  ? -0.745  4.400   2.738   1.00 1.00 ? 102 STE A H152 5  
HETATM 6694  H H161 . STE C 3 .  ? -1.660  2.967   0.993   1.00 1.00 ? 102 STE A H161 5  
HETATM 6695  H H162 . STE C 3 .  ? -1.124  4.098   -0.246  1.00 1.00 ? 102 STE A H162 5  
HETATM 6696  H H171 . STE C 3 .  ? -2.584  5.844   0.845   1.00 1.00 ? 102 STE A H171 5  
HETATM 6697  H H172 . STE C 3 .  ? -3.241  4.557   1.860   1.00 1.00 ? 102 STE A H172 5  
HETATM 6698  H H181 . STE C 3 .  ? -3.471  4.908   -1.130  1.00 1.00 ? 102 STE A H181 5  
HETATM 6699  H H182 . STE C 3 .  ? -4.754  4.652   0.051   1.00 1.00 ? 102 STE A H182 5  
HETATM 6700  H H183 . STE C 3 .  ? -3.683  3.320   -0.392  1.00 1.00 ? 102 STE A H183 5  
ATOM   6701  N N    . ALA A 1 1  ? -9.522  -4.045  6.785   1.00 1.00 ? 1   ALA A N    6  
ATOM   6702  C CA   . ALA A 1 1  ? -9.711  -4.157  5.311   1.00 1.00 ? 1   ALA A CA   6  
ATOM   6703  C C    . ALA A 1 1  ? -9.934  -5.621  4.940   1.00 1.00 ? 1   ALA A C    6  
ATOM   6704  O O    . ALA A 1 1  ? -9.857  -6.505  5.791   1.00 1.00 ? 1   ALA A O    6  
ATOM   6705  C CB   . ALA A 1 1  ? -8.469  -3.617  4.598   1.00 1.00 ? 1   ALA A CB   6  
ATOM   6706  H H1   . ALA A 1 1  ? -8.914  -3.229  6.996   1.00 1.00 ? 1   ALA A H1   6  
ATOM   6707  H H2   . ALA A 1 1  ? -9.075  -4.914  7.143   1.00 1.00 ? 1   ALA A H2   6  
ATOM   6708  H H3   . ALA A 1 1  ? -10.445 -3.915  7.244   1.00 1.00 ? 1   ALA A H3   6  
ATOM   6709  H HA   . ALA A 1 1  ? -10.573 -3.576  5.016   1.00 1.00 ? 1   ALA A HA   6  
ATOM   6710  H HB1  . ALA A 1 1  ? -7.717  -4.390  4.551   1.00 1.00 ? 1   ALA A HB1  6  
ATOM   6711  H HB2  . ALA A 1 1  ? -8.080  -2.770  5.143   1.00 1.00 ? 1   ALA A HB2  6  
ATOM   6712  H HB3  . ALA A 1 1  ? -8.736  -3.309  3.597   1.00 1.00 ? 1   ALA A HB3  6  
ATOM   6713  N N    . LYS A 1 2  ? -10.208 -5.867  3.664   1.00 1.00 ? 2   LYS A N    6  
ATOM   6714  C CA   . LYS A 1 2  ? -10.442 -7.224  3.186   1.00 1.00 ? 2   LYS A CA   6  
ATOM   6715  C C    . LYS A 1 2  ? -9.119  -7.918  2.880   1.00 1.00 ? 2   LYS A C    6  
ATOM   6716  O O    . LYS A 1 2  ? -8.143  -7.275  2.505   1.00 1.00 ? 2   LYS A O    6  
ATOM   6717  C CB   . LYS A 1 2  ? -11.309 -7.194  1.928   1.00 1.00 ? 2   LYS A CB   6  
ATOM   6718  C CG   . LYS A 1 2  ? -12.700 -6.663  2.280   1.00 1.00 ? 2   LYS A CG   6  
ATOM   6719  C CD   . LYS A 1 2  ? -13.550 -6.578  1.011   1.00 1.00 ? 2   LYS A CD   6  
ATOM   6720  C CE   . LYS A 1 2  ? -14.914 -5.973  1.348   1.00 1.00 ? 2   LYS A CE   6  
ATOM   6721  N NZ   . LYS A 1 2  ? -15.664 -6.902  2.238   1.00 1.00 ? 2   LYS A NZ   6  
ATOM   6722  H H    . LYS A 1 2  ? -10.256 -5.118  3.028   1.00 1.00 ? 2   LYS A H    6  
ATOM   6723  H HA   . LYS A 1 2  ? -10.960 -7.781  3.955   1.00 1.00 ? 2   LYS A HA   6  
ATOM   6724  H HB2  . LYS A 1 2  ? -10.853 -6.549  1.192   1.00 1.00 ? 2   LYS A HB2  6  
ATOM   6725  H HB3  . LYS A 1 2  ? -11.398 -8.193  1.530   1.00 1.00 ? 2   LYS A HB3  6  
ATOM   6726  H HG2  . LYS A 1 2  ? -13.173 -7.332  2.985   1.00 1.00 ? 2   LYS A HG2  6  
ATOM   6727  H HG3  . LYS A 1 2  ? -12.613 -5.681  2.718   1.00 1.00 ? 2   LYS A HG3  6  
ATOM   6728  H HD2  . LYS A 1 2  ? -13.048 -5.956  0.283   1.00 1.00 ? 2   LYS A HD2  6  
ATOM   6729  H HD3  . LYS A 1 2  ? -13.688 -7.568  0.603   1.00 1.00 ? 2   LYS A HD3  6  
ATOM   6730  H HE2  . LYS A 1 2  ? -14.773 -5.028  1.851   1.00 1.00 ? 2   LYS A HE2  6  
ATOM   6731  H HE3  . LYS A 1 2  ? -15.474 -5.816  0.438   1.00 1.00 ? 2   LYS A HE3  6  
ATOM   6732  H HZ1  . LYS A 1 2  ? -16.642 -6.568  2.343   1.00 1.00 ? 2   LYS A HZ1  6  
ATOM   6733  H HZ2  . LYS A 1 2  ? -15.205 -6.932  3.172   1.00 1.00 ? 2   LYS A HZ2  6  
ATOM   6734  H HZ3  . LYS A 1 2  ? -15.668 -7.855  1.822   1.00 1.00 ? 2   LYS A HZ3  6  
ATOM   6735  N N    . LYS A 1 3  ? -9.096  -9.234  3.043   1.00 1.00 ? 3   LYS A N    6  
ATOM   6736  C CA   . LYS A 1 3  ? -7.885  -10.003 2.788   1.00 1.00 ? 3   LYS A CA   6  
ATOM   6737  C C    . LYS A 1 3  ? -7.442  -9.848  1.340   1.00 1.00 ? 3   LYS A C    6  
ATOM   6738  O O    . LYS A 1 3  ? -6.250  -9.727  1.057   1.00 1.00 ? 3   LYS A O    6  
ATOM   6739  C CB   . LYS A 1 3  ? -8.143  -11.482 3.084   1.00 1.00 ? 3   LYS A CB   6  
ATOM   6740  C CG   . LYS A 1 3  ? -8.350  -11.677 4.589   1.00 1.00 ? 3   LYS A CG   6  
ATOM   6741  C CD   . LYS A 1 3  ? -8.958  -13.059 4.848   1.00 1.00 ? 3   LYS A CD   6  
ATOM   6742  C CE   . LYS A 1 3  ? -8.132  -14.127 4.126   1.00 1.00 ? 3   LYS A CE   6  
ATOM   6743  N NZ   . LYS A 1 3  ? -8.444  -15.465 4.694   1.00 1.00 ? 3   LYS A NZ   6  
ATOM   6744  H H    . LYS A 1 3  ? -9.909  -9.699  3.341   1.00 1.00 ? 3   LYS A H    6  
ATOM   6745  H HA   . LYS A 1 3  ? -7.101  -9.650  3.440   1.00 1.00 ? 3   LYS A HA   6  
ATOM   6746  H HB2  . LYS A 1 3  ? -9.020  -11.814 2.553   1.00 1.00 ? 3   LYS A HB2  6  
ATOM   6747  H HB3  . LYS A 1 3  ? -7.287  -12.067 2.767   1.00 1.00 ? 3   LYS A HB3  6  
ATOM   6748  H HG2  . LYS A 1 3  ? -7.401  -11.602 5.098   1.00 1.00 ? 3   LYS A HG2  6  
ATOM   6749  H HG3  . LYS A 1 3  ? -9.021  -10.916 4.959   1.00 1.00 ? 3   LYS A HG3  6  
ATOM   6750  H HD2  . LYS A 1 3  ? -8.956  -13.259 5.910   1.00 1.00 ? 3   LYS A HD2  6  
ATOM   6751  H HD3  . LYS A 1 3  ? -9.973  -13.080 4.480   1.00 1.00 ? 3   LYS A HD3  6  
ATOM   6752  H HE2  . LYS A 1 3  ? -8.378  -14.113 3.070   1.00 1.00 ? 3   LYS A HE2  6  
ATOM   6753  H HE3  . LYS A 1 3  ? -7.081  -13.914 4.251   1.00 1.00 ? 3   LYS A HE3  6  
ATOM   6754  H HZ1  . LYS A 1 3  ? -7.672  -15.762 5.324   1.00 1.00 ? 3   LYS A HZ1  6  
ATOM   6755  H HZ2  . LYS A 1 3  ? -8.547  -16.153 3.920   1.00 1.00 ? 3   LYS A HZ2  6  
ATOM   6756  H HZ3  . LYS A 1 3  ? -9.329  -15.416 5.235   1.00 1.00 ? 3   LYS A HZ3  6  
ATOM   6757  N N    . GLU A 1 4  ? -8.406  -9.854  0.425   1.00 1.00 ? 4   GLU A N    6  
ATOM   6758  C CA   . GLU A 1 4  ? -8.096  -9.720  -0.994  1.00 1.00 ? 4   GLU A CA   6  
ATOM   6759  C C    . GLU A 1 4  ? -7.350  -8.420  -1.265  1.00 1.00 ? 4   GLU A C    6  
ATOM   6760  O O    . GLU A 1 4  ? -6.349  -8.407  -1.978  1.00 1.00 ? 4   GLU A O    6  
ATOM   6761  C CB   . GLU A 1 4  ? -9.393  -9.754  -1.810  1.00 1.00 ? 4   GLU A CB   6  
ATOM   6762  C CG   . GLU A 1 4  ? -10.198 -8.481  -1.541  1.00 1.00 ? 4   GLU A CG   6  
ATOM   6763  C CD   . GLU A 1 4  ? -11.630 -8.655  -2.027  1.00 1.00 ? 4   GLU A CD   6  
ATOM   6764  O OE1  . GLU A 1 4  ? -11.821 -9.346  -3.015  1.00 1.00 ? 4   GLU A OE1  6  
ATOM   6765  O OE2  . GLU A 1 4  ? -12.517 -8.100  -1.401  1.00 1.00 ? 4   GLU A OE2  6  
ATOM   6766  H H    . GLU A 1 4  ? -9.339  -9.949  0.710   1.00 1.00 ? 4   GLU A H    6  
ATOM   6767  H HA   . GLU A 1 4  ? -7.477  -10.552 -1.294  1.00 1.00 ? 4   GLU A HA   6  
ATOM   6768  H HB2  . GLU A 1 4  ? -9.153  -9.814  -2.862  1.00 1.00 ? 4   GLU A HB2  6  
ATOM   6769  H HB3  . GLU A 1 4  ? -9.978  -10.617 -1.521  1.00 1.00 ? 4   GLU A HB3  6  
ATOM   6770  H HG2  . GLU A 1 4  ? -10.198 -8.272  -0.483  1.00 1.00 ? 4   GLU A HG2  6  
ATOM   6771  H HG3  . GLU A 1 4  ? -9.745  -7.654  -2.070  1.00 1.00 ? 4   GLU A HG3  6  
ATOM   6772  N N    . THR A 1 5  ? -7.848  -7.330  -0.695  1.00 1.00 ? 5   THR A N    6  
ATOM   6773  C CA   . THR A 1 5  ? -7.226  -6.027  -0.878  1.00 1.00 ? 5   THR A CA   6  
ATOM   6774  C C    . THR A 1 5  ? -5.862  -5.986  -0.190  1.00 1.00 ? 5   THR A C    6  
ATOM   6775  O O    . THR A 1 5  ? -4.902  -5.433  -0.718  1.00 1.00 ? 5   THR A O    6  
ATOM   6776  C CB   . THR A 1 5  ? -8.121  -4.929  -0.305  1.00 1.00 ? 5   THR A CB   6  
ATOM   6777  O OG1  . THR A 1 5  ? -9.468  -5.185  -0.676  1.00 1.00 ? 5   THR A OG1  6  
ATOM   6778  C CG2  . THR A 1 5  ? -7.690  -3.573  -0.879  1.00 1.00 ? 5   THR A CG2  6  
ATOM   6779  H H    . THR A 1 5  ? -8.653  -7.401  -0.137  1.00 1.00 ? 5   THR A H    6  
ATOM   6780  H HA   . THR A 1 5  ? -7.082  -5.855  -1.936  1.00 1.00 ? 5   THR A HA   6  
ATOM   6781  H HB   . THR A 1 5  ? -8.031  -4.906  0.768   1.00 1.00 ? 5   THR A HB   6  
ATOM   6782  H HG1  . THR A 1 5  ? -10.009 -5.099  0.116   1.00 1.00 ? 5   THR A HG1  6  
ATOM   6783  H HG21 . THR A 1 5  ? -8.117  -2.781  -0.284  1.00 1.00 ? 5   THR A HG21 6  
ATOM   6784  H HG22 . THR A 1 5  ? -8.037  -3.485  -1.901  1.00 1.00 ? 5   THR A HG22 6  
ATOM   6785  H HG23 . THR A 1 5  ? -6.613  -3.500  -0.859  1.00 1.00 ? 5   THR A HG23 6  
ATOM   6786  N N    . ILE A 1 6  ? -5.790  -6.576  1.001   1.00 1.00 ? 6   ILE A N    6  
ATOM   6787  C CA   . ILE A 1 6  ? -4.545  -6.598  1.757   1.00 1.00 ? 6   ILE A CA   6  
ATOM   6788  C C    . ILE A 1 6  ? -3.465  -7.348  0.981   1.00 1.00 ? 6   ILE A C    6  
ATOM   6789  O O    . ILE A 1 6  ? -2.325  -6.890  0.897   1.00 1.00 ? 6   ILE A O    6  
ATOM   6790  C CB   . ILE A 1 6  ? -4.768  -7.275  3.113   1.00 1.00 ? 6   ILE A CB   6  
ATOM   6791  C CG1  . ILE A 1 6  ? -5.620  -6.368  4.004   1.00 1.00 ? 6   ILE A CG1  6  
ATOM   6792  C CG2  . ILE A 1 6  ? -3.421  -7.541  3.787   1.00 1.00 ? 6   ILE A CG2  6  
ATOM   6793  C CD1  . ILE A 1 6  ? -6.071  -7.145  5.243   1.00 1.00 ? 6   ILE A CD1  6  
ATOM   6794  H H    . ILE A 1 6  ? -6.593  -7.002  1.377   1.00 1.00 ? 6   ILE A H    6  
ATOM   6795  H HA   . ILE A 1 6  ? -4.220  -5.586  1.928   1.00 1.00 ? 6   ILE A HA   6  
ATOM   6796  H HB   . ILE A 1 6  ? -5.287  -8.217  2.963   1.00 1.00 ? 6   ILE A HB   6  
ATOM   6797  H HG12 . ILE A 1 6  ? -5.029  -5.517  4.309   1.00 1.00 ? 6   ILE A HG12 6  
ATOM   6798  H HG13 . ILE A 1 6  ? -6.480  -6.029  3.458   1.00 1.00 ? 6   ILE A HG13 6  
ATOM   6799  H HG21 . ILE A 1 6  ? -3.574  -7.741  4.828   1.00 1.00 ? 6   ILE A HG21 6  
ATOM   6800  H HG22 . ILE A 1 6  ? -2.789  -6.678  3.669   1.00 1.00 ? 6   ILE A HG22 6  
ATOM   6801  H HG23 . ILE A 1 6  ? -2.950  -8.394  3.320   1.00 1.00 ? 6   ILE A HG23 6  
ATOM   6802  H HD11 . ILE A 1 6  ? -6.410  -6.452  5.998   1.00 1.00 ? 6   ILE A HD11 6  
ATOM   6803  H HD12 . ILE A 1 6  ? -5.244  -7.723  5.631   1.00 1.00 ? 6   ILE A HD12 6  
ATOM   6804  H HD13 . ILE A 1 6  ? -6.879  -7.811  4.975   1.00 1.00 ? 6   ILE A HD13 6  
ATOM   6805  N N    . ASP A 1 7  ? -3.828  -8.495  0.428   1.00 1.00 ? 7   ASP A N    6  
ATOM   6806  C CA   . ASP A 1 7  ? -2.880  -9.296  -0.336  1.00 1.00 ? 7   ASP A CA   6  
ATOM   6807  C C    . ASP A 1 7  ? -2.416  -8.526  -1.572  1.00 1.00 ? 7   ASP A C    6  
ATOM   6808  O O    . ASP A 1 7  ? -1.263  -8.643  -1.989  1.00 1.00 ? 7   ASP A O    6  
ATOM   6809  C CB   . ASP A 1 7  ? -3.538  -10.611 -0.767  1.00 1.00 ? 7   ASP A CB   6  
ATOM   6810  C CG   . ASP A 1 7  ? -3.461  -11.627 0.368   1.00 1.00 ? 7   ASP A CG   6  
ATOM   6811  O OD1  . ASP A 1 7  ? -2.837  -11.322 1.372   1.00 1.00 ? 7   ASP A OD1  6  
ATOM   6812  O OD2  . ASP A 1 7  ? -4.031  -12.692 0.220   1.00 1.00 ? 7   ASP A OD2  6  
ATOM   6813  H H    . ASP A 1 7  ? -4.749  -8.812  0.534   1.00 1.00 ? 7   ASP A H    6  
ATOM   6814  H HA   . ASP A 1 7  ? -2.019  -9.508  0.276   1.00 1.00 ? 7   ASP A HA   6  
ATOM   6815  H HB2  . ASP A 1 7  ? -4.570  -10.428 -1.022  1.00 1.00 ? 7   ASP A HB2  6  
ATOM   6816  H HB3  . ASP A 1 7  ? -3.020  -11.006 -1.630  1.00 1.00 ? 7   ASP A HB3  6  
ATOM   6817  N N    . LYS A 1 8  ? -3.320  -7.746  -2.153  1.00 1.00 ? 8   LYS A N    6  
ATOM   6818  C CA   . LYS A 1 8  ? -2.984  -6.963  -3.334  1.00 1.00 ? 8   LYS A CA   6  
ATOM   6819  C C    . LYS A 1 8  ? -1.992  -5.858  -2.988  1.00 1.00 ? 8   LYS A C    6  
ATOM   6820  O O    . LYS A 1 8  ? -0.991  -5.677  -3.676  1.00 1.00 ? 8   LYS A O    6  
ATOM   6821  C CB   . LYS A 1 8  ? -4.256  -6.339  -3.920  1.00 1.00 ? 8   LYS A CB   6  
ATOM   6822  C CG   . LYS A 1 8  ? -5.052  -7.410  -4.675  1.00 1.00 ? 8   LYS A CG   6  
ATOM   6823  C CD   . LYS A 1 8  ? -4.519  -7.531  -6.110  1.00 1.00 ? 8   LYS A CD   6  
ATOM   6824  C CE   . LYS A 1 8  ? -5.218  -6.502  -7.002  1.00 1.00 ? 8   LYS A CE   6  
ATOM   6825  N NZ   . LYS A 1 8  ? -4.766  -6.677  -8.407  1.00 1.00 ? 8   LYS A NZ   6  
ATOM   6826  H H    . LYS A 1 8  ? -4.222  -7.693  -1.778  1.00 1.00 ? 8   LYS A H    6  
ATOM   6827  H HA   . LYS A 1 8  ? -2.540  -7.613  -4.070  1.00 1.00 ? 8   LYS A HA   6  
ATOM   6828  H HB2  . LYS A 1 8  ? -4.862  -5.946  -3.122  1.00 1.00 ? 8   LYS A HB2  6  
ATOM   6829  H HB3  . LYS A 1 8  ? -3.987  -5.542  -4.597  1.00 1.00 ? 8   LYS A HB3  6  
ATOM   6830  H HG2  . LYS A 1 8  ? -4.947  -8.358  -4.170  1.00 1.00 ? 8   LYS A HG2  6  
ATOM   6831  H HG3  . LYS A 1 8  ? -6.094  -7.136  -4.695  1.00 1.00 ? 8   LYS A HG3  6  
ATOM   6832  H HD2  . LYS A 1 8  ? -3.453  -7.343  -6.122  1.00 1.00 ? 8   LYS A HD2  6  
ATOM   6833  H HD3  . LYS A 1 8  ? -4.710  -8.522  -6.483  1.00 1.00 ? 8   LYS A HD3  6  
ATOM   6834  H HE2  . LYS A 1 8  ? -6.288  -6.647  -6.945  1.00 1.00 ? 8   LYS A HE2  6  
ATOM   6835  H HE3  . LYS A 1 8  ? -4.975  -5.505  -6.667  1.00 1.00 ? 8   LYS A HE3  6  
ATOM   6836  H HZ1  . LYS A 1 8  ? -3.794  -7.041  -8.417  1.00 1.00 ? 8   LYS A HZ1  6  
ATOM   6837  H HZ2  . LYS A 1 8  ? -4.802  -5.760  -8.898  1.00 1.00 ? 8   LYS A HZ2  6  
ATOM   6838  H HZ3  . LYS A 1 8  ? -5.392  -7.352  -8.890  1.00 1.00 ? 8   LYS A HZ3  6  
ATOM   6839  N N    . VAL A 1 9  ? -2.284  -5.124  -1.919  1.00 1.00 ? 9   VAL A N    6  
ATOM   6840  C CA   . VAL A 1 9  ? -1.412  -4.032  -1.500  1.00 1.00 ? 9   VAL A CA   6  
ATOM   6841  C C    . VAL A 1 9  ? -0.017  -4.550  -1.181  1.00 1.00 ? 9   VAL A C    6  
ATOM   6842  O O    . VAL A 1 9  ? 0.980   -3.993  -1.641  1.00 1.00 ? 9   VAL A O    6  
ATOM   6843  C CB   . VAL A 1 9  ? -2.003  -3.343  -0.267  1.00 1.00 ? 9   VAL A CB   6  
ATOM   6844  C CG1  . VAL A 1 9  ? -1.015  -2.298  0.259   1.00 1.00 ? 9   VAL A CG1  6  
ATOM   6845  C CG2  . VAL A 1 9  ? -3.319  -2.658  -0.640  1.00 1.00 ? 9   VAL A CG2  6  
ATOM   6846  H H    . VAL A 1 9  ? -3.099  -5.318  -1.409  1.00 1.00 ? 9   VAL A H    6  
ATOM   6847  H HA   . VAL A 1 9  ? -1.346  -3.310  -2.302  1.00 1.00 ? 9   VAL A HA   6  
ATOM   6848  H HB   . VAL A 1 9  ? -2.185  -4.082  0.503   1.00 1.00 ? 9   VAL A HB   6  
ATOM   6849  H HG11 . VAL A 1 9  ? -0.212  -2.795  0.783   1.00 1.00 ? 9   VAL A HG11 6  
ATOM   6850  H HG12 . VAL A 1 9  ? -1.523  -1.625  0.930   1.00 1.00 ? 9   VAL A HG12 6  
ATOM   6851  H HG13 . VAL A 1 9  ? -0.608  -1.741  -0.573  1.00 1.00 ? 9   VAL A HG13 6  
ATOM   6852  H HG21 . VAL A 1 9  ? -3.949  -3.354  -1.170  1.00 1.00 ? 9   VAL A HG21 6  
ATOM   6853  H HG22 . VAL A 1 9  ? -3.115  -1.808  -1.267  1.00 1.00 ? 9   VAL A HG22 6  
ATOM   6854  H HG23 . VAL A 1 9  ? -3.821  -2.330  0.260   1.00 1.00 ? 9   VAL A HG23 6  
ATOM   6855  N N    . SER A 1 10 ? 0.047   -5.612  -0.392  1.00 1.00 ? 10  SER A N    6  
ATOM   6856  C CA   . SER A 1 10 ? 1.330   -6.196  -0.022  1.00 1.00 ? 10  SER A CA   6  
ATOM   6857  C C    . SER A 1 10 ? 2.069   -6.695  -1.262  1.00 1.00 ? 10  SER A C    6  
ATOM   6858  O O    . SER A 1 10 ? 3.269   -6.481  -1.403  1.00 1.00 ? 10  SER A O    6  
ATOM   6859  C CB   . SER A 1 10 ? 1.109   -7.364  0.945   1.00 1.00 ? 10  SER A CB   6  
ATOM   6860  O OG   . SER A 1 10 ? 2.320   -7.632  1.643   1.00 1.00 ? 10  SER A OG   6  
ATOM   6861  H H    . SER A 1 10 ? -0.780  -6.010  -0.052  1.00 1.00 ? 10  SER A H    6  
ATOM   6862  H HA   . SER A 1 10 ? 1.932   -5.447  0.470   1.00 1.00 ? 10  SER A HA   6  
ATOM   6863  H HB2  . SER A 1 10 ? 0.339   -7.113  1.650   1.00 1.00 ? 10  SER A HB2  6  
ATOM   6864  H HB3  . SER A 1 10 ? 0.806   -8.242  0.387   1.00 1.00 ? 10  SER A HB3  6  
ATOM   6865  H HG   . SER A 1 10 ? 3.047   -7.312  1.107   1.00 1.00 ? 10  SER A HG   6  
ATOM   6866  N N    . ASP A 1 11 ? 1.338   -7.352  -2.156  1.00 1.00 ? 11  ASP A N    6  
ATOM   6867  C CA   . ASP A 1 11 ? 1.937   -7.889  -3.375  1.00 1.00 ? 11  ASP A CA   6  
ATOM   6868  C C    . ASP A 1 11 ? 2.801   -6.835  -4.053  1.00 1.00 ? 11  ASP A C    6  
ATOM   6869  O O    . ASP A 1 11 ? 3.919   -7.121  -4.482  1.00 1.00 ? 11  ASP A O    6  
ATOM   6870  C CB   . ASP A 1 11 ? 0.842   -8.350  -4.335  1.00 1.00 ? 11  ASP A CB   6  
ATOM   6871  C CG   . ASP A 1 11 ? 1.463   -9.052  -5.536  1.00 1.00 ? 11  ASP A CG   6  
ATOM   6872  O OD1  . ASP A 1 11 ? 2.680   -9.114  -5.595  1.00 1.00 ? 11  ASP A OD1  6  
ATOM   6873  O OD2  . ASP A 1 11 ? 0.716   -9.511  -6.383  1.00 1.00 ? 11  ASP A OD2  6  
ATOM   6874  H H    . ASP A 1 11 ? 0.383   -7.480  -1.994  1.00 1.00 ? 11  ASP A H    6  
ATOM   6875  H HA   . ASP A 1 11 ? 2.554   -8.739  -3.114  1.00 1.00 ? 11  ASP A HA   6  
ATOM   6876  H HB2  . ASP A 1 11 ? 0.180   -9.035  -3.824  1.00 1.00 ? 11  ASP A HB2  6  
ATOM   6877  H HB3  . ASP A 1 11 ? 0.278   -7.493  -4.672  1.00 1.00 ? 11  ASP A HB3  6  
ATOM   6878  N N    . ILE A 1 12 ? 2.284   -5.619  -4.140  1.00 1.00 ? 12  ILE A N    6  
ATOM   6879  C CA   . ILE A 1 12 ? 3.028   -4.539  -4.767  1.00 1.00 ? 12  ILE A CA   6  
ATOM   6880  C C    . ILE A 1 12 ? 4.394   -4.376  -4.106  1.00 1.00 ? 12  ILE A C    6  
ATOM   6881  O O    . ILE A 1 12 ? 5.403   -4.261  -4.795  1.00 1.00 ? 12  ILE A O    6  
ATOM   6882  C CB   . ILE A 1 12 ? 2.233   -3.221  -4.655  1.00 1.00 ? 12  ILE A CB   6  
ATOM   6883  C CG1  . ILE A 1 12 ? 1.311   -3.063  -5.867  1.00 1.00 ? 12  ILE A CG1  6  
ATOM   6884  C CG2  . ILE A 1 12 ? 3.191   -2.029  -4.580  1.00 1.00 ? 12  ILE A CG2  6  
ATOM   6885  C CD1  . ILE A 1 12 ? 0.194   -4.099  -5.808  1.00 1.00 ? 12  ILE A CD1  6  
ATOM   6886  H H    . ILE A 1 12 ? 1.388   -5.447  -3.781  1.00 1.00 ? 12  ILE A H    6  
ATOM   6887  H HA   . ILE A 1 12 ? 3.172   -4.768  -5.812  1.00 1.00 ? 12  ILE A HA   6  
ATOM   6888  H HB   . ILE A 1 12 ? 1.629   -3.250  -3.753  1.00 1.00 ? 12  ILE A HB   6  
ATOM   6889  H HG12 . ILE A 1 12 ? 0.893   -2.071  -5.868  1.00 1.00 ? 12  ILE A HG12 6  
ATOM   6890  H HG13 . ILE A 1 12 ? 1.890   -3.208  -6.773  1.00 1.00 ? 12  ILE A HG13 6  
ATOM   6891  H HG21 . ILE A 1 12 ? 3.622   -1.984  -3.586  1.00 1.00 ? 12  ILE A HG21 6  
ATOM   6892  H HG22 . ILE A 1 12 ? 2.663   -1.125  -4.789  1.00 1.00 ? 12  ILE A HG22 6  
ATOM   6893  H HG23 . ILE A 1 12 ? 3.979   -2.170  -5.304  1.00 1.00 ? 12  ILE A HG23 6  
ATOM   6894  H HD11 . ILE A 1 12 ? -0.465  -3.861  -4.987  1.00 1.00 ? 12  ILE A HD11 6  
ATOM   6895  H HD12 . ILE A 1 12 ? 0.614   -5.080  -5.664  1.00 1.00 ? 12  ILE A HD12 6  
ATOM   6896  H HD13 . ILE A 1 12 ? -0.361  -4.079  -6.733  1.00 1.00 ? 12  ILE A HD13 6  
ATOM   6897  N N    . VAL A 1 13 ? 4.404   -4.331  -2.786  1.00 1.00 ? 13  VAL A N    6  
ATOM   6898  C CA   . VAL A 1 13 ? 5.643   -4.151  -2.050  1.00 1.00 ? 13  VAL A CA   6  
ATOM   6899  C C    . VAL A 1 13 ? 6.579   -5.330  -2.291  1.00 1.00 ? 13  VAL A C    6  
ATOM   6900  O O    . VAL A 1 13 ? 7.775   -5.163  -2.467  1.00 1.00 ? 13  VAL A O    6  
ATOM   6901  C CB   . VAL A 1 13 ? 5.352   -4.025  -0.551  1.00 1.00 ? 13  VAL A CB   6  
ATOM   6902  C CG1  . VAL A 1 13 ? 6.658   -3.787  0.206   1.00 1.00 ? 13  VAL A CG1  6  
ATOM   6903  C CG2  . VAL A 1 13 ? 4.399   -2.854  -0.314  1.00 1.00 ? 13  VAL A CG2  6  
ATOM   6904  H H    . VAL A 1 13 ? 3.563   -4.407  -2.298  1.00 1.00 ? 13  VAL A H    6  
ATOM   6905  H HA   . VAL A 1 13 ? 6.129   -3.245  -2.386  1.00 1.00 ? 13  VAL A HA   6  
ATOM   6906  H HB   . VAL A 1 13 ? 4.895   -4.940  -0.199  1.00 1.00 ? 13  VAL A HB   6  
ATOM   6907  H HG11 . VAL A 1 13 ? 7.274   -4.672  0.155   1.00 1.00 ? 13  VAL A HG11 6  
ATOM   6908  H HG12 . VAL A 1 13 ? 6.439   -3.561  1.241   1.00 1.00 ? 13  VAL A HG12 6  
ATOM   6909  H HG13 . VAL A 1 13 ? 7.184   -2.954  -0.239  1.00 1.00 ? 13  VAL A HG13 6  
ATOM   6910  H HG21 . VAL A 1 13 ? 4.106   -2.835  0.726   1.00 1.00 ? 13  VAL A HG21 6  
ATOM   6911  H HG22 . VAL A 1 13 ? 3.522   -2.971  -0.932  1.00 1.00 ? 13  VAL A HG22 6  
ATOM   6912  H HG23 . VAL A 1 13 ? 4.897   -1.932  -0.565  1.00 1.00 ? 13  VAL A HG23 6  
ATOM   6913  N N    . LYS A 1 14 ? 6.023   -6.531  -2.284  1.00 1.00 ? 14  LYS A N    6  
ATOM   6914  C CA   . LYS A 1 14 ? 6.819   -7.728  -2.490  1.00 1.00 ? 14  LYS A CA   6  
ATOM   6915  C C    . LYS A 1 14 ? 7.420   -7.750  -3.889  1.00 1.00 ? 14  LYS A C    6  
ATOM   6916  O O    . LYS A 1 14 ? 8.515   -8.266  -4.096  1.00 1.00 ? 14  LYS A O    6  
ATOM   6917  C CB   . LYS A 1 14 ? 5.944   -8.977  -2.301  1.00 1.00 ? 14  LYS A CB   6  
ATOM   6918  C CG   . LYS A 1 14 ? 5.228   -8.897  -0.946  1.00 1.00 ? 14  LYS A CG   6  
ATOM   6919  C CD   . LYS A 1 14 ? 4.945   -10.313 -0.428  1.00 1.00 ? 14  LYS A CD   6  
ATOM   6920  C CE   . LYS A 1 14 ? 6.225   -10.893 0.194   1.00 1.00 ? 14  LYS A CE   6  
ATOM   6921  N NZ   . LYS A 1 14 ? 6.002   -11.120 1.648   1.00 1.00 ? 14  LYS A NZ   6  
ATOM   6922  H H    . LYS A 1 14 ? 5.055   -6.615  -2.131  1.00 1.00 ? 14  LYS A H    6  
ATOM   6923  H HA   . LYS A 1 14 ? 7.614   -7.756  -1.761  1.00 1.00 ? 14  LYS A HA   6  
ATOM   6924  H HB2  . LYS A 1 14 ? 5.211   -9.030  -3.092  1.00 1.00 ? 14  LYS A HB2  6  
ATOM   6925  H HB3  . LYS A 1 14 ? 6.568   -9.863  -2.328  1.00 1.00 ? 14  LYS A HB3  6  
ATOM   6926  H HG2  . LYS A 1 14 ? 5.848   -8.368  -0.235  1.00 1.00 ? 14  LYS A HG2  6  
ATOM   6927  H HG3  . LYS A 1 14 ? 4.303   -8.380  -1.059  1.00 1.00 ? 14  LYS A HG3  6  
ATOM   6928  H HD2  . LYS A 1 14 ? 4.167   -10.278 0.314   1.00 1.00 ? 14  LYS A HD2  6  
ATOM   6929  H HD3  . LYS A 1 14 ? 4.631   -10.940 -1.253  1.00 1.00 ? 14  LYS A HD3  6  
ATOM   6930  H HE2  . LYS A 1 14 ? 6.470   -11.830 -0.283  1.00 1.00 ? 14  LYS A HE2  6  
ATOM   6931  H HE3  . LYS A 1 14 ? 7.049   -10.209 0.067   1.00 1.00 ? 14  LYS A HE3  6  
ATOM   6932  H HZ1  . LYS A 1 14 ? 5.341   -10.407 2.016   1.00 1.00 ? 14  LYS A HZ1  6  
ATOM   6933  H HZ2  . LYS A 1 14 ? 6.909   -11.044 2.152   1.00 1.00 ? 14  LYS A HZ2  6  
ATOM   6934  H HZ3  . LYS A 1 14 ? 5.601   -12.067 1.795   1.00 1.00 ? 14  LYS A HZ3  6  
ATOM   6935  N N    . GLU A 1 15 ? 6.694   -7.186  -4.846  1.00 1.00 ? 15  GLU A N    6  
ATOM   6936  C CA   . GLU A 1 15 ? 7.155   -7.154  -6.227  1.00 1.00 ? 15  GLU A CA   6  
ATOM   6937  C C    . GLU A 1 15 ? 8.270   -6.139  -6.412  1.00 1.00 ? 15  GLU A C    6  
ATOM   6938  O O    . GLU A 1 15 ? 9.046   -6.222  -7.364  1.00 1.00 ? 15  GLU A O    6  
ATOM   6939  C CB   . GLU A 1 15 ? 5.988   -6.817  -7.159  1.00 1.00 ? 15  GLU A CB   6  
ATOM   6940  C CG   . GLU A 1 15 ? 5.029   -8.009  -7.243  1.00 1.00 ? 15  GLU A CG   6  
ATOM   6941  C CD   . GLU A 1 15 ? 5.681   -9.148  -8.020  1.00 1.00 ? 15  GLU A CD   6  
ATOM   6942  O OE1  . GLU A 1 15 ? 6.597   -8.872  -8.779  1.00 1.00 ? 15  GLU A OE1  6  
ATOM   6943  O OE2  . GLU A 1 15 ? 5.252   -10.277 -7.851  1.00 1.00 ? 15  GLU A OE2  6  
ATOM   6944  H H    . GLU A 1 15 ? 5.831   -6.775  -4.618  1.00 1.00 ? 15  GLU A H    6  
ATOM   6945  H HA   . GLU A 1 15 ? 7.528   -8.139  -6.484  1.00 1.00 ? 15  GLU A HA   6  
ATOM   6946  H HB2  . GLU A 1 15 ? 5.460   -5.959  -6.771  1.00 1.00 ? 15  GLU A HB2  6  
ATOM   6947  H HB3  . GLU A 1 15 ? 6.367   -6.596  -8.144  1.00 1.00 ? 15  GLU A HB3  6  
ATOM   6948  H HG2  . GLU A 1 15 ? 4.795   -8.348  -6.247  1.00 1.00 ? 15  GLU A HG2  6  
ATOM   6949  H HG3  . GLU A 1 15 ? 4.122   -7.705  -7.744  1.00 1.00 ? 15  GLU A HG3  6  
ATOM   6950  N N    . LYS A 1 16 ? 8.349   -5.187  -5.492  1.00 1.00 ? 16  LYS A N    6  
ATOM   6951  C CA   . LYS A 1 16 ? 9.380   -4.153  -5.559  1.00 1.00 ? 16  LYS A CA   6  
ATOM   6952  C C    . LYS A 1 16 ? 10.758  -4.772  -5.484  1.00 1.00 ? 16  LYS A C    6  
ATOM   6953  O O    . LYS A 1 16 ? 11.701  -4.289  -6.111  1.00 1.00 ? 16  LYS A O    6  
ATOM   6954  C CB   . LYS A 1 16 ? 9.180   -3.139  -4.425  1.00 1.00 ? 16  LYS A CB   6  
ATOM   6955  C CG   . LYS A 1 16 ? 8.509   -1.876  -4.968  1.00 1.00 ? 16  LYS A CG   6  
ATOM   6956  C CD   . LYS A 1 16 ? 7.104   -2.216  -5.477  1.00 1.00 ? 16  LYS A CD   6  
ATOM   6957  C CE   . LYS A 1 16 ? 6.657   -1.157  -6.488  1.00 1.00 ? 16  LYS A CE   6  
ATOM   6958  N NZ   . LYS A 1 16 ? 7.324   -1.410  -7.797  1.00 1.00 ? 16  LYS A NZ   6  
ATOM   6959  H H    . LYS A 1 16 ? 7.700   -5.174  -4.756  1.00 1.00 ? 16  LYS A H    6  
ATOM   6960  H HA   . LYS A 1 16 ? 9.286   -3.646  -6.515  1.00 1.00 ? 16  LYS A HA   6  
ATOM   6961  H HB2  . LYS A 1 16 ? 8.553   -3.570  -3.672  1.00 1.00 ? 16  LYS A HB2  6  
ATOM   6962  H HB3  . LYS A 1 16 ? 10.127  -2.878  -4.000  1.00 1.00 ? 16  LYS A HB3  6  
ATOM   6963  H HG2  . LYS A 1 16 ? 8.437   -1.148  -4.184  1.00 1.00 ? 16  LYS A HG2  6  
ATOM   6964  H HG3  . LYS A 1 16 ? 9.097   -1.485  -5.780  1.00 1.00 ? 16  LYS A HG3  6  
ATOM   6965  H HD2  . LYS A 1 16 ? 7.102   -3.180  -5.956  1.00 1.00 ? 16  LYS A HD2  6  
ATOM   6966  H HD3  . LYS A 1 16 ? 6.419   -2.224  -4.646  1.00 1.00 ? 16  LYS A HD3  6  
ATOM   6967  H HE2  . LYS A 1 16 ? 5.591   -1.209  -6.615  1.00 1.00 ? 16  LYS A HE2  6  
ATOM   6968  H HE3  . LYS A 1 16 ? 6.933   -0.178  -6.127  1.00 1.00 ? 16  LYS A HE3  6  
ATOM   6969  H HZ1  . LYS A 1 16 ? 6.709   -1.999  -8.392  1.00 1.00 ? 16  LYS A HZ1  6  
ATOM   6970  H HZ2  . LYS A 1 16 ? 8.227   -1.902  -7.637  1.00 1.00 ? 16  LYS A HZ2  6  
ATOM   6971  H HZ3  . LYS A 1 16 ? 7.503   -0.505  -8.275  1.00 1.00 ? 16  LYS A HZ3  6  
ATOM   6972  N N    . LEU A 1 17 ? 10.882  -5.825  -4.696  1.00 1.00 ? 17  LEU A N    6  
ATOM   6973  C CA   . LEU A 1 17 ? 12.164  -6.505  -4.525  1.00 1.00 ? 17  LEU A CA   6  
ATOM   6974  C C    . LEU A 1 17 ? 12.101  -7.896  -5.151  1.00 1.00 ? 17  LEU A C    6  
ATOM   6975  O O    . LEU A 1 17 ? 13.089  -8.634  -5.127  1.00 1.00 ? 17  LEU A O    6  
ATOM   6976  C CB   . LEU A 1 17 ? 12.521  -6.629  -3.041  1.00 1.00 ? 17  LEU A CB   6  
ATOM   6977  C CG   . LEU A 1 17 ? 11.278  -6.336  -2.190  1.00 1.00 ? 17  LEU A CG   6  
ATOM   6978  C CD1  . LEU A 1 17 ? 11.482  -6.889  -0.782  1.00 1.00 ? 17  LEU A CD1  6  
ATOM   6979  C CD2  . LEU A 1 17 ? 11.047  -4.820  -2.126  1.00 1.00 ? 17  LEU A CD2  6  
ATOM   6980  H H    . LEU A 1 17 ? 10.099  -6.154  -4.200  1.00 1.00 ? 17  LEU A H    6  
ATOM   6981  H HA   . LEU A 1 17 ? 12.937  -5.940  -5.030  1.00 1.00 ? 17  LEU A HA   6  
ATOM   6982  H HB2  . LEU A 1 17 ? 12.882  -7.618  -2.830  1.00 1.00 ? 17  LEU A HB2  6  
ATOM   6983  H HB3  . LEU A 1 17 ? 13.293  -5.907  -2.799  1.00 1.00 ? 17  LEU A HB3  6  
ATOM   6984  H HG   . LEU A 1 17 ? 10.415  -6.814  -2.634  1.00 1.00 ? 17  LEU A HG   6  
ATOM   6985  H HD11 . LEU A 1 17 ? 11.806  -7.912  -0.844  1.00 1.00 ? 17  LEU A HD11 6  
ATOM   6986  H HD12 . LEU A 1 17 ? 10.554  -6.830  -0.239  1.00 1.00 ? 17  LEU A HD12 6  
ATOM   6987  H HD13 . LEU A 1 17 ? 12.235  -6.299  -0.277  1.00 1.00 ? 17  LEU A HD13 6  
ATOM   6988  H HD21 . LEU A 1 17 ? 11.528  -4.338  -2.963  1.00 1.00 ? 17  LEU A HD21 6  
ATOM   6989  H HD22 . LEU A 1 17 ? 11.461  -4.427  -1.209  1.00 1.00 ? 17  LEU A HD22 6  
ATOM   6990  H HD23 . LEU A 1 17 ? 9.990   -4.619  -2.157  1.00 1.00 ? 17  LEU A HD23 6  
ATOM   6991  N N    . ALA A 1 18 ? 10.945  -8.250  -5.696  1.00 1.00 ? 18  ALA A N    6  
ATOM   6992  C CA   . ALA A 1 18 ? 10.773  -9.553  -6.320  1.00 1.00 ? 18  ALA A CA   6  
ATOM   6993  C C    . ALA A 1 18 ? 10.502  -10.627 -5.281  1.00 1.00 ? 18  ALA A C    6  
ATOM   6994  O O    . ALA A 1 18 ? 11.189  -11.653 -5.239  1.00 1.00 ? 18  ALA A O    6  
ATOM   6995  C CB   . ALA A 1 18 ? 12.027  -9.919  -7.127  1.00 1.00 ? 18  ALA A CB   6  
ATOM   6996  H H    . ALA A 1 18 ? 10.192  -7.623  -5.673  1.00 1.00 ? 18  ALA A H    6  
ATOM   6997  H HA   . ALA A 1 18 ? 9.928   -9.506  -6.994  1.00 1.00 ? 18  ALA A HA   6  
ATOM   6998  H HB1  . ALA A 1 18 ? 12.483  -9.013  -7.501  1.00 1.00 ? 18  ALA A HB1  6  
ATOM   6999  H HB2  . ALA A 1 18 ? 11.758  -10.556 -7.952  1.00 1.00 ? 18  ALA A HB2  6  
ATOM   7000  H HB3  . ALA A 1 18 ? 12.731  -10.433 -6.490  1.00 1.00 ? 18  ALA A HB3  6  
ATOM   7001  N N    . LEU A 1 19 ? 9.509   -10.395 -4.436  1.00 1.00 ? 19  LEU A N    6  
ATOM   7002  C CA   . LEU A 1 19 ? 9.153   -11.355 -3.395  1.00 1.00 ? 19  LEU A CA   6  
ATOM   7003  C C    . LEU A 1 19 ? 7.775   -11.947 -3.673  1.00 1.00 ? 19  LEU A C    6  
ATOM   7004  O O    . LEU A 1 19 ? 7.217   -11.780 -4.752  1.00 1.00 ? 19  LEU A O    6  
ATOM   7005  C CB   . LEU A 1 19 ? 9.159   -10.676 -2.026  1.00 1.00 ? 19  LEU A CB   6  
ATOM   7006  C CG   . LEU A 1 19 ? 10.541  -10.825 -1.383  1.00 1.00 ? 19  LEU A CG   6  
ATOM   7007  C CD1  . LEU A 1 19 ? 11.599  -10.204 -2.299  1.00 1.00 ? 19  LEU A CD1  6  
ATOM   7008  C CD2  . LEU A 1 19 ? 10.553  -10.120 -0.027  1.00 1.00 ? 19  LEU A CD2  6  
ATOM   7009  H H    . LEU A 1 19 ? 9.002   -9.556  -4.509  1.00 1.00 ? 19  LEU A H    6  
ATOM   7010  H HA   . LEU A 1 19 ? 9.872   -12.160 -3.390  1.00 1.00 ? 19  LEU A HA   6  
ATOM   7011  H HB2  . LEU A 1 19 ? 8.936   -9.625  -2.154  1.00 1.00 ? 19  LEU A HB2  6  
ATOM   7012  H HB3  . LEU A 1 19 ? 8.426   -11.127 -1.387  1.00 1.00 ? 19  LEU A HB3  6  
ATOM   7013  H HG   . LEU A 1 19 ? 10.756  -11.878 -1.248  1.00 1.00 ? 19  LEU A HG   6  
ATOM   7014  H HD11 . LEU A 1 19 ? 11.852  -10.899 -3.085  1.00 1.00 ? 19  LEU A HD11 6  
ATOM   7015  H HD12 . LEU A 1 19 ? 12.486  -9.978  -1.724  1.00 1.00 ? 19  LEU A HD12 6  
ATOM   7016  H HD13 . LEU A 1 19 ? 11.212  -9.293  -2.732  1.00 1.00 ? 19  LEU A HD13 6  
ATOM   7017  H HD21 . LEU A 1 19 ? 10.055  -10.737 0.702   1.00 1.00 ? 19  LEU A HD21 6  
ATOM   7018  H HD22 . LEU A 1 19 ? 10.040  -9.175  -0.109  1.00 1.00 ? 19  LEU A HD22 6  
ATOM   7019  H HD23 . LEU A 1 19 ? 11.575  -9.954  0.279   1.00 1.00 ? 19  LEU A HD23 6  
ATOM   7020  N N    . GLY A 1 20 ? 7.222   -12.637 -2.674  1.00 1.00 ? 20  GLY A N    6  
ATOM   7021  C CA   . GLY A 1 20 ? 5.906   -13.243 -2.809  1.00 1.00 ? 20  GLY A CA   6  
ATOM   7022  C C    . GLY A 1 20 ? 6.023   -14.712 -3.186  1.00 1.00 ? 20  GLY A C    6  
ATOM   7023  O O    . GLY A 1 20 ? 5.018   -15.391 -3.398  1.00 1.00 ? 20  GLY A O    6  
ATOM   7024  H H    . GLY A 1 20 ? 7.712   -12.732 -1.827  1.00 1.00 ? 20  GLY A H    6  
ATOM   7025  H HA2  . GLY A 1 20 ? 5.376   -13.155 -1.870  1.00 1.00 ? 20  GLY A HA2  6  
ATOM   7026  H HA3  . GLY A 1 20 ? 5.351   -12.724 -3.575  1.00 1.00 ? 20  GLY A HA3  6  
ATOM   7027  N N    . ALA A 1 21 ? 7.257   -15.201 -3.270  1.00 1.00 ? 21  ALA A N    6  
ATOM   7028  C CA   . ALA A 1 21 ? 7.492   -16.597 -3.624  1.00 1.00 ? 21  ALA A CA   6  
ATOM   7029  C C    . ALA A 1 21 ? 7.413   -17.481 -2.388  1.00 1.00 ? 21  ALA A C    6  
ATOM   7030  O O    . ALA A 1 21 ? 6.398   -18.132 -2.138  1.00 1.00 ? 21  ALA A O    6  
ATOM   7031  C CB   . ALA A 1 21 ? 8.869   -16.746 -4.271  1.00 1.00 ? 21  ALA A CB   6  
ATOM   7032  H H    . ALA A 1 21 ? 8.021   -14.616 -3.090  1.00 1.00 ? 21  ALA A H    6  
ATOM   7033  H HA   . ALA A 1 21 ? 6.739   -16.915 -4.329  1.00 1.00 ? 21  ALA A HA   6  
ATOM   7034  H HB1  . ALA A 1 21 ? 9.615   -16.276 -3.644  1.00 1.00 ? 21  ALA A HB1  6  
ATOM   7035  H HB2  . ALA A 1 21 ? 8.864   -16.271 -5.241  1.00 1.00 ? 21  ALA A HB2  6  
ATOM   7036  H HB3  . ALA A 1 21 ? 9.104   -17.793 -4.383  1.00 1.00 ? 21  ALA A HB3  6  
ATOM   7037  N N    . ASP A 1 22 ? 8.492   -17.504 -1.608  1.00 1.00 ? 22  ASP A N    6  
ATOM   7038  C CA   . ASP A 1 22 ? 8.532   -18.310 -0.393  1.00 1.00 ? 22  ASP A CA   6  
ATOM   7039  C C    . ASP A 1 22 ? 8.326   -17.438 0.836   1.00 1.00 ? 22  ASP A C    6  
ATOM   7040  O O    . ASP A 1 22 ? 8.348   -17.924 1.969   1.00 1.00 ? 22  ASP A O    6  
ATOM   7041  C CB   . ASP A 1 22 ? 9.876   -19.033 -0.289  1.00 1.00 ? 22  ASP A CB   6  
ATOM   7042  C CG   . ASP A 1 22 ? 9.967   -20.118 -1.357  1.00 1.00 ? 22  ASP A CG   6  
ATOM   7043  O OD1  . ASP A 1 22 ? 8.946   -20.423 -1.952  1.00 1.00 ? 22  ASP A OD1  6  
ATOM   7044  O OD2  . ASP A 1 22 ? 11.054  -20.632 -1.561  1.00 1.00 ? 22  ASP A OD2  6  
ATOM   7045  H H    . ASP A 1 22 ? 9.273   -16.966 -1.852  1.00 1.00 ? 22  ASP A H    6  
ATOM   7046  H HA   . ASP A 1 22 ? 7.745   -19.046 -0.429  1.00 1.00 ? 22  ASP A HA   6  
ATOM   7047  H HB2  . ASP A 1 22 ? 10.676  -18.321 -0.434  1.00 1.00 ? 22  ASP A HB2  6  
ATOM   7048  H HB3  . ASP A 1 22 ? 9.968   -19.483 0.688   1.00 1.00 ? 22  ASP A HB3  6  
ATOM   7049  N N    . VAL A 1 23 ? 8.131   -16.141 0.613   1.00 1.00 ? 23  VAL A N    6  
ATOM   7050  C CA   . VAL A 1 23 ? 7.932   -15.204 1.714   1.00 1.00 ? 23  VAL A CA   6  
ATOM   7051  C C    . VAL A 1 23 ? 6.447   -15.061 2.029   1.00 1.00 ? 23  VAL A C    6  
ATOM   7052  O O    . VAL A 1 23 ? 5.623   -14.902 1.130   1.00 1.00 ? 23  VAL A O    6  
ATOM   7053  C CB   . VAL A 1 23 ? 8.514   -13.838 1.349   1.00 1.00 ? 23  VAL A CB   6  
ATOM   7054  C CG1  . VAL A 1 23 ? 8.382   -12.891 2.544   1.00 1.00 ? 23  VAL A CG1  6  
ATOM   7055  C CG2  . VAL A 1 23 ? 9.989   -13.993 0.979   1.00 1.00 ? 23  VAL A CG2  6  
ATOM   7056  H H    . VAL A 1 23 ? 8.127   -15.807 -0.308  1.00 1.00 ? 23  VAL A H    6  
ATOM   7057  H HA   . VAL A 1 23 ? 8.442   -15.574 2.592   1.00 1.00 ? 23  VAL A HA   6  
ATOM   7058  H HB   . VAL A 1 23 ? 7.970   -13.430 0.508   1.00 1.00 ? 23  VAL A HB   6  
ATOM   7059  H HG11 . VAL A 1 23 ? 8.892   -13.318 3.397   1.00 1.00 ? 23  VAL A HG11 6  
ATOM   7060  H HG12 . VAL A 1 23 ? 7.339   -12.753 2.784   1.00 1.00 ? 23  VAL A HG12 6  
ATOM   7061  H HG13 . VAL A 1 23 ? 8.825   -11.938 2.299   1.00 1.00 ? 23  VAL A HG13 6  
ATOM   7062  H HG21 . VAL A 1 23 ? 10.445  -13.019 0.903   1.00 1.00 ? 23  VAL A HG21 6  
ATOM   7063  H HG22 . VAL A 1 23 ? 10.069  -14.504 0.031   1.00 1.00 ? 23  VAL A HG22 6  
ATOM   7064  H HG23 . VAL A 1 23 ? 10.492  -14.567 1.742   1.00 1.00 ? 23  VAL A HG23 6  
ATOM   7065  N N    . VAL A 1 24 ? 6.111   -15.120 3.314   1.00 1.00 ? 24  VAL A N    6  
ATOM   7066  C CA   . VAL A 1 24 ? 4.723   -14.998 3.736   1.00 1.00 ? 24  VAL A CA   6  
ATOM   7067  C C    . VAL A 1 24 ? 4.258   -13.554 3.639   1.00 1.00 ? 24  VAL A C    6  
ATOM   7068  O O    . VAL A 1 24 ? 5.067   -12.623 3.683   1.00 1.00 ? 24  VAL A O    6  
ATOM   7069  C CB   . VAL A 1 24 ? 4.574   -15.483 5.181   1.00 1.00 ? 24  VAL A CB   6  
ATOM   7070  C CG1  . VAL A 1 24 ? 5.228   -16.858 5.326   1.00 1.00 ? 24  VAL A CG1  6  
ATOM   7071  C CG2  . VAL A 1 24 ? 5.253   -14.493 6.131   1.00 1.00 ? 24  VAL A CG2  6  
ATOM   7072  H H    . VAL A 1 24 ? 6.803   -15.247 3.992   1.00 1.00 ? 24  VAL A H    6  
ATOM   7073  H HA   . VAL A 1 24 ? 4.105   -15.608 3.098   1.00 1.00 ? 24  VAL A HA   6  
ATOM   7074  H HB   . VAL A 1 24 ? 3.532   -15.558 5.425   1.00 1.00 ? 24  VAL A HB   6  
ATOM   7075  H HG11 . VAL A 1 24 ? 4.935   -17.300 6.268   1.00 1.00 ? 24  VAL A HG11 6  
ATOM   7076  H HG12 . VAL A 1 24 ? 6.304   -16.749 5.300   1.00 1.00 ? 24  VAL A HG12 6  
ATOM   7077  H HG13 . VAL A 1 24 ? 4.912   -17.497 4.515   1.00 1.00 ? 24  VAL A HG13 6  
ATOM   7078  H HG21 . VAL A 1 24 ? 4.653   -13.595 6.200   1.00 1.00 ? 24  VAL A HG21 6  
ATOM   7079  H HG22 . VAL A 1 24 ? 6.232   -14.244 5.747   1.00 1.00 ? 24  VAL A HG22 6  
ATOM   7080  H HG23 . VAL A 1 24 ? 5.349   -14.938 7.108   1.00 1.00 ? 24  VAL A HG23 6  
ATOM   7081  N N    . VAL A 1 25 ? 2.948   -13.362 3.509   1.00 1.00 ? 25  VAL A N    6  
ATOM   7082  C CA   . VAL A 1 25 ? 2.386   -12.017 3.408   1.00 1.00 ? 25  VAL A CA   6  
ATOM   7083  C C    . VAL A 1 25 ? 1.576   -11.690 4.654   1.00 1.00 ? 25  VAL A C    6  
ATOM   7084  O O    . VAL A 1 25 ? 0.711   -12.462 5.074   1.00 1.00 ? 25  VAL A O    6  
ATOM   7085  C CB   . VAL A 1 25 ? 1.486   -11.919 2.176   1.00 1.00 ? 25  VAL A CB   6  
ATOM   7086  C CG1  . VAL A 1 25 ? 0.388   -12.981 2.256   1.00 1.00 ? 25  VAL A CG1  6  
ATOM   7087  C CG2  . VAL A 1 25 ? 0.848   -10.529 2.123   1.00 1.00 ? 25  VAL A CG2  6  
ATOM   7088  H H    . VAL A 1 25 ? 2.351   -14.137 3.480   1.00 1.00 ? 25  VAL A H    6  
ATOM   7089  H HA   . VAL A 1 25 ? 3.182   -11.295 3.312   1.00 1.00 ? 25  VAL A HA   6  
ATOM   7090  H HB   . VAL A 1 25 ? 2.078   -12.081 1.286   1.00 1.00 ? 25  VAL A HB   6  
ATOM   7091  H HG11 . VAL A 1 25 ? -0.094  -13.075 1.294   1.00 1.00 ? 25  VAL A HG11 6  
ATOM   7092  H HG12 . VAL A 1 25 ? -0.343  -12.690 2.995   1.00 1.00 ? 25  VAL A HG12 6  
ATOM   7093  H HG13 . VAL A 1 25 ? 0.822   -13.929 2.535   1.00 1.00 ? 25  VAL A HG13 6  
ATOM   7094  H HG21 . VAL A 1 25 ? 0.386   -10.385 1.158   1.00 1.00 ? 25  VAL A HG21 6  
ATOM   7095  H HG22 . VAL A 1 25 ? 1.608   -9.778  2.277   1.00 1.00 ? 25  VAL A HG22 6  
ATOM   7096  H HG23 . VAL A 1 25 ? 0.098   -10.447 2.895   1.00 1.00 ? 25  VAL A HG23 6  
ATOM   7097  N N    . THR A 1 26 ? 1.857   -10.533 5.252   1.00 1.00 ? 26  THR A N    6  
ATOM   7098  C CA   . THR A 1 26 ? 1.147   -10.107 6.454   1.00 1.00 ? 26  THR A CA   6  
ATOM   7099  C C    . THR A 1 26 ? 0.647   -8.677  6.301   1.00 1.00 ? 26  THR A C    6  
ATOM   7100  O O    . THR A 1 26 ? 1.219   -7.882  5.557   1.00 1.00 ? 26  THR A O    6  
ATOM   7101  C CB   . THR A 1 26 ? 2.078   -10.202 7.667   1.00 1.00 ? 26  THR A CB   6  
ATOM   7102  O OG1  . THR A 1 26 ? 3.384   -9.796  7.289   1.00 1.00 ? 26  THR A OG1  6  
ATOM   7103  C CG2  . THR A 1 26 ? 2.117   -11.643 8.177   1.00 1.00 ? 26  THR A CG2  6  
ATOM   7104  H H    . THR A 1 26 ? 2.554   -9.952  4.879   1.00 1.00 ? 26  THR A H    6  
ATOM   7105  H HA   . THR A 1 26 ? 0.297   -10.756 6.618   1.00 1.00 ? 26  THR A HA   6  
ATOM   7106  H HB   . THR A 1 26 ? 1.715   -9.556  8.454   1.00 1.00 ? 26  THR A HB   6  
ATOM   7107  H HG1  . THR A 1 26 ? 4.011   -10.231 7.874   1.00 1.00 ? 26  THR A HG1  6  
ATOM   7108  H HG21 . THR A 1 26 ? 2.795   -11.711 9.011   1.00 1.00 ? 26  THR A HG21 6  
ATOM   7109  H HG22 . THR A 1 26 ? 2.452   -12.294 7.383   1.00 1.00 ? 26  THR A HG22 6  
ATOM   7110  H HG23 . THR A 1 26 ? 1.126   -11.937 8.489   1.00 1.00 ? 26  THR A HG23 6  
ATOM   7111  N N    . ALA A 1 27 ? -0.426  -8.352  7.016   1.00 1.00 ? 27  ALA A N    6  
ATOM   7112  C CA   . ALA A 1 27 ? -0.993  -7.013  6.955   1.00 1.00 ? 27  ALA A CA   6  
ATOM   7113  C C    . ALA A 1 27 ? -0.340  -6.100  7.987   1.00 1.00 ? 27  ALA A C    6  
ATOM   7114  O O    . ALA A 1 27 ? -0.174  -4.904  7.753   1.00 1.00 ? 27  ALA A O    6  
ATOM   7115  C CB   . ALA A 1 27 ? -2.506  -7.077  7.211   1.00 1.00 ? 27  ALA A CB   6  
ATOM   7116  H H    . ALA A 1 27 ? -0.839  -9.022  7.596   1.00 1.00 ? 27  ALA A H    6  
ATOM   7117  H HA   . ALA A 1 27 ? -0.826  -6.603  5.968   1.00 1.00 ? 27  ALA A HA   6  
ATOM   7118  H HB1  . ALA A 1 27 ? -3.008  -6.337  6.604   1.00 1.00 ? 27  ALA A HB1  6  
ATOM   7119  H HB2  . ALA A 1 27 ? -2.710  -6.884  8.254   1.00 1.00 ? 27  ALA A HB2  6  
ATOM   7120  H HB3  . ALA A 1 27 ? -2.871  -8.062  6.959   1.00 1.00 ? 27  ALA A HB3  6  
ATOM   7121  N N    . ASP A 1 28 ? 0.012   -6.672  9.134   1.00 1.00 ? 28  ASP A N    6  
ATOM   7122  C CA   . ASP A 1 28 ? 0.627   -5.897  10.203  1.00 1.00 ? 28  ASP A CA   6  
ATOM   7123  C C    . ASP A 1 28 ? 2.082   -5.594  9.878   1.00 1.00 ? 28  ASP A C    6  
ATOM   7124  O O    . ASP A 1 28 ? 2.757   -4.874  10.614  1.00 1.00 ? 28  ASP A O    6  
ATOM   7125  C CB   . ASP A 1 28 ? 0.545   -6.668  11.522  1.00 1.00 ? 28  ASP A CB   6  
ATOM   7126  C CG   . ASP A 1 28 ? 1.256   -8.010  11.383  1.00 1.00 ? 28  ASP A CG   6  
ATOM   7127  O OD1  . ASP A 1 28 ? 1.930   -8.199  10.383  1.00 1.00 ? 28  ASP A OD1  6  
ATOM   7128  O OD2  . ASP A 1 28 ? 1.124   -8.824  12.281  1.00 1.00 ? 28  ASP A OD2  6  
ATOM   7129  H H    . ASP A 1 28 ? -0.150  -7.628  9.264   1.00 1.00 ? 28  ASP A H    6  
ATOM   7130  H HA   . ASP A 1 28 ? 0.089   -4.963  10.306  1.00 1.00 ? 28  ASP A HA   6  
ATOM   7131  H HB2  . ASP A 1 28 ? 1.012   -6.092  12.305  1.00 1.00 ? 28  ASP A HB2  6  
ATOM   7132  H HB3  . ASP A 1 28 ? -0.492  -6.842  11.773  1.00 1.00 ? 28  ASP A HB3  6  
ATOM   7133  N N    . SER A 1 29 ? 2.563   -6.148  8.769   1.00 1.00 ? 29  SER A N    6  
ATOM   7134  C CA   . SER A 1 29 ? 3.943   -5.927  8.355   1.00 1.00 ? 29  SER A CA   6  
ATOM   7135  C C    . SER A 1 29 ? 4.081   -4.572  7.667   1.00 1.00 ? 29  SER A C    6  
ATOM   7136  O O    . SER A 1 29 ? 3.783   -4.435  6.479   1.00 1.00 ? 29  SER A O    6  
ATOM   7137  C CB   . SER A 1 29 ? 4.383   -7.035  7.396   1.00 1.00 ? 29  SER A CB   6  
ATOM   7138  O OG   . SER A 1 29 ? 4.798   -8.166  8.148   1.00 1.00 ? 29  SER A OG   6  
ATOM   7139  H H    . SER A 1 29 ? 1.978   -6.714  8.218   1.00 1.00 ? 29  SER A H    6  
ATOM   7140  H HA   . SER A 1 29 ? 4.576   -5.944  9.225   1.00 1.00 ? 29  SER A HA   6  
ATOM   7141  H HB2  . SER A 1 29 ? 3.558   -7.313  6.761   1.00 1.00 ? 29  SER A HB2  6  
ATOM   7142  H HB3  . SER A 1 29 ? 5.202   -6.681  6.781   1.00 1.00 ? 29  SER A HB3  6  
ATOM   7143  H HG   . SER A 1 29 ? 4.698   -7.960  9.076   1.00 1.00 ? 29  SER A HG   6  
ATOM   7144  N N    . GLU A 1 30 ? 4.538   -3.577  8.417   1.00 1.00 ? 30  GLU A N    6  
ATOM   7145  C CA   . GLU A 1 30 ? 4.711   -2.235  7.870   1.00 1.00 ? 30  GLU A CA   6  
ATOM   7146  C C    . GLU A 1 30 ? 5.297   -2.301  6.461   1.00 1.00 ? 30  GLU A C    6  
ATOM   7147  O O    . GLU A 1 30 ? 5.961   -3.273  6.101   1.00 1.00 ? 30  GLU A O    6  
ATOM   7148  C CB   . GLU A 1 30 ? 5.642   -1.424  8.771   1.00 1.00 ? 30  GLU A CB   6  
ATOM   7149  C CG   . GLU A 1 30 ? 5.016   -1.286  10.160  1.00 1.00 ? 30  GLU A CG   6  
ATOM   7150  C CD   . GLU A 1 30 ? 5.985   -0.580  11.103  1.00 1.00 ? 30  GLU A CD   6  
ATOM   7151  O OE1  . GLU A 1 30 ? 7.057   -0.211  10.651  1.00 1.00 ? 30  GLU A OE1  6  
ATOM   7152  O OE2  . GLU A 1 30 ? 5.642   -0.416  12.261  1.00 1.00 ? 30  GLU A OE2  6  
ATOM   7153  H H    . GLU A 1 30 ? 4.761   -3.745  9.357   1.00 1.00 ? 30  GLU A H    6  
ATOM   7154  H HA   . GLU A 1 30 ? 3.749   -1.749  7.828   1.00 1.00 ? 30  GLU A HA   6  
ATOM   7155  H HB2  . GLU A 1 30 ? 6.595   -1.921  8.851   1.00 1.00 ? 30  GLU A HB2  6  
ATOM   7156  H HB3  . GLU A 1 30 ? 5.780   -0.440  8.348   1.00 1.00 ? 30  GLU A HB3  6  
ATOM   7157  H HG2  . GLU A 1 30 ? 4.106   -0.715  10.090  1.00 1.00 ? 30  GLU A HG2  6  
ATOM   7158  H HG3  . GLU A 1 30 ? 4.794   -2.270  10.550  1.00 1.00 ? 30  GLU A HG3  6  
ATOM   7159  N N    . PHE A 1 31 ? 5.044   -1.264  5.674   1.00 1.00 ? 31  PHE A N    6  
ATOM   7160  C CA   . PHE A 1 31 ? 5.551   -1.217  4.307   1.00 1.00 ? 31  PHE A CA   6  
ATOM   7161  C C    . PHE A 1 31 ? 7.066   -1.347  4.296   1.00 1.00 ? 31  PHE A C    6  
ATOM   7162  O O    . PHE A 1 31 ? 7.634   -2.044  3.452   1.00 1.00 ? 31  PHE A O    6  
ATOM   7163  C CB   . PHE A 1 31 ? 5.143   0.103   3.645   1.00 1.00 ? 31  PHE A CB   6  
ATOM   7164  C CG   . PHE A 1 31 ? 3.707   0.019   3.186   1.00 1.00 ? 31  PHE A CG   6  
ATOM   7165  C CD1  . PHE A 1 31 ? 2.668   0.294   4.077   1.00 1.00 ? 31  PHE A CD1  6  
ATOM   7166  C CD2  . PHE A 1 31 ? 3.420   -0.341  1.863   1.00 1.00 ? 31  PHE A CD2  6  
ATOM   7167  C CE1  . PHE A 1 31 ? 1.338   0.210   3.650   1.00 1.00 ? 31  PHE A CE1  6  
ATOM   7168  C CE2  . PHE A 1 31 ? 2.091   -0.424  1.433   1.00 1.00 ? 31  PHE A CE2  6  
ATOM   7169  C CZ   . PHE A 1 31 ? 1.049   -0.149  2.326   1.00 1.00 ? 31  PHE A CZ   6  
ATOM   7170  H H    . PHE A 1 31 ? 4.506   -0.519  6.015   1.00 1.00 ? 31  PHE A H    6  
ATOM   7171  H HA   . PHE A 1 31 ? 5.125   -2.036  3.746   1.00 1.00 ? 31  PHE A HA   6  
ATOM   7172  H HB2  . PHE A 1 31 ? 5.240   0.904   4.360   1.00 1.00 ? 31  PHE A HB2  6  
ATOM   7173  H HB3  . PHE A 1 31 ? 5.777   0.294   2.796   1.00 1.00 ? 31  PHE A HB3  6  
ATOM   7174  H HD1  . PHE A 1 31 ? 2.887   0.570   5.097   1.00 1.00 ? 31  PHE A HD1  6  
ATOM   7175  H HD2  . PHE A 1 31 ? 4.224   -0.552  1.175   1.00 1.00 ? 31  PHE A HD2  6  
ATOM   7176  H HE1  . PHE A 1 31 ? 0.537   0.427   4.340   1.00 1.00 ? 31  PHE A HE1  6  
ATOM   7177  H HE2  . PHE A 1 31 ? 1.868   -0.700  0.413   1.00 1.00 ? 31  PHE A HE2  6  
ATOM   7178  H HZ   . PHE A 1 31 ? 0.028   -0.213  1.994   1.00 1.00 ? 31  PHE A HZ   6  
ATOM   7179  N N    . SER A 1 32 ? 7.723   -0.669  5.232   1.00 1.00 ? 32  SER A N    6  
ATOM   7180  C CA   . SER A 1 32 ? 9.181   -0.719  5.318   1.00 1.00 ? 32  SER A CA   6  
ATOM   7181  C C    . SER A 1 32 ? 9.624   -0.843  6.772   1.00 1.00 ? 32  SER A C    6  
ATOM   7182  O O    . SER A 1 32 ? 10.056  0.133   7.384   1.00 1.00 ? 32  SER A O    6  
ATOM   7183  C CB   . SER A 1 32 ? 9.781   0.547   4.707   1.00 1.00 ? 32  SER A CB   6  
ATOM   7184  O OG   . SER A 1 32 ? 9.544   0.551   3.304   1.00 1.00 ? 32  SER A OG   6  
ATOM   7185  H H    . SER A 1 32 ? 7.221   -0.128  5.875   1.00 1.00 ? 32  SER A H    6  
ATOM   7186  H HA   . SER A 1 32 ? 9.542   -1.576  4.769   1.00 1.00 ? 32  SER A HA   6  
ATOM   7187  H HB2  . SER A 1 32 ? 9.322   1.417   5.146   1.00 1.00 ? 32  SER A HB2  6  
ATOM   7188  H HB3  . SER A 1 32 ? 10.845  0.568   4.901   1.00 1.00 ? 32  SER A HB3  6  
ATOM   7189  H HG   . SER A 1 32 ? 9.146   -0.289  3.069   1.00 1.00 ? 32  SER A HG   6  
ATOM   7190  N N    . LYS A 1 33 ? 9.519   -2.050  7.316   1.00 1.00 ? 33  LYS A N    6  
ATOM   7191  C CA   . LYS A 1 33 ? 9.916   -2.294  8.699   1.00 1.00 ? 33  LYS A CA   6  
ATOM   7192  C C    . LYS A 1 33 ? 11.403  -2.018  8.883   1.00 1.00 ? 33  LYS A C    6  
ATOM   7193  O O    . LYS A 1 33 ? 11.814  -1.404  9.870   1.00 1.00 ? 33  LYS A O    6  
ATOM   7194  C CB   . LYS A 1 33 ? 9.611   -3.742  9.084   1.00 1.00 ? 33  LYS A CB   6  
ATOM   7195  C CG   . LYS A 1 33 ? 9.918   -3.951  10.567  1.00 1.00 ? 33  LYS A CG   6  
ATOM   7196  C CD   . LYS A 1 33 ? 9.525   -5.372  10.975  1.00 1.00 ? 33  LYS A CD   6  
ATOM   7197  C CE   . LYS A 1 33 ? 9.802   -5.570  12.467  1.00 1.00 ? 33  LYS A CE   6  
ATOM   7198  N NZ   . LYS A 1 33 ? 11.269  -5.520  12.714  1.00 1.00 ? 33  LYS A NZ   6  
ATOM   7199  H H    . LYS A 1 33 ? 9.169   -2.793  6.779   1.00 1.00 ? 33  LYS A H    6  
ATOM   7200  H HA   . LYS A 1 33 ? 9.354   -1.634  9.343   1.00 1.00 ? 33  LYS A HA   6  
ATOM   7201  H HB2  . LYS A 1 33 ? 8.564   -3.949  8.901   1.00 1.00 ? 33  LYS A HB2  6  
ATOM   7202  H HB3  . LYS A 1 33 ? 10.217  -4.408  8.492   1.00 1.00 ? 33  LYS A HB3  6  
ATOM   7203  H HG2  . LYS A 1 33 ? 10.976  -3.807  10.737  1.00 1.00 ? 33  LYS A HG2  6  
ATOM   7204  H HG3  . LYS A 1 33 ? 9.359   -3.242  11.157  1.00 1.00 ? 33  LYS A HG3  6  
ATOM   7205  H HD2  . LYS A 1 33 ? 8.475   -5.526  10.776  1.00 1.00 ? 33  LYS A HD2  6  
ATOM   7206  H HD3  . LYS A 1 33 ? 10.107  -6.083  10.406  1.00 1.00 ? 33  LYS A HD3  6  
ATOM   7207  H HE2  . LYS A 1 33 ? 9.315   -4.787  13.028  1.00 1.00 ? 33  LYS A HE2  6  
ATOM   7208  H HE3  . LYS A 1 33 ? 9.414   -6.531  12.779  1.00 1.00 ? 33  LYS A HE3  6  
ATOM   7209  H HZ1  . LYS A 1 33 ? 11.716  -4.889  12.019  1.00 1.00 ? 33  LYS A HZ1  6  
ATOM   7210  H HZ2  . LYS A 1 33 ? 11.667  -6.478  12.623  1.00 1.00 ? 33  LYS A HZ2  6  
ATOM   7211  H HZ3  . LYS A 1 33 ? 11.448  -5.160  13.671  1.00 1.00 ? 33  LYS A HZ3  6  
ATOM   7212  N N    . LEU A 1 34 ? 12.208  -2.479  7.933   1.00 1.00 ? 34  LEU A N    6  
ATOM   7213  C CA   . LEU A 1 34 ? 13.651  -2.280  8.005   1.00 1.00 ? 34  LEU A CA   6  
ATOM   7214  C C    . LEU A 1 34 ? 13.987  -0.794  7.965   1.00 1.00 ? 34  LEU A C    6  
ATOM   7215  O O    . LEU A 1 34 ? 14.842  -0.320  8.713   1.00 1.00 ? 34  LEU A O    6  
ATOM   7216  C CB   . LEU A 1 34 ? 14.329  -2.986  6.831   1.00 1.00 ? 34  LEU A CB   6  
ATOM   7217  C CG   . LEU A 1 34 ? 14.175  -4.501  6.989   1.00 1.00 ? 34  LEU A CG   6  
ATOM   7218  C CD1  . LEU A 1 34 ? 14.643  -5.199  5.708   1.00 1.00 ? 34  LEU A CD1  6  
ATOM   7219  C CD2  . LEU A 1 34 ? 15.017  -4.986  8.174   1.00 1.00 ? 34  LEU A CD2  6  
ATOM   7220  H H    . LEU A 1 34 ? 11.826  -2.965  7.172   1.00 1.00 ? 34  LEU A H    6  
ATOM   7221  H HA   . LEU A 1 34 ? 14.018  -2.692  8.929   1.00 1.00 ? 34  LEU A HA   6  
ATOM   7222  H HB2  . LEU A 1 34 ? 13.878  -2.671  5.906   1.00 1.00 ? 34  LEU A HB2  6  
ATOM   7223  H HB3  . LEU A 1 34 ? 15.382  -2.734  6.818   1.00 1.00 ? 34  LEU A HB3  6  
ATOM   7224  H HG   . LEU A 1 34 ? 13.134  -4.737  7.165   1.00 1.00 ? 34  LEU A HG   6  
ATOM   7225  H HD11 . LEU A 1 34 ? 14.176  -4.738  4.854   1.00 1.00 ? 34  LEU A HD11 6  
ATOM   7226  H HD12 . LEU A 1 34 ? 14.371  -6.245  5.751   1.00 1.00 ? 34  LEU A HD12 6  
ATOM   7227  H HD13 . LEU A 1 34 ? 15.717  -5.111  5.627   1.00 1.00 ? 34  LEU A HD13 6  
ATOM   7228  H HD21 . LEU A 1 34 ? 15.909  -4.385  8.262   1.00 1.00 ? 34  LEU A HD21 6  
ATOM   7229  H HD22 . LEU A 1 34 ? 15.298  -6.018  8.023   1.00 1.00 ? 34  LEU A HD22 6  
ATOM   7230  H HD23 . LEU A 1 34 ? 14.439  -4.907  9.082   1.00 1.00 ? 34  LEU A HD23 6  
ATOM   7231  N N    . GLY A 1 35 ? 13.308  -0.061  7.088   1.00 1.00 ? 35  GLY A N    6  
ATOM   7232  C CA   . GLY A 1 35 ? 13.542  1.374   6.962   1.00 1.00 ? 35  GLY A CA   6  
ATOM   7233  C C    . GLY A 1 35 ? 13.112  1.877   5.588   1.00 1.00 ? 35  GLY A C    6  
ATOM   7234  O O    . GLY A 1 35 ? 13.613  1.416   4.562   1.00 1.00 ? 35  GLY A O    6  
ATOM   7235  H H    . GLY A 1 35 ? 12.639  -0.491  6.517   1.00 1.00 ? 35  GLY A H    6  
ATOM   7236  H HA2  . GLY A 1 35 ? 12.978  1.893   7.724   1.00 1.00 ? 35  GLY A HA2  6  
ATOM   7237  H HA3  . GLY A 1 35 ? 14.594  1.578   7.097   1.00 1.00 ? 35  GLY A HA3  6  
ATOM   7238  N N    . ALA A 1 36 ? 12.181  2.824   5.575   1.00 1.00 ? 36  ALA A N    6  
ATOM   7239  C CA   . ALA A 1 36 ? 11.691  3.382   4.321   1.00 1.00 ? 36  ALA A CA   6  
ATOM   7240  C C    . ALA A 1 36 ? 12.761  4.244   3.663   1.00 1.00 ? 36  ALA A C    6  
ATOM   7241  O O    . ALA A 1 36 ? 13.487  4.975   4.339   1.00 1.00 ? 36  ALA A O    6  
ATOM   7242  C CB   . ALA A 1 36 ? 10.439  4.226   4.579   1.00 1.00 ? 36  ALA A CB   6  
ATOM   7243  H H    . ALA A 1 36 ? 11.818  3.155   6.423   1.00 1.00 ? 36  ALA A H    6  
ATOM   7244  H HA   . ALA A 1 36 ? 11.433  2.573   3.654   1.00 1.00 ? 36  ALA A HA   6  
ATOM   7245  H HB1  . ALA A 1 36 ? 9.807   3.722   5.295   1.00 1.00 ? 36  ALA A HB1  6  
ATOM   7246  H HB2  . ALA A 1 36 ? 9.899   4.361   3.653   1.00 1.00 ? 36  ALA A HB2  6  
ATOM   7247  H HB3  . ALA A 1 36 ? 10.729  5.191   4.971   1.00 1.00 ? 36  ALA A HB3  6  
ATOM   7248  N N    . ASP A 1 37 ? 12.853  4.161   2.342   1.00 1.00 ? 37  ASP A N    6  
ATOM   7249  C CA   . ASP A 1 37 ? 13.832  4.943   1.595   1.00 1.00 ? 37  ASP A CA   6  
ATOM   7250  C C    . ASP A 1 37 ? 13.283  6.333   1.283   1.00 1.00 ? 37  ASP A C    6  
ATOM   7251  O O    . ASP A 1 37 ? 12.107  6.612   1.516   1.00 1.00 ? 37  ASP A O    6  
ATOM   7252  C CB   . ASP A 1 37 ? 14.195  4.228   0.295   1.00 1.00 ? 37  ASP A CB   6  
ATOM   7253  C CG   . ASP A 1 37 ? 12.927  3.811   -0.440  1.00 1.00 ? 37  ASP A CG   6  
ATOM   7254  O OD1  . ASP A 1 37 ? 11.893  3.747   0.200   1.00 1.00 ? 37  ASP A OD1  6  
ATOM   7255  O OD2  . ASP A 1 37 ? 13.011  3.558   -1.629  1.00 1.00 ? 37  ASP A OD2  6  
ATOM   7256  H H    . ASP A 1 37 ? 12.247  3.562   1.853   1.00 1.00 ? 37  ASP A H    6  
ATOM   7257  H HA   . ASP A 1 37 ? 14.726  5.050   2.197   1.00 1.00 ? 37  ASP A HA   6  
ATOM   7258  H HB2  . ASP A 1 37 ? 14.768  4.899   -0.331  1.00 1.00 ? 37  ASP A HB2  6  
ATOM   7259  H HB3  . ASP A 1 37 ? 14.786  3.355   0.519   1.00 1.00 ? 37  ASP A HB3  6  
ATOM   7260  N N    . SER A 1 38 ? 14.142  7.198   0.757   1.00 1.00 ? 38  SER A N    6  
ATOM   7261  C CA   . SER A 1 38 ? 13.732  8.555   0.421   1.00 1.00 ? 38  SER A CA   6  
ATOM   7262  C C    . SER A 1 38 ? 12.648  8.545   -0.642  1.00 1.00 ? 38  SER A C    6  
ATOM   7263  O O    . SER A 1 38 ? 11.645  9.254   -0.531  1.00 1.00 ? 38  SER A O    6  
ATOM   7264  C CB   . SER A 1 38 ? 14.937  9.353   -0.083  1.00 1.00 ? 38  SER A CB   6  
ATOM   7265  H H    . SER A 1 38 ? 15.067  6.919   0.590   1.00 1.00 ? 38  SER A H    6  
ATOM   7266  H HA   . SER A 1 38 ? 13.347  9.035   1.309   1.00 1.00 ? 38  SER A HA   6  
ATOM   7267  H HB2  . SER A 1 38 ? 15.143  9.084   -1.112  1.00 1.00 ? 38  SER A HB2  6  
ATOM   7268  H HB3  . SER A 1 38 ? 15.800  9.130   0.521   1.00 1.00 ? 38  SER A HB3  6  
ATOM   7269  N N    . LEU A 1 39 ? 12.853  7.738   -1.682  1.00 1.00 ? 39  LEU A N    6  
ATOM   7270  C CA   . LEU A 1 39 ? 11.882  7.652   -2.768  1.00 1.00 ? 39  LEU A CA   6  
ATOM   7271  C C    . LEU A 1 39 ? 11.250  6.267   -2.816  1.00 1.00 ? 39  LEU A C    6  
ATOM   7272  O O    . LEU A 1 39 ? 11.947  5.260   -2.930  1.00 1.00 ? 39  LEU A O    6  
ATOM   7273  C CB   . LEU A 1 39 ? 12.581  7.935   -4.104  1.00 1.00 ? 39  LEU A CB   6  
ATOM   7274  C CG   . LEU A 1 39 ? 13.322  9.273   -4.019  1.00 1.00 ? 39  LEU A CG   6  
ATOM   7275  C CD1  . LEU A 1 39 ? 14.065  9.531   -5.333  1.00 1.00 ? 39  LEU A CD1  6  
ATOM   7276  C CD2  . LEU A 1 39 ? 12.318  10.403  -3.770  1.00 1.00 ? 39  LEU A CD2  6  
ATOM   7277  H H    . LEU A 1 39 ? 13.667  7.197   -1.720  1.00 1.00 ? 39  LEU A H    6  
ATOM   7278  H HA   . LEU A 1 39 ? 11.104  8.385   -2.625  1.00 1.00 ? 39  LEU A HA   6  
ATOM   7279  H HB2  . LEU A 1 39 ? 13.282  7.148   -4.326  1.00 1.00 ? 39  LEU A HB2  6  
ATOM   7280  H HB3  . LEU A 1 39 ? 11.840  7.992   -4.893  1.00 1.00 ? 39  LEU A HB3  6  
ATOM   7281  H HG   . LEU A 1 39 ? 14.032  9.236   -3.206  1.00 1.00 ? 39  LEU A HG   6  
ATOM   7282  H HD11 . LEU A 1 39 ? 13.354  9.584   -6.143  1.00 1.00 ? 39  LEU A HD11 6  
ATOM   7283  H HD12 . LEU A 1 39 ? 14.763  8.729   -5.515  1.00 1.00 ? 39  LEU A HD12 6  
ATOM   7284  H HD13 . LEU A 1 39 ? 14.601  10.467  -5.264  1.00 1.00 ? 39  LEU A HD13 6  
