data_2FYT
# 
_entry.id   2FYT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FYT         
RCSB  RCSB036473   
WWPDB D_1000036473 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FYT 
_pdbx_database_status.recvd_initial_deposition_date   2006-02-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Min, J.R.'                            1  
'Wu, H.'                               2  
'Zeng, H.'                             3  
'Loppnau, P.'                          4  
'Sundstrom, M.'                        5  
'Arrowsmith, C.H.'                     6  
'Edwards, A.M.'                        7  
'Bochkarev, A.'                        8  
'Plotnikov, A.N.'                      9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     
;The Crystal Structure of Human HMT1 hnRNP 
methyltransferase-like 3 in complex with SAH.
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, H.'           1 
primary 'Min, J.R.'        2 
primary 'Zeng, H.'         3 
primary 'Loppnau, P.'      4 
primary 'Sundstrom, M.'    5 
primary 'Arrowsmith, C.H.' 6 
primary 'Edwards, A.M.'    7 
primary 'Bochkarev, A.'    8 
primary 'Plotnikov, A.N.'  9 
# 
_cell.entry_id           2FYT 
_cell.length_a           107.486 
_cell.length_b           107.486 
_cell.length_c           68.420 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2FYT 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein arginine N-methyltransferase 3' 38281.914 1   2.1.1.- ? ? ? 
2 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE                384.411   1   ?       ? ? ? 
3 water       nat water                                    18.015    228 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  ASP n 
1 21  LEU n 
1 22  GLN n 
1 23  GLU n 
1 24  ASP n 
1 25  GLU n 
1 26  ASP n 
1 27  GLY n 
1 28  VAL n 
1 29  TYR n 
1 30  PHE n 
1 31  SER n 
1 32  SER n 
1 33  TYR n 
1 34  GLY n 
1 35  HIS n 
1 36  TYR n 
1 37  GLY n 
1 38  ILE n 
1 39  HIS n 
1 40  GLU n 
1 41  GLU n 
1 42  MET n 
1 43  LEU n 
1 44  LYS n 
1 45  ASP n 
1 46  LYS n 
1 47  ILE n 
1 48  ARG n 
1 49  THR n 
1 50  GLU n 
1 51  SER n 
1 52  TYR n 
1 53  ARG n 
1 54  ASP n 
1 55  PHE n 
1 56  ILE n 
1 57  TYR n 
1 58  GLN n 
1 59  ASN n 
1 60  PRO n 
1 61  HIS n 
1 62  ILE n 
1 63  PHE n 
1 64  LYS n 
1 65  ASP n 
1 66  LYS n 
1 67  VAL n 
1 68  VAL n 
1 69  LEU n 
1 70  ASP n 
1 71  VAL n 
1 72  GLY n 
1 73  CYS n 
1 74  GLY n 
1 75  THR n 
1 76  GLY n 
1 77  ILE n 
1 78  LEU n 
1 79  SER n 
1 80  MET n 
1 81  PHE n 
1 82  ALA n 
1 83  ALA n 
1 84  LYS n 
1 85  ALA n 
1 86  GLY n 
1 87  ALA n 
1 88  LYS n 
1 89  LYS n 
1 90  VAL n 
1 91  LEU n 
1 92  GLY n 
1 93  VAL n 
1 94  ASP n 
1 95  GLN n 
1 96  SER n 
1 97  GLU n 
1 98  ILE n 
1 99  LEU n 
1 100 TYR n 
1 101 GLN n 
1 102 ALA n 
1 103 MET n 
1 104 ASP n 
1 105 ILE n 
1 106 ILE n 
1 107 ARG n 
1 108 LEU n 
1 109 ASN n 
1 110 LYS n 
1 111 LEU n 
1 112 GLU n 
1 113 ASP n 
1 114 THR n 
1 115 ILE n 
1 116 THR n 
1 117 LEU n 
1 118 ILE n 
1 119 LYS n 
1 120 GLY n 
1 121 LYS n 
1 122 ILE n 
1 123 GLU n 
1 124 GLU n 
1 125 VAL n 
1 126 HIS n 
1 127 LEU n 
1 128 PRO n 
1 129 VAL n 
1 130 GLU n 
1 131 LYS n 
1 132 VAL n 
1 133 ASP n 
1 134 VAL n 
1 135 ILE n 
1 136 ILE n 
1 137 SER n 
1 138 GLU n 
1 139 TRP n 
1 140 MET n 
1 141 GLY n 
1 142 TYR n 
1 143 PHE n 
1 144 LEU n 
1 145 LEU n 
1 146 PHE n 
1 147 GLU n 
1 148 SER n 
1 149 MET n 
1 150 LEU n 
1 151 ASP n 
1 152 SER n 
1 153 VAL n 
1 154 LEU n 
1 155 TYR n 
1 156 ALA n 
1 157 LYS n 
1 158 ASN n 
1 159 LYS n 
1 160 TYR n 
1 161 LEU n 
1 162 ALA n 
1 163 LYS n 
1 164 GLY n 
1 165 GLY n 
1 166 SER n 
1 167 VAL n 
1 168 TYR n 
1 169 PRO n 
1 170 ASP n 
1 171 ILE n 
1 172 CYS n 
1 173 THR n 
1 174 ILE n 
1 175 SER n 
1 176 LEU n 
1 177 VAL n 
1 178 ALA n 
1 179 VAL n 
1 180 SER n 
1 181 ASP n 
1 182 VAL n 
1 183 ASN n 
1 184 LYS n 
1 185 HIS n 
1 186 ALA n 
1 187 ASP n 
1 188 ARG n 
1 189 ILE n 
1 190 ALA n 
1 191 PHE n 
1 192 TRP n 
1 193 ASP n 
1 194 ASP n 
1 195 VAL n 
1 196 TYR n 
1 197 GLY n 
1 198 PHE n 
1 199 LYS n 
1 200 MET n 
1 201 SER n 
1 202 CYS n 
1 203 MET n 
1 204 LYS n 
1 205 LYS n 
1 206 ALA n 
1 207 VAL n 
1 208 ILE n 
1 209 PRO n 
1 210 GLU n 
1 211 ALA n 
1 212 VAL n 
1 213 VAL n 
1 214 GLU n 
1 215 VAL n 
1 216 LEU n 
1 217 ASP n 
1 218 PRO n 
1 219 LYS n 
1 220 THR n 
1 221 LEU n 
1 222 ILE n 
1 223 SER n 
1 224 GLU n 
1 225 PRO n 
1 226 CYS n 
1 227 GLY n 
1 228 ILE n 
1 229 LYS n 
1 230 HIS n 
1 231 ILE n 
1 232 ASP n 
1 233 CYS n 
1 234 HIS n 
1 235 THR n 
1 236 THR n 
1 237 SER n 
1 238 ILE n 
1 239 SER n 
1 240 ASP n 
1 241 LEU n 
1 242 GLU n 
1 243 PHE n 
1 244 SER n 
1 245 SER n 
1 246 ASP n 
1 247 PHE n 
1 248 THR n 
1 249 LEU n 
1 250 LYS n 
1 251 ILE n 
1 252 THR n 
1 253 ARG n 
1 254 THR n 
1 255 SER n 
1 256 MET n 
1 257 CYS n 
1 258 THR n 
1 259 ALA n 
1 260 ILE n 
1 261 ALA n 
1 262 GLY n 
1 263 TYR n 
1 264 PHE n 
1 265 ASP n 
1 266 ILE n 
1 267 TYR n 
1 268 PHE n 
1 269 GLU n 
1 270 LYS n 
1 271 ASN n 
1 272 CYS n 
1 273 HIS n 
1 274 ASN n 
1 275 ARG n 
1 276 VAL n 
1 277 VAL n 
1 278 PHE n 
1 279 SER n 
1 280 THR n 
1 281 GLY n 
1 282 PRO n 
1 283 GLN n 
1 284 SER n 
1 285 THR n 
1 286 LYS n 
1 287 THR n 
1 288 HIS n 
1 289 TRP n 
1 290 LYS n 
1 291 GLN n 
1 292 THR n 
1 293 VAL n 
1 294 PHE n 
1 295 LEU n 
1 296 LEU n 
1 297 GLU n 
1 298 LYS n 
1 299 PRO n 
1 300 PHE n 
1 301 SER n 
1 302 VAL n 
1 303 LYS n 
1 304 ALA n 
1 305 GLY n 
1 306 GLU n 
1 307 ALA n 
1 308 LEU n 
1 309 LYS n 
1 310 GLY n 
1 311 LYS n 
1 312 VAL n 
1 313 THR n 
1 314 VAL n 
1 315 HIS n 
1 316 LYS n 
1 317 ASN n 
1 318 LYS n 
1 319 LYS n 
1 320 ASP n 
1 321 PRO n 
1 322 ARG n 
1 323 SER n 
1 324 LEU n 
1 325 THR n 
1 326 VAL n 
1 327 THR n 
1 328 LEU n 
1 329 THR n 
1 330 LEU n 
1 331 ASN n 
1 332 ASN n 
1 333 SER n 
1 334 THR n 
1 335 GLN n 
1 336 THR n 
1 337 TYR n 
1 338 GLY n 
1 339 LEU n 
1 340 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'HRMT1L3, PRMT3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ANM3_HUMAN 
_struct_ref.pdbx_db_accession          O60678 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           211 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2FYT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 340 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O60678 
_struct_ref_seq.db_align_beg                  211 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  531 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       228 
_struct_ref_seq.pdbx_auth_seq_align_end       548 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2FYT MET A 1  ? UNP O60678 ? ? 'CLONING ARTIFACT' 209 1  
1 2FYT GLY A 2  ? UNP O60678 ? ? 'CLONING ARTIFACT' 210 2  
1 2FYT SER A 3  ? UNP O60678 ? ? 'CLONING ARTIFACT' 211 3  
1 2FYT SER A 4  ? UNP O60678 ? ? 'CLONING ARTIFACT' 212 4  
1 2FYT HIS A 5  ? UNP O60678 ? ? 'EXPRESSION TAG'   213 5  
1 2FYT HIS A 6  ? UNP O60678 ? ? 'EXPRESSION TAG'   214 6  
1 2FYT HIS A 7  ? UNP O60678 ? ? 'EXPRESSION TAG'   215 7  
1 2FYT HIS A 8  ? UNP O60678 ? ? 'EXPRESSION TAG'   216 8  
1 2FYT HIS A 9  ? UNP O60678 ? ? 'EXPRESSION TAG'   217 9  
1 2FYT HIS A 10 ? UNP O60678 ? ? 'EXPRESSION TAG'   218 10 
1 2FYT SER A 11 ? UNP O60678 ? ? 'CLONING ARTIFACT' 219 11 
1 2FYT SER A 12 ? UNP O60678 ? ? 'CLONING ARTIFACT' 220 12 
1 2FYT GLY A 13 ? UNP O60678 ? ? 'CLONING ARTIFACT' 221 13 
1 2FYT LEU A 14 ? UNP O60678 ? ? 'CLONING ARTIFACT' 222 14 
1 2FYT VAL A 15 ? UNP O60678 ? ? 'CLONING ARTIFACT' 223 15 
1 2FYT PRO A 16 ? UNP O60678 ? ? 'CLONING ARTIFACT' 224 16 
1 2FYT ARG A 17 ? UNP O60678 ? ? 'CLONING ARTIFACT' 225 17 
1 2FYT GLY A 18 ? UNP O60678 ? ? 'CLONING ARTIFACT' 226 18 
1 2FYT SER A 19 ? UNP O60678 ? ? 'CLONING ARTIFACT' 227 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2FYT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.58 
_exptl_crystal.density_percent_sol   52.33 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_details    
'20% PEG3350, 0.2 M sodium dihydrogen phosphate, pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   2006-02-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    verimax 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     2FYT 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             76 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   31961 
_reflns.number_all                   31961 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2FYT 
_refine.ls_number_reflns_obs                     26214 
_refine.ls_number_reflns_all                     26214 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             76.03 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.87 
_refine.ls_R_factor_obs                          0.19756 
_refine.ls_R_factor_all                          0.19756 
_refine.ls_R_factor_R_work                       0.19509 
_refine.ls_R_factor_R_free                       0.24556 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1389 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.934 
_refine.B_iso_mean                               39.737 
_refine.aniso_B[1][1]                            1.34 
_refine.aniso_B[2][2]                            1.34 
_refine.aniso_B[3][3]                            -2.68 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.168 
_refine.pdbx_overall_ESU_R_Free                  0.162 
_refine.overall_SU_ML                            0.112 
_refine.overall_SU_B                             7.559 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2455 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         26 
_refine_hist.number_atoms_solvent             228 
_refine_hist.number_atoms_total               2709 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        76.03 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015  0.022  ? 2567 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.582  1.972  ? 3477 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.552  5.000  ? 318  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   37.237 24.600 ? 100  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.662 15.000 ? 470  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   13.152 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.120  0.200  ? 402  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006  0.020  ? 1862 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.219  0.200  ? 1264 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.306  0.200  ? 1751 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.157  0.200  ? 217  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.210  0.200  ? 77   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.135  0.200  ? 12   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.892  1.500  ? 1618 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.375  2.000  ? 2565 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.303  3.000  ? 1087 'X-RAY DIFFRACTION' ? 
r_scangle_it             3.502  4.500  ? 912  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             1895 
_refine_ls_shell.R_factor_R_work                  0.261 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.306 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             103 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2FYT 
_struct.title                     'Human HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae) protein' 
_struct.pdbx_descriptor           'Protein arginine N-methyltransferase 3 (E.C.2.1.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FYT 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'methyltransferase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 31  ? GLY A 34  ? SER A 239 GLY A 242 5 ? 4  
HELX_P HELX_P2  2  HIS A 35  ? LYS A 44  ? HIS A 243 LYS A 252 1 ? 10 
HELX_P HELX_P3  3  ASP A 45  ? ASN A 59  ? ASP A 253 ASN A 267 1 ? 15 
HELX_P HELX_P4  4  PRO A 60  ? PHE A 63  ? PRO A 268 PHE A 271 5 ? 4  
HELX_P HELX_P5  5  GLY A 76  ? ALA A 85  ? GLY A 284 ALA A 293 1 ? 10 
HELX_P HELX_P6  6  GLU A 97  ? ASN A 109 ? GLU A 305 ASN A 317 1 ? 13 
HELX_P HELX_P7  7  SER A 148 ? TYR A 160 ? SER A 356 TYR A 368 1 ? 13 
HELX_P HELX_P8  8  ASP A 181 ? ILE A 189 ? ASP A 389 ILE A 397 1 ? 9  
HELX_P HELX_P9  9  ALA A 190 ? ASP A 194 ? ALA A 398 ASP A 402 5 ? 5  
HELX_P HELX_P10 10 MET A 200 ? CYS A 202 ? MET A 408 CYS A 410 5 ? 3  
HELX_P HELX_P11 11 MET A 203 ? ILE A 208 ? MET A 411 ILE A 416 1 ? 6  
HELX_P HELX_P12 12 ASP A 217 ? LEU A 221 ? ASP A 425 LEU A 429 5 ? 5  
HELX_P HELX_P13 13 SER A 237 ? GLU A 242 ? SER A 445 GLU A 450 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           168 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            376 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    169 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     377 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -4.91 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 115 ? LYS A 119 ? ILE A 323 LYS A 327 
A 2 LYS A 89  ? ASP A 94  ? LYS A 297 ASP A 302 
A 3 VAL A 67  ? VAL A 71  ? VAL A 275 VAL A 279 
A 4 VAL A 132 ? SER A 137 ? VAL A 340 SER A 345 
A 5 LEU A 161 ? TYR A 168 ? LEU A 369 TYR A 376 
B 1 VAL A 212 ? GLU A 214 ? VAL A 420 GLU A 422 
B 2 GLN A 291 ? VAL A 302 ? GLN A 499 VAL A 510 
B 3 SER A 255 ? PHE A 268 ? SER A 463 PHE A 476 
B 4 ILE A 171 ? VAL A 179 ? ILE A 379 VAL A 387 
B 5 CYS A 226 ? ASP A 232 ? CYS A 434 ASP A 440 
C 1 VAL A 212 ? GLU A 214 ? VAL A 420 GLU A 422 
C 2 GLN A 291 ? VAL A 302 ? GLN A 499 VAL A 510 
C 3 SER A 255 ? PHE A 268 ? SER A 463 PHE A 476 
C 4 VAL A 276 ? SER A 279 ? VAL A 484 SER A 487 
D 1 PHE A 243 ? LYS A 250 ? PHE A 451 LYS A 458 
D 2 ALA A 307 ? LYS A 316 ? ALA A 515 LYS A 524 
D 3 LEU A 324 ? LEU A 330 ? LEU A 532 LEU A 538 
D 4 SER A 333 ? LEU A 339 ? SER A 541 LEU A 547 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 116 ? O THR A 324 N VAL A 90  ? N VAL A 298 
A 2 3 O LEU A 91  ? O LEU A 299 N ASP A 70  ? N ASP A 278 
A 3 4 N LEU A 69  ? N LEU A 277 O VAL A 134 ? O VAL A 342 
A 4 5 N VAL A 132 ? N VAL A 340 O ALA A 162 ? O ALA A 370 
B 1 2 N VAL A 212 ? N VAL A 420 O VAL A 293 ? O VAL A 501 
B 2 3 O THR A 292 ? O THR A 500 N GLY A 262 ? N GLY A 470 
B 3 4 O ALA A 261 ? O ALA A 469 N VAL A 177 ? N VAL A 385 
B 4 5 N CYS A 172 ? N CYS A 380 O ILE A 231 ? O ILE A 439 
C 1 2 N VAL A 212 ? N VAL A 420 O VAL A 293 ? O VAL A 501 
C 2 3 O THR A 292 ? O THR A 500 N GLY A 262 ? N GLY A 470 
C 3 4 N PHE A 268 ? N PHE A 476 O VAL A 276 ? O VAL A 484 
D 1 2 N PHE A 243 ? N PHE A 451 O VAL A 314 ? O VAL A 522 
D 2 3 N LYS A 311 ? N LYS A 519 O THR A 329 ? O THR A 537 
D 3 4 N VAL A 326 ? N VAL A 534 O TYR A 337 ? O TYR A 545 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    22 
_struct_site.details              'BINDING SITE FOR RESIDUE SAH A 549' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 TYR A 33  ? TYR A 241 . ? 1_555 ? 