ATOM   7285  H HD21 . LEU A 1 39 ? 12.741  11.343  -4.096  1.00 1.00 ? 39  LEU A HD21 6  
ATOM   7286  H HD22 . LEU A 1 39 ? 12.095  10.461  -2.716  1.00 1.00 ? 39  LEU A HD22 6  
ATOM   7287  H HD23 . LEU A 1 39 ? 11.409  10.210  -4.322  1.00 1.00 ? 39  LEU A HD23 6  
ATOM   7288  N N    . ASP A 1 40 ? 9.924   6.227   -2.733  1.00 1.00 ? 40  ASP A N    6  
ATOM   7289  C CA   . ASP A 1 40 ? 9.203   4.962   -2.769  1.00 1.00 ? 40  ASP A CA   6  
ATOM   7290  C C    . ASP A 1 40 ? 7.698   5.198   -2.723  1.00 1.00 ? 40  ASP A C    6  
ATOM   7291  O O    . ASP A 1 40 ? 6.921   4.441   -3.304  1.00 1.00 ? 40  ASP A O    6  
ATOM   7292  C CB   . ASP A 1 40 ? 9.622   4.084   -1.589  1.00 1.00 ? 40  ASP A CB   6  
ATOM   7293  C CG   . ASP A 1 40 ? 9.506   4.874   -0.289  1.00 1.00 ? 40  ASP A CG   6  
ATOM   7294  O OD1  . ASP A 1 40 ? 9.241   6.063   -0.363  1.00 1.00 ? 40  ASP A OD1  6  
ATOM   7295  O OD2  . ASP A 1 40 ? 9.682   4.280   0.760   1.00 1.00 ? 40  ASP A OD2  6  
ATOM   7296  H H    . ASP A 1 40 ? 9.421   7.065   -2.641  1.00 1.00 ? 40  ASP A H    6  
ATOM   7297  H HA   . ASP A 1 40 ? 9.449   4.448   -3.688  1.00 1.00 ? 40  ASP A HA   6  
ATOM   7298  H HB2  . ASP A 1 40 ? 8.978   3.218   -1.540  1.00 1.00 ? 40  ASP A HB2  6  
ATOM   7299  H HB3  . ASP A 1 40 ? 10.640  3.763   -1.726  1.00 1.00 ? 40  ASP A HB3  6  
ATOM   7300  N N    . THR A 1 41 ? 7.292   6.254   -2.028  1.00 1.00 ? 41  THR A N    6  
ATOM   7301  C CA   . THR A 1 41 ? 5.876   6.580   -1.907  1.00 1.00 ? 41  THR A CA   6  
ATOM   7302  C C    . THR A 1 41 ? 5.272   6.854   -3.279  1.00 1.00 ? 41  THR A C    6  
ATOM   7303  O O    . THR A 1 41 ? 4.170   6.402   -3.582  1.00 1.00 ? 41  THR A O    6  
ATOM   7304  C CB   . THR A 1 41 ? 5.696   7.808   -1.014  1.00 1.00 ? 41  THR A CB   6  
ATOM   7305  O OG1  . THR A 1 41 ? 6.441   7.634   0.184   1.00 1.00 ? 41  THR A OG1  6  
ATOM   7306  C CG2  . THR A 1 41 ? 4.216   7.982   -0.674  1.00 1.00 ? 41  THR A CG2  6  
ATOM   7307  H H    . THR A 1 41 ? 7.957   6.824   -1.586  1.00 1.00 ? 41  THR A H    6  
ATOM   7308  H HA   . THR A 1 41 ? 5.362   5.743   -1.458  1.00 1.00 ? 41  THR A HA   6  
ATOM   7309  H HB   . THR A 1 41 ? 6.049   8.686   -1.532  1.00 1.00 ? 41  THR A HB   6  
ATOM   7310  H HG1  . THR A 1 41 ? 6.842   8.477   0.408   1.00 1.00 ? 41  THR A HG1  6  
ATOM   7311  H HG21 . THR A 1 41 ? 3.885   7.153   -0.064  1.00 1.00 ? 41  THR A HG21 6  
ATOM   7312  H HG22 . THR A 1 41 ? 3.638   8.009   -1.585  1.00 1.00 ? 41  THR A HG22 6  
ATOM   7313  H HG23 . THR A 1 41 ? 4.075   8.906   -0.129  1.00 1.00 ? 41  THR A HG23 6  
ATOM   7314  N N    . VAL A 1 42 ? 5.999   7.600   -4.103  1.00 1.00 ? 42  VAL A N    6  
ATOM   7315  C CA   . VAL A 1 42 ? 5.522   7.930   -5.438  1.00 1.00 ? 42  VAL A CA   6  
ATOM   7316  C C    . VAL A 1 42 ? 5.346   6.665   -6.274  1.00 1.00 ? 42  VAL A C    6  
ATOM   7317  O O    . VAL A 1 42 ? 4.363   6.516   -6.992  1.00 1.00 ? 42  VAL A O    6  
ATOM   7318  C CB   . VAL A 1 42 ? 6.517   8.866   -6.133  1.00 1.00 ? 42  VAL A CB   6  
ATOM   7319  C CG1  . VAL A 1 42 ? 6.072   9.109   -7.577  1.00 1.00 ? 42  VAL A CG1  6  
ATOM   7320  C CG2  . VAL A 1 42 ? 6.567   10.200  -5.384  1.00 1.00 ? 42  VAL A CG2  6  
ATOM   7321  H H    . VAL A 1 42 ? 6.872   7.932   -3.806  1.00 1.00 ? 42  VAL A H    6  
ATOM   7322  H HA   . VAL A 1 42 ? 4.571   8.434   -5.360  1.00 1.00 ? 42  VAL A HA   6  
ATOM   7323  H HB   . VAL A 1 42 ? 7.498   8.413   -6.130  1.00 1.00 ? 42  VAL A HB   6  
ATOM   7324  H HG11 . VAL A 1 42 ? 5.017   9.341   -7.593  1.00 1.00 ? 42  VAL A HG11 6  
ATOM   7325  H HG12 . VAL A 1 42 ? 6.254   8.220   -8.162  1.00 1.00 ? 42  VAL A HG12 6  
ATOM   7326  H HG13 . VAL A 1 42 ? 6.629   9.935   -7.990  1.00 1.00 ? 42  VAL A HG13 6  
ATOM   7327  H HG21 . VAL A 1 42 ? 6.921   10.034  -4.377  1.00 1.00 ? 42  VAL A HG21 6  
ATOM   7328  H HG22 . VAL A 1 42 ? 5.580   10.632  -5.352  1.00 1.00 ? 42  VAL A HG22 6  
ATOM   7329  H HG23 . VAL A 1 42 ? 7.239   10.874  -5.894  1.00 1.00 ? 42  VAL A HG23 6  
ATOM   7330  N N    . GLU A 1 43 ? 6.312   5.762   -6.181  1.00 1.00 ? 43  GLU A N    6  
ATOM   7331  C CA   . GLU A 1 43 ? 6.252   4.520   -6.930  1.00 1.00 ? 43  GLU A CA   6  
ATOM   7332  C C    . GLU A 1 43 ? 5.240   3.559   -6.310  1.00 1.00 ? 43  GLU A C    6  
ATOM   7333  O O    . GLU A 1 43 ? 4.452   2.928   -7.013  1.00 1.00 ? 43  GLU A O    6  
ATOM   7334  C CB   . GLU A 1 43 ? 7.631   3.851   -6.953  1.00 1.00 ? 43  GLU A CB   6  
ATOM   7335  C CG   . GLU A 1 43 ? 8.598   4.709   -7.776  1.00 1.00 ? 43  GLU A CG   6  
ATOM   7336  C CD   . GLU A 1 43 ? 9.989   4.087   -7.765  1.00 1.00 ? 43  GLU A CD   6  
ATOM   7337  O OE1  . GLU A 1 43 ? 10.142  3.039   -7.159  1.00 1.00 ? 43  GLU A OE1  6  
ATOM   7338  O OE2  . GLU A 1 43 ? 10.880  4.663   -8.364  1.00 1.00 ? 43  GLU A OE2  6  
ATOM   7339  H H    . GLU A 1 43 ? 7.082   5.935   -5.598  1.00 1.00 ? 43  GLU A H    6  
ATOM   7340  H HA   . GLU A 1 43 ? 5.954   4.729   -7.945  1.00 1.00 ? 43  GLU A HA   6  
ATOM   7341  H HB2  . GLU A 1 43 ? 8.004   3.758   -5.944  1.00 1.00 ? 43  GLU A HB2  6  
ATOM   7342  H HB3  . GLU A 1 43 ? 7.555   2.872   -7.403  1.00 1.00 ? 43  GLU A HB3  6  
ATOM   7343  H HG2  . GLU A 1 43 ? 8.242   4.778   -8.792  1.00 1.00 ? 43  GLU A HG2  6  
ATOM   7344  H HG3  . GLU A 1 43 ? 8.648   5.701   -7.347  1.00 1.00 ? 43  GLU A HG3  6  
ATOM   7345  N N    . ILE A 1 44 ? 5.274   3.451   -4.986  1.00 1.00 ? 44  ILE A N    6  
ATOM   7346  C CA   . ILE A 1 44 ? 4.370   2.550   -4.292  1.00 1.00 ? 44  ILE A CA   6  
ATOM   7347  C C    . ILE A 1 44 ? 2.923   2.983   -4.446  1.00 1.00 ? 44  ILE A C    6  
ATOM   7348  O O    . ILE A 1 44 ? 2.054   2.170   -4.755  1.00 1.00 ? 44  ILE A O    6  
ATOM   7349  C CB   . ILE A 1 44 ? 4.731   2.513   -2.795  1.00 1.00 ? 44  ILE A CB   6  
ATOM   7350  C CG1  . ILE A 1 44 ? 6.101   1.839   -2.609  1.00 1.00 ? 44  ILE A CG1  6  
ATOM   7351  C CG2  . ILE A 1 44 ? 3.663   1.717   -2.027  1.00 1.00 ? 44  ILE A CG2  6  
ATOM   7352  C CD1  . ILE A 1 44 ? 5.936   0.315   -2.576  1.00 1.00 ? 44  ILE A CD1  6  
ATOM   7353  H H    . ILE A 1 44 ? 5.922   3.979   -4.473  1.00 1.00 ? 44  ILE A H    6  
ATOM   7354  H HA   . ILE A 1 44 ? 4.487   1.557   -4.696  1.00 1.00 ? 44  ILE A HA   6  
ATOM   7355  H HB   . ILE A 1 44 ? 4.769   3.519   -2.408  1.00 1.00 ? 44  ILE A HB   6  
ATOM   7356  H HG12 . ILE A 1 44 ? 6.748   2.109   -3.429  1.00 1.00 ? 44  ILE A HG12 6  
ATOM   7357  H HG13 . ILE A 1 44 ? 6.540   2.173   -1.682  1.00 1.00 ? 44  ILE A HG13 6  
ATOM   7358  H HG21 . ILE A 1 44 ? 4.053   1.436   -1.059  1.00 1.00 ? 44  ILE A HG21 6  
ATOM   7359  H HG22 . ILE A 1 44 ? 3.416   0.820   -2.587  1.00 1.00 ? 44  ILE A HG22 6  
ATOM   7360  H HG23 . ILE A 1 44 ? 2.786   2.317   -1.911  1.00 1.00 ? 44  ILE A HG23 6  
ATOM   7361  H HD11 . ILE A 1 44 ? 6.870   -0.155  -2.786  1.00 1.00 ? 44  ILE A HD11 6  
ATOM   7362  H HD12 . ILE A 1 44 ? 5.202   0.014   -3.309  1.00 1.00 ? 44  ILE A HD12 6  
ATOM   7363  H HD13 . ILE A 1 44 ? 5.588   0.021   -1.595  1.00 1.00 ? 44  ILE A HD13 6  
ATOM   7364  N N    . VAL A 1 45 ? 2.676   4.267   -4.234  1.00 1.00 ? 45  VAL A N    6  
ATOM   7365  C CA   . VAL A 1 45 ? 1.323   4.795   -4.344  1.00 1.00 ? 45  VAL A CA   6  
ATOM   7366  C C    . VAL A 1 45 ? 0.784   4.635   -5.757  1.00 1.00 ? 45  VAL A C    6  
ATOM   7367  O O    . VAL A 1 45 ? -0.363  4.251   -5.956  1.00 1.00 ? 45  VAL A O    6  
ATOM   7368  C CB   . VAL A 1 45 ? 1.310   6.279   -3.947  1.00 1.00 ? 45  VAL A CB   6  
ATOM   7369  C CG1  . VAL A 1 45 ? 1.917   7.113   -5.079  1.00 1.00 ? 45  VAL A CG1  6  
ATOM   7370  C CG2  . VAL A 1 45 ? -0.131  6.730   -3.698  1.00 1.00 ? 45  VAL A CG2  6  
ATOM   7371  H H    . VAL A 1 45 ? 3.412   4.869   -3.996  1.00 1.00 ? 45  VAL A H    6  
ATOM   7372  H HA   . VAL A 1 45 ? 0.683   4.254   -3.658  1.00 1.00 ? 45  VAL A HA   6  
ATOM   7373  H HB   . VAL A 1 45 ? 1.892   6.419   -3.046  1.00 1.00 ? 45  VAL A HB   6  
ATOM   7374  H HG11 . VAL A 1 45 ? 2.163   8.094   -4.713  1.00 1.00 ? 45  VAL A HG11 6  
ATOM   7375  H HG12 . VAL A 1 45 ? 1.202   7.195   -5.890  1.00 1.00 ? 45  VAL A HG12 6  
ATOM   7376  H HG13 . VAL A 1 45 ? 2.801   6.627   -5.442  1.00 1.00 ? 45  VAL A HG13 6  
ATOM   7377  H HG21 . VAL A 1 45 ? -0.131  7.746   -3.334  1.00 1.00 ? 45  VAL A HG21 6  
ATOM   7378  H HG22 . VAL A 1 45 ? -0.587  6.084   -2.964  1.00 1.00 ? 45  VAL A HG22 6  
ATOM   7379  H HG23 . VAL A 1 45 ? -0.689  6.678   -4.621  1.00 1.00 ? 45  VAL A HG23 6  
ATOM   7380  N N    . MET A 1 46 ? 1.627   4.946   -6.736  1.00 1.00 ? 46  MET A N    6  
ATOM   7381  C CA   . MET A 1 46 ? 1.227   4.850   -8.133  1.00 1.00 ? 46  MET A CA   6  
ATOM   7382  C C    . MET A 1 46 ? 0.875   3.411   -8.488  1.00 1.00 ? 46  MET A C    6  
ATOM   7383  O O    . MET A 1 46 ? -0.068  3.159   -9.240  1.00 1.00 ? 46  MET A O    6  
ATOM   7384  C CB   . MET A 1 46 ? 2.358   5.343   -9.038  1.00 1.00 ? 46  MET A CB   6  
ATOM   7385  C CG   . MET A 1 46 ? 1.815   5.593   -10.446 1.00 1.00 ? 46  MET A CG   6  
ATOM   7386  S SD   . MET A 1 46 ? 0.860   7.134   -10.457 1.00 1.00 ? 46  MET A SD   6  
ATOM   7387  C CE   . MET A 1 46 ? -0.745  6.410   -10.878 1.00 1.00 ? 46  MET A CE   6  
ATOM   7388  H H    . MET A 1 46 ? 2.533   5.253   -6.517  1.00 1.00 ? 46  MET A H    6  
ATOM   7389  H HA   . MET A 1 46 ? 0.358   5.473   -8.290  1.00 1.00 ? 46  MET A HA   6  
ATOM   7390  H HB2  . MET A 1 46 ? 2.762   6.260   -8.641  1.00 1.00 ? 46  MET A HB2  6  
ATOM   7391  H HB3  . MET A 1 46 ? 3.134   4.593   -9.083  1.00 1.00 ? 46  MET A HB3  6  
ATOM   7392  H HG2  . MET A 1 46 ? 2.635   5.677   -11.137 1.00 1.00 ? 46  MET A HG2  6  
ATOM   7393  H HG3  . MET A 1 46 ? 1.181   4.772   -10.735 1.00 1.00 ? 46  MET A HG3  6  
ATOM   7394  H HE1  . MET A 1 46 ? -1.512  7.161   -10.790 1.00 1.00 ? 46  MET A HE1  6  
ATOM   7395  H HE2  . MET A 1 46 ? -0.959  5.595   -10.205 1.00 1.00 ? 46  MET A HE2  6  
ATOM   7396  H HE3  . MET A 1 46 ? -0.710  6.033   -11.893 1.00 1.00 ? 46  MET A HE3  6  
ATOM   7397  N N    . ASN A 1 47 ? 1.645   2.468   -7.949  1.00 1.00 ? 47  ASN A N    6  
ATOM   7398  C CA   . ASN A 1 47 ? 1.401   1.056   -8.224  1.00 1.00 ? 47  ASN A CA   6  
ATOM   7399  C C    . ASN A 1 47 ? 0.024   0.643   -7.716  1.00 1.00 ? 47  ASN A C    6  
ATOM   7400  O O    . ASN A 1 47 ? -0.738  -0.008  -8.432  1.00 1.00 ? 47  ASN A O    6  
ATOM   7401  C CB   . ASN A 1 47 ? 2.478   0.206   -7.541  1.00 1.00 ? 47  ASN A CB   6  
ATOM   7402  C CG   . ASN A 1 47 ? 3.727   0.138   -8.415  1.00 1.00 ? 47  ASN A CG   6  
ATOM   7403  O OD1  . ASN A 1 47 ? 4.629   0.960   -8.276  1.00 1.00 ? 47  ASN A OD1  6  
ATOM   7404  N ND2  . ASN A 1 47 ? 3.825   -0.800  -9.317  1.00 1.00 ? 47  ASN A ND2  6  
ATOM   7405  H H    . ASN A 1 47 ? 2.382   2.726   -7.361  1.00 1.00 ? 47  ASN A H    6  
ATOM   7406  H HA   . ASN A 1 47 ? 1.446   0.890   -9.288  1.00 1.00 ? 47  ASN A HA   6  
ATOM   7407  H HB2  . ASN A 1 47 ? 2.732   0.650   -6.587  1.00 1.00 ? 47  ASN A HB2  6  
ATOM   7408  H HB3  . ASN A 1 47 ? 2.106   -0.791  -7.379  1.00 1.00 ? 47  ASN A HB3  6  
ATOM   7409  H HD21 . ASN A 1 47 ? 3.102   -1.453  -9.427  1.00 1.00 ? 47  ASN A HD21 6  
ATOM   7410  H HD22 . ASN A 1 47 ? 4.622   -0.849  -9.885  1.00 1.00 ? 47  ASN A HD22 6  
ATOM   7411  N N    . LEU A 1 48 ? -0.285  1.018   -6.480  1.00 1.00 ? 48  LEU A N    6  
ATOM   7412  C CA   . LEU A 1 48 ? -1.578  0.677   -5.894  1.00 1.00 ? 48  LEU A CA   6  
ATOM   7413  C C    . LEU A 1 48 ? -2.705  1.382   -6.638  1.00 1.00 ? 48  LEU A C    6  
ATOM   7414  O O    . LEU A 1 48 ? -3.713  0.772   -6.981  1.00 1.00 ? 48  LEU A O    6  
ATOM   7415  C CB   . LEU A 1 48 ? -1.601  1.095   -4.420  1.00 1.00 ? 48  LEU A CB   6  
ATOM   7416  C CG   . LEU A 1 48 ? -0.427  0.441   -3.685  1.00 1.00 ? 48  LEU A CG   6  
ATOM   7417  C CD1  . LEU A 1 48 ? -0.196  1.157   -2.354  1.00 1.00 ? 48  LEU A CD1  6  
ATOM   7418  C CD2  . LEU A 1 48 ? -0.748  -1.032  -3.420  1.00 1.00 ? 48  LEU A CD2  6  
ATOM   7419  H H    . LEU A 1 48 ? 0.365   1.529   -5.954  1.00 1.00 ? 48  LEU A H    6  
ATOM   7420  H HA   . LEU A 1 48 ? -1.730  -0.383  -5.962  1.00 1.00 ? 48  LEU A HA   6  
ATOM   7421  H HB2  . LEU A 1 48 ? -1.521  2.169   -4.347  1.00 1.00 ? 48  LEU A HB2  6  
ATOM   7422  H HB3  . LEU A 1 48 ? -2.537  0.774   -3.967  1.00 1.00 ? 48  LEU A HB3  6  
ATOM   7423  H HG   . LEU A 1 48 ? 0.464   0.512   -4.289  1.00 1.00 ? 48  LEU A HG   6  
ATOM   7424  H HD11 . LEU A 1 48 ? 0.495   0.587   -1.753  1.00 1.00 ? 48  LEU A HD11 6  
ATOM   7425  H HD12 . LEU A 1 48 ? -1.133  1.258   -1.831  1.00 1.00 ? 48  LEU A HD12 6  
ATOM   7426  H HD13 . LEU A 1 48 ? 0.216   2.139   -2.543  1.00 1.00 ? 48  LEU A HD13 6  
ATOM   7427  H HD21 . LEU A 1 48 ? -1.707  -1.109  -2.938  1.00 1.00 ? 48  LEU A HD21 6  
ATOM   7428  H HD22 . LEU A 1 48 ? 0.013   -1.455  -2.785  1.00 1.00 ? 48  LEU A HD22 6  
ATOM   7429  H HD23 . LEU A 1 48 ? -0.771  -1.572  -4.350  1.00 1.00 ? 48  LEU A HD23 6  
ATOM   7430  N N    . GLU A 1 49 ? -2.522  2.674   -6.895  1.00 1.00 ? 49  GLU A N    6  
ATOM   7431  C CA   . GLU A 1 49 ? -3.531  3.453   -7.602  1.00 1.00 ? 49  GLU A CA   6  
ATOM   7432  C C    . GLU A 1 49 ? -3.713  2.926   -9.022  1.00 1.00 ? 49  GLU A C    6  
ATOM   7433  O O    . GLU A 1 49 ? -4.824  2.910   -9.552  1.00 1.00 ? 49  GLU A O    6  
ATOM   7434  C CB   . GLU A 1 49 ? -3.115  4.925   -7.653  1.00 1.00 ? 49  GLU A CB   6  
ATOM   7435  C CG   . GLU A 1 49 ? -4.276  5.766   -8.184  1.00 1.00 ? 49  GLU A CG   6  
ATOM   7436  C CD   . GLU A 1 49 ? -3.858  7.228   -8.291  1.00 1.00 ? 49  GLU A CD   6  
ATOM   7437  O OE1  . GLU A 1 49 ? -2.920  7.608   -7.610  1.00 1.00 ? 49  GLU A OE1  6  
ATOM   7438  O OE2  . GLU A 1 49 ? -4.472  7.942   -9.067  1.00 1.00 ? 49  GLU A OE2  6  
ATOM   7439  H H    . GLU A 1 49 ? -1.697  3.112   -6.601  1.00 1.00 ? 49  GLU A H    6  
ATOM   7440  H HA   . GLU A 1 49 ? -4.465  3.376   -7.077  1.00 1.00 ? 49  GLU A HA   6  
ATOM   7441  H HB2  . GLU A 1 49 ? -2.848  5.257   -6.662  1.00 1.00 ? 49  GLU A HB2  6  
ATOM   7442  H HB3  . GLU A 1 49 ? -2.266  5.037   -8.313  1.00 1.00 ? 49  GLU A HB3  6  
ATOM   7443  H HG2  . GLU A 1 49 ? -4.573  5.401   -9.152  1.00 1.00 ? 49  GLU A HG2  6  
ATOM   7444  H HG3  . GLU A 1 49 ? -5.115  5.688   -7.494  1.00 1.00 ? 49  GLU A HG3  6  
ATOM   7445  N N    . GLU A 1 50 ? -2.613  2.495   -9.634  1.00 1.00 ? 50  GLU A N    6  
ATOM   7446  C CA   . GLU A 1 50 ? -2.665  1.967   -10.990 1.00 1.00 ? 50  GLU A CA   6  
ATOM   7447  C C    . GLU A 1 50 ? -3.341  0.600   -11.011 1.00 1.00 ? 50  GLU A C    6  
ATOM   7448  O O    . GLU A 1 50 ? -4.152  0.309   -11.891 1.00 1.00 ? 50  GLU A O    6  
ATOM   7449  C CB   . GLU A 1 50 ? -1.249  1.846   -11.558 1.00 1.00 ? 50  GLU A CB   6  
ATOM   7450  C CG   . GLU A 1 50 ? -1.319  1.391   -13.018 1.00 1.00 ? 50  GLU A CG   6  
ATOM   7451  C CD   . GLU A 1 50 ? 0.085   1.334   -13.614 1.00 1.00 ? 50  GLU A CD   6  
ATOM   7452  O OE1  . GLU A 1 50 ? 1.034   1.398   -12.852 1.00 1.00 ? 50  GLU A OE1  6  
ATOM   7453  O OE2  . GLU A 1 50 ? 0.187   1.231   -14.825 1.00 1.00 ? 50  GLU A OE2  6  
ATOM   7454  H H    . GLU A 1 50 ? -1.755  2.530   -9.164  1.00 1.00 ? 50  GLU A H    6  
ATOM   7455  H HA   . GLU A 1 50 ? -3.231  2.646   -11.611 1.00 1.00 ? 50  GLU A HA   6  
ATOM   7456  H HB2  . GLU A 1 50 ? -0.756  2.806   -11.502 1.00 1.00 ? 50  GLU A HB2  6  
ATOM   7457  H HB3  . GLU A 1 50 ? -0.691  1.122   -10.984 1.00 1.00 ? 50  GLU A HB3  6  
ATOM   7458  H HG2  . GLU A 1 50 ? -1.766  0.411   -13.066 1.00 1.00 ? 50  GLU A HG2  6  
ATOM   7459  H HG3  . GLU A 1 50 ? -1.919  2.089   -13.581 1.00 1.00 ? 50  GLU A HG3  6  
ATOM   7460  N N    . GLU A 1 51 ? -2.996  -0.240  -10.040 1.00 1.00 ? 51  GLU A N    6  
ATOM   7461  C CA   . GLU A 1 51 ? -3.570  -1.575  -9.964  1.00 1.00 ? 51  GLU A CA   6  
ATOM   7462  C C    . GLU A 1 51 ? -5.062  -1.508  -9.667  1.00 1.00 ? 51  GLU A C    6  
ATOM   7463  O O    . GLU A 1 51 ? -5.879  -2.043  -10.417 1.00 1.00 ? 51  GLU A O    6  
ATOM   7464  C CB   . GLU A 1 51 ? -2.869  -2.380  -8.863  1.00 1.00 ? 51  GLU A CB   6  
ATOM   7465  C CG   . GLU A 1 51 ? -3.370  -3.826  -8.888  1.00 1.00 ? 51  GLU A CG   6  
ATOM   7466  C CD   . GLU A 1 51 ? -2.694  -4.631  -7.784  1.00 1.00 ? 51  GLU A CD   6  
ATOM   7467  O OE1  . GLU A 1 51 ? -2.697  -4.169  -6.655  1.00 1.00 ? 51  GLU A OE1  6  
ATOM   7468  O OE2  . GLU A 1 51 ? -2.187  -5.700  -8.082  1.00 1.00 ? 51  GLU A OE2  6  
ATOM   7469  H H    . GLU A 1 51 ? -2.343  0.043   -9.364  1.00 1.00 ? 51  GLU A H    6  
ATOM   7470  H HA   . GLU A 1 51 ? -3.421  -2.079  -10.907 1.00 1.00 ? 51  GLU A HA   6  
ATOM   7471  H HB2  . GLU A 1 51 ? -1.801  -2.367  -9.031  1.00 1.00 ? 51  GLU A HB2  6  
ATOM   7472  H HB3  . GLU A 1 51 ? -3.086  -1.943  -7.901  1.00 1.00 ? 51  GLU A HB3  6  
ATOM   7473  H HG2  . GLU A 1 51 ? -4.439  -3.838  -8.735  1.00 1.00 ? 51  GLU A HG2  6  
ATOM   7474  H HG3  . GLU A 1 51 ? -3.140  -4.270  -9.846  1.00 1.00 ? 51  GLU A HG3  6  
ATOM   7475  N N    . PHE A 1 52 ? -5.413  -0.848  -8.572  1.00 1.00 ? 52  PHE A N    6  
ATOM   7476  C CA   . PHE A 1 52 ? -6.810  -0.720  -8.185  1.00 1.00 ? 52  PHE A CA   6  
ATOM   7477  C C    . PHE A 1 52 ? -7.567  0.168   -9.164  1.00 1.00 ? 52  PHE A C    6  
ATOM   7478  O O    . PHE A 1 52 ? -8.779  0.035   -9.330  1.00 1.00 ? 52  PHE A O    6  
ATOM   7479  C CB   . PHE A 1 52 ? -6.911  -0.126  -6.774  1.00 1.00 ? 52  PHE A CB   6  
ATOM   7480  C CG   . PHE A 1 52 ? -6.414  -1.133  -5.764  1.00 1.00 ? 52  PHE A CG   6  
ATOM   7481  C CD1  . PHE A 1 52 ? -7.083  -2.355  -5.607  1.00 1.00 ? 52  PHE A CD1  6  
ATOM   7482  C CD2  . PHE A 1 52 ? -5.287  -0.849  -4.982  1.00 1.00 ? 52  PHE A CD2  6  
ATOM   7483  C CE1  . PHE A 1 52 ? -6.624  -3.288  -4.670  1.00 1.00 ? 52  PHE A CE1  6  
ATOM   7484  C CE2  . PHE A 1 52 ? -4.829  -1.782  -4.047  1.00 1.00 ? 52  PHE A CE2  6  
ATOM   7485  C CZ   . PHE A 1 52 ? -5.497  -3.001  -3.892  1.00 1.00 ? 52  PHE A CZ   6  
ATOM   7486  H H    . PHE A 1 52 ? -4.718  -0.438  -8.009  1.00 1.00 ? 52  PHE A H    6  
ATOM   7487  H HA   . PHE A 1 52 ? -7.261  -1.699  -8.179  1.00 1.00 ? 52  PHE A HA   6  
ATOM   7488  H HB2  . PHE A 1 52 ? -6.306  0.767   -6.720  1.00 1.00 ? 52  PHE A HB2  6  
ATOM   7489  H HB3  . PHE A 1 52 ? -7.937  0.120   -6.557  1.00 1.00 ? 52  PHE A HB3  6  
ATOM   7490  H HD1  . PHE A 1 52 ? -7.954  -2.576  -6.203  1.00 1.00 ? 52  PHE A HD1  6  
ATOM   7491  H HD2  . PHE A 1 52 ? -4.774  0.091   -5.097  1.00 1.00 ? 52  PHE A HD2  6  
ATOM   7492  H HE1  . PHE A 1 52 ? -7.139  -4.231  -4.551  1.00 1.00 ? 52  PHE A HE1  6  
ATOM   7493  H HE2  . PHE A 1 52 ? -3.959  -1.561  -3.447  1.00 1.00 ? 52  PHE A HE2  6  
ATOM   7494  H HZ   . PHE A 1 52 ? -5.144  -3.715  -3.170  1.00 1.00 ? 52  PHE A HZ   6  
ATOM   7495  N N    . GLY A 1 53 ? -6.842  1.083   -9.804  1.00 1.00 ? 53  GLY A N    6  
ATOM   7496  C CA   . GLY A 1 53 ? -7.456  2.006   -10.758 1.00 1.00 ? 53  GLY A CA   6  
ATOM   7497  C C    . GLY A 1 53 ? -8.268  3.062   -10.019 1.00 1.00 ? 53  GLY A C    6  
ATOM   7498  O O    . GLY A 1 53 ? -9.399  3.373   -10.397 1.00 1.00 ? 53  GLY A O    6  
ATOM   7499  H H    . GLY A 1 53 ? -5.881  1.138   -9.632  1.00 1.00 ? 53  GLY A H    6  
ATOM   7500  H HA2  . GLY A 1 53 ? -6.687  2.484   -11.331 1.00 1.00 ? 53  GLY A HA2  6  
ATOM   7501  H HA3  . GLY A 1 53 ? -8.115  1.456   -11.408 1.00 1.00 ? 53  GLY A HA3  6  
ATOM   7502  N N    . ILE A 1 54 ? -7.691  3.617   -8.956  1.00 1.00 ? 54  ILE A N    6  
ATOM   7503  C CA   . ILE A 1 54 ? -8.379  4.632   -8.156  1.00 1.00 ? 54  ILE A CA   6  
ATOM   7504  C C    . ILE A 1 54 ? -7.630  5.945   -8.186  1.00 1.00 ? 54  ILE A C    6  
ATOM   7505  O O    . ILE A 1 54 ? -6.781  6.166   -9.048  1.00 1.00 ? 54  ILE A O    6  
ATOM   7506  C CB   . ILE A 1 54 ? -8.498  4.139   -6.706  1.00 1.00 ? 54  ILE A CB   6  
ATOM   7507  C CG1  . ILE A 1 54 ? -7.125  3.674   -6.206  1.00 1.00 ? 54  ILE A CG1  6  
ATOM   7508  C CG2  . ILE A 1 54 ? -9.489  2.972   -6.633  1.00 1.00 ? 54  ILE A CG2  6  
ATOM   7509  C CD1  . ILE A 1 54 ? -7.280  2.911   -4.889  1.00 1.00 ? 54  ILE A CD1  6  
ATOM   7510  H H    . ILE A 1 54 ? -6.785  3.339   -8.699  1.00 1.00 ? 54  ILE A H    6  
ATOM   7511  H HA   . ILE A 1 54 ? -9.372  4.781   -8.542  1.00 1.00 ? 54  ILE A HA   6  
ATOM   7512  H HB   . ILE A 1 54 ? -8.849  4.943   -6.082  1.00 1.00 ? 54  ILE A HB   6  
ATOM   7513  H HG12 . ILE A 1 54 ? -6.679  3.030   -6.941  1.00 1.00 ? 54  ILE A HG12 6  
ATOM   7514  H HG13 . ILE A 1 54 ? -6.493  4.533   -6.043  1.00 1.00 ? 54  ILE A HG13 6  
ATOM   7515  H HG21 . ILE A 1 54 ? -9.751  2.781   -5.600  1.00 1.00 ? 54  ILE A HG21 6  
ATOM   7516  H HG22 . ILE A 1 54 ? -9.032  2.092   -7.056  1.00 1.00 ? 54  ILE A HG22 6  
ATOM   7517  H HG23 . ILE A 1 54 ? -10.378 3.218   -7.185  1.00 1.00 ? 54  ILE A HG23 6  
ATOM   7518  H HD11 . ILE A 1 54 ? -6.331  2.854   -4.387  1.00 1.00 ? 54  ILE A HD11 6  
ATOM   7519  H HD12 . ILE A 1 54 ? -7.639  1.914   -5.103  1.00 1.00 ? 54  ILE A HD12 6  
ATOM   7520  H HD13 . ILE A 1 54 ? -7.993  3.419   -4.269  1.00 1.00 ? 54  ILE A HD13 6  
ATOM   7521  N N    . ASN A 1 55 ? -7.951  6.829   -7.242  1.00 1.00 ? 55  ASN A N    6  
ATOM   7522  C CA   . ASN A 1 55 ? -7.295  8.133   -7.169  1.00 1.00 ? 55  ASN A CA   6  
ATOM   7523  C C    . ASN A 1 55 ? -6.708  8.347   -5.780  1.00 1.00 ? 55  ASN A C    6  
ATOM   7524  O O    . ASN A 1 55 ? -7.406  8.229   -4.773  1.00 1.00 ? 55  ASN A O    6  
ATOM   7525  C CB   . ASN A 1 55 ? -8.292  9.242   -7.486  1.00 1.00 ? 55  ASN A CB   6  
ATOM   7526  C CG   . ASN A 1 55 ? -9.616  8.967   -6.780  1.00 1.00 ? 55  ASN A CG   6  
ATOM   7527  O OD1  . ASN A 1 55 ? -10.642 8.784   -7.435  1.00 1.00 ? 55  ASN A OD1  6  
ATOM   7528  N ND2  . ASN A 1 55 ? -9.656  8.928   -5.477  1.00 1.00 ? 55  ASN A ND2  6  
ATOM   7529  H H    . ASN A 1 55 ? -8.640  6.604   -6.585  1.00 1.00 ? 55  ASN A H    6  
ATOM   7530  H HA   . ASN A 1 55 ? -6.491  8.169   -7.890  1.00 1.00 ? 55  ASN A HA   6  
ATOM   7531  H HB2  . ASN A 1 55 ? -7.896  10.188  -7.147  1.00 1.00 ? 55  ASN A HB2  6  
ATOM   7532  H HB3  . ASN A 1 55 ? -8.455  9.282   -8.551  1.00 1.00 ? 55  ASN A HB3  6  
ATOM   7533  H HD21 . ASN A 1 55 ? -8.838  9.073   -4.958  1.00 1.00 ? 55  ASN A HD21 6  
ATOM   7534  H HD22 . ASN A 1 55 ? -10.504 8.752   -5.018  1.00 1.00 ? 55  ASN A HD22 6  
ATOM   7535  N N    . VAL A 1 56 ? -5.416  8.670   -5.730  1.00 1.00 ? 56  VAL A N    6  
ATOM   7536  C CA   . VAL A 1 56 ? -4.745  8.898   -4.458  1.00 1.00 ? 56  VAL A CA   6  
ATOM   7537  C C    . VAL A 1 56 ? -3.990  10.216  -4.473  1.00 1.00 ? 56  VAL A C    6  
ATOM   7538  O O    . VAL A 1 56 ? -3.293  10.535  -5.437  1.00 1.00 ? 56  VAL A O    6  
ATOM   7539  C CB   . VAL A 1 56 ? -3.762  7.755   -4.178  1.00 1.00 ? 56  VAL A CB   6  
ATOM   7540  C CG1  . VAL A 1 56 ? -3.041  8.012   -2.852  1.00 1.00 ? 56  VAL A CG1  6  
ATOM   7541  C CG2  . VAL A 1 56 ? -4.529  6.431   -4.095  1.00 1.00 ? 56  VAL A CG2  6  
ATOM   7542  H H    . VAL A 1 56 ? -4.908  8.755   -6.564  1.00 1.00 ? 56  VAL A H    6  
ATOM   7543  H HA   . VAL A 1 56 ? -5.473  8.926   -3.656  1.00 1.00 ? 56  VAL A HA   6  
ATOM   7544  H HB   . VAL A 1 56 ? -3.034  7.700   -4.977  1.00 1.00 ? 56  VAL A HB   6  
ATOM   7545  H HG11 . VAL A 1 56 ? -3.735  8.417   -2.135  1.00 1.00 ? 56  VAL A HG11 6  
ATOM   7546  H HG12 . VAL A 1 56 ? -2.237  8.716   -3.009  1.00 1.00 ? 56  VAL A HG12 6  
ATOM   7547  H HG13 . VAL A 1 56 ? -2.634  7.085   -2.474  1.00 1.00 ? 56  VAL A HG13 6  
ATOM   7548  H HG21 . VAL A 1 56 ? -3.894  5.678   -3.650  1.00 1.00 ? 56  VAL A HG21 6  
ATOM   7549  H HG22 . VAL A 1 56 ? -4.817  6.120   -5.086  1.00 1.00 ? 56  VAL A HG22 6  
ATOM   7550  H HG23 . VAL A 1 56 ? -5.410  6.566   -3.489  1.00 1.00 ? 56  VAL A HG23 6  
ATOM   7551  N N    . ASP A 1 57 ? -4.131  10.989  -3.398  1.00 1.00 ? 57  ASP A N    6  
ATOM   7552  C CA   . ASP A 1 57 ? -3.453  12.278  -3.297  1.00 1.00 ? 57  ASP A CA   6  
ATOM   7553  C C    . ASP A 1 57 ? -2.330  12.210  -2.266  1.00 1.00 ? 57  ASP A C    6  
ATOM   7554  O O    . ASP A 1 57 ? -2.374  11.405  -1.335  1.00 1.00 ? 57  ASP A O    6  
ATOM   7555  C CB   . ASP A 1 57 ? -4.451  13.364  -2.894  1.00 1.00 ? 57  ASP A CB   6  
ATOM   7556  C CG   . ASP A 1 57 ? -3.798  14.736  -3.000  1.00 1.00 ? 57  ASP A CG   6  
ATOM   7557  O OD1  . ASP A 1 57 ? -2.768  14.833  -3.649  1.00 1.00 ? 57  ASP A OD1  6  
ATOM   7558  O OD2  . ASP A 1 57 ? -4.333  15.672  -2.429  1.00 1.00 ? 57  ASP A OD2  6  
ATOM   7559  H H    . ASP A 1 57 ? -4.700  10.686  -2.660  1.00 1.00 ? 57  ASP A H    6  
ATOM   7560  H HA   . ASP A 1 57 ? -3.027  12.537  -4.256  1.00 1.00 ? 57  ASP A HA   6  
ATOM   7561  H HB2  . ASP A 1 57 ? -5.308  13.323  -3.551  1.00 1.00 ? 57  ASP A HB2  6  
ATOM   7562  H HB3  . ASP A 1 57 ? -4.771  13.197  -1.877  1.00 1.00 ? 57  ASP A HB3  6  
ATOM   7563  N N    . GLU A 1 58 ? -1.325  13.061  -2.436  1.00 1.00 ? 58  GLU A N    6  
ATOM   7564  C CA   . GLU A 1 58 ? -0.197  13.090  -1.514  1.00 1.00 ? 58  GLU A CA   6  
ATOM   7565  C C    . GLU A 1 58 ? -0.677  13.326  -0.086  1.00 1.00 ? 58  GLU A C    6  
ATOM   7566  O O    . GLU A 1 58 ? -0.077  12.836  0.867   1.00 1.00 ? 58  GLU A O    6  
ATOM   7567  C CB   . GLU A 1 58 ? 0.777   14.202  -1.918  1.00 1.00 ? 58  GLU A CB   6  
ATOM   7568  C CG   . GLU A 1 58 ? 0.056   15.552  -1.876  1.00 1.00 ? 58  GLU A CG   6  
ATOM   7569  C CD   . GLU A 1 58 ? 0.993   16.658  -2.346  1.00 1.00 ? 58  GLU A CD   6  
ATOM   7570  O OE1  . GLU A 1 58 ? 2.168   16.378  -2.523  1.00 1.00 ? 58  GLU A OE1  6  
ATOM   7571  O OE2  . GLU A 1 58 ? 0.525   17.771  -2.520  1.00 1.00 ? 58  GLU A OE2  6  
ATOM   7572  H H    . GLU A 1 58 ? -1.342  13.681  -3.197  1.00 1.00 ? 58  GLU A H    6  
ATOM   7573  H HA   . GLU A 1 58 ? 0.320   12.144  -1.560  1.00 1.00 ? 58  GLU A HA   6  
ATOM   7574  H HB2  . GLU A 1 58 ? 1.611   14.218  -1.229  1.00 1.00 ? 58  GLU A HB2  6  
ATOM   7575  H HB3  . GLU A 1 58 ? 1.138   14.022  -2.917  1.00 1.00 ? 58  GLU A HB3  6  
ATOM   7576  H HG2  . GLU A 1 58 ? -0.810  15.515  -2.519  1.00 1.00 ? 58  GLU A HG2  6  
ATOM   7577  H HG3  . GLU A 1 58 ? -0.258  15.760  -0.863  1.00 1.00 ? 58  GLU A HG3  6  
ATOM   7578  N N    . ASP A 1 59 ? -1.760  14.082  0.050   1.00 1.00 ? 59  ASP A N    6  
ATOM   7579  C CA   . ASP A 1 59 ? -2.309  14.380  1.367   1.00 1.00 ? 59  ASP A CA   6  
ATOM   7580  C C    . ASP A 1 59 ? -2.763  13.103  2.060   1.00 1.00 ? 59  ASP A C    6  
ATOM   7581  O O    . ASP A 1 59 ? -2.692  12.988  3.285   1.00 1.00 ? 59  ASP A O    6  
ATOM   7582  C CB   . ASP A 1 59 ? -3.496  15.337  1.234   1.00 1.00 ? 59  ASP A CB   6  
ATOM   7583  C CG   . ASP A 1 59 ? -3.836  15.941  2.592   1.00 1.00 ? 59  ASP A CG   6  
ATOM   7584  O OD1  . ASP A 1 59 ? -3.444  15.360  3.590   1.00 1.00 ? 59  ASP A OD1  6  
ATOM   7585  O OD2  . ASP A 1 59 ? -4.480  16.976  2.614   1.00 1.00 ? 59  ASP A OD2  6  
ATOM   7586  H H    . ASP A 1 59 ? -2.197  14.447  -0.747  1.00 1.00 ? 59  ASP A H    6  
ATOM   7587  H HA   . ASP A 1 59 ? -1.547  14.849  1.966   1.00 1.00 ? 59  ASP A HA   6  
ATOM   7588  H HB2  . ASP A 1 59 ? -3.242  16.126  0.544   1.00 1.00 ? 59  ASP A HB2  6  
ATOM   7589  H HB3  . ASP A 1 59 ? -4.352  14.789  0.859   1.00 1.00 ? 59  ASP A HB3  6  
ATOM   7590  N N    . LYS A 1 60 ? -3.239  12.145  1.274   1.00 1.00 ? 60  LYS A N    6  
ATOM   7591  C CA   . LYS A 1 60 ? -3.705  10.884  1.823   1.00 1.00 ? 60  LYS A CA   6  
ATOM   7592  C C    . LYS A 1 60 ? -2.590  9.849   1.820   1.00 1.00 ? 60  LYS A C    6  
ATOM   7593  O O    . LYS A 1 60 ? -2.617  8.884   2.588   1.00 1.00 ? 60  LYS A O    6  
ATOM   7594  C CB   . LYS A 1 60 ? -4.893  10.365  1.003   1.00 1.00 ? 60  LYS A CB   6  
ATOM   7595  C CG   . LYS A 1 60 ? -5.303  8.975   1.517   1.00 1.00 ? 60  LYS A CG   6  
ATOM   7596  C CD   . LYS A 1 60 ? -4.630  7.889   0.665   1.00 1.00 ? 60  LYS A CD   6  
ATOM   7597  C CE   . LYS A 1 60 ? -5.593  7.424   -0.423  1.00 1.00 ? 60  LYS A CE   6  
ATOM   7598  N NZ   . LYS A 1 60 ? -5.001  6.277   -1.156  1.00 1.00 ? 60  LYS A NZ   6  
ATOM   7599  H H    . LYS A 1 60 ? -3.277  12.290  0.305   1.00 1.00 ? 60  LYS A H    6  
ATOM   7600  H HA   . LYS A 1 60 ? -4.037  11.018  2.837   1.00 1.00 ? 60  LYS A HA   6  
ATOM   7601  H HB2  . LYS A 1 60 ? -5.723  11.043  1.096   1.00 1.00 ? 60  LYS A HB2  6  
ATOM   7602  H HB3  . LYS A 1 60 ? -4.610  10.301  -0.038  1.00 1.00 ? 60  LYS A HB3  6  
ATOM   7603  H HG2  . LYS A 1 60 ? -4.998  8.864   2.550   1.00 1.00 ? 60  LYS A HG2  6  
ATOM   7604  H HG3  . LYS A 1 60 ? -6.377  8.876   1.458   1.00 1.00 ? 60  LYS A HG3  6  
ATOM   7605  H HD2  . LYS A 1 60 ? -3.739  8.290   0.201   1.00 1.00 ? 60  LYS A HD2  6  
ATOM   7606  H HD3  . LYS A 1 60 ? -4.358  7.062   1.286   1.00 1.00 ? 60  LYS A HD3  6  
ATOM   7607  H HE2  . LYS A 1 60 ? -6.527  7.120   0.029   1.00 1.00 ? 60  LYS A HE2  6  
ATOM   7608  H HE3  . LYS A 1 60 ? -5.785  8.238   -1.110  1.00 1.00 ? 60  LYS A HE3  6  
ATOM   7609  H HZ1  . LYS A 1 60 ? -4.203  6.607   -1.732  1.00 1.00 ? 60  LYS A HZ1  6  
ATOM   7610  H HZ2  . LYS A 1 60 ? -5.722  5.849   -1.774  1.00 1.00 ? 60  LYS A HZ2  6  
ATOM   7611  H HZ3  . LYS A 1 60 ? -4.666  5.569   -0.477  1.00 1.00 ? 60  LYS A HZ3  6  
ATOM   7612  N N    . ALA A 1 61 ? -1.612  10.042  0.942   1.00 1.00 ? 61  ALA A N    6  
ATOM   7613  C CA   . ALA A 1 61 ? -0.493  9.108   0.832   1.00 1.00 ? 61  ALA A CA   6  
ATOM   7614  C C    . ALA A 1 61 ? 0.786   9.743   1.344   1.00 1.00 ? 61  ALA A C    6  
ATOM   7615  O O    . ALA A 1 61 ? 1.832   9.670   0.694   1.00 1.00 ? 61  ALA A O    6  
ATOM   7616  C CB   . ALA A 1 61 ? -0.308  8.685   -0.626  1.00 1.00 ? 61  ALA A CB   6  
ATOM   7617  H H    . ALA A 1 61 ? -1.643  10.825  0.354   1.00 1.00 ? 61  ALA A H    6  
ATOM   7618  H HA   . ALA A 1 61 ? -0.703  8.226   1.419   1.00 1.00 ? 61  ALA A HA   6  
ATOM   7619  H HB1  . ALA A 1 61 ? -1.132  8.052   -0.926  1.00 1.00 ? 61  ALA A HB1  6  
ATOM   7620  H HB2  . ALA A 1 61 ? 0.619   8.139   -0.728  1.00 1.00 ? 61  ALA A HB2  6  
ATOM   7621  H HB3  . ALA A 1 61 ? -0.281  9.561   -1.255  1.00 1.00 ? 61  ALA A HB3  6  
ATOM   7622  N N    . GLN A 1 62 ? 0.708   10.369  2.513   1.00 1.00 ? 62  GLN A N    6  
ATOM   7623  C CA   . GLN A 1 62 ? 1.872   11.016  3.108   1.00 1.00 ? 62  GLN A CA   6  
ATOM   7624  C C    . GLN A 1 62 ? 2.212   10.376  4.450   1.00 1.00 ? 62  GLN A C    6  
ATOM   7625  O O    . GLN A 1 62 ? 3.366   10.387  4.882   1.00 1.00 ? 62  GLN A O    6  
ATOM   7626  C CB   . GLN A 1 62 ? 1.599   12.508  3.308   1.00 1.00 ? 62  GLN A CB   6  
ATOM   7627  C CG   . GLN A 1 62 ? 0.176   12.700  3.836   1.00 1.00 ? 62  GLN A CG   6  
ATOM   7628  C CD   . GLN A 1 62 ? -0.101  14.182  4.060   1.00 1.00 ? 62  GLN A CD   6  
ATOM   7629  O OE1  . GLN A 1 62 ? -1.101  14.541  4.683   1.00 1.00 ? 62  GLN A OE1  6  
ATOM   7630  N NE2  . GLN A 1 62 ? 0.728   15.071  3.584   1.00 1.00 ? 62  GLN A NE2  6  
ATOM   7631  H H    . GLN A 1 62 ? -0.150  10.399  2.985   1.00 1.00 ? 62  GLN A H    6  
ATOM   7632  H HA   . GLN A 1 62 ? 2.722   10.905  2.450   1.00 1.00 ? 62  GLN A HA   6  
ATOM   7633  H HB2  . GLN A 1 62 ? 2.305   12.914  4.019   1.00 1.00 ? 62  GLN A HB2  6  
ATOM   7634  H HB3  . GLN A 1 62 ? 1.704   13.022  2.365   1.00 1.00 ? 62  GLN A HB3  6  
ATOM   7635  H HG2  . GLN A 1 62 ? -0.524  12.309  3.117   1.00 1.00 ? 62  GLN A HG2  6  
ATOM   7636  H HG3  . GLN A 1 62 ? 0.066   12.171  4.771   1.00 1.00 ? 62  GLN A HG3  6  
ATOM   7637  H HE21 . GLN A 1 62 ? 1.522   14.782  3.088   1.00 1.00 ? 62  GLN A HE21 6  
ATOM   7638  H HE22 . GLN A 1 62 ? 0.557   16.026  3.724   1.00 1.00 ? 62  GLN A HE22 6  
ATOM   7639  N N    . ASP A 1 63 ? 1.198   9.824   5.111   1.00 1.00 ? 63  ASP A N    6  
ATOM   7640  C CA   . ASP A 1 63 ? 1.400   9.193   6.408   1.00 1.00 ? 63  ASP A CA   6  
ATOM   7641  C C    . ASP A 1 63 ? 0.427   8.038   6.604   1.00 1.00 ? 63  ASP A C    6  
ATOM   7642  O O    . ASP A 1 63 ? -0.389  8.047   7.526   1.00 1.00 ? 63  ASP A O    6  
ATOM   7643  C CB   . ASP A 1 63 ? 1.199   10.223  7.526   1.00 1.00 ? 63  ASP A CB   6  
ATOM   7644  C CG   . ASP A 1 63 ? 1.573   9.612   8.873   1.00 1.00 ? 63  ASP A CG   6  
ATOM   7645  O OD1  . ASP A 1 63 ? 2.157   8.541   8.874   1.00 1.00 ? 63  ASP A OD1  6  
ATOM   7646  O OD2  . ASP A 1 63 ? 1.271   10.225  9.884   1.00 1.00 ? 63  ASP A OD2  6  
ATOM   7647  H H    . ASP A 1 63 ? 0.301   9.844   4.722   1.00 1.00 ? 63  ASP A H    6  
ATOM   7648  H HA   . ASP A 1 63 ? 2.409   8.812   6.469   1.00 1.00 ? 63  ASP A HA   6  
ATOM   7649  H HB2  . ASP A 1 63 ? 1.823   11.083  7.337   1.00 1.00 ? 63  ASP A HB2  6  
ATOM   7650  H HB3  . ASP A 1 63 ? 0.164   10.530  7.549   1.00 1.00 ? 63  ASP A HB3  6  
ATOM   7651  N N    . ILE A 1 64 ? 0.519   7.041   5.731   1.00 1.00 ? 64  ILE A N    6  
ATOM   7652  C CA   . ILE A 1 64 ? -0.349  5.873   5.819   1.00 1.00 ? 64  ILE A CA   6  
ATOM   7653  C C    . ILE A 1 64 ? 0.287   4.800   6.701   1.00 1.00 ? 64  ILE A C    6  
ATOM   7654  O O    . ILE A 1 64 ? 1.441   4.428   6.503   1.00 1.00 ? 64  ILE A O    6  
ATOM   7655  C CB   . ILE A 1 64 ? -0.607  5.302   4.425   1.00 1.00 ? 64  ILE A CB   6  
ATOM   7656  C CG1  . ILE A 1 64 ? -1.356  6.341   3.584   1.00 1.00 ? 64  ILE A CG1  6  
ATOM   7657  C CG2  . ILE A 1 64 ? -1.450  4.029   4.539   1.00 1.00 ? 64  ILE A CG2  6  
ATOM   7658  C CD1  . ILE A 1 64 ? -2.703  6.668   4.238   1.00 1.00 ? 64  ILE A CD1  6  
ATOM   7659  H H    . ILE A 1 64 ? 1.186   7.088   5.014   1.00 1.00 ? 64  ILE A H    6  
ATOM   7660  H HA   . ILE A 1 64 ? -1.288  6.160   6.269   1.00 1.00 ? 64  ILE A HA   6  
ATOM   7661  H HB   . ILE A 1 64 ? 0.331   5.066   3.956   1.00 1.00 ? 64  ILE A HB   6  
ATOM   7662  H HG12 . ILE A 1 64 ? -0.761  7.241   3.515   1.00 1.00 ? 64  ILE A HG12 6  
ATOM   7663  H HG13 . ILE A 1 64 ? -1.528  5.947   2.594   1.00 1.00 ? 64  ILE A HG13 6  
ATOM   7664  H HG21 . ILE A 1 64 ? -0.846  3.226   4.912   1.00 1.00 ? 64  ILE A HG21 6  
ATOM   7665  H HG22 . ILE A 1 64 ? -1.847  3.777   3.569   1.00 1.00 ? 64  ILE A HG22 6  
ATOM   7666  H HG23 . ILE A 1 64 ? -2.276  4.212   5.222   1.00 1.00 ? 64  ILE A HG23 6  
ATOM   7667  H HD11 . ILE A 1 64 ? -3.056  5.825   4.812   1.00 1.00 ? 64  ILE A HD11 6  
ATOM   7668  H HD12 . ILE A 1 64 ? -3.426  6.900   3.482   1.00 1.00 ? 64  ILE A HD12 6  
ATOM   7669  H HD13 . ILE A 1 64 ? -2.581  7.516   4.900   1.00 1.00 ? 64  ILE A HD13 6  
ATOM   7670  N N    . SER A 1 65 ? -0.475  4.305   7.666   1.00 1.00 ? 65  SER A N    6  
ATOM   7671  C CA   . SER A 1 65 ? 0.010   3.271   8.570   1.00 1.00 ? 65  SER A CA   6  
ATOM   7672  C C    . SER A 1 65 ? 0.419   2.025   7.784   1.00 1.00 ? 65  SER A C    6  
ATOM   7673  O O    . SER A 1 65 ? 0.496   2.052   6.558   1.00 1.00 ? 65  SER A O    6  
ATOM   7674  C CB   . SER A 1 65 ? -1.060  2.907   9.594   1.00 1.00 ? 65  SER A CB   6  
ATOM   7675  O OG   . SER A 1 65 ? -1.601  1.633   9.279   1.00 1.00 ? 65  SER A OG   6  
ATOM   7676  H H    . SER A 1 65 ? -1.394  4.640   7.774   1.00 1.00 ? 65  SER A H    6  
ATOM   7677  H HA   . SER A 1 65 ? 0.885   3.653   9.088   1.00 1.00 ? 65  SER A HA   6  
ATOM   7678  H HB2  . SER A 1 65 ? -0.630  2.873   10.582  1.00 1.00 ? 65  SER A HB2  6  
ATOM   7679  H HB3  . SER A 1 65 ? -1.840  3.657   9.571   1.00 1.00 ? 65  SER A HB3  6  
ATOM   7680  H HG   . SER A 1 65 ? -1.885  1.221   10.093  1.00 1.00 ? 65  SER A HG   6  
ATOM   7681  N N    . THR A 1 66 ? 0.682   0.942   8.505   1.00 1.00 ? 66  THR A N    6  
ATOM   7682  C CA   . THR A 1 66 ? 1.082   -0.310  7.872   1.00 1.00 ? 66  THR A CA   6  
ATOM   7683  C C    . THR A 1 66 ? 0.109   -0.676  6.753   1.00 1.00 ? 66  THR A C    6  
ATOM   7684  O O    . THR A 1 66 ? -0.778  0.100   6.404   1.00 1.00 ? 66  THR A O    6  
ATOM   7685  C CB   . THR A 1 66 ? 1.118   -1.434  8.909   1.00 1.00 ? 66  THR A CB   6  
ATOM   7686  O OG1  . THR A 1 66 ? 1.229   -2.686  8.246   1.00 1.00 ? 66  THR A OG1  6  
ATOM   7687  C CG2  . THR A 1 66 ? -0.167  -1.408  9.741   1.00 1.00 ? 66  THR A CG2  6  
ATOM   7688  H H    . THR A 1 66 ? 0.598   0.980   9.483   1.00 1.00 ? 66  THR A H    6  
ATOM   7689  H HA   . THR A 1 66 ? 2.064   -0.187  7.451   1.00 1.00 ? 66  THR A HA   6  
ATOM   7690  H HB   . THR A 1 66 ? 1.967   -1.296  9.556   1.00 1.00 ? 66  THR A HB   6  
ATOM   7691  H HG1  . THR A 1 66 ? 0.352   -2.944  7.953   1.00 1.00 ? 66  THR A HG1  6  
ATOM   7692  H HG21 . THR A 1 66 ? -0.542  -2.416  9.846   1.00 1.00 ? 66  THR A HG21 6  
ATOM   7693  H HG22 . THR A 1 66 ? -0.913  -0.792  9.248   1.00 1.00 ? 66  THR A HG22 6  
ATOM   7694  H HG23 . THR A 1 66 ? 0.042   -0.997  10.717  1.00 1.00 ? 66  THR A HG23 6  
ATOM   7695  N N    . ILE A 1 67 ? 0.281   -1.869  6.196   1.00 1.00 ? 67  ILE A N    6  
ATOM   7696  C CA   . ILE A 1 67 ? -0.576  -2.327  5.113   1.00 1.00 ? 67  ILE A CA   6  
ATOM   7697  C C    . ILE A 1 67 ? -2.027  -2.407  5.566   1.00 1.00 ? 67  ILE A C    6  
ATOM   7698  O O    . ILE A 1 67 ? -2.944  -2.361  4.743   1.00 1.00 ? 67  ILE A O    6  
ATOM   7699  C CB   . ILE A 1 67 ? -0.109  -3.703  4.618   1.00 1.00 ? 67  ILE A CB   6  
ATOM   7700  C CG1  . ILE A 1 67 ? 1.239   -3.560  3.904   1.00 1.00 ? 67  ILE A CG1  6  
ATOM   7701  C CG2  . ILE A 1 67 ? -1.141  -4.277  3.647   1.00 1.00 ? 67  ILE A CG2  6  
ATOM   7702  C CD1  . ILE A 1 67 ? 1.839   -4.948  3.670   1.00 1.00 ? 67  ILE A CD1  6  
ATOM   7703  H H    . ILE A 1 67 ? 1.000   -2.456  6.521   1.00 1.00 ? 67  ILE A H    6  
ATOM   7704  H HA   . ILE A 1 67 ? -0.498  -1.631  4.294   1.00 1.00 ? 67  ILE A HA   6  
ATOM   7705  H HB   . ILE A 1 67 ? -0.001  -4.369  5.465   1.00 1.00 ? 67  ILE A HB   6  
ATOM   7706  H HG12 . ILE A 1 67 ? 1.094   -3.062  2.953   1.00 1.00 ? 67  ILE A HG12 6  
ATOM   7707  H HG13 . ILE A 1 67 ? 1.912   -2.975  4.509   1.00 1.00 ? 67  ILE A HG13 6  
ATOM   7708  H HG21 . ILE A 1 67 ? -0.715  -5.114  3.120   1.00 1.00 ? 67  ILE A HG21 6  
ATOM   7709  H HG22 . ILE A 1 67 ? -1.434  -3.514  2.941   1.00 1.00 ? 67  ILE A HG22 6  
ATOM   7710  H HG23 . ILE A 1 67 ? -2.007  -4.602  4.204   1.00 1.00 ? 67  ILE A HG23 6  
ATOM   7711  H HD11 . ILE A 1 67 ? 1.082   -5.605  3.270   1.00 1.00 ? 67  ILE A HD11 6  
ATOM   7712  H HD12 . ILE A 1 67 ? 2.202   -5.346  4.606   1.00 1.00 ? 67  ILE A HD12 6  
ATOM   7713  H HD13 . ILE A 1 67 ? 2.657   -4.872  2.969   1.00 1.00 ? 67  ILE A HD13 6  
ATOM   7714  N N    . GLN A 1 68 ? -2.226  -2.541  6.868   1.00 1.00 ? 68  GLN A N    6  
ATOM   7715  C CA   . GLN A 1 68 ? -3.573  -2.651  7.406   1.00 1.00 ? 68  GLN A CA   6  
ATOM   7716  C C    . GLN A 1 68 ? -4.400  -1.422  7.065   1.00 1.00 ? 68  GLN A C    6  
ATOM   7717  O O    . GLN A 1 68 ? -5.493  -1.537  6.510   1.00 1.00 ? 68  GLN A O    6  
ATOM   7718  C CB   . GLN A 1 68 ? -3.504  -2.806  8.937   1.00 1.00 ? 68  GLN A CB   6  
ATOM   7719  C CG   . GLN A 1 68 ? -3.105  -4.243  9.292   1.00 1.00 ? 68  GLN A CG   6  
ATOM   7720  C CD   . GLN A 1 68 ? -4.333  -5.151  9.255   1.00 1.00 ? 68  GLN A CD   6  
ATOM   7721  O OE1  . GLN A 1 68 ? -4.906  -5.458  10.299  1.00 1.00 ? 68  GLN A OE1  6  
ATOM   7722  N NE2  . GLN A 1 68 ? -4.776  -5.588  8.108   1.00 1.00 ? 68  GLN A NE2  6  
ATOM   7723  H H    . GLN A 1 68 ? -1.455  -2.578  7.472   1.00 1.00 ? 68  GLN A H    6  
ATOM   7724  H HA   . GLN A 1 68 ? -4.051  -3.528  6.996   1.00 1.00 ? 68  GLN A HA   6  
ATOM   7725  H HB2  . GLN A 1 68 ? -2.775  -2.123  9.334   1.00 1.00 ? 68  GLN A HB2  6  
ATOM   7726  H HB3  . GLN A 1 68 ? -4.469  -2.586  9.367   1.00 1.00 ? 68  GLN A HB3  6  
ATOM   7727  H HG2  . GLN A 1 68 ? -2.377  -4.599  8.578   1.00 1.00 ? 68  GLN A HG2  6  
ATOM   7728  H HG3  . GLN A 1 68 ? -2.676  -4.263  10.280  1.00 1.00 ? 68  GLN A HG3  6  
ATOM   7729  H HE21 . GLN A 1 68 ? -4.322  -5.334  7.278   1.00 1.00 ? 68  GLN A HE21 6  
ATOM   7730  H HE22 . GLN A 1 68 ? -5.565  -6.167  8.078   1.00 1.00 ? 68  GLN A HE22 6  
ATOM   7731  N N    . GLN A 1 69 ? -3.873  -0.249  7.392   1.00 1.00 ? 69  GLN A N    6  
ATOM   7732  C CA   . GLN A 1 69 ? -4.575  0.994   7.114   1.00 1.00 ? 69  GLN A CA   6  
ATOM   7733  C C    . GLN A 1 69 ? -4.649  1.256   5.617   1.00 1.00 ? 69  GLN A C    6  
ATOM   7734  O O    . GLN A 1 69 ? -5.669  1.717   5.106   1.00 1.00 ? 69  GLN A O    6  
ATOM   7735  C CB   . GLN A 1 69 ? -3.864  2.162   7.805   1.00 1.00 ? 69  GLN A CB   6  
ATOM   7736  C CG   . GLN A 1 69 ? -4.641  3.455   7.558   1.00 1.00 ? 69  GLN A CG   6  
ATOM   7737  C CD   . GLN A 1 69 ? -4.075  4.580   8.417   1.00 1.00 ? 69  GLN A CD   6  
ATOM   7738  O OE1  . GLN A 1 69 ? -4.038  4.467   9.643   1.00 1.00 ? 69  GLN A OE1  6  
ATOM   7739  N NE2  . GLN A 1 69 ? -3.624  5.663   7.845   1.00 1.00 ? 69  GLN A NE2  6  
ATOM   7740  H H    . GLN A 1 69 ? -2.998  -0.213  7.827   1.00 1.00 ? 69  GLN A H    6  
ATOM   7741  H HA   . GLN A 1 69 ? -5.580  0.923   7.509   1.00 1.00 ? 69  GLN A HA   6  
ATOM   7742  H HB2  . GLN A 1 69 ? -3.811  1.974   8.864   1.00 1.00 ? 69  GLN A HB2  6  
ATOM   7743  H HB3  . GLN A 1 69 ? -2.869  2.266   7.398   1.00 1.00 ? 69  GLN A HB3  6  
ATOM   7744  H HG2  . GLN A 1 69 ? -4.560  3.721   6.518   1.00 1.00 ? 69  GLN A HG2  6  
ATOM   7745  H HG3  . GLN A 1 69 ? -5.676  3.297   7.812   1.00 1.00 ? 69  GLN A HG3  6  
ATOM   7746  H HE21 . GLN A 1 69 ? -3.651  5.746   6.871   1.00 1.00 ? 69  GLN A HE21 6  
ATOM   7747  H HE22 . GLN A 1 69 ? -3.255  6.387   8.392   1.00 1.00 ? 69  GLN A HE22 6  
ATOM   7748  N N    . ALA A 1 70 ? -3.560  0.959   4.919   1.00 1.00 ? 70  ALA A N    6  
ATOM   7749  C CA   . ALA A 1 70 ? -3.509  1.177   3.478   1.00 1.00 ? 70  ALA A CA   6  
ATOM   7750  C C    . ALA A 1 70 ? -4.651  0.452   2.782   1.00 1.00 ? 70  ALA A C    6  
ATOM   7751  O O    . ALA A 1 70 ? -5.363  1.039   1.965   1.00 1.00 ? 70  ALA A O    6  
ATOM   7752  C CB   . ALA A 1 70 ? -2.175  0.675   2.924   1.00 1.00 ? 70  ALA A CB   6  
ATOM   7753  H H    . ALA A 1 70 ? -2.776  0.592   5.383   1.00 1.00 ? 70  ALA A H    6  
ATOM   7754  H HA   . ALA A 1 70 ? -3.588  2.235   3.281   1.00 1.00 ? 70  ALA A HA   6  
ATOM   7755  H HB1  . ALA A 1 70 ? -2.179  0.739   1.849   1.00 1.00 ? 70  ALA A HB1  6  
ATOM   7756  H HB2  . ALA A 1 70 ? -2.028  -0.353  3.215   1.00 1.00 ? 70  ALA A HB2  6  
ATOM   7757  H HB3  . ALA A 1 70 ? -1.367  1.276   3.317   1.00 1.00 ? 70  ALA A HB3  6  
ATOM   7758  N N    . ALA A 1 71 ? -4.826  -0.822  3.110   1.00 1.00 ? 71  ALA A N    6  
ATOM   7759  C CA   . ALA A 1 71 ? -5.888  -1.615  2.505   1.00 1.00 ? 71  ALA A CA   6  
ATOM   7760  C C    . ALA A 1 71 ? -7.254  -1.021  2.822   1.00 1.00 ? 71  ALA A C    6  
ATOM   7761  O O    . ALA A 1 71 ? -8.125  -0.946  1.956   1.00 1.00 ? 71  ALA A O    6  
ATOM   7762  C CB   . ALA A 1 71 ? -5.826  -3.053  3.030   1.00 1.00 ? 71  ALA A CB   6  
ATOM   7763  H H    . ALA A 1 71 ? -4.230  -1.236  3.769   1.00 1.00 ? 71  ALA A H    6  
ATOM   7764  H HA   . ALA A 1 71 ? -5.750  -1.632  1.436   1.00 1.00 ? 71  ALA A HA   6  
ATOM   7765  H HB1  . ALA A 1 71 ? -6.649  -3.622  2.623   1.00 1.00 ? 71  ALA A HB1  6  
ATOM   7766  H HB2  . ALA A 1 71 ? -5.889  -3.046  4.108   1.00 1.00 ? 71  ALA A HB2  6  
ATOM   7767  H HB3  . ALA A 1 71 ? -4.894  -3.507  2.730   1.00 1.00 ? 71  ALA A HB3  6  
ATOM   7768  N N    . ASP A 1 72 ? -7.434  -0.592  4.067   1.00 1.00 ? 72  ASP A N    6  
ATOM   7769  C CA   . ASP A 1 72 ? -8.699  -0.005  4.485   1.00 1.00 ? 72  ASP A CA   6  
ATOM   7770  C C    . ASP A 1 72 ? -8.963  1.299   3.742   1.00 1.00 ? 72  ASP A C    6  
ATOM   7771  O O    . ASP A 1 72 ? -10.090 1.578   3.335   1.00 1.00 ? 72  ASP A O    6  
ATOM   7772  C CB   . ASP A 1 72 ? -8.679  0.260   5.992   1.00 1.00 ? 72  ASP A CB   6  
ATOM   7773  C CG   . ASP A 1 72 ? -10.012 0.852   6.439   1.00 1.00 ? 72  ASP A CG   6  
ATOM   7774  O OD1  . ASP A 1 72 ? -10.822 1.154   5.577   1.00 1.00 ? 72  ASP A OD1  6  
ATOM   7775  O OD2  . ASP A 1 72 ? -10.207 0.989   7.635   1.00 1.00 ? 72  ASP A OD2  6  
ATOM   7776  H H    . ASP A 1 72 ? -6.702  -0.673  4.714   1.00 1.00 ? 72  ASP A H    6  
ATOM   7777  H HA   . ASP A 1 72 ? -9.496  -0.703  4.266   1.00 1.00 ? 72  ASP A HA   6  
ATOM   7778  H HB2  . ASP A 1 72 ? -8.502  -0.666  6.518   1.00 1.00 ? 72  ASP A HB2  6  
ATOM   7779  H HB3  . ASP A 1 72 ? -7.886  0.958   6.222   1.00 1.00 ? 72  ASP A HB3  6  
ATOM   7780  N N    . VAL A 1 73 ? -7.915  2.095   3.569   1.00 1.00 ? 73  VAL A N    6  
ATOM   7781  C CA   . VAL A 1 73 ? -8.043  3.367   2.877   1.00 1.00 ? 73  VAL A CA   6  
ATOM   7782  C C    . VAL A 1 73 ? -8.436  3.158   1.417   1.00 1.00 ? 73  VAL A C    6  
ATOM   7783  O O    . VAL A 1 73 ? -9.305  3.855   0.893   1.00 1.00 ? 73  VAL A O    6  
ATOM   7784  C CB   . VAL A 1 73 ? -6.721  4.137   2.944   1.00 1.00 ? 73  VAL A CB   6  
ATOM   7785  C CG1  . VAL A 1 73 ? -6.774  5.344   1.997   1.00 1.00 ? 73  VAL A CG1  6  
ATOM   7786  C CG2  . VAL A 1 73 ? -6.488  4.628   4.376   1.00 1.00 ? 73  VAL A CG2  6  
ATOM   7787  H H    . VAL A 1 73 ? -7.036  1.821   3.913   1.00 1.00 ? 73  VAL A H    6  
ATOM   7788  H HA   . VAL A 1 73 ? -8.809  3.958   3.366   1.00 1.00 ? 73  VAL A HA   6  
ATOM   7789  H HB   . VAL A 1 73 ? -5.912  3.484   2.650   1.00 1.00 ? 73  VAL A HB   6  
ATOM   7790  H HG11 . VAL A 1 73 ? -6.107  6.110   2.343   1.00 1.00 ? 73  VAL A HG11 6  
ATOM   7791  H HG12 . VAL A 1 73 ? -7.783  5.733   1.964   1.00 1.00 ? 73  VAL A HG12 6  
ATOM   7792  H HG13 . VAL A 1 73 ? -6.482  5.027   1.004   1.00 1.00 ? 73  VAL A HG13 6  
ATOM   7793  H HG21 . VAL A 1 73 ? -6.692  3.831   5.069   1.00 1.00 ? 73  VAL A HG21 6  
ATOM   7794  H HG22 . VAL A 1 73 ? -7.142  5.464   4.579   1.00 1.00 ? 73  VAL A HG22 6  
ATOM   7795  H HG23 . VAL A 1 73 ? -5.459  4.947   4.481   1.00 1.00 ? 73  VAL A HG23 6  
ATOM   7796  N N    . ILE A 1 74 ? -7.795  2.192   0.776   1.00 1.00 ? 74  ILE A N    6  
ATOM   7797  C CA   . ILE A 1 74 ? -8.089  1.897   -0.618  1.00 1.00 ? 74  ILE A CA   6  
ATOM   7798  C C    . ILE A 1 74 ? -9.536  1.457   -0.786  1.00 1.00 ? 74  ILE A C    6  
ATOM   7799  O O    . ILE A 1 74 ? -10.213 1.878   -1.725  1.00 1.00 ? 74  ILE A O    6  
ATOM   7800  C CB   . ILE A 1 74 ? -7.156  0.798   -1.131  1.00 1.00 ? 74  ILE A CB   6  
ATOM   7801  C CG1  . ILE A 1 74 ? -5.741  1.362   -1.310  1.00 1.00 ? 74  ILE A CG1  6  
ATOM   7802  C CG2  . ILE A 1 74 ? -7.667  0.251   -2.466  1.00 1.00 ? 74  ILE A CG2  6  
ATOM   7803  C CD1  . ILE A 1 74 ? -4.735  0.210   -1.406  1.00 1.00 ? 74  ILE A CD1  6  
ATOM   7804  H H    . ILE A 1 74 ? -7.112  1.669   1.247   1.00 1.00 ? 74  ILE A H    6  
ATOM   7805  H HA   . ILE A 1 74 ? -7.917  2.787   -1.210  1.00 1.00 ? 74  ILE A HA   6  
ATOM   7806  H HB   . ILE A 1 74 ? -7.117  -0.008  -0.407  1.00 1.00 ? 74  ILE A HB   6  
ATOM   7807  H HG12 . ILE A 1 74 ? -5.707  1.938   -2.229  1.00 1.00 ? 74  ILE A HG12 6  
ATOM   7808  H HG13 . ILE A 1 74 ? -5.491  1.991   -0.481  1.00 1.00 ? 74  ILE A HG13 6  
ATOM   7809  H HG21 . ILE A 1 74 ? -6.860  -0.210  -3.006  1.00 1.00 ? 74  ILE A HG21 6  
ATOM   7810  H HG22 . ILE A 1 74 ? -8.076  1.064   -3.043  1.00 1.00 ? 74  ILE A HG22 6  
ATOM   7811  H HG23 . ILE A 1 74 ? -8.442  -0.477  -2.278  1.00 1.00 ? 74  ILE A HG23 6  
ATOM   7812  H HD11 . ILE A 1 74 ? -4.268  0.069   -0.444  1.00 1.00 ? 74  ILE A HD11 6  
ATOM   7813  H HD12 . ILE A 1 74 ? -3.984  0.445   -2.143  1.00 1.00 ? 74  ILE A HD12 6  
ATOM   7814  H HD13 . ILE A 1 74 ? -5.242  -0.700  -1.695  1.00 1.00 ? 74  ILE A HD13 6  
ATOM   7815  N N    . GLU A 1 75 ? -9.999  0.611   0.122   1.00 1.00 ? 75  GLU A N    6  
ATOM   7816  C CA   . GLU A 1 75 ? -11.371 0.125   0.061   1.00 1.00 ? 75  GLU A CA   6  
ATOM   7817  C C    . GLU A 1 75 ? -12.342 1.280   -0.148  1.00 1.00 ? 75  GLU A C    6  
ATOM   7818  O O    . GLU A 1 75 ? -13.247 1.196   -0.977  1.00 1.00 ? 75  GLU A O    6  
ATOM   7819  C CB   . GLU A 1 75 ? -11.721 -0.612  1.360   1.00 1.00 ? 75  GLU A CB   6  
ATOM   7820  C CG   . GLU A 1 75 ? -11.133 -2.024  1.326   1.00 1.00 ? 75  GLU A CG   6  
ATOM   7821  C CD   . GLU A 1 75 ? -11.400 -2.732  2.647   1.00 1.00 ? 75  GLU A CD   6  
ATOM   7822  O OE1  . GLU A 1 75 ? -11.930 -2.095  3.542   1.00 1.00 ? 75  GLU A OE1  6  
ATOM   7823  O OE2  . GLU A 1 75 ? -11.081 -3.900  2.739   1.00 1.00 ? 75  GLU A OE2  6  
ATOM   7824  H H    . GLU A 1 75 ? -9.409  0.309   0.843   1.00 1.00 ? 75  GLU A H    6  
ATOM   7825  H HA   . GLU A 1 75 ? -11.465 -0.565  -0.763  1.00 1.00 ? 75  GLU A HA   6  
ATOM   7826  H HB2  . GLU A 1 75 ? -11.303 -0.072  2.199   1.00 1.00 ? 75  GLU A HB2  6  
ATOM   7827  H HB3  . GLU A 1 75 ? -12.792 -0.672  1.468   1.00 1.00 ? 75  GLU A HB3  6  
ATOM   7828  H HG2  . GLU A 1 75 ? -11.592 -2.578  0.520   1.00 1.00 ? 75  GLU A HG2  6  
ATOM   7829  H HG3  . GLU A 1 75 ? -10.070 -1.966  1.159   1.00 1.00 ? 75  GLU A HG3  6  
ATOM   7830  N N    . GLY A 1 76 ? -12.151 2.352   0.608   1.00 1.00 ? 76  GLY A N    6  
ATOM   7831  C CA   . GLY A 1 76 ? -13.018 3.520   0.496   1.00 1.00 ? 76  GLY A CA   6  
ATOM   7832  C C    . GLY A 1 76 ? -12.887 4.164   -0.880  1.00 1.00 ? 76  GLY A C    6  
ATOM   7833  O O    . GLY A 1 76 ? -13.882 4.569   -1.482  1.00 1.00 ? 76  GLY A O    6  
ATOM   7834  H H    . GLY A 1 76 ? -11.412 2.361   1.252   1.00 1.00 ? 76  GLY A H    6  
ATOM   7835  H HA2  . GLY A 1 76 ? -14.044 3.214   0.650   1.00 1.00 ? 76  GLY A HA2  6  
ATOM   7836  H HA3  . GLY A 1 76 ? -12.744 4.240   1.250   1.00 1.00 ? 76  GLY A HA3  6  
ATOM   7837  N N    . LEU A 1 77 ? -11.658 4.252   -1.371  1.00 1.00 ? 77  LEU A N    6  
ATOM   7838  C CA   . LEU A 1 77 ? -11.410 4.843   -2.681  1.00 1.00 ? 77  LEU A CA   6  
ATOM   7839  C C    . LEU A 1 77 ? -12.080 4.028   -3.777  1.00 1.00 ? 77  LEU A C    6  
ATOM   7840  O O    . LEU A 1 77 ? -12.639 4.581   -4.724  1.00 1.00 ? 77  LEU A O    6  
ATOM   7841  C CB   . LEU A 1 77 ? -9.911  4.913   -2.943  1.00 1.00 ? 77  LEU A CB   6  
ATOM   7842  C CG   . LEU A 1 77 ? -9.279  5.984   -2.048  1.00 1.00 ? 77  LEU A CG   6  
ATOM   7843  C CD1  . LEU A 1 77 ? -7.749  5.866   -2.102  1.00 1.00 ? 77  LEU A CD1  6  
ATOM   7844  C CD2  . LEU A 1 77 ? -9.706  7.377   -2.539  1.00 1.00 ? 77  LEU A CD2  6  
ATOM   7845  H H    . LEU A 1 77 ? -10.902 3.913   -0.847  1.00 1.00 ? 77  LEU A H    6  
ATOM   7846  H HA   . LEU A 1 77 ? -11.818 5.838   -2.694  1.00 1.00 ? 77  LEU A HA   6  
ATOM   7847  H HB2  . LEU A 1 77 ? -9.463  3.959   -2.720  1.00 1.00 ? 77  LEU A HB2  6  
ATOM   7848  H HB3  . LEU A 1 77 ? -9.726  5.163   -3.981  1.00 1.00 ? 77  LEU A HB3  6  
ATOM   7849  H HG   . LEU A 1 77 ? -9.610  5.845   -1.029  1.00 1.00 ? 77  LEU A HG   6  
ATOM   7850  H HD11 . LEU A 1 77 ? -7.314  6.851   -2.165  1.00 1.00 ? 77  LEU A HD11 6  
ATOM   7851  H HD12 . LEU A 1 77 ? -7.455  5.300   -2.973  1.00 1.00 ? 77  LEU A HD12 6  
ATOM   7852  H HD13 . LEU A 1 77 ? -7.398  5.370   -1.212  1.00 1.00 ? 77  LEU A HD13 6  
ATOM   7853  H HD21 . LEU A 1 77 ? -9.807  7.372   -3.612  1.00 1.00 ? 77  LEU A HD21 6  
ATOM   7854  H HD22 . LEU A 1 77 ? -8.951  8.102   -2.259  1.00 1.00 ? 77  LEU A HD22 6  
ATOM   7855  H HD23 . LEU A 1 77 ? -10.640 7.648   -2.084  1.00 1.00 ? 77  LEU A HD23 6  
ATOM   7856  N N    . LEU A 1 78 ? -12.022 2.709   -3.645  1.00 1.00 ? 78  LEU A N    6  
ATOM   7857  C CA   . LEU A 1 78 ? -12.625 1.822   -4.634  1.00 1.00 ? 78  LEU A CA   6  
ATOM   7858  C C    . LEU A 1 78 ? -14.123 2.071   -4.730  1.00 1.00 ? 78  LEU A C    6  
ATOM   7859  O O    . LEU A 1 78 ? -14.703 1.997   -5.814  1.00 1.00 ? 78  LEU A O    6  
ATOM   7860  C CB   . LEU A 1 78 ? -12.364 0.363   -4.249  1.00 1.00 ? 78  LEU A CB   6  
ATOM   7861  C CG   . LEU A 1 78 ? -10.938 -0.029  -4.648  1.00 1.00 ? 78  LEU A CG   6  
ATOM   7862  C CD1  . LEU A 1 78 ? -10.521 -1.288  -3.885  1.00 1.00 ? 78  LEU A CD1  6  
ATOM   7863  C CD2  . LEU A 1 78 ? -10.888 -0.308  -6.157  1.00 1.00 ? 78  LEU A CD2  6  
ATOM   7864  H H    . LEU A 1 78 ? -11.563 2.323   -2.868  1.00 1.00 ? 78  LEU A H    6  
ATOM   7865  H HA   . LEU A 1 78 ? -12.178 2.021   -5.593  1.00 1.00 ? 78  LEU A HA   6  
ATOM   7866  H HB2  . LEU A 1 78 ? -12.486 0.247   -3.186  1.00 1.00 ? 78  LEU A HB2  6  
ATOM   7867  H HB3  . LEU A 1 78 ? -13.072 -0.274  -4.758  1.00 1.00 ? 78  LEU A HB3  6  
ATOM   7868  H HG   . LEU A 1 78 ? -10.263 0.779   -4.410  1.00 1.00 ? 78  LEU A HG   6  
ATOM   7869  H HD11 . LEU A 1 78 ? -10.615 -1.110  -2.828  1.00 1.00 ? 78  LEU A HD11 6  
ATOM   7870  H HD12 . LEU A 1 78 ? -9.494  -1.524  -4.121  1.00 1.00 ? 78  LEU A HD12 6  
ATOM   7871  H HD13 . LEU A 1 78 ? -11.158 -2.110  -4.172  1.00 1.00 ? 78  LEU A HD13 6  
ATOM   7872  H HD21 . LEU A 1 78 ? -10.823 0.622   -6.696  1.00 1.00 ? 78  LEU A HD21 6  
ATOM   7873  H HD22 . LEU A 1 78 ? -11.777 -0.839  -6.462  1.00 1.00 ? 78  LEU A HD22 6  
ATOM   7874  H HD23 . LEU A 1 78 ? -10.023 -0.911  -6.382  1.00 1.00 ? 78  LEU A HD23 6  
ATOM   7875  N N    . GLU A 1 79 ? -14.746 2.354   -3.592  1.00 1.00 ? 79  GLU A N    6  
ATOM   7876  C CA   . GLU A 1 79 ? -16.180 2.605   -3.566  1.00 1.00 ? 79  GLU A CA   6  
ATOM   7877  C C    . GLU A 1 79 ? -16.502 3.929   -4.252  1.00 1.00 ? 79  GLU A C    6  
ATOM   7878  O O    . GLU A 1 79 ? -17.255 3.970   -5.223  1.00 1.00 ? 79  GLU A O    6  
ATOM   7879  C CB   . GLU A 1 79 ? -16.671 2.646   -2.115  1.00 1.00 ? 79  GLU A CB   6  
ATOM   7880  C CG   . GLU A 1 79 ? -16.491 1.269   -1.474  1.00 1.00 ? 79  GLU A CG   6  
ATOM   7881  C CD   . GLU A 1 79 ? -17.449 0.269   -2.112  1.00 1.00 ? 79  GLU A CD   6  
ATOM   7882  O OE1  . GLU A 1 79 ? -18.427 0.706   -2.697  1.00 1.00 ? 79  GLU A OE1  6  
ATOM   7883  O OE2  . GLU A 1 79 ? -17.195 -0.919  -2.002  1.00 1.00 ? 79  GLU A OE2  6  
ATOM   7884  H H    . GLU A 1 79 ? -14.232 2.398   -2.757  1.00 1.00 ? 79  GLU A H    6  
ATOM   7885  H HA   . GLU A 1 79 ? -16.689 1.811   -4.083  1.00 1.00 ? 79  GLU A HA   6  
ATOM   7886  H HB2  . GLU A 1 79 ? -16.103 3.380   -1.560  1.00 1.00 ? 79  GLU A HB2  6  
ATOM   7887  H HB3  . GLU A 1 79 ? -17.718 2.915   -2.096  1.00 1.00 ? 79  GLU A HB3  6  
ATOM   7888  H HG2  . GLU A 1 79 ? -15.475 0.936   -1.628  1.00 1.00 ? 79  GLU A HG2  6  
ATOM   7889  H HG3  . GLU A 1 79 ? -16.690 1.340   -0.419  1.00 1.00 ? 79  GLU A HG3  6  
ATOM   7890  N N    . LYS A 1 80 ? -15.931 5.014   -3.735  1.00 1.00 ? 80  LYS A N    6  
ATOM   7891  C CA   . LYS A 1 80 ? -16.176 6.339   -4.298  1.00 1.00 ? 80  LYS A CA   6  
ATOM   7892  C C    . LYS A 1 80 ? -15.257 7.371   -3.654  1.00 1.00 ? 80  LYS A C    6  
ATOM   7893  O O    . LYS A 1 80 ? -15.035 8.444   -4.209  1.00 1.00 ? 80  LYS A O    6  
ATOM   7894  C CB   . LYS A 1 80 ? -17.644 6.741   -4.068  1.00 1.00 ? 80  LYS A CB   6  
ATOM   7895  C CG   . LYS A 1 80 ? -18.107 6.237   -2.694  1.00 1.00 ? 80  LYS A CG   6  
ATOM   7896  C CD   . LYS A 1 80 ? -17.888 7.331   -1.645  1.00 1.00 ? 80  LYS A CD   6  
ATOM   7897  C CE   . LYS A 1 80 ? -18.051 6.738   -0.249  1.00 1.00 ? 80  LYS A CE   6  
ATOM   7898  N NZ   . LYS A 1 80 ? -17.659 7.755   0.769   1.00 1.00 ? 80  LYS A NZ   6  
ATOM   7899  H H    . LYS A 1 80 ? -15.349 4.924   -2.948  1.00 1.00 ? 80  LYS A H    6  
ATOM   7900  H HA   . LYS A 1 80 ? -15.989 6.308   -5.353  1.00 1.00 ? 80  LYS A HA   6  
ATOM   7901  H HB2  . LYS A 1 80 ? -17.734 7.820   -4.113  1.00 1.00 ? 80  LYS A HB2  6  
ATOM   7902  H HB3  . LYS A 1 80 ? -18.260 6.303   -4.839  1.00 1.00 ? 80  LYS A HB3  6  
ATOM   7903  H HG2  . LYS A 1 80 ? -19.158 5.987   -2.740  1.00 1.00 ? 80  LYS A HG2  6  
ATOM   7904  H HG3  . LYS A 1 80 ? -17.560 5.363   -2.404  1.00 1.00 ? 80  LYS A HG3  6  
ATOM   7905  H HD2  . LYS A 1 80 ? -16.899 7.739   -1.752  1.00 1.00 ? 80  LYS A HD2  6  
ATOM   7906  H HD3  . LYS A 1 80 ? -18.614 8.118   -1.793  1.00 1.00 ? 80  LYS A HD3  6  
ATOM   7907  H HE2  . LYS A 1 80 ? -19.079 6.452   -0.098  1.00 1.00 ? 80  LYS A HE2  6  
ATOM   7908  H HE3  . LYS A 1 80 ? -17.416 5.866   -0.151  1.00 1.00 ? 80  LYS A HE3  6  
ATOM   7909  H HZ1  . LYS A 1 80 ? -17.246 7.277   1.594   1.00 1.00 ? 80  LYS A HZ1  6  
ATOM   7910  H HZ2  . LYS A 1 80 ? -18.501 8.293   1.061   1.00 1.00 ? 80  LYS A HZ2  6  
ATOM   7911  H HZ3  . LYS A 1 80 ? -16.958 8.404   0.359   1.00 1.00 ? 80  LYS A HZ3  6  
ATOM   7912  N N    . LYS A 1 81 ? -14.740 7.042   -2.472  1.00 1.00 ? 81  LYS A N    6  
ATOM   7913  C CA   . LYS A 1 81 ? -13.852 7.954   -1.762  1.00 1.00 ? 81  LYS A CA   6  
ATOM   7914  C C    . LYS A 1 81 ? -13.257 7.273   -0.534  1.00 1.00 ? 81  LYS A C    6  
ATOM   7915  O O    . LYS A 1 81 ? -13.872 6.380   0.050   1.00 1.00 ? 81  LYS A O    6  
ATOM   7916  C CB   . LYS A 1 81 ? -14.616 9.207   -1.335  1.00 1.00 ? 81  LYS A CB   6  
ATOM   7917  C CG   . LYS A 1 81 ? -13.631 10.253  -0.811  1.00 1.00 ? 81  LYS A CG   6  
ATOM   7918  C CD   . LYS A 1 81 ? -14.384 11.539  -0.472  1.00 1.00 ? 81  LYS A CD   6  
ATOM   7919  C CE   . LYS A 1 81 ? -13.396 12.593  0.036   1.00 1.00 ? 81  LYS A CE   6  
ATOM   7920  N NZ   . LYS A 1 81 ? -14.122 13.863  0.314   1.00 1.00 ? 81  LYS A NZ   6  
ATOM   7921  H H    . LYS A 1 81 ? -14.963 6.175   -2.074  1.00 1.00 ? 81  LYS A H    6  
ATOM   7922  H HA   . LYS A 1 81 ? -13.048 8.244   -2.424  1.00 1.00 ? 81  LYS A HA   6  
ATOM   7923  H HB2  . LYS A 1 81 ? -15.154 9.607   -2.180  1.00 1.00 ? 81  LYS A HB2  6  
ATOM   7924  H HB3  . LYS A 1 81 ? -15.313 8.953   -0.550  1.00 1.00 ? 81  LYS A HB3  6  
ATOM   7925  H HG2  . LYS A 1 81 ? -13.139 9.877   0.072   1.00 1.00 ? 81  LYS A HG2  6  
ATOM   7926  H HG3  . LYS A 1 81 ? -12.893 10.463  -1.572  1.00 1.00 ? 81  LYS A HG3  6  
ATOM   7927  H HD2  . LYS A 1 81 ? -14.885 11.910  -1.354  1.00 1.00 ? 81  LYS A HD2  6  
ATOM   7928  H HD3  . LYS A 1 81 ? -15.114 11.336  0.298   1.00 1.00 ? 81  LYS A HD3  6  
ATOM   7929  H HE2  . LYS A 1 81 ? -12.927 12.240  0.942   1.00 1.00 ? 81  LYS A HE2  6  
ATOM   7930  H HE3  . LYS A 1 81 ? -12.640 12.767  -0.716  1.00 1.00 ? 81  LYS A HE3  6  
ATOM   7931  H HZ1  . LYS A 1 81 ? -15.147 13.691  0.283   1.00 1.00 ? 81  LYS A HZ1  6  
ATOM   7932  H HZ2  . LYS A 1 81 ? -13.867 14.573  -0.404  1.00 1.00 ? 81  LYS A HZ2  6  
ATOM   7933  H HZ3  . LYS A 1 81 ? -13.860 14.214  1.256   1.00 1.00 ? 81  LYS A HZ3  6  
ATOM   7934  N N    . ALA A 1 82 ? -12.062 7.702   -0.144  1.00 1.00 ? 82  ALA A N    6  
ATOM   7935  C CA   . ALA A 1 82 ? -11.395 7.127   1.018   1.00 1.00 ? 82  ALA A CA   6  
ATOM   7936  C C    . ALA A 1 82 ? -12.342 7.078   2.211   1.00 1.00 ? 82  ALA A C    6  
ATOM   7937  O O    . ALA A 1 82 ? -11.992 6.449   3.196   1.00 1.00 ? 82  ALA A O    6  
ATOM   7938  C CB   . ALA A 1 82 ? -10.162 7.958   1.376   1.00 1.00 ? 82  ALA A CB   6  
ATOM   7939  O OXT  . ALA A 1 82 ? -13.405 7.671   2.124   1.00 1.00 ? 82  ALA A OXT  6  
ATOM   7940  H H    . ALA A 1 82 ? -11.621 8.420   -0.647  1.00 1.00 ? 82  ALA A H    6  
ATOM   7941  H HA   . ALA A 1 82 ? -11.080 6.122   0.780   1.00 1.00 ? 82  ALA A HA   6  
ATOM   7942  H HB1  . ALA A 1 82 ? -10.474 8.930   1.729   1.00 1.00 ? 82  ALA A HB1  6  
ATOM   7943  H HB2  . ALA A 1 82 ? -9.539  8.075   0.502   1.00 1.00 ? 82  ALA A HB2  6  
ATOM   7944  H HB3  . ALA A 1 82 ? -9.603  7.456   2.153   1.00 1.00 ? 82  ALA A HB3  6  
HETATM 7945  O O23  . PNS B 2 .  ? 14.652  10.744  0.005   1.00 1.00 ? 101 PNS A O23  6  
HETATM 7946  P P24  . PNS B 2 .  ? 15.023  11.573  1.332   1.00 1.00 ? 101 PNS A P24  6  
HETATM 7947  O O25  . PNS B 2 .  ? 14.591  10.781  2.505   1.00 1.00 ? 101 PNS A O25  6  
HETATM 7948  O O26  . PNS B 2 .  ? 16.427  12.024  1.222   1.00 1.00 ? 101 PNS A O26  6  
HETATM 7949  O O27  . PNS B 2 .  ? 14.069  12.865  1.219   1.00 1.00 ? 101 PNS A O27  6  
HETATM 7950  C C28  . PNS B 2 .  ? 12.662  12.734  1.355   1.00 1.00 ? 101 PNS A C28  6  
HETATM 7951  C C29  . PNS B 2 .  ? 12.037  14.125  1.534   1.00 1.00 ? 101 PNS A C29  6  
HETATM 7952  C C30  . PNS B 2 .  ? 10.524  13.993  1.689   1.00 1.00 ? 101 PNS A C30  6  
HETATM 7953  C C31  . PNS B 2 .  ? 12.363  14.981  0.305   1.00 1.00 ? 101 PNS A C31  6  
HETATM 7954  C C32  . PNS B 2 .  ? 12.599  14.784  2.790   1.00 1.00 ? 101 PNS A C32  6  
HETATM 7955  O O33  . PNS B 2 .  ? 12.098  16.105  2.878   1.00 1.00 ? 101 PNS A O33  6  
HETATM 7956  C C34  . PNS B 2 .  ? 12.192  13.997  4.031   1.00 1.00 ? 101 PNS A C34  6  
HETATM 7957  O O35  . PNS B 2 .  ? 12.957  13.177  4.538   1.00 1.00 ? 101 PNS A O35  6  
HETATM 7958  N N36  . PNS B 2 .  ? 10.981  14.251  4.509   1.00 1.00 ? 101 PNS A N36  6  
HETATM 7959  C C37  . PNS B 2 .  ? 10.476  13.559  5.689   1.00 1.00 ? 101 PNS A C37  6  
HETATM 7960  C C38  . PNS B 2 .  ? 11.050  14.189  6.959   1.00 1.00 ? 101 PNS A C38  6  
HETATM 7961  C C39  . PNS B 2 .  ? 10.424  13.544  8.191   1.00 1.00 ? 101 PNS A C39  6  
HETATM 7962  O O40  . PNS B 2 .  ? 10.874  12.494  8.649   1.00 1.00 ? 101 PNS A O40  6  
HETATM 7963  N N41  . PNS B 2 .  ? 9.385   14.180  8.722   1.00 1.00 ? 101 PNS A N41  6  
HETATM 7964  C C42  . PNS B 2 .  ? 8.704   13.657  9.900   1.00 1.00 ? 101 PNS A C42  6  
HETATM 7965  C C43  . PNS B 2 .  ? 7.762   12.519  9.507   1.00 1.00 ? 101 PNS A C43  6  
HETATM 7966  S S44  . PNS B 2 .  ? 8.690   10.995  9.362   1.00 1.00 ? 101 PNS A S44  6  
HETATM 7967  H H282 . PNS B 2 .  ? 12.444  12.128  2.221   1.00 1.00 ? 101 PNS A H282 6  
HETATM 7968  H H281 . PNS B 2 .  ? 12.244  12.263  0.476   1.00 1.00 ? 101 PNS A H281 6  
HETATM 7969  H H303 . PNS B 2 .  ? 10.109  14.933  2.009   1.00 1.00 ? 101 PNS A H303 6  
HETATM 7970  H H302 . PNS B 2 .  ? 10.089  13.715  0.733   1.00 1.00 ? 101 PNS A H302 6  
HETATM 7971  H H301 . PNS B 2 .  ? 10.297  13.227  2.415   1.00 1.00 ? 101 PNS A H301 6  
HETATM 7972  H H313 . PNS B 2 .  ? 11.865  15.935  0.396   1.00 1.00 ? 101 PNS A H313 6  
HETATM 7973  H H312 . PNS B 2 .  ? 13.429  15.133  0.247   1.00 1.00 ? 101 PNS A H312 6  
HETATM 7974  H H311 . PNS B 2 .  ? 12.018  14.478  -0.584  1.00 1.00 ? 101 PNS A H311 6  
HETATM 7975  H H32  . PNS B 2 .  ? 13.687  14.810  2.730   1.00 1.00 ? 101 PNS A H32  6  
HETATM 7976  H H33  . PNS B 2 .  ? 12.509  16.629  2.186   1.00 1.00 ? 101 PNS A H33  6  
HETATM 7977  H H36  . PNS B 2 .  ? 10.414  14.914  4.061   1.00 1.00 ? 101 PNS A H36  6  
HETATM 7978  H H372 . PNS B 2 .  ? 10.765  12.519  5.644   1.00 1.00 ? 101 PNS A H372 6  
HETATM 7979  H H371 . PNS B 2 .  ? 9.398   13.628  5.713   1.00 1.00 ? 101 PNS A H371 6  
HETATM 7980  H H382 . PNS B 2 .  ? 12.121  14.041  6.980   1.00 1.00 ? 101 PNS A H382 6  
HETATM 7981  H H381 . PNS B 2 .  ? 10.836  15.249  6.963   1.00 1.00 ? 101 PNS A H381 6  
HETATM 7982  H H41  . PNS B 2 .  ? 9.071   15.013  8.315   1.00 1.00 ? 101 PNS A H41  6  
HETATM 7983  H H422 . PNS B 2 .  ? 8.136   14.449  10.364  1.00 1.00 ? 101 PNS A H422 6  
HETATM 7984  H H421 . PNS B 2 .  ? 9.437   13.286  10.604  1.00 1.00 ? 101 PNS A H421 6  
HETATM 7985  H H431 . PNS B 2 .  ? 7.294   12.748  8.561   1.00 1.00 ? 101 PNS A H431 6  
HETATM 7986  H H432 . PNS B 2 .  ? 7.000   12.402  10.265  1.00 1.00 ? 101 PNS A H432 6  
HETATM 7987  C C1   . STE C 3 .  ? 8.412   10.069  7.917   1.00 1.00 ? 102 STE A C1   6  
HETATM 7988  O O1   . STE C 3 .  ? 7.644   10.410  7.046   1.00 1.00 ? 102 STE A O1   6  
HETATM 7989  C C2   . STE C 3 .  ? 9.236   8.815   7.893   1.00 1.00 ? 102 STE A C2   6  
HETATM 7990  C C3   . STE C 3 .  ? 9.339   8.285   6.463   1.00 1.00 ? 102 STE A C3   6  
HETATM 7991  C C4   . STE C 3 .  ? 8.039   7.569   6.085   1.00 1.00 ? 102 STE A C4   6  
HETATM 7992  C C5   . STE C 3 .  ? 8.063   7.214   4.598   1.00 1.00 ? 102 STE A C5   6  
HETATM 7993  C C6   . STE C 3 .  ? 7.019   6.134   4.313   1.00 1.00 ? 102 STE A C6   6  
HETATM 7994  C C7   . STE C 3 .  ? 7.068   5.752   2.832   1.00 1.00 ? 102 STE A C7   6  
HETATM 7995  C C8   . STE C 3 .  ? 6.338   4.424   2.623   1.00 1.00 ? 102 STE A C8   6  
HETATM 7996  C C9   . STE C 3 .  ? 4.847   4.618   2.878   1.00 1.00 ? 102 STE A C9   6  
HETATM 7997  C C10  . STE C 3 .  ? 4.078   3.393   2.378   1.00 1.00 ? 102 STE A C10  6  
HETATM 7998  C C11  . STE C 3 .  ? 2.580   3.588   2.640   1.00 1.00 ? 102 STE A C11  6  
HETATM 7999  C C12  . STE C 3 .  ? 1.943   4.317   1.445   1.00 1.00 ? 102 STE A C12  6  
HETATM 8000  C C13  . STE C 3 .  ? 1.564   3.293   0.366   1.00 1.00 ? 102 STE A C13  6  
HETATM 8001  C C14  . STE C 3 .  ? 0.176   2.717   0.670   1.00 1.00 ? 102 STE A C14  6  
HETATM 8002  C C15  . STE C 3 .  ? -0.894  3.613   0.041   1.00 1.00 ? 102 STE A C15  6  
HETATM 8003  C C16  . STE C 3 .  ? -2.278  3.070   0.382   1.00 1.00 ? 102 STE A C16  6  
HETATM 8004  C C17  . STE C 3 .  ? -3.348  3.998   -0.197  1.00 1.00 ? 102 STE A C17  6  
HETATM 8005  C C18  . STE C 3 .  ? -3.500  3.735   -1.699  1.00 1.00 ? 102 STE A C18  6  
HETATM 8006  H H21  . STE C 3 .  ? 10.224  9.028   8.268   1.00 1.00 ? 102 STE A H21  6  
HETATM 8007  H H22  . STE C 3 .  ? 8.768   8.068   8.520   1.00 1.00 ? 102 STE A H22  6  
HETATM 8008  H H31  . STE C 3 .  ? 10.162  7.588   6.394   1.00 1.00 ? 102 STE A H31  6  
HETATM 8009  H H32  . STE C 3 .  ? 9.509   9.107   5.782   1.00 1.00 ? 102 STE A H32  6  
HETATM 8010  H H41  . STE C 3 .  ? 7.200   8.219   6.286   1.00 1.00 ? 102 STE A H41  6  
HETATM 8011  H H42  . STE C 3 .  ? 7.945   6.666   6.673   1.00 1.00 ? 102 STE A H42  6  
HETATM 8012  H H51  . STE C 3 .  ? 9.042   6.845   4.330   1.00 1.00 ? 102 STE A H51  6  
HETATM 8013  H H52  . STE C 3 .  ? 7.838   8.096   4.015   1.00 1.00 ? 102 STE A H52  6  
HETATM 8014  H H61  . STE C 3 .  ? 6.038   6.510   4.556   1.00 1.00 ? 102 STE A H61  6  
HETATM 8015  H H62  . STE C 3 .  ? 7.230   5.264   4.921   1.00 1.00 ? 102 STE A H62  6  
HETATM 8016  H H71  . STE C 3 .  ? 8.096   5.648   2.521   1.00 1.00 ? 102 STE A H71  6  
HETATM 8017  H H72  . STE C 3 .  ? 6.591   6.524   2.248   1.00 1.00 ? 102 STE A H72  6  
HETATM 8018  H H81  . STE C 3 .  ? 6.725   3.686   3.308   1.00 1.00 ? 102 STE A H81  6  
HETATM 8019  H H82  . STE C 3 .  ? 6.489   4.087   1.608   1.00 1.00 ? 102 STE A H82  6  
HETATM 8020  H H91  . STE C 3 .  ? 4.499   5.497   2.355   1.00 1.00 ? 102 STE A H91  6  
HETATM 8021  H H92  . STE C 3 .  ? 4.671   4.739   3.939   1.00 1.00 ? 102 STE A H92  6  
HETATM 8022  H H101 . STE C 3 .  ? 4.420   2.514   2.896   1.00 1.00 ? 102 STE A H101 6  
HETATM 8023  H H102 . STE C 3 .  ? 4.252   3.272   1.317   1.00 1.00 ? 102 STE A H102 6  
HETATM 8024  H H111 . STE C 3 .  ? 2.436   4.174   3.532   1.00 1.00 ? 102 STE A H111 6  
HETATM 8025  H H112 . STE C 3 .  ? 2.110   2.621   2.769   1.00 1.00 ? 102 STE A H112 6  
HETATM 8026  H H121 . STE C 3 .  ? 2.645   5.023   1.033   1.00 1.00 ? 102 STE A H121 6  
HETATM 8027  H H122 . STE C 3 .  ? 1.062   4.840   1.776   1.00 1.00 ? 102 STE A H122 6  
HETATM 8028  H H131 . STE C 3 .  ? 2.288   2.488   0.357   1.00 1.00 ? 102 STE A H131 6  
HETATM 8029  H H132 . STE C 3 .  ? 1.558   3.777   -0.598  1.00 1.00 ? 102 STE A H132 6  
HETATM 8030  H H141 . STE C 3 .  ? 0.021   2.682   1.742   1.00 1.00 ? 102 STE A H141 6  
HETATM 8031  H H142 . STE C 3 .  ? 0.100   1.722   0.265   1.00 1.00 ? 102 STE A H142 6  
HETATM 8032  H H151 . STE C 3 .  ? -0.764  3.624   -1.031  1.00 1.00 ? 102 STE A H151 6  
HETATM 8033  H H152 . STE C 3 .  ? -0.796  4.619   0.423   1.00 1.00 ? 102 STE A H152 6  
HETATM 8034  H H161 . STE C 3 .  ? -2.391  3.018   1.449   1.00 1.00 ? 102 STE A H161 6  
HETATM 8035  H H162 . STE C 3 .  ? -2.387  2.078   -0.035  1.00 1.00 ? 102 STE A H162 6  
HETATM 8036  H H171 . STE C 3 .  ? -3.054  5.026   -0.043  1.00 1.00 ? 102 STE A H171 6  
HETATM 8037  H H172 . STE C 3 .  ? -4.289  3.815   0.299   1.00 1.00 ? 102 STE A H172 6  
HETATM 8038  H H181 . STE C 3 .  ? -2.696  4.223   -2.231  1.00 1.00 ? 102 STE A H181 6  
HETATM 8039  H H182 . STE C 3 .  ? -4.447  4.118   -2.036  1.00 1.00 ? 102 STE A H182 6  
HETATM 8040  H H183 . STE C 3 .  ? -3.462  2.674   -1.889  1.00 1.00 ? 102 STE A H183 6  
ATOM   8041  N N    . ALA A 1 1  ? -10.092 -3.479  7.121   1.00 1.00 ? 1   ALA A N    7  
ATOM   8042  C CA   . ALA A 1 1  ? -10.164 -3.649  5.643   1.00 1.00 ? 1   ALA A CA   7  
ATOM   8043  C C    . ALA A 1 1  ? -10.340 -5.131  5.313   1.00 1.00 ? 1   ALA A C    7  
ATOM   8044  O O    . ALA A 1 1  ? -10.121 -5.996  6.161   1.00 1.00 ? 1   ALA A O    7  
ATOM   8045  C CB   . ALA A 1 1  ? -8.876  -3.111  5.005   1.00 1.00 ? 1   ALA A CB   7  
ATOM   8046  H H1   . ALA A 1 1  ? -11.048 -3.544  7.525   1.00 1.00 ? 1   ALA A H1   7  
ATOM   8047  H H2   . ALA A 1 1  ? -9.684  -2.548  7.345   1.00 1.00 ? 1   ALA A H2   7  
ATOM   8048  H H3   . ALA A 1 1  ? -9.495  -4.226  7.529   1.00 1.00 ? 1   ALA A H3   7  
ATOM   8049  H HA   . ALA A 1 1  ? -11.008 -3.094  5.261   1.00 1.00 ? 1   ALA A HA   7  
ATOM   8050  H HB1  . ALA A 1 1  ? -9.073  -2.841  3.976   1.00 1.00 ? 1   ALA A HB1  7  
ATOM   8051  H HB2  . ALA A 1 1  ? -8.111  -3.871  5.040   1.00 1.00 ? 1   ALA A HB2  7  
ATOM   8052  H HB3  . ALA A 1 1  ? -8.539  -2.239  5.545   1.00 1.00 ? 1   ALA A HB3  7  
ATOM   8053  N N    . LYS A 1 2  ? -10.730 -5.413  4.075   1.00 1.00 ? 2   LYS A N    7  
ATOM   8054  C CA   . LYS A 1 2  ? -10.929 -6.788  3.637   1.00 1.00 ? 2   LYS A CA   7  
ATOM   8055  C C    . LYS A 1 2  ? -9.587  -7.448  3.343   1.00 1.00 ? 2   LYS A C    7  
ATOM   8056  O O    . LYS A 1 2  ? -8.626  -6.781  2.965   1.00 1.00 ? 2   LYS A O    7  
ATOM   8057  C CB   . LYS A 1 2  ? -11.800 -6.816  2.380   1.00 1.00 ? 2   LYS A CB   7  
ATOM   8058  C CG   . LYS A 1 2  ? -13.204 -6.318  2.724   1.00 1.00 ? 2   LYS A CG   7  
ATOM   8059  C CD   . LYS A 1 2  ? -14.073 -6.334  1.464   1.00 1.00 ? 2   LYS A CD   7  
ATOM   8060  C CE   . LYS A 1 2  ? -15.477 -5.833  1.805   1.00 1.00 ? 2   LYS A CE   7  
ATOM   8061  N NZ   . LYS A 1 2  ? -16.320 -5.844  0.578   1.00 1.00 ? 2   LYS A NZ   7  
ATOM   8062  H H    . LYS A 1 2  ? -10.886 -4.680  3.443   1.00 1.00 ? 2   LYS A H    7  
ATOM   8063  H HA   . LYS A 1 2  ? -11.428 -7.338  4.420   1.00 1.00 ? 2   LYS A HA   7  
ATOM   8064  H HB2  . LYS A 1 2  ? -11.364 -6.177  1.624   1.00 1.00 ? 2   LYS A HB2  7  
ATOM   8065  H HB3  . LYS A 1 2  ? -11.860 -7.826  2.006   1.00 1.00 ? 2   LYS A HB3  7  
ATOM   8066  H HG2  . LYS A 1 2  ? -13.641 -6.964  3.471   1.00 1.00 ? 2   LYS A HG2  7  
ATOM   8067  H HG3  . LYS A 1 2  ? -13.147 -5.310  3.105   1.00 1.00 ? 2   LYS A HG3  7  
ATOM   8068  H HD2  . LYS A 1 2  ? -13.634 -5.692  0.714   1.00 1.00 ? 2   LYS A HD2  7  
ATOM   8069  H HD3  . LYS A 1 2  ? -14.137 -7.343  1.084   1.00 1.00 ? 2   LYS A HD3  7  
ATOM   8070  H HE2  . LYS A 1 2  ? -15.917 -6.478  2.551   1.00 1.00 ? 2   LYS A HE2  7  
ATOM   8071  H HE3  . LYS A 1 2  ? -15.416 -4.826  2.194   1.00 1.00 ? 2   LYS A HE3  7  
ATOM   8072  H HZ1  . LYS A 1 2  ? -16.501 -4.866  0.272   1.00 1.00 ? 2   LYS A HZ1  7  
ATOM   8073  H HZ2  . LYS A 1 2  ? -17.224 -6.318  0.782   1.00 1.00 ? 2   LYS A HZ2  7  
ATOM   8074  H HZ3  . LYS A 1 2  ? -15.824 -6.353  -0.181  1.00 1.00 ? 2   LYS A HZ3  7  
ATOM   8075  N N    . LYS A 1 3  ? -9.527  -8.759  3.523   1.00 1.00 ? 3   LYS A N    7  
ATOM   8076  C CA   . LYS A 1 3  ? -8.293  -9.500  3.284   1.00 1.00 ? 3   LYS A CA   7  
ATOM   8077  C C    . LYS A 1 3  ? -7.869  -9.383  1.825   1.00 1.00 ? 3   LYS A C    7  
ATOM   8078  O O    . LYS A 1 3  ? -6.682  -9.280  1.520   1.00 1.00 ? 3   LYS A O    7  
ATOM   8079  C CB   . LYS A 1 3  ? -8.495  -10.970 3.632   1.00 1.00 ? 3   LYS A CB   7  
ATOM   8080  C CG   . LYS A 1 3  ? -8.786  -11.106 5.127   1.00 1.00 ? 3   LYS A CG   7  
ATOM   8081  C CD   . LYS A 1 3  ? -8.838  -12.587 5.514   1.00 1.00 ? 3   LYS A CD   7  
ATOM   8082  C CE   . LYS A 1 3  ? -10.037 -13.267 4.841   1.00 1.00 ? 3   LYS A CE   7  
ATOM   8083  N NZ   . LYS A 1 3  ? -10.349 -14.538 5.554   1.00 1.00 ? 3   LYS A NZ   7  
ATOM   8084  H H    . LYS A 1 3  ? -10.326 -9.240  3.827   1.00 1.00 ? 3   LYS A H    7  
ATOM   8085  H HA   . LYS A 1 3  ? -7.513  -9.097  3.908   1.00 1.00 ? 3   LYS A HA   7  
ATOM   8086  H HB2  . LYS A 1 3  ? -9.327  -11.357 3.064   1.00 1.00 ? 3   LYS A HB2  7  
ATOM   8087  H HB3  . LYS A 1 3  ? -7.602  -11.525 3.389   1.00 1.00 ? 3   LYS A HB3  7  
ATOM   8088  H HG2  . LYS A 1 3  ? -8.007  -10.613 5.691   1.00 1.00 ? 3   LYS A HG2  7  
ATOM   8089  H HG3  . LYS A 1 3  ? -9.737  -10.644 5.352   1.00 1.00 ? 3   LYS A HG3  7  
ATOM   8090  H HD2  . LYS A 1 3  ? -7.926  -13.071 5.194   1.00 1.00 ? 3   LYS A HD2  7  
ATOM   8091  H HD3  . LYS A 1 3  ? -8.932  -12.677 6.586   1.00 1.00 ? 3   LYS A HD3  7  
ATOM   8092  H HE2  . LYS A 1 3  ? -10.894 -12.612 4.878   1.00 1.00 ? 3   LYS A HE2  7  
ATOM   8093  H HE3  . LYS A 1 3  ? -9.795  -13.488 3.810   1.00 1.00 ? 3   LYS A HE3  7  
ATOM   8094  H HZ1  . LYS A 1 3  ? -11.255 -14.441 6.055   1.00 1.00 ? 3   LYS A HZ1  7  
ATOM   8095  H HZ2  . LYS A 1 3  ? -9.594  -14.746 6.238   1.00 1.00 ? 3   LYS A HZ2  7  
ATOM   8096  H HZ3  . LYS A 1 3  ? -10.420 -15.313 4.866   1.00 1.00 ? 3   LYS A HZ3  7  
ATOM   8097  N N    . GLU A 1 4  ? -8.843  -9.416  0.923   1.00 1.00 ? 4   GLU A N    7  
ATOM   8098  C CA   . GLU A 1 4  ? -8.552  -9.325  -0.500  1.00 1.00 ? 4   GLU A CA   7  
ATOM   8099  C C    . GLU A 1 4  ? -7.790  -8.038  -0.813  1.00 1.00 ? 4   GLU A C    7  
ATOM   8100  O O    . GLU A 1 4  ? -6.807  -8.050  -1.551  1.00 1.00 ? 4   GLU A O    7  
ATOM   8101  C CB   . GLU A 1 4  ? -9.860  -9.361  -1.299  1.00 1.00 ? 4   GLU A CB   7  
ATOM   8102  C CG   . GLU A 1 4  ? -10.653 -8.071  -1.054  1.00 1.00 ? 4   GLU A CG   7  
ATOM   8103  C CD   . GLU A 1 4  ? -12.089 -8.241  -1.534  1.00 1.00 ? 4   GLU A CD   7  
ATOM   8104  O OE1  . GLU A 1 4  ? -12.292 -8.966  -2.492  1.00 1.00 ? 4   GLU A OE1  7  
ATOM   8105  O OE2  . GLU A 1 4  ? -12.967 -7.642  -0.933  1.00 1.00 ? 4   GLU A OE2  7  
ATOM   8106  H H    . GLU A 1 4  ? -9.773  -9.509  1.222   1.00 1.00 ? 4   GLU A H    7  
ATOM   8107  H HA   . GLU A 1 4  ? -7.947  -10.174 -0.785  1.00 1.00 ? 4   GLU A HA   7  
ATOM   8108  H HB2  . GLU A 1 4  ? -9.634  -9.449  -2.351  1.00 1.00 ? 4   GLU A HB2  7  
ATOM   8109  H HB3  . GLU A 1 4  ? -10.451 -10.208 -0.985  1.00 1.00 ? 4   GLU A HB3  7  
ATOM   8110  H HG2  . GLU A 1 4  ? -10.649 -7.843  0.002   1.00 1.00 ? 4   GLU A HG2  7  
ATOM   8111  H HG3  . GLU A 1 4  ? -10.193 -7.259  -1.599  1.00 1.00 ? 4   GLU A HG3  7  
ATOM   8112  N N    . THR A 1 5  ? -8.263  -6.926  -0.253  1.00 1.00 ? 5   THR A N    7  
ATOM   8113  C CA   . THR A 1 5  ? -7.630  -5.635  -0.484  1.00 1.00 ? 5   THR A CA   7  
ATOM   8114  C C    . THR A 1 5  ? -6.266  -5.582  0.190   1.00 1.00 ? 5   THR A C    7  
ATOM   8115  O O    . THR A 1 5  ? -5.298  -5.098  -0.381  1.00 1.00 ? 5   THR A O    7  
ATOM   8116  C CB   . THR A 1 5  ? -8.517  -4.503  0.047   1.00 1.00 ? 5   THR A CB   7  
ATOM   8117  O OG1  . THR A 1 5  ? -9.867  -4.760  -0.318  1.00 1.00 ? 5   THR A OG1  7  
ATOM   8118  C CG2  . THR A 1 5  ? -8.078  -3.181  -0.586  1.00 1.00 ? 5   THR A CG2  7  
ATOM   8119  H H    . THR A 1 5  ? -9.054  -6.976  0.322   1.00 1.00 ? 5   THR A H    7  
ATOM   8120  H HA   . THR A 1 5  ? -7.491  -5.501  -1.546  1.00 1.00 ? 5   THR A HA   7  
ATOM   8121  H HB   . THR A 1 5  ? -8.428  -4.432  1.123   1.00 1.00 ? 5   THR A HB   7  
ATOM   8122  H HG1  . THR A 1 5  ? -9.948  -4.634  -1.264  1.00 1.00 ? 5   THR A HG1  7  
ATOM   8123  H HG21 . THR A 1 5  ? -8.172  -3.252  -1.664  1.00 1.00 ? 5   THR A HG21 7  
ATOM   8124  H HG22 . THR A 1 5  ? -7.050  -2.982  -0.328  1.00 1.00 ? 5   THR A HG22 7  
ATOM   8125  H HG23 . THR A 1 5  ? -8.705  -2.380  -0.224  1.00 1.00 ? 5   THR A HG23 7  
ATOM   8126  N N    . ILE A 1 6  ? -6.201  -6.086  1.417   1.00 1.00 ? 6   ILE A N    7  
ATOM   8127  C CA   . ILE A 1 6  ? -4.956  -6.085  2.169   1.00 1.00 ? 6   ILE A CA   7  
ATOM   8128  C C    . ILE A 1 6  ? -3.879  -6.872  1.432   1.00 1.00 ? 6   ILE A C    7  
ATOM   8129  O O    . ILE A 1 6  ? -2.728  -6.439  1.355   1.00 1.00 ? 6   ILE A O    7  
ATOM   8130  C CB   . ILE A 1 6  ? -5.186  -6.709  3.556   1.00 1.00 ? 6   ILE A CB   7  
ATOM   8131  C CG1  . ILE A 1 6  ? -6.066  -5.775  4.399   1.00 1.00 ? 6   ILE A CG1  7  
ATOM   8132  C CG2  . ILE A 1 6  ? -3.841  -6.936  4.267   1.00 1.00 ? 6   ILE A CG2  7  
ATOM   8133  C CD1  . ILE A 1 6  ? -6.545  -6.514  5.653   1.00 1.00 ? 6   ILE A CD1  7  
ATOM   8134  H H    . ILE A 1 6  ? -7.009  -6.463  1.825   1.00 1.00 ? 6   ILE A H    7  
ATOM   8135  H HA   . ILE A 1 6  ? -4.624  -5.067  2.297   1.00 1.00 ? 6   ILE A HA   7  
ATOM   8136  H HB   . ILE A 1 6  ? -5.689  -7.661  3.439   1.00 1.00 ? 6   ILE A HB   7  
ATOM   8137  H HG12 . ILE A 1 6  ? -5.493  -4.908  4.689   1.00 1.00 ? 6   ILE A HG12 7  
ATOM   8138  H HG13 . ILE A 1 6  ? -6.917  -5.463  3.818   1.00 1.00 ? 6   ILE A HG13 7  
ATOM   8139  H HG21 . ILE A 1 6  ? -3.167  -6.129  4.032   1.00 1.00 ? 6   ILE A HG21 7  
ATOM   8140  H HG22 . ILE A 1 6  ? -3.411  -7.869  3.933   1.00 1.00 ? 6   ILE A HG22 7  
ATOM   8141  H HG23 . ILE A 1 6  ? -3.996  -6.975  5.331   1.00 1.00 ? 6   ILE A HG23 7  
ATOM   8142  H HD11 . ILE A 1 6  ? -5.695  -6.941  6.166   1.00 1.00 ? 6   ILE A HD11 7  
ATOM   8143  H HD12 . ILE A 1 6  ? -7.226  -7.302  5.370   1.00 1.00 ? 6   ILE A HD12 7  
ATOM   8144  H HD13 . ILE A 1 6  ? -7.049  -5.822  6.310   1.00 1.00 ? 6   ILE A HD13 7  
ATOM   8145  N N    . ASP A 1 7  ? -4.248  -8.026  0.899   1.00 1.00 ? 7   ASP A N    7  
ATOM   8146  C CA   . ASP A 1 7  ? -3.293  -8.859  0.183   1.00 1.00 ? 7   ASP A CA   7  
ATOM   8147  C C    . ASP A 1 7  ? -2.783  -8.116  -1.051  1.00 1.00 ? 7   ASP A C    7  
ATOM   8148  O O    . ASP A 1 7  ? -1.611  -8.223  -1.413  1.00 1.00 ? 7   ASP A O    7  
ATOM   8149  C CB   . ASP A 1 7  ? -3.977  -10.172 -0.233  1.00 1.00 ? 7   ASP A CB   7  
ATOM   8150  C CG   . ASP A 1 7  ? -3.942  -11.188 0.909   1.00 1.00 ? 7   ASP A CG   7  
ATOM   8151  O OD1  . ASP A 1 7  ? -3.321  -10.905 1.921   1.00 1.00 ? 7   ASP A OD1  7  
ATOM   8152  O OD2  . ASP A 1 7  ? -4.550  -12.235 0.760   1.00 1.00 ? 7   ASP A OD2  7  
ATOM   8153  H H    . ASP A 1 7  ? -5.176  -8.327  0.994   1.00 1.00 ? 7   ASP A H    7  
ATOM   8154  H HA   . ASP A 1 7  ? -2.456  -9.074  0.826   1.00 1.00 ? 7   ASP A HA   7  
ATOM   8155  H HB2  . ASP A 1 7  ? -5.005  -9.969  -0.498  1.00 1.00 ? 7   ASP A HB2  7  
ATOM   8156  H HB3  . ASP A 1 7  ? -3.466  -10.589 -1.089  1.00 1.00 ? 7   ASP A HB3  7  
ATOM   8157  N N    . LYS A 1 8  ? -3.665  -7.362  -1.687  1.00 1.00 ? 8   LYS A N    7  
ATOM   8158  C CA   . LYS A 1 8  ? -3.289  -6.603  -2.872  1.00 1.00 ? 8   LYS A CA   7  
ATOM   8159  C C    . LYS A 1 8  ? -2.281  -5.517  -2.522  1.00 1.00 ? 8   LYS A C    7  
ATOM   8160  O O    . LYS A 1 8  ? -1.285  -5.336  -3.216  1.00 1.00 ? 8   LYS A O    7  
ATOM   8161  C CB   . LYS A 1 8  ? -4.537  -5.961  -3.477  1.00 1.00 ? 8   LYS A CB   7  
ATOM   8162  C CG   . LYS A 1 8  ? -5.378  -7.017  -4.216  1.00 1.00 ? 8   LYS A CG   7  
ATOM   8163  C CD   . LYS A 1 8  ? -4.886  -7.170  -5.670  1.00 1.00 ? 8   LYS A CD   7  
ATOM   8164  C CE   . LYS A 1 8  ? -5.610  -6.162  -6.569  1.00 1.00 ? 8   LYS A CE   7  
ATOM   8165  N NZ   . LYS A 1 8  ? -7.052  -6.526  -6.644  1.00 1.00 ? 8   LYS A NZ   7  
ATOM   8166  H H    . LYS A 1 8  ? -4.584  -7.305  -1.350  1.00 1.00 ? 8   LYS A H    7  
ATOM   8167  H HA   . LYS A 1 8  ? -2.847  -7.272  -3.600  1.00 1.00 ? 8   LYS A HA   7  
ATOM   8168  H HB2  . LYS A 1 8  ? -5.127  -5.539  -2.681  1.00 1.00 ? 8   LYS A HB2  7  
ATOM   8169  H HB3  . LYS A 1 8  ? -4.248  -5.180  -4.164  1.00 1.00 ? 8   LYS A HB3  7  
ATOM   8170  H HG2  . LYS A 1 8  ? -5.297  -7.963  -3.704  1.00 1.00 ? 8   LYS A HG2  7  
ATOM   8171  H HG3  . LYS A 1 8  ? -6.411  -6.709  -4.213  1.00 1.00 ? 8   LYS A HG3  7  
ATOM   8172  H HD2  . LYS A 1 8  ? -3.819  -6.994  -5.719  1.00 1.00 ? 8   LYS A HD2  7  
ATOM   8173  H HD3  . LYS A 1 8  ? -5.096  -8.171  -6.018  1.00 1.00 ? 8   LYS A HD3  7  
ATOM   8174  H HE2  . LYS A 1 8  ? -5.509  -5.172  -6.151  1.00 1.00 ? 8   LYS A HE2  7  
ATOM   8175  H HE3  . LYS A 1 8  ? -5.178  -6.181  -7.560  1.00 1.00 ? 8   LYS A HE3  7  
ATOM   8176  H HZ1  . LYS A 1 8  ? -7.146  -7.560  -6.713  1.00 1.00 ? 8   LYS A HZ1  7  
ATOM   8177  H HZ2  . LYS A 1 8  ? -7.479  -6.081  -7.483  1.00 1.00 ? 8   LYS A HZ2  7  
ATOM   8178  H HZ3  . LYS A 1 8  ? -7.539  -6.194  -5.788  1.00 1.00 ? 8   LYS A HZ3  7  
ATOM   8179  N N    . VAL A 1 9  ? -2.548  -4.794  -1.445  1.00 1.00 ? 9   VAL A N    7  
ATOM   8180  C CA   . VAL A 1 9  ? -1.654  -3.723  -1.029  1.00 1.00 ? 9   VAL A CA   7  
ATOM   8181  C C    . VAL A 1 9  ? -0.270  -4.276  -0.725  1.00 1.00 ? 9   VAL A C    7  
ATOM   8182  O O    . VAL A 1 9  ? 0.739   -3.737  -1.181  1.00 1.00 ? 9   VAL A O    7  
ATOM   8183  C CB   . VAL A 1 9  ? -2.213  -3.038  0.218   1.00 1.00 ? 9   VAL A CB   7  
ATOM   8184  C CG1  . VAL A 1 9  ? -1.226  -1.977  0.702   1.00 1.00 ? 9   VAL A CG1  7  
ATOM   8185  C CG2  . VAL A 1 9  ? -3.544  -2.375  -0.122  1.00 1.00 ? 9   VAL A CG2  7  
ATOM   8186  H H    . VAL A 1 9  ? -3.362  -4.979  -0.930  1.00 1.00 ? 9   VAL A H    7  
ATOM   8187  H HA   . VAL A 1 9  ? -1.576  -2.997  -1.823  1.00 1.00 ? 9   VAL A HA   7  
ATOM   8188  H HB   . VAL A 1 9  ? -2.362  -3.772  0.998   1.00 1.00 ? 9   VAL A HB   7  
ATOM   8189  H HG11 . VAL A 1 9  ? -1.712  -1.331  1.418   1.00 1.00 ? 9   VAL A HG11 7  
ATOM   8190  H HG12 . VAL A 1 9  ? -0.887  -1.390  -0.141  1.00 1.00 ? 9   VAL A HG12 7  
ATOM   8191  H HG13 . VAL A 1 9  ? -0.379  -2.457  1.167   1.00 1.00 ? 9   VAL A HG13 7  
ATOM   8192  H HG21 . VAL A 1 9  ? -3.377  -1.603  -0.841  1.00 1.00 ? 9   VAL A HG21 7  
ATOM   8193  H HG22 . VAL A 1 9  ? -3.977  -1.951  0.772   1.00 1.00 ? 9   VAL A HG22 7  
ATOM   8194  H HG23 . VAL A 1 9  ? -4.216  -3.103  -0.537  1.00 1.00 ? 9   VAL A HG23 7  
ATOM   8195  N N    . SER A 1 10 ? -0.231  -5.354  0.039   1.00 1.00 ? 10  SER A N    7  
ATOM   8196  C CA   . SER A 1 10 ? 1.034   -5.972  0.392   1.00 1.00 ? 10  SER A CA   7  
ATOM   8197  C C    . SER A 1 10 ? 1.745   -6.492  -0.855  1.00 1.00 ? 10  SER A C    7  
ATOM   8198  O O    . SER A 1 10 ? 2.962   -6.388  -0.969  1.00 1.00 ? 10  SER A O    7  
ATOM   8199  C CB   . SER A 1 10 ? 0.805   -7.134  1.360   1.00 1.00 ? 10  SER A CB   7  
ATOM   8200  O OG   . SER A 1 10 ? 0.015   -6.688  2.453   1.00 1.00 ? 10  SER A OG   7  
ATOM   8201  H H    . SER A 1 10 ? -1.069  -5.741  0.371   1.00 1.00 ? 10  SER A H    7  
ATOM   8202  H HA   . SER A 1 10 ? 1.661   -5.236  0.871   1.00 1.00 ? 10  SER A HA   7  
ATOM   8203  H HB2  . SER A 1 10 ? 0.292   -7.932  0.856   1.00 1.00 ? 10  SER A HB2  7  
ATOM   8204  H HB3  . SER A 1 10 ? 1.762   -7.494  1.720   1.00 1.00 ? 10  SER A HB3  7  
ATOM   8205  H HG   . SER A 1 10 ? -0.664  -6.103  2.107   1.00 1.00 ? 10  SER A HG   7  
ATOM   8206  N N    . ASP A 1 11 ? 0.972   -7.054  -1.783  1.00 1.00 ? 11  ASP A N    7  
ATOM   8207  C CA   . ASP A 1 11 ? 1.530   -7.603  -3.008  1.00 1.00 ? 11  ASP A CA   7  
ATOM   8208  C C    . ASP A 1 11 ? 2.369   -6.559  -3.730  1.00 1.00 ? 11  ASP A C    7  
ATOM   8209  O O    . ASP A 1 11 ? 3.451   -6.855  -4.226  1.00 1.00 ? 11  ASP A O    7  
ATOM   8210  C CB   . ASP A 1 11 ? 0.381   -8.086  -3.915  1.00 1.00 ? 11  ASP A CB   7  
ATOM   8211  C CG   . ASP A 1 11 ? -0.046  -9.501  -3.542  1.00 1.00 ? 11  ASP A CG   7  
ATOM   8212  O OD1  . ASP A 1 11 ? 0.824   -10.318 -3.297  1.00 1.00 ? 11  ASP A OD1  7  
ATOM   8213  O OD2  . ASP A 1 11 ? -1.241  -9.746  -3.505  1.00 1.00 ? 11  ASP A OD2  7  
ATOM   8214  H H    . ASP A 1 11 ? 0.009   -7.100  -1.640  1.00 1.00 ? 11  ASP A H    7  
ATOM   8215  H HA   . ASP A 1 11 ? 2.164   -8.444  -2.758  1.00 1.00 ? 11  ASP A HA   7  
ATOM   8216  H HB2  . ASP A 1 11 ? -0.459  -7.425  -3.804  1.00 1.00 ? 11  ASP A HB2  7  
ATOM   8217  H HB3  . ASP A 1 11 ? 0.698   -8.074  -4.942  1.00 1.00 ? 11  ASP A HB3  7  
ATOM   8218  N N    . ILE A 1 12 ? 1.876   -5.334  -3.771  1.00 1.00 ? 12  ILE A N    7  
ATOM   8219  C CA   . ILE A 1 12 ? 2.607   -4.270  -4.437  1.00 1.00 ? 12  ILE A CA   7  
ATOM   8220  C C    . ILE A 1 12 ? 4.012   -4.166  -3.852  1.00 1.00 ? 12  ILE A C    7  
ATOM   8221  O O    . ILE A 1 12 ? 4.990   -4.037  -4.587  1.00 1.00 ? 12  ILE A O    7  
ATOM   8222  C CB   . ILE A 1 12 ? 1.847   -2.929  -4.265  1.00 1.00 ? 12  ILE A CB   7  
ATOM   8223  C CG1  . ILE A 1 12 ? 0.869   -2.701  -5.429  1.00 1.00 ? 12  ILE A CG1  7  
ATOM   8224  C CG2  . ILE A 1 12 ? 2.813   -1.741  -4.188  1.00 1.00 ? 12  ILE A CG2  7  
ATOM   8225  C CD1  . ILE A 1 12 ? -0.269  -3.714  -5.378  1.00 1.00 ? 12  ILE A CD1  7  
ATOM   8226  H H    . ILE A 1 12 ? 1.010   -5.145  -3.350  1.00 1.00 ? 12  ILE A H    7  
ATOM   8227  H HA   . ILE A 1 12 ? 2.688   -4.505  -5.482  1.00 1.00 ? 12  ILE A HA   7  
ATOM   8228  H HB   . ILE A 1 12 ? 1.285   -2.971  -3.343  1.00 1.00 ? 12  ILE A HB   7  
ATOM   8229  H HG12 . ILE A 1 12 ? 0.459   -1.705  -5.348  1.00 1.00 ? 12  ILE A HG12 7  
ATOM   8230  H HG13 . ILE A 1 12 ? 1.392   -2.794  -6.369  1.00 1.00 ? 12  ILE A HG13 7  
ATOM   8231  H HG21 . ILE A 1 12 ? 3.300   -1.743  -3.224  1.00 1.00 ? 12  ILE A HG21 7  
ATOM   8232  H HG22 . ILE A 1 12 ? 2.267   -0.822  -4.311  1.00 1.00 ? 12  ILE A HG22 7  
ATOM   8233  H HG23 . ILE A 1 12 ? 3.552   -1.830  -4.971  1.00 1.00 ? 12  ILE A HG23 7  
ATOM   8234  H HD11 . ILE A 1 12 ? 0.134   -4.708  -5.273  1.00 1.00 ? 12  ILE A HD11 7  
ATOM   8235  H HD12 . ILE A 1 12 ? -0.840  -3.653  -6.294  1.00 1.00 ? 12  ILE A HD12 7  
ATOM   8236  H HD13 . ILE A 1 12 ? -0.907  -3.488  -4.540  1.00 1.00 ? 12  ILE A HD13 7  
ATOM   8237  N N    . VAL A 1 13 ? 4.105   -4.204  -2.539  1.00 1.00 ? 13  VAL A N    7  
ATOM   8238  C CA   . VAL A 1 13 ? 5.398   -4.089  -1.895  1.00 1.00 ? 13  VAL A CA   7  
ATOM   8239  C C    . VAL A 1 13 ? 6.282   -5.272  -2.261  1.00 1.00 ? 13  VAL A C    7  
ATOM   8240  O O    . VAL A 1 13 ? 7.444   -5.107  -2.612  1.00 1.00 ? 13  VAL A O    7  
ATOM   8241  C CB   . VAL A 1 13 ? 5.210   -4.046  -0.376  1.00 1.00 ? 13  VAL A CB   7  
ATOM   8242  C CG1  . VAL A 1 13 ? 6.577   -3.969  0.310   1.00 1.00 ? 13  VAL A CG1  7  
ATOM   8243  C CG2  . VAL A 1 13 ? 4.364   -2.824  0.013   1.00 1.00 ? 13  VAL A CG2  7  
ATOM   8244  H H    . VAL A 1 13 ? 3.292   -4.298  -1.993  1.00 1.00 ? 13  VAL A H    7  
ATOM   8245  H HA   . VAL A 1 13 ? 5.873   -3.172  -2.220  1.00 1.00 ? 13  VAL A HA   7  
ATOM   8246  H HB   . VAL A 1 13 ? 4.704   -4.947  -0.059  1.00 1.00 ? 13  VAL A HB   7  
ATOM   8247  H HG11 . VAL A 1 13 ? 6.440   -3.715  1.351   1.00 1.00 ? 13  VAL A HG11 7  
ATOM   8248  H HG12 . VAL A 1 13 ? 7.177   -3.208  -0.170  1.00 1.00 ? 13  VAL A HG12 7  
ATOM   8249  H HG13 . VAL A 1 13 ? 7.074   -4.923  0.231   1.00 1.00 ? 13  VAL A HG13 7  
ATOM   8250  H HG21 . VAL A 1 13 ? 3.611   -2.642  -0.743  1.00 1.00 ? 13  VAL A HG21 7  
ATOM   8251  H HG22 . VAL A 1 13 ? 4.999   -1.959  0.103   1.00 1.00 ? 13  VAL A HG22 7  
ATOM   8252  H HG23 . VAL A 1 13 ? 3.879   -3.011  0.959   1.00 1.00 ? 13  VAL A HG23 7  
ATOM   8253  N N    . LYS A 1 14 ? 5.725   -6.466  -2.166  1.00 1.00 ? 14  LYS A N    7  
ATOM   8254  C CA   . LYS A 1 14 ? 6.484   -7.670  -2.472  1.00 1.00 ? 14  LYS A CA   7  
ATOM   8255  C C    . LYS A 1 14 ? 6.874   -7.709  -3.944  1.00 1.00 ? 14  LYS A C    7  
ATOM   8256  O O    . LYS A 1 14 ? 7.983   -8.110  -4.295  1.00 1.00 ? 14  LYS A O    7  
ATOM   8257  C CB   . LYS A 1 14 ? 5.664   -8.909  -2.136  1.00 1.00 ? 14  LYS A CB   7  
ATOM   8258  C CG   . LYS A 1 14 ? 5.127   -8.799  -0.698  1.00 1.00 ? 14  LYS A CG   7  
ATOM   8259  C CD   . LYS A 1 14 ? 4.840   -10.200 -0.118  1.00 1.00 ? 14  LYS A CD   7  
ATOM   8260  C CE   . LYS A 1 14 ? 6.044   -10.713 0.691   1.00 1.00 ? 14  LYS A CE   7  
ATOM   8261  N NZ   . LYS A 1 14 ? 5.837   -10.386 2.127   1.00 1.00 ? 14  LYS A NZ   7  
ATOM   8262  H H    . LYS A 1 14 ? 4.790   -6.543  -1.877  1.00 1.00 ? 14  LYS A H    7  
ATOM   8263  H HA   . LYS A 1 14 ? 7.376   -7.674  -1.867  1.00 1.00 ? 14  LYS A HA   7  
ATOM   8264  H HB2  . LYS A 1 14 ? 4.840   -8.992  -2.828  1.00 1.00 ? 14  LYS A HB2  7  
ATOM   8265  H HB3  . LYS A 1 14 ? 6.289   -9.783  -2.218  1.00 1.00 ? 14  LYS A HB3  7  
ATOM   8266  H HG2  . LYS A 1 14 ? 5.840   -8.279  -0.078  1.00 1.00 ? 14  LYS A HG2  7  
ATOM   8267  H HG3  . LYS A 1 14 ? 4.215   -8.237  -0.714  1.00 1.00 ? 14  LYS A HG3  7  
ATOM   8268  H HD2  . LYS A 1 14 ? 3.980   -10.144 0.536   1.00 1.00 ? 14  LYS A HD2  7  
ATOM   8269  H HD3  . LYS A 1 14 ? 4.625   -10.890 -0.921  1.00 1.00 ? 14  LYS A HD3  7  
ATOM   8270  H HE2  . LYS A 1 14 ? 6.129   -11.781 0.577   1.00 1.00 ? 14  LYS A HE2  7  
ATOM   8271  H HE3  . LYS A 1 14 ? 6.952   -10.248 0.349   1.00 1.00 ? 14  LYS A HE3  7  
ATOM   8272  H HZ1  . LYS A 1 14 ? 4.846   -10.115 2.279   1.00 1.00 ? 14  LYS A HZ1  7  
ATOM   8273  H HZ2  . LYS A 1 14 ? 6.460   -9.593  2.391   1.00 1.00 ? 14  LYS A HZ2  7  
ATOM   8274  H HZ3  . LYS A 1 14 ? 6.060   -11.216 2.711   1.00 1.00 ? 14  LYS A HZ3  7  
ATOM   8275  N N    . GLU A 1 15 ? 5.943   -7.304  -4.796  1.00 1.00 ? 15  GLU A N    7  
ATOM   8276  C CA   . GLU A 1 15 ? 6.177   -7.305  -6.236  1.00 1.00 ? 15  GLU A CA   7  
ATOM   8277  C C    . GLU A 1 15 ? 7.273   -6.330  -6.625  1.00 1.00 ? 15  GLU A C    7  
ATOM   8278  O O    . GLU A 1 15 ? 8.006   -6.554  -7.586  1.00 1.00 ? 15  GLU A O    7  
ATOM   8279  C CB   . GLU A 1 15 ? 4.888   -6.949  -6.974  1.00 1.00 ? 15  GLU A CB   7  
ATOM   8280  C CG   . GLU A 1 15 ? 3.898   -8.124  -6.894  1.00 1.00 ? 15  GLU A CG   7  
ATOM   8281  C CD   . GLU A 1 15 ? 4.404   -9.296  -7.731  1.00 1.00 ? 15  GLU A CD   7  
ATOM   8282  O OE1  . GLU A 1 15 ? 5.209   -9.066  -8.617  1.00 1.00 ? 15  GLU A OE1  7  
ATOM   8283  O OE2  . GLU A 1 15 ? 3.972   -10.410 -7.475  1.00 1.00 ? 15  GLU A OE2  7  
ATOM   8284  H H    . GLU A 1 15 ? 5.075   -7.002  -4.452  1.00 1.00 ? 15  GLU A H    7  
ATOM   8285  H HA   . GLU A 1 15 ? 6.484   -8.283  -6.524  1.00 1.00 ? 15  GLU A HA   7  
ATOM   8286  H HB2  . GLU A 1 15 ? 4.452   -6.068  -6.513  1.00 1.00 ? 15  GLU A HB2  7  
ATOM   8287  H HB3  . GLU A 1 15 ? 5.115   -6.741  -8.007  1.00 1.00 ? 15  GLU A HB3  7  
ATOM   8288  H HG2  . GLU A 1 15 ? 3.795   -8.441  -5.869  1.00 1.00 ? 15  GLU A HG2  7  
ATOM   8289  H HG3  . GLU A 1 15 ? 2.938   -7.806  -7.269  1.00 1.00 ? 15  GLU A HG3  7  
ATOM   8290  N N    . LYS A 1 16 ? 7.379   -5.246  -5.880  1.00 1.00 ? 16  LYS A N    7  
ATOM   8291  C CA   . LYS A 1 16 ? 8.386   -4.238  -6.163  1.00 1.00 ? 16  LYS A CA   7  
ATOM   8292  C C    . LYS A 1 16 ? 9.791   -4.829  -6.082  1.00 1.00 ? 16  LYS A C    7  
ATOM   8293  O O    . LYS A 1 16 ? 10.666  -4.485  -6.871  1.00 1.00 ? 16  LYS A O    7  
ATOM   8294  C CB   . LYS A 1 16 ? 8.225   -3.090  -5.171  1.00 1.00 ? 16  LYS A CB   7  
ATOM   8295  C CG   . LYS A 1 16 ? 7.177   -2.117  -5.708  1.00 1.00 ? 16  LYS A CG   7  
ATOM   8296  C CD   . LYS A 1 16 ? 6.835   -1.117  -4.630  1.00 1.00 ? 16  LYS A CD   7  
ATOM   8297  C CE   . LYS A 1 16 ? 6.118   0.101   -5.239  1.00 1.00 ? 16  LYS A CE   7  
ATOM   8298  N NZ   . LYS A 1 16 ? 6.299   1.282   -4.351  1.00 1.00 ? 16  LYS A NZ   7  
ATOM   8299  H H    . LYS A 1 16 ? 6.763   -5.117  -5.128  1.00 1.00 ? 16  LYS A H    7  
ATOM   8300  H HA   . LYS A 1 16 ? 8.228   -3.849  -7.153  1.00 1.00 ? 16  LYS A HA   7  
ATOM   8301  H HB2  . LYS A 1 16 ? 7.902   -3.474  -4.215  1.00 1.00 ? 16  LYS A HB2  7  
ATOM   8302  H HB3  . LYS A 1 16 ? 9.165   -2.568  -5.053  1.00 1.00 ? 16  LYS A HB3  7  
ATOM   8303  H HG2  . LYS A 1 16 ? 7.576   -1.608  -6.562  1.00 1.00 ? 16  LYS A HG2  7  
ATOM   8304  H HG3  . LYS A 1 16 ? 6.286   -2.656  -5.988  1.00 1.00 ? 16  LYS A HG3  7  
ATOM   8305  H HD2  . LYS A 1 16 ? 6.178   -1.613  -3.926  1.00 1.00 ? 16  LYS A HD2  7  
ATOM   8306  H HD3  . LYS A 1 16 ? 7.736   -0.805  -4.134  1.00 1.00 ? 16  LYS A HD3  7  
ATOM   8307  H HE2  . LYS A 1 16 ? 6.528   0.329   -6.212  1.00 1.00 ? 16  LYS A HE2  7  
ATOM   8308  H HE3  . LYS A 1 16 ? 5.066   -0.111  -5.337  1.00 1.00 ? 16  LYS A HE3  7  
ATOM   8309  H HZ1  . LYS A 1 16 ? 7.254   1.676   -4.483  1.00 1.00 ? 16  LYS A HZ1  7  
ATOM   8310  H HZ2  . LYS A 1 16 ? 6.182   0.990   -3.363  1.00 1.00 ? 16  LYS A HZ2  7  
ATOM   8311  H HZ3  . LYS A 1 16 ? 5.597   2.009   -4.586  1.00 1.00 ? 16  LYS A HZ3  7  
ATOM   8312  N N    . LEU A 1 17 ? 10.002  -5.705  -5.104  1.00 1.00 ? 17  LEU A N    7  
ATOM   8313  C CA   . LEU A 1 17 ? 11.311  -6.330  -4.898  1.00 1.00 ? 17  LEU A CA   7  
ATOM   8314  C C    . LEU A 1 17 ? 11.291  -7.760  -5.411  1.00 1.00 ? 17  LEU A C    7  
ATOM   8315  O O    . LEU A 1 17 ? 12.299  -8.458  -5.352  1.00 1.00 ? 17  LEU A O    7  
ATOM   8316  C CB   . LEU A 1 17 ? 11.688  -6.310  -3.394  1.00 1.00 ? 17  LEU A CB   7  
ATOM   8317  C CG   . LEU A 1 17 ? 10.442  -5.984  -2.531  1.00 1.00 ? 17  LEU A CG   7  
ATOM   8318  C CD1  . LEU A 1 17 ? 10.636  -6.506  -1.109  1.00 1.00 ? 17  LEU A CD1  7  
ATOM   8319  C CD2  . LEU A 1 17 ? 10.229  -4.463  -2.484  1.00 1.00 ? 17  LEU A CD2  7  
ATOM   8320  H H    . LEU A 1 17 ? 9.269   -5.929  -4.496  1.00 1.00 ? 17  LEU A H    7  
ATOM   8321  H HA   . LEU A 1 17 ? 12.061  -5.778  -5.452  1.00 1.00 ? 17  LEU A HA   7  
ATOM   8322  H HB2  . LEU A 1 17 ? 12.092  -7.268  -3.109  1.00 1.00 ? 17  LEU A HB2  7  
ATOM   8323  H HB3  . LEU A 1 17 ? 12.441  -5.555  -3.227  1.00 1.00 ? 17  LEU A HB3  7  
ATOM   8324  H HG   . LEU A 1 17 ? 9.571   -6.463  -2.949  1.00 1.00 ? 17  LEU A HG   7  
ATOM   8325  H HD11 . LEU A 1 17 ? 9.680   -6.525  -0.605  1.00 1.00 ? 17  LEU A HD11 7  
ATOM   8326  H HD12 . LEU A 1 17 ? 11.314  -5.861  -0.574  1.00 1.00 ? 17  LEU A HD12 7  
ATOM   8327  H HD13 . LEU A 1 17 ? 11.040  -7.499  -1.145  1.00 1.00 ? 17  LEU A HD13 7  
ATOM   8328  H HD21 . LEU A 1 17 ? 9.410   -4.231  -1.823  1.00 1.00 ? 17  LEU A HD21 7  
ATOM   8329  H HD22 . LEU A 1 17 ? 10.008  -4.096  -3.470  1.00 1.00 ? 17  LEU A HD22 7  
ATOM   8330  H HD23 . LEU A 1 17 ? 11.124  -3.986  -2.121  1.00 1.00 ? 17  LEU A HD23 7  
ATOM   8331  N N    . ALA A 1 18 ? 10.142  -8.183  -5.917  1.00 1.00 ? 18  ALA A N    7  
ATOM   8332  C CA   . ALA A 1 18 ? 10.008  -9.532  -6.448  1.00 1.00 ? 18  ALA A CA   7  
ATOM   8333  C C    . ALA A 1 18 ? 9.931   -10.572 -5.331  1.00 1.00 ? 18  ALA A C    7  
ATOM   8334  O O    . ALA A 1 18 ? 10.719  -11.517 -5.295  1.00 1.00 ? 18  ALA A O    7  
ATOM   8335  C CB   . ALA A 1 18 ? 11.196  -9.840  -7.368  1.00 1.00 ? 18  ALA A CB   7  
ATOM   8336  H H    . ALA A 1 18 ? 9.374   -7.577  -5.941  1.00 1.00 ? 18  ALA A H    7  
ATOM   8337  H HA   . ALA A 1 18 ? 9.099   -9.583  -7.024  1.00 1.00 ? 18  ALA A HA   7  
ATOM   8338  H HB1  . ALA A 1 18 ? 12.012  -10.249 -6.788  1.00 1.00 ? 18  ALA A HB1  7  
ATOM   8339  H HB2  . ALA A 1 18 ? 11.520  -8.928  -7.846  1.00 1.00 ? 18  ALA A HB2  7  
ATOM   8340  H HB3  . ALA A 1 18 ? 10.898  -10.556 -8.118  1.00 1.00 ? 18  ALA A HB3  7  
ATOM   8341  N N    . LEU A 1 19 ? 8.973   -10.400 -4.426  1.00 1.00 ? 19  LEU A N    7  
ATOM   8342  C CA   . LEU A 1 19 ? 8.786   -11.332 -3.317  1.00 1.00 ? 19  LEU A CA   7  
ATOM   8343  C C    . LEU A 1 19 ? 7.428   -12.020 -3.432  1.00 1.00 ? 19  LEU A C    7  
ATOM   8344  O O    . LEU A 1 19 ? 6.785   -11.979 -4.482  1.00 1.00 ? 19  LEU A O    7  
ATOM   8345  C CB   . LEU A 1 19 ? 8.893   -10.567 -1.992  1.00 1.00 ? 19  LEU A CB   7  
ATOM   8346  C CG   . LEU A 1 19 ? 10.331  -10.604 -1.465  1.00 1.00 ? 19  LEU A CG   7  
ATOM   8347  C CD1  . LEU A 1 19 ? 11.274  -9.980  -2.506  1.00 1.00 ? 19  LEU A CD1  7  
ATOM   8348  C CD2  . LEU A 1 19 ? 10.404  -9.834  -0.129  1.00 1.00 ? 19  LEU A CD2  7  
ATOM   8349  H H    . LEU A 1 19 ? 8.372   -9.628  -4.506  1.00 1.00 ? 19  LEU A H    7  
ATOM   8350  H HA   . LEU A 1 19 ? 9.550   -12.096 -3.344  1.00 1.00 ? 19  LEU A HA   7  
ATOM   8351  H HB2  . LEU A 1 19 ? 8.614   -9.545  -2.163  1.00 1.00 ? 19  LEU A HB2  7  
ATOM   8352  H HB3  . LEU A 1 19 ? 8.241   -10.999 -1.258  1.00 1.00 ? 19  LEU A HB3  7  
ATOM   8353  H HG   . LEU A 1 19 ? 10.616  -11.634 -1.297  1.00 1.00 ? 19  LEU A HG   7  
ATOM   8354  H HD11 . LEU A 1 19 ? 12.161  -9.607  -2.018  1.00 1.00 ? 19  LEU A HD11 7  
ATOM   8355  H HD12 . LEU A 1 19 ? 10.772  -9.167  -3.011  1.00 1.00 ? 19  LEU A HD12 7  
ATOM   8356  H HD13 . LEU A 1 19 ? 11.551  -10.732 -3.229  1.00 1.00 ? 19  LEU A HD13 7  
ATOM   8357  H HD21 . LEU A 1 19 ? 10.145  -10.499 0.677   1.00 1.00 ? 19  LEU A HD21 7  
ATOM   8358  H HD22 . LEU A 1 19 ? 9.705   -9.008  -0.142  1.00 1.00 ? 19  LEU A HD22 7  
ATOM   8359  H HD23 . LEU A 1 19 ? 11.405  -9.462  0.024   1.00 1.00 ? 19  LEU A HD23 7  
ATOM   8360  N N    . GLY A 1 20 ? 7.007   -12.654 -2.344  1.00 1.00 ? 20  GLY A N    7  
ATOM   8361  C CA   . GLY A 1 20 ? 5.734   -13.360 -2.308  1.00 1.00 ? 20  GLY A CA   7  
ATOM   8362  C C    . GLY A 1 20 ? 5.940   -14.850 -2.546  1.00 1.00 ? 20  GLY A C    7  
ATOM   8363  O O    . GLY A 1 20 ? 4.976   -15.603 -2.685  1.00 1.00 ? 20  GLY A O    7  
ATOM   8364  H H    . GLY A 1 20 ? 7.569   -12.648 -1.543  1.00 1.00 ? 20  GLY A H    7  
ATOM   8365  H HA2  . GLY A 1 20 ? 5.280   -13.213 -1.339  1.00 1.00 ? 20  GLY A HA2  7  
ATOM   8366  H HA3  . GLY A 1 20 ? 5.078   -12.968 -3.070  1.00 1.00 ? 20  GLY A HA3  7  
ATOM   8367  N N    . ALA A 1 21 ? 7.201   -15.275 -2.588  1.00 1.00 ? 21  ALA A N    7  
ATOM   8368  C CA   . ALA A 1 21 ? 7.511   -16.682 -2.806  1.00 1.00 ? 21  ALA A CA   7  
ATOM   8369  C C    . ALA A 1 21 ? 7.363   -17.464 -1.509  1.00 1.00 ? 21  ALA A C    7  
ATOM   8370  O O    . ALA A 1 21 ? 6.336   -18.099 -1.268  1.00 1.00 ? 21  ALA A O    7  
ATOM   8371  C CB   . ALA A 1 21 ? 8.941   -16.827 -3.332  1.00 1.00 ? 21  ALA A CB   7  
ATOM   8372  H H    . ALA A 1 21 ? 7.933   -14.637 -2.465  1.00 1.00 ? 21  ALA A H    7  
ATOM   8373  H HA   . ALA A 1 21 ? 6.829   -17.085 -3.539  1.00 1.00 ? 21  ALA A HA   7  
ATOM   8374  H HB1  . ALA A 1 21 ? 9.230   -17.868 -3.306  1.00 1.00 ? 21  ALA A HB1  7  
ATOM   8375  H HB2  . ALA A 1 21 ? 9.612   -16.251 -2.713  1.00 1.00 ? 21  ALA A HB2  7  
ATOM   8376  H HB3  . ALA A 1 21 ? 8.989   -16.467 -4.348  1.00 1.00 ? 21  ALA A HB3  7  
ATOM   8377  N N    . ASP A 1 22 ? 8.398   -17.411 -0.668  1.00 1.00 ? 22  ASP A N    7  
ATOM   8378  C CA   . ASP A 1 22 ? 8.381   -18.115 0.616   1.00 1.00 ? 22  ASP A CA   7  
ATOM   8379  C C    . ASP A 1 22 ? 8.377   -17.121 1.772   1.00 1.00 ? 22  ASP A C    7  
ATOM   8380  O O    . ASP A 1 22 ? 8.519   -17.505 2.935   1.00 1.00 ? 22  ASP A O    7  
ATOM   8381  C CB   . ASP A 1 22 ? 9.604   -19.026 0.729   1.00 1.00 ? 22  ASP A CB   7  
ATOM   8382  C CG   . ASP A 1 22 ? 9.483   -20.179 -0.262  1.00 1.00 ? 22  ASP A CG   7  
ATOM   8383  O OD1  . ASP A 1 22 ? 8.416   -20.334 -0.833  1.00 1.00 ? 22  ASP A OD1  7  
ATOM   8384  O OD2  . ASP A 1 22 ? 10.460  -20.890 -0.435  1.00 1.00 ? 22  ASP A OD2  7  
ATOM   8385  H H    . ASP A 1 22 ? 9.186   -16.884 -0.914  1.00 1.00 ? 22  ASP A H    7  
ATOM   8386  H HA   . ASP A 1 22 ? 7.491   -18.719 0.685   1.00 1.00 ? 22  ASP A HA   7  
ATOM   8387  H HB2  . ASP A 1 22 ? 10.498  -18.457 0.513   1.00 1.00 ? 22  ASP A HB2  7  
ATOM   8388  H HB3  . ASP A 1 22 ? 9.665   -19.423 1.732   1.00 1.00 ? 22  ASP A HB3  7  
ATOM   8389  N N    . VAL A 1 23 ? 8.221   -15.842 1.448   1.00 1.00 ? 23  VAL A N    7  
ATOM   8390  C CA   . VAL A 1 23 ? 8.206   -14.799 2.469   1.00 1.00 ? 23  VAL A CA   7  
ATOM   8391  C C    . VAL A 1 23 ? 6.798   -14.610 3.024   1.00 1.00 ? 23  VAL A C    7  
ATOM   8392  O O    . VAL A 1 23 ? 5.833   -14.490 2.270   1.00 1.00 ? 23  VAL A O    7  
ATOM   8393  C CB   . VAL A 1 23 ? 8.704   -13.481 1.874   1.00 1.00 ? 23  VAL A CB   7  
ATOM   8394  C CG1  . VAL A 1 23 ? 8.944   -12.469 2.998   1.00 1.00 ? 23  VAL A CG1  7  
ATOM   8395  C CG2  . VAL A 1 23 ? 10.011  -13.726 1.111   1.00 1.00 ? 23  VAL A CG2  7  
ATOM   8396  H H    . VAL A 1 23 ? 8.116   -15.593 0.506   1.00 1.00 ? 23  VAL A H    7  
ATOM   8397  H HA   . VAL A 1 23 ? 8.864   -15.087 3.277   1.00 1.00 ? 23  VAL A HA   7  
ATOM   8398  H HB   . VAL A 1 23 ? 7.961   -13.091 1.198   1.00 1.00 ? 23  VAL A HB   7  
ATOM   8399  H HG11 . VAL A 1 23 ? 9.558   -12.917 3.765   1.00 1.00 ? 23  VAL A HG11 7  
ATOM   8400  H HG12 . VAL A 1 23 ? 7.997   -12.171 3.422   1.00 1.00 ? 23  VAL A HG12 7  
ATOM   8401  H HG13 . VAL A 1 23 ? 9.447   -11.601 2.599   1.00 1.00 ? 23  VAL A HG13 7  
ATOM   8402  H HG21 . VAL A 1 23 ? 9.786   -14.188 0.160   1.00 1.00 ? 23  VAL A HG21 7  
ATOM   8403  H HG22 . VAL A 1 23 ? 10.650  -14.379 1.687   1.00 1.00 ? 23  VAL A HG22 7  
ATOM   8404  H HG23 . VAL A 1 23 ? 10.513  -12.787 0.944   1.00 1.00 ? 23  VAL A HG23 7  
ATOM   8405  N N    . VAL A 1 24 ? 6.691   -14.583 4.348   1.00 1.00 ? 24  VAL A N    7  
ATOM   8406  C CA   . VAL A 1 24 ? 5.399   -14.405 4.996   1.00 1.00 ? 24  VAL A CA   7  
ATOM   8407  C C    . VAL A 1 24 ? 4.933   -12.961 4.857   1.00 1.00 ? 24  VAL A C    7  
ATOM   8408  O O    . VAL A 1 24 ? 5.703   -12.026 5.078   1.00 1.00 ? 24  VAL A O    7  
ATOM   8409  C CB   . VAL A 1 24 ? 5.499   -14.769 6.479   1.00 1.00 ? 24  VAL A CB   7  
ATOM   8410  C CG1  . VAL A 1 24 ? 4.160   -14.491 7.166   1.00 1.00 ? 24  VAL A CG1  7  
ATOM   8411  C CG2  . VAL A 1 24 ? 5.842   -16.254 6.614   1.00 1.00 ? 24  VAL A CG2  7  
ATOM   8412  H H    . VAL A 1 24 ? 7.496   -14.682 4.897   1.00 1.00 ? 24  VAL A H    7  
ATOM   8413  H HA   . VAL A 1 24 ? 4.676   -15.054 4.524   1.00 1.00 ? 24  VAL A HA   7  
ATOM   8414  H HB   . VAL A 1 24 ? 6.272   -14.175 6.942   1.00 1.00 ? 24  VAL A HB   7  
ATOM   8415  H HG11 . VAL A 1 24 ? 4.157   -14.947 8.145   1.00 1.00 ? 24  VAL A HG11 7  
ATOM   8416  H HG12 . VAL A 1 24 ? 3.358   -14.903 6.574   1.00 1.00 ? 24  VAL A HG12 7  
ATOM   8417  H HG13 . VAL A 1 24 ? 4.022   -13.424 7.265   1.00 1.00 ? 24  VAL A HG13 7  
ATOM   8418  H HG21 . VAL A 1 24 ? 5.780   -16.544 7.651   1.00 1.00 ? 24  VAL A HG21 7  
ATOM   8419  H HG22 . VAL A 1 24 ? 6.845   -16.425 6.250   1.00 1.00 ? 24  VAL A HG22 7  
ATOM   8420  H HG23 . VAL A 1 24 ? 5.144   -16.839 6.033   1.00 1.00 ? 24  VAL A HG23 7  
ATOM   8421  N N    . VAL A 1 25 ? 3.665   -12.782 4.488   1.00 1.00 ? 25  VAL A N    7  
ATOM   8422  C CA   . VAL A 1 25 ? 3.094   -11.445 4.316   1.00 1.00 ? 25  VAL A CA   7  
ATOM   8423  C C    . VAL A 1 25 ? 2.114   -11.138 5.441   1.00 1.00 ? 25  VAL A C    7  
ATOM   8424  O O    . VAL A 1 25 ? 1.216   -11.929 5.731   1.00 1.00 ? 25  VAL A O    7  
ATOM   8425  C CB   . VAL A 1 25 ? 2.367   -11.362 2.977   1.00 1.00 ? 25  VAL A CB   7  
ATOM   8426  C CG1  . VAL A 1 25 ? 1.209   -12.365 2.950   1.00 1.00 ? 25  VAL A CG1  7  
ATOM   8427  C CG2  . VAL A 1 25 ? 1.821   -9.946  2.796   1.00 1.00 ? 25  VAL A CG2  7  
ATOM   8428  H H    . VAL A 1 25 ? 3.101   -13.566 4.326   1.00 1.00 ? 25  VAL A H    7  
ATOM   8429  H HA   . VAL A 1 25 ? 3.882   -10.703 4.327   1.00 1.00 ? 25  VAL A HA   7  
ATOM   8430  H HB   . VAL A 1 25 ? 3.056   -11.586 2.178   1.00 1.00 ? 25  VAL A HB   7  
ATOM   8431  H HG11 . VAL A 1 25 ? 0.386   -11.987 3.539   1.00 1.00 ? 25  VAL A HG11 7  
ATOM   8432  H HG12 . VAL A 1 25 ? 1.541   -13.307 3.359   1.00 1.00 ? 25  VAL A HG12 7  
ATOM   8433  H HG13 . VAL A 1 25 ? 0.884   -12.510 1.930   1.00 1.00 ? 25  VAL A HG13 7  
ATOM   8434  H HG21 . VAL A 1 25 ? 1.001   -9.784  3.481   1.00 1.00 ? 25  VAL A HG21 7  
ATOM   8435  H HG22 . VAL A 1 25 ? 1.472   -9.820  1.781   1.00 1.00 ? 25  VAL A HG22 7  
ATOM   8436  H HG23 . VAL A 1 25 ? 2.605   -9.233  3.000   1.00 1.00 ? 25  VAL A HG23 7  
ATOM   8437  N N    . THR A 1 26 ? 2.289   -9.977  6.072   1.00 1.00 ? 26  THR A N    7  
ATOM   8438  C CA   . THR A 1 26 ? 1.414   -9.557  7.167   1.00 1.00 ? 26  THR A CA   7  
ATOM   8439  C C    . THR A 1 26 ? 0.945   -8.121  6.949   1.00 1.00 ? 26  THR A C    7  
ATOM   8440  O O    . THR A 1 26 ? 1.675   -7.290  6.415   1.00 1.00 ? 26  THR A O    7  
ATOM   8441  C CB   . THR A 1 26 ? 2.165   -9.662  8.507   1.00 1.00 ? 26  THR A CB   7  
ATOM   8442  O OG1  . THR A 1 26 ? 3.517   -9.268  8.324   1.00 1.00 ? 26  THR A OG1  7  
ATOM   8443  C CG2  . THR A 1 26 ? 2.122   -11.103 9.021   1.00 1.00 ? 26  THR A CG2  7  
ATOM   8444  H H    . THR A 1 26 ? 3.019   -9.387  5.793   1.00 1.00 ? 26  THR A H    7  
ATOM   8445  H HA   . THR A 1 26 ? 0.542   -10.200 7.202   1.00 1.00 ? 26  THR A HA   7  
ATOM   8446  H HB   . THR A 1 26 ? 1.700   -9.016  9.237   1.00 1.00 ? 26  THR A HB   7  
ATOM   8447  H HG1  . THR A 1 26 ? 3.985   -9.997  7.906   1.00 1.00 ? 26  THR A HG1  7  
ATOM   8448  H HG21 . THR A 1 26 ? 1.149   -11.303 9.443   1.00 1.00 ? 26  THR A HG21 7  
ATOM   8449  H HG22 . THR A 1 26 ? 2.877   -11.234 9.783   1.00 1.00 ? 26  THR A HG22 7  
ATOM   8450  H HG23 . THR A 1 26 ? 2.310   -11.784 8.205   1.00 1.00 ? 26  THR A HG23 7  
ATOM   8451  N N    . ALA A 1 27 ? -0.282  -7.845  7.371   1.00 1.00 ? 27  ALA A N    7  
ATOM   8452  C CA   . ALA A 1 27 ? -0.848  -6.513  7.228   1.00 1.00 ? 27  ALA A CA   7  
ATOM   8453  C C    . ALA A 1 27 ? -0.167  -5.534  8.178   1.00 1.00 ? 27  ALA A C    7  
ATOM   8454  O O    . ALA A 1 27 ? 0.097   -4.384  7.837   1.00 1.00 ? 27  ALA A O    7  
ATOM   8455  C CB   . ALA A 1 27 ? -2.353  -6.567  7.521   1.00 1.00 ? 27  ALA A CB   7  
ATOM   8456  H H    . ALA A 1 27 ? -0.814  -8.549  7.790   1.00 1.00 ? 27  ALA A H    7  
ATOM   8457  H HA   . ALA A 1 27 ? -0.701  -6.179  6.212   1.00 1.00 ? 27  ALA A HA   7  
ATOM   8458  H HB1  . ALA A 1 27 ? -2.748  -7.512  7.183   1.00 1.00 ? 27  ALA A HB1  7  
ATOM   8459  H HB2  . ALA A 1 27 ? -2.849  -5.761  7.000   1.00 1.00 ? 27  ALA A HB2  7  
ATOM   8460  H HB3  . ALA A 1 27 ? -2.524  -6.472  8.583   1.00 1.00 ? 27  ALA A HB3  7  
ATOM   8461  N N    . ASP A 1 28 ? 0.113   -5.998  9.379   1.00 1.00 ? 28  ASP A N    7  
ATOM   8462  C CA   . ASP A 1 28 ? 0.757   -5.155  10.378  1.00 1.00 ? 28  ASP A CA   7  
ATOM   8463  C C    . ASP A 1 28 ? 2.264   -5.112  10.153  1.00 1.00 ? 28  ASP A C    7  
ATOM   8464  O O    . ASP A 1 28 ? 3.026   -4.763  11.052  1.00 1.00 ? 28  ASP A O    7  
ATOM   8465  C CB   . ASP A 1 28 ? 0.457   -5.684  11.781  1.00 1.00 ? 28  ASP A CB   7  
ATOM   8466  C CG   . ASP A 1 28 ? 1.160   -7.018  12.002  1.00 1.00 ? 28  ASP A CG   7  
ATOM   8467  O OD1  . ASP A 1 28 ? 1.745   -7.521  11.058  1.00 1.00 ? 28  ASP A OD1  7  