2  AC1 22 HIS A 39  ? HIS A 247 . ? 1_555 ? 
3  AC1 22 MET A 42  ? MET A 250 . ? 1_555 ? 
4  AC1 22 ARG A 48  ? ARG A 256 . ? 1_555 ? 
5  AC1 22 GLY A 72  ? GLY A 280 . ? 1_555 ? 
6  AC1 22 CYS A 73  ? CYS A 281 . ? 1_555 ? 
7  AC1 22 ILE A 77  ? ILE A 285 . ? 1_555 ? 
8  AC1 22 LEU A 78  ? LEU A 286 . ? 1_555 ? 
9  AC1 22 ASP A 94  ? ASP A 302 . ? 1_555 ? 
10 AC1 22 GLN A 95  ? GLN A 303 . ? 1_555 ? 
11 AC1 22 SER A 96  ? SER A 304 . ? 1_555 ? 
12 AC1 22 GLY A 120 ? GLY A 328 . ? 1_555 ? 
13 AC1 22 LYS A 121 ? LYS A 329 . ? 1_555 ? 
14 AC1 22 ILE A 122 ? ILE A 330 . ? 1_555 ? 
15 AC1 22 GLU A 123 ? GLU A 331 . ? 1_555 ? 
16 AC1 22 GLU A 138 ? GLU A 346 . ? 1_555 ? 
17 AC1 22 MET A 149 ? MET A 357 . ? 1_555 ? 
18 AC1 22 SER A 152 ? SER A 360 . ? 1_555 ? 
19 AC1 22 HOH C .   ? HOH A 550 . ? 1_555 ? 
20 AC1 22 HOH C .   ? HOH A 552 . ? 1_555 ? 
21 AC1 22 HOH C .   ? HOH A 562 . ? 1_555 ? 
22 AC1 22 HOH C .   ? HOH A 582 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FYT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FYT 
_atom_sites.fract_transf_matrix[1][1]   0.009304 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009304 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014616 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . PHE A 1 30  ? -13.813 -21.727 27.905 1.00 52.97 ? 238 PHE A N     1 
ATOM   2    C CA    . PHE A 1 30  ? -13.792 -23.208 27.864 1.00 52.75 ? 238 PHE A CA    1 
ATOM   3    C C     . PHE A 1 30  ? -12.971 -23.870 28.967 1.00 52.61 ? 238 PHE A C     1 
ATOM   4    O O     . PHE A 1 30  ? -12.305 -24.887 28.731 1.00 51.95 ? 238 PHE A O     1 
ATOM   5    N N     . SER A 1 31  ? -13.013 -23.283 30.168 1.00 52.22 ? 239 SER A N     1 
ATOM   6    C CA    . SER A 1 31  ? -12.779 -24.040 31.404 1.00 51.87 ? 239 SER A CA    1 
ATOM   7    C C     . SER A 1 31  ? -13.831 -25.146 31.483 1.00 51.40 ? 239 SER A C     1 
ATOM   8    O O     . SER A 1 31  ? -13.554 -26.245 31.954 1.00 51.22 ? 239 SER A O     1 
ATOM   9    C CB    . SER A 1 31  ? -12.903 -23.141 32.645 1.00 51.73 ? 239 SER A CB    1 
ATOM   10   O OG    . SER A 1 31  ? -11.655 -22.585 33.022 1.00 53.15 ? 239 SER A OG    1 
ATOM   11   N N     . SER A 1 32  ? -15.048 -24.836 31.029 1.00 51.17 ? 240 SER A N     1 
ATOM   12   C CA    . SER A 1 32  ? -16.154 -25.804 31.052 1.00 51.42 ? 240 SER A CA    1 
ATOM   13   C C     . SER A 1 32  ? -15.772 -27.087 30.306 1.00 50.77 ? 240 SER A C     1 
ATOM   14   O O     . SER A 1 32  ? -16.084 -28.196 30.754 1.00 50.63 ? 240 SER A O     1 
ATOM   15   C CB    . SER A 1 32  ? -17.445 -25.188 30.480 1.00 51.46 ? 240 SER A CB    1 
ATOM   16   O OG    . SER A 1 32  ? -17.318 -24.911 29.095 1.00 52.61 ? 240 SER A OG    1 
ATOM   17   N N     . TYR A 1 33  ? -15.047 -26.920 29.196 1.00 50.32 ? 241 TYR A N     1 
ATOM   18   C CA    . TYR A 1 33  ? -14.611 -28.045 28.359 1.00 49.56 ? 241 TYR A CA    1 
ATOM   19   C C     . TYR A 1 33  ? -13.428 -28.817 28.950 1.00 49.26 ? 241 TYR A C     1 
ATOM   20   O O     . TYR A 1 33  ? -12.983 -29.799 28.367 1.00 49.42 ? 241 TYR A O     1 
ATOM   21   C CB    . TYR A 1 33  ? -14.330 -27.581 26.919 1.00 49.50 ? 241 TYR A CB    1 
ATOM   22   C CG    . TYR A 1 33  ? -15.606 -27.345 26.146 1.00 48.72 ? 241 TYR A CG    1 
ATOM   23   C CD1   . TYR A 1 33  ? -16.067 -26.055 25.911 1.00 49.46 ? 241 TYR A CD1   1 
ATOM   24   C CD2   . TYR A 1 33  ? -16.377 -28.414 25.694 1.00 47.48 ? 241 TYR A CD2   1 
ATOM   25   C CE1   . TYR A 1 33  ? -17.260 -25.824 25.230 1.00 48.96 ? 241 TYR A CE1   1 
ATOM   26   C CE2   . TYR A 1 33  ? -17.573 -28.198 24.991 1.00 47.87 ? 241 TYR A CE2   1 
ATOM   27   C CZ    . TYR A 1 33  ? -18.013 -26.899 24.775 1.00 48.93 ? 241 TYR A CZ    1 
ATOM   28   O OH    . TYR A 1 33  ? -19.190 -26.663 24.088 1.00 49.29 ? 241 TYR A OH    1 
ATOM   29   N N     . GLY A 1 34  ? -12.939 -28.365 30.108 1.00 48.41 ? 242 GLY A N     1 
ATOM   30   C CA    . GLY A 1 34  ? -11.938 -29.084 30.868 1.00 47.78 ? 242 GLY A CA    1 
ATOM   31   C C     . GLY A 1 34  ? -12.528 -30.209 31.704 1.00 47.71 ? 242 GLY A C     1 
ATOM   32   O O     . GLY A 1 34  ? -11.793 -31.081 32.178 1.00 48.68 ? 242 GLY A O     1 
ATOM   33   N N     . HIS A 1 35  ? -13.849 -30.203 31.879 1.00 45.94 ? 243 HIS A N     1 
ATOM   34   C CA    . HIS A 1 35  ? -14.519 -31.120 32.786 1.00 44.97 ? 243 HIS A CA    1 
ATOM   35   C C     . HIS A 1 35  ? -15.055 -32.343 32.043 1.00 43.35 ? 243 HIS A C     1 
ATOM   36   O O     . HIS A 1 35  ? -15.517 -32.241 30.900 1.00 42.33 ? 243 HIS A O     1 
ATOM   37   C CB    . HIS A 1 35  ? -15.676 -30.394 33.485 1.00 46.29 ? 243 HIS A CB    1 
ATOM   38   C CG    . HIS A 1 35  ? -15.245 -29.477 34.594 1.00 49.43 ? 243 HIS A CG    1 
ATOM   39   N ND1   . HIS A 1 35  ? -14.491 -28.342 34.378 1.00 52.61 ? 243 HIS A ND1   1 
ATOM   40   C CD2   . HIS A 1 35  ? -15.478 -29.522 35.930 1.00 52.22 ? 243 HIS A CD2   1 
ATOM   41   C CE1   . HIS A 1 35  ? -14.275 -27.730 35.529 1.00 54.32 ? 243 HIS A CE1   1 
ATOM   42   N NE2   . HIS A 1 35  ? -14.863 -28.425 36.487 1.00 55.28 ? 243 HIS A NE2   1 
ATOM   43   N N     . TYR A 1 36  ? -15.024 -33.493 32.699 1.00 41.72 ? 244 TYR A N     1 
ATOM   44   C CA    . TYR A 1 36  ? -15.474 -34.722 32.067 1.00 40.81 ? 244 TYR A CA    1 
ATOM   45   C C     . TYR A 1 36  ? -16.931 -34.680 31.646 1.00 40.65 ? 244 TYR A C     1 
ATOM   46   O O     . TYR A 1 36  ? -17.302 -35.354 30.681 1.00 41.35 ? 244 TYR A O     1 
ATOM   47   C CB    . TYR A 1 36  ? -15.230 -35.941 32.963 1.00 40.19 ? 244 TYR A CB    1 
ATOM   48   C CG    . TYR A 1 36  ? -16.277 -36.160 34.040 1.00 39.53 ? 244 TYR A CG    1 
ATOM   49   C CD1   . TYR A 1 36  ? -17.456 -36.873 33.770 1.00 39.93 ? 244 TYR A CD1   1 
ATOM   50   C CD2   . TYR A 1 36  ? -16.095 -35.656 35.330 1.00 40.02 ? 244 TYR A CD2   1 
ATOM   51   C CE1   . TYR A 1 36  ? -18.427 -37.074 34.767 1.00 39.53 ? 244 TYR A CE1   1 
ATOM   52   C CE2   . TYR A 1 36  ? -17.047 -35.855 36.321 1.00 38.50 ? 244 TYR A CE2   1 
ATOM   53   C CZ    . TYR A 1 36  ? -18.208 -36.574 36.039 1.00 38.82 ? 244 TYR A CZ    1 
ATOM   54   O OH    . TYR A 1 36  ? -19.162 -36.782 37.029 1.00 37.81 ? 244 TYR A OH    1 
ATOM   55   N N     . GLY A 1 37  ? -17.750 -33.911 32.377 1.00 39.60 ? 245 GLY A N     1 
ATOM   56   C CA    . GLY A 1 37  ? -19.201 -33.951 32.217 1.00 38.09 ? 245 GLY A CA    1 
ATOM   57   C C     . GLY A 1 37  ? -19.694 -33.603 30.822 1.00 37.31 ? 245 GLY A C     1 
ATOM   58   O O     . GLY A 1 37  ? -20.493 -34.332 30.256 1.00 36.75 ? 245 GLY A O     1 
ATOM   59   N N     . ILE A 1 38  ? -19.231 -32.470 30.297 1.00 36.52 ? 246 ILE A N     1 
ATOM   60   C CA    . ILE A 1 38  ? -19.529 -32.015 28.945 1.00 36.58 ? 246 ILE A CA    1 
ATOM   61   C C     . ILE A 1 38  ? -19.151 -33.050 27.861 1.00 35.23 ? 246 ILE A C     1 
ATOM   62   O O     . ILE A 1 38  ? -19.909 -33.267 26.911 1.00 35.21 ? 246 ILE A O     1 
ATOM   63   C CB    . ILE A 1 38  ? -18.846 -30.629 28.653 1.00 36.99 ? 246 ILE A CB    1 
ATOM   64   C CG1   . ILE A 1 38  ? -19.192 -30.117 27.264 1.00 39.74 ? 246 ILE A CG1   1 
ATOM   65   C CG2   . ILE A 1 38  ? -17.334 -30.708 28.745 1.00 38.99 ? 246 ILE A CG2   1 
ATOM   66   C CD1   . ILE A 1 38  ? -20.291 -29.078 27.275 1.00 44.25 ? 246 ILE A CD1   1 
ATOM   67   N N     . HIS A 1 39  ? -17.972 -33.650 28.004 1.00 33.53 ? 247 HIS A N     1 
ATOM   68   C CA    . HIS A 1 39  ? -17.503 -34.698 27.102 1.00 31.79 ? 247 HIS A CA    1 
ATOM   69   C C     . HIS A 1 39  ? -18.292 -35.971 27.279 1.00 31.93 ? 247 HIS A C     1 
ATOM   70   O O     . HIS A 1 39  ? -18.689 -36.605 26.288 1.00 30.16 ? 247 HIS A O     1 
ATOM   71   C CB    . HIS A 1 39  ? -16.001 -34.886 27.292 1.00 30.72 ? 247 HIS A CB    1 
ATOM   72   C CG    . HIS A 1 39  ? -15.220 -33.689 26.822 1.00 31.24 ? 247 HIS A CG    1 
ATOM   73   N ND1   . HIS A 1 39  ? -14.747 -32.718 27.681 1.00 34.23 ? 247 HIS A ND1   1 
ATOM   74   C CD2   . HIS A 1 39  ? -14.911 -33.268 25.575 1.00 28.63 ? 247 HIS A CD2   1 
ATOM   75   C CE1   . HIS A 1 39  ? -14.156 -31.760 26.983 1.00 29.83 ? 247 HIS A CE1   1 
ATOM   76   N NE2   . HIS A 1 39  ? -14.244 -32.071 25.703 1.00 34.87 ? 247 HIS A NE2   1 
ATOM   77   N N     . GLU A 1 40  ? -18.566 -36.325 28.535 1.00 31.48 ? 248 GLU A N     1 
ATOM   78   C CA    . GLU A 1 40  ? -19.411 -37.480 28.783 1.00 32.88 ? 248 GLU A CA    1 
ATOM   79   C C     . GLU A 1 40  ? -20.763 -37.282 28.067 1.00 33.29 ? 248 GLU A C     1 
ATOM   80   O O     . GLU A 1 40  ? -21.243 -38.190 27.398 1.00 32.43 ? 248 GLU A O     1 
ATOM   81   C CB    . GLU A 1 40  ? -19.590 -37.741 30.293 1.00 32.49 ? 248 GLU A CB    1 
ATOM   82   C CG    . GLU A 1 40  ? -20.187 -39.153 30.596 1.00 37.54 ? 248 GLU A CG    1 
ATOM   83   C CD    . GLU A 1 40  ? -19.562 -39.904 31.821 1.00 40.86 ? 248 GLU A CD    1 
ATOM   84   O OE1   . GLU A 1 40  ? -19.961 -41.067 32.055 1.00 42.05 ? 248 GLU A OE1   1 
ATOM   85   O OE2   . GLU A 1 40  ? -18.675 -39.378 32.524 1.00 39.96 ? 248 GLU A OE2   1 
ATOM   86   N N     . GLU A 1 41  ? -21.368 -36.100 28.213 1.00 33.28 ? 249 GLU A N     1 
ATOM   87   C CA    . GLU A 1 41  ? -22.666 -35.824 27.570 1.00 34.59 ? 249 GLU A CA    1 
ATOM   88   C C     . GLU A 1 41  ? -22.568 -35.887 26.041 1.00 33.62 ? 249 GLU A C     1 
ATOM   89   O O     . GLU A 1 41  ? -23.466 -36.407 25.398 1.00 33.13 ? 249 GLU A O     1 
ATOM   90   C CB    . GLU A 1 41  ? -23.301 -34.471 28.014 1.00 34.25 ? 249 GLU A CB    1 
ATOM   91   C CG    . GLU A 1 41  ? -24.692 -34.155 27.299 1.00 35.32 ? 249 GLU A CG    1 
ATOM   92   C CD    . GLU A 1 41  ? -25.205 -32.669 27.376 1.00 38.89 ? 249 GLU A CD    1 
ATOM   93   O OE1   . GLU A 1 41  ? -24.396 -31.703 27.352 1.00 40.08 ? 249 GLU A OE1   1 
ATOM   94   O OE2   . GLU A 1 41  ? -26.461 -32.478 27.433 1.00 42.13 ? 249 GLU A OE2   1 
ATOM   95   N N     . MET A 1 42  ? -21.505 -35.343 25.448 1.00 33.75 ? 250 MET A N     1 
ATOM   96   C CA    . MET A 1 42  ? -21.374 -35.432 23.981 1.00 36.08 ? 250 MET A CA    1 
ATOM   97   C C     . MET A 1 42  ? -21.176 -36.885 23.515 1.00 33.83 ? 250 MET A C     1 
ATOM   98   O O     . MET A 1 42  ? -21.753 -37.314 22.514 1.00 33.24 ? 250 MET A O     1 
ATOM   99   C CB    . MET A 1 42  ? -20.217 -34.578 23.492 1.00 34.77 ? 250 MET A CB    1 
ATOM   100  C CG    . MET A 1 42  ? -20.625 -33.133 23.448 1.00 41.10 ? 250 MET A CG    1 
ATOM   101  S SD    . MET A 1 42  ? -19.216 -32.171 22.972 1.00 45.16 ? 250 MET A SD    1 
ATOM   102  C CE    . MET A 1 42  ? -17.857 -33.008 23.788 1.00 46.33 ? 250 MET A CE    1 
ATOM   103  N N     . LEU A 1 43  ? -20.365 -37.632 24.252 1.00 32.83 ? 251 LEU A N     1 
ATOM   104  C CA    . LEU A 1 43  ? -20.077 -39.021 23.862 1.00 32.67 ? 251 LEU A CA    1 
ATOM   105  C C     . LEU A 1 43  ? -21.297 -39.879 24.092 1.00 33.54 ? 251 LEU A C     1 
ATOM   106  O O     . LEU A 1 43  ? -21.527 -40.812 23.349 1.00 35.12 ? 251 LEU A O     1 
ATOM   107  C CB    . LEU A 1 43  ? -18.860 -39.553 24.618 1.00 32.08 ? 251 LEU A CB    1 
ATOM   108  C CG    . LEU A 1 43  ? -17.559 -38.876 24.166 1.00 31.85 ? 251 LEU A CG    1 
ATOM   109  C CD1   . LEU A 1 43  ? -16.471 -39.110 25.150 1.00 31.37 ? 251 LEU A CD1   1 
ATOM   110  C CD2   . LEU A 1 43  ? -17.137 -39.383 22.739 1.00 30.78 ? 251 LEU A CD2   1 
ATOM   111  N N     . LYS A 1 44  ? -22.091 -39.562 25.121 1.00 34.22 ? 252 LYS A N     1 
ATOM   112  C CA    . LYS A 1 44  ? -23.390 -40.242 25.305 1.00 34.50 ? 252 LYS A CA    1 
ATOM   113  C C     . LYS A 1 44  ? -24.471 -39.816 24.296 1.00 34.91 ? 252 LYS A C     1 
ATOM   114  O O     . LYS A 1 44  ? -25.544 -40.416 24.251 1.00 36.29 ? 252 LYS A O     1 
ATOM   115  C CB    . LYS A 1 44  ? -23.870 -40.086 26.745 1.00 33.81 ? 252 LYS A CB    1 