ATOM   8468  O OD2  . ASP A 1 28 ? 1.100   -7.519  13.114  1.00 1.00 ? 28  ASP A OD2  7  
ATOM   8469  H H    . ASP A 1 28 ? -0.121  -6.922  9.604   1.00 1.00 ? 28  ASP A H    7  
ATOM   8470  H HA   . ASP A 1 28 ? 0.357   -4.152  10.290  1.00 1.00 ? 28  ASP A HA   7  
ATOM   8471  H HB2  . ASP A 1 28 ? 0.808   -4.971  12.512  1.00 1.00 ? 28  ASP A HB2  7  
ATOM   8472  H HB3  . ASP A 1 28 ? -0.607  -5.821  11.892  1.00 1.00 ? 28  ASP A HB3  7  
ATOM   8473  N N    . SER A 1 29 ? 2.683   -5.487  8.951   1.00 1.00 ? 29  SER A N    7  
ATOM   8474  C CA   . SER A 1 29 ? 4.102   -5.507  8.628   1.00 1.00 ? 29  SER A CA   7  
ATOM   8475  C C    . SER A 1 29 ? 4.668   -4.097  8.544   1.00 1.00 ? 29  SER A C    7  
ATOM   8476  O O    . SER A 1 29 ? 5.875   -3.914  8.388   1.00 1.00 ? 29  SER A O    7  
ATOM   8477  C CB   . SER A 1 29 ? 4.331   -6.228  7.301   1.00 1.00 ? 29  SER A CB   7  
ATOM   8478  O OG   . SER A 1 29 ? 3.819   -5.435  6.240   1.00 1.00 ? 29  SER A OG   7  
ATOM   8479  H H    . SER A 1 29 ? 2.030   -5.768  8.276   1.00 1.00 ? 29  SER A H    7  
ATOM   8480  H HA   . SER A 1 29 ? 4.618   -6.036  9.405   1.00 1.00 ? 29  SER A HA   7  
ATOM   8481  H HB2  . SER A 1 29 ? 5.387   -6.382  7.150   1.00 1.00 ? 29  SER A HB2  7  
ATOM   8482  H HB3  . SER A 1 29 ? 3.833   -7.184  7.323   1.00 1.00 ? 29  SER A HB3  7  
ATOM   8483  H HG   . SER A 1 29 ? 3.406   -6.025  5.604   1.00 1.00 ? 29  SER A HG   7  
ATOM   8484  N N    . GLU A 1 30 ? 3.792   -3.107  8.643   1.00 1.00 ? 30  GLU A N    7  
ATOM   8485  C CA   . GLU A 1 30 ? 4.217   -1.716  8.579   1.00 1.00 ? 30  GLU A CA   7  
ATOM   8486  C C    . GLU A 1 30 ? 4.942   -1.436  7.271   1.00 1.00 ? 30  GLU A C    7  
ATOM   8487  O O    . GLU A 1 30 ? 5.970   -0.763  7.258   1.00 1.00 ? 30  GLU A O    7  
ATOM   8488  C CB   . GLU A 1 30 ? 5.132   -1.387  9.760   1.00 1.00 ? 30  GLU A CB   7  
ATOM   8489  C CG   . GLU A 1 30 ? 4.366   -1.583  11.071  1.00 1.00 ? 30  GLU A CG   7  
ATOM   8490  C CD   . GLU A 1 30 ? 5.275   -1.274  12.253  1.00 1.00 ? 30  GLU A CD   7  
ATOM   8491  O OE1  . GLU A 1 30 ? 6.427   -0.947  12.019  1.00 1.00 ? 30  GLU A OE1  7  
ATOM   8492  O OE2  . GLU A 1 30 ? 4.808   -1.369  13.377  1.00 1.00 ? 30  GLU A OE2  7  
ATOM   8493  H H    . GLU A 1 30 ? 2.842   -3.316  8.764   1.00 1.00 ? 30  GLU A H    7  
ATOM   8494  H HA   . GLU A 1 30 ? 3.355   -1.086  8.632   1.00 1.00 ? 30  GLU A HA   7  
ATOM   8495  H HB2  . GLU A 1 30 ? 5.996   -2.031  9.746   1.00 1.00 ? 30  GLU A HB2  7  
ATOM   8496  H HB3  . GLU A 1 30 ? 5.446   -0.358  9.688   1.00 1.00 ? 30  GLU A HB3  7  
ATOM   8497  H HG2  . GLU A 1 30 ? 3.513   -0.920  11.092  1.00 1.00 ? 30  GLU A HG2  7  
ATOM   8498  H HG3  . GLU A 1 30 ? 4.026   -2.606  11.139  1.00 1.00 ? 30  GLU A HG3  7  
ATOM   8499  N N    . PHE A 1 31 ? 4.398   -1.960  6.173   1.00 1.00 ? 31  PHE A N    7  
ATOM   8500  C CA   . PHE A 1 31 ? 5.005   -1.761  4.861   1.00 1.00 ? 31  PHE A CA   7  
ATOM   8501  C C    . PHE A 1 31 ? 6.490   -2.109  4.905   1.00 1.00 ? 31  PHE A C    7  
ATOM   8502  O O    . PHE A 1 31 ? 6.886   -3.228  4.577   1.00 1.00 ? 31  PHE A O    7  
ATOM   8503  C CB   . PHE A 1 31 ? 4.823   -0.301  4.413   1.00 1.00 ? 31  PHE A CB   7  
ATOM   8504  C CG   . PHE A 1 31 ? 3.437   -0.101  3.849   1.00 1.00 ? 31  PHE A CG   7  
ATOM   8505  C CD1  . PHE A 1 31 ? 3.170   -0.462  2.526   1.00 1.00 ? 31  PHE A CD1  7  
ATOM   8506  C CD2  . PHE A 1 31 ? 2.422   0.434   4.648   1.00 1.00 ? 31  PHE A CD2  7  
ATOM   8507  C CE1  . PHE A 1 31 ? 1.889   -0.284  2.000   1.00 1.00 ? 31  PHE A CE1  7  
ATOM   8508  C CE2  . PHE A 1 31 ? 1.143   0.609   4.125   1.00 1.00 ? 31  PHE A CE2  7  
ATOM   8509  C CZ   . PHE A 1 31 ? 0.873   0.249   2.799   1.00 1.00 ? 31  PHE A CZ   7  
ATOM   8510  H H    . PHE A 1 31 ? 3.577   -2.490  6.248   1.00 1.00 ? 31  PHE A H    7  
ATOM   8511  H HA   . PHE A 1 31 ? 4.520   -2.412  4.147   1.00 1.00 ? 31  PHE A HA   7  
ATOM   8512  H HB2  . PHE A 1 31 ? 4.957   0.353   5.261   1.00 1.00 ? 31  PHE A HB2  7  
ATOM   8513  H HB3  . PHE A 1 31 ? 5.550   -0.059  3.654   1.00 1.00 ? 31  PHE A HB3  7  
ATOM   8514  H HD1  . PHE A 1 31 ? 3.955   -0.872  1.911   1.00 1.00 ? 31  PHE A HD1  7  
ATOM   8515  H HD2  . PHE A 1 31 ? 2.625   0.717   5.665   1.00 1.00 ? 31  PHE A HD2  7  
ATOM   8516  H HE1  . PHE A 1 31 ? 1.683   -0.562  0.976   1.00 1.00 ? 31  PHE A HE1  7  
ATOM   8517  H HE2  . PHE A 1 31 ? 0.365   1.020   4.745   1.00 1.00 ? 31  PHE A HE2  7  
ATOM   8518  H HZ   . PHE A 1 31 ? -0.116  0.384   2.393   1.00 1.00 ? 31  PHE A HZ   7  
ATOM   8519  N N    . SER A 1 32 ? 7.308   -1.143  5.310   1.00 1.00 ? 32  SER A N    7  
ATOM   8520  C CA   . SER A 1 32 ? 8.750   -1.354  5.394   1.00 1.00 ? 32  SER A CA   7  
ATOM   8521  C C    . SER A 1 32 ? 9.363   -0.445  6.452   1.00 1.00 ? 32  SER A C    7  
ATOM   8522  O O    . SER A 1 32 ? 8.715   0.477   6.945   1.00 1.00 ? 32  SER A O    7  
ATOM   8523  C CB   . SER A 1 32 ? 9.393   -1.071  4.037   1.00 1.00 ? 32  SER A CB   7  
ATOM   8524  O OG   . SER A 1 32 ? 8.794   -1.902  3.051   1.00 1.00 ? 32  SER A OG   7  
ATOM   8525  H H    . SER A 1 32 ? 6.936   -0.270  5.560   1.00 1.00 ? 32  SER A H    7  
ATOM   8526  H HA   . SER A 1 32 ? 8.943   -2.383  5.663   1.00 1.00 ? 32  SER A HA   7  
ATOM   8527  H HB2  . SER A 1 32 ? 9.240   -0.038  3.772   1.00 1.00 ? 32  SER A HB2  7  
ATOM   8528  H HB3  . SER A 1 32 ? 10.456  -1.270  4.095   1.00 1.00 ? 32  SER A HB3  7  
ATOM   8529  H HG   . SER A 1 32 ? 9.102   -2.799  3.193   1.00 1.00 ? 32  SER A HG   7  
ATOM   8530  N N    . LYS A 1 33 ? 10.617  -0.717  6.798   1.00 1.00 ? 33  LYS A N    7  
ATOM   8531  C CA   . LYS A 1 33 ? 11.310  0.078   7.804   1.00 1.00 ? 33  LYS A CA   7  
ATOM   8532  C C    . LYS A 1 33 ? 11.491  1.512   7.319   1.00 1.00 ? 33  LYS A C    7  
ATOM   8533  O O    . LYS A 1 33 ? 11.677  1.754   6.125   1.00 1.00 ? 33  LYS A O    7  
ATOM   8534  C CB   . LYS A 1 33 ? 12.681  -0.536  8.098   1.00 1.00 ? 33  LYS A CB   7  
ATOM   8535  C CG   . LYS A 1 33 ? 12.496  -1.898  8.770   1.00 1.00 ? 33  LYS A CG   7  
ATOM   8536  C CD   . LYS A 1 33 ? 13.867  -2.513  9.061   1.00 1.00 ? 33  LYS A CD   7  
ATOM   8537  C CE   . LYS A 1 33 ? 13.684  -3.838  9.802   1.00 1.00 ? 33  LYS A CE   7  
ATOM   8538  N NZ   . LYS A 1 33 ? 13.001  -4.817  8.910   1.00 1.00 ? 33  LYS A NZ   7  
ATOM   8539  H H    . LYS A 1 33 ? 11.082  -1.467  6.373   1.00 1.00 ? 33  LYS A H    7  
ATOM   8540  H HA   . LYS A 1 33 ? 10.728  0.084   8.713   1.00 1.00 ? 33  LYS A HA   7  
ATOM   8541  H HB2  . LYS A 1 33 ? 13.225  -0.661  7.174   1.00 1.00 ? 33  LYS A HB2  7  
ATOM   8542  H HB3  . LYS A 1 33 ? 13.232  0.116   8.757   1.00 1.00 ? 33  LYS A HB3  7  
ATOM   8543  H HG2  . LYS A 1 33 ? 11.952  -1.772  9.696   1.00 1.00 ? 33  LYS A HG2  7  
ATOM   8544  H HG3  . LYS A 1 33 ? 11.943  -2.552  8.112   1.00 1.00 ? 33  LYS A HG3  7  
ATOM   8545  H HD2  . LYS A 1 33 ? 14.386  -2.689  8.130   1.00 1.00 ? 33  LYS A HD2  7  
ATOM   8546  H HD3  . LYS A 1 33 ? 14.442  -1.836  9.675   1.00 1.00 ? 33  LYS A HD3  7  
ATOM   8547  H HE2  . LYS A 1 33 ? 14.650  -4.227  10.089  1.00 1.00 ? 33  LYS A HE2  7  
ATOM   8548  H HE3  . LYS A 1 33 ? 13.084  -3.677  10.686  1.00 1.00 ? 33  LYS A HE3  7  
ATOM   8549  H HZ1  . LYS A 1 33 ? 13.683  -5.535  8.594   1.00 1.00 ? 33  LYS A HZ1  7  
ATOM   8550  H HZ2  . LYS A 1 33 ? 12.612  -4.319  8.083   1.00 1.00 ? 33  LYS A HZ2  7  
ATOM   8551  H HZ3  . LYS A 1 33 ? 12.230  -5.281  9.429   1.00 1.00 ? 33  LYS A HZ3  7  
ATOM   8552  N N    . LEU A 1 34 ? 11.428  2.457   8.249   1.00 1.00 ? 34  LEU A N    7  
ATOM   8553  C CA   . LEU A 1 34 ? 11.579  3.866   7.904   1.00 1.00 ? 34  LEU A CA   7  
ATOM   8554  C C    . LEU A 1 34 ? 13.003  4.150   7.442   1.00 1.00 ? 34  LEU A C    7  
ATOM   8555  O O    . LEU A 1 34 ? 13.963  3.592   7.975   1.00 1.00 ? 34  LEU A O    7  
ATOM   8556  C CB   . LEU A 1 34 ? 11.255  4.736   9.118   1.00 1.00 ? 34  LEU A CB   7  
ATOM   8557  C CG   . LEU A 1 34 ? 9.870   4.365   9.664   1.00 1.00 ? 34  LEU A CG   7  
ATOM   8558  C CD1  . LEU A 1 34 ? 9.565   5.220   10.898  1.00 1.00 ? 34  LEU A CD1  7  
ATOM   8559  C CD2  . LEU A 1 34 ? 8.799   4.606   8.587   1.00 1.00 ? 34  LEU A CD2  7  
ATOM   8560  H H    . LEU A 1 34 ? 11.274  2.205   9.182   1.00 1.00 ? 34  LEU A H    7  
ATOM   8561  H HA   . LEU A 1 34 ? 10.899  4.110   7.103   1.00 1.00 ? 34  LEU A HA   7  
ATOM   8562  H HB2  . LEU A 1 34 ? 12.000  4.575   9.884   1.00 1.00 ? 34  LEU A HB2  7  
ATOM   8563  H HB3  . LEU A 1 34 ? 11.258  5.776   8.828   1.00 1.00 ? 34  LEU A HB3  7  
ATOM   8564  H HG   . LEU A 1 34 ? 9.868   3.322   9.946   1.00 1.00 ? 34  LEU A HG   7  
ATOM   8565  H HD11 . LEU A 1 34 ? 10.355  5.099   11.625  1.00 1.00 ? 34  LEU A HD11 7  
ATOM   8566  H HD12 . LEU A 1 34 ? 8.627   4.904   11.330  1.00 1.00 ? 34  LEU A HD12 7  
ATOM   8567  H HD13 . LEU A 1 34 ? 9.497   6.258   10.610  1.00 1.00 ? 34  LEU A HD13 7  
ATOM   8568  H HD21 . LEU A 1 34 ? 7.832   4.723   9.056   1.00 1.00 ? 34  LEU A HD21 7  
ATOM   8569  H HD22 . LEU A 1 34 ? 8.767   3.762   7.915   1.00 1.00 ? 34  LEU A HD22 7  
ATOM   8570  H HD23 . LEU A 1 34 ? 9.037   5.502   8.029   1.00 1.00 ? 34  LEU A HD23 7  
ATOM   8571  N N    . GLY A 1 35 ? 13.132  5.023   6.446   1.00 1.00 ? 35  GLY A N    7  
ATOM   8572  C CA   . GLY A 1 35 ? 14.445  5.380   5.910   1.00 1.00 ? 35  GLY A CA   7  
ATOM   8573  C C    . GLY A 1 35 ? 14.466  6.833   5.451   1.00 1.00 ? 35  GLY A C    7  
ATOM   8574  O O    . GLY A 1 35 ? 13.660  7.244   4.617   1.00 1.00 ? 35  GLY A O    7  
ATOM   8575  H H    . GLY A 1 35 ? 12.330  5.435   6.062   1.00 1.00 ? 35  GLY A H    7  
ATOM   8576  H HA2  . GLY A 1 35 ? 15.198  5.240   6.674   1.00 1.00 ? 35  GLY A HA2  7  
ATOM   8577  H HA3  . GLY A 1 35 ? 14.669  4.743   5.069   1.00 1.00 ? 35  GLY A HA3  7  
ATOM   8578  N N    . ALA A 1 36 ? 15.398  7.605   6.000   1.00 1.00 ? 36  ALA A N    7  
ATOM   8579  C CA   . ALA A 1 36 ? 15.521  9.012   5.640   1.00 1.00 ? 36  ALA A CA   7  
ATOM   8580  C C    . ALA A 1 36 ? 16.222  9.159   4.293   1.00 1.00 ? 36  ALA A C    7  
ATOM   8581  O O    . ALA A 1 36 ? 16.231  10.240  3.703   1.00 1.00 ? 36  ALA A O    7  
ATOM   8582  C CB   . ALA A 1 36 ? 16.314  9.757   6.715   1.00 1.00 ? 36  ALA A CB   7  
ATOM   8583  H H    . ALA A 1 36 ? 16.014  7.221   6.660   1.00 1.00 ? 36  ALA A H    7  
ATOM   8584  H HA   . ALA A 1 36 ? 14.534  9.444   5.571   1.00 1.00 ? 36  ALA A HA   7  
ATOM   8585  H HB1  . ALA A 1 36 ? 17.204  9.199   6.958   1.00 1.00 ? 36  ALA A HB1  7  
ATOM   8586  H HB2  . ALA A 1 36 ? 15.704  9.869   7.599   1.00 1.00 ? 36  ALA A HB2  7  
ATOM   8587  H HB3  . ALA A 1 36 ? 16.591  10.734  6.345   1.00 1.00 ? 36  ALA A HB3  7  
ATOM   8588  N N    . ASP A 1 37 ? 16.811  8.068   3.815   1.00 1.00 ? 37  ASP A N    7  
ATOM   8589  C CA   . ASP A 1 37 ? 17.516  8.092   2.538   1.00 1.00 ? 37  ASP A CA   7  
ATOM   8590  C C    . ASP A 1 37 ? 16.565  8.462   1.403   1.00 1.00 ? 37  ASP A C    7  
ATOM   8591  O O    . ASP A 1 37 ? 16.876  9.315   0.574   1.00 1.00 ? 37  ASP A O    7  
ATOM   8592  C CB   . ASP A 1 37 ? 18.133  6.721   2.259   1.00 1.00 ? 37  ASP A CB   7  
ATOM   8593  C CG   . ASP A 1 37 ? 18.846  6.734   0.910   1.00 1.00 ? 37  ASP A CG   7  
ATOM   8594  O OD1  . ASP A 1 37 ? 19.819  7.459   0.785   1.00 1.00 ? 37  ASP A OD1  7  
ATOM   8595  O OD2  . ASP A 1 37 ? 18.407  6.019   0.024   1.00 1.00 ? 37  ASP A OD2  7  
ATOM   8596  H H    . ASP A 1 37 ? 16.775  7.235   4.330   1.00 1.00 ? 37  ASP A H    7  
ATOM   8597  H HA   . ASP A 1 37 ? 18.307  8.826   2.586   1.00 1.00 ? 37  ASP A HA   7  
ATOM   8598  H HB2  . ASP A 1 37 ? 18.843  6.482   3.037   1.00 1.00 ? 37  ASP A HB2  7  
ATOM   8599  H HB3  . ASP A 1 37 ? 17.354  5.974   2.244   1.00 1.00 ? 37  ASP A HB3  7  
ATOM   8600  N N    . SER A 1 38 ? 15.407  7.814   1.375   1.00 1.00 ? 38  SER A N    7  
ATOM   8601  C CA   . SER A 1 38 ? 14.417  8.084   0.340   1.00 1.00 ? 38  SER A CA   7  
ATOM   8602  C C    . SER A 1 38 ? 13.042  7.603   0.784   1.00 1.00 ? 38  SER A C    7  
ATOM   8603  O O    . SER A 1 38 ? 12.926  6.757   1.671   1.00 1.00 ? 38  SER A O    7  
ATOM   8604  C CB   . SER A 1 38 ? 14.813  7.379   -0.957  1.00 1.00 ? 38  SER A CB   7  
ATOM   8605  H H    . SER A 1 38 ? 15.212  7.143   2.063   1.00 1.00 ? 38  SER A H    7  
ATOM   8606  H HA   . SER A 1 38 ? 14.376  9.149   0.160   1.00 1.00 ? 38  SER A HA   7  
ATOM   8607  H HB2  . SER A 1 38 ? 14.649  6.314   -0.850  1.00 1.00 ? 38  SER A HB2  7  
ATOM   8608  H HB3  . SER A 1 38 ? 15.853  7.557   -1.164  1.00 1.00 ? 38  SER A HB3  7  
ATOM   8609  N N    . LEU A 1 39 ? 11.997  8.146   0.160   1.00 1.00 ? 39  LEU A N    7  
ATOM   8610  C CA   . LEU A 1 39 ? 10.621  7.771   0.494   1.00 1.00 ? 39  LEU A CA   7  
ATOM   8611  C C    . LEU A 1 39 ? 9.985   7.012   -0.662  1.00 1.00 ? 39  LEU A C    7  
ATOM   8612  O O    . LEU A 1 39 ? 10.041  7.447   -1.812  1.00 1.00 ? 39  LEU A O    7  
ATOM   8613  C CB   . LEU A 1 39 ? 9.800   9.024   0.793   1.00 1.00 ? 39  LEU A CB   7  
ATOM   8614  C CG   . LEU A 1 39 ? 10.497  9.849   1.880   1.00 1.00 ? 39  LEU A CG   7  
ATOM   8615  C CD1  . LEU A 1 39 ? 9.694   11.126  2.140   1.00 1.00 ? 39  LEU A CD1  7  
ATOM   8616  C CD2  . LEU A 1 39 ? 10.601  9.028   3.179   1.00 1.00 ? 39  LEU A CD2  7  
ATOM   8617  H H    . LEU A 1 39 ? 12.152  8.815   -0.538  1.00 1.00 ? 39  LEU A H    7  
ATOM   8618  H HA   . LEU A 1 39 ? 10.617  7.134   1.369   1.00 1.00 ? 39  LEU A HA   7  
ATOM   8619  H HB2  . LEU A 1 39 ? 9.708   9.616   -0.108  1.00 1.00 ? 39  LEU A HB2  7  
ATOM   8620  H HB3  . LEU A 1 39 ? 8.816   8.737   1.134   1.00 1.00 ? 39  LEU A HB3  7  
ATOM   8621  H HG   . LEU A 1 39 ? 11.489  10.115  1.542   1.00 1.00 ? 39  LEU A HG   7  
ATOM   8622  H HD11 . LEU A 1 39 ? 8.688   10.866  2.433   1.00 1.00 ? 39  LEU A HD11 7  
ATOM   8623  H HD12 . LEU A 1 39 ? 9.664   11.722  1.240   1.00 1.00 ? 39  LEU A HD12 7  
ATOM   8624  H HD13 . LEU A 1 39 ? 10.165  11.692  2.930   1.00 1.00 ? 39  LEU A HD13 7  
ATOM   8625  H HD21 . LEU A 1 39 ? 10.715  9.693   4.022   1.00 1.00 ? 39  LEU A HD21 7  
ATOM   8626  H HD22 . LEU A 1 39 ? 11.462  8.376   3.124   1.00 1.00 ? 39  LEU A HD22 7  
ATOM   8627  H HD23 . LEU A 1 39 ? 9.708   8.436   3.308   1.00 1.00 ? 39  LEU A HD23 7  
ATOM   8628  N N    . ASP A 1 40 ? 9.381   5.868   -0.348  1.00 1.00 ? 40  ASP A N    7  
ATOM   8629  C CA   . ASP A 1 40 ? 8.727   5.042   -1.360  1.00 1.00 ? 40  ASP A CA   7  
ATOM   8630  C C    . ASP A 1 40 ? 7.231   5.335   -1.406  1.00 1.00 ? 40  ASP A C    7  
ATOM   8631  O O    . ASP A 1 40 ? 6.472   4.632   -2.073  1.00 1.00 ? 40  ASP A O    7  
ATOM   8632  C CB   . ASP A 1 40 ? 8.951   3.562   -1.054  1.00 1.00 ? 40  ASP A CB   7  
ATOM   8633  C CG   . ASP A 1 40 ? 10.421  3.207   -1.252  1.00 1.00 ? 40  ASP A CG   7  
ATOM   8634  O OD1  . ASP A 1 40 ? 11.152  4.051   -1.745  1.00 1.00 ? 40  ASP A OD1  7  
ATOM   8635  O OD2  . ASP A 1 40 ? 10.794  2.098   -0.908  1.00 1.00 ? 40  ASP A OD2  7  
ATOM   8636  H H    . ASP A 1 40 ? 9.368   5.576   0.587   1.00 1.00 ? 40  ASP A H    7  
ATOM   8637  H HA   . ASP A 1 40 ? 9.153   5.261   -2.330  1.00 1.00 ? 40  ASP A HA   7  
ATOM   8638  H HB2  . ASP A 1 40 ? 8.669   3.361   -0.030  1.00 1.00 ? 40  ASP A HB2  7  
ATOM   8639  H HB3  . ASP A 1 40 ? 8.348   2.961   -1.717  1.00 1.00 ? 40  ASP A HB3  7  
ATOM   8640  N N    . THR A 1 41 ? 6.814   6.371   -0.684  1.00 1.00 ? 41  THR A N    7  
ATOM   8641  C CA   . THR A 1 41 ? 5.402   6.741   -0.645  1.00 1.00 ? 41  THR A CA   7  
ATOM   8642  C C    . THR A 1 41 ? 4.901   7.071   -2.046  1.00 1.00 ? 41  THR A C    7  
ATOM   8643  O O    . THR A 1 41 ? 3.819   6.645   -2.441  1.00 1.00 ? 41  THR A O    7  
ATOM   8644  C CB   . THR A 1 41 ? 5.203   7.954   0.267   1.00 1.00 ? 41  THR A CB   7  
ATOM   8645  O OG1  . THR A 1 41 ? 5.626   7.625   1.583   1.00 1.00 ? 41  THR A OG1  7  
ATOM   8646  C CG2  . THR A 1 41 ? 3.722   8.344   0.295   1.00 1.00 ? 41  THR A CG2  7  
ATOM   8647  H H    . THR A 1 41 ? 7.464   6.892   -0.169  1.00 1.00 ? 41  THR A H    7  
ATOM   8648  H HA   . THR A 1 41 ? 4.833   5.910   -0.254  1.00 1.00 ? 41  THR A HA   7  
ATOM   8649  H HB   . THR A 1 41 ? 5.782   8.783   -0.106  1.00 1.00 ? 41  THR A HB   7  
ATOM   8650  H HG1  . THR A 1 41 ? 6.343   8.220   1.820   1.00 1.00 ? 41  THR A HG1  7  
ATOM   8651  H HG21 . THR A 1 41 ? 3.112   7.454   0.372   1.00 1.00 ? 41  THR A HG21 7  
ATOM   8652  H HG22 . THR A 1 41 ? 3.468   8.877   -0.611  1.00 1.00 ? 41  THR A HG22 7  
ATOM   8653  H HG23 . THR A 1 41 ? 3.538   8.979   1.147   1.00 1.00 ? 41  THR A HG23 7  
ATOM   8654  N N    . VAL A 1 42 ? 5.700   7.830   -2.791  1.00 1.00 ? 42  VAL A N    7  
ATOM   8655  C CA   . VAL A 1 42 ? 5.336   8.211   -4.153  1.00 1.00 ? 42  VAL A CA   7  
ATOM   8656  C C    . VAL A 1 42 ? 5.254   6.973   -5.042  1.00 1.00 ? 42  VAL A C    7  
ATOM   8657  O O    . VAL A 1 42 ? 4.363   6.849   -5.878  1.00 1.00 ? 42  VAL A O    7  
ATOM   8658  C CB   . VAL A 1 42 ? 6.366   9.188   -4.720  1.00 1.00 ? 42  VAL A CB   7  
ATOM   8659  C CG1  . VAL A 1 42 ? 6.018   9.506   -6.178  1.00 1.00 ? 42  VAL A CG1  7  
ATOM   8660  C CG2  . VAL A 1 42 ? 6.346   10.478  -3.899  1.00 1.00 ? 42  VAL A CG2  7  
ATOM   8661  H H    . VAL A 1 42 ? 6.554   8.136   -2.418  1.00 1.00 ? 42  VAL A H    7  
ATOM   8662  H HA   . VAL A 1 42 ? 4.370   8.692   -4.134  1.00 1.00 ? 42  VAL A HA   7  
ATOM   8663  H HB   . VAL A 1 42 ? 7.349   8.743   -4.674  1.00 1.00 ? 42  VAL A HB   7  
ATOM   8664  H HG11 . VAL A 1 42 ? 6.222   8.643   -6.794  1.00 1.00 ? 42  VAL A HG11 7  
ATOM   8665  H HG12 . VAL A 1 42 ? 6.614   10.340  -6.516  1.00 1.00 ? 42  VAL A HG12 7  
ATOM   8666  H HG13 . VAL A 1 42 ? 4.970   9.761   -6.249  1.00 1.00 ? 42  VAL A HG13 7  
ATOM   8667  H HG21 . VAL A 1 42 ? 6.540   10.249  -2.862  1.00 1.00 ? 42  VAL A HG21 7  
ATOM   8668  H HG22 . VAL A 1 42 ? 5.377   10.947  -3.989  1.00 1.00 ? 42  VAL A HG22 7  
ATOM   8669  H HG23 . VAL A 1 42 ? 7.106   11.152  -4.267  1.00 1.00 ? 42  VAL A HG23 7  
ATOM   8670  N N    . GLU A 1 43 ? 6.200   6.063   -4.872  1.00 1.00 ? 43  GLU A N    7  
ATOM   8671  C CA   . GLU A 1 43 ? 6.210   4.843   -5.668  1.00 1.00 ? 43  GLU A CA   7  
ATOM   8672  C C    . GLU A 1 43 ? 5.087   3.908   -5.228  1.00 1.00 ? 43  GLU A C    7  
ATOM   8673  O O    . GLU A 1 43 ? 4.386   3.331   -6.060  1.00 1.00 ? 43  GLU A O    7  
ATOM   8674  C CB   . GLU A 1 43 ? 7.554   4.134   -5.521  1.00 1.00 ? 43  GLU A CB   7  
ATOM   8675  C CG   . GLU A 1 43 ? 8.638   4.964   -6.206  1.00 1.00 ? 43  GLU A CG   7  
ATOM   8676  C CD   . GLU A 1 43 ? 10.001  4.321   -5.992  1.00 1.00 ? 43  GLU A CD   7  
ATOM   8677  O OE1  . GLU A 1 43 ? 10.051  3.284   -5.349  1.00 1.00 ? 43  GLU A OE1  7  
ATOM   8678  O OE2  . GLU A 1 43 ? 10.978  4.872   -6.475  1.00 1.00 ? 43  GLU A OE2  7  
ATOM   8679  H H    . GLU A 1 43 ? 6.899   6.211   -4.202  1.00 1.00 ? 43  GLU A H    7  
ATOM   8680  H HA   . GLU A 1 43 ? 6.063   5.100   -6.705  1.00 1.00 ? 43  GLU A HA   7  
ATOM   8681  H HB2  . GLU A 1 43 ? 7.790   4.027   -4.471  1.00 1.00 ? 43  GLU A HB2  7  
ATOM   8682  H HB3  . GLU A 1 43 ? 7.501   3.160   -5.981  1.00 1.00 ? 43  GLU A HB3  7  
ATOM   8683  H HG2  . GLU A 1 43 ? 8.429   5.019   -7.266  1.00 1.00 ? 43  GLU A HG2  7  
ATOM   8684  H HG3  . GLU A 1 43 ? 8.643   5.961   -5.791  1.00 1.00 ? 43  GLU A HG3  7  
ATOM   8685  N N    . ILE A 1 44 ? 4.933   3.749   -3.917  1.00 1.00 ? 44  ILE A N    7  
ATOM   8686  C CA   . ILE A 1 44 ? 3.902   2.861   -3.387  1.00 1.00 ? 44  ILE A CA   7  
ATOM   8687  C C    . ILE A 1 44 ? 2.506   3.380   -3.692  1.00 1.00 ? 44  ILE A C    7  
ATOM   8688  O O    . ILE A 1 44 ? 1.660   2.644   -4.189  1.00 1.00 ? 44  ILE A O    7  
ATOM   8689  C CB   . ILE A 1 44 ? 4.068   2.723   -1.862  1.00 1.00 ? 44  ILE A CB   7  
ATOM   8690  C CG1  . ILE A 1 44 ? 5.366   1.959   -1.538  1.00 1.00 ? 44  ILE A CG1  7  
ATOM   8691  C CG2  . ILE A 1 44 ? 2.864   1.984   -1.258  1.00 1.00 ? 44  ILE A CG2  7  
ATOM   8692  C CD1  . ILE A 1 44 ? 5.170   0.442   -1.709  1.00 1.00 ? 44  ILE A CD1  7  
ATOM   8693  H H    . ILE A 1 44 ? 5.526   4.228   -3.301  1.00 1.00 ? 44  ILE A H    7  
ATOM   8694  H HA   . ILE A 1 44 ? 4.012   1.896   -3.843  1.00 1.00 ? 44  ILE A HA   7  
ATOM   8695  H HB   . ILE A 1 44 ? 4.122   3.711   -1.425  1.00 1.00 ? 44  ILE A HB   7  
ATOM   8696  H HG12 . ILE A 1 44 ? 6.151   2.300   -2.188  1.00 1.00 ? 44  ILE A HG12 7  
ATOM   8697  H HG13 . ILE A 1 44 ? 5.645   2.162   -0.514  1.00 1.00 ? 44  ILE A HG13 7  
ATOM   8698  H HG21 . ILE A 1 44 ? 2.022   2.658   -1.194  1.00 1.00 ? 44  ILE A HG21 7  
ATOM   8699  H HG22 . ILE A 1 44 ? 3.116   1.630   -0.270  1.00 1.00 ? 44  ILE A HG22 7  
ATOM   8700  H HG23 . ILE A 1 44 ? 2.607   1.146   -1.887  1.00 1.00 ? 44  ILE A HG23 7  
ATOM   8701  H HD11 . ILE A 1 44 ? 4.578   0.233   -2.580  1.00 1.00 ? 44  ILE A HD11 7  
ATOM   8702  H HD12 . ILE A 1 44 ? 4.663   0.059   -0.842  1.00 1.00 ? 44  ILE A HD12 7  
ATOM   8703  H HD13 . ILE A 1 44 ? 6.132   -0.037  -1.814  1.00 1.00 ? 44  ILE A HD13 7  
ATOM   8704  N N    . VAL A 1 45 ? 2.265   4.643   -3.389  1.00 1.00 ? 45  VAL A N    7  
ATOM   8705  C CA   . VAL A 1 45 ? 0.950   5.221   -3.620  1.00 1.00 ? 45  VAL A CA   7  
ATOM   8706  C C    . VAL A 1 45 ? 0.568   5.090   -5.088  1.00 1.00 ? 45  VAL A C    7  
ATOM   8707  O O    . VAL A 1 45 ? -0.574  4.769   -5.418  1.00 1.00 ? 45  VAL A O    7  
ATOM   8708  C CB   . VAL A 1 45 ? 0.963   6.700   -3.220  1.00 1.00 ? 45  VAL A CB   7  
ATOM   8709  C CG1  . VAL A 1 45 ? 1.786   7.498   -4.231  1.00 1.00 ? 45  VAL A CG1  7  
ATOM   8710  C CG2  . VAL A 1 45 ? -0.469  7.239   -3.187  1.00 1.00 ? 45  VAL A CG2  7  
ATOM   8711  H H    . VAL A 1 45 ? 2.972   5.189   -2.984  1.00 1.00 ? 45  VAL A H    7  
ATOM   8712  H HA   . VAL A 1 45 ? 0.227   4.696   -3.016  1.00 1.00 ? 45  VAL A HA   7  
ATOM   8713  H HB   . VAL A 1 45 ? 1.408   6.801   -2.239  1.00 1.00 ? 45  VAL A HB   7  
ATOM   8714  H HG11 . VAL A 1 45 ? 1.217   7.625   -5.146  1.00 1.00 ? 45  VAL A HG11 7  
ATOM   8715  H HG12 . VAL A 1 45 ? 2.687   6.963   -4.452  1.00 1.00 ? 45  VAL A HG12 7  
ATOM   8716  H HG13 . VAL A 1 45 ? 2.030   8.465   -3.820  1.00 1.00 ? 45  VAL A HG13 7  
ATOM   8717  H HG21 . VAL A 1 45 ? -0.479  8.192   -2.678  1.00 1.00 ? 45  VAL A HG21 7  
ATOM   8718  H HG22 . VAL A 1 45 ? -1.101  6.544   -2.660  1.00 1.00 ? 45  VAL A HG22 7  
ATOM   8719  H HG23 . VAL A 1 45 ? -0.829  7.365   -4.196  1.00 1.00 ? 45  VAL A HG23 7  
ATOM   8720  N N    . MET A 1 46 ? 1.528   5.353   -5.963  1.00 1.00 ? 46  MET A N    7  
ATOM   8721  C CA   . MET A 1 46 ? 1.279   5.274   -7.392  1.00 1.00 ? 46  MET A CA   7  
ATOM   8722  C C    . MET A 1 46 ? 0.915   3.846   -7.793  1.00 1.00 ? 46  MET A C    7  
ATOM   8723  O O    . MET A 1 46 ? 0.026   3.630   -8.615  1.00 1.00 ? 46  MET A O    7  
ATOM   8724  C CB   . MET A 1 46 ? 2.521   5.729   -8.162  1.00 1.00 ? 46  MET A CB   7  
ATOM   8725  C CG   . MET A 1 46 ? 2.138   6.053   -9.600  1.00 1.00 ? 46  MET A CG   7  
ATOM   8726  S SD   . MET A 1 46 ? 1.237   7.627   -9.643  1.00 1.00 ? 46  MET A SD   7  
ATOM   8727  C CE   . MET A 1 46 ? -0.329  7.009   -10.314 1.00 1.00 ? 46  MET A CE   7  
ATOM   8728  H H    . MET A 1 46 ? 2.418   5.610   -5.641  1.00 1.00 ? 46  MET A H    7  
ATOM   8729  H HA   . MET A 1 46 ? 0.455   5.926   -7.637  1.00 1.00 ? 46  MET A HA   7  
ATOM   8730  H HB2  . MET A 1 46 ? 2.932   6.610   -7.695  1.00 1.00 ? 46  MET A HB2  7  
ATOM   8731  H HB3  . MET A 1 46 ? 3.257   4.940   -8.159  1.00 1.00 ? 46  MET A HB3  7  
ATOM   8732  H HG2  . MET A 1 46 ? 3.034   6.138   -10.191 1.00 1.00 ? 46  MET A HG2  7  
ATOM   8733  H HG3  . MET A 1 46 ? 1.519   5.264   -9.991  1.00 1.00 ? 46  MET A HG3  7  
ATOM   8734  H HE1  . MET A 1 46 ? -0.144  6.516   -11.260 1.00 1.00 ? 46  MET A HE1  7  
ATOM   8735  H HE2  . MET A 1 46 ? -1.008  7.830   -10.465 1.00 1.00 ? 46  MET A HE2  7  
ATOM   8736  H HE3  . MET A 1 46 ? -0.766  6.307   -9.615  1.00 1.00 ? 46  MET A HE3  7  
ATOM   8737  N N    . ASN A 1 47 ? 1.607   2.869   -7.207  1.00 1.00 ? 47  ASN A N    7  
ATOM   8738  C CA   . ASN A 1 47 ? 1.343   1.471   -7.517  1.00 1.00 ? 47  ASN A CA   7  
ATOM   8739  C C    . ASN A 1 47 ? -0.081  1.091   -7.116  1.00 1.00 ? 47  ASN A C    7  
ATOM   8740  O O    . ASN A 1 47 ? -0.811  0.478   -7.891  1.00 1.00 ? 47  ASN A O    7  
ATOM   8741  C CB   . ASN A 1 47 ? 2.357   0.587   -6.766  1.00 1.00 ? 47  ASN A CB   7  
ATOM   8742  C CG   . ASN A 1 47 ? 3.665   0.495   -7.545  1.00 1.00 ? 47  ASN A CG   7  
ATOM   8743  O OD1  . ASN A 1 47 ? 4.571   1.302   -7.342  1.00 1.00 ? 47  ASN A OD1  7  
ATOM   8744  N ND2  . ASN A 1 47 ? 3.813   -0.452  -8.427  1.00 1.00 ? 47  ASN A ND2  7  
ATOM   8745  H H    . ASN A 1 47 ? 2.305   3.091   -6.557  1.00 1.00 ? 47  ASN A H    7  
ATOM   8746  H HA   . ASN A 1 47 ? 1.456   1.314   -8.580  1.00 1.00 ? 47  ASN A HA   7  
ATOM   8747  H HB2  . ASN A 1 47 ? 2.556   1.017   -5.796  1.00 1.00 ? 47  ASN A HB2  7  
ATOM   8748  H HB3  . ASN A 1 47 ? 1.956   -0.404  -6.636  1.00 1.00 ? 47  ASN A HB3  7  
ATOM   8749  H HD21 . ASN A 1 47 ? 3.087   -1.095  -8.580  1.00 1.00 ? 47  ASN A HD21 7  
ATOM   8750  H HD22 . ASN A 1 47 ? 4.646   -0.524  -8.937  1.00 1.00 ? 47  ASN A HD22 7  
ATOM   8751  N N    . LEU A 1 48 ? -0.470  1.466   -5.905  1.00 1.00 ? 48  LEU A N    7  
ATOM   8752  C CA   . LEU A 1 48 ? -1.809  1.160   -5.418  1.00 1.00 ? 48  LEU A CA   7  
ATOM   8753  C C    . LEU A 1 48 ? -2.849  1.942   -6.208  1.00 1.00 ? 48  LEU A C    7  
ATOM   8754  O O    . LEU A 1 48 ? -3.870  1.399   -6.627  1.00 1.00 ? 48  LEU A O    7  
ATOM   8755  C CB   . LEU A 1 48 ? -1.908  1.511   -3.926  1.00 1.00 ? 48  LEU A CB   7  
ATOM   8756  C CG   . LEU A 1 48 ? -0.739  0.865   -3.154  1.00 1.00 ? 48  LEU A CG   7  
ATOM   8757  C CD1  . LEU A 1 48 ? -0.567  1.569   -1.808  1.00 1.00 ? 48  LEU A CD1  7  
ATOM   8758  C CD2  . LEU A 1 48 ? -1.033  -0.615  -2.898  1.00 1.00 ? 48  LEU A CD2  7  
ATOM   8759  H H    . LEU A 1 48 ? 0.153   1.956   -5.329  1.00 1.00 ? 48  LEU A H    7  
ATOM   8760  H HA   . LEU A 1 48 ? -2.002  0.110   -5.547  1.00 1.00 ? 48  LEU A HA   7  
ATOM   8761  H HB2  . LEU A 1 48 ? -1.865  2.586   -3.811  1.00 1.00 ? 48  LEU A HB2  7  
ATOM   8762  H HB3  . LEU A 1 48 ? -2.848  1.145   -3.528  1.00 1.00 ? 48  LEU A HB3  7  
ATOM   8763  H HG   . LEU A 1 48 ? 0.170   0.955   -3.720  1.00 1.00 ? 48  LEU A HG   7  
ATOM   8764  H HD11 . LEU A 1 48 ? -0.275  2.596   -1.976  1.00 1.00 ? 48  LEU A HD11 7  
ATOM   8765  H HD12 . LEU A 1 48 ? 0.197   1.067   -1.234  1.00 1.00 ? 48  LEU A HD12 7  
ATOM   8766  H HD13 . LEU A 1 48 ? -1.501  1.543   -1.269  1.00 1.00 ? 48  LEU A HD13 7  
ATOM   8767  H HD21 . LEU A 1 48 ? -1.166  -1.128  -3.829  1.00 1.00 ? 48  LEU A HD21 7  
ATOM   8768  H HD22 . LEU A 1 48 ? -1.928  -0.700  -2.314  1.00 1.00 ? 48  LEU A HD22 7  
ATOM   8769  H HD23 . LEU A 1 48 ? -0.207  -1.057  -2.359  1.00 1.00 ? 48  LEU A HD23 7  
ATOM   8770  N N    . GLU A 1 49 ? -2.578  3.219   -6.422  1.00 1.00 ? 49  GLU A N    7  
ATOM   8771  C CA   . GLU A 1 49 ? -3.501  4.059   -7.166  1.00 1.00 ? 49  GLU A CA   7  
ATOM   8772  C C    . GLU A 1 49 ? -3.629  3.557   -8.597  1.00 1.00 ? 49  GLU A C    7  
ATOM   8773  O O    . GLU A 1 49 ? -4.708  3.595   -9.188  1.00 1.00 ? 49  GLU A O    7  
ATOM   8774  C CB   . GLU A 1 49 ? -3.006  5.505   -7.164  1.00 1.00 ? 49  GLU A CB   7  
ATOM   8775  C CG   . GLU A 1 49 ? -4.078  6.414   -7.771  1.00 1.00 ? 49  GLU A CG   7  
ATOM   8776  C CD   . GLU A 1 49 ? -3.576  7.853   -7.810  1.00 1.00 ? 49  GLU A CD   7  
ATOM   8777  O OE1  . GLU A 1 49 ? -2.613  8.142   -7.116  1.00 1.00 ? 49  GLU A OE1  7  
ATOM   8778  O OE2  . GLU A 1 49 ? -4.149  8.642   -8.540  1.00 1.00 ? 49  GLU A OE2  7  
ATOM   8779  H H    . GLU A 1 49 ? -1.747  3.603   -6.075  1.00 1.00 ? 49  GLU A H    7  
ATOM   8780  H HA   . GLU A 1 49 ? -4.467  4.021   -6.692  1.00 1.00 ? 49  GLU A HA   7  
ATOM   8781  H HB2  . GLU A 1 49 ? -2.803  5.814   -6.150  1.00 1.00 ? 49  GLU A HB2  7  
ATOM   8782  H HB3  . GLU A 1 49 ? -2.103  5.578   -7.751  1.00 1.00 ? 49  GLU A HB3  7  
ATOM   8783  H HG2  . GLU A 1 49 ? -4.304  6.083   -8.775  1.00 1.00 ? 49  GLU A HG2  7  
ATOM   8784  H HG3  . GLU A 1 49 ? -4.976  6.366   -7.164  1.00 1.00 ? 49  GLU A HG3  7  
ATOM   8785  N N    . GLU A 1 50 ? -2.517  3.086   -9.151  1.00 1.00 ? 50  GLU A N    7  
ATOM   8786  C CA   . GLU A 1 50 ? -2.513  2.571   -10.515 1.00 1.00 ? 50  GLU A CA   7  
ATOM   8787  C C    . GLU A 1 50 ? -3.181  1.200   -10.578 1.00 1.00 ? 50  GLU A C    7  
ATOM   8788  O O    . GLU A 1 50 ? -3.975  0.928   -11.479 1.00 1.00 ? 50  GLU A O    7  
ATOM   8789  C CB   . GLU A 1 50 ? -1.077  2.466   -11.035 1.00 1.00 ? 50  GLU A CB   7  
ATOM   8790  C CG   . GLU A 1 50 ? -1.090  2.011   -12.497 1.00 1.00 ? 50  GLU A CG   7  
ATOM   8791  C CD   . GLU A 1 50 ? 0.330   1.991   -13.052 1.00 1.00 ? 50  GLU A CD   7  
ATOM   8792  O OE1  . GLU A 1 50 ? 1.204   2.548   -12.408 1.00 1.00 ? 50  GLU A OE1  7  
ATOM   8793  O OE2  . GLU A 1 50 ? 0.523   1.417   -14.112 1.00 1.00 ? 50  GLU A OE2  7  
ATOM   8794  H H    . GLU A 1 50 ? -1.686  3.077   -8.631  1.00 1.00 ? 50  GLU A H    7  
ATOM   8795  H HA   . GLU A 1 50 ? -3.059  3.253   -11.144 1.00 1.00 ? 50  GLU A HA   7  
ATOM   8796  H HB2  . GLU A 1 50 ? -0.597  3.433   -10.964 1.00 1.00 ? 50  GLU A HB2  7  
ATOM   8797  H HB3  . GLU A 1 50 ? -0.529  1.748   -10.443 1.00 1.00 ? 50  GLU A HB3  7  
ATOM   8798  H HG2  . GLU A 1 50 ? -1.511  1.018   -12.559 1.00 1.00 ? 50  GLU A HG2  7  
ATOM   8799  H HG3  . GLU A 1 50 ? -1.692  2.692   -13.081 1.00 1.00 ? 50  GLU A HG3  7  
ATOM   8800  N N    . GLU A 1 51 ? -2.846  0.335   -9.623  1.00 1.00 ? 51  GLU A N    7  
ATOM   8801  C CA   . GLU A 1 51 ? -3.414  -1.007  -9.590  1.00 1.00 ? 51  GLU A CA   7  
ATOM   8802  C C    . GLU A 1 51 ? -4.919  -0.948  -9.347  1.00 1.00 ? 51  GLU A C    7  
ATOM   8803  O O    . GLU A 1 51 ? -5.709  -1.431  -10.159 1.00 1.00 ? 51  GLU A O    7  
ATOM   8804  C CB   . GLU A 1 51 ? -2.752  -1.820  -8.476  1.00 1.00 ? 51  GLU A CB   7  
ATOM   8805  C CG   . GLU A 1 51 ? -3.171  -3.288  -8.583  1.00 1.00 ? 51  GLU A CG   7  
ATOM   8806  C CD   . GLU A 1 51 ? -2.506  -3.929  -9.797  1.00 1.00 ? 51  GLU A CD   7  
ATOM   8807  O OE1  . GLU A 1 51 ? -1.664  -3.281  -10.394 1.00 1.00 ? 51  GLU A OE1  7  
ATOM   8808  O OE2  . GLU A 1 51 ? -2.848  -5.057  -10.108 1.00 1.00 ? 51  GLU A OE2  7  
ATOM   8809  H H    . GLU A 1 51 ? -2.201  0.602   -8.934  1.00 1.00 ? 51  GLU A H    7  
ATOM   8810  H HA   . GLU A 1 51 ? -3.229  -1.494  -10.535 1.00 1.00 ? 51  GLU A HA   7  
ATOM   8811  H HB2  . GLU A 1 51 ? -1.677  -1.746  -8.569  1.00 1.00 ? 51  GLU A HB2  7  
ATOM   8812  H HB3  . GLU A 1 51 ? -3.054  -1.430  -7.516  1.00 1.00 ? 51  GLU A HB3  7  
ATOM   8813  H HG2  . GLU A 1 51 ? -2.871  -3.813  -7.689  1.00 1.00 ? 51  GLU A HG2  7  
ATOM   8814  H HG3  . GLU A 1 51 ? -4.244  -3.352  -8.690  1.00 1.00 ? 51  GLU A HG3  7  
ATOM   8815  N N    . PHE A 1 52 ? -5.308  -0.348  -8.228  1.00 1.00 ? 52  PHE A N    7  
ATOM   8816  C CA   . PHE A 1 52 ? -6.721  -0.226  -7.886  1.00 1.00 ? 52  PHE A CA   7  
ATOM   8817  C C    . PHE A 1 52 ? -7.439  0.655   -8.899  1.00 1.00 ? 52  PHE A C    7  
ATOM   8818  O O    . PHE A 1 52 ? -8.599  0.413   -9.233  1.00 1.00 ? 52  PHE A O    7  
ATOM   8819  C CB   . PHE A 1 52 ? -6.877  0.359   -6.481  1.00 1.00 ? 52  PHE A CB   7  
ATOM   8820  C CG   . PHE A 1 52 ? -6.453  -0.666  -5.454  1.00 1.00 ? 52  PHE A CG   7  
ATOM   8821  C CD1  . PHE A 1 52 ? -7.183  -1.855  -5.308  1.00 1.00 ? 52  PHE A CD1  7  
ATOM   8822  C CD2  . PHE A 1 52 ? -5.331  -0.433  -4.649  1.00 1.00 ? 52  PHE A CD2  7  
ATOM   8823  C CE1  . PHE A 1 52 ? -6.788  -2.803  -4.356  1.00 1.00 ? 52  PHE A CE1  7  
ATOM   8824  C CE2  . PHE A 1 52 ? -4.942  -1.379  -3.701  1.00 1.00 ? 52  PHE A CE2  7  
ATOM   8825  C CZ   . PHE A 1 52 ? -5.668  -2.562  -3.554  1.00 1.00 ? 52  PHE A CZ   7  
ATOM   8826  H H    . PHE A 1 52 ? -4.633  0.020   -7.620  1.00 1.00 ? 52  PHE A H    7  
ATOM   8827  H HA   . PHE A 1 52 ? -7.170  -1.207  -7.903  1.00 1.00 ? 52  PHE A HA   7  
ATOM   8828  H HB2  . PHE A 1 52 ? -6.258  1.238   -6.391  1.00 1.00 ? 52  PHE A HB2  7  
ATOM   8829  H HB3  . PHE A 1 52 ? -7.905  0.628   -6.313  1.00 1.00 ? 52  PHE A HB3  7  
ATOM   8830  H HD1  . PHE A 1 52 ? -8.049  -2.040  -5.926  1.00 1.00 ? 52  PHE A HD1  7  
ATOM   8831  H HD2  . PHE A 1 52 ? -4.772  0.480   -4.751  1.00 1.00 ? 52  PHE A HD2  7  
ATOM   8832  H HE1  . PHE A 1 52 ? -7.347  -3.721  -4.240  1.00 1.00 ? 52  PHE A HE1  7  
ATOM   8833  H HE2  . PHE A 1 52 ? -4.077  -1.199  -3.085  1.00 1.00 ? 52  PHE A HE2  7  
ATOM   8834  H HZ   . PHE A 1 52 ? -5.366  -3.284  -2.819  1.00 1.00 ? 52  PHE A HZ   7  
ATOM   8835  N N    . GLY A 1 53 ? -6.744  1.681   -9.383  1.00 1.00 ? 53  GLY A N    7  
ATOM   8836  C CA   . GLY A 1 53 ? -7.329  2.595   -10.357 1.00 1.00 ? 53  GLY A CA   7  
ATOM   8837  C C    . GLY A 1 53 ? -8.103  3.707   -9.664  1.00 1.00 ? 53  GLY A C    7  
ATOM   8838  O O    . GLY A 1 53 ? -9.068  4.240   -10.212 1.00 1.00 ? 53  GLY A O    7  
ATOM   8839  H H    . GLY A 1 53 ? -5.825  1.825   -9.078  1.00 1.00 ? 53  GLY A H    7  
ATOM   8840  H HA2  . GLY A 1 53 ? -6.539  3.030   -10.952 1.00 1.00 ? 53  GLY A HA2  7  
ATOM   8841  H HA3  . GLY A 1 53 ? -8.000  2.049   -11.006 1.00 1.00 ? 53  GLY A HA3  7  
ATOM   8842  N N    . ILE A 1 54 ? -7.677  4.053   -8.451  1.00 1.00 ? 54  ILE A N    7  
ATOM   8843  C CA   . ILE A 1 54 ? -8.336  5.109   -7.683  1.00 1.00 ? 54  ILE A CA   7  
ATOM   8844  C C    . ILE A 1 54 ? -7.548  6.411   -7.789  1.00 1.00 ? 54  ILE A C    7  
ATOM   8845  O O    . ILE A 1 54 ? -6.738  6.585   -8.698  1.00 1.00 ? 54  ILE A O    7  
ATOM   8846  C CB   . ILE A 1 54 ? -8.457  4.688   -6.218  1.00 1.00 ? 54  ILE A CB   7  
ATOM   8847  C CG1  . ILE A 1 54 ? -7.063  4.356   -5.665  1.00 1.00 ? 54  ILE A CG1  7  
ATOM   8848  C CG2  . ILE A 1 54 ? -9.373  3.469   -6.113  1.00 1.00 ? 54  ILE A CG2  7  
ATOM   8849  C CD1  . ILE A 1 54 ? -7.136  4.031   -4.172  1.00 1.00 ? 54  ILE A CD1  7  
ATOM   8850  H H    . ILE A 1 54 ? -6.902  3.593   -8.064  1.00 1.00 ? 54  ILE A H    7  
ATOM   8851  H HA   . ILE A 1 54 ? -9.330  5.274   -8.076  1.00 1.00 ? 54  ILE A HA   7  
ATOM   8852  H HB   . ILE A 1 54 ? -8.880  5.500   -5.657  1.00 1.00 ? 54  ILE A HB   7  
ATOM   8853  H HG12 . ILE A 1 54 ? -6.660  3.510   -6.197  1.00 1.00 ? 54  ILE A HG12 7  
ATOM   8854  H HG13 . ILE A 1 54 ? -6.418  5.207   -5.800  1.00 1.00 ? 54  ILE A HG13 7  
ATOM   8855  H HG21 . ILE A 1 54 ? -8.956  2.661   -6.691  1.00 1.00 ? 54  ILE A HG21 7  
ATOM   8856  H HG22 . ILE A 1 54 ? -10.353 3.716   -6.491  1.00 1.00 ? 54  ILE A HG22 7  
ATOM   8857  H HG23 . ILE A 1 54 ? -9.455  3.168   -5.078  1.00 1.00 ? 54  ILE A HG23 7  
ATOM   8858  H HD11 . ILE A 1 54 ? -7.957  3.363   -3.984  1.00 1.00 ? 54  ILE A HD11 7  
ATOM   8859  H HD12 . ILE A 1 54 ? -7.275  4.940   -3.613  1.00 1.00 ? 54  ILE A HD12 7  
ATOM   8860  H HD13 . ILE A 1 54 ? -6.212  3.557   -3.865  1.00 1.00 ? 54  ILE A HD13 7  
ATOM   8861  N N    . ASN A 1 55 ? -7.792  7.327   -6.852  1.00 1.00 ? 55  ASN A N    7  
ATOM   8862  C CA   . ASN A 1 55 ? -7.102  8.617   -6.842  1.00 1.00 ? 55  ASN A CA   7  
ATOM   8863  C C    . ASN A 1 55 ? -6.699  8.987   -5.420  1.00 1.00 ? 55  ASN A C    7  
ATOM   8864  O O    . ASN A 1 55 ? -7.480  9.577   -4.673  1.00 1.00 ? 55  ASN A O    7  
ATOM   8865  C CB   . ASN A 1 55 ? -8.018  9.700   -7.422  1.00 1.00 ? 55  ASN A CB   7  
ATOM   8866  C CG   . ASN A 1 55 ? -9.446  9.495   -6.925  1.00 1.00 ? 55  ASN A CG   7  
ATOM   8867  O OD1  . ASN A 1 55 ? -10.358 9.291   -7.725  1.00 1.00 ? 55  ASN A OD1  7  
ATOM   8868  N ND2  . ASN A 1 55 ? -9.695  9.534   -5.645  1.00 1.00 ? 55  ASN A ND2  7  
ATOM   8869  H H    . ASN A 1 55 ? -8.448  7.136   -6.152  1.00 1.00 ? 55  ASN A H    7  
ATOM   8870  H HA   . ASN A 1 55 ? -6.211  8.554   -7.449  1.00 1.00 ? 55  ASN A HA   7  
ATOM   8871  H HB2  . ASN A 1 55 ? -7.669  10.676  -7.116  1.00 1.00 ? 55  ASN A HB2  7  
ATOM   8872  H HB3  . ASN A 1 55 ? -8.006  9.639   -8.499  1.00 1.00 ? 55  ASN A HB3  7  
ATOM   8873  H HD21 . ASN A 1 55 ? -8.968  9.693   -5.008  1.00 1.00 ? 55  ASN A HD21 7  
ATOM   8874  H HD22 . ASN A 1 55 ? -10.610 9.402   -5.320  1.00 1.00 ? 55  ASN A HD22 7  
ATOM   8875  N N    . VAL A 1 56 ? -5.469  8.639   -5.051  1.00 1.00 ? 56  VAL A N    7  
ATOM   8876  C CA   . VAL A 1 56 ? -4.971  8.939   -3.713  1.00 1.00 ? 56  VAL A CA   7  
ATOM   8877  C C    . VAL A 1 56 ? -4.366  10.339  -3.676  1.00 1.00 ? 56  VAL A C    7  
ATOM   8878  O O    . VAL A 1 56 ? -3.519  10.682  -4.500  1.00 1.00 ? 56  VAL A O    7  
ATOM   8879  C CB   . VAL A 1 56 ? -3.908  7.917   -3.310  1.00 1.00 ? 56  VAL A CB   7  
ATOM   8880  C CG1  . VAL A 1 56 ? -3.339  8.291   -1.932  1.00 1.00 ? 56  VAL A CG1  7  
ATOM   8881  C CG2  . VAL A 1 56 ? -4.530  6.511   -3.254  1.00 1.00 ? 56  VAL A CG2  7  
ATOM   8882  H H    . VAL A 1 56 ? -4.889  8.171   -5.686  1.00 1.00 ? 56  VAL A H    7  
ATOM   8883  H HA   . VAL A 1 56 ? -5.787  8.890   -3.006  1.00 1.00 ? 56  VAL A HA   7  
ATOM   8884  H HB   . VAL A 1 56 ? -3.109  7.929   -4.038  1.00 1.00 ? 56  VAL A HB   7  
ATOM   8885  H HG11 . VAL A 1 56 ? -2.597  9.067   -2.048  1.00 1.00 ? 56  VAL A HG11 7  
ATOM   8886  H HG12 . VAL A 1 56 ? -2.886  7.426   -1.483  1.00 1.00 ? 56  VAL A HG12 7  
ATOM   8887  H HG13 . VAL A 1 56 ? -4.135  8.646   -1.291  1.00 1.00 ? 56  VAL A HG13 7  
ATOM   8888  H HG21 . VAL A 1 56 ? -5.041  6.376   -2.314  1.00 1.00 ? 56  VAL A HG21 7  
ATOM   8889  H HG22 . VAL A 1 56 ? -3.751  5.770   -3.345  1.00 1.00 ? 56  VAL A HG22 7  
ATOM   8890  H HG23 . VAL A 1 56 ? -5.232  6.392   -4.068  1.00 1.00 ? 56  VAL A HG23 7  
ATOM   8891  N N    . ASP A 1 57 ? -4.806  11.140  -2.710  1.00 1.00 ? 57  ASP A N    7  
ATOM   8892  C CA   . ASP A 1 57 ? -4.304  12.503  -2.562  1.00 1.00 ? 57  ASP A CA   7  
ATOM   8893  C C    . ASP A 1 57 ? -3.083  12.524  -1.647  1.00 1.00 ? 57  ASP A C    7  
ATOM   8894  O O    . ASP A 1 57 ? -2.988  11.735  -0.707  1.00 1.00 ? 57  ASP A O    7  
ATOM   8895  C CB   . ASP A 1 57 ? -5.398  13.401  -1.978  1.00 1.00 ? 57  ASP A CB   7  
ATOM   8896  C CG   . ASP A 1 57 ? -6.525  13.570  -2.991  1.00 1.00 ? 57  ASP A CG   7  
ATOM   8897  O OD1  . ASP A 1 57 ? -6.294  13.295  -4.158  1.00 1.00 ? 57  ASP A OD1  7  
ATOM   8898  O OD2  . ASP A 1 57 ? -7.606  13.967  -2.586  1.00 1.00 ? 57  ASP A OD2  7  
ATOM   8899  H H    . ASP A 1 57 ? -5.481  10.808  -2.083  1.00 1.00 ? 57  ASP A H    7  
ATOM   8900  H HA   . ASP A 1 57 ? -4.021  12.887  -3.532  1.00 1.00 ? 57  ASP A HA   7  
ATOM   8901  H HB2  . ASP A 1 57 ? -5.787  12.952  -1.076  1.00 1.00 ? 57  ASP A HB2  7  
ATOM   8902  H HB3  . ASP A 1 57 ? -4.980  14.369  -1.747  1.00 1.00 ? 57  ASP A HB3  7  
ATOM   8903  N N    . GLU A 1 58 ? -2.157  13.433  -1.923  1.00 1.00 ? 58  GLU A N    7  
ATOM   8904  C CA   . GLU A 1 58 ? -0.948  13.552  -1.117  1.00 1.00 ? 58  GLU A CA   7  
ATOM   8905  C C    . GLU A 1 58 ? -1.306  13.752  0.352   1.00 1.00 ? 58  GLU A C    7  
ATOM   8906  O O    . GLU A 1 58 ? -0.469  13.574  1.235   1.00 1.00 ? 58  GLU A O    7  
ATOM   8907  C CB   . GLU A 1 58 ? -0.115  14.738  -1.609  1.00 1.00 ? 58  GLU A CB   7  
ATOM   8908  C CG   . GLU A 1 58 ? -0.965  16.012  -1.575  1.00 1.00 ? 58  GLU A CG   7  
ATOM   8909  C CD   . GLU A 1 58 ? -0.152  17.195  -2.088  1.00 1.00 ? 58  GLU A CD   7  
ATOM   8910  O OE1  . GLU A 1 58 ? 1.040   17.027  -2.293  1.00 1.00 ? 58  GLU A OE1  7  
ATOM   8911  O OE2  . GLU A 1 58 ? -0.732  18.253  -2.272  1.00 1.00 ? 58  GLU A OE2  7  
ATOM   8912  H H    . GLU A 1 58 ? -2.289  14.037  -2.685  1.00 1.00 ? 58  GLU A H    7  
ATOM   8913  H HA   . GLU A 1 58 ? -0.361  12.647  -1.214  1.00 1.00 ? 58  GLU A HA   7  
ATOM   8914  H HB2  . GLU A 1 58 ? 0.745   14.865  -0.963  1.00 1.00 ? 58  GLU A HB2  7  
ATOM   8915  H HB3  . GLU A 1 58 ? 0.217   14.553  -2.617  1.00 1.00 ? 58  GLU A HB3  7  
ATOM   8916  H HG2  . GLU A 1 58 ? -1.835  15.875  -2.203  1.00 1.00 ? 58  GLU A HG2  7  
ATOM   8917  H HG3  . GLU A 1 58 ? -1.280  16.208  -0.563  1.00 1.00 ? 58  GLU A HG3  7  
ATOM   8918  N N    . ASP A 1 59 ? -2.559  14.122  0.605   1.00 1.00 ? 59  ASP A N    7  
ATOM   8919  C CA   . ASP A 1 59 ? -3.017  14.339  1.975   1.00 1.00 ? 59  ASP A CA   7  
ATOM   8920  C C    . ASP A 1 59 ? -3.418  13.023  2.616   1.00 1.00 ? 59  ASP A C    7  
ATOM   8921  O O    . ASP A 1 59 ? -3.401  12.885  3.839   1.00 1.00 ? 59  ASP A O    7  
ATOM   8922  C CB   . ASP A 1 59 ? -4.211  15.296  1.982   1.00 1.00 ? 59  ASP A CB   7  
ATOM   8923  C CG   . ASP A 1 59 ? -3.746  16.705  1.629   1.00 1.00 ? 59  ASP A CG   7  
ATOM   8924  O OD1  . ASP A 1 59 ? -2.551  16.943  1.683   1.00 1.00 ? 59  ASP A OD1  7  
ATOM   8925  O OD2  . ASP A 1 59 ? -4.590  17.525  1.308   1.00 1.00 ? 59  ASP A OD2  7  
ATOM   8926  H H    . ASP A 1 59 ? -3.186  14.244  -0.136  1.00 1.00 ? 59  ASP A H    7  
ATOM   8927  H HA   . ASP A 1 59 ? -2.215  14.779  2.550   1.00 1.00 ? 59  ASP A HA   7  
ATOM   8928  H HB2  . ASP A 1 59 ? -4.941  14.963  1.257   1.00 1.00 ? 59  ASP A HB2  7  
ATOM   8929  H HB3  . ASP A 1 59 ? -4.659  15.301  2.965   1.00 1.00 ? 59  ASP A HB3  7  
ATOM   8930  N N    . LYS A 1 60 ? -3.778  12.050  1.782   1.00 1.00 ? 60  LYS A N    7  
ATOM   8931  C CA   . LYS A 1 60 ? -4.181  10.738  2.275   1.00 1.00 ? 60  LYS A CA   7  
ATOM   8932  C C    . LYS A 1 60 ? -3.004  9.777   2.263   1.00 1.00 ? 60  LYS A C    7  
ATOM   8933  O O    . LYS A 1 60 ? -3.098  8.667   2.778   1.00 1.00 ? 60  LYS A O    7  
ATOM   8934  C CB   . LYS A 1 60 ? -5.331  10.190  1.404   1.00 1.00 ? 60  LYS A CB   7  
ATOM   8935  C CG   . LYS A 1 60 ? -6.677  10.307  2.140   1.00 1.00 ? 60  LYS A CG   7  
ATOM   8936  C CD   . LYS A 1 60 ? -6.722  9.333   3.333   1.00 1.00 ? 60  LYS A CD   7  
ATOM   8937  C CE   . LYS A 1 60 ? -8.171  8.991   3.671   1.00 1.00 ? 60  LYS A CE   7  
ATOM   8938  N NZ   . LYS A 1 60 ? -8.227  8.406   5.037   1.00 1.00 ? 60  LYS A NZ   7  
ATOM   8939  H H    . LYS A 1 60 ? -3.769  12.215  0.816   1.00 1.00 ? 60  LYS A H    7  
ATOM   8940  H HA   . LYS A 1 60 ? -4.518  10.838  3.291   1.00 1.00 ? 60  LYS A HA   7  
ATOM   8941  H HB2  . LYS A 1 60 ? -5.383  10.764  0.491   1.00 1.00 ? 60  LYS A HB2  7  
ATOM   8942  H HB3  . LYS A 1 60 ? -5.151  9.157   1.151   1.00 1.00 ? 60  LYS A HB3  7  
ATOM   8943  H HG2  . LYS A 1 60 ? -6.793  11.317  2.501   1.00 1.00 ? 60  LYS A HG2  7  
ATOM   8944  H HG3  . LYS A 1 60 ? -7.477  10.076  1.454   1.00 1.00 ? 60  LYS A HG3  7  
ATOM   8945  H HD2  . LYS A 1 60 ? -6.195  8.430   3.087   1.00 1.00 ? 60  LYS A HD2  7  
ATOM   8946  H HD3  . LYS A 1 60 ? -6.265  9.789   4.195   1.00 1.00 ? 60  LYS A HD3  7  
ATOM   8947  H HE2  . LYS A 1 60 ? -8.771  9.889   3.636   1.00 1.00 ? 60  LYS A HE2  7  
ATOM   8948  H HE3  . LYS A 1 60 ? -8.548  8.276   2.955   1.00 1.00 ? 60  LYS A HE3  7  
ATOM   8949  H HZ1  . LYS A 1 60 ? -8.960  7.672   5.071   1.00 1.00 ? 60  LYS A HZ1  7  
ATOM   8950  H HZ2  . LYS A 1 60 ? -8.448  9.155   5.725   1.00 1.00 ? 60  LYS A HZ2  7  
ATOM   8951  H HZ3  . LYS A 1 60 ? -7.305  7.982   5.269   1.00 1.00 ? 60  LYS A HZ3  7  
ATOM   8952  N N    . ALA A 1 61 ? -1.899  10.200  1.670   1.00 1.00 ? 61  ALA A N    7  
ATOM   8953  C CA   . ALA A 1 61 ? -0.707  9.359   1.597   1.00 1.00 ? 61  ALA A CA   7  
ATOM   8954  C C    . ALA A 1 61 ? 0.480   10.072  2.219   1.00 1.00 ? 61  ALA A C    7  
ATOM   8955  O O    . ALA A 1 61 ? 1.581   10.040  1.680   1.00 1.00 ? 61  ALA A O    7  
ATOM   8956  C CB   . ALA A 1 61 ? -0.398  9.032   0.137   1.00 1.00 ? 61  ALA A CB   7  
ATOM   8957  H H    . ALA A 1 61 ? -1.881  11.094  1.270   1.00 1.00 ? 61  ALA A H    7  
ATOM   8958  H HA   . ALA A 1 61 ? -0.877  8.432   2.132   1.00 1.00 ? 61  ALA A HA   7  
ATOM   8959  H HB1  . ALA A 1 61 ? 0.543   8.506   0.078   1.00 1.00 ? 61  ALA A HB1  7  
ATOM   8960  H HB2  . ALA A 1 61 ? -0.337  9.949   -0.431  1.00 1.00 ? 61  ALA A HB2  7  
ATOM   8961  H HB3  . ALA A 1 61 ? -1.182  8.413   -0.264  1.00 1.00 ? 61  ALA A HB3  7  
ATOM   8962  N N    . GLN A 1 62 ? 0.251   10.719  3.359   1.00 1.00 ? 62  GLN A N    7  
ATOM   8963  C CA   . GLN A 1 62 ? 1.318   11.442  4.057   1.00 1.00 ? 62  GLN A CA   7  
ATOM   8964  C C    . GLN A 1 62 ? 1.558   10.844  5.438   1.00 1.00 ? 62  GLN A C    7  
ATOM   8965  O O    . GLN A 1 62 ? 2.691   10.804  5.919   1.00 1.00 ? 62  GLN A O    7  
ATOM   8966  C CB   . GLN A 1 62 ? 0.942   12.916  4.197   1.00 1.00 ? 62  GLN A CB   7  
ATOM   8967  C CG   . GLN A 1 62 ? -0.415  13.034  4.889   1.00 1.00 ? 62  GLN A CG   7  
ATOM   8968  C CD   . GLN A 1 62 ? -0.840  14.496  4.952   1.00 1.00 ? 62  GLN A CD   7  
ATOM   8969  O OE1  . GLN A 1 62 ? -2.034  14.800  4.922   1.00 1.00 ? 62  GLN A OE1  7  
ATOM   8970  N NE2  . GLN A 1 62 ? 0.070   15.428  5.038   1.00 1.00 ? 62  GLN A NE2  7  
ATOM   8971  H H    . GLN A 1 62 ? -0.651  10.712  3.743   1.00 1.00 ? 62  GLN A H    7  
ATOM   8972  H HA   . GLN A 1 62 ? 2.234   11.376  3.487   1.00 1.00 ? 62  GLN A HA   7  
ATOM   8973  H HB2  . GLN A 1 62 ? 1.693   13.424  4.787   1.00 1.00 ? 62  GLN A HB2  7  
ATOM   8974  H HB3  . GLN A 1 62 ? 0.886   13.366  3.219   1.00 1.00 ? 62  GLN A HB3  7  
ATOM   8975  H HG2  . GLN A 1 62 ? -1.147  12.468  4.332   1.00 1.00 ? 62  GLN A HG2  7  
ATOM   8976  H HG3  . GLN A 1 62 ? -0.343  12.640  5.891   1.00 1.00 ? 62  GLN A HG3  7  
ATOM   8977  H HE21 . GLN A 1 62 ? 1.019   15.185  5.063   1.00 1.00 ? 62  GLN A HE21 7  
ATOM   8978  H HE22 . GLN A 1 62 ? -0.196  16.371  5.079   1.00 1.00 ? 62  GLN A HE22 7  
ATOM   8979  N N    . ASP A 1 63 ? 0.485   10.384  6.077   1.00 1.00 ? 63  ASP A N    7  
ATOM   8980  C CA   . ASP A 1 63 ? 0.585   9.792   7.413   1.00 1.00 ? 63  ASP A CA   7  
ATOM   8981  C C    . ASP A 1 63 ? -0.265  8.529   7.511   1.00 1.00 ? 63  ASP A C    7  
ATOM   8982  O O    . ASP A 1 63 ? -1.036  8.360   8.460   1.00 1.00 ? 63  ASP A O    7  
ATOM   8983  C CB   . ASP A 1 63 ? 0.122   10.802  8.460   1.00 1.00 ? 63  ASP A CB   7  
ATOM   8984  C CG   . ASP A 1 63 ? 1.157   11.913  8.600   1.00 1.00 ? 63  ASP A CG   7  
ATOM   8985  O OD1  . ASP A 1 63 ? 2.249   11.748  8.082   1.00 1.00 ? 63  ASP A OD1  7  
ATOM   8986  O OD2  . ASP A 1 63 ? 0.842   12.913  9.224   1.00 1.00 ? 63  ASP A OD2  7  
ATOM   8987  H H    . ASP A 1 63 ? -0.392  10.446  5.647   1.00 1.00 ? 63  ASP A H    7  
ATOM   8988  H HA   . ASP A 1 63 ? 1.614   9.532   7.615   1.00 1.00 ? 63  ASP A HA   7  
ATOM   8989  H HB2  . ASP A 1 63 ? -0.824  11.227  8.156   1.00 1.00 ? 63  ASP A HB2  7  
ATOM   8990  H HB3  . ASP A 1 63 ? 0.001   10.305  9.408   1.00 1.00 ? 63  ASP A HB3  7  
ATOM   8991  N N    . ILE A 1 64 ? -0.114  7.638   6.536   1.00 1.00 ? 64  ILE A N    7  
ATOM   8992  C CA   . ILE A 1 64 ? -0.864  6.385   6.526   1.00 1.00 ? 64  ILE A CA   7  
ATOM   8993  C C    . ILE A 1 64 ? -0.139  5.319   7.336   1.00 1.00 ? 64  ILE A C    7  
ATOM   8994  O O    . ILE A 1 64 ? 1.055   5.080   7.151   1.00 1.00 ? 64  ILE A O    7  
ATOM   8995  C CB   . ILE A 1 64 ? -1.063  5.898   5.086   1.00 1.00 ? 64  ILE A CB   7  
ATOM   8996  C CG1  . ILE A 1 64 ? -1.956  6.893   4.323   1.00 1.00 ? 64  ILE A CG1  7  
ATOM   8997  C CG2  . ILE A 1 64 ? -1.707  4.509   5.080   1.00 1.00 ? 64  ILE A CG2  7  
ATOM   8998  C CD1  . ILE A 1 64 ? -3.350  7.007   4.976   1.00 1.00 ? 64  ILE A CD1  7  
ATOM   8999  H H    . ILE A 1 64 ? 0.521   7.824   5.813   1.00 1.00 ? 64  ILE A H    7  
ATOM   9000  H HA   . ILE A 1 64 ? -1.831  6.551   6.973   1.00 1.00 ? 64  ILE A HA   7  
ATOM   9001  H HB   . ILE A 1 64 ? -0.100  5.839   4.598   1.00 1.00 ? 64  ILE A HB   7  
ATOM   9002  H HG12 . ILE A 1 64 ? -1.485  7.863   4.327   1.00 1.00 ? 64  ILE A HG12 7  
ATOM   9003  H HG13 . ILE A 1 64 ? -2.069  6.558   3.303   1.00 1.00 ? 64  ILE A HG13 7  
ATOM   9004  H HG21 . ILE A 1 64 ? -0.974  3.769   5.353   1.00 1.00 ? 64  ILE A HG21 7  
ATOM   9005  H HG22 . ILE A 1 64 ? -2.084  4.291   4.093   1.00 1.00 ? 64  ILE A HG22 7  
ATOM   9006  H HG23 . ILE A 1 64 ? -2.524  4.489   5.789   1.00 1.00 ? 64  ILE A HG23 7  
ATOM   9007  H HD11 . ILE A 1 64 ? -3.349  7.829   5.676   1.00 1.00 ? 64  ILE A HD11 7  
ATOM   9008  H HD12 . ILE A 1 64 ? -3.595  6.100   5.500   1.00 1.00 ? 64  ILE A HD12 7  
ATOM   9009  H HD13 . ILE A 1 64 ? -4.093  7.185   4.216   1.00 1.00 ? 64  ILE A HD13 7  
ATOM   9010  N N    . SER A 1 65 ? -0.881  4.683   8.232   1.00 1.00 ? 65  SER A N    7  
ATOM   9011  C CA   . SER A 1 65 ? -0.322  3.636   9.077   1.00 1.00 ? 65  SER A CA   7  
ATOM   9012  C C    . SER A 1 65 ? 0.056   2.434   8.217   1.00 1.00 ? 65  SER A C    7  
ATOM   9013  O O    . SER A 1 65 ? 0.061   2.516   6.992   1.00 1.00 ? 65  SER A O    7  
ATOM   9014  C CB   . SER A 1 65 ? -1.336  3.211   10.158  1.00 1.00 ? 65  SER A CB   7  
ATOM   9015  O OG   . SER A 1 65 ? -1.718  1.853   9.957   1.00 1.00 ? 65  SER A OG   7  
ATOM   9016  H H    . SER A 1 65 ? -1.831  4.922   8.324   1.00 1.00 ? 65  SER A H    7  
ATOM   9017  H HA   . SER A 1 65 ? 0.569   4.016   9.555   1.00 1.00 ? 65  SER A HA   7  
ATOM   9018  H HB2  . SER A 1 65 ? -0.899  3.309   11.137  1.00 1.00 ? 65  SER A HB2  7  
ATOM   9019  H HB3  . SER A 1 65 ? -2.209  3.851   10.097  1.00 1.00 ? 65  SER A HB3  7  
ATOM   9020  H HG   . SER A 1 65 ? -1.846  1.717   9.016   1.00 1.00 ? 65  SER A HG   7  
ATOM   9021  N N    . THR A 1 66 ? 0.380   1.331   8.874   1.00 1.00 ? 66  THR A N    7  
ATOM   9022  C CA   . THR A 1 66 ? 0.754   0.109   8.177   1.00 1.00 ? 66  THR A CA   7  
ATOM   9023  C C    . THR A 1 66 ? -0.251  -0.217  7.077   1.00 1.00 ? 66  THR A C    7  
ATOM   9024  O O    . THR A 1 66 ? -1.132  0.579   6.761   1.00 1.00 ? 66  THR A O    7  
ATOM   9025  C CB   . THR A 1 66 ? 0.824   -1.059  9.166   1.00 1.00 ? 66  THR A CB   7  
ATOM   9026  O OG1  . THR A 1 66 ? 1.326   -2.210  8.501   1.00 1.00 ? 66  THR A OG1  7  
ATOM   9027  C CG2  . THR A 1 66 ? -0.563  -1.373  9.718   1.00 1.00 ? 66  THR A CG2  7  
ATOM   9028  H H    . THR A 1 66 ? 0.359   1.337   9.851   1.00 1.00 ? 66  THR A H    7  
ATOM   9029  H HA   . THR A 1 66 ? 1.722   0.248   7.731   1.00 1.00 ? 66  THR A HA   7  
ATOM   9030  H HB   . THR A 1 66 ? 1.478   -0.796  9.981   1.00 1.00 ? 66  THR A HB   7  
ATOM   9031  H HG1  . THR A 1 66 ? 1.825   -1.918  7.739   1.00 1.00 ? 66  THR A HG1  7  
ATOM   9032  H HG21 . THR A 1 66 ? -1.053  -2.063  9.056   1.00 1.00 ? 66  THR A HG21 7  
ATOM   9033  H HG22 . THR A 1 66 ? -1.148  -0.462  9.796   1.00 1.00 ? 66  THR A HG22 7  
ATOM   9034  H HG23 . THR A 1 66 ? -0.465  -1.824  10.695  1.00 1.00 ? 66  THR A HG23 7  
ATOM   9035  N N    . ILE A 1 67 ? -0.113  -1.396  6.488   1.00 1.00 ? 67  ILE A N    7  
ATOM   9036  C CA   . ILE A 1 67 ? -1.008  -1.802  5.416   1.00 1.00 ? 67  ILE A CA   7  
ATOM   9037  C C    . ILE A 1 67 ? -2.458  -1.780  5.899   1.00 1.00 ? 67  ILE A C    7  
ATOM   9038  O O    . ILE A 1 67 ? -3.350  -1.329  5.183   1.00 1.00 ? 67  ILE A O    7  
ATOM   9039  C CB   . ILE A 1 67 ? -0.645  -3.214  4.944   1.00 1.00 ? 67  ILE A CB   7  
ATOM   9040  C CG1  . ILE A 1 67 ? 0.723   -3.193  4.251   1.00 1.00 ? 67  ILE A CG1  7  
ATOM   9041  C CG2  . ILE A 1 67 ? -1.700  -3.725  3.967   1.00 1.00 ? 67  ILE A CG2  7  
ATOM   9042  C CD1  . ILE A 1 67 ? 1.272   -4.624  4.120   1.00 1.00 ? 67  ILE A CD1  7  
ATOM   9043  H H    . ILE A 1 67 ? 0.606   -1.999  6.772   1.00 1.00 ? 67  ILE A H    7  
ATOM   9044  H HA   . ILE A 1 67 ? -0.900  -1.120  4.590   1.00 1.00 ? 67  ILE A HA   7  
ATOM   9045  H HB   . ILE A 1 67 ? -0.606  -3.878  5.787   1.00 1.00 ? 67  ILE A HB   7  
ATOM   9046  H HG12 . ILE A 1 67 ? 0.625   -2.754  3.269   1.00 1.00 ? 67  ILE A HG12 7  
ATOM   9047  H HG13 . ILE A 1 67 ? 1.409   -2.606  4.833   1.00 1.00 ? 67  ILE A HG13 7  
ATOM   9048  H HG21 . ILE A 1 67 ? -1.911  -2.964  3.232   1.00 1.00 ? 67  ILE A HG21 7  
ATOM   9049  H HG22 . ILE A 1 67 ? -2.600  -3.961  4.513   1.00 1.00 ? 67  ILE A HG22 7  
ATOM   9050  H HG23 . ILE A 1 67 ? -1.334  -4.614  3.477   1.00 1.00 ? 67  ILE A HG23 7  
ATOM   9051  H HD11 . ILE A 1 67 ? 2.048   -4.774  4.855   1.00 1.00 ? 67  ILE A HD11 7  
ATOM   9052  H HD12 . ILE A 1 67 ? 1.684   -4.760  3.134   1.00 1.00 ? 67  ILE A HD12 7  
ATOM   9053  H HD13 . ILE A 1 67 ? 0.484   -5.345  4.282   1.00 1.00 ? 67  ILE A HD13 7  
ATOM   9054  N N    . GLN A 1 68 ? -2.686  -2.268  7.111   1.00 1.00 ? 68  GLN A N    7  
ATOM   9055  C CA   . GLN A 1 68 ? -4.035  -2.296  7.670   1.00 1.00 ? 68  GLN A CA   7  
ATOM   9056  C C    . GLN A 1 68 ? -4.769  -0.989  7.374   1.00 1.00 ? 68  GLN A C    7  
ATOM   9057  O O    . GLN A 1 68 ? -5.875  -1.002  6.831   1.00 1.00 ? 68  GLN A O    7  
ATOM   9058  C CB   . GLN A 1 68 ? -3.959  -2.510  9.185   1.00 1.00 ? 68  GLN A CB   7  