ATOM   116  C CG    . LYS A 1 44  ? -23.382 -41.201 27.636 1.00 35.53 ? 252 LYS A CG    1 
ATOM   117  C CD    . LYS A 1 44  ? -23.456 -40.874 29.117 1.00 33.46 ? 252 LYS A CD    1 
ATOM   118  C CE    . LYS A 1 44  ? -23.030 -42.133 29.897 1.00 34.80 ? 252 LYS A CE    1 
ATOM   119  N NZ    . LYS A 1 44  ? -22.982 -42.025 31.412 1.00 35.83 ? 252 LYS A NZ    1 
ATOM   120  N N     . ASP A 1 45  ? -24.203 -38.758 23.518 1.00 34.82 ? 253 ASP A N     1 
ATOM   121  C CA    . ASP A 1 45  ? -25.066 -38.344 22.404 1.00 33.93 ? 253 ASP A CA    1 
ATOM   122  C C     . ASP A 1 45  ? -24.764 -39.269 21.225 1.00 33.93 ? 253 ASP A C     1 
ATOM   123  O O     . ASP A 1 45  ? -23.865 -39.021 20.419 1.00 31.90 ? 253 ASP A O     1 
ATOM   124  C CB    . ASP A 1 45  ? -24.834 -36.870 22.023 1.00 33.91 ? 253 ASP A CB    1 
ATOM   125  C CG    . ASP A 1 45  ? -25.885 -36.326 21.035 1.00 34.67 ? 253 ASP A CG    1 
ATOM   126  O OD1   . ASP A 1 45  ? -26.056 -35.080 20.941 1.00 34.64 ? 253 ASP A OD1   1 
ATOM   127  O OD2   . ASP A 1 45  ? -26.538 -37.126 20.342 1.00 33.52 ? 253 ASP A OD2   1 
ATOM   128  N N     . LYS A 1 46  ? -25.528 -40.352 21.152 1.00 33.38 ? 254 LYS A N     1 
ATOM   129  C CA    . LYS A 1 46  ? -25.283 -41.420 20.199 1.00 34.68 ? 254 LYS A CA    1 
ATOM   130  C C     . LYS A 1 46  ? -25.603 -41.002 18.775 1.00 34.52 ? 254 LYS A C     1 
ATOM   131  O O     . LYS A 1 46  ? -24.893 -41.369 17.857 1.00 34.33 ? 254 LYS A O     1 
ATOM   132  C CB    . LYS A 1 46  ? -26.096 -42.639 20.580 1.00 34.51 ? 254 LYS A CB    1 
ATOM   133  C CG    . LYS A 1 46  ? -25.550 -43.313 21.825 1.00 40.00 ? 254 LYS A CG    1 
ATOM   134  C CD    . LYS A 1 46  ? -25.979 -44.782 21.899 1.00 44.70 ? 254 LYS A CD    1 
ATOM   135  C CE    . LYS A 1 46  ? -27.346 -44.961 22.533 1.00 49.19 ? 254 LYS A CE    1 
ATOM   136  N NZ    . LYS A 1 46  ? -27.276 -44.809 24.021 1.00 52.02 ? 254 LYS A NZ    1 
ATOM   137  N N     . ILE A 1 47  ? -26.683 -40.238 18.597 1.00 33.59 ? 255 ILE A N     1 
ATOM   138  C CA    . ILE A 1 47  ? -26.992 -39.672 17.276 1.00 34.25 ? 255 ILE A CA    1 
ATOM   139  C C     . ILE A 1 47  ? -25.802 -38.849 16.747 1.00 34.00 ? 255 ILE A C     1 
ATOM   140  O O     . ILE A 1 47  ? -25.377 -39.012 15.608 1.00 34.04 ? 255 ILE A O     1 
ATOM   141  C CB    . ILE A 1 47  ? -28.283 -38.792 17.291 1.00 34.18 ? 255 ILE A CB    1 
ATOM   142  C CG1   . ILE A 1 47  ? -29.511 -39.612 17.723 1.00 33.48 ? 255 ILE A CG1   1 
ATOM   143  C CG2   . ILE A 1 47  ? -28.520 -38.126 15.911 1.00 35.44 ? 255 ILE A CG2   1 
ATOM   144  C CD1   . ILE A 1 47  ? -29.969 -40.641 16.715 1.00 36.21 ? 255 ILE A CD1   1 
ATOM   145  N N     . ARG A 1 48  ? -25.282 -37.973 17.590 1.00 33.29 ? 256 ARG A N     1 
ATOM   146  C CA    . ARG A 1 48  ? -24.175 -37.130 17.202 1.00 33.83 ? 256 ARG A CA    1 
ATOM   147  C C     . ARG A 1 48  ? -22.927 -37.971 16.906 1.00 33.69 ? 256 ARG A C     1 
ATOM   148  O O     . ARG A 1 48  ? -22.331 -37.880 15.822 1.00 34.52 ? 256 ARG A O     1 
ATOM   149  C CB    . ARG A 1 48  ? -23.860 -36.130 18.321 1.00 33.43 ? 256 ARG A CB    1 
ATOM   150  C CG    . ARG A 1 48  ? -22.565 -35.356 18.049 1.00 36.73 ? 256 ARG A CG    1 
ATOM   151  C CD    . ARG A 1 48  ? -21.960 -34.860 19.313 1.00 35.69 ? 256 ARG A CD    1 
ATOM   152  N NE    . ARG A 1 48  ? -21.071 -35.825 19.952 1.00 34.15 ? 256 ARG A NE    1 
ATOM   153  C CZ    . ARG A 1 48  ? -19.734 -35.796 19.881 1.00 35.40 ? 256 ARG A CZ    1 
ATOM   154  N NH1   . ARG A 1 48  ? -19.115 -34.853 19.189 1.00 36.78 ? 256 ARG A NH1   1 
ATOM   155  N NH2   . ARG A 1 48  ? -18.994 -36.691 20.535 1.00 32.69 ? 256 ARG A NH2   1 
ATOM   156  N N     . THR A 1 49  ? -22.519 -38.780 17.877 1.00 32.43 ? 257 THR A N     1 
ATOM   157  C CA    . THR A 1 49  ? -21.221 -39.440 17.779 1.00 32.08 ? 257 THR A CA    1 
ATOM   158  C C     . THR A 1 49  ? -21.226 -40.500 16.676 1.00 32.20 ? 257 THR A C     1 
ATOM   159  O O     . THR A 1 49  ? -20.266 -40.607 15.937 1.00 31.30 ? 257 THR A O     1 
ATOM   160  C CB    . THR A 1 49  ? -20.763 -40.023 19.122 1.00 31.51 ? 257 THR A CB    1 
ATOM   161  O OG1   . THR A 1 49  ? -20.931 -39.036 20.139 1.00 31.66 ? 257 THR A OG1   1 
ATOM   162  C CG2   . THR A 1 49  ? -19.260 -40.415 19.078 1.00 29.09 ? 257 THR A CG2   1 
ATOM   163  N N     . GLU A 1 50  ? -22.311 -41.275 16.577 1.00 32.90 ? 258 GLU A N     1 
ATOM   164  C CA    . GLU A 1 50  ? -22.418 -42.323 15.554 1.00 33.72 ? 258 GLU A CA    1 
ATOM   165  C C     . GLU A 1 50  ? -22.506 -41.741 14.150 1.00 33.69 ? 258 GLU A C     1 
ATOM   166  O O     . GLU A 1 50  ? -22.014 -42.356 13.212 1.00 33.92 ? 258 GLU A O     1 
ATOM   167  C CB    . GLU A 1 50  ? -23.602 -43.254 15.840 1.00 33.67 ? 258 GLU A CB    1 
ATOM   168  C CG    . GLU A 1 50  ? -23.503 -43.897 17.205 1.00 37.36 ? 258 GLU A CG    1 
ATOM   169  C CD    . GLU A 1 50  ? -24.547 -44.981 17.435 1.00 44.27 ? 258 GLU A CD    1 
ATOM   170  O OE1   . GLU A 1 50  ? -24.292 -45.843 18.318 1.00 48.70 ? 258 GLU A OE1   1 
ATOM   171  O OE2   . GLU A 1 50  ? -25.607 -44.973 16.751 1.00 45.13 ? 258 GLU A OE2   1 
ATOM   172  N N     . SER A 1 51  ? -23.090 -40.550 14.014 1.00 33.56 ? 259 SER A N     1 
ATOM   173  C CA    . SER A 1 51  ? -23.065 -39.841 12.738 1.00 34.19 ? 259 SER A CA    1 
ATOM   174  C C     . SER A 1 51  ? -21.647 -39.560 12.256 1.00 33.57 ? 259 SER A C     1 
ATOM   175  O O     . SER A 1 51  ? -21.359 -39.847 11.090 1.00 34.09 ? 259 SER A O     1 
ATOM   176  C CB    . SER A 1 51  ? -23.864 -38.527 12.758 1.00 33.48 ? 259 SER A CB    1 
ATOM   177  O OG    . SER A 1 51  ? -25.257 -38.779 12.905 1.00 36.72 ? 259 SER A OG    1 
ATOM   178  N N     . TYR A 1 52  ? -20.800 -38.948 13.101 1.00 32.10 ? 260 TYR A N     1 
ATOM   179  C CA    . TYR A 1 52  ? -19.378 -38.693 12.748 1.00 31.20 ? 260 TYR A CA    1 
ATOM   180  C C     . TYR A 1 52  ? -18.627 -40.021 12.509 1.00 31.86 ? 260 TYR A C     1 
ATOM   181  O O     . TYR A 1 52  ? -17.855 -40.138 11.541 1.00 31.03 ? 260 TYR A O     1 
ATOM   182  C CB    . TYR A 1 52  ? -18.635 -37.914 13.855 1.00 29.97 ? 260 TYR A CB    1 
ATOM   183  C CG    . TYR A 1 52  ? -18.823 -36.406 13.838 1.00 29.79 ? 260 TYR A CG    1 
ATOM   184  C CD1   . TYR A 1 52  ? -19.979 -35.829 14.354 1.00 29.90 ? 260 TYR A CD1   1 
ATOM   185  C CD2   . TYR A 1 52  ? -17.824 -35.551 13.339 1.00 28.20 ? 260 TYR A CD2   1 
ATOM   186  C CE1   . TYR A 1 52  ? -20.176 -34.426 14.325 1.00 29.81 ? 260 TYR A CE1   1 
ATOM   187  C CE2   . TYR A 1 52  ? -17.993 -34.171 13.336 1.00 26.45 ? 260 TYR A CE2   1 
ATOM   188  C CZ    . TYR A 1 52  ? -19.188 -33.620 13.833 1.00 28.37 ? 260 TYR A CZ    1 
ATOM   189  O OH    . TYR A 1 52  ? -19.403 -32.247 13.802 1.00 30.37 ? 260 TYR A OH    1 
ATOM   190  N N     . ARG A 1 53  ? -18.887 -41.020 13.368 1.00 31.55 ? 261 ARG A N     1 
ATOM   191  C CA    . ARG A 1 53  ? -18.288 -42.369 13.206 1.00 32.04 ? 261 ARG A CA    1 
ATOM   192  C C     . ARG A 1 53  ? -18.669 -43.003 11.848 1.00 32.40 ? 261 ARG A C     1 
ATOM   193  O O     . ARG A 1 53  ? -17.798 -43.463 11.136 1.00 31.98 ? 261 ARG A O     1 
ATOM   194  C CB    . ARG A 1 53  ? -18.712 -43.325 14.333 1.00 31.77 ? 261 ARG A CB    1 
ATOM   195  C CG    . ARG A 1 53  ? -18.018 -44.738 14.269 1.00 32.26 ? 261 ARG A CG    1 
ATOM   196  C CD    . ARG A 1 53  ? -18.815 -45.733 15.032 1.00 37.34 ? 261 ARG A CD    1 
ATOM   197  N NE    . ARG A 1 53  ? -20.158 -45.939 14.476 1.00 38.66 ? 261 ARG A NE    1 
ATOM   198  C CZ    . ARG A 1 53  ? -21.127 -46.608 15.110 1.00 39.91 ? 261 ARG A CZ    1 
ATOM   199  N NH1   . ARG A 1 53  ? -20.895 -47.142 16.300 1.00 39.58 ? 261 ARG A NH1   1 
ATOM   200  N NH2   . ARG A 1 53  ? -22.326 -46.750 14.561 1.00 40.08 ? 261 ARG A NH2   1 
ATOM   201  N N     . ASP A 1 54  ? -19.973 -43.046 11.529 1.00 32.71 ? 262 ASP A N     1 
ATOM   202  C CA    . ASP A 1 54  ? -20.465 -43.645 10.276 1.00 33.92 ? 262 ASP A CA    1 
ATOM   203  C C     . ASP A 1 54  ? -19.887 -42.893 9.068  1.00 33.38 ? 262 ASP A C     1 
ATOM   204  O O     . ASP A 1 54  ? -19.445 -43.510 8.102  1.00 34.61 ? 262 ASP A O     1 
ATOM   205  C CB    . ASP A 1 54  ? -22.017 -43.663 10.229 1.00 34.50 ? 262 ASP A CB    1 
ATOM   206  C CG    . ASP A 1 54  ? -22.637 -44.635 11.246 1.00 35.74 ? 262 ASP A CG    1 
ATOM   207  O OD1   . ASP A 1 54  ? -23.868 -44.580 11.415 1.00 35.63 ? 262 ASP A OD1   1 
ATOM   208  O OD2   . ASP A 1 54  ? -21.915 -45.431 11.898 1.00 36.58 ? 262 ASP A OD2   1 
ATOM   209  N N     . PHE A 1 55  ? -19.848 -41.570 9.139  1.00 32.22 ? 263 PHE A N     1 
ATOM   210  C CA    . PHE A 1 55  ? -19.227 -40.769 8.074  1.00 32.18 ? 263 PHE A CA    1 
ATOM   211  C C     . PHE A 1 55  ? -17.776 -41.197 7.792  1.00 31.42 ? 263 PHE A C     1 
ATOM   212  O O     . PHE A 1 55  ? -17.415 -41.474 6.643  1.00 30.49 ? 263 PHE A O     1 
ATOM   213  C CB    . PHE A 1 55  ? -19.299 -39.255 8.381  1.00 31.58 ? 263 PHE A CB    1 
ATOM   214  C CG    . PHE A 1 55  ? -18.259 -38.448 7.660  1.00 30.65 ? 263 PHE A CG    1 
ATOM   215  C CD1   . PHE A 1 55  ? -18.245 -38.394 6.259  1.00 33.49 ? 263 PHE A CD1   1 
ATOM   216  C CD2   . PHE A 1 55  ? -17.296 -37.749 8.371  1.00 30.63 ? 263 PHE A CD2   1 
ATOM   217  C CE1   . PHE A 1 55  ? -17.252 -37.685 5.572  1.00 34.11 ? 263 PHE A CE1   1 
ATOM   218  C CE2   . PHE A 1 55  ? -16.325 -37.007 7.704  1.00 31.04 ? 263 PHE A CE2   1 
ATOM   219  C CZ    . PHE A 1 55  ? -16.299 -36.981 6.288  1.00 29.73 ? 263 PHE A CZ    1 
ATOM   220  N N     . ILE A 1 56  ? -16.967 -41.226 8.846  1.00 31.83 ? 264 ILE A N     1 
ATOM   221  C CA    . ILE A 1 56  ? -15.553 -41.579 8.775  1.00 31.71 ? 264 ILE A CA    1 
ATOM   222  C C     . ILE A 1 56  ? -15.352 -43.059 8.362  1.00 32.49 ? 264 ILE A C     1 
ATOM   223  O O     . ILE A 1 56  ? -14.657 -43.356 7.382  1.00 32.98 ? 264 ILE A O     1 
ATOM   224  C CB    . ILE A 1 56  ? -14.807 -41.194 10.083 1.00 32.40 ? 264 ILE A CB    1 
ATOM   225  C CG1   . ILE A 1 56  ? -14.863 -39.666 10.299 1.00 32.84 ? 264 ILE A CG1   1 
ATOM   226  C CG2   . ILE A 1 56  ? -13.336 -41.571 9.989  1.00 29.91 ? 264 ILE A CG2   1 
ATOM   227  C CD1   . ILE A 1 56  ? -14.558 -39.171 11.746 1.00 31.35 ? 264 ILE A CD1   1 
ATOM   228  N N     . TYR A 1 57  ? -16.013 -43.971 9.055  1.00 32.26 ? 265 TYR A N     1 
ATOM   229  C CA    . TYR A 1 57  ? -15.872 -45.401 8.771  1.00 33.36 ? 265 TYR A CA    1 
ATOM   230  C C     . TYR A 1 57  ? -16.425 -45.863 7.406  1.00 32.96 ? 265 TYR A C     1 
ATOM   231  O O     . TYR A 1 57  ? -15.874 -46.774 6.806  1.00 32.18 ? 265 TYR A O     1 
ATOM   232  C CB    . TYR A 1 57  ? -16.478 -46.221 9.919  1.00 33.50 ? 265 TYR A CB    1 
ATOM   233  C CG    . TYR A 1 57  ? -15.607 -46.207 11.162 1.00 34.47 ? 265 TYR A CG    1 
ATOM   234  C CD1   . TYR A 1 57  ? -14.434 -45.424 11.211 1.00 33.87 ? 265 TYR A CD1   1 
ATOM   235  C CD2   . TYR A 1 57  ? -15.936 -46.989 12.283 1.00 34.81 ? 265 TYR A CD2   1 
ATOM   236  C CE1   . TYR A 1 57  ? -13.636 -45.400 12.345 1.00 34.31 ? 265 TYR A CE1   1 
ATOM   237  C CE2   . TYR A 1 57  ? -15.143 -46.976 13.424 1.00 34.18 ? 265 TYR A CE2   1 
ATOM   238  C CZ    . TYR A 1 57  ? -14.000 -46.182 13.450 1.00 34.76 ? 265 TYR A CZ    1 
ATOM   239  O OH    . TYR A 1 57  ? -13.188 -46.190 14.561 1.00 35.04 ? 265 TYR A OH    1 
ATOM   240  N N     . GLN A 1 58  ? -17.511 -45.247 6.948  1.00 32.45 ? 266 GLN A N     1 
ATOM   241  C CA    . GLN A 1 58  ? -18.154 -45.592 5.674  1.00 33.33 ? 266 GLN A CA    1 
ATOM   242  C C     . GLN A 1 58  ? -17.539 -44.890 4.474  1.00 33.11 ? 266 GLN A C     1 
ATOM   243  O O     . GLN A 1 58  ? -17.837 -45.253 3.339  1.00 32.82 ? 266 GLN A O     1 
ATOM   244  C CB    . GLN A 1 58  ? -19.653 -45.252 5.718  1.00 33.37 ? 266 GLN A CB    1 
ATOM   245  C CG    . GLN A 1 58  ? -20.450 -46.137 6.661  1.00 38.34 ? 266 GLN A CG    1 
ATOM   246  C CD    . GLN A 1 58  ? -21.905 -45.748 6.720  1.00 44.32 ? 266 GLN A CD    1 
ATOM   247  O OE1   . GLN A 1 58  ? -22.691 -46.381 7.426  1.00 49.33 ? 266 GLN A OE1   1 
ATOM   248  N NE2   . GLN A 1 58  ? -22.275 -44.685 6.012  1.00 44.93 ? 266 GLN A NE2   1 
ATOM   249  N N     . ASN A 1 59  ? -16.696 -43.883 4.721  1.00 33.19 ? 267 ASN A N     1 
ATOM   250  C CA    . ASN A 1 59  ? -15.990 -43.175 3.662  1.00 33.35 ? 267 ASN A CA    1 
ATOM   251  C C     . ASN A 1 59  ? -14.489 -43.114 3.885  1.00 33.63 ? 267 ASN A C     1 
ATOM   252  O O     . ASN A 1 59  ? -13.920 -42.038 3.896  1.00 32.41 ? 267 ASN A O     1 
ATOM   253  C CB    . ASN A 1 59  ? -16.539 -41.750 3.496  1.00 33.03 ? 267 ASN A CB    1 
ATOM   254  C CG    . ASN A 1 59  ? -17.998 -41.742 3.107  1.00 34.87 ? 267 ASN A CG    1 
ATOM   255  O OD1   . ASN A 1 59  ? -18.360 -42.018 1.944  1.00 38.13 ? 267 ASN A OD1   1 
ATOM   256  N ND2   . ASN A 1 59  ? -18.859 -41.446 4.073  1.00 33.17 ? 267 ASN A ND2   1 
ATOM   257  N N     . PRO A 1 60  ? -13.829 -44.276 4.046  1.00 33.71 ? 268 PRO A N     1 
ATOM   258  C CA    . PRO A 1 60  ? -12.405 -44.258 4.417  1.00 34.37 ? 268 PRO A CA    1 
ATOM   259  C C     . PRO A 1 60  ? -11.489 -43.591 3.405  1.00 35.34 ? 268 PRO A C     1 
ATOM   260  O O     . PRO A 1 60  ? -10.437 -43.063 3.764  1.00 36.56 ? 268 PRO A O     1 
ATOM   261  C CB    . PRO A 1 60  ? -12.048 -45.750 4.525  1.00 35.01 ? 268 PRO A CB    1 
ATOM   262  C CG    . PRO A 1 60  ? -13.089 -46.465 3.649  1.00 34.48 ? 268 PRO A CG    1 
ATOM   263  C CD    . PRO A 1 60  ? -14.348 -45.640 3.879  1.00 34.02 ? 268 PRO A CD    1 
ATOM   264  N N     . HIS A 1 61  ? -11.897 -43.608 2.136  1.00 35.53 ? 269 HIS A N     1 
ATOM   265  C CA    . HIS A 1 61  ? -11.155 -43.019 1.037  1.00 35.46 ? 269 HIS A CA    1 
ATOM   266  C C     . HIS A 1 61  ? -10.877 -41.540 1.306  1.00 33.81 ? 269 HIS A C     1 
ATOM   267  O O     . HIS A 1 61  ? -9.888  -41.000 0.872  1.00 31.80 ? 269 HIS A O     1 
ATOM   268  C CB    . HIS A 1 61  ? -11.992 -43.251 -0.237 1.00 37.35 ? 269 HIS A CB    1 
ATOM   269  C CG    . HIS A 1 61  ? -13.106 -44.251 -0.014 1.00 43.88 ? 269 HIS A CG    1 
ATOM   270  N ND1   . HIS A 1 61  ? -14.345 -43.894 0.492  1.00 44.57 ? 269 HIS A ND1   1 
ATOM   271  C CD2   . HIS A 1 61  ? -13.139 -45.602 -0.163 1.00 46.37 ? 269 HIS A CD2   1 
ATOM   272  C CE1   . HIS A 1 61  ? -15.092 -44.978 0.619  1.00 45.97 ? 269 HIS A CE1   1 
ATOM   273  N NE2   . HIS A 1 61  ? -14.389 -46.028 0.228  1.00 46.37 ? 269 HIS A NE2   1 
ATOM   274  N N     . ILE A 1 62  ? -11.752 -40.893 2.072  1.00 32.69 ? 270 ILE A N     1 
ATOM   275  C CA    . ILE A 1 62  ? -11.544 -39.502 2.429  1.00 31.94 ? 270 ILE A CA    1 
ATOM   276  C C     . ILE A 1 62  ? -10.330 -39.342 3.358  1.00 31.69 ? 270 ILE A C     1 
ATOM   277  O O     . ILE A 1 62  ? -9.643  -38.326 3.300  1.00 31.27 ? 270 ILE A O     1 
ATOM   278  C CB    . ILE A 1 62  ? -12.830 -38.912 3.089  1.00 32.05 ? 270 ILE A CB    1 
ATOM   279  C CG1   . ILE A 1 62  ? -13.966 -38.832 2.052  1.00 32.80 ? 270 ILE A CG1   1 
ATOM   280  C CG2   . ILE A 1 62  ? -12.566 -37.531 3.755  1.00 31.54 ? 270 ILE A CG2   1 
ATOM   281  C CD1   . ILE A 1 62  ? -15.282 -38.371 2.665  1.00 31.01 ? 270 ILE A CD1   1 
ATOM   282  N N     . PHE A 1 63  ? -10.071 -40.372 4.173  1.00 31.88 ? 271 PHE A N     1 
ATOM   283  C CA    . PHE A 1 63  ? -9.094  -40.333 5.266  1.00 32.05 ? 271 PHE A CA    1 
ATOM   284  C C     . PHE A 1 63  ? -7.810  -41.102 4.983  1.00 32.64 ? 271 PHE A C     1 
ATOM   285  O O     . PHE A 1 63  ? -6.726  -40.717 5.430  1.00 32.07 ? 271 PHE A O     1 
ATOM   286  C CB    . PHE A 1 63  ? -9.778  -40.817 6.589  1.00 32.42 ? 271 PHE A CB    1 
ATOM   287  C CG    . PHE A 1 63  ? -10.876 -39.904 7.034  1.00 32.93 ? 271 PHE A CG    1 
ATOM   288  C CD1   . PHE A 1 63  ? -12.201 -40.155 6.659  1.00 31.88 ? 271 PHE A CD1   1 
ATOM   289  C CD2   . PHE A 1 63  ? -10.577 -38.717 7.707  1.00 32.23 ? 271 PHE A CD2   1 
ATOM   290  C CE1   . PHE A 1 63  ? -13.207 -39.265 7.003  1.00 31.21 ? 271 PHE A CE1   1 
ATOM   291  C CE2   . PHE A 1 63  ? -11.615 -37.797 8.040  1.00 29.49 ? 271 PHE A CE2   1 
ATOM   292  C CZ    . PHE A 1 63  ? -12.904 -38.102 7.713  1.00 31.64 ? 271 PHE A CZ    1 
ATOM   293  N N     . LYS A 1 64  ? -7.937  -42.185 4.230  1.00 33.58 ? 272 LYS A N     1 
ATOM   294  C CA    . LYS A 1 64  ? -6.790  -43.095 3.993  1.00 34.36 ? 272 LYS A CA    1 
ATOM   295  C C     . LYS A 1 64  ? -5.588  -42.355 3.421  1.00 33.80 ? 272 LYS A C     1 
ATOM   296  O O     . LYS A 1 64  ? -5.716  -41.687 2.402  1.00 34.50 ? 272 LYS A O     1 
ATOM   297  C CB    . LYS A 1 64  ? -7.205  -44.228 3.062  1.00 34.18 ? 272 LYS A CB    1 
ATOM   298  C CG    . LYS A 1 64  ? -6.040  -45.097 2.528  1.00 37.41 ? 272 LYS A CG    1 
ATOM   299  C CD    . LYS A 1 64  ? -5.344  -45.796 3.653  1.00 40.94 ? 272 LYS A CD    1 
ATOM   300  C CE    . LYS A 1 64  ? -4.592  -47.021 3.152  1.00 44.64 ? 272 LYS A CE    1 
ATOM   301  N NZ    . LYS A 1 64  ? -4.518  -47.928 4.311  1.00 48.46 ? 272 LYS A NZ    1 
ATOM   302  N N     . ASP A 1 65  ? -4.438  -42.487 4.099  1.00 34.09 ? 273 ASP A N     1 
ATOM   303  C CA    . ASP A 1 65  ? -3.166  -41.833 3.744  1.00 33.43 ? 273 ASP A CA    1 
ATOM   304  C C     . ASP A 1 65  ? -3.209  -40.311 3.744  1.00 33.25 ? 273 ASP A C     1 
ATOM   305  O O     . ASP A 1 65  ? -2.312  -39.688 3.218  1.00 33.26 ? 273 ASP A O     1 
ATOM   306  C CB    . ASP A 1 65  ? -2.629  -42.328 2.390  1.00 33.95 ? 273 ASP A CB    1 
ATOM   307  C CG    . ASP A 1 65  ? -2.377  -43.831 2.380  1.00 34.39 ? 273 ASP A CG    1 
ATOM   308  O OD1   . ASP A 1 65  ? -2.012  -44.380 3.440  1.00 33.99 ? 273 ASP A OD1   1 
ATOM   309  O OD2   . ASP A 1 65  ? -2.565  -44.459 1.321  1.00 37.12 ? 273 ASP A OD2   1 
ATOM   310  N N     . LYS A 1 66  ? -4.237  -39.699 4.336  1.00 33.09 ? 274 LYS A N     1 
ATOM   311  C CA    . LYS A 1 66  ? -4.321  -38.225 4.354  1.00 31.83 ? 274 LYS A CA    1 
ATOM   312  C C     . LYS A 1 66  ? -3.873  -37.633 5.694  1.00 31.55 ? 274 LYS A C     1 
ATOM   313  O O     . LYS A 1 66  ? -3.771  -38.339 6.714  1.00 30.23 ? 274 LYS A O     1 
ATOM   314  C CB    . LYS A 1 66  ? -5.762  -37.734 4.057  1.00 32.34 ? 274 LYS A CB    1 
ATOM   315  C CG    . LYS A 1 66  ? -6.374  -38.293 2.777  1.00 35.73 ? 274 LYS A CG    1 
ATOM   316  C CD    . LYS A 1 66  ? -5.745  -37.629 1.583  1.00 38.26 ? 274 LYS A CD    1 
ATOM   317  C CE    . LYS A 1 66  ? -6.296  -38.170 0.272  1.00 43.94 ? 274 LYS A CE    1 
ATOM   318  N NZ    . LYS A 1 66  ? -5.845  -37.278 -0.841 1.00 46.77 ? 274 LYS A NZ    1 
ATOM   319  N N     . VAL A 1 67  ? -3.656  -36.318 5.681  1.00 30.79 ? 275 VAL A N     1 
ATOM   320  C CA    . VAL A 1 67  ? -3.276  -35.548 6.847  1.00 30.66 ? 275 VAL A CA    1 
ATOM   321  C C     . VAL A 1 67  ? -4.568  -34.838 7.316  1.00 30.79 ? 275 VAL A C     1 
ATOM   322  O O     . VAL A 1 67  ? -5.197  -34.077 6.559  1.00 29.78 ? 275 VAL A O     1 
ATOM   323  C CB    . VAL A 1 67  ? -2.165  -34.510 6.516  1.00 30.74 ? 275 VAL A CB    1 
ATOM   324  C CG1   . VAL A 1 67  ? -1.849  -33.604 7.740  1.00 32.16 ? 275 VAL A CG1   1 
ATOM   325  C CG2   . VAL A 1 67  ? -0.886  -35.195 5.991  1.00 32.16 ? 275 VAL A CG2   1 
ATOM   326  N N     . VAL A 1 68  ? -4.961  -35.111 8.558  1.00 30.40 ? 276 VAL A N     1 
ATOM   327  C CA    . VAL A 1 68  ? -6.242  -34.645 9.095  1.00 30.69 ? 276 VAL A CA    1 
ATOM   328  C C     . VAL A 1 68  ? -6.069  -33.674 10.262 1.00 30.96 ? 276 VAL A C     1 
ATOM   329  O O     . VAL A 1 68  ? -5.236  -33.878 11.142 1.00 30.49 ? 276 VAL A O     1 
ATOM   330  C CB    . VAL A 1 68  ? -7.113  -35.864 9.561  1.00 30.20 ? 276 VAL A CB    1 
ATOM   331  C CG1   . VAL A 1 68  ? -8.566  -35.428 9.908  1.00 30.46 ? 276 VAL A CG1   1 
ATOM   332  C CG2   . VAL A 1 68  ? -7.153  -36.915 8.458  1.00 29.33 ? 276 VAL A CG2   1 
ATOM   333  N N     . LEU A 1 69  ? -6.871  -32.615 10.270 1.00 30.46 ? 277 LEU A N     1 
ATOM   334  C CA    . LEU A 1 69  ? -6.886  -31.736 11.401 1.00 30.88 ? 277 LEU A CA    1 
ATOM   335  C C     . LEU A 1 69  ? -8.235  -31.845 12.085 1.00 29.93 ? 277 LEU A C     1 
ATOM   336  O O     . LEU A 1 69  ? -9.272  -31.741 11.443 1.00 30.68 ? 277 LEU A O     1 
ATOM   337  C CB    . LEU A 1 69  ? -6.563  -30.288 10.988 1.00 30.14 ? 277 LEU A CB    1 
ATOM   338  C CG    . LEU A 1 69  ? -6.811  -29.209 12.065 1.00 32.06 ? 277 LEU A CG    1 
ATOM   339  C CD1   . LEU A 1 69  ? -5.759  -29.216 13.212 1.00 32.24 ? 277 LEU A CD1   1 
ATOM   340  C CD2   . LEU A 1 69  ? -6.848  -27.860 11.412 1.00 28.37 ? 277 LEU A CD2   1 
ATOM   341  N N     . ASP A 1 70  ? -8.191  -32.087 13.389 1.00 30.89 ? 278 ASP A N     1 
ATOM   342  C CA    . ASP A 1 70  ? -9.364  -32.217 14.250 1.00 29.70 ? 278 ASP A CA    1 
ATOM   343  C C     . ASP A 1 70  ? -9.343  -30.967 15.113 1.00 29.16 ? 278 ASP A C     1 
ATOM   344  O O     . ASP A 1 70  ? -8.553  -30.866 16.050 1.00 29.35 ? 278 ASP A O     1 
ATOM   345  C CB    . ASP A 1 70  ? -9.281  -33.499 15.118 1.00 29.14 ? 278 ASP A CB    1 
ATOM   346  C CG    . ASP A 1 70  ? -10.472 -33.679 16.082 1.00 30.90 ? 278 ASP A CG    1 
ATOM   347  O OD1   . ASP A 1 70  ? -10.465 -34.709 16.794 1.00 33.24 ? 278 ASP A OD1   1 
ATOM   348  O OD2   . ASP A 1 70  ? -11.421 -32.835 16.164 1.00 27.46 ? 278 ASP A OD2   1 
ATOM   349  N N     . VAL A 1 71  ? -10.187 -29.999 14.745 1.00 28.04 ? 279 VAL A N     1 
ATOM   350  C CA    . VAL A 1 71  ? -10.283 -28.735 15.458 1.00 27.88 ? 279 VAL A CA    1 
ATOM   351  C C     . VAL A 1 71  ? -11.164 -28.882 16.715 1.00 27.75 ? 279 VAL A C     1 
ATOM   352  O O     . VAL A 1 71  ? -12.407 -29.119 16.619 1.00 28.74 ? 279 VAL A O     1 
ATOM   353  C CB    . VAL A 1 71  ? -10.825 -27.592 14.503 1.00 27.82 ? 279 VAL A CB    1 
ATOM   354  C CG1   . VAL A 1 71  ? -11.083 -26.279 15.263 1.00 27.20 ? 279 VAL A CG1   1 
ATOM   355  C CG2   . VAL A 1 71  ? -9.923  -27.412 13.270 1.00 29.34 ? 279 VAL A CG2   1 
ATOM   356  N N     . GLY A 1 72  ? -10.543 -28.760 17.890 1.00 27.28 ? 280 GLY A N     1 
ATOM   357  C CA    . GLY A 1 72  ? -11.255 -28.920 19.166 1.00 27.09 ? 280 GLY A CA    1 
ATOM   358  C C     . GLY A 1 72  ? -11.451 -30.392 19.470 1.00 27.63 ? 280 GLY A C     1 
ATOM   359  O O     . GLY A 1 72  ? -12.587 -30.866 19.574 1.00 27.07 ? 280 GLY A O     1 
ATOM   360  N N     . CYS A 1 73  ? -10.343 -31.126 19.577 1.00 26.94 ? 281 CYS A N     1 
ATOM   361  C CA    . CYS A 1 73  ? -10.407 -32.599 19.570 1.00 28.34 ? 281 CYS A CA    1 
ATOM   362  C C     . CYS A 1 73  ? -11.025 -33.242 20.831 1.00 27.81 ? 281 CYS A C     1 
ATOM   363  O O     . CYS A 1 73  ? -11.420 -34.425 20.807 1.00 28.84 ? 281 CYS A O     1 
ATOM   364  C CB    . CYS A 1 73  ? -9.007  -33.177 19.322 1.00 27.00 ? 281 CYS A CB    1 
ATOM   365  S SG    . CYS A 1 73  ? -7.847  -32.761 20.599 1.00 29.35 ? 281 CYS A SG    1 
ATOM   366  N N     . GLY A 1 74  ? -11.118 -32.472 21.919 1.00 28.33 ? 282 GLY A N     1 
ATOM   367  C CA    . GLY A 1 74  ? -11.681 -32.950 23.189 1.00 27.05 ? 282 GLY A CA    1 
ATOM   368  C C     . GLY A 1 74  ? -10.941 -34.195 23.683 1.00 26.76 ? 282 GLY A C     1 
ATOM   369  O O     . GLY A 1 74  ? -9.723  -34.182 23.854 1.00 25.85 ? 282 GLY A O     1 
ATOM   370  N N     . THR A 1 75  ? -11.669 -35.297 23.855 1.00 26.26 ? 283 THR A N     1 
ATOM   371  C CA    . THR A 1 75  ? -11.043 -36.545 24.317 1.00 26.88 ? 283 THR A CA    1 
ATOM   372  C C     . THR A 1 75  ? -10.223 -37.222 23.226 1.00 27.04 ? 283 THR A C     1 
ATOM   373  O O     . THR A 1 75  ? -9.552  -38.244 23.477 1.00 27.74 ? 283 THR A O     1 
ATOM   374  C CB    . THR A 1 75  ? -12.121 -37.543 24.762 1.00 26.48 ? 283 THR A CB    1 