ATOM   9059  C CG   . GLN A 1 68 ? -3.460  -3.925  9.481   1.00 1.00 ? 68  GLN A CG   7  
ATOM   9060  C CD   . GLN A 1 68 ? -4.597  -4.931  9.300   1.00 1.00 ? 68  GLN A CD   7  
ATOM   9061  O OE1  . GLN A 1 68 ? -5.223  -5.337  10.280  1.00 1.00 ? 68  GLN A OE1  7  
ATOM   9062  N NE2  . GLN A 1 68 ? -4.922  -5.337  8.104   1.00 1.00 ? 68  GLN A NE2  7  
ATOM   9063  H H    . GLN A 1 68 ? -1.935  -2.616  7.639   1.00 1.00 ? 68  GLN A H    7  
ATOM   9064  H HA   . GLN A 1 68 ? -4.580  -3.112  7.228   1.00 1.00 ? 68  GLN A HA   7  
ATOM   9065  H HB2  . GLN A 1 68 ? -3.285  -1.788  9.617   1.00 1.00 ? 68  GLN A HB2  7  
ATOM   9066  H HB3  . GLN A 1 68 ? -4.939  -2.380  9.613   1.00 1.00 ? 68  GLN A HB3  7  
ATOM   9067  H HG2  . GLN A 1 68 ? -2.652  -4.168  8.805   1.00 1.00 ? 68  GLN A HG2  7  
ATOM   9068  H HG3  . GLN A 1 68 ? -3.101  -3.971  10.498  1.00 1.00 ? 68  GLN A HG3  7  
ATOM   9069  H HE21 . GLN A 1 68 ? -4.438  -4.998  7.324   1.00 1.00 ? 68  GLN A HE21 7  
ATOM   9070  H HE22 . GLN A 1 68 ? -5.650  -5.984  7.989   1.00 1.00 ? 68  GLN A HE22 7  
ATOM   9071  N N    . GLN A 1 69 ? -4.157  0.135   7.726   1.00 1.00 ? 69  GLN A N    7  
ATOM   9072  C CA   . GLN A 1 69 ? -4.770  1.427   7.485   1.00 1.00 ? 69  GLN A CA   7  
ATOM   9073  C C    . GLN A 1 69 ? -4.858  1.711   5.992   1.00 1.00 ? 69  GLN A C    7  
ATOM   9074  O O    . GLN A 1 69 ? -5.859  2.238   5.510   1.00 1.00 ? 69  GLN A O    7  
ATOM   9075  C CB   . GLN A 1 69 ? -3.933  2.507   8.158   1.00 1.00 ? 69  GLN A CB   7  
ATOM   9076  C CG   . GLN A 1 69 ? -4.604  3.862   8.019   1.00 1.00 ? 69  GLN A CG   7  
ATOM   9077  C CD   . GLN A 1 69 ? -5.926  3.872   8.777   1.00 1.00 ? 69  GLN A CD   7  
ATOM   9078  O OE1  . GLN A 1 69 ? -6.035  3.266   9.844   1.00 1.00 ? 69  GLN A OE1  7  
ATOM   9079  N NE2  . GLN A 1 69 ? -6.938  4.528   8.289   1.00 1.00 ? 69  GLN A NE2  7  
ATOM   9080  H H    . GLN A 1 69 ? -3.277  0.101   8.152   1.00 1.00 ? 69  GLN A H    7  
ATOM   9081  H HA   . GLN A 1 69 ? -5.761  1.434   7.909   1.00 1.00 ? 69  GLN A HA   7  
ATOM   9082  H HB2  . GLN A 1 69 ? -3.826  2.274   9.205   1.00 1.00 ? 69  GLN A HB2  7  
ATOM   9083  H HB3  . GLN A 1 69 ? -2.964  2.546   7.691   1.00 1.00 ? 69  GLN A HB3  7  
ATOM   9084  H HG2  . GLN A 1 69 ? -3.950  4.613   8.426   1.00 1.00 ? 69  GLN A HG2  7  
ATOM   9085  H HG3  . GLN A 1 69 ? -4.783  4.067   6.979   1.00 1.00 ? 69  GLN A HG3  7  
ATOM   9086  H HE21 . GLN A 1 69 ? -6.844  5.010   7.443   1.00 1.00 ? 69  GLN A HE21 7  
ATOM   9087  H HE22 . GLN A 1 69 ? -7.792  4.536   8.767   1.00 1.00 ? 69  GLN A HE22 7  
ATOM   9088  N N    . ALA A 1 70 ? -3.797  1.374   5.267   1.00 1.00 ? 70  ALA A N    7  
ATOM   9089  C CA   . ALA A 1 70 ? -3.770  1.618   3.830   1.00 1.00 ? 70  ALA A CA   7  
ATOM   9090  C C    . ALA A 1 70 ? -4.917  0.893   3.142   1.00 1.00 ? 70  ALA A C    7  
ATOM   9091  O O    . ALA A 1 70 ? -5.622  1.467   2.314   1.00 1.00 ? 70  ALA A O    7  
ATOM   9092  C CB   . ALA A 1 70 ? -2.444  1.143   3.242   1.00 1.00 ? 70  ALA A CB   7  
ATOM   9093  H H    . ALA A 1 70 ? -3.021  0.965   5.707   1.00 1.00 ? 70  ALA A H    7  
ATOM   9094  H HA   . ALA A 1 70 ? -3.870  2.678   3.652   1.00 1.00 ? 70  ALA A HA   7  
ATOM   9095  H HB1  . ALA A 1 70 ? -2.395  0.066   3.288   1.00 1.00 ? 70  ALA A HB1  7  
ATOM   9096  H HB2  . ALA A 1 70 ? -1.630  1.568   3.806   1.00 1.00 ? 70  ALA A HB2  7  
ATOM   9097  H HB3  . ALA A 1 70 ? -2.373  1.461   2.215   1.00 1.00 ? 70  ALA A HB3  7  
ATOM   9098  N N    . ALA A 1 71 ? -5.100  -0.373  3.495   1.00 1.00 ? 71  ALA A N    7  
ATOM   9099  C CA   . ALA A 1 71 ? -6.166  -1.165  2.906   1.00 1.00 ? 71  ALA A CA   7  
ATOM   9100  C C    . ALA A 1 71 ? -7.521  -0.514  3.158   1.00 1.00 ? 71  ALA A C    7  
ATOM   9101  O O    . ALA A 1 71 ? -8.342  -0.401  2.250   1.00 1.00 ? 71  ALA A O    7  
ATOM   9102  C CB   . ALA A 1 71 ? -6.160  -2.570  3.512   1.00 1.00 ? 71  ALA A CB   7  
ATOM   9103  H H    . ALA A 1 71 ? -4.507  -0.779  4.161   1.00 1.00 ? 71  ALA A H    7  
ATOM   9104  H HA   . ALA A 1 71 ? -6.003  -1.245  1.842   1.00 1.00 ? 71  ALA A HA   7  
ATOM   9105  H HB1  . ALA A 1 71 ? -6.318  -2.497  4.578   1.00 1.00 ? 71  ALA A HB1  7  
ATOM   9106  H HB2  . ALA A 1 71 ? -5.208  -3.039  3.320   1.00 1.00 ? 71  ALA A HB2  7  
ATOM   9107  H HB3  . ALA A 1 71 ? -6.950  -3.158  3.070   1.00 1.00 ? 71  ALA A HB3  7  
ATOM   9108  N N    . ASP A 1 72 ? -7.746  -0.080  4.395   1.00 1.00 ? 72  ASP A N    7  
ATOM   9109  C CA   . ASP A 1 72 ? -9.009  0.556   4.748   1.00 1.00 ? 72  ASP A CA   7  
ATOM   9110  C C    . ASP A 1 72 ? -9.192  1.848   3.952   1.00 1.00 ? 72  ASP A C    7  
ATOM   9111  O O    . ASP A 1 72 ? -10.286 2.143   3.474   1.00 1.00 ? 72  ASP A O    7  
ATOM   9112  C CB   . ASP A 1 72 ? -9.037  0.864   6.255   1.00 1.00 ? 72  ASP A CB   7  
ATOM   9113  C CG   . ASP A 1 72 ? -9.500  -0.356  7.044   1.00 1.00 ? 72  ASP A CG   7  
ATOM   9114  O OD1  . ASP A 1 72 ? -10.600 -0.819  6.784   1.00 1.00 ? 72  ASP A OD1  7  
ATOM   9115  O OD2  . ASP A 1 72 ? -8.750  -0.814  7.888   1.00 1.00 ? 72  ASP A OD2  7  
ATOM   9116  H H    . ASP A 1 72 ? -7.055  -0.195  5.080   1.00 1.00 ? 72  ASP A H    7  
ATOM   9117  H HA   . ASP A 1 72 ? -9.818  -0.121  4.507   1.00 1.00 ? 72  ASP A HA   7  
ATOM   9118  H HB2  . ASP A 1 72 ? -8.040  1.137   6.580   1.00 1.00 ? 72  ASP A HB2  7  
ATOM   9119  H HB3  . ASP A 1 72 ? -9.709  1.686   6.449   1.00 1.00 ? 72  ASP A HB3  7  
ATOM   9120  N N    . VAL A 1 73 ? -8.114  2.612   3.814   1.00 1.00 ? 73  VAL A N    7  
ATOM   9121  C CA   . VAL A 1 73 ? -8.180  3.866   3.070   1.00 1.00 ? 73  VAL A CA   7  
ATOM   9122  C C    . VAL A 1 73 ? -8.558  3.601   1.616   1.00 1.00 ? 73  VAL A C    7  
ATOM   9123  O O    . VAL A 1 73 ? -9.385  4.307   1.040   1.00 1.00 ? 73  VAL A O    7  
ATOM   9124  C CB   . VAL A 1 73 ? -6.825  4.587   3.143   1.00 1.00 ? 73  VAL A CB   7  
ATOM   9125  C CG1  . VAL A 1 73 ? -6.729  5.662   2.052   1.00 1.00 ? 73  VAL A CG1  7  
ATOM   9126  C CG2  . VAL A 1 73 ? -6.675  5.253   4.515   1.00 1.00 ? 73  VAL A CG2  7  
ATOM   9127  H H    . VAL A 1 73 ? -7.260  2.330   4.218   1.00 1.00 ? 73  VAL A H    7  
ATOM   9128  H HA   . VAL A 1 73 ? -8.936  4.496   3.517   1.00 1.00 ? 73  VAL A HA   7  
ATOM   9129  H HB   . VAL A 1 73 ? -6.033  3.867   3.007   1.00 1.00 ? 73  VAL A HB   7  
ATOM   9130  H HG11 . VAL A 1 73 ? -7.645  6.234   2.028   1.00 1.00 ? 73  VAL A HG11 7  
ATOM   9131  H HG12 . VAL A 1 73 ? -6.574  5.188   1.093   1.00 1.00 ? 73  VAL A HG12 7  
ATOM   9132  H HG13 . VAL A 1 73 ? -5.898  6.312   2.262   1.00 1.00 ? 73  VAL A HG13 7  
ATOM   9133  H HG21 . VAL A 1 73 ? -5.640  5.496   4.679   1.00 1.00 ? 73  VAL A HG21 7  
ATOM   9134  H HG22 . VAL A 1 73 ? -7.009  4.577   5.287   1.00 1.00 ? 73  VAL A HG22 7  
ATOM   9135  H HG23 . VAL A 1 73 ? -7.265  6.160   4.545   1.00 1.00 ? 73  VAL A HG23 7  
ATOM   9136  N N    . ILE A 1 74 ? -7.936  2.592   1.026   1.00 1.00 ? 74  ILE A N    7  
ATOM   9137  C CA   . ILE A 1 74 ? -8.206  2.257   -0.365  1.00 1.00 ? 74  ILE A CA   7  
ATOM   9138  C C    . ILE A 1 74 ? -9.664  1.867   -0.548  1.00 1.00 ? 74  ILE A C    7  
ATOM   9139  O O    . ILE A 1 74 ? -10.307 2.274   -1.514  1.00 1.00 ? 74  ILE A O    7  
ATOM   9140  C CB   . ILE A 1 74 ? -7.290  1.115   -0.813  1.00 1.00 ? 74  ILE A CB   7  
ATOM   9141  C CG1  . ILE A 1 74 ? -5.847  1.626   -0.904  1.00 1.00 ? 74  ILE A CG1  7  
ATOM   9142  C CG2  . ILE A 1 74 ? -7.739  0.580   -2.182  1.00 1.00 ? 74  ILE A CG2  7  
ATOM   9143  C CD1  . ILE A 1 74 ? -4.878  0.440   -0.917  1.00 1.00 ? 74  ILE A CD1  7  
ATOM   9144  H H    . ILE A 1 74 ? -7.279  2.069   1.532   1.00 1.00 ? 74  ILE A H    7  
ATOM   9145  H HA   . ILE A 1 74 ? -7.995  3.122   -0.970  1.00 1.00 ? 74  ILE A HA   7  
ATOM   9146  H HB   . ILE A 1 74 ? -7.335  0.318   -0.091  1.00 1.00 ? 74  ILE A HB   7  
ATOM   9147  H HG12 . ILE A 1 74 ? -5.725  2.198   -1.815  1.00 1.00 ? 74  ILE A HG12 7  
ATOM   9148  H HG13 . ILE A 1 74 ? -5.631  2.250   -0.052  1.00 1.00 ? 74  ILE A HG13 7  
ATOM   9149  H HG21 . ILE A 1 74 ? -8.072  1.396   -2.800  1.00 1.00 ? 74  ILE A HG21 7  
ATOM   9150  H HG22 . ILE A 1 74 ? -8.549  -0.114  -2.039  1.00 1.00 ? 74  ILE A HG22 7  
ATOM   9151  H HG23 . ILE A 1 74 ? -6.918  0.075   -2.664  1.00 1.00 ? 74  ILE A HG23 7  
ATOM   9152  H HD11 . ILE A 1 74 ? -4.020  0.682   -1.525  1.00 1.00 ? 74  ILE A HD11 7  
ATOM   9153  H HD12 . ILE A 1 74 ? -5.369  -0.435  -1.320  1.00 1.00 ? 74  ILE A HD12 7  
ATOM   9154  H HD13 . ILE A 1 74 ? -4.557  0.232   0.092   1.00 1.00 ? 74  ILE A HD13 7  
ATOM   9155  N N    . GLU A 1 75 ? -10.178 1.072   0.378   1.00 1.00 ? 75  GLU A N    7  
ATOM   9156  C CA   . GLU A 1 75 ? -11.565 0.637   0.299   1.00 1.00 ? 75  GLU A CA   7  
ATOM   9157  C C    . GLU A 1 75 ? -12.491 1.832   0.111   1.00 1.00 ? 75  GLU A C    7  
ATOM   9158  O O    . GLU A 1 75 ? -13.445 1.773   -0.665  1.00 1.00 ? 75  GLU A O    7  
ATOM   9159  C CB   . GLU A 1 75 ? -11.944 -0.124  1.573   1.00 1.00 ? 75  GLU A CB   7  
ATOM   9160  C CG   . GLU A 1 75 ? -11.330 -1.522  1.539   1.00 1.00 ? 75  GLU A CG   7  
ATOM   9161  C CD   . GLU A 1 75 ? -11.663 -2.260  2.826   1.00 1.00 ? 75  GLU A CD   7  
ATOM   9162  O OE1  . GLU A 1 75 ? -12.287 -1.662  3.687   1.00 1.00 ? 75  GLU A OE1  7  
ATOM   9163  O OE2  . GLU A 1 75 ? -11.288 -3.412  2.934   1.00 1.00 ? 75  GLU A OE2  7  
ATOM   9164  H H    . GLU A 1 75 ? -9.620  0.777   1.127   1.00 1.00 ? 75  GLU A H    7  
ATOM   9165  H HA   . GLU A 1 75 ? -11.674 -0.025  -0.548  1.00 1.00 ? 75  GLU A HA   7  
ATOM   9166  H HB2  . GLU A 1 75 ? -11.566 0.409   2.435   1.00 1.00 ? 75  GLU A HB2  7  
ATOM   9167  H HB3  . GLU A 1 75 ? -13.018 -0.206  1.642   1.00 1.00 ? 75  GLU A HB3  7  
ATOM   9168  H HG2  . GLU A 1 75 ? -11.730 -2.070  0.698   1.00 1.00 ? 75  GLU A HG2  7  
ATOM   9169  H HG3  . GLU A 1 75 ? -10.261 -1.444  1.439   1.00 1.00 ? 75  GLU A HG3  7  
ATOM   9170  N N    . GLY A 1 76 ? -12.205 2.917   0.819   1.00 1.00 ? 76  GLY A N    7  
ATOM   9171  C CA   . GLY A 1 76 ? -13.018 4.123   0.712   1.00 1.00 ? 76  GLY A CA   7  
ATOM   9172  C C    . GLY A 1 76 ? -12.762 4.833   -0.604  1.00 1.00 ? 76  GLY A C    7  
ATOM   9173  O O    . GLY A 1 76 ? -13.610 5.580   -1.093  1.00 1.00 ? 76  GLY A O    7  
ATOM   9174  H H    . GLY A 1 76 ? -11.428 2.910   1.417   1.00 1.00 ? 76  GLY A H    7  
ATOM   9175  H HA2  . GLY A 1 76 ? -14.062 3.857   0.768   1.00 1.00 ? 76  GLY A HA2  7  
ATOM   9176  H HA3  . GLY A 1 76 ? -12.777 4.790   1.523   1.00 1.00 ? 76  GLY A HA3  7  
ATOM   9177  N N    . LEU A 1 77 ? -11.584 4.606   -1.176  1.00 1.00 ? 77  LEU A N    7  
ATOM   9178  C CA   . LEU A 1 77 ? -11.226 5.243   -2.439  1.00 1.00 ? 77  LEU A CA   7  
ATOM   9179  C C    . LEU A 1 77 ? -11.719 4.416   -3.615  1.00 1.00 ? 77  LEU A C    7  
ATOM   9180  O O    . LEU A 1 77 ? -11.628 4.836   -4.765  1.00 1.00 ? 77  LEU A O    7  
ATOM   9181  C CB   . LEU A 1 77 ? -9.710  5.411   -2.526  1.00 1.00 ? 77  LEU A CB   7  
ATOM   9182  C CG   . LEU A 1 77 ? -9.244  6.409   -1.457  1.00 1.00 ? 77  LEU A CG   7  
ATOM   9183  C CD1  . LEU A 1 77 ? -7.717  6.375   -1.363  1.00 1.00 ? 77  LEU A CD1  7  
ATOM   9184  C CD2  . LEU A 1 77 ? -9.697  7.838   -1.823  1.00 1.00 ? 77  LEU A CD2  7  
ATOM   9185  H H    . LEU A 1 77 ? -10.945 4.005   -0.739  1.00 1.00 ? 77  LEU A H    7  
ATOM   9186  H HA   . LEU A 1 77 ? -11.681 6.212   -2.478  1.00 1.00 ? 77  LEU A HA   7  
ATOM   9187  H HB2  . LEU A 1 77 ? -9.239  4.457   -2.364  1.00 1.00 ? 77  LEU A HB2  7  
ATOM   9188  H HB3  . LEU A 1 77 ? -9.439  5.777   -3.504  1.00 1.00 ? 77  LEU A HB3  7  
ATOM   9189  H HG   . LEU A 1 77 ? -9.667  6.129   -0.503  1.00 1.00 ? 77  LEU A HG   7  
ATOM   9190  H HD11 . LEU A 1 77 ? -7.298  6.835   -2.242  1.00 1.00 ? 77  LEU A HD11 7  
ATOM   9191  H HD12 . LEU A 1 77 ? -7.378  5.354   -1.292  1.00 1.00 ? 77  LEU A HD12 7  
ATOM   9192  H HD13 . LEU A 1 77 ? -7.401  6.919   -0.486  1.00 1.00 ? 77  LEU A HD13 7  
ATOM   9193  H HD21 . LEU A 1 77 ? -10.710 7.996   -1.482  1.00 1.00 ? 77  LEU A HD21 7  
ATOM   9194  H HD22 . LEU A 1 77 ? -9.650  7.974   -2.894  1.00 1.00 ? 77  LEU A HD22 7  
ATOM   9195  H HD23 . LEU A 1 77 ? -9.046  8.558   -1.346  1.00 1.00 ? 77  LEU A HD23 7  
ATOM   9196  N N    . LEU A 1 78 ? -12.243 3.237   -3.324  1.00 1.00 ? 78  LEU A N    7  
ATOM   9197  C CA   . LEU A 1 78 ? -12.759 2.353   -4.368  1.00 1.00 ? 78  LEU A CA   7  
ATOM   9198  C C    . LEU A 1 78 ? -14.261 2.548   -4.544  1.00 1.00 ? 78  LEU A C    7  
ATOM   9199  O O    . LEU A 1 78 ? -14.862 2.008   -5.475  1.00 1.00 ? 78  LEU A O    7  
ATOM   9200  C CB   . LEU A 1 78 ? -12.465 0.895   -3.998  1.00 1.00 ? 78  LEU A CB   7  
ATOM   9201  C CG   . LEU A 1 78 ? -11.022 0.519   -4.375  1.00 1.00 ? 78  LEU A CG   7  
ATOM   9202  C CD1  . LEU A 1 78 ? -10.629 -0.779  -3.663  1.00 1.00 ? 78  LEU A CD1  7  
ATOM   9203  C CD2  . LEU A 1 78 ? -10.896 0.317   -5.897  1.00 1.00 ? 78  LEU A CD2  7  
ATOM   9204  H H    . LEU A 1 78 ? -12.298 2.956   -2.388  1.00 1.00 ? 78  LEU A H    7  
ATOM   9205  H HA   . LEU A 1 78 ? -12.273 2.585   -5.298  1.00 1.00 ? 78  LEU A HA   7  
ATOM   9206  H HB2  . LEU A 1 78 ? -12.590 0.780   -2.932  1.00 1.00 ? 78  LEU A HB2  7  
ATOM   9207  H HB3  . LEU A 1 78 ? -13.160 0.249   -4.505  1.00 1.00 ? 78  LEU A HB3  7  
ATOM   9208  H HG   . LEU A 1 78 ? -10.356 1.307   -4.061  1.00 1.00 ? 78  LEU A HG   7  
ATOM   9209  H HD11 . LEU A 1 78 ? -11.270 -1.582  -3.997  1.00 1.00 ? 78  LEU A HD11 7  
ATOM   9210  H HD12 . LEU A 1 78 ? -10.740 -0.654  -2.597  1.00 1.00 ? 78  LEU A HD12 7  
ATOM   9211  H HD13 . LEU A 1 78 ? -9.603  -1.018  -3.898  1.00 1.00 ? 78  LEU A HD13 7  
ATOM   9212  H HD21 . LEU A 1 78 ? -10.777 1.270   -6.382  1.00 1.00 ? 78  LEU A HD21 7  
ATOM   9213  H HD22 . LEU A 1 78 ? -11.777 -0.172  -6.276  1.00 1.00 ? 78  LEU A HD22 7  
ATOM   9214  H HD23 . LEU A 1 78 ? -10.030 -0.296  -6.109  1.00 1.00 ? 78  LEU A HD23 7  
ATOM   9215  N N    . GLU A 1 79 ? -14.858 3.294   -3.636  1.00 1.00 ? 79  GLU A N    7  
ATOM   9216  C CA   . GLU A 1 79 ? -16.297 3.523   -3.680  1.00 1.00 ? 79  GLU A CA   7  
ATOM   9217  C C    . GLU A 1 79 ? -16.699 4.246   -4.945  1.00 1.00 ? 79  GLU A C    7  
ATOM   9218  O O    . GLU A 1 79 ? -17.536 3.771   -5.707  1.00 1.00 ? 79  GLU A O    7  
ATOM   9219  C CB   . GLU A 1 79 ? -16.724 4.354   -2.479  1.00 1.00 ? 79  GLU A CB   7  
ATOM   9220  C CG   . GLU A 1 79 ? -16.257 3.672   -1.200  1.00 1.00 ? 79  GLU A CG   7  
ATOM   9221  C CD   . GLU A 1 79 ? -16.693 4.484   0.019   1.00 1.00 ? 79  GLU A CD   7  
ATOM   9222  O OE1  . GLU A 1 79 ? -17.320 5.513   -0.172  1.00 1.00 ? 79  GLU A OE1  7  
ATOM   9223  O OE2  . GLU A 1 79 ? -16.392 4.066   1.126   1.00 1.00 ? 79  GLU A OE2  7  
ATOM   9224  H H    . GLU A 1 79 ? -14.330 3.680   -2.911  1.00 1.00 ? 79  GLU A H    7  
ATOM   9225  H HA   . GLU A 1 79 ? -16.800 2.582   -3.651  1.00 1.00 ? 79  GLU A HA   7  
ATOM   9226  H HB2  . GLU A 1 79 ? -16.283 5.335   -2.547  1.00 1.00 ? 79  GLU A HB2  7  
ATOM   9227  H HB3  . GLU A 1 79 ? -17.799 4.434   -2.464  1.00 1.00 ? 79  GLU A HB3  7  
ATOM   9228  H HG2  . GLU A 1 79 ? -16.676 2.681   -1.147  1.00 1.00 ? 79  GLU A HG2  7  
ATOM   9229  H HG3  . GLU A 1 79 ? -15.178 3.606   -1.219  1.00 1.00 ? 79  GLU A HG3  7  
ATOM   9230  N N    . LYS A 1 80 ? -16.095 5.391   -5.163  1.00 1.00 ? 80  LYS A N    7  
ATOM   9231  C CA   . LYS A 1 80 ? -16.409 6.175   -6.355  1.00 1.00 ? 80  LYS A CA   7  
ATOM   9232  C C    . LYS A 1 80 ? -16.112 5.377   -7.623  1.00 1.00 ? 80  LYS A C    7  
ATOM   9233  O O    . LYS A 1 80 ? -16.830 5.470   -8.615  1.00 1.00 ? 80  LYS A O    7  
ATOM   9234  C CB   . LYS A 1 80 ? -15.602 7.485   -6.346  1.00 1.00 ? 80  LYS A CB   7  
ATOM   9235  C CG   . LYS A 1 80 ? -14.184 7.296   -6.922  1.00 1.00 ? 80  LYS A CG   7  
ATOM   9236  C CD   . LYS A 1 80 ? -13.343 6.424   -5.989  1.00 1.00 ? 80  LYS A CD   7  
ATOM   9237  C CE   . LYS A 1 80 ? -12.956 7.215   -4.729  1.00 1.00 ? 80  LYS A CE   7  
ATOM   9238  N NZ   . LYS A 1 80 ? -11.478 7.221   -4.609  1.00 1.00 ? 80  LYS A NZ   7  
ATOM   9239  H H    . LYS A 1 80 ? -15.422 5.720   -4.503  1.00 1.00 ? 80  LYS A H    7  
ATOM   9240  H HA   . LYS A 1 80 ? -17.459 6.423   -6.340  1.00 1.00 ? 80  LYS A HA   7  
ATOM   9241  H HB2  . LYS A 1 80 ? -16.119 8.227   -6.930  1.00 1.00 ? 80  LYS A HB2  7  
ATOM   9242  H HB3  . LYS A 1 80 ? -15.524 7.836   -5.327  1.00 1.00 ? 80  LYS A HB3  7  
ATOM   9243  H HG2  . LYS A 1 80 ? -14.213 6.865   -7.899  1.00 1.00 ? 80  LYS A HG2  7  
ATOM   9244  H HG3  . LYS A 1 80 ? -13.727 8.238   -7.003  1.00 1.00 ? 80  LYS A HG3  7  
ATOM   9245  H HD2  . LYS A 1 80 ? -13.894 5.552   -5.701  1.00 1.00 ? 80  LYS A HD2  7  
ATOM   9246  H HD3  . LYS A 1 80 ? -12.450 6.117   -6.507  1.00 1.00 ? 80  LYS A HD3  7  
ATOM   9247  H HE2  . LYS A 1 80 ? -13.310 8.230   -4.789  1.00 1.00 ? 80  LYS A HE2  7  
ATOM   9248  H HE3  . LYS A 1 80 ? -13.396 6.740   -3.862  1.00 1.00 ? 80  LYS A HE3  7  
ATOM   9249  H HZ1  . LYS A 1 80 ? -11.069 7.727   -5.420  1.00 1.00 ? 80  LYS A HZ1  7  
ATOM   9250  H HZ2  . LYS A 1 80 ? -11.133 6.240   -4.601  1.00 1.00 ? 80  LYS A HZ2  7  
ATOM   9251  H HZ3  . LYS A 1 80 ? -11.207 7.698   -3.731  1.00 1.00 ? 80  LYS A HZ3  7  
ATOM   9252  N N    . LYS A 1 81 ? -15.003 4.636   -7.589  1.00 1.00 ? 81  LYS A N    7  
ATOM   9253  C CA   . LYS A 1 81 ? -14.565 3.852   -8.740  1.00 1.00 ? 81  LYS A CA   7  
ATOM   9254  C C    . LYS A 1 81 ? -14.022 2.502   -8.296  1.00 1.00 ? 81  LYS A C    7  
ATOM   9255  O O    . LYS A 1 81 ? -13.119 2.427   -7.461  1.00 1.00 ? 81  LYS A O    7  
ATOM   9256  C CB   . LYS A 1 81 ? -13.481 4.613   -9.519  1.00 1.00 ? 81  LYS A CB   7  
ATOM   9257  C CG   . LYS A 1 81 ? -13.115 3.828   -10.778 1.00 1.00 ? 81  LYS A CG   7  
ATOM   9258  C CD   . LYS A 1 81 ? -12.115 4.629   -11.613 1.00 1.00 ? 81  LYS A CD   7  
ATOM   9259  C CE   . LYS A 1 81 ? -11.766 3.848   -12.881 1.00 1.00 ? 81  LYS A CE   7  
ATOM   9260  N NZ   . LYS A 1 81 ? -10.817 4.643   -13.709 1.00 1.00 ? 81  LYS A NZ   7  
ATOM   9261  H H    . LYS A 1 81 ? -14.457 4.638   -6.781  1.00 1.00 ? 81  LYS A H    7  
ATOM   9262  H HA   . LYS A 1 81 ? -15.401 3.695   -9.388  1.00 1.00 ? 81  LYS A HA   7  
ATOM   9263  H HB2  . LYS A 1 81 ? -13.855 5.585   -9.802  1.00 1.00 ? 81  LYS A HB2  7  
ATOM   9264  H HB3  . LYS A 1 81 ? -12.603 4.729   -8.899  1.00 1.00 ? 81  LYS A HB3  7  
ATOM   9265  H HG2  . LYS A 1 81 ? -12.671 2.883   -10.496 1.00 1.00 ? 81  LYS A HG2  7  
ATOM   9266  H HG3  . LYS A 1 81 ? -14.005 3.647   -11.361 1.00 1.00 ? 81  LYS A HG3  7  
ATOM   9267  H HD2  . LYS A 1 81 ? -12.553 5.579   -11.883 1.00 1.00 ? 81  LYS A HD2  7  
ATOM   9268  H HD3  . LYS A 1 81 ? -11.216 4.799   -11.037 1.00 1.00 ? 81  LYS A HD3  7  
ATOM   9269  H HE2  . LYS A 1 81 ? -11.307 2.908   -12.609 1.00 1.00 ? 81  LYS A HE2  7  
ATOM   9270  H HE3  . LYS A 1 81 ? -12.666 3.660   -13.446 1.00 1.00 ? 81  LYS A HE3  7  
ATOM   9271  H HZ1  . LYS A 1 81 ? -11.179 4.713   -14.681 1.00 1.00 ? 81  LYS A HZ1  7  
ATOM   9272  H HZ2  . LYS A 1 81 ? -9.886  4.174   -13.716 1.00 1.00 ? 81  LYS A HZ2  7  
ATOM   9273  H HZ3  . LYS A 1 81 ? -10.721 5.598   -13.308 1.00 1.00 ? 81  LYS A HZ3  7  
ATOM   9274  N N    . ALA A 1 82 ? -14.572 1.438   -8.862  1.00 1.00 ? 82  ALA A N    7  
ATOM   9275  C CA   . ALA A 1 82 ? -14.136 0.094   -8.519  1.00 1.00 ? 82  ALA A CA   7  
ATOM   9276  C C    . ALA A 1 82 ? -12.696 -0.136  -8.971  1.00 1.00 ? 82  ALA A C    7  
ATOM   9277  O O    . ALA A 1 82 ? -12.236 0.611   -9.817  1.00 1.00 ? 82  ALA A O    7  
ATOM   9278  C CB   . ALA A 1 82 ? -15.053 -0.934  -9.183  1.00 1.00 ? 82  ALA A CB   7  
ATOM   9279  O OXT  . ALA A 1 82 ? -12.078 -1.056  -8.463  1.00 1.00 ? 82  ALA A OXT  7  
ATOM   9280  H H    . ALA A 1 82 ? -15.286 1.561   -9.523  1.00 1.00 ? 82  ALA A H    7  
ATOM   9281  H HA   . ALA A 1 82 ? -14.191 -0.031  -7.448  1.00 1.00 ? 82  ALA A HA   7  
ATOM   9282  H HB1  . ALA A 1 82 ? -14.992 -0.831  -10.256 1.00 1.00 ? 82  ALA A HB1  7  
ATOM   9283  H HB2  . ALA A 1 82 ? -16.071 -0.768  -8.862  1.00 1.00 ? 82  ALA A HB2  7  
ATOM   9284  H HB3  . ALA A 1 82 ? -14.744 -1.930  -8.897  1.00 1.00 ? 82  ALA A HB3  7  
HETATM 9285  O O23  . PNS B 2 .  ? 14.029  7.889   -2.029  1.00 1.00 ? 101 PNS A O23  7  
HETATM 9286  P P24  . PNS B 2 .  ? 14.439  7.592   -3.556  1.00 1.00 ? 101 PNS A P24  7  
HETATM 9287  O O25  . PNS B 2 .  ? 13.304  7.976   -4.425  1.00 1.00 ? 101 PNS A O25  7  
HETATM 9288  O O26  . PNS B 2 .  ? 15.780  8.168   -3.795  1.00 1.00 ? 101 PNS A O26  7  
HETATM 9289  O O27  . PNS B 2 .  ? 14.570  5.986   -3.579  1.00 1.00 ? 101 PNS A O27  7  
HETATM 9290  C C28  . PNS B 2 .  ? 15.088  5.320   -4.724  1.00 1.00 ? 101 PNS A C28  7  
HETATM 9291  C C29  . PNS B 2 .  ? 15.675  3.969   -4.296  1.00 1.00 ? 101 PNS A C29  7  
HETATM 9292  C C30  . PNS B 2 .  ? 16.725  4.181   -3.206  1.00 1.00 ? 101 PNS A C30  7  
HETATM 9293  C C31  . PNS B 2 .  ? 16.315  3.296   -5.517  1.00 1.00 ? 101 PNS A C31  7  
HETATM 9294  C C32  . PNS B 2 .  ? 14.569  3.079   -3.732  1.00 1.00 ? 101 PNS A C32  7  
HETATM 9295  O O33  . PNS B 2 .  ? 13.677  2.756   -4.785  1.00 1.00 ? 101 PNS A O33  7  
HETATM 9296  C C34  . PNS B 2 .  ? 15.159  1.795   -3.154  1.00 1.00 ? 101 PNS A C34  7  
HETATM 9297  O O35  . PNS B 2 .  ? 15.428  0.839   -3.881  1.00 1.00 ? 101 PNS A O35  7  
HETATM 9298  N N36  . PNS B 2 .  ? 15.361  1.785   -1.842  1.00 1.00 ? 101 PNS A N36  7  
HETATM 9299  C C37  . PNS B 2 .  ? 15.924  0.618   -1.175  1.00 1.00 ? 101 PNS A C37  7  
HETATM 9300  C C38  . PNS B 2 .  ? 14.930  -0.542  -1.215  1.00 1.00 ? 101 PNS A C38  7  
HETATM 9301  C C39  . PNS B 2 .  ? 15.391  -1.654  -0.278  1.00 1.00 ? 101 PNS A C39  7  
HETATM 9302  O O40  . PNS B 2 .  ? 16.554  -2.056  -0.303  1.00 1.00 ? 101 PNS A O40  7  
HETATM 9303  N N41  . PNS B 2 .  ? 14.474  -2.145  0.547   1.00 1.00 ? 101 PNS A N41  7  
HETATM 9304  C C42  . PNS B 2 .  ? 14.799  -3.209  1.491   1.00 1.00 ? 101 PNS A C42  7  
HETATM 9305  C C43  . PNS B 2 .  ? 15.469  -2.627  2.737   1.00 1.00 ? 101 PNS A C43  7  
HETATM 9306  S S44  . PNS B 2 .  ? 14.506  -1.247  3.343   1.00 1.00 ? 101 PNS A S44  7  
HETATM 9307  H H282 . PNS B 2 .  ? 15.858  5.926   -5.167  1.00 1.00 ? 101 PNS A H282 7  
HETATM 9308  H H281 . PNS B 2 .  ? 14.300  5.157   -5.447  1.00 1.00 ? 101 PNS A H281 7  
HETATM 9309  H H303 . PNS B 2 .  ? 17.374  4.996   -3.489  1.00 1.00 ? 101 PNS A H303 7  
HETATM 9310  H H302 . PNS B 2 .  ? 16.239  4.417   -2.271  1.00 1.00 ? 101 PNS A H302 7  
HETATM 9311  H H301 . PNS B 2 .  ? 17.308  3.279   -3.091  1.00 1.00 ? 101 PNS A H301 7  
HETATM 9312  H H313 . PNS B 2 .  ? 15.579  3.201   -6.303  1.00 1.00 ? 101 PNS A H313 7  
HETATM 9313  H H312 . PNS B 2 .  ? 17.140  3.896   -5.867  1.00 1.00 ? 101 PNS A H312 7  
HETATM 9314  H H311 . PNS B 2 .  ? 16.673  2.315   -5.241  1.00 1.00 ? 101 PNS A H311 7  
HETATM 9315  H H32  . PNS B 2 .  ? 14.035  3.607   -2.951  1.00 1.00 ? 101 PNS A H32  7  
HETATM 9316  H H33  . PNS B 2 .  ? 13.586  1.801   -4.814  1.00 1.00 ? 101 PNS A H33  7  
HETATM 9317  H H36  . PNS B 2 .  ? 15.131  2.577   -1.312  1.00 1.00 ? 101 PNS A H36  7  
HETATM 9318  H H372 . PNS B 2 .  ? 16.143  0.866   -0.148  1.00 1.00 ? 101 PNS A H372 7  
HETATM 9319  H H371 . PNS B 2 .  ? 16.836  0.324   -1.673  1.00 1.00 ? 101 PNS A H371 7  
HETATM 9320  H H382 . PNS B 2 .  ? 13.956  -0.194  -0.904  1.00 1.00 ? 101 PNS A H382 7  
HETATM 9321  H H381 . PNS B 2 .  ? 14.868  -0.927  -2.222  1.00 1.00 ? 101 PNS A H381 7  
HETATM 9322  H H41  . PNS B 2 .  ? 13.562  -1.784  0.523   1.00 1.00 ? 101 PNS A H41  7  
HETATM 9323  H H422 . PNS B 2 .  ? 15.467  -3.912  1.020   1.00 1.00 ? 101 PNS A H422 7  
HETATM 9324  H H421 . PNS B 2 .  ? 13.892  -3.720  1.782   1.00 1.00 ? 101 PNS A H421 7  
HETATM 9325  H H431 . PNS B 2 .  ? 16.464  -2.290  2.484   1.00 1.00 ? 101 PNS A H431 7  
HETATM 9326  H H432 . PNS B 2 .  ? 15.530  -3.387  3.501   1.00 1.00 ? 101 PNS A H432 7  
HETATM 9327  C C1   . STE C 3 .  ? 15.075  0.335   2.896   1.00 1.00 ? 102 STE A C1   7  
HETATM 9328  O O1   . STE C 3 .  ? 16.059  0.518   2.215   1.00 1.00 ? 102 STE A O1   7  
HETATM 9329  C C2   . STE C 3 .  ? 14.200  1.416   3.449   1.00 1.00 ? 102 STE A C2   7  
HETATM 9330  C C3   . STE C 3 .  ? 12.899  1.488   2.652   1.00 1.00 ? 102 STE A C3   7  
HETATM 9331  C C4   . STE C 3 .  ? 12.167  2.781   3.003   1.00 1.00 ? 102 STE A C4   7  
HETATM 9332  C C5   . STE C 3 .  ? 10.795  2.798   2.325   1.00 1.00 ? 102 STE A C5   7  
HETATM 9333  C C6   . STE C 3 .  ? 9.906   3.873   2.977   1.00 1.00 ? 102 STE A C6   7  
HETATM 9334  C C7   . STE C 3 .  ? 9.169   3.279   4.195   1.00 1.00 ? 102 STE A C7   7  
HETATM 9335  C C8   . STE C 3 .  ? 7.869   2.587   3.739   1.00 1.00 ? 102 STE A C8   7  
HETATM 9336  C C9   . STE C 3 .  ? 6.734   3.610   3.690   1.00 1.00 ? 102 STE A C9   7  
HETATM 9337  C C10  . STE C 3 .  ? 5.458   2.935   3.195   1.00 1.00 ? 102 STE A C10  7  
HETATM 9338  C C11  . STE C 3 .  ? 4.436   4.003   2.804   1.00 1.00 ? 102 STE A C11  7  
HETATM 9339  C C12  . STE C 3 .  ? 3.053   3.369   2.697   1.00 1.00 ? 102 STE A C12  7  
HETATM 9340  C C13  . STE C 3 .  ? 2.071   4.387   2.119   1.00 1.00 ? 102 STE A C13  7  
HETATM 9341  C C14  . STE C 3 .  ? 0.700   3.730   1.950   1.00 1.00 ? 102 STE A C14  7  
HETATM 9342  C C15  . STE C 3 .  ? -0.169  4.593   1.036   1.00 1.00 ? 102 STE A C15  7  
HETATM 9343  C C16  . STE C 3 .  ? -1.521  3.908   0.821   1.00 1.00 ? 102 STE A C16  7  
HETATM 9344  C C17  . STE C 3 .  ? -2.223  4.524   -0.391  1.00 1.00 ? 102 STE A C17  7  
HETATM 9345  C C18  . STE C 3 .  ? -3.542  3.793   -0.652  1.00 1.00 ? 102 STE A C18  7  
HETATM 9346  H H21  . STE C 3 .  ? 13.974  1.200   4.483   1.00 1.00 ? 102 STE A H21  7  
HETATM 9347  H H22  . STE C 3 .  ? 14.714  2.363   3.384   1.00 1.00 ? 102 STE A H22  7  
HETATM 9348  H H31  . STE C 3 .  ? 12.276  0.642   2.901   1.00 1.00 ? 102 STE A H31  7  
HETATM 9349  H H32  . STE C 3 .  ? 13.121  1.474   1.594   1.00 1.00 ? 102 STE A H32  7  
HETATM 9350  H H41  . STE C 3 .  ? 12.744  3.625   2.660   1.00 1.00 ? 102 STE A H41  7  
HETATM 9351  H H42  . STE C 3 .  ? 12.041  2.844   4.074   1.00 1.00 ? 102 STE A H42  7  
HETATM 9352  H H51  . STE C 3 .  ? 10.327  1.830   2.428   1.00 1.00 ? 102 STE A H51  7  
HETATM 9353  H H52  . STE C 3 .  ? 10.922  3.021   1.279   1.00 1.00 ? 102 STE A H52  7  
HETATM 9354  H H61  . STE C 3 .  ? 9.185   4.225   2.254   1.00 1.00 ? 102 STE A H61  7  
HETATM 9355  H H62  . STE C 3 .  ? 10.515  4.707   3.298   1.00 1.00 ? 102 STE A H62  7  
HETATM 9356  H H71  . STE C 3 .  ? 8.933   4.070   4.893   1.00 1.00 ? 102 STE A H71  7  
HETATM 9357  H H72  . STE C 3 .  ? 9.804   2.555   4.685   1.00 1.00 ? 102 STE A H72  7  
HETATM 9358  H H81  . STE C 3 .  ? 7.612   1.804   4.437   1.00 1.00 ? 102 STE A H81  7  
HETATM 9359  H H82  . STE C 3 .  ? 8.008   2.158   2.757   1.00 1.00 ? 102 STE A H82  7  
HETATM 9360  H H91  . STE C 3 .  ? 6.997   4.412   3.018   1.00 1.00 ? 102 STE A H91  7  
HETATM 9361  H H92  . STE C 3 .  ? 6.568   4.011   4.680   1.00 1.00 ? 102 STE A H92  7  
HETATM 9362  H H101 . STE C 3 .  ? 5.050   2.319   3.983   1.00 1.00 ? 102 STE A H101 7  
HETATM 9363  H H102 . STE C 3 .  ? 5.685   2.317   2.335   1.00 1.00 ? 102 STE A H102 7  
HETATM 9364  H H111 . STE C 3 .  ? 4.710   4.429   1.850   1.00 1.00 ? 102 STE A H111 7  
HETATM 9365  H H112 . STE C 3 .  ? 4.420   4.780   3.555   1.00 1.00 ? 102 STE A H112 7  
HETATM 9366  H H121 . STE C 3 .  ? 2.719   3.064   3.677   1.00 1.00 ? 102 STE A H121 7  
HETATM 9367  H H122 . STE C 3 .  ? 3.103   2.505   2.048   1.00 1.00 ? 102 STE A H122 7  
HETATM 9368  H H131 . STE C 3 .  ? 2.429   4.727   1.160   1.00 1.00 ? 102 STE A H131 7  
HETATM 9369  H H132 . STE C 3 .  ? 1.989   5.227   2.793   1.00 1.00 ? 102 STE A H132 7  
HETATM 9370  H H141 . STE C 3 .  ? 0.223   3.636   2.914   1.00 1.00 ? 102 STE A H141 7  
HETATM 9371  H H142 . STE C 3 .  ? 0.822   2.749   1.511   1.00 1.00 ? 102 STE A H142 7  
HETATM 9372  H H151 . STE C 3 .  ? 0.325   4.719   0.084   1.00 1.00 ? 102 STE A H151 7  
HETATM 9373  H H152 . STE C 3 .  ? -0.322  5.561   1.493   1.00 1.00 ? 102 STE A H152 7  
HETATM 9374  H H161 . STE C 3 .  ? -2.137  4.043   1.697   1.00 1.00 ? 102 STE A H161 7  
HETATM 9375  H H162 . STE C 3 .  ? -1.367  2.853   0.648   1.00 1.00 ? 102 STE A H162 7  
HETATM 9376  H H171 . STE C 3 .  ? -1.586  4.437   -1.259  1.00 1.00 ? 102 STE A H171 7  
HETATM 9377  H H172 . STE C 3 .  ? -2.422  5.565   -0.192  1.00 1.00 ? 102 STE A H172 7  
HETATM 9378  H H181 . STE C 3 .  ? -3.397  2.728   -0.531  1.00 1.00 ? 102 STE A H181 7  
HETATM 9379  H H182 . STE C 3 .  ? -3.874  3.998   -1.659  1.00 1.00 ? 102 STE A H182 7  
HETATM 9380  H H183 . STE C 3 .  ? -4.286  4.138   0.050   1.00 1.00 ? 102 STE A H183 7  
ATOM   9381  N N    . ALA A 1 1  ? -9.685  -3.703  7.020   1.00 1.00 ? 1   ALA A N    8  
ATOM   9382  C CA   . ALA A 1 1  ? -9.930  -3.850  5.559   1.00 1.00 ? 1   ALA A CA   8  
ATOM   9383  C C    . ALA A 1 1  ? -10.231 -5.311  5.240   1.00 1.00 ? 1   ALA A C    8  
ATOM   9384  O O    . ALA A 1 1  ? -10.284 -6.152  6.137   1.00 1.00 ? 1   ALA A O    8  
ATOM   9385  C CB   . ALA A 1 1  ? -8.692  -3.385  4.787   1.00 1.00 ? 1   ALA A CB   8  
ATOM   9386  H H1   . ALA A 1 1  ? -10.243 -2.907  7.388   1.00 1.00 ? 1   ALA A H1   8  
ATOM   9387  H H2   . ALA A 1 1  ? -8.673  -3.526  7.185   1.00 1.00 ? 1   ALA A H2   8  
ATOM   9388  H H3   . ALA A 1 1  ? -9.968  -4.575  7.508   1.00 1.00 ? 1   ALA A H3   8  
ATOM   9389  H HA   . ALA A 1 1  ? -10.773 -3.241  5.275   1.00 1.00 ? 1   ALA A HA   8  
ATOM   9390  H HB1  . ALA A 1 1  ? -7.975  -4.186  4.742   1.00 1.00 ? 1   ALA A HB1  8  
ATOM   9391  H HB2  . ALA A 1 1  ? -8.249  -2.539  5.288   1.00 1.00 ? 1   ALA A HB2  8  
ATOM   9392  H HB3  . ALA A 1 1  ? -8.980  -3.100  3.784   1.00 1.00 ? 1   ALA A HB3  8  
ATOM   9393  N N    . LYS A 1 2  ? -10.425 -5.606  3.958   1.00 1.00 ? 2   LYS A N    8  
ATOM   9394  C CA   . LYS A 1 2  ? -10.720 -6.969  3.528   1.00 1.00 ? 2   LYS A CA   8  
ATOM   9395  C C    . LYS A 1 2  ? -9.432  -7.715  3.203   1.00 1.00 ? 2   LYS A C    8  
ATOM   9396  O O    . LYS A 1 2  ? -8.438  -7.115  2.811   1.00 1.00 ? 2   LYS A O    8  
ATOM   9397  C CB   . LYS A 1 2  ? -11.623 -6.942  2.296   1.00 1.00 ? 2   LYS A CB   8  
ATOM   9398  C CG   . LYS A 1 2  ? -12.990 -6.371  2.677   1.00 1.00 ? 2   LYS A CG   8  
ATOM   9399  C CD   . LYS A 1 2  ? -13.892 -6.335  1.442   1.00 1.00 ? 2   LYS A CD   8  
ATOM   9400  C CE   . LYS A 1 2  ? -15.268 -5.791  1.829   1.00 1.00 ? 2   LYS A CE   8  
ATOM   9401  N NZ   . LYS A 1 2  ? -16.141 -5.745  0.623   1.00 1.00 ? 2   LYS A NZ   8  
ATOM   9402  H H    . LYS A 1 2  ? -10.370 -4.891  3.288   1.00 1.00 ? 2   LYS A H    8  
ATOM   9403  H HA   . LYS A 1 2  ? -11.234 -7.493  4.320   1.00 1.00 ? 2   LYS A HA   8  
ATOM   9404  H HB2  . LYS A 1 2  ? -11.173 -6.325  1.531   1.00 1.00 ? 2   LYS A HB2  8  
ATOM   9405  H HB3  . LYS A 1 2  ? -11.749 -7.947  1.921   1.00 1.00 ? 2   LYS A HB3  8  
ATOM   9406  H HG2  . LYS A 1 2  ? -13.441 -6.993  3.436   1.00 1.00 ? 2   LYS A HG2  8  
ATOM   9407  H HG3  . LYS A 1 2  ? -12.867 -5.369  3.057   1.00 1.00 ? 2   LYS A HG3  8  
ATOM   9408  H HD2  . LYS A 1 2  ? -13.448 -5.696  0.692   1.00 1.00 ? 2   LYS A HD2  8  
ATOM   9409  H HD3  . LYS A 1 2  ? -14.001 -7.333  1.047   1.00 1.00 ? 2   LYS A HD3  8  
ATOM   9410  H HE2  . LYS A 1 2  ? -15.713 -6.435  2.572   1.00 1.00 ? 2   LYS A HE2  8  
ATOM   9411  H HE3  . LYS A 1 2  ? -15.161 -4.795  2.234   1.00 1.00 ? 2   LYS A HE3  8  
ATOM   9412  H HZ1  . LYS A 1 2  ? -15.595 -5.392  -0.189  1.00 1.00 ? 2   LYS A HZ1  8  
ATOM   9413  H HZ2  . LYS A 1 2  ? -16.947 -5.110  0.802   1.00 1.00 ? 2   LYS A HZ2  8  
ATOM   9414  H HZ3  . LYS A 1 2  ? -16.492 -6.701  0.412   1.00 1.00 ? 2   LYS A HZ3  8  
ATOM   9415  N N    . LYS A 1 3  ? -9.459  -9.030  3.372   1.00 1.00 ? 3   LYS A N    8  
ATOM   9416  C CA   . LYS A 1 3  ? -8.282  -9.846  3.106   1.00 1.00 ? 3   LYS A CA   8  
ATOM   9417  C C    . LYS A 1 3  ? -7.851  -9.716  1.649   1.00 1.00 ? 3   LYS A C    8  
ATOM   9418  O O    . LYS A 1 3  ? -6.660  -9.633  1.353   1.00 1.00 ? 3   LYS A O    8  
ATOM   9419  C CB   . LYS A 1 3  ? -8.596  -11.312 3.409   1.00 1.00 ? 3   LYS A CB   8  
ATOM   9420  C CG   . LYS A 1 3  ? -8.764  -11.501 4.919   1.00 1.00 ? 3   LYS A CG   8  
ATOM   9421  C CD   . LYS A 1 3  ? -9.421  -12.857 5.197   1.00 1.00 ? 3   LYS A CD   8  
ATOM   9422  C CE   . LYS A 1 3  ? -8.662  -13.960 4.455   1.00 1.00 ? 3   LYS A CE   8  
ATOM   9423  N NZ   . LYS A 1 3  ? -9.011  -15.284 5.042   1.00 1.00 ? 3   LYS A NZ   8  
ATOM   9424  H H    . LYS A 1 3  ? -10.281 -9.458  3.692   1.00 1.00 ? 3   LYS A H    8  
ATOM   9425  H HA   . LYS A 1 3  ? -7.474  -9.521  3.741   1.00 1.00 ? 3   LYS A HA   8  
ATOM   9426  H HB2  . LYS A 1 3  ? -9.506  -11.601 2.904   1.00 1.00 ? 3   LYS A HB2  8  
ATOM   9427  H HB3  . LYS A 1 3  ? -7.781  -11.931 3.064   1.00 1.00 ? 3   LYS A HB3  8  
ATOM   9428  H HG2  . LYS A 1 3  ? -7.794  -11.468 5.396   1.00 1.00 ? 3   LYS A HG2  8  
ATOM   9429  H HG3  . LYS A 1 3  ? -9.388  -10.713 5.314   1.00 1.00 ? 3   LYS A HG3  8  
ATOM   9430  H HD2  . LYS A 1 3  ? -9.402  -13.055 6.259   1.00 1.00 ? 3   LYS A HD2  8  
ATOM   9431  H HD3  . LYS A 1 3  ? -10.446 -12.837 4.855   1.00 1.00 ? 3   LYS A HD3  8  
ATOM   9432  H HE2  . LYS A 1 3  ? -8.940  -13.942 3.408   1.00 1.00 ? 3   LYS A HE2  8  
ATOM   9433  H HE3  . LYS A 1 3  ? -7.598  -13.794 4.550   1.00 1.00 ? 3   LYS A HE3  8  
ATOM   9434  H HZ1  . LYS A 1 3  ? -9.484  -15.867 4.323   1.00 1.00 ? 3   LYS A HZ1  8  
ATOM   9435  H HZ2  . LYS A 1 3  ? -9.649  -15.147 5.854   1.00 1.00 ? 3   LYS A HZ2  8  
ATOM   9436  H HZ3  . LYS A 1 3  ? -8.145  -15.763 5.357   1.00 1.00 ? 3   LYS A HZ3  8  
ATOM   9437  N N    . GLU A 1 4  ? -8.822  -9.705  0.747   1.00 1.00 ? 4   GLU A N    8  
ATOM   9438  C CA   . GLU A 1 4  ? -8.525  -9.593  -0.674  1.00 1.00 ? 4   GLU A CA   8  
ATOM   9439  C C    . GLU A 1 4  ? -7.734  -8.319  -0.959  1.00 1.00 ? 4   GLU A C    8  
ATOM   9440  O O    . GLU A 1 4  ? -6.747  -8.345  -1.696  1.00 1.00 ? 4   GLU A O    8  
ATOM   9441  C CB   . GLU A 1 4  ? -9.831  -9.579  -1.473  1.00 1.00 ? 4   GLU A CB   8  
ATOM   9442  C CG   . GLU A 1 4  ? -10.600 -8.286  -1.182  1.00 1.00 ? 4   GLU A CG   8  
ATOM   9443  C CD   . GLU A 1 4  ? -12.044 -8.418  -1.650  1.00 1.00 ? 4   GLU A CD   8  
ATOM   9444  O OE1  . GLU A 1 4  ? -12.266 -9.096  -2.640  1.00 1.00 ? 4   GLU A OE1  8  
ATOM   9445  O OE2  . GLU A 1 4  ? -12.908 -7.842  -1.010  1.00 1.00 ? 4   GLU A OE2  8  
ATOM   9446  H H    . GLU A 1 4  ? -9.755  -9.783  1.041   1.00 1.00 ? 4   GLU A H    8  
ATOM   9447  H HA   . GLU A 1 4  ? -7.940  -10.444 -0.980  1.00 1.00 ? 4   GLU A HA   8  
ATOM   9448  H HB2  . GLU A 1 4  ? -9.606  -9.631  -2.532  1.00 1.00 ? 4   GLU A HB2  8  
ATOM   9449  H HB3  . GLU A 1 4  ? -10.433 -10.432 -1.186  1.00 1.00 ? 4   GLU A HB3  8  
ATOM   9450  H HG2  . GLU A 1 4  ? -10.583 -8.092  -0.118  1.00 1.00 ? 4   GLU A HG2  8  
ATOM   9451  H HG3  . GLU A 1 4  ? -10.135 -7.467  -1.707  1.00 1.00 ? 4   GLU A HG3  8  
ATOM   9452  N N    . THR A 1 5  ? -8.177  -7.209  -0.379  1.00 1.00 ? 5   THR A N    8  
ATOM   9453  C CA   . THR A 1 5  ? -7.508  -5.933  -0.578  1.00 1.00 ? 5   THR A CA   8  
ATOM   9454  C C    . THR A 1 5  ? -6.146  -5.932  0.105   1.00 1.00 ? 5   THR A C    8  
ATOM   9455  O O    . THR A 1 5  ? -5.164  -5.437  -0.444  1.00 1.00 ? 5   THR A O    8  
ATOM   9456  C CB   . THR A 1 5  ? -8.366  -4.794  -0.019  1.00 1.00 ? 5   THR A CB   8  
ATOM   9457  O OG1  . THR A 1 5  ? -9.722  -5.009  -0.383  1.00 1.00 ? 5   THR A OG1  8  
ATOM   9458  C CG2  . THR A 1 5  ? -7.894  -3.466  -0.616  1.00 1.00 ? 5   THR A CG2  8  
ATOM   9459  H H    . THR A 1 5  ? -8.969  -7.250  0.195   1.00 1.00 ? 5   THR A H    8  
ATOM   9460  H HA   . THR A 1 5  ? -7.368  -5.778  -1.639  1.00 1.00 ? 5   THR A HA   8  
ATOM   9461  H HB   . THR A 1 5  ? -8.277  -4.755  1.063   1.00 1.00 ? 5   THR A HB   8  
ATOM   9462  H HG1  . THR A 1 5  ? -10.243 -5.042  0.422   1.00 1.00 ? 5   THR A HG1  8  
ATOM   9463  H HG21 . THR A 1 5  ? -8.228  -2.654  0.012   1.00 1.00 ? 5   THR A HG21 8  
ATOM   9464  H HG22 . THR A 1 5  ? -8.308  -3.347  -1.611  1.00 1.00 ? 5   THR A HG22 8  
ATOM   9465  H HG23 . THR A 1 5  ? -6.814  -3.457  -0.675  1.00 1.00 ? 5   THR A HG23 8  
ATOM   9466  N N    . ILE A 1 6  ? -6.097  -6.484  1.310   1.00 1.00 ? 6   ILE A N    8  
ATOM   9467  C CA   . ILE A 1 6  ? -4.850  -6.538  2.065   1.00 1.00 ? 6   ILE A CA   8  
ATOM   9468  C C    . ILE A 1 6  ? -3.795  -7.323  1.294   1.00 1.00 ? 6   ILE A C    8  
ATOM   9469  O O    . ILE A 1 6  ? -2.644  -6.901  1.202   1.00 1.00 ? 6   ILE A O    8  
ATOM   9470  C CB   . ILE A 1 6  ? -5.093  -7.202  3.428   1.00 1.00 ? 6   ILE A CB   8  
ATOM   9471  C CG1  . ILE A 1 6  ? -5.909  -6.258  4.316   1.00 1.00 ? 6   ILE A CG1  8  
ATOM   9472  C CG2  . ILE A 1 6  ? -3.756  -7.511  4.102   1.00 1.00 ? 6   ILE A CG2  8  
ATOM   9473  C CD1  . ILE A 1 6  ? -6.392  -7.012  5.558   1.00 1.00 ? 6   ILE A CD1  8  
ATOM   9474  H H    . ILE A 1 6  ? -6.912  -6.864  1.702   1.00 1.00 ? 6   ILE A H    8  
ATOM   9475  H HA   . ILE A 1 6  ? -4.494  -5.532  2.227   1.00 1.00 ? 6   ILE A HA   8  
ATOM   9476  H HB   . ILE A 1 6  ? -5.641  -8.122  3.286   1.00 1.00 ? 6   ILE A HB   8  
ATOM   9477  H HG12 . ILE A 1 6  ? -5.294  -5.427  4.615   1.00 1.00 ? 6   ILE A HG12 8  
ATOM   9478  H HG13 . ILE A 1 6  ? -6.755  -5.892  3.763   1.00 1.00 ? 6   ILE A HG13 8  
ATOM   9479  H HG21 . ILE A 1 6  ? -3.102  -6.668  3.998   1.00 1.00 ? 6   ILE A HG21 8  
ATOM   9480  H HG22 . ILE A 1 6  ? -3.306  -8.370  3.632   1.00 1.00 ? 6   ILE A HG22 8  
ATOM   9481  H HG23 . ILE A 1 6  ? -3.914  -7.713  5.145   1.00 1.00 ? 6   ILE A HG23 8  
ATOM   9482  H HD11 . ILE A 1 6  ? -5.543  -7.441  6.070   1.00 1.00 ? 6   ILE A HD11 8  
ATOM   9483  H HD12 . ILE A 1 6  ? -7.067  -7.801  5.261   1.00 1.00 ? 6   ILE A HD12 8  
ATOM   9484  H HD13 . ILE A 1 6  ? -6.904  -6.332  6.219   1.00 1.00 ? 6   ILE A HD13 8  
ATOM   9485  N N    . ASP A 1 7  ? -4.192  -8.463  0.746   1.00 1.00 ? 7   ASP A N    8  
ATOM   9486  C CA   . ASP A 1 7  ? -3.264  -9.294  -0.010  1.00 1.00 ? 7   ASP A CA   8  
ATOM   9487  C C    . ASP A 1 7  ? -2.774  -8.540  -1.238  1.00 1.00 ? 7   ASP A C    8  
ATOM   9488  O O    . ASP A 1 7  ? -1.610  -8.649  -1.623  1.00 1.00 ? 7   ASP A O    8  
ATOM   9489  C CB   . ASP A 1 7  ? -3.962  -10.594 -0.435  1.00 1.00 ? 7   ASP A CB   8  
ATOM   9490  C CG   . ASP A 1 7  ? -3.924  -11.614 0.703   1.00 1.00 ? 7   ASP A CG   8  
ATOM   9491  O OD1  . ASP A 1 7  ? -3.306  -11.327 1.713   1.00 1.00 ? 7   ASP A OD1  8  
ATOM   9492  O OD2  . ASP A 1 7  ? -4.503  -12.671 0.540   1.00 1.00 ? 7   ASP A OD2  8  
ATOM   9493  H H    . ASP A 1 7  ? -5.121  -8.755  0.856   1.00 1.00 ? 7   ASP A H    8  
ATOM   9494  H HA   . ASP A 1 7  ? -2.407  -9.527  0.610   1.00 1.00 ? 7   ASP A HA   8  
ATOM   9495  H HB2  . ASP A 1 7  ? -4.992  -10.378 -0.690  1.00 1.00 ? 7   ASP A HB2  8  
ATOM   9496  H HB3  . ASP A 1 7  ? -3.464  -11.009 -1.298  1.00 1.00 ? 7   ASP A HB3  8  
ATOM   9497  N N    . LYS A 1 8  ? -3.671  -7.783  -1.859  1.00 1.00 ? 8   LYS A N    8  
ATOM   9498  C CA   . LYS A 1 8  ? -3.310  -7.017  -3.043  1.00 1.00 ? 8   LYS A CA   8  
ATOM   9499  C C    . LYS A 1 8  ? -2.321  -5.917  -2.701  1.00 1.00 ? 8   LYS A C    8  
ATOM   9500  O O    . LYS A 1 8  ? -1.321  -5.731  -3.390  1.00 1.00 ? 8   LYS A O    8  
ATOM   9501  C CB   . LYS A 1 8  ? -4.570  -6.402  -3.661  1.00 1.00 ? 8   LYS A CB   8  
ATOM   9502  C CG   . LYS A 1 8  ? -5.370  -7.483  -4.399  1.00 1.00 ? 8   LYS A CG   8  
ATOM   9503  C CD   . LYS A 1 8  ? -4.836  -7.631  -5.840  1.00 1.00 ? 8   LYS A CD   8  
ATOM   9504  C CE   . LYS A 1 8  ? -5.545  -6.630  -6.755  1.00 1.00 ? 8   LYS A CE   8  
ATOM   9505  N NZ   . LYS A 1 8  ? -5.051  -6.799  -8.146  1.00 1.00 ? 8   LYS A NZ   8  
ATOM   9506  H H    . LYS A 1 8  ? -4.586  -7.733  -1.511  1.00 1.00 ? 8   LYS A H    8  
ATOM   9507  H HA   . LYS A 1 8  ? -2.854  -7.681  -3.760  1.00 1.00 ? 8   LYS A HA   8  
ATOM   9508  H HB2  . LYS A 1 8  ? -5.182  -5.994  -2.874  1.00 1.00 ? 8   LYS A HB2  8  
ATOM   9509  H HB3  . LYS A 1 8  ? -4.289  -5.615  -4.347  1.00 1.00 ? 8   LYS A HB3  8  
ATOM   9510  H HG2  . LYS A 1 8  ? -5.278  -8.419  -3.873  1.00 1.00 ? 8   LYS A HG2  8  
ATOM   9511  H HG3  . LYS A 1 8  ? -6.414  -7.203  -4.421  1.00 1.00 ? 8   LYS A HG3  8  
ATOM   9512  H HD2  . LYS A 1 8  ? -3.771  -7.438  -5.863  1.00 1.00 ? 8   LYS A HD2  8  
ATOM   9513  H HD3  . LYS A 1 8  ? -5.018  -8.633  -6.191  1.00 1.00 ? 8   LYS A HD3  8  
ATOM   9514  H HE2  . LYS A 1 8  ? -6.608  -6.809  -6.726  1.00 1.00 ? 8   LYS A HE2  8  
ATOM   9515  H HE3  . LYS A 1 8  ? -5.340  -5.622  -6.422  1.00 1.00 ? 8   LYS A HE3  8  
ATOM   9516  H HZ1  . LYS A 1 8  ? -5.073  -5.882  -8.632  1.00 1.00 ? 8   LYS A HZ1  8  
ATOM   9517  H HZ2  . LYS A 1 8  ? -5.660  -7.476  -8.646  1.00 1.00 ? 8   LYS A HZ2  8  
ATOM   9518  H HZ3  . LYS A 1 8  ? -4.075  -7.155  -8.125  1.00 1.00 ? 8   LYS A HZ3  8  
ATOM   9519  N N    . VAL A 1 9  ? -2.611  -5.186  -1.634  1.00 1.00 ? 9   VAL A N    8  
ATOM   9520  C CA   . VAL A 1 9  ? -1.744  -4.094  -1.210  1.00 1.00 ? 9   VAL A CA   8  
ATOM   9521  C C    . VAL A 1 9  ? -0.363  -4.619  -0.838  1.00 1.00 ? 9   VAL A C    8  
ATOM   9522  O O    . VAL A 1 9  ? 0.655   -4.052  -1.233  1.00 1.00 ? 9   VAL A O    8  
ATOM   9523  C CB   . VAL A 1 9  ? -2.356  -3.376  -0.005  1.00 1.00 ? 9   VAL A CB   8  
ATOM   9524  C CG1  . VAL A 1 9  ? -1.393  -2.294  0.491   1.00 1.00 ? 9   VAL A CG1  8  
ATOM   9525  C CG2  . VAL A 1 9  ? -3.685  -2.728  -0.411  1.00 1.00 ? 9   VAL A CG2  8  
ATOM   9526  H H    . VAL A 1 9  ? -3.432  -5.375  -1.129  1.00 1.00 ? 9   VAL A H    8  
ATOM   9527  H HA   . VAL A 1 9  ? -1.644  -3.392  -2.021  1.00 1.00 ? 9   VAL A HA   8  
ATOM   9528  H HB   . VAL A 1 9  ? -2.532  -4.089  0.789   1.00 1.00 ? 9   VAL A HB   8  
ATOM   9529  H HG11 . VAL A 1 9  ? -1.915  -1.630  1.168   1.00 1.00 ? 9   VAL A HG11 8  
ATOM   9530  H HG12 . VAL A 1 9  ? -1.024  -1.729  -0.350  1.00 1.00 ? 9   VAL A HG12 8  
ATOM   9531  H HG13 . VAL A 1 9  ? -0.566  -2.755  1.009   1.00 1.00 ? 9   VAL A HG13 8  
ATOM   9532  H HG21 . VAL A 1 9  ? -4.274  -2.537  0.468   1.00 1.00 ? 9   VAL A HG21 8  
ATOM   9533  H HG22 . VAL A 1 9  ? -4.224  -3.391  -1.062  1.00 1.00 ? 9   VAL A HG22 8  
ATOM   9534  H HG23 . VAL A 1 9  ? -3.501  -1.800  -0.926  1.00 1.00 ? 9   VAL A HG23 8  
ATOM   9535  N N    . SER A 1 10 ? -0.337  -5.696  -0.067  1.00 1.00 ? 10  SER A N    8  
ATOM   9536  C CA   . SER A 1 10 ? 0.925   -6.278  0.366   1.00 1.00 ? 10  SER A CA   8  
ATOM   9537  C C    . SER A 1 10 ? 1.759   -6.709  -0.830  1.00 1.00 ? 10  SER A C    8  
ATOM   9538  O O    . SER A 1 10 ? 2.964   -6.490  -0.860  1.00 1.00 ? 10  SER A O    8  
ATOM   9539  C CB   . SER A 1 10 ? 0.660   -7.494  1.257   1.00 1.00 ? 10  SER A CB   8  
ATOM   9540  O OG   . SER A 1 10 ? -0.283  -7.147  2.260   1.00 1.00 ? 10  SER A OG   8  
ATOM   9541  H H    . SER A 1 10 ? -1.180  -6.099  0.229   1.00 1.00 ? 10  SER A H    8  
ATOM   9542  H HA   . SER A 1 10 ? 1.477   -5.543  0.935   1.00 1.00 ? 10  SER A HA   8  
ATOM   9543  H HB2  . SER A 1 10 ? 0.267   -8.304  0.668   1.00 1.00 ? 10  SER A HB2  8  
ATOM   9544  H HB3  . SER A 1 10 ? 1.590   -7.807  1.717   1.00 1.00 ? 10  SER A HB3  8  
ATOM   9545  H HG   . SER A 1 10 ? -1.161  -7.340  1.924   1.00 1.00 ? 10  SER A HG   8  
ATOM   9546  N N    . ASP A 1 11 ? 1.110   -7.317  -1.815  1.00 1.00 ? 11  ASP A N    8  
ATOM   9547  C CA   . ASP A 1 11 ? 1.807   -7.791  -3.003  1.00 1.00 ? 11  ASP A CA   8  
ATOM   9548  C C    . ASP A 1 11 ? 2.611   -6.672  -3.641  1.00 1.00 ? 11  ASP A C    8  
ATOM   9549  O O    . ASP A 1 11 ? 3.767   -6.856  -4.003  1.00 1.00 ? 11  ASP A O    8  
ATOM   9550  C CB   . ASP A 1 11 ? 0.798   -8.334  -4.019  1.00 1.00 ? 11  ASP A CB   8  
ATOM   9551  C CG   . ASP A 1 11 ? 1.523   -9.118  -5.107  1.00 1.00 ? 11  ASP A CG   8  
ATOM   9552  O OD1  . ASP A 1 11 ? 2.625   -9.573  -4.850  1.00 1.00 ? 11  ASP A OD1  8  
ATOM   9553  O OD2  . ASP A 1 11 ? 0.963   -9.256  -6.183  1.00 1.00 ? 11  ASP A OD2  8  
ATOM   9554  H H    . ASP A 1 11 ? 0.148   -7.456  -1.736  1.00 1.00 ? 11  ASP A H    8  
ATOM   9555  H HA   . ASP A 1 11 ? 2.478   -8.586  -2.720  1.00 1.00 ? 11  ASP A HA   8  
ATOM   9556  H HB2  . ASP A 1 11 ? 0.097   -8.983  -3.515  1.00 1.00 ? 11  ASP A HB2  8  
ATOM   9557  H HB3  . ASP A 1 11 ? 0.264   -7.510  -4.469  1.00 1.00 ? 11  ASP A HB3  8  
ATOM   9558  N N    . ILE A 1 12 ? 2.003   -5.508  -3.762  1.00 1.00 ? 12  ILE A N    8  
ATOM   9559  C CA   . ILE A 1 12 ? 2.681   -4.376  -4.362  1.00 1.00 ? 12  ILE A CA   8  
ATOM   9560  C C    . ILE A 1 12 ? 4.014   -4.131  -3.674  1.00 1.00 ? 12  ILE A C    8  
ATOM   9561  O O    . ILE A 1 12 ? 4.994   -3.823  -4.338  1.00 1.00 ? 12  ILE A O    8  
ATOM   9562  C CB   . ILE A 1 12 ? 1.786   -3.113  -4.263  1.00 1.00 ? 12  ILE A CB   8  
ATOM   9563  C CG1  . ILE A 1 12 ? 0.896   -2.995  -5.509  1.00 1.00 ? 12  ILE A CG1  8  
ATOM   9564  C CG2  . ILE A 1 12 ? 2.649   -1.850  -4.139  1.00 1.00 ? 12  ILE A CG2  8  
ATOM   9565  C CD1  . ILE A 1 12 ? -0.155  -4.103  -5.503  1.00 1.00 ? 12  ILE A CD1  8  
ATOM   9566  H H    . ILE A 1 12 ? 1.076   -5.410  -3.453  1.00 1.00 ? 12  ILE A H    8  
ATOM   9567  H HA   . ILE A 1 12 ? 2.881   -4.602  -5.395  1.00 1.00 ? 12  ILE A HA   8  
ATOM   9568  H HB   . ILE A 1 12 ? 1.158   -3.196  -3.386  1.00 1.00 ? 12  ILE A HB   8  
ATOM   9569  H HG12 . ILE A 1 12 ? 0.404   -2.034  -5.507  1.00 1.00 ? 12  ILE A HG12 8  
ATOM   9570  H HG13 . ILE A 1 12 ? 1.496   -3.084  -6.398  1.00 1.00 ? 12  ILE A HG13 8  
ATOM   9571  H HG21 . ILE A 1 12 ? 3.051   -1.792  -3.136  1.00 1.00 ? 12  ILE A HG21 8  
ATOM   9572  H HG22 . ILE A 1 12 ? 2.053   -0.975  -4.334  1.00 1.00 ? 12  ILE A HG22 8  
ATOM   9573  H HG23 . ILE A 1 12 ? 3.457   -1.897  -4.853  1.00 1.00 ? 12  ILE A HG23 8  
ATOM   9574  H HD11 . ILE A 1 12 ? -0.619  -4.154  -6.473  1.00 1.00 ? 12  ILE A HD11 8  
ATOM   9575  H HD12 . ILE A 1 12 ? -0.900  -3.885  -4.753  1.00 1.00 ? 12  ILE A HD12 8  
ATOM   9576  H HD13 . ILE A 1 12 ? 0.310   -5.048  -5.284  1.00 1.00 ? 12  ILE A HD13 8  
ATOM   9577  N N    . VAL A 1 13 ? 4.017   -4.198  -2.356  1.00 1.00 ? 13  VAL A N    8  
ATOM   9578  C CA   . VAL A 1 13 ? 5.228   -3.934  -1.595  1.00 1.00 ? 13  VAL A CA   8  
ATOM   9579  C C    . VAL A 1 13 ? 6.289   -4.974  -1.915  1.00 1.00 ? 13  VAL A C    8  
ATOM   9580  O O    . VAL A 1 13 ? 7.454   -4.644  -2.129  1.00 1.00 ? 13  VAL A O    8  
ATOM   9581  C CB   . VAL A 1 13 ? 4.914   -3.956  -0.099  1.00 1.00 ? 13  VAL A CB   8  
ATOM   9582  C CG1  . VAL A 1 13 ? 6.206   -3.758  0.695   1.00 1.00 ? 13  VAL A CG1  8  
ATOM   9583  C CG2  . VAL A 1 13 ? 3.932   -2.830  0.238   1.00 1.00 ? 13  VAL A CG2  8  
ATOM   9584  H H    . VAL A 1 13 ? 3.180   -4.392  -1.886  1.00 1.00 ? 13  VAL A H    8  
ATOM   9585  H HA   . VAL A 1 13 ? 5.606   -2.955  -1.858  1.00 1.00 ? 13  VAL A HA   8  
ATOM   9586  H HB   . VAL A 1 13 ? 4.475   -4.909  0.161   1.00 1.00 ? 13  VAL A HB   8  
ATOM   9587  H HG11 . VAL A 1 13 ? 6.745   -2.908  0.298   1.00 1.00 ? 13  VAL A HG11 8  
ATOM   9588  H HG12 . VAL A 1 13 ? 6.817   -4.644  0.617   1.00 1.00 ? 13  VAL A HG12 8  
ATOM   9589  H HG13 . VAL A 1 13 ? 5.965   -3.577  1.733   1.00 1.00 ? 13  VAL A HG13 8  
ATOM   9590  H HG21 . VAL A 1 13 ? 4.424   -1.875  0.126   1.00 1.00 ? 13  VAL A HG21 8  
ATOM   9591  H HG22 . VAL A 1 13 ? 3.592   -2.943  1.258   1.00 1.00 ? 13  VAL A HG22 8  
ATOM   9592  H HG23 . VAL A 1 13 ? 3.084   -2.879  -0.430  1.00 1.00 ? 13  VAL A HG23 8  
ATOM   9593  N N    . LYS A 1 14 ? 5.881   -6.236  -1.934  1.00 1.00 ? 14  LYS A N    8  
ATOM   9594  C CA   . LYS A 1 14 ? 6.809   -7.329  -2.213  1.00 1.00 ? 14  LYS A CA   8  
ATOM   9595  C C    . LYS A 1 14 ? 7.365   -7.208  -3.627  1.00 1.00 ? 14  LYS A C    8  
ATOM   9596  O O    . LYS A 1 14 ? 8.536   -7.492  -3.869  1.00 1.00 ? 14  LYS A O    8  
ATOM   9597  C CB   . LYS A 1 14 ? 6.096   -8.668  -2.056  1.00 1.00 ? 14  LYS A CB   8  
ATOM   9598  C CG   . LYS A 1 14 ? 5.346   -8.695  -0.721  1.00 1.00 ? 14  LYS A CG   8  
ATOM   9599  C CD   . LYS A 1 14 ? 5.066   -10.148 -0.317  1.00 1.00 ? 14  LYS A CD   8  
ATOM   9600  C CE   . LYS A 1 14 ? 6.339   -10.776 0.295   1.00 1.00 ? 14  LYS A CE   8  
ATOM   9601  N NZ   . LYS A 1 14 ? 6.069   -11.141 1.708   1.00 1.00 ? 14  LYS A NZ   8  
ATOM   9602  H H    . LYS A 1 14 ? 4.939   -6.441  -1.746  1.00 1.00 ? 14  LYS A H    8  
ATOM   9603  H HA   . LYS A 1 14 ? 7.634   -7.290  -1.506  1.00 1.00 ? 14  LYS A HA   8  
ATOM   9604  H HB2  . LYS A 1 14 ? 5.394   -8.805  -2.868  1.00 1.00 ? 14  LYS A HB2  8  
ATOM   9605  H HB3  . LYS A 1 14 ? 6.825   -9.461  -2.075  1.00 1.00 ? 14  LYS A HB3  8  
ATOM   9606  H HG2  . LYS A 1 14 ? 5.929   -8.200  0.046   1.00 1.00 ? 14  LYS A HG2  8  
ATOM   9607  H HG3  . LYS A 1 14 ? 4.422   -8.185  -0.831  1.00 1.00 ? 14  LYS A HG3  8  
ATOM   9608  H HD2  . LYS A 1 14 ? 4.265   -10.172 0.413   1.00 1.00 ? 14  LYS A HD2  8  
ATOM   9609  H HD3  . LYS A 1 14 ? 4.761   -10.713 -1.192  1.00 1.00 ? 14  LYS A HD3  8  
ATOM   9610  H HE2  . LYS A 1 14 ? 6.613   -11.659 -0.256  1.00 1.00 ? 14  LYS A HE2  8  
ATOM   9611  H HE3  . LYS A 1 14 ? 7.166   -10.082 0.268   1.00 1.00 ? 14  LYS A HE3  8  
ATOM   9612  H HZ1  . LYS A 1 14 ? 5.266   -10.586 2.067   1.00 1.00 ? 14  LYS A HZ1  8  
ATOM   9613  H HZ2  . LYS A 1 14 ? 6.914   -10.935 2.279   1.00 1.00 ? 14  LYS A HZ2  8  
ATOM   9614  H HZ3  . LYS A 1 14 ? 5.844   -12.150 1.767   1.00 1.00 ? 14  LYS A HZ3  8  
ATOM   9615  N N    . GLU A 1 15 ? 6.514   -6.795  -4.557  1.00 1.00 ? 15  GLU A N    8  
ATOM   9616  C CA   . GLU A 1 15 ? 6.930   -6.645  -5.944  1.00 1.00 ? 15  GLU A CA   8  
ATOM   9617  C C    . GLU A 1 15 ? 8.169   -5.761  -6.047  1.00 1.00 ? 15  GLU A C    8  
ATOM   9618  O O    . GLU A 1 15 ? 8.999   -5.944  -6.932  1.00 1.00 ? 15  GLU A O    8  
ATOM   9619  C CB   . GLU A 1 15 ? 5.789   -6.035  -6.769  1.00 1.00 ? 15  GLU A CB   8  
ATOM   9620  C CG   . GLU A 1 15 ? 4.713   -7.093  -7.021  1.00 1.00 ? 15  GLU A CG   8  
ATOM   9621  C CD   . GLU A 1 15 ? 3.502   -6.457  -7.695  1.00 1.00 ? 15  GLU A CD   8  
ATOM   9622  O OE1  . GLU A 1 15 ? 3.550   -5.264  -7.950  1.00 1.00 ? 15  GLU A OE1  8  
ATOM   9623  O OE2  . GLU A 1 15 ? 2.547   -7.171  -7.947  1.00 1.00 ? 15  GLU A OE2  8  
ATOM   9624  H H    . GLU A 1 15 ? 5.593   -6.589  -4.306  1.00 1.00 ? 15  GLU A H    8  
ATOM   9625  H HA   . GLU A 1 15 ? 7.165   -7.616  -6.345  1.00 1.00 ? 15  GLU A HA   8  
ATOM   9626  H HB2  . GLU A 1 15 ? 5.359   -5.205  -6.226  1.00 1.00 ? 15  GLU A HB2  8  
ATOM   9627  H HB3  . GLU A 1 15 ? 6.172   -5.685  -7.718  1.00 1.00 ? 15  GLU A HB3  8  
ATOM   9628  H HG2  . GLU A 1 15 ? 5.115   -7.863  -7.661  1.00 1.00 ? 15  GLU A HG2  8  
ATOM   9629  H HG3  . GLU A 1 15 ? 4.413   -7.532  -6.085  1.00 1.00 ? 15  GLU A HG3  8  
ATOM   9630  N N    . LYS A 1 16 ? 8.282   -4.808  -5.138  1.00 1.00 ? 16  LYS A N    8  
ATOM   9631  C CA   . LYS A 1 16 ? 9.419   -3.897  -5.143  1.00 1.00 ? 16  LYS A CA   8  
ATOM   9632  C C    . LYS A 1 16 ? 10.716  -4.672  -4.977  1.00 1.00 ? 16  LYS A C    8  
ATOM   9633  O O    . LYS A 1 16 ? 11.639  -4.524  -5.762  1.00 1.00 ? 16  LYS A O    8  
ATOM   9634  C CB   . LYS A 1 16 ? 9.264   -2.876  -4.010  1.00 1.00 ? 16  LYS A CB   8  
ATOM   9635  C CG   . LYS A 1 16 ? 7.817   -2.363  -3.952  1.00 1.00 ? 16  LYS A CG   8  
ATOM   9636  C CD   . LYS A 1 16 ? 7.587   -1.325  -5.053  1.00 1.00 ? 16  LYS A CD   8  
ATOM   9637  C CE   . LYS A 1 16 ? 8.315   -0.022  -4.700  1.00 1.00 ? 16  LYS A CE   8  
ATOM   9638  N NZ   . LYS A 1 16 ? 7.664   1.108   -5.396  1.00 1.00 ? 16  LYS A NZ   8  
ATOM   9639  H H    . LYS A 1 16 ? 7.582   -4.714  -4.462  1.00 1.00 ? 16  LYS A H    8  
ATOM   9640  H HA   . LYS A 1 16 ? 9.462   -3.376  -6.079  1.00 1.00 ? 16  LYS A HA   8  
ATOM   9641  H HB2  . LYS A 1 16 ? 9.504   -3.336  -3.082  1.00 1.00 ? 16  LYS A HB2  8  
ATOM   9642  H HB3  . LYS A 1 16 ? 9.931   -2.054  -4.170  1.00 1.00 ? 16  LYS A HB3  8  
ATOM   9643  H HG2  . LYS A 1 16 ? 7.136   -3.169  -4.081  1.00 1.00 ? 16  LYS A HG2  8  
ATOM   9644  H HG3  . LYS A 1 16 ? 7.633   -1.928  -2.996  1.00 1.00 ? 16  LYS A HG3  8  
ATOM   9645  H HD2  . LYS A 1 16 ? 7.963   -1.704  -5.992  1.00 1.00 ? 16  LYS A HD2  8  
ATOM   9646  H HD3  . LYS A 1 16 ? 6.529   -1.133  -5.153  1.00 1.00 ? 16  LYS A HD3  8  
ATOM   9647  H HE2  . LYS A 1 16 ? 8.278   0.150   -3.636  1.00 1.00 ? 16  LYS A HE2  8  
ATOM   9648  H HE3  . LYS A 1 16 ? 9.345   -0.080  -5.017  1.00 1.00 ? 16  LYS A HE3  8  
ATOM   9649  H HZ1  . LYS A 1 16 ? 8.320   1.912   -5.429  1.00 1.00 ? 16  LYS A HZ1  8  
ATOM   9650  H HZ2  . LYS A 1 16 ? 6.804   1.378   -4.879  1.00 1.00 ? 16  LYS A HZ2  8  