ATOM   375  O OG1   . THR A 1 75  ? -13.112 -37.639 23.730 1.00 27.76 ? 283 THR A OG1   1 
ATOM   376  C CG2   . THR A 1 75  ? -12.762 -37.098 26.088 1.00 27.38 ? 283 THR A CG2   1 
ATOM   377  N N     . GLY A 1 76  ? -10.334 -36.708 22.005 1.00 26.77 ? 284 GLY A N     1 
ATOM   378  C CA    . GLY A 1 76  ? -9.607  -37.279 20.864 1.00 27.63 ? 284 GLY A CA    1 
ATOM   379  C C     . GLY A 1 76  ? -10.443 -38.273 20.071 1.00 27.48 ? 284 GLY A C     1 
ATOM   380  O O     . GLY A 1 76  ? -9.939  -38.909 19.142 1.00 26.93 ? 284 GLY A O     1 
ATOM   381  N N     . ILE A 1 77  ? -11.723 -38.396 20.428 1.00 26.87 ? 285 ILE A N     1 
ATOM   382  C CA    . ILE A 1 77  ? -12.615 -39.347 19.770 1.00 27.64 ? 285 ILE A CA    1 
ATOM   383  C C     . ILE A 1 77  ? -12.590 -39.268 18.214 1.00 27.42 ? 285 ILE A C     1 
ATOM   384  O O     . ILE A 1 77  ? -12.500 -40.301 17.525 1.00 26.06 ? 285 ILE A O     1 
ATOM   385  C CB    . ILE A 1 77  ? -14.080 -39.260 20.312 1.00 27.90 ? 285 ILE A CB    1 
ATOM   386  C CG1   . ILE A 1 77  ? -14.972 -40.380 19.740 1.00 30.24 ? 285 ILE A CG1   1 
ATOM   387  C CG2   . ILE A 1 77  ? -14.713 -37.833 20.054 1.00 26.54 ? 285 ILE A CG2   1 
ATOM   388  C CD1   . ILE A 1 77  ? -14.480 -41.817 19.972 1.00 32.66 ? 285 ILE A CD1   1 
ATOM   389  N N     . LEU A 1 78  ? -12.686 -38.062 17.657 1.00 27.97 ? 286 LEU A N     1 
ATOM   390  C CA    . LEU A 1 78  ? -12.795 -37.946 16.196 1.00 27.87 ? 286 LEU A CA    1 
ATOM   391  C C     . LEU A 1 78  ? -11.459 -38.273 15.548 1.00 28.42 ? 286 LEU A C     1 
ATOM   392  O O     . LEU A 1 78  ? -11.418 -38.885 14.479 1.00 28.33 ? 286 LEU A O     1 
ATOM   393  C CB    . LEU A 1 78  ? -13.288 -36.544 15.780 1.00 28.15 ? 286 LEU A CB    1 
ATOM   394  C CG    . LEU A 1 78  ? -14.688 -36.156 16.245 1.00 28.86 ? 286 LEU A CG    1 
ATOM   395  C CD1   . LEU A 1 78  ? -15.131 -34.754 15.736 1.00 25.95 ? 286 LEU A CD1   1 
ATOM   396  C CD2   . LEU A 1 78  ? -15.734 -37.267 15.985 1.00 29.02 ? 286 LEU A CD2   1 
ATOM   397  N N     . SER A 1 79  ? -10.372 -37.827 16.188 1.00 28.45 ? 287 SER A N     1 
ATOM   398  C CA    . SER A 1 79  ? -9.001  -38.104 15.723 1.00 29.18 ? 287 SER A CA    1 
ATOM   399  C C     . SER A 1 79  ? -8.732  -39.610 15.688 1.00 28.69 ? 287 SER A C     1 
ATOM   400  O O     . SER A 1 79  ? -8.083  -40.113 14.754 1.00 28.42 ? 287 SER A O     1 
ATOM   401  C CB    . SER A 1 79  ? -7.957  -37.417 16.612 1.00 28.80 ? 287 SER A CB    1 
ATOM   402  O OG    . SER A 1 79  ? -8.073  -36.009 16.496 1.00 31.13 ? 287 SER A OG    1 
ATOM   403  N N     . MET A 1 80  ? -9.268  -40.334 16.669 1.00 27.29 ? 288 MET A N     1 
ATOM   404  C CA    . MET A 1 80  ? -9.115  -41.803 16.638 1.00 27.08 ? 288 MET A CA    1 
ATOM   405  C C     . MET A 1 80  ? -9.933  -42.478 15.544 1.00 26.49 ? 288 MET A C     1 
ATOM   406  O O     . MET A 1 80  ? -9.462  -43.443 14.959 1.00 25.80 ? 288 MET A O     1 
ATOM   407  C CB    . MET A 1 80  ? -9.352  -42.472 18.012 1.00 26.85 ? 288 MET A CB    1 
ATOM   408  C CG    . MET A 1 80  ? -8.411  -41.965 19.133 1.00 27.22 ? 288 MET A CG    1 
ATOM   409  S SD    . MET A 1 80  ? -8.474  -42.912 20.685 1.00 26.23 ? 288 MET A SD    1 
ATOM   410  C CE    . MET A 1 80  ? -10.049 -42.251 21.280 1.00 24.90 ? 288 MET A CE    1 
ATOM   411  N N     . PHE A 1 81  ? -11.165 -42.021 15.300 1.00 27.12 ? 289 PHE A N     1 
ATOM   412  C CA    . PHE A 1 81  ? -11.952 -42.465 14.126 1.00 27.80 ? 289 PHE A CA    1 
ATOM   413  C C     . PHE A 1 81  ? -11.168 -42.272 12.832 1.00 28.12 ? 289 PHE A C     1 
ATOM   414  O O     . PHE A 1 81  ? -11.139 -43.156 11.985 1.00 28.00 ? 289 PHE A O     1 
ATOM   415  C CB    . PHE A 1 81  ? -13.288 -41.662 13.983 1.00 28.14 ? 289 PHE A CB    1 
ATOM   416  C CG    . PHE A 1 81  ? -14.360 -41.998 15.009 1.00 28.62 ? 289 PHE A CG    1 
ATOM   417  C CD1   . PHE A 1 81  ? -15.310 -41.027 15.355 1.00 27.82 ? 289 PHE A CD1   1 
ATOM   418  C CD2   . PHE A 1 81  ? -14.426 -43.269 15.617 1.00 28.08 ? 289 PHE A CD2   1 
ATOM   419  C CE1   . PHE A 1 81  ? -16.317 -41.302 16.311 1.00 28.01 ? 289 PHE A CE1   1 
ATOM   420  C CE2   . PHE A 1 81  ? -15.417 -43.573 16.561 1.00 30.53 ? 289 PHE A CE2   1 
ATOM   421  C CZ    . PHE A 1 81  ? -16.390 -42.554 16.910 1.00 28.78 ? 289 PHE A CZ    1 
ATOM   422  N N     . ALA A 1 82  ? -10.538 -41.100 12.676 1.00 28.20 ? 290 ALA A N     1 
ATOM   423  C CA    . ALA A 1 82  ? -9.750  -40.802 11.474 1.00 28.54 ? 290 ALA A CA    1 
ATOM   424  C C     . ALA A 1 82  ? -8.550  -41.746 11.318 1.00 28.31 ? 290 ALA A C     1 
ATOM   425  O O     . ALA A 1 82  ? -8.256  -42.172 10.206 1.00 26.67 ? 290 ALA A O     1 
ATOM   426  C CB    . ALA A 1 82  ? -9.274  -39.361 11.466 1.00 27.69 ? 290 ALA A CB    1 
ATOM   427  N N     . ALA A 1 83  ? -7.872  -42.027 12.425 1.00 28.39 ? 291 ALA A N     1 
ATOM   428  C CA    . ALA A 1 83  ? -6.730  -42.911 12.464 1.00 29.01 ? 291 ALA A CA    1 
ATOM   429  C C     . ALA A 1 83  ? -7.139  -44.316 12.064 1.00 28.82 ? 291 ALA A C     1 
ATOM   430  O O     . ALA A 1 83  ? -6.504  -44.929 11.200 1.00 30.56 ? 291 ALA A O     1 
ATOM   431  C CB    . ALA A 1 83  ? -6.082  -42.906 13.862 1.00 29.91 ? 291 ALA A CB    1 
ATOM   432  N N     . LYS A 1 84  ? -8.215  -44.818 12.648 1.00 28.68 ? 292 LYS A N     1 
ATOM   433  C CA    . LYS A 1 84  ? -8.744  -46.124 12.282 1.00 29.63 ? 292 LYS A CA    1 
ATOM   434  C C     . LYS A 1 84  ? -9.159  -46.246 10.813 1.00 29.64 ? 292 LYS A C     1 
ATOM   435  O O     . LYS A 1 84  ? -8.991  -47.306 10.229 1.00 29.02 ? 292 LYS A O     1 
ATOM   436  C CB    . LYS A 1 84  ? -9.883  -46.540 13.219 1.00 29.09 ? 292 LYS A CB    1 
ATOM   437  C CG    . LYS A 1 84  ? -9.403  -46.822 14.621 1.00 35.57 ? 292 LYS A CG    1 
ATOM   438  C CD    . LYS A 1 84  ? -8.750  -48.243 14.697 1.00 40.84 ? 292 LYS A CD    1 
ATOM   439  C CE    . LYS A 1 84  ? -7.856  -48.396 15.902 1.00 43.35 ? 292 LYS A CE    1 
ATOM   440  N NZ    . LYS A 1 84  ? -7.224  -49.800 15.949 1.00 44.99 ? 292 LYS A NZ    1 
ATOM   441  N N     . ALA A 1 85  ? -9.655  -45.151 10.222 1.00 29.44 ? 293 ALA A N     1 
ATOM   442  C CA    . ALA A 1 85  ? -9.946  -45.104 8.778  1.00 30.56 ? 293 ALA A CA    1 
ATOM   443  C C     . ALA A 1 85  ? -8.708  -44.930 7.879  1.00 30.18 ? 293 ALA A C     1 
ATOM   444  O O     . ALA A 1 85  ? -8.814  -44.931 6.660  1.00 31.61 ? 293 ALA A O     1 
ATOM   445  C CB    . ALA A 1 85  ? -10.998 -44.015 8.478  1.00 29.12 ? 293 ALA A CB    1 
ATOM   446  N N     . GLY A 1 86  ? -7.544  -44.759 8.467  1.00 30.18 ? 294 GLY A N     1 
ATOM   447  C CA    . GLY A 1 86  ? -6.295  -44.940 7.722  1.00 30.64 ? 294 GLY A CA    1 
ATOM   448  C C     . GLY A 1 86  ? -5.558  -43.631 7.486  1.00 31.51 ? 294 GLY A C     1 
ATOM   449  O O     . GLY A 1 86  ? -4.637  -43.579 6.668  1.00 32.06 ? 294 GLY A O     1 
ATOM   450  N N     . ALA A 1 87  ? -5.933  -42.580 8.217  1.00 30.30 ? 295 ALA A N     1 
ATOM   451  C CA    . ALA A 1 87  ? -5.163  -41.317 8.167  1.00 31.56 ? 295 ALA A CA    1 
ATOM   452  C C     . ALA A 1 87  ? -3.655  -41.557 8.371  1.00 32.22 ? 295 ALA A C     1 
ATOM   453  O O     . ALA A 1 87  ? -3.258  -42.365 9.233  1.00 31.43 ? 295 ALA A O     1 
ATOM   454  C CB    . ALA A 1 87  ? -5.688  -40.356 9.202  1.00 30.86 ? 295 ALA A CB    1 
ATOM   455  N N     . LYS A 1 88  ? -2.819  -40.874 7.566  1.00 32.73 ? 296 LYS A N     1 
ATOM   456  C CA    . LYS A 1 88  ? -1.368  -40.899 7.772  1.00 32.98 ? 296 LYS A CA    1 
ATOM   457  C C     . LYS A 1 88  ? -0.925  -40.110 9.001  1.00 31.89 ? 296 LYS A C     1 
ATOM   458  O O     . LYS A 1 88  ? 0.094   -40.426 9.647  1.00 30.49 ? 296 LYS A O     1 
ATOM   459  C CB    . LYS A 1 88  ? -0.662  -40.306 6.564  1.00 33.52 ? 296 LYS A CB    1 
ATOM   460  C CG    . LYS A 1 88  ? 0.839   -40.487 6.564  1.00 37.71 ? 296 LYS A CG    1 
ATOM   461  C CD    . LYS A 1 88  ? 1.271   -41.546 5.558  1.00 42.99 ? 296 LYS A CD    1 
ATOM   462  C CE    . LYS A 1 88  ? 1.021   -41.056 4.134  1.00 44.04 ? 296 LYS A CE    1 
ATOM   463  N NZ    . LYS A 1 88  ? 1.510   -42.020 3.101  1.00 44.64 ? 296 LYS A NZ    1 
ATOM   464  N N     . LYS A 1 89  ? -1.644  -39.032 9.270  1.00 30.87 ? 297 LYS A N     1 
ATOM   465  C CA    . LYS A 1 89  ? -1.251  -38.106 10.308 1.00 31.38 ? 297 LYS A CA    1 
ATOM   466  C C     . LYS A 1 89  ? -2.513  -37.400 10.728 1.00 30.97 ? 297 LYS A C     1 
ATOM   467  O O     . LYS A 1 89  ? -3.300  -36.968 9.863  1.00 29.99 ? 297 LYS A O     1 
ATOM   468  C CB    . LYS A 1 89  ? -0.219  -37.119 9.742  1.00 31.08 ? 297 LYS A CB    1 
ATOM   469  C CG    . LYS A 1 89  ? 0.388   -36.067 10.697 1.00 35.76 ? 297 LYS A CG    1 
ATOM   470  C CD    . LYS A 1 89  ? 1.106   -36.673 11.912 1.00 38.90 ? 297 LYS A CD    1 
ATOM   471  C CE    . LYS A 1 89  ? 2.427   -35.929 12.237 1.00 40.22 ? 297 LYS A CE    1 
ATOM   472  N NZ    . LYS A 1 89  ? 2.318   -34.538 12.682 1.00 41.66 ? 297 LYS A NZ    1 
ATOM   473  N N     . VAL A 1 90  ? -2.719  -37.299 12.047 1.00 30.27 ? 298 VAL A N     1 
ATOM   474  C CA    . VAL A 1 90  ? -3.866  -36.523 12.593 1.00 30.27 ? 298 VAL A CA    1 
ATOM   475  C C     . VAL A 1 90  ? -3.374  -35.577 13.655 1.00 31.19 ? 298 VAL A C     1 
ATOM   476  O O     . VAL A 1 90  ? -2.643  -35.985 14.557 1.00 31.63 ? 298 VAL A O     1 
ATOM   477  C CB    . VAL A 1 90  ? -4.964  -37.422 13.225 1.00 30.23 ? 298 VAL A CB    1 
ATOM   478  C CG1   . VAL A 1 90  ? -6.188  -36.564 13.618 1.00 28.67 ? 298 VAL A CG1   1 
ATOM   479  C CG2   . VAL A 1 90  ? -5.352  -38.582 12.266 1.00 28.06 ? 298 VAL A CG2   1 
ATOM   480  N N     . LEU A 1 91  ? -3.729  -34.299 13.513 1.00 32.72 ? 299 LEU A N     1 
ATOM   481  C CA    . LEU A 1 91  ? -3.437  -33.281 14.513 1.00 33.21 ? 299 LEU A CA    1 
ATOM   482  C C     . LEU A 1 91  ? -4.748  -32.955 15.216 1.00 33.29 ? 299 LEU A C     1 
ATOM   483  O O     . LEU A 1 91  ? -5.698  -32.447 14.597 1.00 33.99 ? 299 LEU A O     1 
ATOM   484  C CB    . LEU A 1 91  ? -2.778  -32.007 13.931 1.00 33.22 ? 299 LEU A CB    1 
ATOM   485  C CG    . LEU A 1 91  ? -1.278  -32.067 13.534 1.00 33.33 ? 299 LEU A CG    1 
ATOM   486  C CD1   . LEU A 1 91  ? -1.118  -32.909 12.371 1.00 32.91 ? 299 LEU A CD1   1 
ATOM   487  C CD2   . LEU A 1 91  ? -0.764  -30.703 13.170 1.00 35.40 ? 299 LEU A CD2   1 
ATOM   488  N N     . GLY A 1 92  ? -4.767  -33.293 16.501 1.00 32.33 ? 300 GLY A N     1 
ATOM   489  C CA    . GLY A 1 92  ? -5.856  -32.989 17.428 1.00 31.93 ? 300 GLY A CA    1 
ATOM   490  C C     . GLY A 1 92  ? -5.466  -31.737 18.190 1.00 31.13 ? 300 GLY A C     1 
ATOM   491  O O     . GLY A 1 92  ? -4.458  -31.705 18.861 1.00 30.14 ? 300 GLY A O     1 
ATOM   492  N N     . VAL A 1 93  ? -6.255  -30.688 18.023 1.00 30.69 ? 301 VAL A N     1 
ATOM   493  C CA    . VAL A 1 93  ? -5.958  -29.417 18.661 1.00 31.11 ? 301 VAL A CA    1 
ATOM   494  C C     . VAL A 1 93  ? -7.073  -29.090 19.641 1.00 31.93 ? 301 VAL A C     1 
ATOM   495  O O     . VAL A 1 93  ? -8.273  -29.138 19.284 1.00 32.43 ? 301 VAL A O     1 
ATOM   496  C CB    . VAL A 1 93  ? -5.754  -28.288 17.609 1.00 30.77 ? 301 VAL A CB    1 
ATOM   497  C CG1   . VAL A 1 93  ? -5.600  -26.901 18.269 1.00 30.63 ? 301 VAL A CG1   1 
ATOM   498  C CG2   . VAL A 1 93  ? -4.523  -28.625 16.675 1.00 32.30 ? 301 VAL A CG2   1 
ATOM   499  N N     . ASP A 1 94  ? -6.680  -28.770 20.870 1.00 32.48 ? 302 ASP A N     1 
ATOM   500  C CA    . ASP A 1 94  ? -7.634  -28.273 21.865 1.00 33.54 ? 302 ASP A CA    1 
ATOM   501  C C     . ASP A 1 94  ? -6.991  -27.268 22.822 1.00 34.01 ? 302 ASP A C     1 
ATOM   502  O O     . ASP A 1 94  ? -5.854  -27.430 23.263 1.00 34.55 ? 302 ASP A O     1 
ATOM   503  C CB    . ASP A 1 94  ? -8.293  -29.430 22.625 1.00 33.28 ? 302 ASP A CB    1 
ATOM   504  C CG    . ASP A 1 94  ? -9.675  -29.082 23.110 1.00 35.31 ? 302 ASP A CG    1 
ATOM   505  O OD1   . ASP A 1 94  ? -9.767  -28.113 23.901 1.00 35.39 ? 302 ASP A OD1   1 
ATOM   506  O OD2   . ASP A 1 94  ? -10.657 -29.760 22.712 1.00 32.24 ? 302 ASP A OD2   1 
ATOM   507  N N     . GLN A 1 95  ? -7.733  -26.202 23.105 1.00 34.75 ? 303 GLN A N     1 
ATOM   508  C CA    . GLN A 1 95  ? -7.301  -25.136 24.021 1.00 36.06 ? 303 GLN A CA    1 
ATOM   509  C C     . GLN A 1 95  ? -7.481  -25.569 25.501 1.00 35.13 ? 303 GLN A C     1 
ATOM   510  O O     . GLN A 1 95  ? -6.749  -25.128 26.395 1.00 35.17 ? 303 GLN A O     1 
ATOM   511  C CB    . GLN A 1 95  ? -8.139  -23.875 23.754 1.00 35.18 ? 303 GLN A CB    1 
ATOM   512  C CG    . GLN A 1 95  ? -9.651  -24.200 23.920 1.00 39.34 ? 303 GLN A CG    1 
ATOM   513  C CD    . GLN A 1 95  ? -10.617 -23.010 24.007 1.00 40.28 ? 303 GLN A CD    1 
ATOM   514  O OE1   . GLN A 1 95  ? -11.611 -23.082 24.735 1.00 46.29 ? 303 GLN A OE1   1 
ATOM   515  N NE2   . GLN A 1 95  ? -10.359 -21.948 23.248 1.00 46.17 ? 303 GLN A NE2   1 
ATOM   516  N N     . SER A 1 96  ? -8.468  -26.418 25.748 1.00 33.74 ? 304 SER A N     1 
ATOM   517  C CA    . SER A 1 96  ? -8.809  -26.830 27.089 1.00 33.85 ? 304 SER A CA    1 
ATOM   518  C C     . SER A 1 96  ? -7.843  -27.909 27.659 1.00 33.54 ? 304 SER A C     1 
ATOM   519  O O     . SER A 1 96  ? -7.097  -28.562 26.905 1.00 32.24 ? 304 SER A O     1 
ATOM   520  C CB    . SER A 1 96  ? -10.271 -27.294 27.082 1.00 34.58 ? 304 SER A CB    1 
ATOM   521  O OG    . SER A 1 96  ? -10.508 -28.335 28.010 1.00 36.39 ? 304 SER A OG    1 
ATOM   522  N N     . GLU A 1 97  ? -7.886  -28.093 28.985 1.00 32.76 ? 305 GLU A N     1 
ATOM   523  C CA    . GLU A 1 97  ? -7.068  -29.077 29.701 1.00 32.97 ? 305 GLU A CA    1 
ATOM   524  C C     . GLU A 1 97  ? -7.467  -30.499 29.344 1.00 31.61 ? 305 GLU A C     1 
ATOM   525  O O     . GLU A 1 97  ? -6.723  -31.448 29.602 1.00 30.15 ? 305 GLU A O     1 
ATOM   526  C CB    . GLU A 1 97  ? -7.228  -28.929 31.217 1.00 34.14 ? 305 GLU A CB    1 
ATOM   527  C CG    . GLU A 1 97  ? -6.910  -27.549 31.775 1.00 41.52 ? 305 GLU A CG    1 
ATOM   528  C CD    . GLU A 1 97  ? -5.439  -27.257 31.712 1.00 49.60 ? 305 GLU A CD    1 
ATOM   529  O OE1   . GLU A 1 97  ? -4.934  -27.041 30.584 1.00 53.76 ? 305 GLU A OE1   1 
ATOM   530  O OE2   . GLU A 1 97  ? -4.794  -27.249 32.791 1.00 53.55 ? 305 GLU A OE2   1 
ATOM   531  N N     . ILE A 1 98  ? -8.656  -30.647 28.773 1.00 31.61 ? 306 ILE A N     1 
ATOM   532  C CA    . ILE A 1 98  ? -9.065  -31.955 28.216 1.00 31.02 ? 306 ILE A CA    1 
ATOM   533  C C     . ILE A 1 98  ? -7.995  -32.546 27.240 1.00 32.01 ? 306 ILE A C     1 
ATOM   534  O O     . ILE A 1 98  ? -7.878  -33.771 27.084 1.00 31.68 ? 306 ILE A O     1 
ATOM   535  C CB    . ILE A 1 98  ? -10.423 -31.874 27.506 1.00 31.51 ? 306 ILE A CB    1 
ATOM   536  C CG1   . ILE A 1 98  ? -11.028 -33.286 27.373 1.00 30.70 ? 306 ILE A CG1   1 
ATOM   537  C CG2   . ILE A 1 98  ? -10.266 -31.201 26.103 1.00 29.21 ? 306 ILE A CG2   1 
ATOM   538  C CD1   . ILE A 1 98  ? -11.333 -33.969 28.749 1.00 32.14 ? 306 ILE A CD1   1 
ATOM   539  N N     . LEU A 1 99  ? -7.240  -31.667 26.579 1.00 31.96 ? 307 LEU A N     1 
ATOM   540  C CA    . LEU A 1 99  ? -6.161  -32.115 25.679 1.00 32.53 ? 307 LEU A CA    1 
ATOM   541  C C     . LEU A 1 99  ? -5.191  -33.141 26.323 1.00 31.61 ? 307 LEU A C     1 
ATOM   542  O O     . LEU A 1 99  ? -4.728  -34.056 25.664 1.00 30.24 ? 307 LEU A O     1 
ATOM   543  C CB    . LEU A 1 99  ? -5.331  -30.935 25.169 1.00 32.24 ? 307 LEU A CB    1 
ATOM   544  C CG    . LEU A 1 99  ? -4.496  -31.643 24.093 1.00 35.54 ? 307 LEU A CG    1 
ATOM   545  C CD1   . LEU A 1 99  ? -5.076  -31.460 22.693 1.00 33.91 ? 307 LEU A CD1   1 
ATOM   546  C CD2   . LEU A 1 99  ? -2.987  -31.439 24.195 1.00 31.39 ? 307 LEU A CD2   1 
ATOM   547  N N     . TYR A 1 100 ? -4.897  -32.965 27.609 1.00 32.20 ? 308 TYR A N     1 
ATOM   548  C CA    . TYR A 1 100 ? -3.983  -33.860 28.349 1.00 32.11 ? 308 TYR A CA    1 
ATOM   549  C C     . TYR A 1 100 ? -4.574  -35.257 28.525 1.00 32.38 ? 308 TYR A C     1 
ATOM   550  O O     . TYR A 1 100 ? -3.859  -36.272 28.445 1.00 31.12 ? 308 TYR A O     1 
ATOM   551  C CB    . TYR A 1 100 ? -3.648  -33.245 29.724 1.00 34.34 ? 308 TYR A CB    1 
ATOM   552  C CG    . TYR A 1 100 ? -3.065  -31.840 29.670 1.00 36.47 ? 308 TYR A CG    1 
ATOM   553  C CD1   . TYR A 1 100 ? -3.496  -30.835 30.550 1.00 39.39 ? 308 TYR A CD1   1 
ATOM   554  C CD2   . TYR A 1 100 ? -2.090  -31.512 28.733 1.00 40.05 ? 308 TYR A CD2   1 
ATOM   555  C CE1   . TYR A 1 100 ? -2.940  -29.542 30.501 1.00 39.47 ? 308 TYR A CE1   1 
ATOM   556  C CE2   . TYR A 1 100 ? -1.537  -30.223 28.670 1.00 40.55 ? 308 TYR A CE2   1 
ATOM   557  C CZ    . TYR A 1 100 ? -1.963  -29.248 29.550 1.00 39.90 ? 308 TYR A CZ    1 
ATOM   558  O OH    . TYR A 1 100 ? -1.403  -27.983 29.454 1.00 38.64 ? 308 TYR A OH    1 
ATOM   559  N N     . GLN A 1 101 ? -5.882  -35.322 28.783 1.00 30.93 ? 309 GLN A N     1 
ATOM   560  C CA    . GLN A 1 101 ? -6.556  -36.620 28.737 1.00 31.93 ? 309 GLN A CA    1 
ATOM   561  C C     . GLN A 1 101 ? -6.463  -37.243 27.358 1.00 31.28 ? 309 GLN A C     1 
ATOM   562  O O     . GLN A 1 101 ? -6.229  -38.442 27.257 1.00 32.17 ? 309 GLN A O     1 
ATOM   563  C CB    . GLN A 1 101 ? -8.026  -36.495 29.153 1.00 30.40 ? 309 GLN A CB    1 
ATOM   564  C CG    . GLN A 1 101 ? -8.169  -36.394 30.668 1.00 34.20 ? 309 GLN A CG    1 
ATOM   565  C CD    . GLN A 1 101 ? -7.922  -37.734 31.362 1.00 38.08 ? 309 GLN A CD    1 
ATOM   566  O OE1   . GLN A 1 101 ? -7.948  -38.793 30.737 1.00 39.95 ? 309 GLN A OE1   1 
ATOM   567  N NE2   . GLN A 1 101 ? -7.712  -37.685 32.670 1.00 42.71 ? 309 GLN A NE2   1 
ATOM   568  N N     . ALA A 1 102 ? -6.626  -36.421 26.318 1.00 30.94 ? 310 ALA A N     1 
ATOM   569  C CA    . ALA A 1 102 ? -6.560  -36.916 24.941 1.00 31.02 ? 310 ALA A CA    1 
ATOM   570  C C     . ALA A 1 102 ? -5.227  -37.588 24.680 1.00 31.07 ? 310 ALA A C     1 
ATOM   571  O O     . ALA A 1 102 ? -5.178  -38.626 24.054 1.00 30.17 ? 310 ALA A O     1 
ATOM   572  C CB    . ALA A 1 102 ? -6.821  -35.837 23.937 1.00 30.24 ? 310 ALA A CB    1 
ATOM   573  N N     . MET A 1 103 ? -4.154  -36.976 25.172 1.00 31.94 ? 311 MET A N     1 
ATOM   574  C CA    . MET A 1 103 ? -2.828  -37.524 25.035 1.00 33.77 ? 311 MET A CA    1 
ATOM   575  C C     . MET A 1 103 ? -2.738  -38.938 25.589 1.00 32.86 ? 311 MET A C     1 
ATOM   576  O O     . MET A 1 103 ? -2.230  -39.829 24.907 1.00 33.27 ? 311 MET A O     1 
ATOM   577  C CB    . MET A 1 103 ? -1.787  -36.630 25.736 1.00 32.72 ? 311 MET A CB    1 
ATOM   578  C CG    . MET A 1 103 ? -1.697  -35.272 25.158 1.00 34.70 ? 311 MET A CG    1 
ATOM   579  S SD    . MET A 1 103 ? -0.511  -34.204 26.037 1.00 39.08 ? 311 MET A SD    1 
ATOM   580  C CE    . MET A 1 103 ? 0.994   -35.127 25.738 1.00 36.08 ? 311 MET A CE    1 
ATOM   581  N N     . ASP A 1 104 ? -3.223  -39.118 26.825 1.00 32.91 ? 312 ASP A N     1 
ATOM   582  C CA    . ASP A 1 104 ? -3.241  -40.404 27.510 1.00 33.28 ? 312 ASP A CA    1 
ATOM   583  C C     . ASP A 1 104 ? -4.189  -41.388 26.829 1.00 31.44 ? 312 ASP A C     1 
ATOM   584  O O     . ASP A 1 104 ? -3.884  -42.582 26.694 1.00 30.94 ? 312 ASP A O     1 
ATOM   585  C CB    . ASP A 1 104 ? -3.740  -40.239 28.962 1.00 34.56 ? 312 ASP A CB    1 
ATOM   586  C CG    . ASP A 1 104 ? -2.641  -40.034 29.954 1.00 37.97 ? 312 ASP A CG    1 
ATOM   587  O OD1   . ASP A 1 104 ? -1.472  -40.378 29.690 1.00 44.93 ? 312 ASP A OD1   1 
ATOM   588  O OD2   . ASP A 1 104 ? -2.960  -39.525 31.043 1.00 41.52 ? 312 ASP A OD2   1 
ATOM   589  N N     . ILE A 1 105 ? -5.353  -40.897 26.433 1.00 30.46 ? 313 ILE A N     1 
ATOM   590  C CA    . ILE A 1 105 ? -6.323  -41.716 25.675 1.00 29.59 ? 313 ILE A CA    1 
ATOM   591  C C     . ILE A 1 105 ? -5.702  -42.254 24.372 1.00 28.93 ? 313 ILE A C     1 
ATOM   592  O O     . ILE A 1 105 ? -5.810  -43.440 24.036 1.00 28.36 ? 313 ILE A O     1 
ATOM   593  C CB    . ILE A 1 105 ? -7.629  -40.882 25.354 1.00 29.87 ? 313 ILE A CB    1 
ATOM   594  C CG1   . ILE A 1 105 ? -8.376  -40.613 26.663 1.00 28.33 ? 313 ILE A CG1   1 
ATOM   595  C CG2   . ILE A 1 105 ? -8.513  -41.630 24.335 1.00 29.77 ? 313 ILE A CG2   1 
ATOM   596  C CD1   . ILE A 1 105 ? -9.535  -39.651 26.579 1.00 30.34 ? 313 ILE A CD1   1 
ATOM   597  N N     . ILE A 1 106 ? -5.090  -41.367 23.611 1.00 30.05 ? 314 ILE A N     1 
ATOM   598  C CA    . ILE A 1 106 ? -4.481  -41.764 22.355 1.00 29.45 ? 314 ILE A CA    1 
ATOM   599  C C     . ILE A 1 106 ? -3.396  -42.863 22.593 1.00 30.67 ? 314 ILE A C     1 
ATOM   600  O O     . ILE A 1 106 ? -3.323  -43.821 21.839 1.00 30.55 ? 314 ILE A O     1 
ATOM   601  C CB    . ILE A 1 106 ? -3.969  -40.521 21.537 1.00 28.62 ? 314 ILE A CB    1 
ATOM   602  C CG1   . ILE A 1 106 ? -5.060  -40.018 20.561 1.00 24.97 ? 314 ILE A CG1   1 
ATOM   603  C CG2   . ILE A 1 106 ? -2.662  -40.905 20.712 1.00 29.53 ? 314 ILE A CG2   1 
ATOM   604  C CD1   . ILE A 1 106 ? -6.390  -39.621 21.230 1.00 26.60 ? 314 ILE A CD1   1 
ATOM   605  N N     . ARG A 1 107 ? -2.606  -42.737 23.657 1.00 31.78 ? 315 ARG A N     1 
ATOM   606  C CA    . ARG A 1 107 ? -1.554  -43.723 23.997 1.00 32.69 ? 315 ARG A CA    1 
ATOM   607  C C     . ARG A 1 107 ? -2.140  -45.042 24.441 1.00 32.86 ? 315 ARG A C     1 
ATOM   608  O O     . ARG A 1 107 ? -1.653  -46.110 24.046 1.00 32.10 ? 315 ARG A O     1 
ATOM   609  C CB    . ARG A 1 107 ? -0.645  -43.250 25.105 1.00 34.01 ? 315 ARG A CB    1 
ATOM   610  C CG    . ARG A 1 107 ? 0.284   -42.172 24.741 1.00 40.58 ? 315 ARG A CG    1 
ATOM   611  C CD    . ARG A 1 107 ? 1.484   -42.096 25.736 1.00 46.79 ? 315 ARG A CD    1 
ATOM   612  N NE    . ARG A 1 107 ? 2.424   -43.185 25.491 1.00 51.51 ? 315 ARG A NE    1 
ATOM   613  C CZ    . ARG A 1 107 ? 3.549   -43.075 24.786 1.00 51.37 ? 315 ARG A CZ    1 
ATOM   614  N NH1   . ARG A 1 107 ? 3.924   -41.904 24.276 1.00 52.20 ? 315 ARG A NH1   1 
ATOM   615  N NH2   . ARG A 1 107 ? 4.312   -44.145 24.614 1.00 51.22 ? 315 ARG A NH2   1 
ATOM   616  N N     . LEU A 1 108 ? -3.203  -44.967 25.246 1.00 31.61 ? 316 LEU A N     1 
ATOM   617  C CA    . LEU A 1 108 ? -3.920  -46.148 25.696 1.00 31.71 ? 316 LEU A CA    1 
ATOM   618  C C     . LEU A 1 108 ? -4.372  -47.018 24.527 1.00 30.71 ? 316 LEU A C     1 
ATOM   619  O O     . LEU A 1 108 ? -4.326  -48.216 24.610 1.00 30.34 ? 316 LEU A O     1 
ATOM   620  C CB    . LEU A 1 108 ? -5.138  -45.709 26.545 1.00 32.20 ? 316 LEU A CB    1 
ATOM   621  C CG    . LEU A 1 108 ? -5.684  -46.581 27.664 1.00 33.71 ? 316 LEU A CG    1 
ATOM   622  C CD1   . LEU A 1 108 ? -4.552  -47.260 28.530 1.00 33.53 ? 316 LEU A CD1   1 
ATOM   623  C CD2   . LEU A 1 108 ? -6.745  -45.842 28.536 1.00 31.50 ? 316 LEU A CD2   1 
ATOM   624  N N     . ASN A 1 109 ? -4.804  -46.383 23.432 1.00 30.57 ? 317 ASN A N     1 
ATOM   625  C CA    . ASN A 1 109 ? -5.212  -47.048 22.208 1.00 30.33 ? 317 ASN A CA    1 
ATOM   626  C C     . ASN A 1 109 ? -4.087  -47.282 21.205 1.00 30.36 ? 317 ASN A C     1 
ATOM   627  O O     . ASN A 1 109 ? -4.340  -47.750 20.101 1.00 29.48 ? 317 ASN A O     1 
ATOM   628  C CB    . ASN A 1 109 ? -6.370  -46.274 21.550 1.00 30.33 ? 317 ASN A CB    1 
ATOM   629  C CG    . ASN A 1 109 ? -7.600  -46.280 22.425 1.00 29.16 ? 317 ASN A CG    1 
ATOM   630  O OD1   . ASN A 1 109 ? -8.342  -47.253 22.426 1.00 27.29 ? 317 ASN A OD1   1 
ATOM   631  N ND2   . ASN A 1 109 ? -7.767  -45.244 23.246 1.00 21.67 ? 317 ASN A ND2   1 
ATOM   632  N N     . LYS A 1 110 ? -2.849  -46.973 21.606 1.00 30.23 ? 318 LYS A N     1 