ATOM   9651  H HZ3  . LYS A 1 16 ? 7.417   0.825   -6.364  1.00 1.00 ? 16  LYS A HZ3  8  
ATOM   9652  N N    . LEU A 1 17 ? 10.771  -5.511  -3.959  1.00 1.00 ? 17  LEU A N    8  
ATOM   9653  C CA   . LEU A 1 17 ? 11.954  -6.318  -3.692  1.00 1.00 ? 17  LEU A CA   8  
ATOM   9654  C C    . LEU A 1 17 ? 11.914  -7.579  -4.514  1.00 1.00 ? 17  LEU A C    8  
ATOM   9655  O O    . LEU A 1 17 ? 12.777  -8.440  -4.370  1.00 1.00 ? 17  LEU A O    8  
ATOM   9656  C CB   . LEU A 1 17 ? 12.015  -6.674  -2.197  1.00 1.00 ? 17  LEU A CB   8  
ATOM   9657  C CG   . LEU A 1 17 ? 11.770  -5.433  -1.333  1.00 1.00 ? 17  LEU A CG   8  
ATOM   9658  C CD1  . LEU A 1 17 ? 12.439  -4.197  -1.968  1.00 1.00 ? 17  LEU A CD1  8  
ATOM   9659  C CD2  . LEU A 1 17 ? 10.256  -5.191  -1.151  1.00 1.00 ? 17  LEU A CD2  8  
ATOM   9660  H H    . LEU A 1 17 ? 10.011  -5.578  -3.354  1.00 1.00 ? 17  LEU A H    8  
ATOM   9661  H HA   . LEU A 1 17 ? 12.839  -5.770  -3.974  1.00 1.00 ? 17  LEU A HA   8  
ATOM   9662  H HB2  . LEU A 1 17 ? 11.251  -7.399  -1.972  1.00 1.00 ? 17  LEU A HB2  8  
ATOM   9663  H HB3  . LEU A 1 17 ? 12.985  -7.097  -1.955  1.00 1.00 ? 17  LEU A HB3  8  
ATOM   9664  H HG   . LEU A 1 17 ? 12.194  -5.618  -0.371  1.00 1.00 ? 17  LEU A HG   8  
ATOM   9665  H HD11 . LEU A 1 17 ? 11.847  -3.856  -2.792  1.00 1.00 ? 17  LEU A HD11 8  
ATOM   9666  H HD12 . LEU A 1 17 ? 13.425  -4.453  -2.311  1.00 1.00 ? 17  LEU A HD12 8  
ATOM   9667  H HD13 . LEU A 1 17 ? 12.516  -3.407  -1.254  1.00 1.00 ? 17  LEU A HD13 8  
ATOM   9668  H HD21 . LEU A 1 17 ? 9.705   -5.608  -1.961  1.00 1.00 ? 17  LEU A HD21 8  
ATOM   9669  H HD22 . LEU A 1 17 ? 10.060  -4.139  -1.088  1.00 1.00 ? 17  LEU A HD22 8  
ATOM   9670  H HD23 . LEU A 1 17 ? 9.928   -5.660  -0.250  1.00 1.00 ? 17  LEU A HD23 8  
ATOM   9671  N N    . ALA A 1 18 ? 10.888  -7.691  -5.344  1.00 1.00 ? 18  ALA A N    8  
ATOM   9672  C CA   . ALA A 1 18 ? 10.724  -8.875  -6.174  1.00 1.00 ? 18  ALA A CA   8  
ATOM   9673  C C    . ALA A 1 18 ? 10.406  -10.081 -5.304  1.00 1.00 ? 18  ALA A C    8  
ATOM   9674  O O    . ALA A 1 18 ? 10.829  -11.200 -5.592  1.00 1.00 ? 18  ALA A O    8  
ATOM   9675  C CB   . ALA A 1 18 ? 12.003  -9.144  -6.979  1.00 1.00 ? 18  ALA A CB   8  
ATOM   9676  H H    . ALA A 1 18 ? 10.218  -6.973  -5.387  1.00 1.00 ? 18  ALA A H    8  
ATOM   9677  H HA   . ALA A 1 18 ? 9.904   -8.716  -6.849  1.00 1.00 ? 18  ALA A HA   8  
ATOM   9678  H HB1  . ALA A 1 18 ? 12.710  -9.688  -6.365  1.00 1.00 ? 18  ALA A HB1  8  
ATOM   9679  H HB2  . ALA A 1 18 ? 12.442  -8.208  -7.283  1.00 1.00 ? 18  ALA A HB2  8  
ATOM   9680  H HB3  . ALA A 1 18 ? 11.763  -9.732  -7.854  1.00 1.00 ? 18  ALA A HB3  8  
ATOM   9681  N N    . LEU A 1 19 ? 9.684   -9.842  -4.212  1.00 1.00 ? 19  LEU A N    8  
ATOM   9682  C CA   . LEU A 1 19 ? 9.338   -10.921 -3.277  1.00 1.00 ? 19  LEU A CA   8  
ATOM   9683  C C    . LEU A 1 19 ? 7.989   -11.525 -3.625  1.00 1.00 ? 19  LEU A C    8  
ATOM   9684  O O    . LEU A 1 19 ? 7.463   -11.298 -4.710  1.00 1.00 ? 19  LEU A O    8  
ATOM   9685  C CB   . LEU A 1 19 ? 9.331   -10.363 -1.837  1.00 1.00 ? 19  LEU A CB   8  
ATOM   9686  C CG   . LEU A 1 19 ? 10.667  -10.653 -1.153  1.00 1.00 ? 19  LEU A CG   8  
ATOM   9687  C CD1  . LEU A 1 19 ? 11.822  -10.008 -1.950  1.00 1.00 ? 19  LEU A CD1  8  
ATOM   9688  C CD2  . LEU A 1 19 ? 10.638  -10.088 0.269   1.00 1.00 ? 19  LEU A CD2  8  
ATOM   9689  H H    . LEU A 1 19 ? 9.393   -8.922  -4.012  1.00 1.00 ? 19  LEU A H    8  
ATOM   9690  H HA   . LEU A 1 19 ? 10.078  -11.699 -3.348  1.00 1.00 ? 19  LEU A HA   8  
ATOM   9691  H HB2  . LEU A 1 19 ? 9.175   -9.293  -1.880  1.00 1.00 ? 19  LEU A HB2  8  
ATOM   9692  H HB3  . LEU A 1 19 ? 8.550   -10.816 -1.258  1.00 1.00 ? 19  LEU A HB3  8  
ATOM   9693  H HG   . LEU A 1 19 ? 10.816  -11.729 -1.103  1.00 1.00 ? 19  LEU A HG   8  
ATOM   9694  H HD11 . LEU A 1 19 ? 11.443  -9.468  -2.790  1.00 1.00 ? 19  LEU A HD11 8  
ATOM   9695  H HD12 . LEU A 1 19 ? 12.469  -10.786 -2.310  1.00 1.00 ? 19  LEU A HD12 8  
ATOM   9696  H HD13 . LEU A 1 19 ? 12.382  -9.327  -1.322  1.00 1.00 ? 19  LEU A HD13 8  
ATOM   9697  H HD21 . LEU A 1 19 ? 10.041  -10.723 0.901   1.00 1.00 ? 19  LEU A HD21 8  
ATOM   9698  H HD22 . LEU A 1 19 ? 10.214  -9.091  0.248   1.00 1.00 ? 19  LEU A HD22 8  
ATOM   9699  H HD23 . LEU A 1 19 ? 11.649  -10.048 0.655   1.00 1.00 ? 19  LEU A HD23 8  
ATOM   9700  N N    . GLY A 1 20 ? 7.428   -12.277 -2.682  1.00 1.00 ? 20  GLY A N    8  
ATOM   9701  C CA   . GLY A 1 20 ? 6.132   -12.901 -2.881  1.00 1.00 ? 20  GLY A CA   8  
ATOM   9702  C C    . GLY A 1 20 ? 6.293   -14.357 -3.286  1.00 1.00 ? 20  GLY A C    8  
ATOM   9703  O O    . GLY A 1 20 ? 5.335   -14.998 -3.713  1.00 1.00 ? 20  GLY A O    8  
ATOM   9704  H H    . GLY A 1 20 ? 7.899   -12.404 -1.825  1.00 1.00 ? 20  GLY A H    8  
ATOM   9705  H HA2  . GLY A 1 20 ? 5.566   -12.845 -1.963  1.00 1.00 ? 20  GLY A HA2  8  
ATOM   9706  H HA3  . GLY A 1 20 ? 5.599   -12.378 -3.658  1.00 1.00 ? 20  GLY A HA3  8  
ATOM   9707  N N    . ALA A 1 21 ? 7.510   -14.876 -3.149  1.00 1.00 ? 21  ALA A N    8  
ATOM   9708  C CA   . ALA A 1 21 ? 7.780   -16.265 -3.505  1.00 1.00 ? 21  ALA A CA   8  
ATOM   9709  C C    . ALA A 1 21 ? 7.429   -17.188 -2.349  1.00 1.00 ? 21  ALA A C    8  
ATOM   9710  O O    . ALA A 1 21 ? 6.348   -17.773 -2.319  1.00 1.00 ? 21  ALA A O    8  
ATOM   9711  C CB   . ALA A 1 21 ? 9.258   -16.434 -3.862  1.00 1.00 ? 21  ALA A CB   8  
ATOM   9712  H H    . ALA A 1 21 ? 8.238   -14.321 -2.798  1.00 1.00 ? 21  ALA A H    8  
ATOM   9713  H HA   . ALA A 1 21 ? 7.182   -16.537 -4.361  1.00 1.00 ? 21  ALA A HA   8  
ATOM   9714  H HB1  . ALA A 1 21 ? 9.868   -16.017 -3.075  1.00 1.00 ? 21  ALA A HB1  8  
ATOM   9715  H HB2  . ALA A 1 21 ? 9.463   -15.920 -4.789  1.00 1.00 ? 21  ALA A HB2  8  
ATOM   9716  H HB3  . ALA A 1 21 ? 9.483   -17.485 -3.976  1.00 1.00 ? 21  ALA A HB3  8  
ATOM   9717  N N    . ASP A 1 22 ? 8.348   -17.316 -1.394  1.00 1.00 ? 22  ASP A N    8  
ATOM   9718  C CA   . ASP A 1 22 ? 8.127   -18.176 -0.228  1.00 1.00 ? 22  ASP A CA   8  
ATOM   9719  C C    . ASP A 1 22 ? 8.139   -17.355 1.052   1.00 1.00 ? 22  ASP A C    8  
ATOM   9720  O O    . ASP A 1 22 ? 8.263   -17.899 2.149   1.00 1.00 ? 22  ASP A O    8  
ATOM   9721  C CB   . ASP A 1 22 ? 9.213   -19.250 -0.161  1.00 1.00 ? 22  ASP A CB   8  
ATOM   9722  C CG   . ASP A 1 22 ? 10.592  -18.603 -0.186  1.00 1.00 ? 22  ASP A CG   8  
ATOM   9723  O OD1  . ASP A 1 22 ? 10.660  -17.394 -0.047  1.00 1.00 ? 22  ASP A OD1  8  
ATOM   9724  O OD2  . ASP A 1 22 ? 11.561  -19.329 -0.341  1.00 1.00 ? 22  ASP A OD2  8  
ATOM   9725  H H    . ASP A 1 22 ? 9.193   -16.822 -1.470  1.00 1.00 ? 22  ASP A H    8  
ATOM   9726  H HA   . ASP A 1 22 ? 7.167   -18.666 -0.305  1.00 1.00 ? 22  ASP A HA   8  
ATOM   9727  H HB2  . ASP A 1 22 ? 9.095   -19.816 0.750   1.00 1.00 ? 22  ASP A HB2  8  
ATOM   9728  H HB3  . ASP A 1 22 ? 9.112   -19.910 -1.010  1.00 1.00 ? 22  ASP A HB3  8  
ATOM   9729  N N    . VAL A 1 23 ? 8.029   -16.037 0.911   1.00 1.00 ? 23  VAL A N    8  
ATOM   9730  C CA   . VAL A 1 23 ? 8.041   -15.146 2.066   1.00 1.00 ? 23  VAL A CA   8  
ATOM   9731  C C    . VAL A 1 23 ? 6.632   -14.953 2.614   1.00 1.00 ? 23  VAL A C    8  
ATOM   9732  O O    . VAL A 1 23 ? 5.692   -14.708 1.860   1.00 1.00 ? 23  VAL A O    8  
ATOM   9733  C CB   . VAL A 1 23 ? 8.628   -13.789 1.673   1.00 1.00 ? 23  VAL A CB   8  
ATOM   9734  C CG1  . VAL A 1 23 ? 8.885   -12.961 2.933   1.00 1.00 ? 23  VAL A CG1  8  
ATOM   9735  C CG2  . VAL A 1 23 ? 9.944   -13.999 0.920   1.00 1.00 ? 23  VAL A CG2  8  
ATOM   9736  H H    . VAL A 1 23 ? 7.947   -15.656 0.010   1.00 1.00 ? 23  VAL A H    8  
ATOM   9737  H HA   . VAL A 1 23 ? 8.662   -15.577 2.840   1.00 1.00 ? 23  VAL A HA   8  
ATOM   9738  H HB   . VAL A 1 23 ? 7.927   -13.265 1.038   1.00 1.00 ? 23  VAL A HB   8  
ATOM   9739  H HG11 . VAL A 1 23 ? 9.632   -13.451 3.539   1.00 1.00 ? 23  VAL A HG11 8  
ATOM   9740  H HG12 . VAL A 1 23 ? 7.969   -12.866 3.497   1.00 1.00 ? 23  VAL A HG12 8  
ATOM   9741  H HG13 . VAL A 1 23 ? 9.236   -11.981 2.654   1.00 1.00 ? 23  VAL A HG13 8  
ATOM   9742  H HG21 . VAL A 1 23 ? 10.533  -14.753 1.422   1.00 1.00 ? 23  VAL A HG21 8  
ATOM   9743  H HG22 . VAL A 1 23 ? 10.497  -13.071 0.893   1.00 1.00 ? 23  VAL A HG22 8  
ATOM   9744  H HG23 . VAL A 1 23 ? 9.732   -14.320 -0.089  1.00 1.00 ? 23  VAL A HG23 8  
ATOM   9745  N N    . VAL A 1 24 ? 6.496   -15.064 3.932   1.00 1.00 ? 24  VAL A N    8  
ATOM   9746  C CA   . VAL A 1 24 ? 5.198   -14.897 4.575   1.00 1.00 ? 24  VAL A CA   8  
ATOM   9747  C C    . VAL A 1 24 ? 4.738   -13.453 4.460   1.00 1.00 ? 24  VAL A C    8  
ATOM   9748  O O    . VAL A 1 24 ? 5.530   -12.523 4.617   1.00 1.00 ? 24  VAL A O    8  
ATOM   9749  C CB   . VAL A 1 24 ? 5.286   -15.287 6.049   1.00 1.00 ? 24  VAL A CB   8  
ATOM   9750  C CG1  . VAL A 1 24 ? 3.952   -14.990 6.737   1.00 1.00 ? 24  VAL A CG1  8  
ATOM   9751  C CG2  . VAL A 1 24 ? 5.595   -16.781 6.158   1.00 1.00 ? 24  VAL A CG2  8  
ATOM   9752  H H    . VAL A 1 24 ? 7.283   -15.256 4.481   1.00 1.00 ? 24  VAL A H    8  
ATOM   9753  H HA   . VAL A 1 24 ? 4.479   -15.534 4.086   1.00 1.00 ? 24  VAL A HA   8  
ATOM   9754  H HB   . VAL A 1 24 ? 6.070   -14.717 6.525   1.00 1.00 ? 24  VAL A HB   8  
ATOM   9755  H HG11 . VAL A 1 24 ? 3.142   -15.354 6.123   1.00 1.00 ? 24  VAL A HG11 8  
ATOM   9756  H HG12 . VAL A 1 24 ? 3.849   -13.923 6.874   1.00 1.00 ? 24  VAL A HG12 8  
ATOM   9757  H HG13 . VAL A 1 24 ? 3.926   -15.481 7.698   1.00 1.00 ? 24  VAL A HG13 8  
ATOM   9758  H HG21 . VAL A 1 24 ? 4.837   -17.344 5.633   1.00 1.00 ? 24  VAL A HG21 8  
ATOM   9759  H HG22 . VAL A 1 24 ? 5.605   -17.069 7.197   1.00 1.00 ? 24  VAL A HG22 8  
ATOM   9760  H HG23 . VAL A 1 24 ? 6.562   -16.980 5.719   1.00 1.00 ? 24  VAL A HG23 8  
ATOM   9761  N N    . VAL A 1 25 ? 3.453   -13.264 4.171   1.00 1.00 ? 25  VAL A N    8  
ATOM   9762  C CA   . VAL A 1 25 ? 2.893   -11.918 4.024   1.00 1.00 ? 25  VAL A CA   8  
ATOM   9763  C C    . VAL A 1 25 ? 1.788   -11.689 5.046   1.00 1.00 ? 25  VAL A C    8  
ATOM   9764  O O    . VAL A 1 25 ? 0.866   -12.495 5.173   1.00 1.00 ? 25  VAL A O    8  
ATOM   9765  C CB   . VAL A 1 25 ? 2.321   -11.748 2.615   1.00 1.00 ? 25  VAL A CB   8  
ATOM   9766  C CG1  . VAL A 1 25 ? 1.286   -12.840 2.340   1.00 1.00 ? 25  VAL A CG1  8  
ATOM   9767  C CG2  . VAL A 1 25 ? 1.658   -10.373 2.501   1.00 1.00 ? 25  VAL A CG2  8  
ATOM   9768  H H    . VAL A 1 25 ? 2.865   -14.043 4.047   1.00 1.00 ? 25  VAL A H    8  
ATOM   9769  H HA   . VAL A 1 25 ? 3.660   -11.170 4.176   1.00 1.00 ? 25  VAL A HA   8  
ATOM   9770  H HB   . VAL A 1 25 ? 3.124   -11.822 1.892   1.00 1.00 ? 25  VAL A HB   8  
ATOM   9771  H HG11 . VAL A 1 25 ? 1.668   -13.795 2.665   1.00 1.00 ? 25  VAL A HG11 8  
ATOM   9772  H HG12 . VAL A 1 25 ? 1.081   -12.881 1.279   1.00 1.00 ? 25  VAL A HG12 8  
ATOM   9773  H HG13 . VAL A 1 25 ? 0.376   -12.615 2.873   1.00 1.00 ? 25  VAL A HG13 8  
ATOM   9774  H HG21 . VAL A 1 25 ? 0.697   -10.391 2.994   1.00 1.00 ? 25  VAL A HG21 8  
ATOM   9775  H HG22 . VAL A 1 25 ? 1.520   -10.128 1.456   1.00 1.00 ? 25  VAL A HG22 8  
ATOM   9776  H HG23 . VAL A 1 25 ? 2.286   -9.630  2.967   1.00 1.00 ? 25  VAL A HG23 8  
ATOM   9777  N N    . THR A 1 26 ? 1.881   -10.576 5.767   1.00 1.00 ? 26  THR A N    8  
ATOM   9778  C CA   . THR A 1 26 ? 0.879   -10.229 6.777   1.00 1.00 ? 26  THR A CA   8  
ATOM   9779  C C    . THR A 1 26 ? 0.460   -8.771  6.634   1.00 1.00 ? 26  THR A C    8  
ATOM   9780  O O    . THR A 1 26 ? 1.151   -7.968  6.010   1.00 1.00 ? 26  THR A O    8  
ATOM   9781  C CB   . THR A 1 26 ? 1.449   -10.483 8.184   1.00 1.00 ? 26  THR A CB   8  
ATOM   9782  O OG1  . THR A 1 26 ? 2.853   -10.271 8.167   1.00 1.00 ? 26  THR A OG1  8  
ATOM   9783  C CG2  . THR A 1 26 ? 1.152   -11.915 8.612   1.00 1.00 ? 26  THR A CG2  8  
ATOM   9784  H H    . THR A 1 26 ? 2.639   -9.970  5.615   1.00 1.00 ? 26  THR A H    8  
ATOM   9785  H HA   . THR A 1 26 ? -0.001  -10.843 6.635   1.00 1.00 ? 26  THR A HA   8  
ATOM   9786  H HB   . THR A 1 26 ? 0.996   -9.807  8.892   1.00 1.00 ? 26  THR A HB   8  
ATOM   9787  H HG1  . THR A 1 26 ? 3.107   -9.904  9.015   1.00 1.00 ? 26  THR A HG1  8  
ATOM   9788  H HG21 . THR A 1 26 ? 1.479   -12.597 7.845   1.00 1.00 ? 26  THR A HG21 8  
ATOM   9789  H HG22 . THR A 1 26 ? 0.088   -12.022 8.766   1.00 1.00 ? 26  THR A HG22 8  
ATOM   9790  H HG23 . THR A 1 26 ? 1.673   -12.128 9.533   1.00 1.00 ? 26  THR A HG23 8  
ATOM   9791  N N    . ALA A 1 27 ? -0.685  -8.436  7.220   1.00 1.00 ? 27  ALA A N    8  
ATOM   9792  C CA   . ALA A 1 27 ? -1.190  -7.075  7.155   1.00 1.00 ? 27  ALA A CA   8  
ATOM   9793  C C    . ALA A 1 27 ? -0.369  -6.146  8.051   1.00 1.00 ? 27  ALA A C    8  
ATOM   9794  O O    . ALA A 1 27 ? 0.198   -5.159  7.597   1.00 1.00 ? 27  ALA A O    8  
ATOM   9795  C CB   . ALA A 1 27 ? -2.659  -7.046  7.605   1.00 1.00 ? 27  ALA A CB   8  
ATOM   9796  H H    . ALA A 1 27 ? -1.197  -9.119  7.704   1.00 1.00 ? 27  ALA A H    8  
ATOM   9797  H HA   . ALA A 1 27 ? -1.129  -6.731  6.136   1.00 1.00 ? 27  ALA A HA   8  
ATOM   9798  H HB1  . ALA A 1 27 ? -2.713  -6.967  8.682   1.00 1.00 ? 27  ALA A HB1  8  
ATOM   9799  H HB2  . ALA A 1 27 ? -3.146  -7.955  7.298   1.00 1.00 ? 27  ALA A HB2  8  
ATOM   9800  H HB3  . ALA A 1 27 ? -3.157  -6.196  7.155   1.00 1.00 ? 27  ALA A HB3  8  
ATOM   9801  N N    . ASP A 1 28 ? -0.304  -6.476  9.329   1.00 1.00 ? 28  ASP A N    8  
ATOM   9802  C CA   . ASP A 1 28 ? 0.440   -5.659  10.279  1.00 1.00 ? 28  ASP A CA   8  
ATOM   9803  C C    . ASP A 1 28 ? 1.942   -5.805  10.055  1.00 1.00 ? 28  ASP A C    8  
ATOM   9804  O O    . ASP A 1 28 ? 2.744   -5.502  10.938  1.00 1.00 ? 28  ASP A O    8  
ATOM   9805  C CB   . ASP A 1 28 ? 0.092   -6.071  11.712  1.00 1.00 ? 28  ASP A CB   8  
ATOM   9806  C CG   . ASP A 1 28 ? -1.349  -5.693  12.028  1.00 1.00 ? 28  ASP A CG   8  
ATOM   9807  O OD1  . ASP A 1 28 ? -1.669  -4.519  11.927  1.00 1.00 ? 28  ASP A OD1  8  
ATOM   9808  O OD2  . ASP A 1 28 ? -2.113  -6.580  12.373  1.00 1.00 ? 28  ASP A OD2  8  
ATOM   9809  H H    . ASP A 1 28 ? -0.766  -7.283  9.641   1.00 1.00 ? 28  ASP A H    8  
ATOM   9810  H HA   . ASP A 1 28 ? 0.160   -4.622  10.133  1.00 1.00 ? 28  ASP A HA   8  
ATOM   9811  H HB2  . ASP A 1 28 ? 0.215   -7.140  11.818  1.00 1.00 ? 28  ASP A HB2  8  
ATOM   9812  H HB3  . ASP A 1 28 ? 0.753   -5.566  12.403  1.00 1.00 ? 28  ASP A HB3  8  
ATOM   9813  N N    . SER A 1 29 ? 2.312   -6.295  8.875   1.00 1.00 ? 29  SER A N    8  
ATOM   9814  C CA   . SER A 1 29 ? 3.713   -6.493  8.552   1.00 1.00 ? 29  SER A CA   8  
ATOM   9815  C C    . SER A 1 29 ? 4.407   -5.163  8.287   1.00 1.00 ? 29  SER A C    8  
ATOM   9816  O O    . SER A 1 29 ? 5.634   -5.099  8.206   1.00 1.00 ? 29  SER A O    8  
ATOM   9817  C CB   . SER A 1 29 ? 3.847   -7.390  7.322   1.00 1.00 ? 29  SER A CB   8  
ATOM   9818  O OG   . SER A 1 29 ? 3.709   -6.600  6.148   1.00 1.00 ? 29  SER A OG   8  
ATOM   9819  H H    . SER A 1 29 ? 1.629   -6.537  8.219   1.00 1.00 ? 29  SER A H    8  
ATOM   9820  H HA   . SER A 1 29 ? 4.180   -6.967  9.391   1.00 1.00 ? 29  SER A HA   8  
ATOM   9821  H HB2  . SER A 1 29 ? 4.810   -7.870  7.313   1.00 1.00 ? 29  SER A HB2  8  
ATOM   9822  H HB3  . SER A 1 29 ? 3.076   -8.140  7.347   1.00 1.00 ? 29  SER A HB3  8  
ATOM   9823  H HG   . SER A 1 29 ? 4.560   -6.577  5.705   1.00 1.00 ? 29  SER A HG   8  
ATOM   9824  N N    . GLU A 1 30 ? 3.614   -4.110  8.143   1.00 1.00 ? 30  GLU A N    8  
ATOM   9825  C CA   . GLU A 1 30 ? 4.158   -2.784  7.885   1.00 1.00 ? 30  GLU A CA   8  
ATOM   9826  C C    . GLU A 1 30 ? 4.946   -2.779  6.581   1.00 1.00 ? 30  GLU A C    8  
ATOM   9827  O O    . GLU A 1 30 ? 6.013   -3.387  6.487   1.00 1.00 ? 30  GLU A O    8  
ATOM   9828  C CB   . GLU A 1 30 ? 5.068   -2.358  9.036   1.00 1.00 ? 30  GLU A CB   8  
ATOM   9829  C CG   . GLU A 1 30 ? 4.350   -2.575  10.367  1.00 1.00 ? 30  GLU A CG   8  
ATOM   9830  C CD   . GLU A 1 30 ? 5.266   -2.200  11.524  1.00 1.00 ? 30  GLU A CD   8  
ATOM   9831  O OE1  . GLU A 1 30 ? 6.381   -1.785  11.258  1.00 1.00 ? 30  GLU A OE1  8  
ATOM   9832  O OE2  . GLU A 1 30 ? 4.839   -2.336  12.658  1.00 1.00 ? 30  GLU A OE2  8  
ATOM   9833  H H    . GLU A 1 30 ? 2.643   -4.228  8.217   1.00 1.00 ? 30  GLU A H    8  
ATOM   9834  H HA   . GLU A 1 30 ? 3.351   -2.078  7.805   1.00 1.00 ? 30  GLU A HA   8  
ATOM   9835  H HB2  . GLU A 1 30 ? 5.979   -2.936  9.015   1.00 1.00 ? 30  GLU A HB2  8  
ATOM   9836  H HB3  . GLU A 1 30 ? 5.301   -1.315  8.933   1.00 1.00 ? 30  GLU A HB3  8  
ATOM   9837  H HG2  . GLU A 1 30 ? 3.466   -1.961  10.400  1.00 1.00 ? 30  GLU A HG2  8  
ATOM   9838  H HG3  . GLU A 1 30 ? 4.069   -3.610  10.457  1.00 1.00 ? 30  GLU A HG3  8  
ATOM   9839  N N    . PHE A 1 31 ? 4.409   -2.100  5.572   1.00 1.00 ? 31  PHE A N    8  
ATOM   9840  C CA   . PHE A 1 31 ? 5.069   -2.034  4.271   1.00 1.00 ? 31  PHE A CA   8  
ATOM   9841  C C    . PHE A 1 31 ? 6.481   -1.480  4.411   1.00 1.00 ? 31  PHE A C    8  
ATOM   9842  O O    . PHE A 1 31 ? 7.039   -1.441  5.507   1.00 1.00 ? 31  PHE A O    8  
ATOM   9843  C CB   . PHE A 1 31 ? 4.259   -1.156  3.318   1.00 1.00 ? 31  PHE A CB   8  
ATOM   9844  C CG   . PHE A 1 31 ? 4.138   0.234   3.898   1.00 1.00 ? 31  PHE A CG   8  
ATOM   9845  C CD1  . PHE A 1 31 ? 3.081   0.545   4.766   1.00 1.00 ? 31  PHE A CD1  8  
ATOM   9846  C CD2  . PHE A 1 31 ? 5.079   1.213   3.567   1.00 1.00 ? 31  PHE A CD2  8  
ATOM   9847  C CE1  . PHE A 1 31 ? 2.974   1.826   5.301   1.00 1.00 ? 31  PHE A CE1  8  
ATOM   9848  C CE2  . PHE A 1 31 ? 4.971   2.499   4.108   1.00 1.00 ? 31  PHE A CE2  8  
ATOM   9849  C CZ   . PHE A 1 31 ? 3.915   2.808   4.971   1.00 1.00 ? 31  PHE A CZ   8  
ATOM   9850  H H    . PHE A 1 31 ? 3.553   -1.643  5.699   1.00 1.00 ? 31  PHE A H    8  
ATOM   9851  H HA   . PHE A 1 31 ? 5.126   -3.026  3.859   1.00 1.00 ? 31  PHE A HA   8  
ATOM   9852  H HB2  . PHE A 1 31 ? 4.760   -1.105  2.362   1.00 1.00 ? 31  PHE A HB2  8  
ATOM   9853  H HB3  . PHE A 1 31 ? 3.274   -1.578  3.188   1.00 1.00 ? 31  PHE A HB3  8  
ATOM   9854  H HD1  . PHE A 1 31 ? 2.350   -0.205  5.030   1.00 1.00 ? 31  PHE A HD1  8  
ATOM   9855  H HD2  . PHE A 1 31 ? 5.888   0.979   2.895   1.00 1.00 ? 31  PHE A HD2  8  
ATOM   9856  H HE1  . PHE A 1 31 ? 2.159   2.058   5.959   1.00 1.00 ? 31  PHE A HE1  8  
ATOM   9857  H HE2  . PHE A 1 31 ? 5.698   3.254   3.851   1.00 1.00 ? 31  PHE A HE2  8  
ATOM   9858  H HZ   . PHE A 1 31 ? 3.830   3.801   5.390   1.00 1.00 ? 31  PHE A HZ   8  
ATOM   9859  N N    . SER A 1 32 ? 7.062   -1.066  3.288   1.00 1.00 ? 32  SER A N    8  
ATOM   9860  C CA   . SER A 1 32 ? 8.417   -0.532  3.294   1.00 1.00 ? 32  SER A CA   8  
ATOM   9861  C C    . SER A 1 32 ? 8.528   0.650   4.247   1.00 1.00 ? 32  SER A C    8  
ATOM   9862  O O    . SER A 1 32 ? 7.735   1.589   4.188   1.00 1.00 ? 32  SER A O    8  
ATOM   9863  C CB   . SER A 1 32 ? 8.808   -0.086  1.885   1.00 1.00 ? 32  SER A CB   8  
ATOM   9864  O OG   . SER A 1 32 ? 10.161  0.351   1.888   1.00 1.00 ? 32  SER A OG   8  
ATOM   9865  H H    . SER A 1 32 ? 6.575   -1.135  2.440   1.00 1.00 ? 32  SER A H    8  
ATOM   9866  H HA   . SER A 1 32 ? 9.096   -1.304  3.618   1.00 1.00 ? 32  SER A HA   8  
ATOM   9867  H HB2  . SER A 1 32 ? 8.703   -0.907  1.202   1.00 1.00 ? 32  SER A HB2  8  
ATOM   9868  H HB3  . SER A 1 32 ? 8.158   0.723   1.573   1.00 1.00 ? 32  SER A HB3  8  
ATOM   9869  H HG   . SER A 1 32 ? 10.166  1.306   1.800   1.00 1.00 ? 32  SER A HG   8  
ATOM   9870  N N    . LYS A 1 33 ? 9.520   0.603   5.128   1.00 1.00 ? 33  LYS A N    8  
ATOM   9871  C CA   . LYS A 1 33 ? 9.733   1.678   6.093   1.00 1.00 ? 33  LYS A CA   8  
ATOM   9872  C C    . LYS A 1 33 ? 11.215  1.840   6.396   1.00 1.00 ? 33  LYS A C    8  
ATOM   9873  O O    . LYS A 1 33 ? 11.995  0.897   6.255   1.00 1.00 ? 33  LYS A O    8  
ATOM   9874  C CB   . LYS A 1 33 ? 8.973   1.386   7.388   1.00 1.00 ? 33  LYS A CB   8  
ATOM   9875  C CG   . LYS A 1 33 ? 7.469   1.498   7.135   1.00 1.00 ? 33  LYS A CG   8  
ATOM   9876  C CD   . LYS A 1 33 ? 6.717   1.303   8.450   1.00 1.00 ? 33  LYS A CD   8  
ATOM   9877  C CE   . LYS A 1 33 ? 5.210   1.408   8.195   1.00 1.00 ? 33  LYS A CE   8  
ATOM   9878  N NZ   . LYS A 1 33 ? 4.791   0.330   7.256   1.00 1.00 ? 33  LYS A NZ   8  
ATOM   9879  H H    . LYS A 1 33 ? 10.127  -0.170  5.128   1.00 1.00 ? 33  LYS A H    8  
ATOM   9880  H HA   . LYS A 1 33 ? 9.364   2.606   5.679   1.00 1.00 ? 33  LYS A HA   8  
ATOM   9881  H HB2  . LYS A 1 33 ? 9.210   0.388   7.722   1.00 1.00 ? 33  LYS A HB2  8  
ATOM   9882  H HB3  . LYS A 1 33 ? 9.265   2.101   8.145   1.00 1.00 ? 33  LYS A HB3  8  
ATOM   9883  H HG2  . LYS A 1 33 ? 7.244   2.473   6.730   1.00 1.00 ? 33  LYS A HG2  8  
ATOM   9884  H HG3  . LYS A 1 33 ? 7.162   0.737   6.436   1.00 1.00 ? 33  LYS A HG3  8  
ATOM   9885  H HD2  . LYS A 1 33 ? 6.950   0.329   8.856   1.00 1.00 ? 33  LYS A HD2  8  
ATOM   9886  H HD3  . LYS A 1 33 ? 7.013   2.065   9.150   1.00 1.00 ? 33  LYS A HD3  8  
ATOM   9887  H HE2  . LYS A 1 33 ? 4.679   1.299   9.129   1.00 1.00 ? 33  LYS A HE2  8  
ATOM   9888  H HE3  . LYS A 1 33 ? 4.985   2.373   7.763   1.00 1.00 ? 33  LYS A HE3  8  
ATOM   9889  H HZ1  . LYS A 1 33 ? 5.627   -0.190  6.928   1.00 1.00 ? 33  LYS A HZ1  8  
ATOM   9890  H HZ2  . LYS A 1 33 ? 4.304   0.752   6.441   1.00 1.00 ? 33  LYS A HZ2  8  
ATOM   9891  H HZ3  . LYS A 1 33 ? 4.148   -0.325  7.744   1.00 1.00 ? 33  LYS A HZ3  8  
ATOM   9892  N N    . LEU A 1 34 ? 11.603  3.040   6.818   1.00 1.00 ? 34  LEU A N    8  
ATOM   9893  C CA   . LEU A 1 34 ? 13.000  3.314   7.140   1.00 1.00 ? 34  LEU A CA   8  
ATOM   9894  C C    . LEU A 1 34 ? 13.932  2.662   6.123   1.00 1.00 ? 34  LEU A C    8  
ATOM   9895  O O    . LEU A 1 34 ? 13.720  2.774   4.916   1.00 1.00 ? 34  LEU A O    8  
ATOM   9896  C CB   . LEU A 1 34 ? 13.319  2.784   8.541   1.00 1.00 ? 34  LEU A CB   8  
ATOM   9897  C CG   . LEU A 1 34 ? 12.324  3.365   9.551   1.00 1.00 ? 34  LEU A CG   8  
ATOM   9898  C CD1  . LEU A 1 34 ? 12.621  2.802   10.942  1.00 1.00 ? 34  LEU A CD1  8  
ATOM   9899  C CD2  . LEU A 1 34 ? 12.454  4.898   9.578   1.00 1.00 ? 34  LEU A CD2  8  
ATOM   9900  H H    . LEU A 1 34 ? 10.937  3.755   6.914   1.00 1.00 ? 34  LEU A H    8  
ATOM   9901  H HA   . LEU A 1 34 ? 13.166  4.380   7.124   1.00 1.00 ? 34  LEU A HA   8  
ATOM   9902  H HB2  . LEU A 1 34 ? 13.246  1.706   8.543   1.00 1.00 ? 34  LEU A HB2  8  
ATOM   9903  H HB3  . LEU A 1 34 ? 14.319  3.076   8.819   1.00 1.00 ? 34  LEU A HB3  8  
ATOM   9904  H HG   . LEU A 1 34 ? 11.319  3.093   9.259   1.00 1.00 ? 34  LEU A HG   8  
ATOM   9905  H HD11 . LEU A 1 34 ? 11.816  3.062   11.613  1.00 1.00 ? 34  LEU A HD11 8  
ATOM   9906  H HD12 . LEU A 1 34 ? 13.546  3.222   11.310  1.00 1.00 ? 34  LEU A HD12 8  
ATOM   9907  H HD13 . LEU A 1 34 ? 12.710  1.727   10.886  1.00 1.00 ? 34  LEU A HD13 8  
ATOM   9908  H HD21 . LEU A 1 34 ? 13.488  5.182   9.434   1.00 1.00 ? 34  LEU A HD21 8  
ATOM   9909  H HD22 . LEU A 1 34 ? 12.111  5.278   10.528  1.00 1.00 ? 34  LEU A HD22 8  
ATOM   9910  H HD23 . LEU A 1 34 ? 11.852  5.320   8.790   1.00 1.00 ? 34  LEU A HD23 8  
ATOM   9911  N N    . GLY A 1 35 ? 14.954  1.975   6.618   1.00 1.00 ? 35  GLY A N    8  
ATOM   9912  C CA   . GLY A 1 35 ? 15.906  1.305   5.744   1.00 1.00 ? 35  GLY A CA   8  
ATOM   9913  C C    . GLY A 1 35 ? 16.623  2.311   4.852   1.00 1.00 ? 35  GLY A C    8  
ATOM   9914  O O    . GLY A 1 35 ? 17.047  3.370   5.312   1.00 1.00 ? 35  GLY A O    8  
ATOM   9915  H H    . GLY A 1 35 ? 15.068  1.916   7.591   1.00 1.00 ? 35  GLY A H    8  
ATOM   9916  H HA2  . GLY A 1 35 ? 16.630  0.780   6.348   1.00 1.00 ? 35  GLY A HA2  8  
ATOM   9917  H HA3  . GLY A 1 35 ? 15.378  0.597   5.123   1.00 1.00 ? 35  GLY A HA3  8  
ATOM   9918  N N    . ALA A 1 36 ? 16.757  1.970   3.574   1.00 1.00 ? 36  ALA A N    8  
ATOM   9919  C CA   . ALA A 1 36 ? 17.429  2.851   2.626   1.00 1.00 ? 36  ALA A CA   8  
ATOM   9920  C C    . ALA A 1 36 ? 16.644  4.145   2.450   1.00 1.00 ? 36  ALA A C    8  
ATOM   9921  O O    . ALA A 1 36 ? 15.413  4.144   2.464   1.00 1.00 ? 36  ALA A O    8  
ATOM   9922  C CB   . ALA A 1 36 ? 17.571  2.151   1.273   1.00 1.00 ? 36  ALA A CB   8  
ATOM   9923  H H    . ALA A 1 36 ? 16.400  1.111   3.265   1.00 1.00 ? 36  ALA A H    8  
ATOM   9924  H HA   . ALA A 1 36 ? 18.414  3.086   3.001   1.00 1.00 ? 36  ALA A HA   8  
ATOM   9925  H HB1  . ALA A 1 36 ? 16.594  2.018   0.833   1.00 1.00 ? 36  ALA A HB1  8  
ATOM   9926  H HB2  . ALA A 1 36 ? 18.038  1.186   1.415   1.00 1.00 ? 36  ALA A HB2  8  
ATOM   9927  H HB3  . ALA A 1 36 ? 18.182  2.753   0.619   1.00 1.00 ? 36  ALA A HB3  8  
ATOM   9928  N N    . ASP A 1 37 ? 17.364  5.251   2.284   1.00 1.00 ? 37  ASP A N    8  
ATOM   9929  C CA   . ASP A 1 37 ? 16.722  6.549   2.107   1.00 1.00 ? 37  ASP A CA   8  
ATOM   9930  C C    . ASP A 1 37 ? 16.298  6.744   0.655   1.00 1.00 ? 37  ASP A C    8  
ATOM   9931  O O    . ASP A 1 37 ? 17.136  6.945   -0.225  1.00 1.00 ? 37  ASP A O    8  
ATOM   9932  C CB   . ASP A 1 37 ? 17.687  7.665   2.512   1.00 1.00 ? 37  ASP A CB   8  
ATOM   9933  C CG   . ASP A 1 37 ? 18.981  7.553   1.712   1.00 1.00 ? 37  ASP A CG   8  
ATOM   9934  O OD1  . ASP A 1 37 ? 19.127  6.578   0.995   1.00 1.00 ? 37  ASP A OD1  8  
ATOM   9935  O OD2  . ASP A 1 37 ? 19.811  8.439   1.836   1.00 1.00 ? 37  ASP A OD2  8  
ATOM   9936  H H    . ASP A 1 37 ? 18.342  5.193   2.283   1.00 1.00 ? 37  ASP A H    8  
ATOM   9937  H HA   . ASP A 1 37 ? 15.847  6.601   2.739   1.00 1.00 ? 37  ASP A HA   8  
ATOM   9938  H HB2  . ASP A 1 37 ? 17.227  8.624   2.317   1.00 1.00 ? 37  ASP A HB2  8  
ATOM   9939  H HB3  . ASP A 1 37 ? 17.910  7.584   3.566   1.00 1.00 ? 37  ASP A HB3  8  
ATOM   9940  N N    . SER A 1 38 ? 14.994  6.685   0.414   1.00 1.00 ? 38  SER A N    8  
ATOM   9941  C CA   . SER A 1 38 ? 14.470  6.860   -0.935  1.00 1.00 ? 38  SER A CA   8  
ATOM   9942  C C    . SER A 1 38 ? 12.981  7.169   -0.893  1.00 1.00 ? 38  SER A C    8  
ATOM   9943  O O    . SER A 1 38 ? 12.297  6.853   0.079   1.00 1.00 ? 38  SER A O    8  
ATOM   9944  C CB   . SER A 1 38 ? 14.705  5.591   -1.755  1.00 1.00 ? 38  SER A CB   8  
ATOM   9945  H H    . SER A 1 38 ? 14.372  6.526   1.155   1.00 1.00 ? 38  SER A H    8  
ATOM   9946  H HA   . SER A 1 38 ? 14.983  7.681   -1.409  1.00 1.00 ? 38  SER A HA   8  
ATOM   9947  H HB2  . SER A 1 38 ? 14.012  4.825   -1.435  1.00 1.00 ? 38  SER A HB2  8  
ATOM   9948  H HB3  . SER A 1 38 ? 15.712  5.246   -1.605  1.00 1.00 ? 38  SER A HB3  8  
ATOM   9949  N N    . LEU A 1 39 ? 12.479  7.787   -1.959  1.00 1.00 ? 39  LEU A N    8  
ATOM   9950  C CA   . LEU A 1 39 ? 11.066  8.132   -2.030  1.00 1.00 ? 39  LEU A CA   8  
ATOM   9951  C C    . LEU A 1 39 ? 10.292  7.057   -2.783  1.00 1.00 ? 39  LEU A C    8  
ATOM   9952  O O    . LEU A 1 39 ? 10.056  7.177   -3.985  1.00 1.00 ? 39  LEU A O    8  
ATOM   9953  C CB   . LEU A 1 39 ? 10.891  9.478   -2.742  1.00 1.00 ? 39  LEU A CB   8  
ATOM   9954  C CG   . LEU A 1 39 ? 9.404   9.864   -2.769  1.00 1.00 ? 39  LEU A CG   8  
ATOM   9955  C CD1  . LEU A 1 39 ? 8.878   10.011  -1.330  1.00 1.00 ? 39  LEU A CD1  8  
ATOM   9956  C CD2  . LEU A 1 39 ? 9.235   11.187  -3.515  1.00 1.00 ? 39  LEU A CD2  8  
ATOM   9957  H H    . LEU A 1 39 ? 13.066  8.015   -2.706  1.00 1.00 ? 39  LEU A H    8  
ATOM   9958  H HA   . LEU A 1 39 ? 10.674  8.210   -1.030  1.00 1.00 ? 39  LEU A HA   8  
ATOM   9959  H HB2  . LEU A 1 39 ? 11.448  10.238  -2.213  1.00 1.00 ? 39  LEU A HB2  8  
ATOM   9960  H HB3  . LEU A 1 39 ? 11.260  9.405   -3.755  1.00 1.00 ? 39  LEU A HB3  8  
ATOM   9961  H HG   . LEU A 1 39 ? 8.838   9.097   -3.279  1.00 1.00 ? 39  LEU A HG   8  
ATOM   9962  H HD11 . LEU A 1 39 ? 9.666   10.380  -0.687  1.00 1.00 ? 39  LEU A HD11 8  
ATOM   9963  H HD12 . LEU A 1 39 ? 8.542   9.050   -0.974  1.00 1.00 ? 39  LEU A HD12 8  
ATOM   9964  H HD13 . LEU A 1 39 ? 8.048   10.699  -1.310  1.00 1.00 ? 39  LEU A HD13 8  
ATOM   9965  H HD21 . LEU A 1 39 ? 9.491   11.052  -4.555  1.00 1.00 ? 39  LEU A HD21 8  
ATOM   9966  H HD22 . LEU A 1 39 ? 9.882   11.931  -3.077  1.00 1.00 ? 39  LEU A HD22 8  
ATOM   9967  H HD23 . LEU A 1 39 ? 8.207   11.510  -3.435  1.00 1.00 ? 39  LEU A HD23 8  
ATOM   9968  N N    . ASP A 1 40 ? 9.883   6.016   -2.068  1.00 1.00 ? 40  ASP A N    8  
ATOM   9969  C CA   . ASP A 1 40 ? 9.125   4.926   -2.679  1.00 1.00 ? 40  ASP A CA   8  
ATOM   9970  C C    . ASP A 1 40 ? 7.627   5.171   -2.540  1.00 1.00 ? 40  ASP A C    8  
ATOM   9971  O O    . ASP A 1 40 ? 6.812   4.385   -3.023  1.00 1.00 ? 40  ASP A O    8  
ATOM   9972  C CB   . ASP A 1 40 ? 9.491   3.601   -2.013  1.00 1.00 ? 40  ASP A CB   8  
ATOM   9973  C CG   . ASP A 1 40 ? 9.287   3.701   -0.506  1.00 1.00 ? 40  ASP A CG   8  
ATOM   9974  O OD1  . ASP A 1 40 ? 9.004   4.792   -0.037  1.00 1.00 ? 40  ASP A OD1  8  
ATOM   9975  O OD2  . ASP A 1 40 ? 9.419   2.687   0.159   1.00 1.00 ? 40  ASP A OD2  8  
ATOM   9976  H H    . ASP A 1 40 ? 10.090  5.980   -1.111  1.00 1.00 ? 40  ASP A H    8  
ATOM   9977  H HA   . ASP A 1 40 ? 9.371   4.863   -3.732  1.00 1.00 ? 40  ASP A HA   8  
ATOM   9978  H HB2  . ASP A 1 40 ? 8.864   2.817   -2.410  1.00 1.00 ? 40  ASP A HB2  8  
ATOM   9979  H HB3  . ASP A 1 40 ? 10.526  3.371   -2.219  1.00 1.00 ? 40  ASP A HB3  8  
ATOM   9980  N N    . THR A 1 41 ? 7.270   6.269   -1.884  1.00 1.00 ? 41  THR A N    8  
ATOM   9981  C CA   . THR A 1 41 ? 5.867   6.610   -1.694  1.00 1.00 ? 41  THR A CA   8  
ATOM   9982  C C    . THR A 1 41 ? 5.182   6.843   -3.032  1.00 1.00 ? 41  THR A C    8  
ATOM   9983  O O    . THR A 1 41 ? 4.057   6.405   -3.242  1.00 1.00 ? 41  THR A O    8  
ATOM   9984  C CB   . THR A 1 41 ? 5.741   7.866   -0.828  1.00 1.00 ? 41  THR A CB   8  
ATOM   9985  O OG1  . THR A 1 41 ? 6.507   7.701   0.358   1.00 1.00 ? 41  THR A OG1  8  
ATOM   9986  C CG2  . THR A 1 41 ? 4.271   8.104   -0.465  1.00 1.00 ? 41  THR A CG2  8  
ATOM   9987  H H    . THR A 1 41 ? 7.960   6.862   -1.527  1.00 1.00 ? 41  THR A H    8  
ATOM   9988  H HA   . THR A 1 41 ? 5.379   5.789   -1.192  1.00 1.00 ? 41  THR A HA   8  
ATOM   9989  H HB   . THR A 1 41 ? 6.111   8.719   -1.378  1.00 1.00 ? 41  THR A HB   8  
ATOM   9990  H HG1  . THR A 1 41 ? 7.409   7.970   0.170   1.00 1.00 ? 41  THR A HG1  8  
ATOM   9991  H HG21 . THR A 1 41 ? 3.760   8.540   -1.309  1.00 1.00 ? 41  THR A HG21 8  
ATOM   9992  H HG22 . THR A 1 41 ? 4.216   8.778   0.377   1.00 1.00 ? 41  THR A HG22 8  
ATOM   9993  H HG23 . THR A 1 41 ? 3.799   7.170   -0.206  1.00 1.00 ? 41  THR A HG23 8  
ATOM   9994  N N    . VAL A 1 42 ? 5.868   7.546   -3.928  1.00 1.00 ? 42  VAL A N    8  
ATOM   9995  C CA   . VAL A 1 42 ? 5.319   7.842   -5.245  1.00 1.00 ? 42  VAL A CA   8  
ATOM   9996  C C    . VAL A 1 42 ? 5.121   6.558   -6.045  1.00 1.00 ? 42  VAL A C    8  
ATOM   9997  O O    . VAL A 1 42 ? 4.134   6.389   -6.746  1.00 1.00 ? 42  VAL A O    8  
ATOM   9998  C CB   . VAL A 1 42 ? 6.256   8.779   -6.007  1.00 1.00 ? 42  VAL A CB   8  
ATOM   9999  C CG1  . VAL A 1 42 ? 5.708   9.016   -7.417  1.00 1.00 ? 42  VAL A CG1  8  
ATOM   10000 C CG2  . VAL A 1 42 ? 6.355   10.114  -5.267  1.00 1.00 ? 42  VAL A CG2  8  
ATOM   10001 H H    . VAL A 1 42 ? 6.760   7.875   -3.695  1.00 1.00 ? 42  VAL A H    8  
ATOM   10002 H HA   . VAL A 1 42 ? 4.366   8.330   -5.123  1.00 1.00 ? 42  VAL A HA   8  
ATOM   10003 H HB   . VAL A 1 42 ? 7.237   8.330   -6.075  1.00 1.00 ? 42  VAL A HB   8  
ATOM   10004 H HG11 . VAL A 1 42 ? 4.656   9.253   -7.358  1.00 1.00 ? 42  VAL A HG11 8  
ATOM   10005 H HG12 . VAL A 1 42 ? 5.844   8.125   -8.010  1.00 1.00 ? 42  VAL A HG12 8  
ATOM   10006 H HG13 . VAL A 1 42 ? 6.237   9.839   -7.875  1.00 1.00 ? 42  VAL A HG13 8  
ATOM   10007 H HG21 . VAL A 1 42 ? 7.086   10.743  -5.755  1.00 1.00 ? 42  VAL A HG21 8  
ATOM   10008 H HG22 . VAL A 1 42 ? 6.655   9.939   -4.246  1.00 1.00 ? 42  VAL A HG22 8  
ATOM   10009 H HG23 . VAL A 1 42 ? 5.392   10.606  -5.280  1.00 1.00 ? 42  VAL A HG23 8  
ATOM   10010 N N    . GLU A 1 43 ? 6.083   5.656   -5.951  1.00 1.00 ? 43  GLU A N    8  
ATOM   10011 C CA   . GLU A 1 43 ? 6.002   4.395   -6.678  1.00 1.00 ? 43  GLU A CA   8  
ATOM   10012 C C    . GLU A 1 43 ? 4.961   3.477   -6.044  1.00 1.00 ? 43  GLU A C    8  
ATOM   10013 O O    . GLU A 1 43 ? 4.204   2.800   -6.741  1.00 1.00 ? 43  GLU A O    8  
ATOM   10014 C CB   . GLU A 1 43 ? 7.364   3.703   -6.670  1.00 1.00 ? 43  GLU A CB   8  
ATOM   10015 C CG   . GLU A 1 43 ? 8.358   4.528   -7.488  1.00 1.00 ? 43  GLU A CG   8  
ATOM   10016 C CD   . GLU A 1 43 ? 9.748   3.904   -7.405  1.00 1.00 ? 43  GLU A CD   8  
ATOM   10017 O OE1  . GLU A 1 43 ? 9.887   2.901   -6.724  1.00 1.00 ? 43  GLU A OE1  8  
ATOM   10018 O OE2  . GLU A 1 43 ? 10.654  4.440   -8.023  1.00 1.00 ? 43  GLU A OE2  8  
ATOM   10019 H H    . GLU A 1 43 ? 6.866   5.844   -5.399  1.00 1.00 ? 43  GLU A H    8  
ATOM   10020 H HA   . GLU A 1 43 ? 5.713   4.593   -7.696  1.00 1.00 ? 43  GLU A HA   8  
ATOM   10021 H HB2  . GLU A 1 43 ? 7.721   3.610   -5.654  1.00 1.00 ? 43  GLU A HB2  8  
ATOM   10022 H HB3  . GLU A 1 43 ? 7.270   2.723   -7.111  1.00 1.00 ? 43  GLU A HB3  8  
ATOM   10023 H HG2  . GLU A 1 43 ? 8.038   4.553   -8.520  1.00 1.00 ? 43  GLU A HG2  8  
ATOM   10024 H HG3  . GLU A 1 43 ? 8.395   5.533   -7.098  1.00 1.00 ? 43  GLU A HG3  8  
ATOM   10025 N N    . ILE A 1 44 ? 4.951   3.432   -4.717  1.00 1.00 ? 44  ILE A N    8  
ATOM   10026 C CA   . ILE A 1 44 ? 4.019   2.569   -4.009  1.00 1.00 ? 44  ILE A CA   8  
ATOM   10027 C C    . ILE A 1 44 ? 2.578   3.004   -4.219  1.00 1.00 ? 44  ILE A C    8  
ATOM   10028 O O    . ILE A 1 44 ? 1.710   2.184   -4.520  1.00 1.00 ? 44  ILE A O    8  
ATOM   10029 C CB   . ILE A 1 44 ? 4.339   2.585   -2.505  1.00 1.00 ? 44  ILE A CB   8  
ATOM   10030 C CG1  . ILE A 1 44 ? 5.689   1.886   -2.251  1.00 1.00 ? 44  ILE A CG1  8  
ATOM   10031 C CG2  . ILE A 1 44 ? 3.231   1.854   -1.728  1.00 1.00 ? 44  ILE A CG2  8  
ATOM   10032 C CD1  . ILE A 1 44 ? 5.483   0.373   -2.104  1.00 1.00 ? 44  ILE A CD1  8  
ATOM   10033 H H    . ILE A 1 44 ? 5.594   3.968   -4.207  1.00 1.00 ? 44  ILE A H    8  
ATOM   10034 H HA   . ILE A 1 44 ? 4.135   1.569   -4.381  1.00 1.00 ? 44  ILE A HA   8  
ATOM   10035 H HB   . ILE A 1 44 ? 4.393   3.614   -2.162  1.00 1.00 ? 44  ILE A HB   8  
ATOM   10036 H HG12 . ILE A 1 44 ? 6.365   2.075   -3.074  1.00 1.00 ? 44  ILE A HG12 8  
ATOM   10037 H HG13 . ILE A 1 44 ? 6.130   2.270   -1.342  1.00 1.00 ? 44  ILE A HG13 8  
ATOM   10038 H HG21 . ILE A 1 44 ? 2.367   2.491   -1.636  1.00 1.00 ? 44  ILE A HG21 8  
ATOM   10039 H HG22 . ILE A 1 44 ? 3.593   1.595   -0.738  1.00 1.00 ? 44  ILE A HG22 8  
ATOM   10040 H HG23 . ILE A 1 44 ? 2.960   0.952   -2.259  1.00 1.00 ? 44  ILE A HG23 8  
ATOM   10041 H HD11 . ILE A 1 44 ? 4.778   0.028   -2.840  1.00 1.00 ? 44  ILE A HD11 8  
ATOM   10042 H HD12 . ILE A 1 44 ? 5.104   0.158   -1.119  1.00 1.00 ? 44  ILE A HD12 8  
ATOM   10043 H HD13 . ILE A 1 44 ? 6.417   -0.131  -2.244  1.00 1.00 ? 44  ILE A HD13 8  
ATOM   10044 N N    . VAL A 1 45 ? 2.326   4.290   -4.030  1.00 1.00 ? 45  VAL A N    8  
ATOM   10045 C CA   . VAL A 1 45 ? 0.977   4.819   -4.169  1.00 1.00 ? 45  VAL A CA   8  
ATOM   10046 C C    . VAL A 1 45 ? 0.455   4.597   -5.581  1.00 1.00 ? 45  VAL A C    8  
ATOM   10047 O O    . VAL A 1 45 ? -0.691  4.189   -5.768  1.00 1.00 ? 45  VAL A O    8  
ATOM   10048 C CB   . VAL A 1 45 ? 0.971   6.317   -3.853  1.00 1.00 ? 45  VAL A CB   8  
ATOM   10049 C CG1  . VAL A 1 45 ? 1.825   7.061   -4.878  1.00 1.00 ? 45  VAL A CG1  8  
ATOM   10050 C CG2  . VAL A 1 45 ? -0.463  6.844   -3.913  1.00 1.00 ? 45  VAL A CG2  8  
ATOM   10051 H H    . VAL A 1 45 ? 3.058   4.888   -3.759  1.00 1.00 ? 45  VAL A H    8  
ATOM   10052 H HA   . VAL A 1 45 ? 0.334   4.311   -3.474  1.00 1.00 ? 45  VAL A HA   8  
ATOM   10053 H HB   . VAL A 1 45 ? 1.378   6.476   -2.863  1.00 1.00 ? 45  VAL A HB   8  
ATOM   10054 H HG11 . VAL A 1 45 ? 2.126   8.017   -4.474  1.00 1.00 ? 45  VAL A HG11 8  
ATOM   10055 H HG12 . VAL A 1 45 ? 1.266   7.209   -5.790  1.00 1.00 ? 45  VAL A HG12 8  
ATOM   10056 H HG13 . VAL A 1 45 ? 2.691   6.480   -5.088  1.00 1.00 ? 45  VAL A HG13 8  
ATOM   10057 H HG21 . VAL A 1 45 ? -0.766  6.958   -4.946  1.00 1.00 ? 45  VAL A HG21 8  
ATOM   10058 H HG22 . VAL A 1 45 ? -0.515  7.802   -3.411  1.00 1.00 ? 45  VAL A HG22 8  
ATOM   10059 H HG23 . VAL A 1 45 ? -1.122  6.145   -3.421  1.00 1.00 ? 45  VAL A HG23 8  
ATOM   10060 N N    . MET A 1 46 ? 1.295   4.874   -6.567  1.00 1.00 ? 46  MET A N    8  
ATOM   10061 C CA   . MET A 1 46 ? 0.900   4.705   -7.952  1.00 1.00 ? 46  MET A CA   8  
ATOM   10062 C C    . MET A 1 46 ? 0.582   3.252   -8.259  1.00 1.00 ? 46  MET A C    8  
ATOM   10063 O O    . MET A 1 46 ? -0.369  2.963   -8.990  1.00 1.00 ? 46  MET A O    8  
ATOM   10064 C CB   . MET A 1 46 ? 2.019   5.201   -8.881  1.00 1.00 ? 46  MET A CB   8  
ATOM   10065 C CG   . MET A 1 46 ? 2.037   6.739   -8.916  1.00 1.00 ? 46  MET A CG   8  
ATOM   10066 S SD   . MET A 1 46 ? 0.413   7.395   -9.397  1.00 1.00 ? 46  MET A SD   8  
ATOM   10067 C CE   . MET A 1 46 ? 0.277   6.514   -10.967 1.00 1.00 ? 46  MET A CE   8  
ATOM   10068 H H    . MET A 1 46 ? 2.194   5.209   -6.356  1.00 1.00 ? 46  MET A H    8  
ATOM   10069 H HA   . MET A 1 46 ? 0.010   5.268   -8.118  1.00 1.00 ? 46  MET A HA   8  
ATOM   10070 H HB2  . MET A 1 46 ? 2.968   4.841   -8.508  1.00 1.00 ? 46  MET A HB2  8  
ATOM   10071 H HB3  . MET A 1 46 ? 1.875   4.816   -9.872  1.00 1.00 ? 46  MET A HB3  8  
ATOM   10072 H HG2  . MET A 1 46 ? 2.293   7.113   -7.937  1.00 1.00 ? 46  MET A HG2  8  
ATOM   10073 H HG3  . MET A 1 46 ? 2.776   7.071   -9.628  1.00 1.00 ? 46  MET A HG3  8  
ATOM   10074 H HE1  . MET A 1 46 ? -0.379  7.064   -11.619 1.00 1.00 ? 46  MET A HE1  8  
ATOM   10075 H HE2  . MET A 1 46 ? -0.130  5.519   -10.809 1.00 1.00 ? 46  MET A HE2  8  
ATOM   10076 H HE3  . MET A 1 46 ? 1.259   6.438   -11.412 1.00 1.00 ? 46  MET A HE3  8  
ATOM   10077 N N    . ASN A 1 47 ? 1.372   2.349   -7.704  1.00 1.00 ? 47  ASN A N    8  
ATOM   10078 C CA   . ASN A 1 47 ? 1.151   0.929   -7.931  1.00 1.00 ? 47  ASN A CA   8  
ATOM   10079 C C    . ASN A 1 47 ? -0.229  0.521   -7.422  1.00 1.00 ? 47  ASN A C    8  
ATOM   10080 O O    . ASN A 1 47 ? -0.968  -0.174  -8.116  1.00 1.00 ? 47  ASN A O    8  
ATOM   10081 C CB   . ASN A 1 47 ? 2.237   0.123   -7.199  1.00 1.00 ? 47  ASN A CB   8  
ATOM   10082 C CG   . ASN A 1 47 ? 3.488   0.009   -8.063  1.00 1.00 ? 47  ASN A CG   8  
ATOM   10083 O OD1  . ASN A 1 47 ? 4.450   0.749   -7.866  1.00 1.00 ? 47  ASN A OD1  8  
ATOM   10084 N ND2  . ASN A 1 47 ? 3.521   -0.875  -9.020  1.00 1.00 ? 47  ASN A ND2  8  
ATOM   10085 H H    . ASN A 1 47 ? 2.112   2.640   -7.130  1.00 1.00 ? 47  ASN A H    8  
ATOM   10086 H HA   . ASN A 1 47 ? 1.201   0.728   -8.995  1.00 1.00 ? 47  ASN A HA   8  
ATOM   10087 H HB2  . ASN A 1 47 ? 2.487   0.624   -6.273  1.00 1.00 ? 47  ASN A HB2  8  
ATOM   10088 H HB3  . ASN A 1 47 ? 1.873   -0.864  -6.976  1.00 1.00 ? 47  ASN A HB3  8  
ATOM   10089 H HD21 . ASN A 1 47 ? 2.746   -1.459  -9.175  1.00 1.00 ? 47  ASN A HD21 8  
ATOM   10090 H HD22 . ASN A 1 47 ? 4.316   -0.955  -9.586  1.00 1.00 ? 47  ASN A HD22 8  
ATOM   10091 N N    . LEU A 1 48 ? -0.569  0.961   -6.217  1.00 1.00 ? 48  LEU A N    8  
ATOM   10092 C CA   . LEU A 1 48 ? -1.872  0.640   -5.641  1.00 1.00 ? 48  LEU A CA   8  
ATOM   10093 C C    . LEU A 1 48 ? -2.975  1.384   -6.380  1.00 1.00 ? 48  LEU A C    8  
ATOM   10094 O O    . LEU A 1 48 ? -3.987  0.799   -6.756  1.00 1.00 ? 48  LEU A O    8  
ATOM   10095 C CB   . LEU A 1 48 ? -1.893  1.024   -4.158  1.00 1.00 ? 48  LEU A CB   8  
ATOM   10096 C CG   . LEU A 1 48 ? -0.710  0.352   -3.434  1.00 1.00 ? 48  LEU A CG   8  
ATOM   10097 C CD1  . LEU A 1 48 ? -0.389  1.127   -2.159  1.00 1.00 ? 48  LEU A CD1  8  
ATOM   10098 C CD2  . LEU A 1 48 ? -1.083  -1.086  -3.078  1.00 1.00 ? 48  LEU A CD2  8  
ATOM   10099 H H    . LEU A 1 48 ? 0.062   1.517   -5.711  1.00 1.00 ? 48  LEU A H    8  
ATOM   10100 H HA   . LEU A 1 48 ? -2.052  -0.417  -5.731  1.00 1.00 ? 48  LEU A HA   8  
ATOM   10101 H HB2  . LEU A 1 48 ? -1.810  2.100   -4.075  1.00 1.00 ? 48  LEU A HB2  8  
ATOM   10102 H HB3  . LEU A 1 48 ? -2.829  0.701   -3.708  1.00 1.00 ? 48  LEU A HB3  8  
ATOM   10103 H HG   . LEU A 1 48 ? 0.165   0.352   -4.068  1.00 1.00 ? 48  LEU A HG   8  
ATOM   10104 H HD11 . LEU A 1 48 ? 0.275   0.543   -1.540  1.00 1.00 ? 48  LEU A HD11 8  
ATOM   10105 H HD12 . LEU A 1 48 ? -1.302  1.327   -1.619  1.00 1.00 ? 48  LEU A HD12 8  
ATOM   10106 H HD13 . LEU A 1 48 ? 0.091   2.059   -2.425  1.00 1.00 ? 48  LEU A HD13 8  
ATOM   10107 H HD21 . LEU A 1 48 ? -1.960  -1.080  -2.462  1.00 1.00 ? 48  LEU A HD21 8  
ATOM   10108 H HD22 . LEU A 1 48 ? -0.270  -1.544  -2.546  1.00 1.00 ? 48  LEU A HD22 8  
ATOM   10109 H HD23 . LEU A 1 48 ? -1.284  -1.648  -3.973  1.00 1.00 ? 48  LEU A HD23 8  
ATOM   10110 N N    . GLU A 1 49 ? -2.756  2.675   -6.611  1.00 1.00 ? 49  GLU A N    8  
ATOM   10111 C CA   . GLU A 1 49 ? -3.737  3.489   -7.318  1.00 1.00 ? 49  GLU A CA   8  
ATOM   10112 C C    . GLU A 1 49 ? -3.942  2.950   -8.730  1.00 1.00 ? 49  GLU A C    8  
ATOM   10113 O O    . GLU A 1 49 ? -5.068  2.880   -9.223  1.00 1.00 ? 49  GLU A O    8  
ATOM   10114 C CB   . GLU A 1 49 ? -3.258  4.940   -7.388  1.00 1.00 ? 49  GLU A CB   8  
ATOM   10115 C CG   . GLU A 1 49 ? -4.376  5.817   -7.957  1.00 1.00 ? 49  GLU A CG   8  
ATOM   10116 C CD   . GLU A 1 49 ? -3.915  7.268   -8.022  1.00 1.00 ? 49  GLU A CD   8  
ATOM   10117 O OE1  . GLU A 1 49 ? -2.923  7.584   -7.383  1.00 1.00 ? 49  GLU A OE1  8  
ATOM   10118 O OE2  . GLU A 1 49 ? -4.558  8.044   -8.707  1.00 1.00 ? 49  GLU A OE2  8  
ATOM   10119 H H    . GLU A 1 49 ? -1.925  3.086   -6.303  1.00 1.00 ? 49  GLU A H    8  
ATOM   10120 H HA   . GLU A 1 49 ? -4.674  3.460   -6.788  1.00 1.00 ? 49  GLU A HA   8  
ATOM   10121 H HB2  . GLU A 1 49 ? -3.000  5.283   -6.396  1.00 1.00 ? 49  GLU A HB2  8  
ATOM   10122 H HB3  . GLU A 1 49 ? -2.393  5.001   -8.028  1.00 1.00 ? 49  GLU A HB3  8  
ATOM   10123 H HG2  . GLU A 1 49 ? -4.626  5.475   -8.954  1.00 1.00 ? 49  GLU A HG2  8  
ATOM   10124 H HG3  . GLU A 1 49 ? -5.247  5.747   -7.318  1.00 1.00 ? 49  GLU A HG3  8  
ATOM   10125 N N    . GLU A 1 50 ? -2.845  2.556   -9.373  1.00 1.00 ? 50  GLU A N    8  
ATOM   10126 C CA   . GLU A 1 50 ? -2.918  2.009   -10.724 1.00 1.00 ? 50  GLU A CA   8  
ATOM   10127 C C    . GLU A 1 50 ? -3.599  0.645   -10.709 1.00 1.00 ? 50  GLU A C    8  
ATOM   10128 O O    . GLU A 1 50 ? -4.386  0.319   -11.600 1.00 1.00 ? 50  GLU A O    8  
ATOM   10129 C CB   . GLU A 1 50 ? -1.514  1.877   -11.312 1.00 1.00 ? 50  GLU A CB   8  
ATOM   10130 C CG   . GLU A 1 50 ? -1.608  1.406   -12.765 1.00 1.00 ? 50  GLU A CG   8  
ATOM   10131 C CD   . GLU A 1 50 ? -0.217  1.332   -13.382 1.00 1.00 ? 50  GLU A CD   8  
ATOM   10132 O OE1  . GLU A 1 50 ? 0.700   1.874   -12.790 1.00 1.00 ? 50  GLU A OE1  8  
ATOM   10133 O OE2  . GLU A 1 50 ? -0.090  0.738   -14.440 1.00 1.00 ? 50  GLU A OE2  8  
ATOM   10134 H H    . GLU A 1 50 ? -1.972  2.627   -8.934  1.00 1.00 ? 50  GLU A H    8  
ATOM   10135 H HA   . GLU A 1 50 ? -3.491  2.680   -11.344 1.00 1.00 ? 50  GLU A HA   8  
ATOM   10136 H HB2  . GLU A 1 50 ? -1.015  2.835   -11.276 1.00 1.00 ? 50  GLU A HB2  8  
ATOM   10137 H HB3  . GLU A 1 50 ? -0.951  1.154   -10.740 1.00 1.00 ? 50  GLU A HB3  8  
ATOM   10138 H HG2  . GLU A 1 50 ? -2.063  0.428   -12.795 1.00 1.00 ? 50  GLU A HG2  8  
ATOM   10139 H HG3  . GLU A 1 50 ? -2.212  2.103   -13.326 1.00 1.00 ? 50  GLU A HG3  8  
ATOM   10140 N N    . GLU A 1 51 ? -3.284  -0.160  -9.695  1.00 1.00 ? 51  GLU A N    8  
ATOM   10141 C CA   . GLU A 1 51 ? -3.868  -1.490  -9.584  1.00 1.00 ? 51  GLU A CA   8  
ATOM   10142 C C    . GLU A 1 51 ? -5.364  -1.397  -9.306  1.00 1.00 ? 51  GLU A C    8  
ATOM   10143 O O    . GLU A 1 51 ? -6.178  -1.958  -10.039 1.00 1.00 ? 51  GLU A O    8  
ATOM   10144 C CB   . GLU A 1 51 ? -3.190  -2.260  -8.446  1.00 1.00 ? 51  GLU A CB   8  
ATOM   10145 C CG   . GLU A 1 51 ? -3.656  -3.719  -8.462  1.00 1.00 ? 51  GLU A CG   8  
ATOM   10146 C CD   . GLU A 1 51 ? -3.155  -4.437  -7.216  1.00 1.00 ? 51  GLU A CD   8  
ATOM   10147 O OE1  . GLU A 1 51 ? -2.878  -3.761  -6.241  1.00 1.00 ? 51  GLU A OE1  8  
ATOM   10148 O OE2  . GLU A 1 51 ? -3.093  -5.657  -7.245  1.00 1.00 ? 51  GLU A OE2  8  
ATOM   10149 H H    . GLU A 1 51 ? -2.643  0.141   -9.012  1.00 1.00 ? 51  GLU A H    8  
ATOM   10150 H HA   . GLU A 1 51 ? -3.713  -2.028  -10.506 1.00 1.00 ? 51  GLU A HA   8  
ATOM   10151 H HB2  . GLU A 1 51 ? -2.118  -2.227  -8.581  1.00 1.00 ? 51  GLU A HB2  8  
ATOM   10152 H HB3  . GLU A 1 51 ? -3.447  -1.811  -7.499  1.00 1.00 ? 51  GLU A HB3  8  
ATOM   10153 H HG2  . GLU A 1 51 ? -4.736  -3.757  -8.484  1.00 1.00 ? 51  GLU A HG2  8  
ATOM   10154 H HG3  . GLU A 1 51 ? -3.265  -4.210  -9.338  1.00 1.00 ? 51  GLU A HG3  8  
ATOM   10155 N N    . PHE A 1 52 ? -5.720  -0.692  -8.235  1.00 1.00 ? 52  PHE A N    8  
ATOM   10156 C CA   . PHE A 1 52 ? -7.123  -0.545  -7.862  1.00 1.00 ? 52  PHE A CA   8  
ATOM   10157 C C    . PHE A 1 52 ? -7.822  0.439   -8.797  1.00 1.00 ? 52  PHE A C    8  
ATOM   10158 O O    . PHE A 1 52 ? -9.037  0.622   -8.721  1.00 1.00 ? 52  PHE A O    8  
ATOM   10159 C CB   . PHE A 1 52 ? -7.231  -0.052  -6.421  1.00 1.00 ? 52  PHE A CB   8  
ATOM   10160 C CG   . PHE A 1 52 ? -6.679  -1.098  -5.482  1.00 1.00 ? 52  PHE A CG   8  
ATOM   10161 C CD1  . PHE A 1 52 ? -7.316  -2.338  -5.365  1.00 1.00 ? 52  PHE A CD1  8  
ATOM   10162 C CD2  . PHE A 1 52 ? -5.529  -0.827  -4.725  1.00 1.00 ? 52  PHE A CD2  8  
ATOM   10163 C CE1  . PHE A 1 52 ? -6.801  -3.307  -4.500  1.00 1.00 ? 52  PHE A CE1  8  
ATOM   10164 C CE2  . PHE A 1 52 ? -5.017  -1.794  -3.862  1.00 1.00 ? 52  PHE A CE2  8  
ATOM   10165 C CZ   . PHE A 1 52 ? -5.655  -3.028  -3.747  1.00 1.00 ? 52  PHE A CZ   8  
ATOM   10166 H H    . PHE A 1 52 ? -5.026  -0.277  -7.677  1.00 1.00 ? 52  PHE A H    8  
ATOM   10167 H HA   . PHE A 1 52 ? -7.608  -1.501  -7.936  1.00 1.00 ? 52  PHE A HA   8  
ATOM   10168 H HB2  . PHE A 1 52 ? -6.667  0.853   -6.316  1.00 1.00 ? 52  PHE A HB2  8  
ATOM   10169 H HB3  . PHE A 1 52 ? -8.262  0.137   -6.179  1.00 1.00 ? 52  PHE A HB3  8  
ATOM   10170 H HD1  . PHE A 1 52 ? -8.202  -2.548  -5.943  1.00 1.00 ? 52  PHE A HD1  8  
ATOM   10171 H HD2  . PHE A 1 52 ? -5.041  0.128   -4.806  1.00 1.00 ? 52  PHE A HD2  8  
ATOM   10172 H HE1  . PHE A 1 52 ? -7.291  -4.266  -4.407  1.00 1.00 ? 52  PHE A HE1  8  
ATOM   10173 H HE2  . PHE A 1 52 ? -4.128  -1.588  -3.284  1.00 1.00 ? 52  PHE A HE2  8  
ATOM   10174 H HZ   . PHE A 1 52 ? -5.262  -3.767  -3.083  1.00 1.00 ? 52  PHE A HZ   8  
ATOM   10175 N N    . GLY A 1 53 ? -7.048  1.062   -9.678  1.00 1.00 ? 53  GLY A N    8  
ATOM   10176 C CA   . GLY A 1 53 ? -7.605  2.020   -10.623 1.00 1.00 ? 53  GLY A CA   8  
ATOM   10177 C C    . GLY A 1 53 ? -8.428  3.077   -9.906  1.00 1.00 ? 53  GLY A C    8  
ATOM   10178 O O    . GLY A 1 53 ? -9.544  3.390   -10.317 1.00 1.00 ? 53  GLY A O    8  
ATOM   10179 H H    . GLY A 1 53 ? -6.087  0.872   -9.692  1.00 1.00 ? 53  GLY A H    8  
ATOM   10180 H HA2  . GLY A 1 53 ? -6.798  2.503   -11.157 1.00 1.00 ? 53  GLY A HA2  8  
ATOM   10181 H HA3  . GLY A 1 53 ? -8.237  1.503   -11.326 1.00 1.00 ? 53  GLY A HA3  8  
ATOM   10182 N N    . ILE A 1 54 ? -7.879  3.616   -8.821  1.00 1.00 ? 54  ILE A N    8  
ATOM   10183 C CA   . ILE A 1 54 ? -8.577  4.638   -8.035  1.00 1.00 ? 54  ILE A CA   8  
ATOM   10184 C C    . ILE A 1 54 ? -7.824  5.953   -8.088  1.00 1.00 ? 54  ILE A C    8  
ATOM   10185 O O    . ILE A 1 54 ? -6.919  6.126   -8.906  1.00 1.00 ? 54  ILE A O    8  
ATOM   10186 C CB   . ILE A 1 54 ? -8.710  4.176   -6.581  1.00 1.00 ? 54  ILE A CB   8  
ATOM   10187 C CG1  . ILE A 1 54 ? -7.341  3.726   -6.063  1.00 1.00 ? 54  ILE A CG1  8  
ATOM   10188 C CG2  . ILE A 1 54 ? -9.699  3.008   -6.501  1.00 1.00 ? 54  ILE A CG2  8  
ATOM   10189 C CD1  . ILE A 1 54 ? -7.492  3.056   -4.696  1.00 1.00 ? 54  ILE A CD1  8  
ATOM   10190 H H    . ILE A 1 54 ? -6.987  3.320   -8.535  1.00 1.00 ? 54  ILE A H    8  
ATOM   10191 H HA   . ILE A 1 54 ? -9.564  4.801   -8.435  1.00 1.00 ? 54  ILE A HA   8  
ATOM   10192 H HB   . ILE A 1 54 ? -9.069  4.994   -5.979  1.00 1.00 ? 54  ILE A HB   8  
ATOM   10193 H HG12 . ILE A 1 54 ? -6.912  3.033   -6.754  1.00 1.00 ? 54  ILE A HG12 8  
ATOM   10194 H HG13 . ILE A 1 54 ? -6.693  4.579   -5.965  1.00 1.00 ? 54  ILE A HG13 8  
ATOM   10195 H HG21 . ILE A 1 54 ? -10.588 3.241   -7.064  1.00 1.00 ? 54  ILE A HG21 8  
ATOM   10196 H HG22 . ILE A 1 54 ? -9.969  2.835   -5.470  1.00 1.00 ? 54  ILE A HG22 8  
ATOM   10197 H HG23 . ILE A 1 54 ? -9.239  2.123   -6.910  1.00 1.00 ? 54  ILE A HG23 8  
ATOM   10198 H HD11 . ILE A 1 54 ? -6.520  2.930   -4.238  1.00 1.00 ? 54  ILE A HD11 8  
ATOM   10199 H HD12 . ILE A 1 54 ? -7.960  2.094   -4.818  1.00 1.00 ? 54  ILE A HD12 8  
ATOM   10200 H HD13 . ILE A 1 54 ? -8.105  3.674   -4.071  1.00 1.00 ? 54  ILE A HD13 8  
ATOM   10201 N N    . ASN A 1 55 ? -8.201  6.883   -7.216  1.00 1.00 ? 55  ASN A N    8  
ATOM   10202 C CA   . ASN A 1 55 ? -7.553  8.194   -7.165  1.00 1.00 ? 55  ASN A CA   8  
ATOM   10203 C C    . ASN A 1 55 ? -6.974  8.437   -5.783  1.00 1.00 ? 55  ASN A C    8  
ATOM   10204 O O    . ASN A 1 55 ? -7.680  8.345   -4.777  1.00 1.00 ? 55  ASN A O    8  
ATOM   10205 C CB   . ASN A 1 55 ? -8.561  9.291   -7.504  1.00 1.00 ? 55  ASN A CB   8  
ATOM   10206 C CG   . ASN A 1 55 ? -9.891  9.009   -6.815  1.00 1.00 ? 55  ASN A CG   8  
ATOM   10207 O OD1  . ASN A 1 55 ? -10.912 8.839   -7.481  1.00 1.00 ? 55  ASN A OD1  8  
ATOM   10208 N ND2  . ASN A 1 55 ? -9.941  8.946   -5.513  1.00 1.00 ? 55  ASN A ND2  8  
ATOM   10209 H H    . ASN A 1 55 ? -8.933  6.685   -6.589  1.00 1.00 ? 55  ASN A H    8  
ATOM   10210 H HA   . ASN A 1 55 ? -6.748  8.237   -7.885  1.00 1.00 ? 55  ASN A HA   8  
ATOM   10211 H HB2  . ASN A 1 55 ? -8.180  10.248  -7.173  1.00 1.00 ? 55  ASN A HB2  8  
ATOM   10212 H HB3  . ASN A 1 55 ? -8.712  9.319   -8.573  1.00 1.00 ? 55  ASN A HB3  8  
ATOM   10213 H HD21 . ASN A 1 55 ? -9.127  9.078   -4.984  1.00 1.00 ? 55  ASN A HD21 8  
ATOM   10214 H HD22 . ASN A 1 55 ? -10.793 8.763   -5.064  1.00 1.00 ? 55  ASN A HD22 8  
ATOM   10215 N N    . VAL A 1 56 ? -5.682  8.747   -5.732  1.00 1.00 ? 56  VAL A N    8  
ATOM   10216 C CA   . VAL A 1 56 ? -5.008  9.000   -4.459  1.00 1.00 ? 56  VAL A CA   8  
ATOM   10217 C C    . VAL A 1 56 ? -4.284  10.336  -4.498  1.00 1.00 ? 56  VAL A C    8  
ATOM   10218 O O    . VAL A 1 56 ? -3.989  10.865  -5.569  1.00 1.00 ? 56  VAL A O    8  
ATOM   10219 C CB   . VAL A 1 56 ? -4.002  7.886   -4.174  1.00 1.00 ? 56  VAL A CB   8  
ATOM   10220 C CG1  . VAL A 1 56 ? -3.332  8.139   -2.819  1.00 1.00 ? 56  VAL A CG1  8  
ATOM   10221 C CG2  . VAL A 1 56 ? -4.730  6.539   -4.139  1.00 1.00 ? 56  VAL A CG2  8  
ATOM   10222 H H    . VAL A 1 56 ? -5.166  8.802   -6.565  1.00 1.00 ? 56  VAL A H    8  
ATOM   10223 H HA   . VAL A 1 56 ? -5.732  9.029   -3.655  1.00 1.00 ? 56  VAL A HA   8  
ATOM   10224 H HB   . VAL A 1 56 ? -3.249  7.870   -4.949  1.00 1.00 ? 56  VAL A HB   8  
ATOM   10225 H HG11 . VAL A 1 56 ? -4.062  8.511   -2.120  1.00 1.00 ? 56  VAL A HG11 8  
ATOM   10226 H HG12 . VAL A 1 56 ? -2.546  8.868   -2.938  1.00 1.00 ? 56  VAL A HG12 8  
ATOM   10227 H HG13 . VAL A 1 56 ? -2.913  7.219   -2.439  1.00 1.00 ? 56  VAL A HG13 8  
ATOM   10228 H HG21 . VAL A 1 56 ? -5.403  6.470   -4.980  1.00 1.00 ? 56  VAL A HG21 8  
ATOM   10229 H HG22 . VAL A 1 56 ? -5.290  6.461   -3.223  1.00 1.00 ? 56  VAL A HG22 8  
ATOM   10230 H HG23 . VAL A 1 56 ? -4.009  5.736   -4.186  1.00 1.00 ? 56  VAL A HG23 8  
ATOM   10231 N N    . ASP A 1 57 ? -3.999  10.885  -3.318  1.00 1.00 ? 57  ASP A N    8  
ATOM   10232 C CA   . ASP A 1 57 ? -3.303  12.169  -3.218  1.00 1.00 ? 57  ASP A CA   8  
ATOM   10233 C C    . ASP A 1 57 ? -2.114  12.060  -2.273  1.00 1.00 ? 57  ASP A C    8  
ATOM   10234 O O    . ASP A 1 57 ? -1.991  11.097  -1.519  1.00 1.00 ? 57  ASP A O    8  
ATOM   10235 C CB   . ASP A 1 57 ? -4.267  13.241  -2.710  1.00 1.00 ? 57  ASP A CB   8  
ATOM   10236 C CG   . ASP A 1 57 ? -5.282  13.587  -3.794  1.00 1.00 ? 57  ASP A CG   8  
ATOM   10237 O OD1  . ASP A 1 57 ? -5.076  13.177  -4.925  1.00 1.00 ? 57  ASP A OD1  8  
ATOM   10238 O OD2  . ASP A 1 57 ? -6.249  14.262  -3.481  1.00 1.00 ? 57  ASP A OD2  8  
ATOM   10239 H H    . ASP A 1 57 ? -4.260  10.418  -2.495  1.00 1.00 ? 57  ASP A H    8  
ATOM   10240 H HA   . ASP A 1 57 ? -2.941  12.467  -4.194  1.00 1.00 ? 57  ASP A HA   8  
ATOM   10241 H HB2  . ASP A 1 57 ? -4.787  12.872  -1.838  1.00 1.00 ? 57  ASP A HB2  8  