ATOM   633  C CA    . LYS A 1 110 ? -1.666  -47.261 20.773 1.00 30.45 ? 318 LYS A CA    1 
ATOM   634  C C     . LYS A 1 110 ? -1.717  -46.565 19.420 1.00 29.36 ? 318 LYS A C     1 
ATOM   635  O O     . LYS A 1 110 ? -1.365  -47.157 18.379 1.00 28.34 ? 318 LYS A O     1 
ATOM   636  C CB    . LYS A 1 110 ? -1.515  -48.780 20.592 1.00 30.75 ? 318 LYS A CB    1 
ATOM   637  C CG    . LYS A 1 110 ? -1.519  -49.514 21.913 1.00 34.99 ? 318 LYS A CG    1 
ATOM   638  C CD    . LYS A 1 110 ? -0.819  -50.852 21.834 1.00 41.76 ? 318 LYS A CD    1 
ATOM   639  C CE    . LYS A 1 110 ? -0.501  -51.338 23.242 1.00 47.00 ? 318 LYS A CE    1 
ATOM   640  N NZ    . LYS A 1 110 ? -1.710  -51.943 23.886 1.00 50.64 ? 318 LYS A NZ    1 
ATOM   641  N N     . LEU A 1 111 ? -2.148  -45.308 19.443 1.00 27.74 ? 319 LEU A N     1 
ATOM   642  C CA    . LEU A 1 111 ? -2.360  -44.546 18.222 1.00 27.33 ? 319 LEU A CA    1 
ATOM   643  C C     . LEU A 1 111 ? -1.406  -43.362 18.172 1.00 27.62 ? 319 LEU A C     1 
ATOM   644  O O     . LEU A 1 111 ? -1.518  -42.510 17.307 1.00 27.21 ? 319 LEU A O     1 
ATOM   645  C CB    . LEU A 1 111 ? -3.825  -44.068 18.113 1.00 27.07 ? 319 LEU A CB    1 
ATOM   646  C CG    . LEU A 1 111 ? -4.822  -45.197 17.839 1.00 26.22 ? 319 LEU A CG    1 
ATOM   647  C CD1   . LEU A 1 111 ? -6.288  -44.765 17.938 1.00 24.00 ? 319 LEU A CD1   1 
ATOM   648  C CD2   . LEU A 1 111 ? -4.502  -45.817 16.455 1.00 25.58 ? 319 LEU A CD2   1 
ATOM   649  N N     . GLU A 1 112 ? -0.478  -43.319 19.116 1.00 27.52 ? 320 GLU A N     1 
ATOM   650  C CA    . GLU A 1 112 ? 0.486   -42.211 19.217 1.00 28.57 ? 320 GLU A CA    1 
ATOM   651  C C     . GLU A 1 112 ? 1.457   -42.082 18.027 1.00 29.00 ? 320 GLU A C     1 
ATOM   652  O O     . GLU A 1 112 ? 2.072   -41.017 17.837 1.00 29.26 ? 320 GLU A O     1 
ATOM   653  C CB    . GLU A 1 112 ? 1.217   -42.216 20.590 1.00 28.02 ? 320 GLU A CB    1 
ATOM   654  C CG    . GLU A 1 112 ? 2.224   -43.335 20.806 1.00 27.64 ? 320 GLU A CG    1 
ATOM   655  C CD    . GLU A 1 112 ? 1.597   -44.665 21.249 1.00 30.85 ? 320 GLU A CD    1 
ATOM   656  O OE1   . GLU A 1 112 ? 0.369   -44.832 21.194 1.00 30.65 ? 320 GLU A OE1   1 
ATOM   657  O OE2   . GLU A 1 112 ? 2.336   -45.548 21.699 1.00 34.71 ? 320 GLU A OE2   1 
ATOM   658  N N     . ASP A 1 113 ? 1.619   -43.142 17.223 1.00 28.37 ? 321 ASP A N     1 
ATOM   659  C CA    . ASP A 1 113 ? 2.421   -43.004 15.996 1.00 28.20 ? 321 ASP A CA    1 
ATOM   660  C C     . ASP A 1 113 ? 1.651   -42.365 14.809 1.00 28.19 ? 321 ASP A C     1 
ATOM   661  O O     . ASP A 1 113 ? 2.235   -42.141 13.744 1.00 28.53 ? 321 ASP A O     1 
ATOM   662  C CB    . ASP A 1 113 ? 3.162   -44.320 15.628 1.00 28.24 ? 321 ASP A CB    1 
ATOM   663  C CG    . ASP A 1 113 ? 4.214   -44.704 16.661 1.00 29.17 ? 321 ASP A CG    1 
ATOM   664  O OD1   . ASP A 1 113 ? 4.595   -45.882 16.700 1.00 33.46 ? 321 ASP A OD1   1 
ATOM   665  O OD2   . ASP A 1 113 ? 4.694   -43.828 17.429 1.00 32.88 ? 321 ASP A OD2   1 
ATOM   666  N N     . THR A 1 114 ? 0.389   -41.985 15.021 1.00 28.26 ? 322 THR A N     1 
ATOM   667  C CA    . THR A 1 114 ? -0.451  -41.385 13.946 1.00 29.14 ? 322 THR A CA    1 
ATOM   668  C C     . THR A 1 114 ? -1.069  -40.072 14.412 1.00 29.09 ? 322 THR A C     1 
ATOM   669  O O     . THR A 1 114 ? -1.175  -39.132 13.652 1.00 30.78 ? 322 THR A O     1 
ATOM   670  C CB    . THR A 1 114 ? -1.607  -42.356 13.554 1.00 29.64 ? 322 THR A CB    1 
ATOM   671  O OG1   . THR A 1 114 ? -1.033  -43.558 13.038 1.00 32.03 ? 322 THR A OG1   1 
ATOM   672  C CG2   . THR A 1 114 ? -2.587  -41.756 12.544 1.00 28.96 ? 322 THR A CG2   1 
ATOM   673  N N     . ILE A 1 115 ? -1.467  -40.013 15.677 1.00 27.29 ? 323 ILE A N     1 
ATOM   674  C CA    . ILE A 1 115 ? -2.210  -38.861 16.167 1.00 28.13 ? 323 ILE A CA    1 
ATOM   675  C C     . ILE A 1 115 ? -1.293  -38.064 17.071 1.00 28.11 ? 323 ILE A C     1 
ATOM   676  O O     . ILE A 1 115 ? -0.784  -38.588 18.066 1.00 28.07 ? 323 ILE A O     1 
ATOM   677  C CB    . ILE A 1 115 ? -3.442  -39.244 16.996 1.00 26.50 ? 323 ILE A CB    1 
ATOM   678  C CG1   . ILE A 1 115 ? -4.352  -40.187 16.194 1.00 28.07 ? 323 ILE A CG1   1 
ATOM   679  C CG2   . ILE A 1 115 ? -4.168  -37.944 17.479 1.00 26.55 ? 323 ILE A CG2   1 
ATOM   680  C CD1   . ILE A 1 115 ? -5.512  -40.793 17.005 1.00 28.49 ? 323 ILE A CD1   1 
ATOM   681  N N     A THR A 1 116 ? -1.102  -36.801 16.702 0.50 28.59 ? 324 THR A N     1 
ATOM   682  N N     B THR A 1 116 ? -1.084  -36.794 16.741 0.50 29.09 ? 324 THR A N     1 
ATOM   683  C CA    A THR A 1 116 ? -0.409  -35.838 17.542 0.50 28.68 ? 324 THR A CA    1 
ATOM   684  C CA    B THR A 1 116 ? -0.299  -35.922 17.614 0.50 29.58 ? 324 THR A CA    1 
ATOM   685  C C     A THR A 1 116 ? -1.428  -34.918 18.231 0.50 29.16 ? 324 THR A C     1 
ATOM   686  C C     B THR A 1 116 ? -1.196  -34.784 18.176 0.50 29.86 ? 324 THR A C     1 
ATOM   687  O O     A THR A 1 116 ? -2.410  -34.473 17.615 0.50 29.17 ? 324 THR A O     1 
ATOM   688  O O     B THR A 1 116 ? -1.895  -34.096 17.417 0.50 30.05 ? 324 THR A O     1 
ATOM   689  C CB    A THR A 1 116 ? 0.563   -34.955 16.727 0.50 29.47 ? 324 THR A CB    1 
ATOM   690  C CB    B THR A 1 116 ? 1.022   -35.416 16.921 0.50 30.76 ? 324 THR A CB    1 
ATOM   691  O OG1   A THR A 1 116 ? 1.240   -35.746 15.737 0.50 30.52 ? 324 THR A OG1   1 
ATOM   692  O OG1   B THR A 1 116 ? 0.839   -34.118 16.352 0.50 31.22 ? 324 THR A OG1   1 
ATOM   693  C CG2   A THR A 1 116 ? 1.590   -34.322 17.657 0.50 26.42 ? 324 THR A CG2   1 
ATOM   694  C CG2   B THR A 1 116 ? 1.489   -36.376 15.803 0.50 30.27 ? 324 THR A CG2   1 
ATOM   695  N N     . LEU A 1 117 ? -1.186  -34.622 19.506 1.00 28.86 ? 325 LEU A N     1 
ATOM   696  C CA    . LEU A 1 117 ? -2.016  -33.663 20.204 1.00 30.62 ? 325 LEU A CA    1 
ATOM   697  C C     . LEU A 1 117 ? -1.290  -32.357 20.439 1.00 31.06 ? 325 LEU A C     1 
ATOM   698  O O     . LEU A 1 117 ? -0.117  -32.332 20.863 1.00 29.34 ? 325 LEU A O     1 
ATOM   699  C CB    . LEU A 1 117 ? -2.578  -34.245 21.505 1.00 30.29 ? 325 LEU A CB    1 
ATOM   700  C CG    . LEU A 1 117 ? -3.314  -35.515 21.041 1.00 33.93 ? 325 LEU A CG    1 
ATOM   701  C CD1   . LEU A 1 117 ? -3.138  -36.592 21.980 1.00 36.14 ? 325 LEU A CD1   1 
ATOM   702  C CD2   . LEU A 1 117 ? -4.776  -35.283 20.623 1.00 32.45 ? 325 LEU A CD2   1 
ATOM   703  N N     A ILE A 1 118 ? -2.016  -31.273 20.169 0.50 30.97 ? 326 ILE A N     1 
ATOM   704  N N     B ILE A 1 118 ? -1.999  -31.268 20.154 0.50 31.15 ? 326 ILE A N     1 
ATOM   705  C CA    A ILE A 1 118 ? -1.502  -29.908 20.261 0.50 30.67 ? 326 ILE A CA    1 
ATOM   706  C CA    B ILE A 1 118 ? -1.462  -29.919 20.291 0.50 30.95 ? 326 ILE A CA    1 
ATOM   707  C C     A ILE A 1 118 ? -2.411  -29.084 21.181 0.50 31.14 ? 326 ILE A C     1 
ATOM   708  C C     B ILE A 1 118 ? -2.397  -29.081 21.172 0.50 31.33 ? 326 ILE A C     1 
ATOM   709  O O     A ILE A 1 118 ? -3.632  -29.046 20.984 0.50 30.39 ? 326 ILE A O     1 
ATOM   710  O O     B ILE A 1 118 ? -3.611  -29.035 20.945 0.50 30.55 ? 326 ILE A O     1 
ATOM   711  C CB    A ILE A 1 118 ? -1.452  -29.233 18.860 0.50 30.68 ? 326 ILE A CB    1 
ATOM   712  C CB    B ILE A 1 118 ? -1.268  -29.251 18.909 0.50 31.29 ? 326 ILE A CB    1 
ATOM   713  C CG1   A ILE A 1 118 ? -0.681  -30.098 17.852 0.50 30.97 ? 326 ILE A CG1   1 
ATOM   714  C CG1   B ILE A 1 118 ? -0.038  -29.839 18.204 0.50 31.64 ? 326 ILE A CG1   1 
ATOM   715  C CG2   A ILE A 1 118 ? -0.840  -27.786 18.935 0.50 30.01 ? 326 ILE A CG2   1 
ATOM   716  C CG2   B ILE A 1 118 ? -1.085  -27.701 19.040 0.50 30.50 ? 326 ILE A CG2   1 
ATOM   717  C CD1   A ILE A 1 118 ? 0.784   -30.347 18.216 0.50 29.82 ? 326 ILE A CD1   1 
ATOM   718  C CD1   B ILE A 1 118 ? -0.119  -29.773 16.705 0.50 33.14 ? 326 ILE A CD1   1 
ATOM   719  N N     . LYS A 1 119 ? -1.802  -28.435 22.174 1.00 31.22 ? 327 LYS A N     1 
ATOM   720  C CA    . LYS A 1 119 ? -2.518  -27.681 23.187 1.00 32.39 ? 327 LYS A CA    1 
ATOM   721  C C     . LYS A 1 119 ? -2.537  -26.190 22.806 1.00 32.63 ? 327 LYS A C     1 
ATOM   722  O O     . LYS A 1 119 ? -1.484  -25.592 22.620 1.00 33.13 ? 327 LYS A O     1 
ATOM   723  C CB    . LYS A 1 119 ? -1.775  -27.873 24.507 1.00 32.03 ? 327 LYS A CB    1 
ATOM   724  C CG    . LYS A 1 119 ? -2.607  -28.041 25.775 1.00 34.98 ? 327 LYS A CG    1 
ATOM   725  C CD    . LYS A 1 119 ? -3.542  -26.917 25.979 1.00 32.53 ? 327 LYS A CD    1 
ATOM   726  C CE    . LYS A 1 119 ? -3.925  -26.755 27.440 1.00 35.74 ? 327 LYS A CE    1 
ATOM   727  N NZ    . LYS A 1 119 ? -4.110  -25.291 27.649 1.00 34.50 ? 327 LYS A NZ    1 
ATOM   728  N N     . GLY A 1 120 ? -3.726  -25.597 22.687 1.00 33.87 ? 328 GLY A N     1 
ATOM   729  C CA    . GLY A 1 120 ? -3.821  -24.178 22.279 1.00 34.16 ? 328 GLY A CA    1 
ATOM   730  C C     . GLY A 1 120 ? -5.038  -23.901 21.412 1.00 35.42 ? 328 GLY A C     1 
ATOM   731  O O     . GLY A 1 120 ? -5.767  -24.840 20.988 1.00 33.51 ? 328 GLY A O     1 
ATOM   732  N N     . LYS A 1 121 ? -5.292  -22.605 21.187 1.00 35.35 ? 329 LYS A N     1 
ATOM   733  C CA    . LYS A 1 121 ? -6.398  -22.182 20.341 1.00 36.86 ? 329 LYS A CA    1 
ATOM   734  C C     . LYS A 1 121 ? -5.995  -22.378 18.884 1.00 36.47 ? 329 LYS A C     1 
ATOM   735  O O     . LYS A 1 121 ? -4.905  -22.007 18.498 1.00 36.95 ? 329 LYS A O     1 
ATOM   736  C CB    . LYS A 1 121 ? -6.772  -20.704 20.624 1.00 36.74 ? 329 LYS A CB    1 
ATOM   737  C CG    . LYS A 1 121 ? -7.442  -20.493 22.000 1.00 38.58 ? 329 LYS A CG    1 
ATOM   738  C CD    . LYS A 1 121 ? -7.689  -18.993 22.285 1.00 40.02 ? 329 LYS A CD    1 
ATOM   739  C CE    . LYS A 1 121 ? -9.162  -18.596 22.125 1.00 45.78 ? 329 LYS A CE    1 
ATOM   740  N NZ    . LYS A 1 121 ? -9.625  -18.667 20.676 1.00 50.26 ? 329 LYS A NZ    1 
ATOM   741  N N     . ILE A 1 122 ? -6.868  -22.962 18.067 1.00 37.05 ? 330 ILE A N     1 
ATOM   742  C CA    . ILE A 1 122 ? -6.546  -23.176 16.645 1.00 37.80 ? 330 ILE A CA    1 
ATOM   743  C C     . ILE A 1 122 ? -6.128  -21.885 15.934 1.00 38.82 ? 330 ILE A C     1 
ATOM   744  O O     . ILE A 1 122 ? -5.345  -21.916 14.986 1.00 39.58 ? 330 ILE A O     1 
ATOM   745  C CB    . ILE A 1 122 ? -7.710  -23.827 15.850 1.00 37.36 ? 330 ILE A CB    1 
ATOM   746  C CG1   . ILE A 1 122 ? -7.206  -24.344 14.487 1.00 37.77 ? 330 ILE A CG1   1 
ATOM   747  C CG2   . ILE A 1 122 ? -8.891  -22.825 15.662 1.00 37.09 ? 330 ILE A CG2   1 
ATOM   748  C CD1   . ILE A 1 122 ? -5.910  -25.256 14.531 1.00 38.43 ? 330 ILE A CD1   1 
ATOM   749  N N     . GLU A 1 123 ? -6.667  -20.750 16.370 1.00 39.89 ? 331 GLU A N     1 
ATOM   750  C CA    . GLU A 1 123 ? -6.321  -19.492 15.703 1.00 40.76 ? 331 GLU A CA    1 
ATOM   751  C C     . GLU A 1 123 ? -5.022  -18.870 16.188 1.00 41.79 ? 331 GLU A C     1 
ATOM   752  O O     . GLU A 1 123 ? -4.633  -17.812 15.681 1.00 41.47 ? 331 GLU A O     1 
ATOM   753  C CB    . GLU A 1 123 ? -7.485  -18.481 15.629 1.00 40.69 ? 331 GLU A CB    1 
ATOM   754  C CG    . GLU A 1 123 ? -8.218  -18.192 16.871 1.00 41.22 ? 331 GLU A CG    1 
ATOM   755  C CD    . GLU A 1 123 ? -9.207  -19.284 17.241 1.00 41.18 ? 331 GLU A CD    1 
ATOM   756  O OE1   . GLU A 1 123 ? -10.392 -19.216 16.856 1.00 43.49 ? 331 GLU A OE1   1 
ATOM   757  O OE2   . GLU A 1 123 ? -8.790  -20.194 17.968 1.00 40.76 ? 331 GLU A OE2   1 
ATOM   758  N N     . GLU A 1 124 ? -4.334  -19.535 17.122 1.00 42.52 ? 332 GLU A N     1 
ATOM   759  C CA    . GLU A 1 124 ? -3.013  -19.059 17.527 1.00 44.06 ? 332 GLU A CA    1 
ATOM   760  C C     . GLU A 1 124 ? -1.861  -20.064 17.696 1.00 43.90 ? 332 GLU A C     1 
ATOM   761  O O     . GLU A 1 124 ? -0.708  -19.642 17.671 1.00 43.57 ? 332 GLU A O     1 