ATOM   10242 H HB3  . ASP A 1 57 ? -3.707  14.124  -2.449  1.00 1.00 ? 57  ASP A HB3  8  
ATOM   10243 N N    . GLU A 1 58 ? -1.238  13.057  -2.321  1.00 1.00 ? 58  GLU A N    8  
ATOM   10244 C CA   . GLU A 1 58 ? -0.057  13.065  -1.466  1.00 1.00 ? 58  GLU A CA   8  
ATOM   10245 C C    . GLU A 1 58 ? -0.458  13.182  -0.002  1.00 1.00 ? 58  GLU A C    8  
ATOM   10246 O O    . GLU A 1 58 ? 0.193   12.618  0.875   1.00 1.00 ? 58  GLU A O    8  
ATOM   10247 C CB   . GLU A 1 58 ? 0.850   14.238  -1.842  1.00 1.00 ? 58  GLU A CB   8  
ATOM   10248 C CG   . GLU A 1 58 ? 1.357   14.069  -3.282  1.00 1.00 ? 58  GLU A CG   8  
ATOM   10249 C CD   . GLU A 1 58 ? 0.290   14.534  -4.271  1.00 1.00 ? 58  GLU A CD   8  
ATOM   10250 O OE1  . GLU A 1 58 ? -0.797  14.872  -3.829  1.00 1.00 ? 58  GLU A OE1  8  
ATOM   10251 O OE2  . GLU A 1 58 ? 0.573   14.543  -5.454  1.00 1.00 ? 58  GLU A OE2  8  
ATOM   10252 H H    . GLU A 1 58 ? -1.388  13.798  -2.945  1.00 1.00 ? 58  GLU A H    8  
ATOM   10253 H HA   . GLU A 1 58 ? 0.486   12.143  -1.608  1.00 1.00 ? 58  GLU A HA   8  
ATOM   10254 H HB2  . GLU A 1 58 ? 0.295   15.169  -1.760  1.00 1.00 ? 58  GLU A HB2  8  
ATOM   10255 H HB3  . GLU A 1 58 ? 1.696   14.275  -1.172  1.00 1.00 ? 58  GLU A HB3  8  
ATOM   10256 H HG2  . GLU A 1 58 ? 2.252   14.639  -3.418  1.00 1.00 ? 58  GLU A HG2  8  
ATOM   10257 H HG3  . GLU A 1 58 ? 1.572   13.016  -3.470  1.00 1.00 ? 58  GLU A HG3  8  
ATOM   10258 N N    . ASP A 1 59 ? -1.535  13.914  0.254   1.00 1.00 ? 59  ASP A N    8  
ATOM   10259 C CA   . ASP A 1 59 ? -2.015  14.097  1.618   1.00 1.00 ? 59  ASP A CA   8  
ATOM   10260 C C    . ASP A 1 59 ? -2.482  12.773  2.202   1.00 1.00 ? 59  ASP A C    8  
ATOM   10261 O O    . ASP A 1 59 ? -2.471  12.579  3.415   1.00 1.00 ? 59  ASP A O    8  
ATOM   10262 C CB   . ASP A 1 59 ? -3.173  15.093  1.633   1.00 1.00 ? 59  ASP A CB   8  
ATOM   10263 C CG   . ASP A 1 59 ? -2.652  16.503  1.355   1.00 1.00 ? 59  ASP A CG   8  
ATOM   10264 O OD1  . ASP A 1 59 ? -1.449  16.697  1.445   1.00 1.00 ? 59  ASP A OD1  8  
ATOM   10265 O OD2  . ASP A 1 59 ? -3.460  17.368  1.059   1.00 1.00 ? 59  ASP A OD2  8  
ATOM   10266 H H    . ASP A 1 59 ? -2.014  14.340  -0.487  1.00 1.00 ? 59  ASP A H    8  
ATOM   10267 H HA   . ASP A 1 59 ? -1.209  14.480  2.224   1.00 1.00 ? 59  ASP A HA   8  
ATOM   10268 H HB2  . ASP A 1 59 ? -3.895  14.811  0.874   1.00 1.00 ? 59  ASP A HB2  8  
ATOM   10269 H HB3  . ASP A 1 59 ? -3.651  15.072  2.601   1.00 1.00 ? 59  ASP A HB3  8  
ATOM   10270 N N    . LYS A 1 60 ? -2.912  11.866  1.335   1.00 1.00 ? 60  LYS A N    8  
ATOM   10271 C CA   . LYS A 1 60 ? -3.386  10.564  1.775   1.00 1.00 ? 60  LYS A CA   8  
ATOM   10272 C C    . LYS A 1 60 ? -2.223  9.600   1.962   1.00 1.00 ? 60  LYS A C    8  
ATOM   10273 O O    . LYS A 1 60 ? -2.282  8.695   2.791   1.00 1.00 ? 60  LYS A O    8  
ATOM   10274 C CB   . LYS A 1 60 ? -4.361  9.994   0.750   1.00 1.00 ? 60  LYS A CB   8  
ATOM   10275 C CG   . LYS A 1 60 ? -5.229  8.905   1.417   1.00 1.00 ? 60  LYS A CG   8  
ATOM   10276 C CD   . LYS A 1 60 ? -5.698  7.914   0.359   1.00 1.00 ? 60  LYS A CD   8  
ATOM   10277 C CE   . LYS A 1 60 ? -4.652  6.805   0.177   1.00 1.00 ? 60  LYS A CE   8  
ATOM   10278 N NZ   . LYS A 1 60 ? -5.163  5.779   -0.768  1.00 1.00 ? 60  LYS A NZ   8  
ATOM   10279 H H    . LYS A 1 60 ? -2.909  12.071  0.377   1.00 1.00 ? 60  LYS A H    8  
ATOM   10280 H HA   . LYS A 1 60 ? -3.905  10.665  2.709   1.00 1.00 ? 60  LYS A HA   8  
ATOM   10281 H HB2  . LYS A 1 60 ? -4.998  10.785  0.381   1.00 1.00 ? 60  LYS A HB2  8  
ATOM   10282 H HB3  . LYS A 1 60 ? -3.808  9.570   -0.072  1.00 1.00 ? 60  LYS A HB3  8  
ATOM   10283 H HG2  . LYS A 1 60 ? -4.660  8.391   2.176   1.00 1.00 ? 60  LYS A HG2  8  
ATOM   10284 H HG3  . LYS A 1 60 ? -6.096  9.364   1.876   1.00 1.00 ? 60  LYS A HG3  8  
ATOM   10285 H HD2  . LYS A 1 60 ? -6.639  7.484   0.665   1.00 1.00 ? 60  LYS A HD2  8  
ATOM   10286 H HD3  . LYS A 1 60 ? -5.829  8.446   -0.571  1.00 1.00 ? 60  LYS A HD3  8  
ATOM   10287 H HE2  . LYS A 1 60 ? -3.742  7.231   -0.208  1.00 1.00 ? 60  LYS A HE2  8  
ATOM   10288 H HE3  . LYS A 1 60 ? -4.451  6.340   1.127   1.00 1.00 ? 60  LYS A HE3  8  
ATOM   10289 H HZ1  . LYS A 1 60 ? -5.758  5.101   -0.254  1.00 1.00 ? 60  LYS A HZ1  8  
ATOM   10290 H HZ2  . LYS A 1 60 ? -4.362  5.281   -1.200  1.00 1.00 ? 60  LYS A HZ2  8  
ATOM   10291 H HZ3  . LYS A 1 60 ? -5.724  6.239   -1.505  1.00 1.00 ? 60  LYS A HZ3  8  
ATOM   10292 N N    . ALA A 1 61 ? -1.177  9.782   1.164   1.00 1.00 ? 61  ALA A N    8  
ATOM   10293 C CA   . ALA A 1 61 ? -0.006  8.905   1.228   1.00 1.00 ? 61  ALA A CA   8  
ATOM   10294 C C    . ALA A 1 61 ? 1.175   9.636   1.836   1.00 1.00 ? 61  ALA A C    8  
ATOM   10295 O O    . ALA A 1 61 ? 2.264   9.642   1.274   1.00 1.00 ? 61  ALA A O    8  
ATOM   10296 C CB   . ALA A 1 61 ? 0.360   8.421   -0.178  1.00 1.00 ? 61  ALA A CB   8  
ATOM   10297 H H    . ALA A 1 61 ? -1.192  10.516  0.513   1.00 1.00 ? 61  ALA A H    8  
ATOM   10298 H HA   . ALA A 1 61 ? -0.227  8.042   1.838   1.00 1.00 ? 61  ALA A HA   8  
ATOM   10299 H HB1  . ALA A 1 61 ? 0.341   9.254   -0.863  1.00 1.00 ? 61  ALA A HB1  8  
ATOM   10300 H HB2  . ALA A 1 61 ? -0.355  7.675   -0.494  1.00 1.00 ? 61  ALA A HB2  8  
ATOM   10301 H HB3  . ALA A 1 61 ? 1.350   7.986   -0.163  1.00 1.00 ? 61  ALA A HB3  8  
ATOM   10302 N N    . GLN A 1 62 ? 0.957   10.254  2.991   1.00 1.00 ? 62  GLN A N    8  
ATOM   10303 C CA   . GLN A 1 62 ? 2.022   10.987  3.683   1.00 1.00 ? 62  GLN A CA   8  
ATOM   10304 C C    . GLN A 1 62 ? 2.315   10.355  5.035   1.00 1.00 ? 62  GLN A C    8  
ATOM   10305 O O    . GLN A 1 62 ? 3.440   10.419  5.529   1.00 1.00 ? 62  GLN A O    8  
ATOM   10306 C CB   . GLN A 1 62 ? 1.608   12.443  3.875   1.00 1.00 ? 62  GLN A CB   8  
ATOM   10307 C CG   . GLN A 1 62 ? 0.321   12.504  4.696   1.00 1.00 ? 62  GLN A CG   8  
ATOM   10308 C CD   . GLN A 1 62 ? -0.186  13.941  4.766   1.00 1.00 ? 62  GLN A CD   8  
ATOM   10309 O OE1  . GLN A 1 62 ? 0.342   14.820  4.084   1.00 1.00 ? 62  GLN A OE1  8  
ATOM   10310 N NE2  . GLN A 1 62 ? -1.189  14.235  5.550   1.00 1.00 ? 62  GLN A NE2  8  
ATOM   10311 H H    . GLN A 1 62 ? 0.061   10.214  3.392   1.00 1.00 ? 62  GLN A H    8  
ATOM   10312 H HA   . GLN A 1 62 ? 2.929   10.966  3.091   1.00 1.00 ? 62  GLN A HA   8  
ATOM   10313 H HB2  . GLN A 1 62 ? 2.394   12.971  4.392   1.00 1.00 ? 62  GLN A HB2  8  
ATOM   10314 H HB3  . GLN A 1 62 ? 1.441   12.900  2.910   1.00 1.00 ? 62  GLN A HB3  8  
ATOM   10315 H HG2  . GLN A 1 62 ? -0.423  11.877  4.233   1.00 1.00 ? 62  GLN A HG2  8  
ATOM   10316 H HG3  . GLN A 1 62 ? 0.518   12.147  5.695   1.00 1.00 ? 62  GLN A HG3  8  
ATOM   10317 H HE21 . GLN A 1 62 ? -1.609  13.535  6.090   1.00 1.00 ? 62  GLN A HE21 8  
ATOM   10318 H HE22 . GLN A 1 62 ? -1.519  15.156  5.597   1.00 1.00 ? 62  GLN A HE22 8  
ATOM   10319 N N    . ASP A 1 63 ? 1.298   9.743   5.632   1.00 1.00 ? 63  ASP A N    8  
ATOM   10320 C CA   . ASP A 1 63 ? 1.459   9.103   6.936   1.00 1.00 ? 63  ASP A CA   8  
ATOM   10321 C C    . ASP A 1 63 ? 0.470   7.958   7.099   1.00 1.00 ? 63  ASP A C    8  
ATOM   10322 O O    . ASP A 1 63 ? -0.329  7.944   8.035   1.00 1.00 ? 63  ASP A O    8  
ATOM   10323 C CB   . ASP A 1 63 ? 1.241   10.129  8.048   1.00 1.00 ? 63  ASP A CB   8  
ATOM   10324 C CG   . ASP A 1 63 ? 1.489   9.485   9.408   1.00 1.00 ? 63  ASP A CG   8  
ATOM   10325 O OD1  . ASP A 1 63 ? 2.006   8.380   9.433   1.00 1.00 ? 63  ASP A OD1  8  
ATOM   10326 O OD2  . ASP A 1 63 ? 1.160   10.106  10.406  1.00 1.00 ? 63  ASP A OD2  8  
ATOM   10327 H H    . ASP A 1 63 ? 0.423   9.722   5.190   1.00 1.00 ? 63  ASP A H    8  
ATOM   10328 H HA   . ASP A 1 63 ? 2.463   8.710   7.019   1.00 1.00 ? 63  ASP A HA   8  
ATOM   10329 H HB2  . ASP A 1 63 ? 1.924   10.955  7.913   1.00 1.00 ? 63  ASP A HB2  8  
ATOM   10330 H HB3  . ASP A 1 63 ? 0.225   10.493  8.007   1.00 1.00 ? 63  ASP A HB3  8  
ATOM   10331 N N    . ILE A 1 64 ? 0.535   6.990   6.190   1.00 1.00 ? 64  ILE A N    8  
ATOM   10332 C CA   . ILE A 1 64 ? -0.350  5.829   6.249   1.00 1.00 ? 64  ILE A CA   8  
ATOM   10333 C C    . ILE A 1 64 ? 0.264   4.723   7.084   1.00 1.00 ? 64  ILE A C    8  
ATOM   10334 O O    . ILE A 1 64 ? 1.406   4.328   6.864   1.00 1.00 ? 64  ILE A O    8  
ATOM   10335 C CB   . ILE A 1 64 ? -0.629  5.314   4.832   1.00 1.00 ? 64  ILE A CB   8  
ATOM   10336 C CG1  . ILE A 1 64 ? -1.362  6.396   4.029   1.00 1.00 ? 64  ILE A CG1  8  
ATOM   10337 C CG2  . ILE A 1 64 ? -1.496  4.058   4.905   1.00 1.00 ? 64  ILE A CG2  8  
ATOM   10338 C CD1  . ILE A 1 64 ? -2.709  6.739   4.697   1.00 1.00 ? 64  ILE A CD1  8  
ATOM   10339 H H    . ILE A 1 64 ? 1.198   7.053   5.469   1.00 1.00 ? 64  ILE A H    8  
ATOM   10340 H HA   . ILE A 1 64 ? -1.285  6.109   6.714   1.00 1.00 ? 64  ILE A HA   8  
ATOM   10341 H HB   . ILE A 1 64 ? 0.310   5.078   4.348   1.00 1.00 ? 64  ILE A HB   8  
ATOM   10342 H HG12 . ILE A 1 64 ? -0.747  7.288   3.984   1.00 1.00 ? 64  ILE A HG12 8  
ATOM   10343 H HG13 . ILE A 1 64 ? -1.542  6.043   3.028   1.00 1.00 ? 64  ILE A HG13 8  
ATOM   10344 H HG21 . ILE A 1 64 ? -0.907  3.228   5.270   1.00 1.00 ? 64  ILE A HG21 8  
ATOM   10345 H HG22 . ILE A 1 64 ? -1.873  3.826   3.921   1.00 1.00 ? 64  ILE A HG22 8  
ATOM   10346 H HG23 . ILE A 1 64 ? -2.323  4.238   5.575   1.00 1.00 ? 64  ILE A HG23 8  
ATOM   10347 H HD11 . ILE A 1 64 ? -3.418  7.016   3.941   1.00 1.00 ? 64  ILE A HD11 8  
ATOM   10348 H HD12 . ILE A 1 64 ? -2.563  7.559   5.377   1.00 1.00 ? 64  ILE A HD12 8  
ATOM   10349 H HD13 . ILE A 1 64 ? -3.097  5.897   5.243   1.00 1.00 ? 64  ILE A HD13 8  
ATOM   10350 N N    . SER A 1 65 ? -0.506  4.223   8.044   1.00 1.00 ? 65  SER A N    8  
ATOM   10351 C CA   . SER A 1 65 ? -0.028  3.150   8.913   1.00 1.00 ? 65  SER A CA   8  
ATOM   10352 C C    . SER A 1 65 ? 0.214   1.885   8.109   1.00 1.00 ? 65  SER A C    8  
ATOM   10353 O O    . SER A 1 65 ? 0.147   1.909   6.888   1.00 1.00 ? 65  SER A O    8  
ATOM   10354 C CB   . SER A 1 65 ? -1.050  2.874   10.024  1.00 1.00 ? 65  SER A CB   8  
ATOM   10355 O OG   . SER A 1 65 ? -1.736  1.661   9.745   1.00 1.00 ? 65  SER A OG   8  
ATOM   10356 H H    . SER A 1 65 ? -1.413  4.577   8.170   1.00 1.00 ? 65  SER A H    8  
ATOM   10357 H HA   . SER A 1 65 ? 0.906   3.453   9.349   1.00 1.00 ? 65  SER A HA   8  
ATOM   10358 H HB2  . SER A 1 65 ? -0.553  2.785   10.976  1.00 1.00 ? 65  SER A HB2  8  
ATOM   10359 H HB3  . SER A 1 65 ? -1.753  3.695   10.066  1.00 1.00 ? 65  SER A HB3  8  
ATOM   10360 H HG   . SER A 1 65 ? -1.535  1.039   10.445  1.00 1.00 ? 65  SER A HG   8  
ATOM   10361 N N    . THR A 1 66 ? 0.501   0.792   8.807   1.00 1.00 ? 66  THR A N    8  
ATOM   10362 C CA   . THR A 1 66 ? 0.756   -0.485  8.151   1.00 1.00 ? 66  THR A CA   8  
ATOM   10363 C C    . THR A 1 66 ? -0.284  -0.761  7.064   1.00 1.00 ? 66  THR A C    8  
ATOM   10364 O O    . THR A 1 66 ? -1.112  0.084   6.738   1.00 1.00 ? 66  THR A O    8  
ATOM   10365 C CB   . THR A 1 66 ? 0.734   -1.617  9.184   1.00 1.00 ? 66  THR A CB   8  
ATOM   10366 O OG1  . THR A 1 66 ? 1.295   -2.793  8.610   1.00 1.00 ? 66  THR A OG1  8  
ATOM   10367 C CG2  . THR A 1 66 ? -0.705  -1.901  9.615   1.00 1.00 ? 66  THR A CG2  8  
ATOM   10368 H H    . THR A 1 66 ? 0.536   0.842   9.785   1.00 1.00 ? 66  THR A H    8  
ATOM   10369 H HA   . THR A 1 66 ? 1.728   -0.447  7.699   1.00 1.00 ? 66  THR A HA   8  
ATOM   10370 H HB   . THR A 1 66 ? 1.308   -1.326  10.042  1.00 1.00 ? 66  THR A HB   8  
ATOM   10371 H HG1  . THR A 1 66 ? 0.577   -3.329  8.267   1.00 1.00 ? 66  THR A HG1  8  
ATOM   10372 H HG21 . THR A 1 66 ? -1.081  -2.715  9.022   1.00 1.00 ? 66  THR A HG21 8  
ATOM   10373 H HG22 . THR A 1 66 ? -1.324  -1.017  9.467   1.00 1.00 ? 66  THR A HG22 8  
ATOM   10374 H HG23 . THR A 1 66 ? -0.721  -2.184  10.657  1.00 1.00 ? 66  THR A HG23 8  
ATOM   10375 N N    . ILE A 1 67 ? -0.235  -1.955  6.503   1.00 1.00 ? 67  ILE A N    8  
ATOM   10376 C CA   . ILE A 1 67 ? -1.161  -2.322  5.443   1.00 1.00 ? 67  ILE A CA   8  
ATOM   10377 C C    . ILE A 1 67 ? -2.602  -2.221  5.927   1.00 1.00 ? 67  ILE A C    8  
ATOM   10378 O O    . ILE A 1 67 ? -3.476  -1.744  5.205   1.00 1.00 ? 67  ILE A O    8  
ATOM   10379 C CB   . ILE A 1 67 ? -0.881  -3.744  4.971   1.00 1.00 ? 67  ILE A CB   8  
ATOM   10380 C CG1  . ILE A 1 67 ? 0.502   -3.803  4.309   1.00 1.00 ? 67  ILE A CG1  8  
ATOM   10381 C CG2  . ILE A 1 67 ? -1.942  -4.171  3.955   1.00 1.00 ? 67  ILE A CG2  8  
ATOM   10382 C CD1  . ILE A 1 67 ? 0.970   -5.260  4.215   1.00 1.00 ? 67  ILE A CD1  8  
ATOM   10383 H H    . ILE A 1 67 ? 0.442   -2.600  6.794   1.00 1.00 ? 67  ILE A H    8  
ATOM   10384 H HA   . ILE A 1 67 ? -1.017  -1.649  4.618   1.00 1.00 ? 67  ILE A HA   8  
ATOM   10385 H HB   . ILE A 1 67 ? -0.914  -4.418  5.808   1.00 1.00 ? 67  ILE A HB   8  
ATOM   10386 H HG12 . ILE A 1 67 ? 0.446   -3.375  3.314   1.00 1.00 ? 67  ILE A HG12 8  
ATOM   10387 H HG13 . ILE A 1 67 ? 1.211   -3.239  4.899   1.00 1.00 ? 67  ILE A HG13 8  
ATOM   10388 H HG21 . ILE A 1 67 ? -2.138  -3.361  3.270   1.00 1.00 ? 67  ILE A HG21 8  
ATOM   10389 H HG22 . ILE A 1 67 ? -2.849  -4.426  4.479   1.00 1.00 ? 67  ILE A HG22 8  
ATOM   10390 H HG23 . ILE A 1 67 ? -1.588  -5.031  3.400   1.00 1.00 ? 67  ILE A HG23 8  
ATOM   10391 H HD11 . ILE A 1 67 ? 0.117   -5.922  4.167   1.00 1.00 ? 67  ILE A HD11 8  
ATOM   10392 H HD12 . ILE A 1 67 ? 1.558   -5.503  5.085   1.00 1.00 ? 67  ILE A HD12 8  
ATOM   10393 H HD13 . ILE A 1 67 ? 1.572   -5.389  3.327   1.00 1.00 ? 67  ILE A HD13 8  
ATOM   10394 N N    . GLN A 1 68 ? -2.847  -2.691  7.144   1.00 1.00 ? 68  GLN A N    8  
ATOM   10395 C CA   . GLN A 1 68 ? -4.192  -2.651  7.710   1.00 1.00 ? 68  GLN A CA   8  
ATOM   10396 C C    . GLN A 1 68 ? -4.882  -1.332  7.372   1.00 1.00 ? 68  GLN A C    8  
ATOM   10397 O O    . GLN A 1 68 ? -5.982  -1.325  6.818   1.00 1.00 ? 68  GLN A O    8  
ATOM   10398 C CB   . GLN A 1 68 ? -4.116  -2.815  9.235   1.00 1.00 ? 68  GLN A CB   8  
ATOM   10399 C CG   . GLN A 1 68 ? -3.931  -4.287  9.591   1.00 1.00 ? 68  GLN A CG   8  
ATOM   10400 C CD   . GLN A 1 68 ? -5.253  -5.029  9.416   1.00 1.00 ? 68  GLN A CD   8  
ATOM   10401 O OE1  . GLN A 1 68 ? -6.299  -4.549  9.856   1.00 1.00 ? 68  GLN A OE1  8  
ATOM   10402 N NE2  . GLN A 1 68 ? -5.273  -6.181  8.804   1.00 1.00 ? 68  GLN A NE2  8  
ATOM   10403 H H    . GLN A 1 68 ? -2.111  -3.066  7.671   1.00 1.00 ? 68  GLN A H    8  
ATOM   10404 H HA   . GLN A 1 68 ? -4.771  -3.464  7.294   1.00 1.00 ? 68  GLN A HA   8  
ATOM   10405 H HB2  . GLN A 1 68 ? -3.289  -2.244  9.615   1.00 1.00 ? 68  GLN A HB2  8  
ATOM   10406 H HB3  . GLN A 1 68 ? -5.020  -2.460  9.684   1.00 1.00 ? 68  GLN A HB3  8  
ATOM   10407 H HG2  . GLN A 1 68 ? -3.187  -4.714  8.944   1.00 1.00 ? 68  GLN A HG2  8  
ATOM   10408 H HG3  . GLN A 1 68 ? -3.606  -4.373  10.616  1.00 1.00 ? 68  GLN A HG3  8  
ATOM   10409 H HE21 . GLN A 1 68 ? -4.444  -6.561  8.456   1.00 1.00 ? 68  GLN A HE21 8  
ATOM   10410 H HE22 . GLN A 1 68 ? -6.117  -6.662  8.690   1.00 1.00 ? 68  GLN A HE22 8  
ATOM   10411 N N    . GLN A 1 69 ? -4.231  -0.216  7.701   1.00 1.00 ? 69  GLN A N    8  
ATOM   10412 C CA   . GLN A 1 69 ? -4.795  1.092   7.419   1.00 1.00 ? 69  GLN A CA   8  
ATOM   10413 C C    . GLN A 1 69 ? -4.798  1.362   5.922   1.00 1.00 ? 69  GLN A C    8  
ATOM   10414 O O    . GLN A 1 69 ? -5.776  1.869   5.376   1.00 1.00 ? 69  GLN A O    8  
ATOM   10415 C CB   . GLN A 1 69 ? -3.980  2.170   8.134   1.00 1.00 ? 69  GLN A CB   8  
ATOM   10416 C CG   . GLN A 1 69 ? -4.627  3.525   7.914   1.00 1.00 ? 69  GLN A CG   8  
ATOM   10417 C CD   . GLN A 1 69 ? -3.973  4.579   8.805   1.00 1.00 ? 69  GLN A CD   8  
ATOM   10418 O OE1  . GLN A 1 69 ? -3.964  4.436   10.027  1.00 1.00 ? 69  GLN A OE1  8  
ATOM   10419 N NE2  . GLN A 1 69 ? -3.412  5.624   8.263   1.00 1.00 ? 69  GLN A NE2  8  
ATOM   10420 H H    . GLN A 1 69 ? -3.358  -0.272  8.135   1.00 1.00 ? 69  GLN A H    8  
ATOM   10421 H HA   . GLN A 1 69 ? -5.807  1.119   7.785   1.00 1.00 ? 69  GLN A HA   8  
ATOM   10422 H HB2  . GLN A 1 69 ? -3.948  1.954   9.189   1.00 1.00 ? 69  GLN A HB2  8  
ATOM   10423 H HB3  . GLN A 1 69 ? -2.976  2.192   7.729   1.00 1.00 ? 69  GLN A HB3  8  
ATOM   10424 H HG2  . GLN A 1 69 ? -4.509  3.803   6.882   1.00 1.00 ? 69  GLN A HG2  8  
ATOM   10425 H HG3  . GLN A 1 69 ? -5.670  3.454   8.154   1.00 1.00 ? 69  GLN A HG3  8  
ATOM   10426 H HE21 . GLN A 1 69 ? -3.413  5.730   7.291   1.00 1.00 ? 69  GLN A HE21 8  
ATOM   10427 H HE22 . GLN A 1 69 ? -2.984  6.299   8.830   1.00 1.00 ? 69  GLN A HE22 8  
ATOM   10428 N N    . ALA A 1 70 ? -3.696  1.022   5.259   1.00 1.00 ? 70  ALA A N    8  
ATOM   10429 C CA   . ALA A 1 70 ? -3.587  1.244   3.821   1.00 1.00 ? 70  ALA A CA   8  
ATOM   10430 C C    . ALA A 1 70 ? -4.738  0.569   3.083   1.00 1.00 ? 70  ALA A C    8  
ATOM   10431 O O    . ALA A 1 70 ? -5.389  1.180   2.235   1.00 1.00 ? 70  ALA A O    8  
ATOM   10432 C CB   . ALA A 1 70 ? -2.258  0.686   3.309   1.00 1.00 ? 70  ALA A CB   8  
ATOM   10433 H H    . ALA A 1 70 ? -2.938  0.626   5.748   1.00 1.00 ? 70  ALA A H    8  
ATOM   10434 H HA   . ALA A 1 70 ? -3.621  2.303   3.624   1.00 1.00 ? 70  ALA A HA   8  
ATOM   10435 H HB1  . ALA A 1 70 ? -2.044  1.100   2.340   1.00 1.00 ? 70  ALA A HB1  8  
ATOM   10436 H HB2  . ALA A 1 70 ? -2.327  -0.385  3.227   1.00 1.00 ? 70  ALA A HB2  8  
ATOM   10437 H HB3  . ALA A 1 70 ? -1.464  0.949   3.998   1.00 1.00 ? 70  ALA A HB3  8  
ATOM   10438 N N    . ALA A 1 71 ? -4.982  -0.696  3.409   1.00 1.00 ? 71  ALA A N    8  
ATOM   10439 C CA   . ALA A 1 71 ? -6.056  -1.441  2.766   1.00 1.00 ? 71  ALA A CA   8  
ATOM   10440 C C    . ALA A 1 71 ? -7.412  -0.832  3.098   1.00 1.00 ? 71  ALA A C    8  
ATOM   10441 O O    . ALA A 1 71 ? -8.280  -0.727  2.237   1.00 1.00 ? 71  ALA A O    8  
ATOM   10442 C CB   . ALA A 1 71 ? -6.028  -2.901  3.235   1.00 1.00 ? 71  ALA A CB   8  
ATOM   10443 H H    . ALA A 1 71 ? -4.429  -1.133  4.090   1.00 1.00 ? 71  ALA A H    8  
ATOM   10444 H HA   . ALA A 1 71 ? -5.912  -1.416  1.699   1.00 1.00 ? 71  ALA A HA   8  
ATOM   10445 H HB1  . ALA A 1 71 ? -5.118  -3.371  2.894   1.00 1.00 ? 71  ALA A HB1  8  
ATOM   10446 H HB2  . ALA A 1 71 ? -6.879  -3.428  2.828   1.00 1.00 ? 71  ALA A HB2  8  
ATOM   10447 H HB3  . ALA A 1 71 ? -6.066  -2.932  4.313   1.00 1.00 ? 71  ALA A HB3  8  
ATOM   10448 N N    . ASP A 1 72 ? -7.581  -0.417  4.348   1.00 1.00 ? 72  ASP A N    8  
ATOM   10449 C CA   . ASP A 1 72 ? -8.848  0.164   4.780   1.00 1.00 ? 72  ASP A CA   8  
ATOM   10450 C C    . ASP A 1 72 ? -9.082  1.496   4.064   1.00 1.00 ? 72  ASP A C    8  
ATOM   10451 O O    . ASP A 1 72 ? -10.210 1.811   3.682   1.00 1.00 ? 72  ASP A O    8  
ATOM   10452 C CB   . ASP A 1 72 ? -8.815  0.398   6.302   1.00 1.00 ? 72  ASP A CB   8  
ATOM   10453 C CG   . ASP A 1 72 ? -9.232  -0.872  7.033   1.00 1.00 ? 72  ASP A CG   8  
ATOM   10454 O OD1  . ASP A 1 72 ? -10.295 -1.384  6.729   1.00 1.00 ? 72  ASP A OD1  8  
ATOM   10455 O OD2  . ASP A 1 72 ? -8.473  -1.322  7.878   1.00 1.00 ? 72  ASP A OD2  8  
ATOM   10456 H H    . ASP A 1 72 ? -6.856  -0.536  4.997   1.00 1.00 ? 72  ASP A H    8  
ATOM   10457 H HA   . ASP A 1 72 ? -9.648  -0.511  4.530   1.00 1.00 ? 72  ASP A HA   8  
ATOM   10458 H HB2  . ASP A 1 72 ? -7.815  0.677   6.601   1.00 1.00 ? 72  ASP A HB2  8  
ATOM   10459 H HB3  . ASP A 1 72 ? -9.501  1.193   6.565   1.00 1.00 ? 72  ASP A HB3  8  
ATOM   10460 N N    . VAL A 1 73 ? -8.019  2.274   3.902   1.00 1.00 ? 73  VAL A N    8  
ATOM   10461 C CA   . VAL A 1 73 ? -8.129  3.565   3.239   1.00 1.00 ? 73  VAL A CA   8  
ATOM   10462 C C    . VAL A 1 73 ? -8.524  3.386   1.777   1.00 1.00 ? 73  VAL A C    8  
ATOM   10463 O O    . VAL A 1 73 ? -9.358  4.123   1.254   1.00 1.00 ? 73  VAL A O    8  
ATOM   10464 C CB   . VAL A 1 73 ? -6.798  4.315   3.332   1.00 1.00 ? 73  VAL A CB   8  
ATOM   10465 C CG1  . VAL A 1 73 ? -6.844  5.560   2.439   1.00 1.00 ? 73  VAL A CG1  8  
ATOM   10466 C CG2  . VAL A 1 73 ? -6.549  4.741   4.786   1.00 1.00 ? 73  VAL A CG2  8  
ATOM   10467 H H    . VAL A 1 73 ? -7.143  1.974   4.240   1.00 1.00 ? 73  VAL A H    8  
ATOM   10468 H HA   . VAL A 1 73 ? -8.888  4.147   3.735   1.00 1.00 ? 73  VAL A HA   8  
ATOM   10469 H HB   . VAL A 1 73 ? -5.996  3.668   3.004   1.00 1.00 ? 73  VAL A HB   8  
ATOM   10470 H HG11 . VAL A 1 73 ? -6.662  5.270   1.415   1.00 1.00 ? 73  VAL A HG11 8  
ATOM   10471 H HG12 . VAL A 1 73 ? -6.088  6.265   2.755   1.00 1.00 ? 73  VAL A HG12 8  
ATOM   10472 H HG13 . VAL A 1 73 ? -7.816  6.027   2.513   1.00 1.00 ? 73  VAL A HG13 8  
ATOM   10473 H HG21 . VAL A 1 73 ? -7.136  5.619   5.012   1.00 1.00 ? 73  VAL A HG21 8  
ATOM   10474 H HG22 . VAL A 1 73 ? -5.501  4.965   4.919   1.00 1.00 ? 73  VAL A HG22 8  
ATOM   10475 H HG23 . VAL A 1 73 ? -6.832  3.941   5.454   1.00 1.00 ? 73  VAL A HG23 8  
ATOM   10476 N N    . ILE A 1 74 ? -7.904  2.416   1.122   1.00 1.00 ? 74  ILE A N    8  
ATOM   10477 C CA   . ILE A 1 74 ? -8.186  2.160   -0.282  1.00 1.00 ? 74  ILE A CA   8  
ATOM   10478 C C    . ILE A 1 74 ? -9.645  1.755   -0.463  1.00 1.00 ? 74  ILE A C    8  
ATOM   10479 O O    . ILE A 1 74 ? -10.307 2.198   -1.401  1.00 1.00 ? 74  ILE A O    8  
ATOM   10480 C CB   . ILE A 1 74 ? -7.263  1.048   -0.809  1.00 1.00 ? 74  ILE A CB   8  
ATOM   10481 C CG1  . ILE A 1 74 ? -5.870  1.628   -1.089  1.00 1.00 ? 74  ILE A CG1  8  
ATOM   10482 C CG2  . ILE A 1 74 ? -7.840  0.461   -2.106  1.00 1.00 ? 74  ILE A CG2  8  
ATOM   10483 C CD1  . ILE A 1 74 ? -4.849  0.491   -1.152  1.00 1.00 ? 74  ILE A CD1  8  
ATOM   10484 H H    . ILE A 1 74 ? -7.235  1.871   1.587   1.00 1.00 ? 74  ILE A H    8  
ATOM   10485 H HA   . ILE A 1 74 ? -8.003  3.063   -0.848  1.00 1.00 ? 74  ILE A HA   8  
ATOM   10486 H HB   . ILE A 1 74 ? -7.183  0.269   -0.066  1.00 1.00 ? 74  ILE A HB   8  
ATOM   10487 H HG12 . ILE A 1 74 ? -5.880  2.157   -2.031  1.00 1.00 ? 74  ILE A HG12 8  
ATOM   10488 H HG13 . ILE A 1 74 ? -5.598  2.307   -0.300  1.00 1.00 ? 74  ILE A HG13 8  
ATOM   10489 H HG21 . ILE A 1 74 ? -8.597  -0.265  -1.859  1.00 1.00 ? 74  ILE A HG21 8  
ATOM   10490 H HG22 . ILE A 1 74 ? -7.059  -0.018  -2.681  1.00 1.00 ? 74  ILE A HG22 8  
ATOM   10491 H HG23 . ILE A 1 74 ? -8.282  1.251   -2.693  1.00 1.00 ? 74  ILE A HG23 8  
ATOM   10492 H HD11 . ILE A 1 74 ? -3.961  0.835   -1.660  1.00 1.00 ? 74  ILE A HD11 8  
ATOM   10493 H HD12 . ILE A 1 74 ? -5.273  -0.344  -1.689  1.00 1.00 ? 74  ILE A HD12 8  
ATOM   10494 H HD13 . ILE A 1 74 ? -4.594  0.182   -0.149  1.00 1.00 ? 74  ILE A HD13 8  
ATOM   10495 N N    . GLU A 1 75 ? -10.130 0.902   0.428   1.00 1.00 ? 75  GLU A N    8  
ATOM   10496 C CA   . GLU A 1 75 ? -11.510 0.438   0.346   1.00 1.00 ? 75  GLU A CA   8  
ATOM   10497 C C    . GLU A 1 75 ? -12.453 1.614   0.133   1.00 1.00 ? 75  GLU A C    8  
ATOM   10498 O O    . GLU A 1 75 ? -13.343 1.556   -0.714  1.00 1.00 ? 75  GLU A O    8  
ATOM   10499 C CB   . GLU A 1 75 ? -11.885 -0.304  1.633   1.00 1.00 ? 75  GLU A CB   8  
ATOM   10500 C CG   . GLU A 1 75 ? -11.320 -1.723  1.596   1.00 1.00 ? 75  GLU A CG   8  
ATOM   10501 C CD   . GLU A 1 75 ? -11.648 -2.444  2.897   1.00 1.00 ? 75  GLU A CD   8  
ATOM   10502 O OE1  . GLU A 1 75 ? -12.248 -1.828  3.762   1.00 1.00 ? 75  GLU A OE1  8  
ATOM   10503 O OE2  . GLU A 1 75 ? -11.298 -3.603  3.005   1.00 1.00 ? 75  GLU A OE2  8  
ATOM   10504 H H    . GLU A 1 75 ? -9.548  0.570   1.145   1.00 1.00 ? 75  GLU A H    8  
ATOM   10505 H HA   . GLU A 1 75 ? -11.607 -0.238  -0.488  1.00 1.00 ? 75  GLU A HA   8  
ATOM   10506 H HB2  . GLU A 1 75 ? -11.469 0.222   2.478   1.00 1.00 ? 75  GLU A HB2  8  
ATOM   10507 H HB3  . GLU A 1 75 ? -12.959 -0.352  1.729   1.00 1.00 ? 75  GLU A HB3  8  
ATOM   10508 H HG2  . GLU A 1 75 ? -11.757 -2.259  0.769   1.00 1.00 ? 75  GLU A HG2  8  
ATOM   10509 H HG3  . GLU A 1 75 ? -10.253 -1.683  1.470   1.00 1.00 ? 75  GLU A HG3  8  
ATOM   10510 N N    . GLY A 1 76 ? -12.251 2.675   0.899   1.00 1.00 ? 76  GLY A N    8  
ATOM   10511 C CA   . GLY A 1 76 ? -13.094 3.860   0.785   1.00 1.00 ? 76  GLY A CA   8  
ATOM   10512 C C    . GLY A 1 76 ? -12.939 4.503   -0.588  1.00 1.00 ? 76  GLY A C    8  
ATOM   10513 O O    . GLY A 1 76 ? -13.911 4.967   -1.183  1.00 1.00 ? 76  GLY A O    8  
ATOM   10514 H H    . GLY A 1 76 ? -11.523 2.663   1.555   1.00 1.00 ? 76  GLY A H    8  
ATOM   10515 H HA2  . GLY A 1 76 ? -14.127 3.574   0.930   1.00 1.00 ? 76  GLY A HA2  8  
ATOM   10516 H HA3  . GLY A 1 76 ? -12.811 4.570   1.542   1.00 1.00 ? 76  GLY A HA3  8  
ATOM   10517 N N    . LEU A 1 77 ? -11.709 4.531   -1.087  1.00 1.00 ? 77  LEU A N    8  
ATOM   10518 C CA   . LEU A 1 77 ? -11.438 5.115   -2.394  1.00 1.00 ? 77  LEU A CA   8  
ATOM   10519 C C    . LEU A 1 77 ? -12.129 4.329   -3.496  1.00 1.00 ? 77  LEU A C    8  
ATOM   10520 O O    . LEU A 1 77 ? -12.637 4.907   -4.457  1.00 1.00 ? 77  LEU A O    8  
ATOM   10521 C CB   . LEU A 1 77 ? -9.926  5.145   -2.645  1.00 1.00 ? 77  LEU A CB   8  
ATOM   10522 C CG   . LEU A 1 77 ? -9.289  6.303   -1.862  1.00 1.00 ? 77  LEU A CG   8  
ATOM   10523 C CD1  . LEU A 1 77 ? -7.774  6.107   -1.811  1.00 1.00 ? 77  LEU A CD1  8  
ATOM   10524 C CD2  . LEU A 1 77 ? -9.618  7.646   -2.550  1.00 1.00 ? 77  LEU A CD2  8  
ATOM   10525 H H    . LEU A 1 77 ? -10.969 4.148   -0.568  1.00 1.00 ? 77  LEU A H    8  
ATOM   10526 H HA   . LEU A 1 77 ? -11.824 6.111   -2.406  1.00 1.00 ? 77  LEU A HA   8  
ATOM   10527 H HB2  . LEU A 1 77 ? -9.500  4.210   -2.314  1.00 1.00 ? 77  LEU A HB2  8  
ATOM   10528 H HB3  . LEU A 1 77 ? -9.727  5.273   -3.707  1.00 1.00 ? 77  LEU A HB3  8  
ATOM   10529 H HG   . LEU A 1 77 ? -9.673  6.314   -0.848  1.00 1.00 ? 77  LEU A HG   8  
ATOM   10530 H HD11 . LEU A 1 77 ? -7.525  5.418   -1.019  1.00 1.00 ? 77  LEU A HD11 8  
ATOM   10531 H HD12 . LEU A 1 77 ? -7.302  7.054   -1.623  1.00 1.00 ? 77  LEU A HD12 8  
ATOM   10532 H HD13 . LEU A 1 77 ? -7.424  5.715   -2.753  1.00 1.00 ? 77  LEU A HD13 8  
ATOM   10533 H HD21 . LEU A 1 77 ? -8.870  8.374   -2.293  1.00 1.00 ? 77  LEU A HD21 8  
ATOM   10534 H HD22 . LEU A 1 77 ? -10.578 7.997   -2.215  1.00 1.00 ? 77  LEU A HD22 8  
ATOM   10535 H HD23 . LEU A 1 77 ? -9.638  7.521   -3.622  1.00 1.00 ? 77  LEU A HD23 8  
ATOM   10536 N N    . LEU A 1 78 ? -12.140 3.017   -3.353  1.00 1.00 ? 78  LEU A N    8  
ATOM   10537 C CA   . LEU A 1 78 ? -12.767 2.160   -4.347  1.00 1.00 ? 78  LEU A CA   8  
ATOM   10538 C C    . LEU A 1 78 ? -14.244 2.490   -4.480  1.00 1.00 ? 78  LEU A C    8  
ATOM   10539 O O    . LEU A 1 78 ? -14.797 2.460   -5.581  1.00 1.00 ? 78  LEU A O    8  
ATOM   10540 C CB   . LEU A 1 78 ? -12.597 0.686   -3.944  1.00 1.00 ? 78  LEU A CB   8  
ATOM   10541 C CG   . LEU A 1 78 ? -11.211 0.181   -4.375  1.00 1.00 ? 78  LEU A CG   8  
ATOM   10542 C CD1  . LEU A 1 78 ? -10.843 -1.067  -3.572  1.00 1.00 ? 78  LEU A CD1  8  
ATOM   10543 C CD2  . LEU A 1 78 ? -11.228 -0.168  -5.873  1.00 1.00 ? 78  LEU A CD2  8  
ATOM   10544 H H    . LEU A 1 78 ? -11.712 2.613   -2.568  1.00 1.00 ? 78  LEU A H    8  
ATOM   10545 H HA   . LEU A 1 78 ? -12.294 2.330   -5.297  1.00 1.00 ? 78  LEU A HA   8  
ATOM   10546 H HB2  . LEU A 1 78 ? -12.691 0.606   -2.875  1.00 1.00 ? 78  LEU A HB2  8  
ATOM   10547 H HB3  . LEU A 1 78 ? -13.364 0.084   -4.407  1.00 1.00 ? 78  LEU A HB3  8  
ATOM   10548 H HG   . LEU A 1 78 ? -10.472 0.951   -4.189  1.00 1.00 ? 78  LEU A HG   8  
ATOM   10549 H HD11 . LEU A 1 78 ? -11.610 -1.814  -3.697  1.00 1.00 ? 78  LEU A HD11 8  
ATOM   10550 H HD12 . LEU A 1 78 ? -10.760 -0.808  -2.534  1.00 1.00 ? 78  LEU A HD12 8  
ATOM   10551 H HD13 . LEU A 1 78 ? -9.898  -1.454  -3.920  1.00 1.00 ? 78  LEU A HD13 8  
ATOM   10552 H HD21 . LEU A 1 78 ? -12.136 -0.695  -6.119  1.00 1.00 ? 78  LEU A HD21 8  
ATOM   10553 H HD22 . LEU A 1 78 ? -10.388 -0.796  -6.102  1.00 1.00 ? 78  LEU A HD22 8  
ATOM   10554 H HD23 . LEU A 1 78 ? -11.169 0.734   -6.458  1.00 1.00 ? 78  LEU A HD23 8  
ATOM   10555 N N    . GLU A 1 79 ? -14.880 2.791   -3.356  1.00 1.00 ? 79  GLU A N    8  
ATOM   10556 C CA   . GLU A 1 79 ? -16.296 3.118   -3.370  1.00 1.00 ? 79  GLU A CA   8  
ATOM   10557 C C    . GLU A 1 79 ? -16.523 4.446   -4.086  1.00 1.00 ? 79  GLU A C    8  
ATOM   10558 O O    . GLU A 1 79 ? -17.269 4.515   -5.062  1.00 1.00 ? 79  GLU A O    8  
ATOM   10559 C CB   . GLU A 1 79 ? -16.816 3.208   -1.931  1.00 1.00 ? 79  GLU A CB   8  
ATOM   10560 C CG   . GLU A 1 79 ? -16.641 1.855   -1.242  1.00 1.00 ? 79  GLU A CG   8  
ATOM   10561 C CD   . GLU A 1 79 ? -17.537 0.811   -1.901  1.00 1.00 ? 79  GLU A CD   8  
ATOM   10562 O OE1  . GLU A 1 79 ? -18.486 1.203   -2.557  1.00 1.00 ? 79  GLU A OE1  8  
ATOM   10563 O OE2  . GLU A 1 79 ? -17.260 -0.367  -1.737  1.00 1.00 ? 79  GLU A OE2  8  
ATOM   10564 H H    . GLU A 1 79 ? -14.388 2.800   -2.505  1.00 1.00 ? 79  GLU A H    8  
ATOM   10565 H HA   . GLU A 1 79 ? -16.837 2.341   -3.890  1.00 1.00 ? 79  GLU A HA   8  
ATOM   10566 H HB2  . GLU A 1 79 ? -16.262 3.962   -1.391  1.00 1.00 ? 79  GLU A HB2  8  
ATOM   10567 H HB3  . GLU A 1 79 ? -17.864 3.468   -1.942  1.00 1.00 ? 79  GLU A HB3  8  
ATOM   10568 H HG2  . GLU A 1 79 ? -15.612 1.543   -1.322  1.00 1.00 ? 79  GLU A HG2  8  
ATOM   10569 H HG3  . GLU A 1 79 ? -16.908 1.956   -0.202  1.00 1.00 ? 79  GLU A HG3  8  
ATOM   10570 N N    . LYS A 1 80 ? -15.896 5.501   -3.575  1.00 1.00 ? 80  LYS A N    8  
ATOM   10571 C CA   . LYS A 1 80 ? -16.064 6.832   -4.153  1.00 1.00 ? 80  LYS A CA   8  
ATOM   10572 C C    . LYS A 1 80 ? -15.091 7.817   -3.515  1.00 1.00 ? 80  LYS A C    8  
ATOM   10573 O O    . LYS A 1 80 ? -14.794 8.865   -4.084  1.00 1.00 ? 80  LYS A O    8  
ATOM   10574 C CB   . LYS A 1 80 ? -17.510 7.323   -3.947  1.00 1.00 ? 80  LYS A CB   8  
ATOM   10575 C CG   . LYS A 1 80 ? -18.037 6.864   -2.561  1.00 1.00 ? 80  LYS A CG   8  
ATOM   10576 C CD   . LYS A 1 80 ? -17.785 7.960   -1.532  1.00 1.00 ? 80  LYS A CD   8  
ATOM   10577 C CE   . LYS A 1 80 ? -18.035 7.402   -0.135  1.00 1.00 ? 80  LYS A CE   8  
ATOM   10578 N NZ   . LYS A 1 80 ? -17.677 8.433   0.879   1.00 1.00 ? 80  LYS A NZ   8  
ATOM   10579 H H    . LYS A 1 80 ? -15.340 5.391   -2.772  1.00 1.00 ? 80  LYS A H    8  
ATOM   10580 H HA   . LYS A 1 80 ? -15.864 6.780   -5.209  1.00 1.00 ? 80  LYS A HA   8  
ATOM   10581 H HB2  . LYS A 1 80 ? -17.544 8.409   -4.015  1.00 1.00 ? 80  LYS A HB2  8  
ATOM   10582 H HB3  . LYS A 1 80 ? -18.144 6.914   -4.723  1.00 1.00 ? 80  LYS A HB3  8  
ATOM   10583 H HG2  . LYS A 1 80 ? -19.090 6.667   -2.630  1.00 1.00 ? 80  LYS A HG2  8  
ATOM   10584 H HG3  . LYS A 1 80 ? -17.551 5.967   -2.232  1.00 1.00 ? 80  LYS A HG3  8  
ATOM   10585 H HD2  . LYS A 1 80 ? -16.765 8.296   -1.604  1.00 1.00 ? 80  LYS A HD2  8  
ATOM   10586 H HD3  . LYS A 1 80 ? -18.446 8.784   -1.717  1.00 1.00 ? 80  LYS A HD3  8  
ATOM   10587 H HE2  . LYS A 1 80 ? -19.076 7.143   -0.038  1.00 1.00 ? 80  LYS A HE2  8  
ATOM   10588 H HE3  . LYS A 1 80 ? -17.426 6.516   0.017   1.00 1.00 ? 80  LYS A HE3  8  
ATOM   10589 H HZ1  . LYS A 1 80 ? -17.610 9.365   0.420   1.00 1.00 ? 80  LYS A HZ1  8  
ATOM   10590 H HZ2  . LYS A 1 80 ? -16.760 8.193   1.309   1.00 1.00 ? 80  LYS A HZ2  8  
ATOM   10591 H HZ3  . LYS A 1 80 ? -18.408 8.465   1.614   1.00 1.00 ? 80  LYS A HZ3  8  
ATOM   10592 N N    . LYS A 1 81 ? -14.617 7.480   -2.317  1.00 1.00 ? 81  LYS A N    8  
ATOM   10593 C CA   . LYS A 1 81 ? -13.688 8.351   -1.605  1.00 1.00 ? 81  LYS A CA   8  
ATOM   10594 C C    . LYS A 1 81 ? -13.165 7.661   -0.350  1.00 1.00 ? 81  LYS A C    8  
ATOM   10595 O O    . LYS A 1 81 ? -13.860 6.849   0.260   1.00 1.00 ? 81  LYS A O    8  
ATOM   10596 C CB   . LYS A 1 81 ? -14.378 9.662   -1.220  1.00 1.00 ? 81  LYS A CB   8  
ATOM   10597 C CG   . LYS A 1 81 ? -13.343 10.633  -0.652  1.00 1.00 ? 81  LYS A CG   8  
ATOM   10598 C CD   . LYS A 1 81 ? -14.019 11.970  -0.335  1.00 1.00 ? 81  LYS A CD   8  
ATOM   10599 C CE   . LYS A 1 81 ? -12.982 12.948  0.219   1.00 1.00 ? 81  LYS A CE   8  
ATOM   10600 N NZ   . LYS A 1 81 ? -13.636 14.253  0.513   1.00 1.00 ? 81  LYS A NZ   8  
ATOM   10601 H H    . LYS A 1 81 ? -14.901 6.634   -1.903  1.00 1.00 ? 81  LYS A H    8  
ATOM   10602 H HA   . LYS A 1 81 ? -12.857 8.573   -2.255  1.00 1.00 ? 81  LYS A HA   8  
ATOM   10603 H HB2  . LYS A 1 81 ? -14.840 10.098  -2.093  1.00 1.00 ? 81  LYS A HB2  8  
ATOM   10604 H HB3  . LYS A 1 81 ? -15.127 9.469   -0.470  1.00 1.00 ? 81  LYS A HB3  8  
ATOM   10605 H HG2  . LYS A 1 81 ? -12.920 10.221  0.252   1.00 1.00 ? 81  LYS A HG2  8  
ATOM   10606 H HG3  . LYS A 1 81 ? -12.561 10.792  -1.377  1.00 1.00 ? 81  LYS A HG3  8  
ATOM   10607 H HD2  . LYS A 1 81 ? -14.453 12.376  -1.239  1.00 1.00 ? 81  LYS A HD2  8  
ATOM   10608 H HD3  . LYS A 1 81 ? -14.794 11.817  0.400   1.00 1.00 ? 81  LYS A HD3  8  
ATOM   10609 H HE2  . LYS A 1 81 ? -12.555 12.545  1.125   1.00 1.00 ? 81  LYS A HE2  8  
ATOM   10610 H HE3  . LYS A 1 81 ? -12.200 13.095  -0.513  1.00 1.00 ? 81  LYS A HE3  8  
ATOM   10611 H HZ1  . LYS A 1 81 ? -13.717 14.376  1.542   1.00 1.00 ? 81  LYS A HZ1  8  
ATOM   10612 H HZ2  . LYS A 1 81 ? -14.586 14.268  0.085   1.00 1.00 ? 81  LYS A HZ2  8  
ATOM   10613 H HZ3  . LYS A 1 81 ? -13.065 15.026  0.119   1.00 1.00 ? 81  LYS A HZ3  8  
ATOM   10614 N N    . ALA A 1 82 ? -11.938 7.996   0.034   1.00 1.00 ? 82  ALA A N    8  
ATOM   10615 C CA   . ALA A 1 82 ? -11.333 7.403   1.223   1.00 1.00 ? 82  ALA A CA   8  
ATOM   10616 C C    . ALA A 1 82 ? -12.300 7.457   2.400   1.00 1.00 ? 82  ALA A C    8  
ATOM   10617 O O    . ALA A 1 82 ? -12.765 8.543   2.710   1.00 1.00 ? 82  ALA A O    8  
ATOM   10618 C CB   . ALA A 1 82 ? -10.049 8.154   1.581   1.00 1.00 ? 82  ALA A CB   8  
ATOM   10619 O OXT  . ALA A 1 82 ? -12.562 6.415   2.975   1.00 1.00 ? 82  ALA A OXT  8  
ATOM   10620 H H    . ALA A 1 82 ? -11.431 8.652   -0.489  1.00 1.00 ? 82  ALA A H    8  
ATOM   10621 H HA   . ALA A 1 82 ? -11.088 6.373   1.017   1.00 1.00 ? 82  ALA A HA   8  
ATOM   10622 H HB1  . ALA A 1 82 ? -9.345  8.076   0.765   1.00 1.00 ? 82  ALA A HB1  8  
ATOM   10623 H HB2  . ALA A 1 82 ? -9.616  7.724   2.472   1.00 1.00 ? 82  ALA A HB2  8  
ATOM   10624 H HB3  . ALA A 1 82 ? -10.278 9.194   1.760   1.00 1.00 ? 82  ALA A HB3  8  
HETATM 10625 O O23  . PNS B 2 .  ? 14.516  5.880   -3.135  1.00 1.00 ? 101 PNS A O23  8  
HETATM 10626 P P24  . PNS B 2 .  ? 14.297  4.687   -4.195  1.00 1.00 ? 101 PNS A P24  8  
HETATM 10627 O O25  . PNS B 2 .  ? 13.540  3.604   -3.525  1.00 1.00 ? 101 PNS A O25  8  
HETATM 10628 O O26  . PNS B 2 .  ? 13.790  5.272   -5.455  1.00 1.00 ? 101 PNS A O26  8  
HETATM 10629 O O27  . PNS B 2 .  ? 15.797  4.165   -4.452  1.00 1.00 ? 101 PNS A O27  8  
HETATM 10630 C C28  . PNS B 2 .  ? 16.288  3.018   -3.768  1.00 1.00 ? 101 PNS A C28  8  
HETATM 10631 C C29  . PNS B 2 .  ? 17.733  2.750   -4.200  1.00 1.00 ? 101 PNS A C29  8  
HETATM 10632 C C30  . PNS B 2 .  ? 18.545  4.043   -4.116  1.00 1.00 ? 101 PNS A C30  8  
HETATM 10633 C C31  . PNS B 2 .  ? 17.739  2.228   -5.643  1.00 1.00 ? 101 PNS A C31  8  
HETATM 10634 C C32  . PNS B 2 .  ? 18.369  1.714   -3.277  1.00 1.00 ? 101 PNS A C32  8  
HETATM 10635 O O33  . PNS B 2 .  ? 18.311  2.200   -1.946  1.00 1.00 ? 101 PNS A O33  8  
HETATM 10636 C C34  . PNS B 2 .  ? 17.606  0.395   -3.370  1.00 1.00 ? 101 PNS A C34  8  
HETATM 10637 O O35  . PNS B 2 .  ? 18.027  -0.529  -4.070  1.00 1.00 ? 101 PNS A O35  8  
HETATM 10638 N N36  . PNS B 2 .  ? 16.481  0.313   -2.666  1.00 1.00 ? 101 PNS A N36  8  
HETATM 10639 C C37  . PNS B 2 .  ? 15.667  -0.901  -2.683  1.00 1.00 ? 101 PNS A C37  8  
HETATM 10640 C C38  . PNS B 2 .  ? 14.240  -0.585  -2.231  1.00 1.00 ? 101 PNS A C38  8  
HETATM 10641 C C39  . PNS B 2 .  ? 14.243  -0.117  -0.780  1.00 1.00 ? 101 PNS A C39  8  
HETATM 10642 O O40  . PNS B 2 .  ? 14.977  -0.649  0.053   1.00 1.00 ? 101 PNS A O40  8  
HETATM 10643 N N41  . PNS B 2 .  ? 13.418  0.882   -0.484  1.00 1.00 ? 101 PNS A N41  8  
HETATM 10644 C C42  . PNS B 2 .  ? 13.335  1.415   0.871   1.00 1.00 ? 101 PNS A C42  8  
HETATM 10645 C C43  . PNS B 2 .  ? 12.630  2.772   0.865   1.00 1.00 ? 101 PNS A C43  8  
HETATM 10646 S S44  . PNS B 2 .  ? 12.066  3.157   2.519   1.00 1.00 ? 101 PNS A S44  8  
HETATM 10647 H H282 . PNS B 2 .  ? 15.671  2.172   -4.016  1.00 1.00 ? 101 PNS A H282 8  
HETATM 10648 H H281 . PNS B 2 .  ? 16.258  3.179   -2.699  1.00 1.00 ? 101 PNS A H281 8  
HETATM 10649 H H303 . PNS B 2 .  ? 18.108  4.780   -4.770  1.00 1.00 ? 101 PNS A H303 8  
HETATM 10650 H H302 . PNS B 2 .  ? 18.538  4.410   -3.101  1.00 1.00 ? 101 PNS A H302 8  
HETATM 10651 H H301 . PNS B 2 .  ? 19.564  3.849   -4.422  1.00 1.00 ? 101 PNS A H301 8  
HETATM 10652 H H313 . PNS B 2 .  ? 18.741  1.925   -5.910  1.00 1.00 ? 101 PNS A H313 8  
HETATM 10653 H H312 . PNS B 2 .  ? 17.073  1.382   -5.724  1.00 1.00 ? 101 PNS A H312 8  
HETATM 10654 H H311 . PNS B 2 .  ? 17.410  3.011   -6.311  1.00 1.00 ? 101 PNS A H311 8  
HETATM 10655 H H32  . PNS B 2 .  ? 19.403  1.548   -3.562  1.00 1.00 ? 101 PNS A H32  8  
HETATM 10656 H H33  . PNS B 2 .  ? 19.042  1.812   -1.459  1.00 1.00 ? 101 PNS A H33  8  
HETATM 10657 H H36  . PNS B 2 .  ? 16.191  1.077   -2.129  1.00 1.00 ? 101 PNS A H36  8  
HETATM 10658 H H372 . PNS B 2 .  ? 16.102  -1.628  -2.017  1.00 1.00 ? 101 PNS A H372 8  
HETATM 10659 H H371 . PNS B 2 .  ? 15.642  -1.305  -3.685  1.00 1.00 ? 101 PNS A H371 8  
HETATM 10660 H H382 . PNS B 2 .  ? 13.829  0.192   -2.858  1.00 1.00 ? 101 PNS A H382 8  
HETATM 10661 H H381 . PNS B 2 .  ? 13.633  -1.475  -2.316  1.00 1.00 ? 101 PNS A H381 8  
HETATM 10662 H H41  . PNS B 2 .  ? 12.856  1.267   -1.188  1.00 1.00 ? 101 PNS A H41  8  
HETATM 10663 H H422 . PNS B 2 .  ? 14.331  1.531   1.269   1.00 1.00 ? 101 PNS A H422 8  
HETATM 10664 H H421 . PNS B 2 .  ? 12.781  0.728   1.495   1.00 1.00 ? 101 PNS A H421 8  
HETATM 10665 H H431 . PNS B 2 .  ? 11.784  2.735   0.194   1.00 1.00 ? 101 PNS A H431 8  
HETATM 10666 H H432 . PNS B 2 .  ? 13.319  3.535   0.534   1.00 1.00 ? 101 PNS A H432 8  
HETATM 10667 C C1   . STE C 3 .  ? 11.988  4.846   2.924   1.00 1.00 ? 102 STE A C1   8  
HETATM 10668 O O1   . STE C 3 .  ? 12.287  5.728   2.154   1.00 1.00 ? 102 STE A O1   8  
HETATM 10669 C C2   . STE C 3 .  ? 11.507  5.057   4.327   1.00 1.00 ? 102 STE A C2   8  
HETATM 10670 C C3   . STE C 3 .  ? 11.469  6.555   4.644   1.00 1.00 ? 102 STE A C3   8  
HETATM 10671 C C4   . STE C 3 .  ? 10.277  7.205   3.920   1.00 1.00 ? 102 STE A C4   8  
HETATM 10672 C C5   . STE C 3 .  ? 9.019   7.081   4.782   1.00 1.00 ? 102 STE A C5   8  
HETATM 10673 C C6   . STE C 3 .  ? 7.867   7.816   4.108   1.00 1.00 ? 102 STE A C6   8  
HETATM 10674 C C7   . STE C 3 .  ? 6.543   7.314   4.680   1.00 1.00 ? 102 STE A C7   8  
HETATM 10675 C C8   . STE C 3 .  ? 5.374   8.011   3.960   1.00 1.00 ? 102 STE A C8   8  
HETATM 10676 C C9   . STE C 3 .  ? 4.139   7.095   3.981   1.00 1.00 ? 102 STE A C9   8  
HETATM 10677 C C10  . STE C 3 .  ? 4.228   6.076   2.837   1.00 1.00 ? 102 STE A C10  8  
HETATM 10678 C C11  . STE C 3 .  ? 2.883   5.387   2.665   1.00 1.00 ? 102 STE A C11  8  
HETATM 10679 C C12  . STE C 3 .  ? 2.998   4.324   1.573   1.00 1.00 ? 102 STE A C12  8  
HETATM 10680 C C13  . STE C 3 .  ? 1.712   3.496   1.530   1.00 1.00 ? 102 STE A C13  8  
HETATM 10681 C C14  . STE C 3 .  ? 0.546   4.377   1.066   1.00 1.00 ? 102 STE A C14  8  
HETATM 10682 C C15  . STE C 3 .  ? -0.585  3.497   0.555   1.00 1.00 ? 102 STE A C15  8  
HETATM 10683 C C16  . STE C 3 .  ? -1.857  4.330   0.408   1.00 1.00 ? 102 STE A C16  8  
HETATM 10684 C C17  . STE C 3 .  ? -2.905  3.538   -0.394  1.00 1.00 ? 102 STE A C17  8  
HETATM 10685 C C18  . STE C 3 .  ? -2.726  3.814   -1.890  1.00 1.00 ? 102 STE A C18  8  
HETATM 10686 H H21  . STE C 3 .  ? 10.520  4.638   4.431   1.00 1.00 ? 102 STE A H21  8  
HETATM 10687 H H22  . STE C 3 .  ? 12.173  4.565   5.014   1.00 1.00 ? 102 STE A H22  8  
HETATM 10688 H H31  . STE C 3 .  ? 12.384  7.018   4.311   1.00 1.00 ? 102 STE A H31  8  
HETATM 10689 H H32  . STE C 3 .  ? 11.374  6.692   5.715   1.00 1.00 ? 102 STE A H32  8  
HETATM 10690 H H41  . STE C 3 .  ? 10.109  6.712   2.970   1.00 1.00 ? 102 STE A H41  8  
HETATM 10691 H H42  . STE C 3 .  ? 10.489  8.250   3.741   1.00 1.00 ? 102 STE A H42  8  
HETATM 10692 H H51  . STE C 3 .  ? 9.197   7.520   5.751   1.00 1.00 ? 102 STE A H51  8  
HETATM 10693 H H52  . STE C 3 .  ? 8.765   6.038   4.902   1.00 1.00 ? 102 STE A H52  8  
HETATM 10694 H H61  . STE C 3 .  ? 7.890   7.627   3.044   1.00 1.00 ? 102 STE A H61  8  
HETATM 10695 H H62  . STE C 3 .  ? 7.960   8.876   4.291   1.00 1.00 ? 102 STE A H62  8  
HETATM 10696 H H71  . STE C 3 .  ? 6.495   7.536   5.735   1.00 1.00 ? 102 STE A H71  8  
HETATM 10697 H H72  . STE C 3 .  ? 6.487   6.245   4.543   1.00 1.00 ? 102 STE A H72  8  
HETATM 10698 H H81  . STE C 3 .  ? 5.647   8.232   2.938   1.00 1.00 ? 102 STE A H81  8  
HETATM 10699 H H82  . STE C 3 .  ? 5.144   8.937   4.465   1.00 1.00 ? 102 STE A H82  8  
HETATM 10700 H H91  . STE C 3 .  ? 3.248   7.692   3.861   1.00 1.00 ? 102 STE A H91  8  
HETATM 10701 H H92  . STE C 3 .  ? 4.090   6.569   4.928   1.00 1.00 ? 102 STE A H92  8  
HETATM 10702 H H101 . STE C 3 .  ? 4.978   5.339   3.064   1.00 1.00 ? 102 STE A H101 8  
HETATM 10703 H H102 . STE C 3 .  ? 4.489   6.579   1.922   1.00 1.00 ? 102 STE A H102 8  
HETATM 10704 H H111 . STE C 3 .  ? 2.145   6.118   2.381   1.00 1.00 ? 102 STE A H111 8  
HETATM 10705 H H112 . STE C 3 .  ? 2.595   4.921   3.597   1.00 1.00 ? 102 STE A H112 8  
HETATM 10706 H H121 . STE C 3 .  ? 3.832   3.676   1.784   1.00 1.00 ? 102 STE A H121 8  
HETATM 10707 H H122 . STE C 3 .  ? 3.153   4.806   0.617   1.00 1.00 ? 102 STE A H122 8  
HETATM 10708 H H131 . STE C 3 .  ? 1.497   3.116   2.520   1.00 1.00 ? 102 STE A H131 8  
HETATM 10709 H H132 . STE C 3 .  ? 1.842   2.668   0.848   1.00 1.00 ? 102 STE A H132 8  
HETATM 10710 H H141 . STE C 3 .  ? 0.870   5.031   0.271   1.00 1.00 ? 102 STE A H141 8  
HETATM 10711 H H142 . STE C 3 .  ? 0.191   4.968   1.895   1.00 1.00 ? 102 STE A H142 8  
HETATM 10712 H H151 . STE C 3 .  ? -0.763  2.696   1.249   1.00 1.00 ? 102 STE A H151 8  
HETATM 10713 H H152 . STE C 3 .  ? -0.310  3.087   -0.397  1.00 1.00 ? 102 STE A H152 8  
HETATM 10714 H H161 . STE C 3 .  ? -1.626  5.255   -0.105  1.00 1.00 ? 102 STE A H161 8  
HETATM 10715 H H162 . STE C 3 .  ? -2.250  4.557   1.388   1.00 1.00 ? 102 STE A H162 8  
HETATM 10716 H H171 . STE C 3 .  ? -3.892  3.848   -0.092  1.00 1.00 ? 102 STE A H171 8  
HETATM 10717 H H172 . STE C 3 .  ? -2.793  2.476   -0.205  1.00 1.00 ? 102 STE A H172 8  
HETATM 10718 H H181 . STE C 3 .  ? -3.444  3.236   -2.451  1.00 1.00 ? 102 STE A H181 8  
HETATM 10719 H H182 . STE C 3 .  ? -1.729  3.541   -2.192  1.00 1.00 ? 102 STE A H182 8  
HETATM 10720 H H183 . STE C 3 .  ? -2.878  4.863   -2.082  1.00 1.00 ? 102 STE A H183 8  
ATOM   10721 N N    . ALA A 1 1  ? -10.740 -3.516  6.227   1.00 1.00 ? 1   ALA A N    9  
ATOM   10722 C CA   . ALA A 1 1  ? -10.524 -3.668  4.760   1.00 1.00 ? 1   ALA A CA   9  
ATOM   10723 C C    . ALA A 1 1  ? -10.786 -5.116  4.359   1.00 1.00 ? 1   ALA A C    9  
ATOM   10724 O O    . ALA A 1 1  ? -10.858 -6.003  5.210   1.00 1.00 ? 1   ALA A O    9  
ATOM   10725 C CB   . ALA A 1 1  ? -9.083  -3.293  4.413   1.00 1.00 ? 1   ALA A CB   9  
ATOM   10726 H H1   . ALA A 1 1  ? -10.076 -4.127  6.742   1.00 1.00 ? 1   ALA A H1   9  
ATOM   10727 H H2   . ALA A 1 1  ? -11.717 -3.786  6.463   1.00 1.00 ? 1   ALA A H2   9  
ATOM   10728 H H3   . ALA A 1 1  ? -10.578 -2.525  6.500   1.00 1.00 ? 1   ALA A H3   9  
ATOM   10729 H HA   . ALA A 1 1  ? -11.200 -3.020  4.227   1.00 1.00 ? 1   ALA A HA   9  
ATOM   10730 H HB1  . ALA A 1 1  ? -8.994  -3.168  3.346   1.00 1.00 ? 1   ALA A HB1  9  
ATOM   10731 H HB2  . ALA A 1 1  ? -8.420  -4.079  4.741   1.00 1.00 ? 1   ALA A HB2  9  
ATOM   10732 H HB3  . ALA A 1 1  ? -8.816  -2.370  4.904   1.00 1.00 ? 1   ALA A HB3  9  
ATOM   10733 N N    . LYS A 1 2  ? -10.921 -5.352  3.057   1.00 1.00 ? 2   LYS A N    9  
ATOM   10734 C CA   . LYS A 1 2  ? -11.167 -6.698  2.553   1.00 1.00 ? 2   LYS A CA   9  
ATOM   10735 C C    . LYS A 1 2  ? -9.857  -7.472  2.466   1.00 1.00 ? 2   LYS A C    9  
ATOM   10736 O O    . LYS A 1 2  ? -8.810  -6.903  2.172   1.00 1.00 ? 2   LYS A O    9  
ATOM   10737 C CB   . LYS A 1 2  ? -11.819 -6.634  1.174   1.00 1.00 ? 2   LYS A CB   9  
ATOM   10738 C CG   . LYS A 1 2  ? -13.214 -6.016  1.297   1.00 1.00 ? 2   LYS A CG   9  
ATOM   10739 C CD   . LYS A 1 2  ? -13.876 -5.970  -0.081  1.00 1.00 ? 2   LYS A CD   9  
ATOM   10740 C CE   . LYS A 1 2  ? -15.309 -5.456  0.058   1.00 1.00 ? 2   LYS A CE   9  
ATOM   10741 N NZ   . LYS A 1 2  ? -15.286 -4.032  0.500   1.00 1.00 ? 2   LYS A NZ   9  
ATOM   10742 H H    . LYS A 1 2  ? -10.850 -4.608  2.423   1.00 1.00 ? 2   LYS A H    9  
ATOM   10743 H HA   . LYS A 1 2  ? -11.833 -7.213  3.232   1.00 1.00 ? 2   LYS A HA   9  
ATOM   10744 H HB2  . LYS A 1 2  ? -11.211 -6.030  0.517   1.00 1.00 ? 2   LYS A HB2  9  
ATOM   10745 H HB3  . LYS A 1 2  ? -11.906 -7.631  0.771   1.00 1.00 ? 2   LYS A HB3  9  
ATOM   10746 H HG2  . LYS A 1 2  ? -13.814 -6.614  1.967   1.00 1.00 ? 2   LYS A HG2  9  
ATOM   10747 H HG3  . LYS A 1 2  ? -13.129 -5.012  1.687   1.00 1.00 ? 2   LYS A HG3  9  
ATOM   10748 H HD2  . LYS A 1 2  ? -13.315 -5.308  -0.726  1.00 1.00 ? 2   LYS A HD2  9  
ATOM   10749 H HD3  . LYS A 1 2  ? -13.890 -6.962  -0.507  1.00 1.00 ? 2   LYS A HD3  9  
ATOM   10750 H HE2  . LYS A 1 2  ? -15.811 -5.528  -0.894  1.00 1.00 ? 2   LYS A HE2  9  
ATOM   10751 H HE3  . LYS A 1 2  ? -15.834 -6.050  0.790   1.00 1.00 ? 2   LYS A HE3  9  
ATOM   10752 H HZ1  . LYS A 1 2  ? -16.074 -3.519  0.056   1.00 1.00 ? 2   LYS A HZ1  9  
ATOM   10753 H HZ2  . LYS A 1 2  ? -14.384 -3.597  0.220   1.00 1.00 ? 2   LYS A HZ2  9  
ATOM   10754 H HZ3  . LYS A 1 2  ? -15.389 -3.988  1.533   1.00 1.00 ? 2   LYS A HZ3  9  
ATOM   10755 N N    . LYS A 1 3  ? -9.922  -8.769  2.719   1.00 1.00 ? 3   LYS A N    9  
ATOM   10756 C CA   . LYS A 1 3  ? -8.729  -9.608  2.675   1.00 1.00 ? 3   LYS A CA   9  
ATOM   10757 C C    . LYS A 1 3  ? -8.076  -9.551  1.298   1.00 1.00 ? 3   LYS A C    9  
ATOM   10758 O O    . LYS A 1 3  ? -6.852  -9.506  1.186   1.00 1.00 ? 3   LYS A O    9  
ATOM   10759 C CB   . LYS A 1 3  ? -9.110  -11.052 2.993   1.00 1.00 ? 3   LYS A CB   9  
ATOM   10760 C CG   . LYS A 1 3  ? -9.537  -11.167 4.458   1.00 1.00 ? 3   LYS A CG   9  
ATOM   10761 C CD   . LYS A 1 3  ? -10.245 -12.507 4.682   1.00 1.00 ? 3   LYS A CD   9  
ATOM   10762 C CE   . LYS A 1 3  ? -9.367  -13.652 4.169   1.00 1.00 ? 3   LYS A CE   9  
ATOM   10763 N NZ   . LYS A 1 3  ? -9.836  -14.940 4.757   1.00 1.00 ? 3   LYS A NZ   9  
ATOM   10764 H H    . LYS A 1 3  ? -10.787 -9.173  2.946   1.00 1.00 ? 3   LYS A H    9  
ATOM   10765 H HA   . LYS A 1 3  ? -8.023  -9.261  3.416   1.00 1.00 ? 3   LYS A HA   9  
ATOM   10766 H HB2  . LYS A 1 3  ? -9.923  -11.354 2.355   1.00 1.00 ? 3   LYS A HB2  9  
ATOM   10767 H HB3  . LYS A 1 3  ? -8.258  -11.693 2.819   1.00 1.00 ? 3   LYS A HB3  9  
ATOM   10768 H HG2  . LYS A 1 3  ? -8.665  -11.110 5.093   1.00 1.00 ? 3   LYS A HG2  9  
ATOM   10769 H HG3  . LYS A 1 3  ? -10.213 -10.361 4.700   1.00 1.00 ? 3   LYS A HG3  9  
ATOM   10770 H HD2  . LYS A 1 3  ? -10.430 -12.643 5.739   1.00 1.00 ? 3   LYS A HD2  9  
ATOM   10771 H HD3  . LYS A 1 3  ? -11.185 -12.511 4.151   1.00 1.00 ? 3   LYS A HD3  9  
ATOM   10772 H HE2  . LYS A 1 3  ? -9.440  -13.701 3.090   1.00 1.00 ? 3   LYS A HE2  9  
ATOM   10773 H HE3  . LYS A 1 3  ? -8.341  -13.476 4.454   1.00 1.00 ? 3   LYS A HE3  9  
ATOM   10774 H HZ1  . LYS A 1 3  ? -10.115 -15.589 3.994   1.00 1.00 ? 3   LYS A HZ1  9  
ATOM   10775 H HZ2  . LYS A 1 3  ? -10.651 -14.761 5.379   1.00 1.00 ? 3   LYS A HZ2  9  
ATOM   10776 H HZ3  . LYS A 1 3  ? -9.066  -15.370 5.308   1.00 1.00 ? 3   LYS A HZ3  9  
ATOM   10777 N N    . GLU A 1 4  ? -8.895  -9.554  0.257   1.00 1.00 ? 4   GLU A N    9  
ATOM   10778 C CA   . GLU A 1 4  ? -8.376  -9.502  -1.102  1.00 1.00 ? 4   GLU A CA   9  
ATOM   10779 C C    . GLU A 1 4  ? -7.603  -8.204  -1.327  1.00 1.00 ? 4   GLU A C    9  
ATOM   10780 O O    . GLU A 1 4  ? -6.526  -8.207  -1.924  1.00 1.00 ? 4   GLU A O    9  
ATOM   10781 C CB   . GLU A 1 4  ? -9.540  -9.601  -2.094  1.00 1.00 ? 4   GLU A CB   9  
ATOM   10782 C CG   . GLU A 1 4  ? -10.347 -8.297  -2.083  1.00 1.00 ? 4   GLU A CG   9  
ATOM   10783 C CD   . GLU A 1 4  ? -11.675 -8.491  -2.806  1.00 1.00 ? 4   GLU A CD   9  
ATOM   10784 O OE1  . GLU A 1 4  ? -11.708 -9.265  -3.749  1.00 1.00 ? 4   GLU A OE1  9  
ATOM   10785 O OE2  . GLU A 1 4  ? -12.642 -7.862  -2.405  1.00 1.00 ? 4   GLU A OE2  9  
ATOM   10786 H H    . GLU A 1 4  ? -9.863  -9.592  0.404   1.00 1.00 ? 4   GLU A H    9  
ATOM   10787 H HA   . GLU A 1 4  ? -7.713  -10.339 -1.259  1.00 1.00 ? 4   GLU A HA   9  
ATOM   10788 H HB2  . GLU A 1 4  ? -9.152  -9.776  -3.087  1.00 1.00 ? 4   GLU A HB2  9  
ATOM   10789 H HB3  . GLU A 1 4  ? -10.182 -10.423 -1.808  1.00 1.00 ? 4   GLU A HB3  9  
ATOM   10790 H HG2  . GLU A 1 4  ? -10.533 -7.999  -1.063  1.00 1.00 ? 4   GLU A HG2  9  
ATOM   10791 H HG3  . GLU A 1 4  ? -9.783  -7.523  -2.583  1.00 1.00 ? 4   GLU A HG3  9  
ATOM   10792 N N    . THR A 1 5  ? -8.165  -7.098  -0.848  1.00 1.00 ? 5   THR A N    9  
ATOM   10793 C CA   . THR A 1 5  ? -7.526  -5.798  -1.000  1.00 1.00 ? 5   THR A CA   9  
ATOM   10794 C C    . THR A 1 5  ? -6.244  -5.739  -0.180  1.00 1.00 ? 5   THR A C    9  
ATOM   10795 O O    . THR A 1 5  ? -5.226  -5.229  -0.636  1.00 1.00 ? 5   THR A O    9  
ATOM   10796 C CB   . THR A 1 5  ? -8.477  -4.680  -0.560  1.00 1.00 ? 5   THR A CB   9  
ATOM   10797 O OG1  . THR A 1 5  ? -9.766  -4.931  -1.100  1.00 1.00 ? 5   THR A OG1  9  
ATOM   10798 C CG2  . THR A 1 5  ? -7.964  -3.344  -1.101  1.00 1.00 ? 5   THR A CG2  9  
ATOM   10799 H H    . THR A 1 5  ? -9.024  -7.158  -0.382  1.00 1.00 ? 5   THR A H    9  
ATOM   10800 H HA   . THR A 1 5  ? -7.277  -5.659  -2.039  1.00 1.00 ? 5   THR A HA   9  
ATOM   10801 H HB   . THR A 1 5  ? -8.528  -4.633  0.523   1.00 1.00 ? 5   THR A HB   9  
ATOM   10802 H HG1  . THR A 1 5  ? -10.417 -4.626  -0.465  1.00 1.00 ? 5   THR A HG1  9  
ATOM   10803 H HG21 . THR A 1 5  ? -8.670  -2.563  -0.859  1.00 1.00 ? 5   THR A HG21 9  
ATOM   10804 H HG22 . THR A 1 5  ? -7.856  -3.410  -2.174  1.00 1.00 ? 5   THR A HG22 9  
ATOM   10805 H HG23 . THR A 1 5  ? -7.007  -3.118  -0.655  1.00 1.00 ? 5   THR A HG23 9  
ATOM   10806 N N    . ILE A 1 6  ? -6.307  -6.259  1.039   1.00 1.00 ? 6   ILE A N    9  
ATOM   10807 C CA   . ILE A 1 6  ? -5.152  -6.253  1.922   1.00 1.00 ? 6   ILE A CA   9  
ATOM   10808 C C    . ILE A 1 6  ? -3.994  -7.031  1.305   1.00 1.00 ? 6   ILE A C    9  
ATOM   10809 O O    . ILE A 1 6  ? -2.853  -6.571  1.314   1.00 1.00 ? 6   ILE A O    9  
ATOM   10810 C CB   . ILE A 1 6  ? -5.532  -6.890  3.269   1.00 1.00 ? 6   ILE A CB   9  
ATOM   10811 C CG1  . ILE A 1 6  ? -6.514  -5.980  4.015   1.00 1.00 ? 6   ILE A CG1  9  
ATOM   10812 C CG2  . ILE A 1 6  ? -4.281  -7.075  4.129   1.00 1.00 ? 6   ILE A CG2  9  
ATOM   10813 C CD1  . ILE A 1 6  ? -7.134  -6.742  5.192   1.00 1.00 ? 6   ILE A CD1  9  
ATOM   10814 H H    . ILE A 1 6  ? -7.151  -6.651  1.352   1.00 1.00 ? 6   ILE A H    9  
ATOM   10815 H HA   . ILE A 1 6  ? -4.845  -5.239  2.094   1.00 1.00 ? 6   ILE A HA   9  
ATOM   10816 H HB   . ILE A 1 6  ? -5.995  -7.854  3.094   1.00 1.00 ? 6   ILE A HB   9  
ATOM   10817 H HG12 . ILE A 1 6  ? -5.986  -5.118  4.388   1.00 1.00 ? 6   ILE A HG12 9  
ATOM   10818 H HG13 . ILE A 1 6  ? -7.292  -5.658  3.345   1.00 1.00 ? 6   ILE A HG13 9  
ATOM   10819 H HG21 . ILE A 1 6  ? -3.699  -7.899  3.747   1.00 1.00 ? 6   ILE A HG21 9  
ATOM   10820 H HG22 . ILE A 1 6  ? -4.572  -7.281  5.149   1.00 1.00 ? 6   ILE A HG22 9  
ATOM   10821 H HG23 . ILE A 1 6  ? -3.688  -6.172  4.097   1.00 1.00 ? 6   ILE A HG23 9  
ATOM   10822 H HD11 . ILE A 1 6  ? -6.376  -7.344  5.676   1.00 1.00 ? 6   ILE A HD11 9  
ATOM   10823 H HD12 . ILE A 1 6  ? -7.925  -7.384  4.830   1.00 1.00 ? 6   ILE A HD12 9  
ATOM   10824 H HD13 . ILE A 1 6  ? -7.538  -6.039  5.902   1.00 1.00 ? 6   ILE A HD13 9  
ATOM   10825 N N    . ASP A 1 7  ? -4.292  -8.204  0.767   1.00 1.00 ? 7   ASP A N    9  
ATOM   10826 C CA   . ASP A 1 7  ? -3.263  -9.030  0.148   1.00 1.00 ? 7   ASP A CA   9  
ATOM   10827 C C    . ASP A 1 7  ? -2.722  -8.335  -1.100  1.00 1.00 ? 7   ASP A C    9  
ATOM   10828 O O    . ASP A 1 7  ? -1.534  -8.428  -1.408  1.00 1.00 ? 7   ASP A O    9  
ATOM   10829 C CB   . ASP A 1 7  ? -3.859  -10.399 -0.222  1.00 1.00 ? 7   ASP A CB   9  
ATOM   10830 C CG   . ASP A 1 7  ? -3.834  -11.341 0.984   1.00 1.00 ? 7   ASP A CG   9  
ATOM   10831 O OD1  . ASP A 1 7  ? -3.287  -10.960 2.006   1.00 1.00 ? 7   ASP A OD1  9  
ATOM   10832 O OD2  . ASP A 1 7  ? -4.371  -12.430 0.864   1.00 1.00 ? 7   ASP A OD2  9  
ATOM   10833 H H    . ASP A 1 7  ? -5.218  -8.522  0.784   1.00 1.00 ? 7   ASP A H    9  
ATOM   10834 H HA   . ASP A 1 7  ? -2.448  -9.167  0.844   1.00 1.00 ? 7   ASP A HA   9  
ATOM   10835 H HB2  . ASP A 1 7  ? -4.879  -10.264 -0.548  1.00 1.00 ? 7   ASP A HB2  9  
ATOM   10836 H HB3  . ASP A 1 7  ? -3.283  -10.837 -1.023  1.00 1.00 ? 7   ASP A HB3  9  
ATOM   10837 N N    . LYS A 1 8  ? -3.598  -7.642  -1.810  1.00 1.00 ? 8   LYS A N    9  
ATOM   10838 C CA   . LYS A 1 8  ? -3.192  -6.941  -3.019  1.00 1.00 ? 8   LYS A CA   9  
ATOM   10839 C C    . LYS A 1 8  ? -2.198  -5.835  -2.701  1.00 1.00 ? 8   LYS A C    9  
ATOM   10840 O O    . LYS A 1 8  ? -1.194  -5.677  -3.388  1.00 1.00 ? 8   LYS A O    9  
ATOM   10841 C CB   . LYS A 1 8  ? -4.425  -6.345  -3.698  1.00 1.00 ? 8   LYS A CB   9  
ATOM   10842 C CG   . LYS A 1 8  ? -5.213  -7.440  -4.430  1.00 1.00 ? 8   LYS A CG   9  
ATOM   10843 C CD   . LYS A 1 8  ? -4.651  -7.648  -5.852  1.00 1.00 ? 8   LYS A CD   9  
ATOM   10844 C CE   . LYS A 1 8  ? -5.272  -6.630  -6.817  1.00 1.00 ? 8   LYS A CE   9  
ATOM   10845 N NZ   . LYS A 1 8  ? -4.797  -6.907  -8.198  1.00 1.00 ? 8   LYS A NZ   9  
ATOM   10846 H H    . LYS A 1 8  ? -4.532  -7.598  -1.516  1.00 1.00 ? 8   LYS A H    9  
ATOM   10847 H HA   . LYS A 1 8  ? -2.727  -7.647  -3.691  1.00 1.00 ? 8   LYS A HA   9  
ATOM   10848 H HB2  . LYS A 1 8  ? -5.056  -5.905  -2.941  1.00 1.00 ? 8   LYS A HB2  9  
ATOM   10849 H HB3  . LYS A 1 8  ? -4.121  -5.583  -4.399  1.00 1.00 ? 8   LYS A HB3  9  
ATOM   10850 H HG2  . LYS A 1 8  ? -5.144  -8.363  -3.876  1.00 1.00 ? 8   LYS A HG2  9  
ATOM   10851 H HG3  . LYS A 1 8  ? -6.248  -7.148  -4.492  1.00 1.00 ? 8   LYS A HG3  9  
ATOM   10852 H HD2  . LYS A 1 8  ? -3.577  -7.522  -5.841  1.00 1.00 ? 8   LYS A HD2  9  
ATOM   10853 H HD3  . LYS A 1 8  ? -4.888  -8.646  -6.187  1.00 1.00 ? 8   LYS A HD3  9  
ATOM   10854 H HE2  . LYS A 1 8  ? -6.347  -6.711  -6.786  1.00 1.00 ? 8   LYS A HE2  9  
ATOM   10855 H HE3  . LYS A 1 8  ? -4.980  -5.630  -6.534  1.00 1.00 ? 8   LYS A HE3  9  
ATOM   10856 H HZ1  . LYS A 1 8  ? -3.953  -6.336  -8.395  1.00 1.00 ? 8   LYS A HZ1  9  
ATOM   10857 H HZ2  . LYS A 1 8  ? -5.549  -6.665  -8.876  1.00 1.00 ? 8   LYS A HZ2  9  
ATOM   10858 H HZ3  . LYS A 1 8  ? -4.559  -7.915  -8.287  1.00 1.00 ? 8   LYS A HZ3  9  
ATOM   10859 N N    . VAL A 1 9  ? -2.491  -5.073  -1.658  1.00 1.00 ? 9   VAL A N    9  
ATOM   10860 C CA   . VAL A 1 9  ? -1.621  -3.974  -1.263  1.00 1.00 ? 9   VAL A CA   9  
ATOM   10861 C C    . VAL A 1 9  ? -0.228  -4.490  -0.941  1.00 1.00 ? 9   VAL A C    9  
ATOM   10862 O O    . VAL A 1 9  ? 0.773   -3.917  -1.366  1.00 1.00 ? 9   VAL A O    9  
ATOM   10863 C CB   . VAL A 1 9  ? -2.205  -3.259  -0.038  1.00 1.00 ? 9   VAL A CB   9  
ATOM   10864 C CG1  . VAL A 1 9  ? -1.237  -2.167  0.422   1.00 1.00 ? 9   VAL A CG1  9  
ATOM   10865 C CG2  . VAL A 1 9  ? -3.564  -2.634  -0.394  1.00 1.00 ? 9   VAL A CG2  9  
ATOM   10866 H H    . VAL A 1 9  ? -3.313  -5.249  -1.149  1.00 1.00 ? 9   VAL A H    9  
ATOM   10867 H HA   . VAL A 1 9  ? -1.552  -3.272  -2.079  1.00 1.00 ? 9   VAL A HA   9  
ATOM   10868 H HB   . VAL A 1 9  ? -2.339  -3.973  0.763   1.00 1.00 ? 9   VAL A HB   9  
ATOM   10869 H HG11 . VAL A 1 9  ? -1.731  -1.525  1.136   1.00 1.00 ? 9   VAL A HG11 9  
ATOM   10870 H HG12 . VAL A 1 9  ? -0.920  -1.583  -0.429  1.00 1.00 ? 9   VAL A HG12 9  
ATOM   10871 H HG13 . VAL A 1 9  ? -0.376  -2.623  0.886   1.00 1.00 ? 9   VAL A HG13 9  
ATOM   10872 H HG21 . VAL A 1 9  ? -4.087  -3.272  -1.086  1.00 1.00 ? 9   VAL A HG21 9  
ATOM   10873 H HG22 . VAL A 1 9  ? -3.416  -1.670  -0.847  1.00 1.00 ? 9   VAL A HG22 9  
ATOM   10874 H HG23 . VAL A 1 9  ? -4.156  -2.521  0.503   1.00 1.00 ? 9   VAL A HG23 9  
ATOM   10875 N N    . SER A 1 10 ? -0.169  -5.578  -0.189  1.00 1.00 ? 10  SER A N    9  
ATOM   10876 C CA   . SER A 1 10 ? 1.110   -6.163  0.178   1.00 1.00 ? 10  SER A CA   9  
ATOM   10877 C C    . SER A 1 10 ? 1.882   -6.584  -1.065  1.00 1.00 ? 10  SER A C    9  
ATOM   10878 O O    . SER A 1 10 ? 3.089   -6.382  -1.142  1.00 1.00 ? 10  SER A O    9  
ATOM   10879 C CB   . SER A 1 10 ? 0.889   -7.394  1.064   1.00 1.00 ? 10  SER A CB   9  
ATOM   10880 O OG   . SER A 1 10 ? 0.131   -8.357  0.348   1.00 1.00 ? 10  SER A OG   9  
ATOM   10881 H H    . SER A 1 10 ? -0.996  -5.996  0.125   1.00 1.00 ? 10  SER A H    9  
ATOM   10882 H HA   . SER A 1 10 ? 1.687   -5.435  0.724   1.00 1.00 ? 10  SER A HA   9  
ATOM   10883 H HB2  . SER A 1 10 ? 1.840   -7.822  1.337   1.00 1.00 ? 10  SER A HB2  9  
ATOM   10884 H HB3  . SER A 1 10 ? 0.360   -7.103  1.961   1.00 1.00 ? 10  SER A HB3  9  
ATOM   10885 H HG   . SER A 1 10 ? 0.726   -8.817  -0.250  1.00 1.00 ? 10  SER A HG   9  
ATOM   10886 N N    . ASP A 1 11 ? 1.172   -7.167  -2.032  1.00 1.00 ? 11  ASP A N    9  
ATOM   10887 C CA   . ASP A 1 11 ? 1.801   -7.640  -3.262  1.00 1.00 ? 11  ASP A CA   9  
ATOM   10888 C C    . ASP A 1 11 ? 2.597   -6.530  -3.932  1.00 1.00 ? 11  ASP A C    9  
ATOM   10889 O O    . ASP A 1 11 ? 3.725   -6.741  -4.365  1.00 1.00 ? 11  ASP A O    9  
ATOM   10890 C CB   . ASP A 1 11 ? 0.735   -8.162  -4.234  1.00 1.00 ? 11  ASP A CB   9  
ATOM   10891 C CG   . ASP A 1 11 ? 1.379   -9.027  -5.317  1.00 1.00 ? 11  ASP A CG   9  
ATOM   10892 O OD1  . ASP A 1 11 ? 2.456   -9.547  -5.074  1.00 1.00 ? 11  ASP A OD1  9  
ATOM   10893 O OD2  . ASP A 1 11 ? 0.779   -9.166  -6.371  1.00 1.00 ? 11  ASP A OD2  9  
ATOM   10894 H H    . ASP A 1 11 ? 0.211   -7.288  -1.911  1.00 1.00 ? 11  ASP A H    9  
ATOM   10895 H HA   . ASP A 1 11 ? 2.471   -8.450  -3.021  1.00 1.00 ? 11  ASP A HA   9  
ATOM   10896 H HB2  . ASP A 1 11 ? 0.011   -8.748  -3.689  1.00 1.00 ? 11  ASP A HB2  9  
ATOM   10897 H HB3  . ASP A 1 11 ? 0.236   -7.323  -4.701  1.00 1.00 ? 11  ASP A HB3  9  
ATOM   10898 N N    . ILE A 1 12 ? 2.008   -5.350  -4.008  1.00 1.00 ? 12  ILE A N    9  
ATOM   10899 C CA   . ILE A 1 12 ? 2.684   -4.227  -4.640  1.00 1.00 ? 12  ILE A CA   9  
ATOM   10900 C C    . ILE A 1 12 ? 4.094   -4.077  -4.074  1.00 1.00 ? 12  ILE A C    9  
ATOM   10901 O O    . ILE A 1 12 ? 5.053   -3.888  -4.822  1.00 1.00 ? 12  ILE A O    9  
ATOM   10902 C CB   . ILE A 1 12 ? 1.869   -2.934  -4.406  1.00 1.00 ? 12  ILE A CB   9  
ATOM   10903 C CG1  . ILE A 1 12 ? 0.844   -2.730  -5.530  1.00 1.00 ? 12  ILE A CG1  9  
ATOM   10904 C CG2  . ILE A 1 12 ? 2.786   -1.707  -4.335  1.00 1.00 ? 12  ILE A CG2  9  
ATOM   10905 C CD1  . ILE A 1 12 ? -0.219  -3.817  -5.472  1.00 1.00 ? 12  ILE A CD1  9  
ATOM   10906 H H    . ILE A 1 12 ? 1.107   -5.233  -3.643  1.00 1.00 ? 12  ILE A H    9  
ATOM   10907 H HA   . ILE A 1 12 ? 2.757   -4.420  -5.699  1.00 1.00 ? 12  ILE A HA   9  
ATOM   10908 H HB   . ILE A 1 12 ? 1.344   -3.022  -3.467  1.00 1.00 ? 12  ILE A HB   9  
ATOM   10909 H HG12 . ILE A 1 12 ? 0.371   -1.768  -5.411  1.00 1.00 ? 12  ILE A HG12 9  
ATOM   10910 H HG13 . ILE A 1 12 ? 1.342   -2.770  -6.487  1.00 1.00 ? 12  ILE A HG13 9  
ATOM   10911 H HG21 . ILE A 1 12 ? 3.511   -1.751  -5.135  1.00 1.00 ? 12  ILE A HG21 9  
ATOM   10912 H HG22 . ILE A 1 12 ? 3.300   -1.703  -3.385  1.00 1.00 ? 12  ILE A HG22 9  
ATOM   10913 H HG23 . ILE A 1 12 ? 2.199   -0.808  -4.429  1.00 1.00 ? 12  ILE A HG23 9  
ATOM   10914 H HD11 . ILE A 1 12 ? -0.779  -3.722  -4.556  1.00 1.00 ? 12  ILE A HD11 9  
ATOM   10915 H HD12 . ILE A 1 12 ? 0.253   -4.787  -5.512  1.00 1.00 ? 12  ILE A HD12 9  
ATOM   10916 H HD13 . ILE A 1 12 ? -0.885  -3.708  -6.313  1.00 1.00 ? 12  ILE A HD13 9  
ATOM   10917 N N    . VAL A 1 13 ? 4.210   -4.138  -2.761  1.00 1.00 ? 13  VAL A N    9  
ATOM   10918 C CA   . VAL A 1 13 ? 5.507   -3.983  -2.132  1.00 1.00 ? 13  VAL A CA   9  
ATOM   10919 C C    . VAL A 1 13 ? 6.435   -5.121  -2.528  1.00 1.00 ? 13  VAL A C    9  
ATOM   10920 O O    . VAL A 1 13 ? 7.594   -4.900  -2.861  1.00 1.00 ? 13  VAL A O    9  
ATOM   10921 C CB   . VAL A 1 13 ? 5.344   -3.948  -0.615  1.00 1.00 ? 13  VAL A CB   9  
ATOM   10922 C CG1  . VAL A 1 13 ? 6.715   -3.783  0.044   1.00 1.00 ? 13  VAL A CG1  9  
ATOM   10923 C CG2  . VAL A 1 13 ? 4.445   -2.774  -0.225  1.00 1.00 ? 13  VAL A CG2  9  
ATOM   10924 H H    . VAL A 1 13 ? 3.411   -4.281  -2.210  1.00 1.00 ? 13  VAL A H    9  
ATOM   10925 H HA   . VAL A 1 13 ? 5.939   -3.050  -2.460  1.00 1.00 ? 13  VAL A HA   9  
ATOM   10926 H HB   . VAL A 1 13 ? 4.897   -4.874  -0.283  1.00 1.00 ? 13  VAL A HB   9  
ATOM   10927 H HG11 . VAL A 1 13 ? 7.241   -2.961  -0.418  1.00 1.00 ? 13  VAL A HG11 9  
ATOM   10928 H HG12 . VAL A 1 13 ? 7.286   -4.692  -0.078  1.00 1.00 ? 13  VAL A HG12 9  
ATOM   10929 H HG13 . VAL A 1 13 ? 6.585   -3.580  1.097   1.00 1.00 ? 13  VAL A HG13 9  
ATOM   10930 H HG21 . VAL A 1 13 ? 4.987   -1.850  -0.350  1.00 1.00 ? 13  VAL A HG21 9  
ATOM   10931 H HG22 . VAL A 1 13 ? 4.146   -2.879  0.808   1.00 1.00 ? 13  VAL A HG22 9  
ATOM   10932 H HG23 . VAL A 1 13 ? 3.568   -2.767  -0.856  1.00 1.00 ? 13  VAL A HG23 9  
ATOM   10933 N N    . LYS A 1 14 ? 5.916   -6.342  -2.482  1.00 1.00 ? 14  LYS A N    9  
ATOM   10934 C CA   . LYS A 1 14 ? 6.710   -7.518  -2.828  1.00 1.00 ? 14  LYS A CA   9  
ATOM   10935 C C    . LYS A 1 14 ? 7.028   -7.533  -4.319  1.00 1.00 ? 14  LYS A C    9  
ATOM   10936 O O    . LYS A 1 14 ? 8.138   -7.872  -4.725  1.00 1.00 ? 14  LYS A O    9  
ATOM   10937 C CB   . LYS A 1 14 ? 5.940   -8.792  -2.447  1.00 1.00 ? 14  LYS A CB   9  
ATOM   10938 C CG   . LYS A 1 14 ? 5.131   -8.547  -1.155  1.00 1.00 ? 14  LYS A CG   9  
ATOM   10939 C CD   . LYS A 1 14 ? 5.095   -9.809  -0.289  1.00 1.00 ? 14  LYS A CD   9  
ATOM   10940 C CE   . LYS A 1 14 ? 6.345   -9.875  0.587   1.00 1.00 ? 14  LYS A CE   9  
ATOM   10941 N NZ   . LYS A 1 14 ? 6.160   -8.987  1.767   1.00 1.00 ? 14  LYS A NZ   9  
ATOM   10942 H H    . LYS A 1 14 ? 4.983   -6.457  -2.206  1.00 1.00 ? 14  LYS A H    9  
ATOM   10943 H HA   . LYS A 1 14 ? 7.639   -7.496  -2.269  1.00 1.00 ? 14  LYS A HA   9  
ATOM   10944 H HB2  . LYS A 1 14 ? 5.266   -9.062  -3.251  1.00 1.00 ? 14  LYS A HB2  9  
ATOM   10945 H HB3  . LYS A 1 14 ? 6.641   -9.595  -2.286  1.00 1.00 ? 14  LYS A HB3  9  
ATOM   10946 H HG2  . LYS A 1 14 ? 5.569   -7.737  -0.587  1.00 1.00 ? 14  LYS A HG2  9  
ATOM   10947 H HG3  . LYS A 1 14 ? 4.124   -8.286  -1.421  1.00 1.00 ? 14  LYS A HG3  9  
ATOM   10948 H HD2  . LYS A 1 14 ? 4.221   -9.778  0.343   1.00 1.00 ? 14  LYS A HD2  9  
ATOM   10949 H HD3  . LYS A 1 14 ? 5.051   -10.681 -0.922  1.00 1.00 ? 14  LYS A HD3  9  
ATOM   10950 H HE2  . LYS A 1 14 ? 6.500   -10.889 0.920   1.00 1.00 ? 14  LYS A HE2  9  
ATOM   10951 H HE3  . LYS A 1 14 ? 7.200   -9.543  0.023   1.00 1.00 ? 14  LYS A HE3  9  
ATOM   10952 H HZ1  . LYS A 1 14 ? 5.195   -8.600  1.763   1.00 1.00 ? 14  LYS A HZ1  9  
ATOM   10953 H HZ2  . LYS A 1 14 ? 6.849   -8.208  1.722   1.00 1.00 ? 14  LYS A HZ2  9  
ATOM   10954 H HZ3  . LYS A 1 14 ? 6.309   -9.533  2.638   1.00 1.00 ? 14  LYS A HZ3  9  
ATOM   10955 N N    . GLU A 1 15 ? 6.038   -7.172  -5.123  1.00 1.00 ? 15  GLU A N    9  
ATOM   10956 C CA   . GLU A 1 15 ? 6.212   -7.154  -6.565  1.00 1.00 ? 15  GLU A CA   9  
ATOM   10957 C C    . GLU A 1 15 ? 7.455   -6.371  -6.942  1.00 1.00 ? 15  GLU A C    9  
ATOM   10958 O O    . GLU A 1 15 ? 8.148   -6.715  -7.901  1.00 1.00 ? 15  GLU A O    9  
ATOM   10959 C CB   . GLU A 1 15 ? 4.976   -6.546  -7.247  1.00 1.00 ? 15  GLU A CB   9  
ATOM   10960 C CG   . GLU A 1 15 ? 3.835   -7.571  -7.294  1.00 1.00 ? 15  GLU A CG   9  
ATOM   10961 C CD   . GLU A 1 15 ? 2.570   -6.914  -7.840  1.00 1.00 ? 15  GLU A CD   9  
ATOM   10962 O OE1  . GLU A 1 15 ? 2.619   -5.729  -8.131  1.00 1.00 ? 15  GLU A OE1  9  
ATOM   10963 O OE2  . GLU A 1 15 ? 1.571   -7.604  -7.957  1.00 1.00 ? 15  GLU A OE2  9  
ATOM   10964 H H    . GLU A 1 15 ? 5.176   -6.923  -4.736  1.00 1.00 ? 15  GLU A H    9  
ATOM   10965 H HA   . GLU A 1 15 ? 6.339   -8.156  -6.899  1.00 1.00 ? 15  GLU A HA   9  
ATOM   10966 H HB2  . GLU A 1 15 ? 4.654   -5.678  -6.686  1.00 1.00 ? 15  GLU A HB2  9  
ATOM   10967 H HB3  . GLU A 1 15 ? 5.230   -6.248  -8.252  1.00 1.00 ? 15  GLU A HB3  9  
ATOM   10968 H HG2  . GLU A 1 15 ? 4.118   -8.390  -7.937  1.00 1.00 ? 15  GLU A HG2  9  
ATOM   10969 H HG3  . GLU A 1 15 ? 3.644   -7.947  -6.305  1.00 1.00 ? 15  GLU A HG3  9  
ATOM   10970 N N    . LYS A 1 16 ? 7.739   -5.329  -6.186  1.00 1.00 ? 16  LYS A N    9  
ATOM   10971 C CA   . LYS A 1 16 ? 8.909   -4.514  -6.456  1.00 1.00 ? 16  LYS A CA   9  
ATOM   10972 C C    . LYS A 1 16 ? 10.174  -5.356  -6.318  1.00 1.00 ? 16  LYS A C    9  
ATOM   10973 O O    . LYS A 1 16 ? 11.082  -5.266  -7.140  1.00 1.00 ? 16  LYS A O    9  
ATOM   10974 C CB   . LYS A 1 16 ? 8.932   -3.355  -5.479  1.00 1.00 ? 16  LYS A CB   9  
ATOM   10975 C CG   . LYS A 1 16 ? 7.772   -2.404  -5.803  1.00 1.00 ? 16  LYS A CG   9  
ATOM   10976 C CD   . LYS A 1 16 ? 7.498   -1.497  -4.608  1.00 1.00 ? 16  LYS A CD   9  
ATOM   10977 C CE   . LYS A 1 16 ? 8.459   -0.295  -4.615  1.00 1.00 ? 16  LYS A CE   9  
ATOM   10978 N NZ   . LYS A 1 16 ? 8.565   0.280   -3.244  1.00 1.00 ? 16  LYS A NZ   9  
ATOM   10979 H H    . LYS A 1 16 ? 7.155   -5.105  -5.430  1.00 1.00 ? 16  LYS A H    9  
ATOM   10980 H HA   . LYS A 1 16 ? 8.841   -4.121  -7.447  1.00 1.00 ? 16  LYS A HA   9  
ATOM   10981 H HB2  . LYS A 1 16 ? 8.819   -3.738  -4.479  1.00 1.00 ? 16  LYS A HB2  9  
ATOM   10982 H HB3  . LYS A 1 16 ? 9.868   -2.828  -5.568  1.00 1.00 ? 16  LYS A HB3  9  
ATOM   10983 H HG2  . LYS A 1 16 ? 8.025   -1.800  -6.657  1.00 1.00 ? 16  LYS A HG2  9  
ATOM   10984 H HG3  . LYS A 1 16 ? 6.881   -2.977  -6.023  1.00 1.00 ? 16  LYS A HG3  9  
ATOM   10985 H HD2  . LYS A 1 16 ? 6.480   -1.153  -4.672  1.00 1.00 ? 16  LYS A HD2  9  
ATOM   10986 H HD3  . LYS A 1 16 ? 7.623   -2.058  -3.699  1.00 1.00 ? 16  LYS A HD3  9  
ATOM   10987 H HE2  . LYS A 1 16 ? 9.437   -0.615  -4.945  1.00 1.00 ? 16  LYS A HE2  9  
ATOM   10988 H HE3  . LYS A 1 16 ? 8.083   0.460   -5.291  1.00 1.00 ? 16  LYS A HE3  9  
ATOM   10989 H HZ1  . LYS A 1 16 ? 9.542   0.586   -3.068  1.00 1.00 ? 16  LYS A HZ1  9  
ATOM   10990 H HZ2  . LYS A 1 16 ? 8.292   -0.440  -2.544  1.00 1.00 ? 16  LYS A HZ2  9  
ATOM   10991 H HZ3  . LYS A 1 16 ? 7.933   1.102   -3.162  1.00 1.00 ? 16  LYS A HZ3  9  
ATOM   10992 N N    . LEU A 1 17 ? 10.234  -6.177  -5.262  1.00 1.00 ? 17  LEU A N    9  
ATOM   10993 C CA   . LEU A 1 17 ? 11.386  -7.033  -5.016  1.00 1.00 ? 17  LEU A CA   9  
ATOM   10994 C C    . LEU A 1 17 ? 11.142  -8.412  -5.590  1.00 1.00 ? 17  LEU A C    9  
ATOM   10995 O O    . LEU A 1 17 ? 11.995  -9.296  -5.497  1.00 1.00 ? 17  LEU A O    9  
ATOM   10996 C CB   . LEU A 1 17 ? 11.621  -7.158  -3.517  1.00 1.00 ? 17  LEU A CB   9  
ATOM   10997 C CG   . LEU A 1 17 ? 11.968  -5.805  -2.909  1.00 1.00 ? 17  LEU A CG   9  
ATOM   10998 C CD1  . LEU A 1 17 ? 13.222  -5.214  -3.587  1.00 1.00 ? 17  LEU A CD1  9  
ATOM   10999 C CD2  . LEU A 1 17 ? 10.782  -4.838  -3.054  1.00 1.00 ? 17  LEU A CD2  9  
ATOM   11000 H H    . LEU A 1 17 ? 9.490   -6.204  -4.622  1.00 1.00 ? 17  LEU A H    9  
ATOM   11001 H HA   . LEU A 1 17 ? 12.258  -6.618  -5.483  1.00 1.00 ? 17  LEU A HA   9  
ATOM   11002 H HB2  . LEU A 1 17 ? 10.722  -7.526  -3.046  1.00 1.00 ? 17  LEU A HB2  9  
ATOM   11003 H HB3  . LEU A 1 17 ? 12.429  -7.848  -3.335  1.00 1.00 ? 17  LEU A HB3  9  
ATOM   11004 H HG   . LEU A 1 17 ? 12.161  -5.966  -1.873  1.00 1.00 ? 17  LEU A HG   9  
ATOM   11005 H HD11 . LEU A 1 17 ? 12.930  -4.661  -4.470  1.00 1.00 ? 17  LEU A HD11 9  
ATOM   11006 H HD12 . LEU A 1 17 ? 13.892  -6.013  -3.874  1.00 1.00 ? 17  LEU A HD12 9  
ATOM   11007 H HD13 . LEU A 1 17 ? 13.724  -4.552  -2.901  1.00 1.00 ? 17  LEU A HD13 9  
ATOM   11008 H HD21 . LEU A 1 17 ? 10.790  -4.137  -2.238  1.00 1.00 ? 17  LEU A HD21 9  
ATOM   11009 H HD22 . LEU A 1 17 ? 9.846   -5.396  -3.040  1.00 1.00 ? 17  LEU A HD22 9  
ATOM   11010 H HD23 . LEU A 1 17 ? 10.872  -4.301  -3.984  1.00 1.00 ? 17  LEU A HD23 9  
ATOM   11011 N N    . ALA A 1 18 ? 9.972   -8.601  -6.172  1.00 1.00 ? 18  ALA A N    9  
ATOM   11012 C CA   . ALA A 1 18 ? 9.622   -9.887  -6.749  1.00 1.00 ? 18  ALA A CA   9  
ATOM   11013 C C    . ALA A 1 18 ? 9.420   -10.914 -5.653  1.00 1.00 ? 18  ALA A C    9  
ATOM   11014 O O    . ALA A 1 18 ? 9.640   -12.108 -5.855  1.00 1.00 ? 18  ALA A O    9  
ATOM   11015 C CB   . ALA A 1 18 ? 10.724  -10.357 -7.710  1.00 1.00 ? 18  ALA A CB   9  
ATOM   11016 H H    . ALA A 1 18 ? 9.327   -7.864  -6.210  1.00 1.00 ? 18  ALA A H    9  
ATOM   11017 H HA   . ALA A 1 18 ? 8.698   -9.781  -7.283  1.00 1.00 ? 18  ALA A HA   9  
ATOM   11018 H HB1  . ALA A 1 18 ? 10.307  -11.045 -8.429  1.00 1.00 ? 18  ALA A HB1  9  
ATOM   11019 H HB2  . ALA A 1 18 ? 11.511  -10.852 -7.156  1.00 1.00 ? 18  ALA A HB2  9  
ATOM   11020 H HB3  . ALA A 1 18 ? 11.139  -9.503  -8.230  1.00 1.00 ? 18  ALA A HB3  9  
ATOM   11021 N N    . LEU A 1 19 ? 8.999   -10.445 -4.486  1.00 1.00 ? 19  LEU A N    9  
ATOM   11022 C CA   . LEU A 1 19 ? 8.771   -11.329 -3.349  1.00 1.00 ? 19  LEU A CA   9  
ATOM   11023 C C    . LEU A 1 19 ? 7.335   -11.851 -3.352  1.00 1.00 ? 19  LEU A C    9  
ATOM   11024 O O    . LEU A 1 19 ? 6.604   -11.680 -4.327  1.00 1.00 ? 19  LEU A O    9  
ATOM   11025 C CB   . LEU A 1 19 ? 9.067   -10.553 -2.055  1.00 1.00 ? 19  LEU A CB   9  
ATOM   11026 C CG   . LEU A 1 19 ? 10.511  -10.795 -1.599  1.00 1.00 ? 19  LEU A CG   9  
ATOM   11027 C CD1  . LEU A 1 19 ? 11.479  -10.438 -2.739  1.00 1.00 ? 19  LEU A CD1  9  
ATOM   11028 C CD2  . LEU A 1 19 ? 10.796  -9.929  -0.364  1.00 1.00 ? 19  LEU A CD2  9  
ATOM   11029 H H    . LEU A 1 19 ? 8.835   -9.480  -4.381  1.00 1.00 ? 19  LEU A H    9  
ATOM   11030 H HA   . LEU A 1 19 ? 9.438   -12.171 -3.412  1.00 1.00 ? 19  LEU A HA   9  
ATOM   11031 H HB2  . LEU A 1 19 ? 8.937   -9.499  -2.250  1.00 1.00 ? 19  LEU A HB2  9  
ATOM   11032 H HB3  . LEU A 1 19 ? 8.401   -10.860 -1.278  1.00 1.00 ? 19  LEU A HB3  9  
ATOM   11033 H HG   . LEU A 1 19 ? 10.635  -11.838 -1.344  1.00 1.00 ? 19  LEU A HG   9  
ATOM   11034 H HD11 . LEU A 1 19 ? 11.025  -9.716  -3.390  1.00 1.00 ? 19  LEU A HD11 9  
ATOM   11035 H HD12 . LEU A 1 19 ? 11.708  -11.330 -3.305  1.00 1.00 ? 19  LEU A HD12 9  
ATOM   11036 H HD13 . LEU A 1 19 ? 12.394  -10.023 -2.337  1.00 1.00 ? 19  LEU A HD13 9  
ATOM   11037 H HD21 . LEU A 1 19 ? 11.863  -9.867  -0.207  1.00 1.00 ? 19  LEU A HD21 9  
ATOM   11038 H HD22 . LEU A 1 19 ? 10.332  -10.375 0.502   1.00 1.00 ? 19  LEU A HD22 9  
ATOM   11039 H HD23 . LEU A 1 19 ? 10.393  -8.935  -0.517  1.00 1.00 ? 19  LEU A HD23 9  
ATOM   11040 N N    . GLY A 1 20 ? 6.949   -12.492 -2.254  1.00 1.00 ? 20  GLY A N    9  
ATOM   11041 C CA   . GLY A 1 20 ? 5.607   -13.049 -2.125  1.00 1.00 ? 20  GLY A CA   9  
ATOM   11042 C C    . GLY A 1 20 ? 5.580   -14.503 -2.578  1.00 1.00 ? 20  GLY A C    9  
ATOM   11043 O O    . GLY A 1 20 ? 4.560   -15.181 -2.459  1.00 1.00 ? 20  GLY A O    9  
ATOM   11044 H H    . GLY A 1 20 ? 7.587   -12.597 -1.513  1.00 1.00 ? 20  GLY A H    9  
ATOM   11045 H HA2  . GLY A 1 20 ? 5.293   -12.995 -1.089  1.00 1.00 ? 20  GLY A HA2  9  
ATOM   11046 H HA3  . GLY A 1 20 ? 4.921   -12.479 -2.733  1.00 1.00 ? 20  GLY A HA3  9  
ATOM   11047 N N    . ALA A 1 21 ? 6.709   -14.984 -3.098  1.00 1.00 ? 21  ALA A N    9  
ATOM   11048 C CA   . ALA A 1 21 ? 6.800   -16.363 -3.564  1.00 1.00 ? 21  ALA A CA   9  
ATOM   11049 C C    . ALA A 1 21 ? 7.163   -17.288 -2.413  1.00 1.00 ? 21  ALA A C    9  
ATOM   11050 O O    . ALA A 1 21 ? 6.321   -18.036 -1.913  1.00 1.00 ? 21  ALA A O    9  
ATOM   11051 C CB   . ALA A 1 21 ? 7.856   -16.476 -4.665  1.00 1.00 ? 21  ALA A CB   9  
ATOM   11052 H H    . ALA A 1 21 ? 7.495   -14.402 -3.167  1.00 1.00 ? 21  ALA A H    9  
ATOM   11053 H HA   . ALA A 1 21 ? 5.844   -16.666 -3.967  1.00 1.00 ? 21  ALA A HA   9  
ATOM   11054 H HB1  . ALA A 1 21 ? 8.842   -16.398 -4.229  1.00 1.00 ? 21  ALA A HB1  9  
ATOM   11055 H HB2  . ALA A 1 21 ? 7.715   -15.681 -5.382  1.00 1.00 ? 21  ALA A HB2  9  
ATOM   11056 H HB3  . ALA A 1 21 ? 7.758   -17.432 -5.160  1.00 1.00 ? 21  ALA A HB3  9  
ATOM   11057 N N    . ASP A 1 22 ? 8.425   -17.237 -1.990  1.00 1.00 ? 22  ASP A N    9  
ATOM   11058 C CA   . ASP A 1 22 ? 8.896   -18.079 -0.888  1.00 1.00 ? 22  ASP A CA   9  
ATOM   11059 C C    . ASP A 1 22 ? 9.035   -17.257 0.387   1.00 1.00 ? 22  ASP A C    9  
ATOM   11060 O O    . ASP A 1 22 ? 9.738   -17.651 1.321   1.00 1.00 ? 22  ASP A O    9  
ATOM   11061 C CB   . ASP A 1 22 ? 10.250  -18.696 -1.242  1.00 1.00 ? 22  ASP A CB   9  
ATOM   11062 C CG   . ASP A 1 22 ? 10.609  -19.776 -0.224  1.00 1.00 ? 22  ASP A CG   9  
ATOM   11063 O OD1  . ASP A 1 22 ? 9.873   -19.924 0.737   1.00 1.00 ? 22  ASP A OD1  9  
ATOM   11064 O OD2  . ASP A 1 22 ? 11.609  -20.444 -0.427  1.00 1.00 ? 22  ASP A OD2  9  
ATOM   11065 H H    . ASP A 1 22 ? 9.052   -16.625 -2.424  1.00 1.00 ? 22  ASP A H    9  
ATOM   11066 H HA   . ASP A 1 22 ? 8.186   -18.874 -0.714  1.00 1.00 ? 22  ASP A HA   9  
ATOM   11067 H HB2  . ASP A 1 22 ? 10.197  -19.134 -2.227  1.00 1.00 ? 22  ASP A HB2  9  
ATOM   11068 H HB3  . ASP A 1 22 ? 11.009  -17.929 -1.230  1.00 1.00 ? 22  ASP A HB3  9  
ATOM   11069 N N    . VAL A 1 23 ? 8.368   -16.103 0.422   1.00 1.00 ? 23  VAL A N    9  
ATOM   11070 C CA   . VAL A 1 23 ? 8.427   -15.221 1.591   1.00 1.00 ? 23  VAL A CA   9  
ATOM   11071 C C    . VAL A 1 23 ? 7.025   -14.981 2.147   1.00 1.00 ? 23  VAL A C    9  
ATOM   11072 O O    . VAL A 1 23 ? 6.081   -14.727 1.397   1.00 1.00 ? 23  VAL A O    9  
ATOM   11073 C CB   . VAL A 1 23 ? 9.059   -13.881 1.202   1.00 1.00 ? 23  VAL A CB   9  
ATOM   11074 C CG1  . VAL A 1 23 ? 8.954   -12.901 2.376   1.00 1.00 ? 23  VAL A CG1  9  
ATOM   11075 C CG2  . VAL A 1 23 ? 10.529  -14.099 0.845   1.00 1.00 ? 23  VAL A CG2  9  
ATOM   11076 H H    . VAL A 1 23 ? 7.830   -15.837 -0.349  1.00 1.00 ? 23  VAL A H    9  
ATOM   11077 H HA   . VAL A 1 23 ? 9.031   -15.676 2.365   1.00 1.00 ? 23  VAL A HA   9  
ATOM   11078 H HB   . VAL A 1 23 ? 8.536   -13.473 0.350   1.00 1.00 ? 23  VAL A HB   9  
ATOM   11079 H HG11 . VAL A 1 23 ? 9.626   -12.072 2.216   1.00 1.00 ? 23  VAL A HG11 9  
ATOM   11080 H HG12 . VAL A 1 23 ? 9.219   -13.408 3.293   1.00 1.00 ? 23  VAL A HG12 9  
ATOM   11081 H HG13 . VAL A 1 23 ? 7.940   -12.535 2.449   1.00 1.00 ? 23  VAL A HG13 9  
ATOM   11082 H HG21 . VAL A 1 23 ? 11.039  -14.565 1.676   1.00 1.00 ? 23  VAL A HG21 9  
ATOM   11083 H HG22 . VAL A 1 23 ? 10.992  -13.147 0.628   1.00 1.00 ? 23  VAL A HG22 9  
ATOM   11084 H HG23 . VAL A 1 23 ? 10.598  -14.738 -0.022  1.00 1.00 ? 23  VAL A HG23 9  
ATOM   11085 N N    . VAL A 1 24 ? 6.901   -15.065 3.466   1.00 1.00 ? 24  VAL A N    9  
ATOM   11086 C CA   . VAL A 1 24 ? 5.616   -14.857 4.120   1.00 1.00 ? 24  VAL A CA   9  
ATOM   11087 C C    . VAL A 1 24 ? 5.155   -13.419 3.927   1.00 1.00 ? 24  VAL A C    9  
ATOM   11088 O O    . VAL A 1 24 ? 5.962   -12.488 3.974   1.00 1.00 ? 24  VAL A O    9  
ATOM   11089 C CB   . VAL A 1 24 ? 5.732   -15.156 5.615   1.00 1.00 ? 24  VAL A CB   9  
ATOM   11090 C CG1  . VAL A 1 24 ? 6.801   -14.255 6.239   1.00 1.00 ? 24  VAL A CG1  9  
ATOM   11091 C CG2  . VAL A 1 24 ? 4.385   -14.892 6.292   1.00 1.00 ? 24  VAL A CG2  9  
ATOM   11092 H H    . VAL A 1 24 ? 7.690   -15.267 4.010   1.00 1.00 ? 24  VAL A H    9  
ATOM   11093 H HA   . VAL A 1 24 ? 4.886   -15.522 3.683   1.00 1.00 ? 24  VAL A HA   9  
ATOM   11094 H HB   . VAL A 1 24 ? 6.010   -16.191 5.754   1.00 1.00 ? 24  VAL A HB   9  
ATOM   11095 H HG11 . VAL A 1 24 ? 6.917   -14.504 7.283   1.00 1.00 ? 24  VAL A HG11 9  
ATOM   11096 H HG12 . VAL A 1 24 ? 6.501   -13.222 6.147   1.00 1.00 ? 24  VAL A HG12 9  
ATOM   11097 H HG13 . VAL A 1 24 ? 7.741   -14.402 5.726   1.00 1.00 ? 24  VAL A HG13 9  
ATOM   11098 H HG21 . VAL A 1 24 ? 4.221   -13.826 6.362   1.00 1.00 ? 24  VAL A HG21 9  
ATOM   11099 H HG22 . VAL A 1 24 ? 4.391   -15.320 7.284   1.00 1.00 ? 24  VAL A HG22 9  
ATOM   11100 H HG23 . VAL A 1 24 ? 3.595   -15.341 5.710   1.00 1.00 ? 24  VAL A HG23 9  
ATOM   11101 N N    . VAL A 1 25 ? 3.853   -13.238 3.706   1.00 1.00 ? 25  VAL A N    9  
ATOM   11102 C CA   . VAL A 1 25 ? 3.292   -11.899 3.503   1.00 1.00 ? 25  VAL A CA   9  
ATOM   11103 C C    . VAL A 1 25 ? 2.279   -11.577 4.595   1.00 1.00 ? 25  VAL A C    9  
ATOM   11104 O O    . VAL A 1 25 ? 1.384   -12.375 4.880   1.00 1.00 ? 25  VAL A O    9  
ATOM   11105 C CB   . VAL A 1 25 ? 2.604   -11.828 2.134   1.00 1.00 ? 25  VAL A CB   9  
ATOM   11106 C CG1  . VAL A 1 25 ? 2.100   -10.403 1.888   1.00 1.00 ? 25  VAL A CG1  9  
ATOM   11107 C CG2  . VAL A 1 25 ? 3.586   -12.254 1.037   1.00 1.00 ? 25  VAL A CG2  9  
ATOM   11108 H H    . VAL A 1 25 ? 3.260   -14.014 3.676   1.00 1.00 ? 25  VAL A H    9  
ATOM   11109 H HA   . VAL A 1 25 ? 4.080   -11.157 3.533   1.00 1.00 ? 25  VAL A HA   9  
ATOM   11110 H HB   . VAL A 1 25 ? 1.769   -12.489 2.126   1.00 1.00 ? 25  VAL A HB   9  
ATOM   11111 H HG11 . VAL A 1 25 ? 2.854   -9.695  2.201   1.00 1.00 ? 25  VAL A HG11 9  
ATOM   11112 H HG12 . VAL A 1 25 ? 1.197   -10.240 2.458   1.00 1.00 ? 25  VAL A HG12 9  
ATOM   11113 H HG13 . VAL A 1 25 ? 1.889   -10.270 0.835   1.00 1.00 ? 25  VAL A HG13 9  
ATOM   11114 H HG21 . VAL A 1 25 ? 3.260   -11.866 0.083   1.00 1.00 ? 25  VAL A HG21 9  
ATOM   11115 H HG22 . VAL A 1 25 ? 3.620   -13.333 0.988   1.00 1.00 ? 25  VAL A HG22 9  
ATOM   11116 H HG23 . VAL A 1 25 ? 4.564   -11.882 1.266   1.00 1.00 ? 25  VAL A HG23 9  
ATOM   11117 N N    . THR A 1 26 ? 2.426   -10.401 5.211   1.00 1.00 ? 26  THR A N    9  
ATOM   11118 C CA   . THR A 1 26 ? 1.523   -9.976  6.272   1.00 1.00 ? 26  THR A CA   9  
ATOM   11119 C C    . THR A 1 26 ? 1.177   -8.506  6.106   1.00 1.00 ? 26  THR A C    9  
ATOM   11120 O O    . THR A 1 26 ? 1.964   -7.727  5.571   1.00 1.00 ? 26  THR A O    9  
ATOM   11121 C CB   . THR A 1 26 ? 2.187   -10.206 7.631   1.00 1.00 ? 26  THR A CB   9  
ATOM   11122 O OG1  . THR A 1 26 ? 3.530   -9.756  7.577   1.00 1.00 ? 26  THR A OG1  9  
ATOM   11123 C CG2  . THR A 1 26 ? 2.156   -11.695 7.967   1.00 1.00 ? 26  THR A CG2  9  
ATOM   11124 H H    . THR A 1 26 ? 3.154   -9.803  4.946   1.00 1.00 ? 26  THR A H    9  
ATOM   11125 H HA   . THR A 1 26 ? 0.609   -10.554 6.227   1.00 1.00 ? 26  THR A HA   9  
ATOM   11126 H HB   . THR A 1 26 ? 1.654   -9.658  8.394   1.00 1.00 ? 26  THR A HB   9  
ATOM   11127 H HG1  . THR A 1 26 ? 4.038   -10.400 7.076   1.00 1.00 ? 26  THR A HG1  9  
ATOM   11128 H HG21 . THR A 1 26 ? 2.500   -12.263 7.114   1.00 1.00 ? 26  THR A HG21 9  
ATOM   11129 H HG22 . THR A 1 26 ? 1.144   -11.985 8.208   1.00 1.00 ? 26  THR A HG22 9  
ATOM   11130 H HG23 . THR A 1 26 ? 2.799   -11.887 8.813   1.00 1.00 ? 26  THR A HG23 9  
ATOM   11131 N N    . ALA A 1 27 ? -0.009  -8.136  6.565   1.00 1.00 ? 27  ALA A N    9  
ATOM   11132 C CA   . ALA A 1 27 ? -0.463  -6.756  6.457   1.00 1.00 ? 27  ALA A CA   9  
ATOM   11133 C C    . ALA A 1 27 ? 0.037   -5.922  7.629   1.00 1.00 ? 27  ALA A C    9  
ATOM   11134 O O    . ALA A 1 27 ? 0.342   -4.742  7.479   1.00 1.00 ? 27  ALA A O    9  
ATOM   11135 C CB   . ALA A 1 27 ? -1.987  -6.720  6.433   1.00 1.00 ? 27  ALA A CB   9  
ATOM   11136 H H    . ALA A 1 27 ? -0.595  -8.804  6.979   1.00 1.00 ? 27  ALA A H    9  
ATOM   11137 H HA   . ALA A 1 27 ? -0.092  -6.336  5.536   1.00 1.00 ? 27  ALA A HA   9  
ATOM   11138 H HB1  . ALA A 1 27 ? -2.318  -5.754  6.078   1.00 1.00 ? 27  ALA A HB1  9  
ATOM   11139 H HB2  . ALA A 1 27 ? -2.368  -6.889  7.430   1.00 1.00 ? 27  ALA A HB2  9  
ATOM   11140 H HB3  . ALA A 1 27 ? -2.349  -7.494  5.777   1.00 1.00 ? 27  ALA A HB3  9  
ATOM   11141 N N    . ASP A 1 28 ? 0.109   -6.543  8.797   1.00 1.00 ? 28  ASP A N    9  
ATOM   11142 C CA   . ASP A 1 28 ? 0.558   -5.841  9.989   1.00 1.00 ? 28  ASP A CA   9  
ATOM   11143 C C    . ASP A 1 28 ? 2.077   -5.782  10.027  1.00 1.00 ? 28  ASP A C    9  
ATOM   11144 O O    . ASP A 1 28 ? 2.665   -5.470  11.062  1.00 1.00 ? 28  ASP A O    9  
ATOM   11145 C CB   . ASP A 1 28 ? 0.036   -6.546  11.243  1.00 1.00 ? 28  ASP A CB   9  
ATOM   11146 C CG   . ASP A 1 28 ? -1.481  -6.668  11.175  1.00 1.00 ? 28  ASP A CG   9  
ATOM   11147 O OD1  . ASP A 1 28 ? -2.006  -6.675  10.073  1.00 1.00 ? 28  ASP A OD1  9  
ATOM   11148 O OD2  . ASP A 1 28 ? -2.098  -6.758  12.224  1.00 1.00 ? 28  ASP A OD2  9  
ATOM   11149 H H    . ASP A 1 28 ? -0.149  -7.488  8.862   1.00 1.00 ? 28  ASP A H    9  
ATOM   11150 H HA   . ASP A 1 28 ? 0.168   -4.832  9.966   1.00 1.00 ? 28  ASP A HA   9  
ATOM   11151 H HB2  . ASP A 1 28 ? 0.473   -7.533  11.309  1.00 1.00 ? 28  ASP A HB2  9  
ATOM   11152 H HB3  . ASP A 1 28 ? 0.309   -5.973  12.117  1.00 1.00 ? 28  ASP A HB3  9  
ATOM   11153 N N    . SER A 1 29 ? 2.711   -6.090  8.896   1.00 1.00 ? 29  SER A N    9  
ATOM   11154 C CA   . SER A 1 29 ? 4.169   -6.070  8.823   1.00 1.00 ? 29  SER A CA   9  
ATOM   11155 C C    . SER A 1 29 ? 4.673   -4.715  8.338   1.00 1.00 ? 29  SER A C    9  
ATOM   11156 O O    . SER A 1 29 ? 5.850   -4.570  8.008   1.00 1.00 ? 29  SER A O    9  
ATOM   11157 C CB   . SER A 1 29 ? 4.662   -7.185  7.891   1.00 1.00 ? 29  SER A CB   9  
ATOM   11158 O OG   . SER A 1 29 ? 4.991   -8.326  8.673   1.00 1.00 ? 29  SER A OG   9  
ATOM   11159 H H    . SER A 1 29 ? 2.190   -6.338  8.091   1.00 1.00 ? 29  SER A H    9  
ATOM   11160 H HA   . SER A 1 29 ? 4.565   -6.246  9.809   1.00 1.00 ? 29  SER A HA   9  
ATOM   11161 H HB2  . SER A 1 29 ? 3.880   -7.447  7.198   1.00 1.00 ? 29  SER A HB2  9  
ATOM   11162 H HB3  . SER A 1 29 ? 5.535   -6.855  7.336   1.00 1.00 ? 29  SER A HB3  9  
ATOM   11163 H HG   . SER A 1 29 ? 5.930   -8.497  8.565   1.00 1.00 ? 29  SER A HG   9  
ATOM   11164 N N    . GLU A 1 30 ? 3.779   -3.739  8.294   1.00 1.00 ? 30  GLU A N    9  
ATOM   11165 C CA   . GLU A 1 30 ? 4.143   -2.404  7.847   1.00 1.00 ? 30  GLU A CA   9  
ATOM   11166 C C    . GLU A 1 30 ? 4.728   -2.459  6.437   1.00 1.00 ? 30  GLU A C    9  
ATOM   11167 O O    . GLU A 1 30 ? 5.261   -3.485  6.014   1.00 1.00 ? 30  GLU A O    9  
ATOM   11168 C CB   . GLU A 1 30 ? 5.168   -1.793  8.805   1.00 1.00 ? 30  GLU A CB   9  
ATOM   11169 C CG   . GLU A 1 30 ? 4.531   -1.589  10.179  1.00 1.00 ? 30  GLU A CG   9  
ATOM   11170 C CD   . GLU A 1 30 ? 5.599   -1.220  11.202  1.00 1.00 ? 30  GLU A CD   9  
ATOM   11171 O OE1  . GLU A 1 30 ? 6.726   -0.990  10.796  1.00 1.00 ? 30  GLU A OE1  9  
ATOM   11172 O OE2  . GLU A 1 30 ? 5.272   -1.172  12.376  1.00 1.00 ? 30  GLU A OE2  9  
ATOM   11173 H H    . GLU A 1 30 ? 2.855   -3.922  8.570   1.00 1.00 ? 30  GLU A H    9  
ATOM   11174 H HA   . GLU A 1 30 ? 3.262   -1.786  7.840   1.00 1.00 ? 30  GLU A HA   9  
ATOM   11175 H HB2  . GLU A 1 30 ? 6.023   -2.446  8.896   1.00 1.00 ? 30  GLU A HB2  9  
ATOM   11176 H HB3  . GLU A 1 30 ? 5.486   -0.838  8.419   1.00 1.00 ? 30  GLU A HB3  9  
ATOM   11177 H HG2  . GLU A 1 30 ? 3.812   -0.788  10.120  1.00 1.00 ? 30  GLU A HG2  9  
ATOM   11178 H HG3  . GLU A 1 30 ? 4.036   -2.498  10.487  1.00 1.00 ? 30  GLU A HG3  9  
ATOM   11179 N N    . PHE A 1 31 ? 4.629   -1.351  5.716   1.00 1.00 ? 31  PHE A N    9  
ATOM   11180 C CA   . PHE A 1 31 ? 5.159   -1.286  4.357   1.00 1.00 ? 31  PHE A CA   9  
ATOM   11181 C C    . PHE A 1 31 ? 6.668   -1.503  4.357   1.00 1.00 ? 31  PHE A C    9  
ATOM   11182 O O    . PHE A 1 31 ? 7.198   -2.238  3.525   1.00 1.00 ? 31  PHE A O    9  
ATOM   11183 C CB   . PHE A 1 31 ? 4.827   0.076   3.736   1.00 1.00 ? 31  PHE A CB   9  
ATOM   11184 C CG   . PHE A 1 31 ? 3.398   0.094   3.260   1.00 1.00 ? 31  PHE A CG   9  
ATOM   11185 C CD1  . PHE A 1 31 ? 2.369   0.486   4.123   1.00 1.00 ? 31  PHE A CD1  9  
ATOM   11186 C CD2  . PHE A 1 31 ? 3.105   -0.286  1.948   1.00 1.00 ? 31  PHE A CD2  9  
ATOM   11187 C CE1  . PHE A 1 31 ? 1.051   0.496   3.672   1.00 1.00 ? 31  PHE A CE1  9  
ATOM   11188 C CE2  . PHE A 1 31 ? 1.784   -0.275  1.495   1.00 1.00 ? 31  PHE A CE2  9  
ATOM   11189 C CZ   . PHE A 1 31 ? 0.754   0.115   2.356   1.00 1.00 ? 31  PHE A CZ   9  
ATOM   11190 H H    . PHE A 1 31 ? 4.196   -0.560  6.101   1.00 1.00 ? 31  PHE A H    9  
ATOM   11191 H HA   . PHE A 1 31 ? 4.697   -2.064  3.765   1.00 1.00 ? 31  PHE A HA   9  
ATOM   11192 H HB2  . PHE A 1 31 ? 4.963   0.847   4.477   1.00 1.00 ? 31  PHE A HB2  9  
ATOM   11193 H HB3  . PHE A 1 31 ? 5.481   0.263   2.898   1.00 1.00 ? 31  PHE A HB3  9  
ATOM   11194 H HD1  . PHE A 1 31 ? 2.590   0.781   5.136   1.00 1.00 ? 31  PHE A HD1  9  
ATOM   11195 H HD2  . PHE A 1 31 ? 3.900   -0.585  1.283   1.00 1.00 ? 31  PHE A HD2  9  
ATOM   11196 H HE1  . PHE A 1 31 ? 0.260   0.799   4.339   1.00 1.00 ? 31  PHE A HE1  9  
ATOM   11197 H HE2  . PHE A 1 31 ? 1.558   -0.569  0.481   1.00 1.00 ? 31  PHE A HE2  9  
ATOM   11198 H HZ   . PHE A 1 31 ? -0.264  0.121   2.008   1.00 1.00 ? 31  PHE A HZ   9  
ATOM   11199 N N    . SER A 1 32 ? 7.355   -0.857  5.292   1.00 1.00 ? 32  SER A N    9  
ATOM   11200 C CA   . SER A 1 32 ? 8.804   -0.988  5.385   1.00 1.00 ? 32  SER A CA   9  
ATOM   11201 C C    . SER A 1 32 ? 9.282   -0.632  6.787   1.00 1.00 ? 32  SER A C    9  
ATOM   11202 O O    . SER A 1 32 ? 8.569   0.021   7.550   1.00 1.00 ? 32  SER A O    9  
ATOM   11203 C CB   . SER A 1 32 ? 9.473   -0.067  4.365   1.00 1.00 ? 32  SER A CB   9  
ATOM   11204 O OG   . SER A 1 32 ? 8.980   1.255   4.530   1.00 1.00 ? 32  SER A OG   9  
ATOM   11205 H H    . SER A 1 32 ? 6.880   -0.284  5.930   1.00 1.00 ? 32  SER A H    9  
ATOM   11206 H HA   . SER A 1 32 ? 9.083   -2.008  5.169   1.00 1.00 ? 32  SER A HA   9  
ATOM   11207 H HB2  . SER A 1 32 ? 10.539  -0.070  4.518   1.00 1.00 ? 32  SER A HB2  9  
ATOM   11208 H HB3  . SER A 1 32 ? 9.256   -0.422  3.366   1.00 1.00 ? 32  SER A HB3  9  
ATOM   11209 H HG   . SER A 1 32 ? 9.654   1.770   4.974   1.00 1.00 ? 32  SER A HG   9  
ATOM   11210 N N    . LYS A 1 33 ? 10.493  -1.066  7.121   1.00 1.00 ? 33  LYS A N    9  
ATOM   11211 C CA   . LYS A 1 33 ? 11.064  -0.790  8.438   1.00 1.00 ? 33  LYS A CA   9  
ATOM   11212 C C    . LYS A 1 33 ? 11.780  0.556   8.441   1.00 1.00 ? 33  LYS A C    9  
ATOM   11213 O O    . LYS A 1 33 ? 12.337  0.978   7.428   1.00 1.00 ? 33  LYS A O    9  
ATOM   11214 C CB   . LYS A 1 33 ? 12.048  -1.895  8.823   1.00 1.00 ? 33  LYS A CB   9  
ATOM   11215 C CG   . LYS A 1 33 ? 11.284  -3.202  9.045   1.00 1.00 ? 33  LYS A CG   9  
ATOM   11216 C CD   . LYS A 1 33 ? 12.268  -4.305  9.442   1.00 1.00 ? 33  LYS A CD   9  
ATOM   11217 C CE   . LYS A 1 33 ? 11.502  -5.606  9.694   1.00 1.00 ? 33  LYS A CE   9  
ATOM   11218 N NZ   . LYS A 1 33 ? 12.460  -6.677  10.085  1.00 1.00 ? 33  LYS A NZ   9  
ATOM   11219 H H    . LYS A 1 33 ? 11.015  -1.582  6.473   1.00 1.00 ? 33  LYS A H    9  
ATOM   11220 H HA   . LYS A 1 33 ? 10.269  -0.765  9.170   1.00 1.00 ? 33  LYS A HA   9  
ATOM   11221 H HB2  . LYS A 1 33 ? 12.769  -2.027  8.029   1.00 1.00 ? 33  LYS A HB2  9  
ATOM   11222 H HB3  . LYS A 1 33 ? 12.560  -1.621  9.734   1.00 1.00 ? 33  LYS A HB3  9  
ATOM   11223 H HG2  . LYS A 1 33 ? 10.557  -3.066  9.832   1.00 1.00 ? 33  LYS A HG2  9  
ATOM   11224 H HG3  . LYS A 1 33 ? 10.780  -3.484  8.133   1.00 1.00 ? 33  LYS A HG3  9  
ATOM   11225 H HD2  . LYS A 1 33 ? 12.981  -4.456  8.645   1.00 1.00 ? 33  LYS A HD2  9  
ATOM   11226 H HD3  . LYS A 1 33 ? 12.789  -4.016  10.344  1.00 1.00 ? 33  LYS A HD3  9  
ATOM   11227 H HE2  . LYS A 1 33 ? 10.788  -5.454  10.488  1.00 1.00 ? 33  LYS A HE2  9  
ATOM   11228 H HE3  . LYS A 1 33 ? 10.983  -5.898  8.793   1.00 1.00 ? 33  LYS A HE3  9  
ATOM   11229 H HZ1  . LYS A 1 33 ? 13.346  -6.563  9.553   1.00 1.00 ? 33  LYS A HZ1  9  
ATOM   11230 H HZ2  . LYS A 1 33 ? 12.044  -7.608  9.872   1.00 1.00 ? 33  LYS A HZ2  9  
ATOM   11231 H HZ3  . LYS A 1 33 ? 12.660  -6.611  11.103  1.00 1.00 ? 33  LYS A HZ3  9  
ATOM   11232 N N    . LEU A 1 34 ? 11.762  1.226   9.589   1.00 1.00 ? 34  LEU A N    9  
ATOM   11233 C CA   . LEU A 1 34 ? 12.410  2.526   9.715   1.00 1.00 ? 34  LEU A CA   9  
ATOM   11234 C C    . LEU A 1 34 ? 13.925  2.366   9.719   1.00 1.00 ? 34  LEU A C    9  
ATOM   11235 O O    . LEU A 1 34 ? 14.461  1.450   10.341  1.00 1.00 ? 34  LEU A O    9  
ATOM   11236 C CB   . LEU A 1 34 ? 11.962  3.204   11.011  1.00 1.00 ? 34  LEU A CB   9  
ATOM   11237 C CG   . LEU A 1 34 ? 10.431  3.291   11.045  1.00 1.00 ? 34  LEU A CG   9  
ATOM   11238 C CD1  . LEU A 1 34 ? 9.986   3.903   12.376  1.00 1.00 ? 34  LEU A CD1  9  
ATOM   11239 C CD2  . LEU A 1 34 ? 9.927   4.160   9.878   1.00 1.00 ? 34  LEU A CD2  9  
ATOM   11240 H H    . LEU A 1 34 ? 11.301  0.841   10.364  1.00 1.00 ? 34  LEU A H    9  
ATOM   11241 H HA   . LEU A 1 34 ? 12.126  3.146   8.878   1.00 1.00 ? 34  LEU A HA   9  
ATOM   11242 H HB2  . LEU A 1 34 ? 12.310  2.629   11.855  1.00 1.00 ? 34  LEU A HB2  9  
ATOM   11243 H HB3  . LEU A 1 34 ? 12.378  4.200   11.057  1.00 1.00 ? 34  LEU A HB3  9  
ATOM   11244 H HG   . LEU A 1 34 ? 10.018  2.296   10.956  1.00 1.00 ? 34  LEU A HG   9  
ATOM   11245 H HD11 . LEU A 1 34 ? 8.911   4.007   12.382  1.00 1.00 ? 34  LEU A HD11 9  
ATOM   11246 H HD12 . LEU A 1 34 ? 10.441  4.876   12.496  1.00 1.00 ? 34  LEU A HD12 9  
ATOM   11247 H HD13 . LEU A 1 34 ? 10.289  3.260   13.188  1.00 1.00 ? 34  LEU A HD13 9  
ATOM   11248 H HD21 . LEU A 1 34 ? 9.850   3.556   8.985   1.00 1.00 ? 34  LEU A HD21 9  
ATOM   11249 H HD22 . LEU A 1 34 ? 10.617  4.973   9.703   1.00 1.00 ? 34  LEU A HD22 9  
ATOM   11250 H HD23 . LEU A 1 34 ? 8.953   4.564   10.117  1.00 1.00 ? 34  LEU A HD23 9  
ATOM   11251 N N    . GLY A 1 35 ? 14.610  3.266   9.020   1.00 1.00 ? 35  GLY A N    9  
ATOM   11252 C CA   . GLY A 1 35 ? 16.065  3.217   8.949   1.00 1.00 ? 35  GLY A CA   9  
ATOM   11253 C C    . GLY A 1 35 ? 16.578  4.009   7.753   1.00 1.00 ? 35  GLY A C    9  
ATOM   11254 O O    . GLY A 1 35 ? 15.820  4.722   7.094   1.00 1.00 ? 35  GLY A O    9  
ATOM   11255 H H    . GLY A 1 35 ? 14.128  3.975   8.544   1.00 1.00 ? 35  GLY A H    9  
ATOM   11256 H HA2  . GLY A 1 35 ? 16.476  3.635   9.857   1.00 1.00 ? 35  GLY A HA2  9  
ATOM   11257 H HA3  . GLY A 1 35 ? 16.382  2.190   8.854   1.00 1.00 ? 35  GLY A HA3  9  
ATOM   11258 N N    . ALA A 1 36 ? 17.871  3.880   7.476   1.00 1.00 ? 36  ALA A N    9  
ATOM   11259 C CA   . ALA A 1 36 ? 18.479  4.592   6.357   1.00 1.00 ? 36  ALA A CA   9  
ATOM   11260 C C    . ALA A 1 36 ? 17.840  4.161   5.042   1.00 1.00 ? 36  ALA A C    9  
ATOM   11261 O O    . ALA A 1 36 ? 17.653  4.974   4.136   1.00 1.00 ? 36  ALA A O    9  
ATOM   11262 C CB   . ALA A 1 36 ? 19.981  4.308   6.311   1.00 1.00 ? 36  ALA A CB   9  
ATOM   11263 H H    . ALA A 1 36 ? 18.428  3.299   8.036   1.00 1.00 ? 36  ALA A H    9  
ATOM   11264 H HA   . ALA A 1 36 ? 18.327  5.651   6.489   1.00 1.00 ? 36  ALA A HA   9  
ATOM   11265 H HB1  . ALA A 1 36 ? 20.469  4.820   7.127   1.00 1.00 ? 36  ALA A HB1  9  
ATOM   11266 H HB2  . ALA A 1 36 ? 20.384  4.658   5.372   1.00 1.00 ? 36  ALA A HB2  9  
ATOM   11267 H HB3  . ALA A 1 36 ? 20.150  3.244   6.401   1.00 1.00 ? 36  ALA A HB3  9  
ATOM   11268 N N    . ASP A 1 37 ? 17.508  2.877   4.941   1.00 1.00 ? 37  ASP A N    9  
ATOM   11269 C CA   . ASP A 1 37 ? 16.888  2.345   3.729   1.00 1.00 ? 37  ASP A CA   9  
ATOM   11270 C C    . ASP A 1 37 ? 15.370  2.378   3.849   1.00 1.00 ? 37  ASP A C    9  
ATOM   11271 O O    . ASP A 1 37 ? 14.785  1.675   4.675   1.00 1.00 ? 37  ASP A O    9  
ATOM   11272 C CB   . ASP A 1 37 ? 17.346  0.904   3.496   1.00 1.00 ? 37  ASP A CB   9  
ATOM   11273 C CG   . ASP A 1 37 ? 16.970  0.460   2.085   1.00 1.00 ? 37  ASP A CG   9  
ATOM   11274 O OD1  . ASP A 1 37 ? 16.769  1.321   1.245   1.00 1.00 ? 37  ASP A OD1  9  
ATOM   11275 O OD2  . ASP A 1 37 ? 16.888  -0.738  1.866   1.00 1.00 ? 37  ASP A OD2  9  
ATOM   11276 H H    . ASP A 1 37 ? 17.680  2.275   5.695   1.00 1.00 ? 37  ASP A H    9  
ATOM   11277 H HA   . ASP A 1 37 ? 17.185  2.946   2.882   1.00 1.00 ? 37  ASP A HA   9  
ATOM   11278 H HB2  . ASP A 1 37 ? 18.418  0.846   3.617   1.00 1.00 ? 37  ASP A HB2  9  
ATOM   11279 H HB3  . ASP A 1 37 ? 16.866  0.256   4.214   1.00 1.00 ? 37  ASP A HB3  9  
ATOM   11280 N N    . SER A 1 38 ? 14.731  3.200   3.017   1.00 1.00 ? 38  SER A N    9  
ATOM   11281 C CA   . SER A 1 38 ? 13.272  3.324   3.032   1.00 1.00 ? 38  SER A CA   9  
ATOM   11282 C C    . SER A 1 38 ? 12.721  3.316   1.612   1.00 1.00 ? 38  SER A C    9  
ATOM   11283 O O    . SER A 1 38 ? 13.366  3.800   0.682   1.00 1.00 ? 38  SER A O    9  
ATOM   11284 C CB   . SER A 1 38 ? 12.866  4.622   3.730   1.00 1.00 ? 38  SER A CB   9  
ATOM   11285 H H    . SER A 1 38 ? 15.247  3.734   2.381   1.00 1.00 ? 38  SER A H    9  
ATOM   11286 H HA   . SER A 1 38 ? 12.843  2.490   3.574   1.00 1.00 ? 38  SER A HA   9  
ATOM   11287 H HB2  . SER A 1 38 ? 13.272  4.631   4.734   1.00 1.00 ? 38  SER A HB2  9  
ATOM   11288 H HB3  . SER A 1 38 ? 11.792  4.688   3.780   1.00 1.00 ? 38  SER A HB3  9  
ATOM   11289 N N    . LEU A 1 39 ? 11.525  2.759   1.453   1.00 1.00 ? 39  LEU A N    9  
ATOM   11290 C CA   . LEU A 1 39 ? 10.888  2.687   0.143   1.00 1.00 ? 39  LEU A CA   9  
ATOM   11291 C C    . LEU A 1 39 ? 10.247  4.023   -0.212  1.00 1.00 ? 39  LEU A C    9  
ATOM   11292 O O    . LEU A 1 39 ? 9.809   4.766   0.666   1.00 1.00 ? 39  LEU A O    9  
ATOM   11293 C CB   . LEU A 1 39 ? 9.825   1.582   0.136   1.00 1.00 ? 39  LEU A CB   9  
ATOM   11294 C CG   . LEU A 1 39 ? 10.503  0.215   0.011   1.00 1.00 ? 39  LEU A CG   9  
ATOM   11295 C CD1  . LEU A 1 39 ? 11.489  0.021   1.169   1.00 1.00 ? 39  LEU A CD1  9  
ATOM   11296 C CD2  . LEU A 1 39 ? 9.439   -0.884  0.050   1.00 1.00 ? 39  LEU A CD2  9  
ATOM   11297 H H    . LEU A 1 39 ? 11.060  2.389   2.232   1.00 1.00 ? 39  LEU A H    9  
ATOM   11298 H HA   . LEU A 1 39 ? 11.639  2.455   -0.599  1.00 1.00 ? 39  LEU A HA   9  
ATOM   11299 H HB2  . LEU A 1 39 ? 9.261   1.620   1.056   1.00 1.00 ? 39  LEU A HB2  9  
ATOM   11300 H HB3  . LEU A 1 39 ? 9.157   1.726   -0.701  1.00 1.00 ? 39  LEU A HB3  9  
ATOM   11301 H HG   . LEU A 1 39 ? 11.039  0.166   -0.928  1.00 1.00 ? 39  LEU A HG   9  
ATOM   11302 H HD11 . LEU A 1 39 ? 11.725  -1.028  1.272   1.00 1.00 ? 39  LEU A HD11 9  
ATOM   11303 H HD12 . LEU A 1 39 ? 11.047  0.382   2.087   1.00 1.00 ? 39  LEU A HD12 9  
ATOM   11304 H HD13 . LEU A 1 39 ? 12.395  0.572   0.966   1.00 1.00 ? 39  LEU A HD13 9  
ATOM   11305 H HD21 . LEU A 1 39 ? 8.868   -0.866  -0.866  1.00 1.00 ? 39  LEU A HD21 9  
ATOM   11306 H HD22 . LEU A 1 39 ? 8.780   -0.716  0.889   1.00 1.00 ? 39  LEU A HD22 9  
ATOM   11307 H HD23 . LEU A 1 39 ? 9.919   -1.847  0.156   1.00 1.00 ? 39  LEU A HD23 9  
ATOM   11308 N N    . ASP A 1 40 ? 10.195  4.322   -1.505  1.00 1.00 ? 40  ASP A N    9  
ATOM   11309 C CA   . ASP A 1 40 ? 9.605   5.571   -1.967  1.00 1.00 ? 40  ASP A CA   9  
ATOM   11310 C C    . ASP A 1 40 ? 8.083   5.485   -1.947  1.00 1.00 ? 40  ASP A C    9  
ATOM   11311 O O    . ASP A 1 40 ? 7.494   4.612   -2.583  1.00 1.00 ? 40  ASP A O    9  
ATOM   11312 C CB   . ASP A 1 40 ? 10.078  5.878   -3.388  1.00 1.00 ? 40  ASP A CB   9  
ATOM   11313 C CG   . ASP A 1 40 ? 11.542  6.300   -3.371  1.00 1.00 ? 40  ASP A CG   9  
ATOM   11314 O OD1  . ASP A 1 40 ? 12.074  6.484   -2.289  1.00 1.00 ? 40  ASP A OD1  9  
ATOM   11315 O OD2  . ASP A 1 40 ? 12.111  6.436   -4.442  1.00 1.00 ? 40  ASP A OD2  9  
ATOM   11316 H H    . ASP A 1 40 ? 10.562  3.691   -2.160  1.00 1.00 ? 40  ASP A H    9  
ATOM   11317 H HA   . ASP A 1 40 ? 9.921   6.372   -1.315  1.00 1.00 ? 40  ASP A HA   9  
ATOM   11318 H HB2  . ASP A 1 40 ? 9.966   4.996   -4.001  1.00 1.00 ? 40  ASP A HB2  9  
ATOM   11319 H HB3  . ASP A 1 40 ? 9.481   6.678   -3.799  1.00 1.00 ? 40  ASP A HB3  9  
ATOM   11320 N N    . THR A 1 41 ? 7.454   6.397   -1.216  1.00 1.00 ? 41  THR A N    9  
ATOM   11321 C CA   . THR A 1 41 ? 5.997   6.421   -1.118  1.00 1.00 ? 41  THR A CA   9  
ATOM   11322 C C    . THR A 1 41 ? 5.373   6.664   -2.486  1.00 1.00 ? 41  THR A C    9  
ATOM   11323 O O    . THR A 1 41 ? 4.318   6.115   -2.804  1.00 1.00 ? 41  THR A O    9  
ATOM   11324 C CB   . THR A 1 41 ? 5.553   7.518   -0.148  1.00 1.00 ? 41  THR A CB   9  
ATOM   11325 O OG1  . THR A 1 41 ? 6.293   7.407   1.061   1.00 1.00 ? 41  THR A OG1  9  
ATOM   11326 C CG2  . THR A 1 41 ? 4.058   7.374   0.149   1.00 1.00 ? 41  THR A CG2  9  
ATOM   11327 H H    . THR A 1 41 ? 7.981   7.069   -0.732  1.00 1.00 ? 41  THR A H    9  
ATOM   11328 H HA   . THR A 1 41 ? 5.661   5.467   -0.744  1.00 1.00 ? 41  THR A HA   9  
ATOM   11329 H HB   . THR A 1 41 ? 5.734   8.483   -0.591  1.00 1.00 ? 41  THR A HB   9  
ATOM   11330 H HG1  . THR A 1 41 ? 6.187   6.512   1.392   1.00 1.00 ? 41  THR A HG1  9  
ATOM   11331 H HG21 . THR A 1 41 ? 3.487   7.668   -0.720  1.00 1.00 ? 41  THR A HG21 9  
ATOM   11332 H HG22 . THR A 1 41 ? 3.795   8.007   0.983   1.00 1.00 ? 41  THR A HG22 9  
ATOM   11333 H HG23 . THR A 1 41 ? 3.832   6.346   0.397   1.00 1.00 ? 41  THR A HG23 9  
ATOM   11334 N N    . VAL A 1 42 ? 6.028   7.494   -3.290  1.00 1.00 ? 42  VAL A N    9  
ATOM   11335 C CA   . VAL A 1 42 ? 5.528   7.811   -4.622  1.00 1.00 ? 42  VAL A CA   9  
ATOM   11336 C C    . VAL A 1 42 ? 5.402   6.539   -5.456  1.00 1.00 ? 42  VAL A C    9  
ATOM   11337 O O    . VAL A 1 42 ? 4.496   6.404   -6.274  1.00 1.00 ? 42  VAL A O    9  
ATOM   11338 C CB   . VAL A 1 42 ? 6.475   8.788   -5.319  1.00 1.00 ? 42  VAL A CB   9  
ATOM   11339 C CG1  . VAL A 1 42 ? 5.988   9.039   -6.748  1.00 1.00 ? 42  VAL A CG1  9  
ATOM   11340 C CG2  . VAL A 1 42 ? 6.499   10.110  -4.548  1.00 1.00 ? 42  VAL A CG2  9  
ATOM   11341 H H    . VAL A 1 42 ? 6.864   7.904   -2.980  1.00 1.00 ? 42  VAL A H    9  
ATOM   11342 H HA   . VAL A 1 42 ? 4.556   8.269   -4.532  1.00 1.00 ? 42  VAL A HA   9  
ATOM   11343 H HB   . VAL A 1 42 ? 7.469   8.368   -5.348  1.00 1.00 ? 42  VAL A HB   9  
ATOM   11344 H HG11 . VAL A 1 42 ? 4.929   9.252   -6.735  1.00 1.00 ? 42  VAL A HG11 9  
ATOM   11345 H HG12 . VAL A 1 42 ? 6.173   8.163   -7.351  1.00 1.00 ? 42  VAL A HG12 9  
ATOM   11346 H HG13 . VAL A 1 42 ? 6.519   9.883   -7.166  1.00 1.00 ? 42  VAL A HG13 9  
ATOM   11347 H HG21 . VAL A 1 42 ? 6.716   9.917   -3.509  1.00 1.00 ? 42  VAL A HG21 9  
ATOM   11348 H HG22 . VAL A 1 42 ? 5.538   10.594  -4.633  1.00 1.00 ? 42  VAL A HG22 9  
ATOM   11349 H HG23 . VAL A 1 42 ? 7.262   10.753  -4.961  1.00 1.00 ? 42  VAL A HG23 9  
ATOM   11350 N N    . GLU A 1 43 ? 6.321   5.607   -5.254  1.00 1.00 ? 43  GLU A N    9  
ATOM   11351 C CA   . GLU A 1 43 ? 6.286   4.353   -5.994  1.00 1.00 ? 43  GLU A CA   9  
ATOM   11352 C C    . GLU A 1 43 ? 5.144   3.464   -5.507  1.00 1.00 ? 43  GLU A C    9  
ATOM   11353 O O    . GLU A 1 43 ? 4.384   2.916   -6.305  1.00 1.00 ? 43  GLU A O    9  
ATOM   11354 C CB   . GLU A 1 43 ? 7.610   3.613   -5.827  1.00 1.00 ? 43  GLU A CB   9  
ATOM   11355 C CG   . GLU A 1 43 ? 8.714   4.382   -6.550  1.00 1.00 ? 43  GLU A CG   9  
ATOM   11356 C CD   . GLU A 1 43 ? 10.060  3.707   -6.312  1.00 1.00 ? 43  GLU A CD   9  
ATOM   11357 O OE1  . GLU A 1 43 ? 10.086  2.711   -5.607  1.00 1.00 ? 43  GLU A OE1  9  
ATOM   11358 O OE2  . GLU A 1 43 ? 11.046  4.193   -6.841  1.00 1.00 ? 43  GLU A OE2  9  
ATOM   11359 H H    . GLU A 1 43 ? 7.031   5.760   -4.595  1.00 1.00 ? 43  GLU A H    9  
ATOM   11360 H HA   . GLU A 1 43 ? 6.138   4.568   -7.040  1.00 1.00 ? 43  GLU A HA   9  
ATOM   11361 H HB2  . GLU A 1 43 ? 7.849   3.538   -4.776  1.00 1.00 ? 43  GLU A HB2  9  
ATOM   11362 H HB3  . GLU A 1 43 ? 7.525   2.622   -6.248  1.00 1.00 ? 43  GLU A HB3  9  
ATOM   11363 H HG2  . GLU A 1 43 ? 8.503   4.399   -7.609  1.00 1.00 ? 43  GLU A HG2  9  
ATOM   11364 H HG3  . GLU A 1 43 ? 8.751   5.393   -6.175  1.00 1.00 ? 43  GLU A HG3  9  
ATOM   11365 N N    . ILE A 1 44 ? 5.039   3.313   -4.190  1.00 1.00 ? 44  ILE A N    9  
ATOM   11366 C CA   . ILE A 1 44 ? 4.000   2.468   -3.610  1.00 1.00 ? 44  ILE A CA   9  
ATOM   11367 C C    . ILE A 1 44 ? 2.605   3.006   -3.915  1.00 1.00 ? 44  ILE A C    9  
ATOM   11368 O O    . ILE A 1 44 ? 1.731   2.268   -4.364  1.00 1.00 ? 44  ILE A O    9  
ATOM   11369 C CB   . ILE A 1 44 ? 4.175   2.397   -2.090  1.00 1.00 ? 44  ILE A CB   9  
ATOM   11370 C CG1  . ILE A 1 44 ? 5.592   1.921   -1.754  1.00 1.00 ? 44  ILE A CG1  9  
ATOM   11371 C CG2  . ILE A 1 44 ? 3.154   1.429   -1.492  1.00 1.00 ? 44  ILE A CG2  9  
ATOM   11372 C CD1  . ILE A 1 44 ? 5.881   0.572   -2.426  1.00 1.00 ? 44  ILE A CD1  9  
ATOM   11373 H H    . ILE A 1 44 ? 5.676   3.767   -3.599  1.00 1.00 ? 44  ILE A H    9  
ATOM   11374 H HA   . ILE A 1 44 ? 4.089   1.469   -4.018  1.00 1.00 ? 44  ILE A HA   9  
ATOM   11375 H HB   . ILE A 1 44 ? 4.019   3.378   -1.667  1.00 1.00 ? 44  ILE A HB   9  
ATOM   11376 H HG12 . ILE A 1 44 ? 6.302   2.651   -2.107  1.00 1.00 ? 44  ILE A HG12 9  
ATOM   11377 H HG13 . ILE A 1 44 ? 5.691   1.814   -0.684  1.00 1.00 ? 44  ILE A HG13 9  
ATOM   11378 H HG21 . ILE A 1 44 ? 3.399   1.245   -0.457  1.00 1.00 ? 44  ILE A HG21 9  
ATOM   11379 H HG22 . ILE A 1 44 ? 3.180   0.500   -2.039  1.00 1.00 ? 44  ILE A HG22 9  
ATOM   11380 H HG23 . ILE A 1 44 ? 2.166   1.859   -1.559  1.00 1.00 ? 44  ILE A HG23 9  
ATOM   11381 H HD11 . ILE A 1 44 ? 4.990   -0.034  -2.453  1.00 1.00 ? 44  ILE A HD11 9  
ATOM   11382 H HD12 . ILE A 1 44 ? 6.645   0.049   -1.868  1.00 1.00 ? 44  ILE A HD12 9  
ATOM   11383 H HD13 . ILE A 1 44 ? 6.227   0.748   -3.433  1.00 1.00 ? 44  ILE A HD13 9  
ATOM   11384 N N    . VAL A 1 45 ? 2.401   4.292   -3.666  1.00 1.00 ? 45  VAL A N    9  
ATOM   11385 C CA   . VAL A 1 45 ? 1.100   4.902   -3.905  1.00 1.00 ? 45  VAL A CA   9  
ATOM   11386 C C    . VAL A 1 45 ? 0.709   4.784   -5.375  1.00 1.00 ? 45  VAL A C    9  
ATOM   11387 O O    . VAL A 1 45 ? -0.429  4.449   -5.700  1.00 1.00 ? 45  VAL A O    9  
ATOM   11388 C CB   . VAL A 1 45 ? 1.144   6.381   -3.510  1.00 1.00 ? 45  VAL A CB   9  
ATOM   11389 C CG1  . VAL A 1 45 ? 1.996   7.162   -4.515  1.00 1.00 ? 45  VAL A CG1  9  
ATOM   11390 C CG2  . VAL A 1 45 ? -0.274  6.946   -3.503  1.00 1.00 ? 45  VAL A CG2  9  
ATOM   11391 H H    . VAL A 1 45 ? 3.131   4.835   -3.301  1.00 1.00 ? 45  VAL A H    9  
ATOM   11392 H HA   . VAL A 1 45 ? 0.359   4.402   -3.300  1.00 1.00 ? 45  VAL A HA   9  
ATOM   11393 H HB   . VAL A 1 45 ? 1.573   6.477   -2.522  1.00 1.00 ? 45  VAL A HB   9  
ATOM   11394 H HG11 . VAL A 1 45 ? 2.898   6.614   -4.710  1.00 1.00 ? 45  VAL A HG11 9  
ATOM   11395 H HG12 . VAL A 1 45 ? 2.244   8.129   -4.105  1.00 1.00 ? 45  VAL A HG12 9  
ATOM   11396 H HG13 . VAL A 1 45 ? 1.446   7.291   -5.441  1.00 1.00 ? 45  VAL A HG13 9  
ATOM   11397 H HG21 . VAL A 1 45 ? -0.244  7.990   -3.227  1.00 1.00 ? 45  VAL A HG21 9  
ATOM   11398 H HG22 . VAL A 1 45 ? -0.876  6.402   -2.788  1.00 1.00 ? 45  VAL A HG22 9  
ATOM   11399 H HG23 . VAL A 1 45 ? -0.702  6.844   -4.487  1.00 1.00 ? 45  VAL A HG23 9  
ATOM   11400 N N    . MET A 1 46 ? 1.658   5.075   -6.255  1.00 1.00 ? 46  MET A N    9  
ATOM   11401 C CA   . MET A 1 46 ? 1.398   5.018   -7.683  1.00 1.00 ? 46  MET A CA   9  
ATOM   11402 C C    . MET A 1 46 ? 1.039   3.597   -8.106  1.00 1.00 ? 46  MET A C    9  
ATOM   11403 O O    . MET A 1 46 ? 0.151   3.394   -8.933  1.00 1.00 ? 46  MET A O    9  
ATOM   11404 C CB   . MET A 1 46 ? 2.629   5.495   -8.454  1.00 1.00 ? 46  MET A CB   9  
ATOM   11405 C CG   . MET A 1 46 ? 2.260   5.712   -9.915  1.00 1.00 ? 46  MET A CG   9  
ATOM   11406 S SD   . MET A 1 46 ? 1.219   7.191   -10.063 1.00 1.00 ? 46  MET A SD   9  
ATOM   11407 C CE   . MET A 1 46 ? -0.303  6.372   -10.611 1.00 1.00 ? 46  MET A CE   9  
ATOM   11408 H H    . MET A 1 46 ? 2.545   5.346   -5.937  1.00 1.00 ? 46  MET A H    9  
ATOM   11409 H HA   . MET A 1 46 ? 0.571   5.671   -7.914  1.00 1.00 ? 46  MET A HA   9  
ATOM   11410 H HB2  . MET A 1 46 ? 2.983   6.423   -8.034  1.00 1.00 ? 46  MET A HB2  9  
ATOM   11411 H HB3  . MET A 1 46 ? 3.406   4.748   -8.390  1.00 1.00 ? 46  MET A HB3  9  
ATOM   11412 H HG2  . MET A 1 46 ? 3.161   5.853   -10.488 1.00 1.00 ? 46  MET A HG2  9  
ATOM   11413 H HG3  . MET A 1 46 ? 1.730   4.850   -10.281 1.00 1.00 ? 46  MET A HG3  9  
ATOM   11414 H HE1  . MET A 1 46 ? -1.127  7.071   -10.553 1.00 1.00 ? 46  MET A HE1  9  
ATOM   11415 H HE2  . MET A 1 46 ? -0.509  5.527   -9.976  1.00 1.00 ? 46  MET A HE2  9  
ATOM   11416 H HE3  . MET A 1 46 ? -0.180  6.031   -11.630 1.00 1.00 ? 46  MET A HE3  9  
ATOM   11417 N N    . ASN A 1 47 ? 1.734   2.617   -7.536  1.00 1.00 ? 47  ASN A N    9  
ATOM   11418 C CA   . ASN A 1 47 ? 1.473   1.226   -7.870  1.00 1.00 ? 47  ASN A CA   9  
ATOM   11419 C C    . ASN A 1 47 ? 0.054   0.832   -7.466  1.00 1.00 ? 47  ASN A C    9  
ATOM   11420 O O    . ASN A 1 47 ? -0.663  0.188   -8.231  1.00 1.00 ? 47  ASN A O    9  
ATOM   11421 C CB   . ASN A 1 47 ? 2.494   0.336   -7.143  1.00 1.00 ? 47  ASN A CB   9  
ATOM   11422 C CG   . ASN A 1 47 ? 3.794   0.258   -7.934  1.00 1.00 ? 47  ASN A CG   9  
ATOM   11423 O OD1  . ASN A 1 47 ? 4.605   1.183   -7.897  1.00 1.00 ? 47  ASN A OD1  9  
ATOM   11424 N ND2  . ASN A 1 47 ? 4.043   -0.807  -8.644  1.00 1.00 ? 47  ASN A ND2  9  
A