ATOM   762  C CB    . GLU A 1 124 ? -3.103  -18.088 18.705 1.00 44.89 ? 332 GLU A CB    1 
ATOM   763  C CG    . GLU A 1 124 ? -3.584  -18.657 19.996 1.00 48.53 ? 332 GLU A CG    1 
ATOM   764  C CD    . GLU A 1 124 ? -4.209  -17.593 20.886 1.00 51.74 ? 332 GLU A CD    1 
ATOM   765  O OE1   . GLU A 1 124 ? -4.360  -17.835 22.101 1.00 53.83 ? 332 GLU A OE1   1 
ATOM   766  O OE2   . GLU A 1 124 ? -4.569  -16.515 20.371 1.00 54.72 ? 332 GLU A OE2   1 
ATOM   767  N N     . VAL A 1 125 ? -2.143  -21.363 17.855 1.00 43.45 ? 333 VAL A N     1 
ATOM   768  C CA    . VAL A 1 125 ? -1.056  -22.358 17.938 1.00 43.59 ? 333 VAL A CA    1 
ATOM   769  C C     . VAL A 1 125 ? -0.252  -22.496 16.658 1.00 44.19 ? 333 VAL A C     1 
ATOM   770  O O     . VAL A 1 125 ? -0.801  -22.438 15.554 1.00 44.61 ? 333 VAL A O     1 
ATOM   771  C CB    . VAL A 1 125 ? -1.527  -23.817 18.329 1.00 43.46 ? 333 VAL A CB    1 
ATOM   772  C CG1   . VAL A 1 125 ? -1.817  -23.902 19.790 1.00 43.52 ? 333 VAL A CG1   1 
ATOM   773  C CG2   . VAL A 1 125 ? -2.711  -24.312 17.492 1.00 42.37 ? 333 VAL A CG2   1 
ATOM   774  N N     . HIS A 1 126 ? 1.045   -22.727 16.811 1.00 44.05 ? 334 HIS A N     1 
ATOM   775  C CA    . HIS A 1 126 ? 1.853   -23.169 15.689 1.00 45.05 ? 334 HIS A CA    1 
ATOM   776  C C     . HIS A 1 126 ? 1.553   -24.656 15.423 1.00 45.00 ? 334 HIS A C     1 
ATOM   777  O O     . HIS A 1 126 ? 1.633   -25.484 16.346 1.00 46.09 ? 334 HIS A O     1 
ATOM   778  C CB    . HIS A 1 126 ? 3.342   -22.955 15.995 1.00 44.88 ? 334 HIS A CB    1 
ATOM   779  C CG    . HIS A 1 126 ? 4.254   -23.343 14.871 1.00 46.65 ? 334 HIS A CG    1 
ATOM   780  N ND1   . HIS A 1 126 ? 4.253   -22.695 13.653 1.00 47.30 ? 334 HIS A ND1   1 
ATOM   781  C CD2   . HIS A 1 126 ? 5.210   -24.302 14.786 1.00 46.47 ? 334 HIS A CD2   1 
ATOM   782  C CE1   . HIS A 1 126 ? 5.151   -23.251 12.860 1.00 46.46 ? 334 HIS A CE1   1 
ATOM   783  N NE2   . HIS A 1 126 ? 5.747   -24.224 13.525 1.00 47.15 ? 334 HIS A NE2   1 
ATOM   784  N N     . LEU A 1 127 ? 1.183   -24.986 14.182 1.00 44.15 ? 335 LEU A N     1 
ATOM   785  C CA    . LEU A 1 127 ? 1.069   -26.372 13.755 1.00 43.61 ? 335 LEU A CA    1 
ATOM   786  C C     . LEU A 1 127 ? 2.347   -26.822 13.065 1.00 43.55 ? 335 LEU A C     1 
ATOM   787  O O     . LEU A 1 127 ? 2.945   -26.053 12.330 1.00 43.50 ? 335 LEU A O     1 
ATOM   788  C CB    . LEU A 1 127 ? -0.129  -26.589 12.818 1.00 43.30 ? 335 LEU A CB    1 
ATOM   789  C CG    . LEU A 1 127 ? -1.558  -26.395 13.335 1.00 42.83 ? 335 LEU A CG    1 
ATOM   790  C CD1   . LEU A 1 127 ? -2.538  -26.825 12.261 1.00 40.17 ? 335 LEU A CD1   1 
ATOM   791  C CD2   . LEU A 1 127 ? -1.802  -27.157 14.636 1.00 43.25 ? 335 LEU A CD2   1 
ATOM   792  N N     . PRO A 1 128 ? 2.777   -28.079 13.305 1.00 43.61 ? 336 PRO A N     1 
ATOM   793  C CA    . PRO A 1 128 ? 4.001   -28.601 12.677 1.00 43.66 ? 336 PRO A CA    1 
ATOM   794  C C     . PRO A 1 128 ? 3.857   -28.902 11.180 1.00 43.88 ? 336 PRO A C     1 
ATOM   795  O O     . PRO A 1 128 ? 4.791   -29.424 10.573 1.00 44.35 ? 336 PRO A O     1 
ATOM   796  C CB    . PRO A 1 128 ? 4.249   -29.909 13.451 1.00 43.83 ? 336 PRO A CB    1 
ATOM   797  C CG    . PRO A 1 128 ? 2.869   -30.382 13.798 1.00 43.74 ? 336 PRO A CG    1 
ATOM   798  C CD    . PRO A 1 128 ? 2.161   -29.082 14.202 1.00 43.83 ? 336 PRO A CD    1 
ATOM   799  N N     . VAL A 1 129 ? 2.687   -28.640 10.605 1.00 43.75 ? 337 VAL A N     1 
ATOM   800  C CA    . VAL A 1 129 ? 2.489   -28.727 9.153  1.00 44.25 ? 337 VAL A CA    1 
ATOM   801  C C     . VAL A 1 129 ? 1.959   -27.397 8.613  1.00 43.86 ? 337 VAL A C     1 
ATOM   802  O O     . VAL A 1 129 ? 1.463   -26.576 9.384  1.00 43.69 ? 337 VAL A O     1 
ATOM   803  C CB    . VAL A 1 129 ? 1.491   -29.831 8.750  1.00 44.42 ? 337 VAL A CB    1 
ATOM   804  C CG1   . VAL A 1 129 ? 2.057   -31.242 9.063  1.00 45.66 ? 337 VAL A CG1   1 
ATOM   805  C CG2   . VAL A 1 129 ? 0.132   -29.600 9.392  1.00 44.44 ? 337 VAL A CG2   1 
ATOM   806  N N     . GLU A 1 130 ? 2.057   -27.199 7.299  1.00 43.05 ? 338 GLU A N     1 
ATOM   807  C CA    . GLU A 1 130 ? 1.531   -25.995 6.683  1.00 43.19 ? 338 GLU A CA    1 
ATOM   808  C C     . GLU A 1 130 ? 0.132   -26.154 6.099  1.00 42.24 ? 338 GLU A C     1 
ATOM   809  O O     . GLU A 1 130 ? -0.659  -25.196 6.155  1.00 42.87 ? 338 GLU A O     1 
ATOM   810  C CB    . GLU A 1 130 ? 2.512   -25.422 5.656  1.00 44.35 ? 338 GLU A CB    1 
ATOM   811  C CG    . GLU A 1 130 ? 3.696   -24.700 6.308  1.00 46.36 ? 338 GLU A CG    1 
ATOM   812  C CD    . GLU A 1 130 ? 4.433   -23.807 5.339  1.00 49.76 ? 338 GLU A CD    1 
ATOM   813  O OE1   . GLU A 1 130 ? 4.005   -22.635 5.147  1.00 51.41 ? 338 GLU A OE1   1 
ATOM   814  O OE2   . GLU A 1 130 ? 5.436   -24.285 4.773  1.00 49.66 ? 338 GLU A OE2   1 
ATOM   815  N N     . LYS A 1 131 ? -0.170  -27.340 5.564  1.00 40.40 ? 339 LYS A N     1 
ATOM   816  C CA    . LYS A 1 131 ? -1.491  -27.666 5.014  1.00 39.30 ? 339 LYS A CA    1 
ATOM   817  C C     . LYS A 1 131 ? -1.963  -29.035 5.486  1.00 39.07 ? 339 LYS A C     1 
ATOM   818  O O     . LYS A 1 131 ? -1.145  -29.892 5.843  1.00 38.91 ? 339 LYS A O     1 
ATOM   819  C CB    . LYS A 1 131 ? -1.515  -27.635 3.474  1.00 39.29 ? 339 LYS A CB    1 
ATOM   820  C CG    . LYS A 1 131 ? -1.152  -26.283 2.843  1.00 40.12 ? 339 LYS A CG    1 
ATOM   821  C CD    . LYS A 1 131 ? -2.201  -25.203 3.094  1.00 40.75 ? 339 LYS A CD    1 
ATOM   822  C CE    . LYS A 1 131 ? -1.775  -23.869 2.441  1.00 41.98 ? 339 LYS A CE    1 
ATOM   823  N NZ    . LYS A 1 131 ? -2.789  -22.823 2.780  1.00 43.72 ? 339 LYS A NZ    1 
ATOM   824  N N     . VAL A 1 132 ? -3.286  -29.218 5.483  1.00 37.57 ? 340 VAL A N     1 
ATOM   825  C CA    . VAL A 1 132 ? -3.919  -30.496 5.782  1.00 36.93 ? 340 VAL A CA    1 
ATOM   826  C C     . VAL A 1 132 ? -4.887  -30.845 4.648  1.00 36.65 ? 340 VAL A C     1 
ATOM   827  O O     . VAL A 1 132 ? -5.373  -29.953 3.955  1.00 37.27 ? 340 VAL A O     1 
ATOM   828  C CB    . VAL A 1 132 ? -4.646  -30.481 7.162  1.00 36.52 ? 340 VAL A CB    1 
ATOM   829  C CG1   . VAL A 1 132 ? -3.653  -30.237 8.280  1.00 34.17 ? 340 VAL A CG1   1 
ATOM   830  C CG2   . VAL A 1 132 ? -5.827  -29.450 7.212  1.00 34.44 ? 340 VAL A CG2   1 
ATOM   831  N N     . ASP A 1 133 ? -5.163  -32.130 4.463  1.00 35.64 ? 341 ASP A N     1 
ATOM   832  C CA    . ASP A 1 133 ? -6.092  -32.577 3.431  1.00 35.57 ? 341 ASP A CA    1 
ATOM   833  C C     . ASP A 1 133 ? -7.544  -32.475 3.877  1.00 36.42 ? 341 ASP A C     1 
ATOM   834  O O     . ASP A 1 133 ? -8.435  -32.229 3.041  1.00 35.50 ? 341 ASP A O     1 
ATOM   835  C CB    . ASP A 1 133 ? -5.776  -34.008 3.010  1.00 35.69 ? 341 ASP A CB    1 
ATOM   836  C CG    . ASP A 1 133 ? -4.337  -34.155 2.521  1.00 36.96 ? 341 ASP A CG    1 
ATOM   837  O OD1   . ASP A 1 133 ? -4.034  -33.584 1.468  1.00 39.24 ? 341 ASP A OD1   1 
ATOM   838  O OD2   . ASP A 1 133 ? -3.505  -34.774 3.205  1.00 39.66 ? 341 ASP A OD2   1 
ATOM   839  N N     . VAL A 1 134 ? -7.774  -32.719 5.178  1.00 35.62 ? 342 VAL A N     1 
ATOM   840  C CA    . VAL A 1 134 ? -9.112  -32.820 5.736  1.00 35.76 ? 342 VAL A CA    1 
ATOM   841  C C     . VAL A 1 134 ? -9.195  -32.118 7.103  1.00 35.32 ? 342 VAL A C     1 
ATOM   842  O O     . VAL A 1 134 ? -8.335  -32.290 7.968  1.00 34.42 ? 342 VAL A O     1 
ATOM   843  C CB    . VAL A 1 134 ? -9.592  -34.302 5.904  1.00 36.43 ? 342 VAL A CB    1 
ATOM   844  C CG1   . VAL A 1 134 ? -11.080 -34.355 6.302  1.00 36.99 ? 342 VAL A CG1   1 
ATOM   845  C CG2   . VAL A 1 134 ? -9.363  -35.124 4.641  1.00 38.40 ? 342 VAL A CG2   1 
ATOM   846  N N     . ILE A 1 135 ? -10.250 -31.326 7.278  1.00 34.49 ? 343 ILE A N     1 
ATOM   847  C CA    . ILE A 1 135 ? -10.583 -30.774 8.586  1.00 33.89 ? 343 ILE A CA    1 
ATOM   848  C C     . ILE A 1 135 ? -11.867 -31.446 9.032  1.00 33.57 ? 343 ILE A C     1 
ATOM   849  O O     . ILE A 1 135 ? -12.835 -31.502 8.263  1.00 33.03 ? 343 ILE A O     1 
ATOM   850  C CB    . ILE A 1 135 ? -10.751 -29.252 8.559  1.00 34.20 ? 343 ILE A CB    1 
ATOM   851  C CG1   . ILE A 1 135 ? -9.394  -28.582 8.263  1.00 32.90 ? 343 ILE A CG1   1 
ATOM   852  C CG2   . ILE A 1 135 ? -11.303 -28.754 9.928  1.00 33.98 ? 343 ILE A CG2   1 
ATOM   853  C CD1   . ILE A 1 135 ? -9.500  -27.077 7.936  1.00 33.62 ? 343 ILE A CD1   1 
ATOM   854  N N     . ILE A 1 136 ? -11.845 -32.003 10.246 1.00 33.11 ? 344 ILE A N     1 
ATOM   855  C CA    . ILE A 1 136 ? -13.067 -32.497 10.889 1.00 32.98 ? 344 ILE A CA    1 
ATOM   856  C C     . ILE A 1 136 ? -13.275 -31.733 12.206 1.00 33.25 ? 344 ILE A C     1 
ATOM   857  O O     . ILE A 1 136 ? -12.308 -31.380 12.896 1.00 32.83 ? 344 ILE A O     1 
ATOM   858  C CB    . ILE A 1 136 ? -13.041 -34.037 11.124 1.00 32.95 ? 344 ILE A CB    1 
ATOM   859  C CG1   . ILE A 1 136 ? -11.913 -34.398 12.107 1.00 33.16 ? 344 ILE A CG1   1 
ATOM   860  C CG2   . ILE A 1 136 ? -12.926 -34.791 9.720  1.00 33.79 ? 344 ILE A CG2   1 
ATOM   861  C CD1   . ILE A 1 136 ? -11.655 -35.930 12.334 1.00 33.22 ? 344 ILE A CD1   1 
ATOM   862  N N     . SER A 1 137 ? -14.530 -31.449 12.535 1.00 32.49 ? 345 SER A N     1 
ATOM   863  C CA    . SER A 1 137 ? -14.807 -30.718 13.778 1.00 33.86 ? 345 SER A CA    1 
ATOM   864  C C     . SER A 1 137 ? -16.223 -30.883 14.280 1.00 33.45 ? 345 SER A C     1 
ATOM   865  O O     . SER A 1 137 ? -17.172 -30.907 13.507 1.00 33.23 ? 345 SER A O     1 
ATOM   866  C CB    . SER A 1 137 ? -14.533 -29.223 13.597 1.00 33.32 ? 345 SER A CB    1 
ATOM   867  O OG    . SER A 1 137 ? -14.477 -28.579 14.860 1.00 33.11 ? 345 SER A OG    1 
ATOM   868  N N     . GLU A 1 138 ? -16.338 -31.047 15.587 1.00 34.49 ? 346 GLU A N     1 
ATOM   869  C CA    . GLU A 1 138 ? -17.600 -30.937 16.235 1.00 34.57 ? 346 GLU A CA    1 
ATOM   870  C C     . GLU A 1 138 ? -17.633 -29.548 16.904 1.00 34.07 ? 346 GLU A C     1 
ATOM   871  O O     . GLU A 1 138 ? -17.035 -29.329 17.979 1.00 34.28 ? 346 GLU A O     1 
ATOM   872  C CB    . GLU A 1 138 ? -17.831 -32.091 17.201 1.00 35.09 ? 346 GLU A CB    1 
ATOM   873  C CG    . GLU A 1 138 ? -19.337 -32.521 17.180 1.00 36.62 ? 346 GLU A CG    1 
ATOM   874  C CD    . GLU A 1 138 ? -20.084 -31.685 18.080 1.00 39.66 ? 346 GLU A CD    1 
ATOM   875  O OE1   . GLU A 1 138 ? -20.603 -30.655 17.651 1.00 36.26 ? 346 GLU A OE1   1 
ATOM   876  O OE2   . GLU A 1 138 ? -20.067 -31.993 19.275 1.00 49.33 ? 346 GLU A OE2   1 
ATOM   877  N N     . TRP A 1 139 ? -18.313 -28.632 16.230 1.00 32.55 ? 347 TRP A N     1 
ATOM   878  C CA    . TRP A 1 139 ? -18.287 -27.208 16.569 1.00 32.51 ? 347 TRP A CA    1 
ATOM   879  C C     . TRP A 1 139 ? -19.660 -26.643 16.918 1.00 32.46 ? 347 TRP A C     1 
ATOM   880  O O     . TRP A 1 139 ? -19.742 -25.543 17.471 1.00 33.17 ? 347 TRP A O     1 
ATOM   881  C CB    . TRP A 1 139 ? -17.660 -26.384 15.422 1.00 32.97 ? 347 TRP A CB    1 
ATOM   882  C CG    . TRP A 1 139 ? -18.370 -26.554 14.086 1.00 32.75 ? 347 TRP A CG    1 
ATOM   883  C CD1   . TRP A 1 139 ? -18.003 -27.392 13.069 1.00 34.30 ? 347 TRP A CD1   1 
ATOM   884  C CD2   . TRP A 1 139 ? -19.565 -25.897 13.651 1.00 34.53 ? 347 TRP A CD2   1 
ATOM   885  N NE1   . TRP A 1 139 ? -18.890 -27.291 12.028 1.00 33.75 ? 347 TRP A NE1   1 
ATOM   886  C CE2   . TRP A 1 139 ? -19.869 -26.394 12.359 1.00 35.67 ? 347 TRP A CE2   1 
ATOM   887  C CE3   . TRP A 1 139 ? -20.414 -24.932 14.223 1.00 33.92 ? 347 TRP A CE3   1 
ATOM   888  C CZ2   . TRP A 1 139 ? -20.991 -25.964 11.630 1.00 33.85 ? 347 TRP A CZ2   1 
ATOM   889  C CZ3   . TRP A 1 139 ? -21.532 -24.515 13.511 1.00 34.12 ? 347 TRP A CZ3   1 
ATOM   890  C CH2   . TRP A 1 139 ? -21.808 -25.018 12.221 1.00 32.67 ? 347 TRP A CH2   1 
ATOM   891  N N     . MET A 1 140 ? -20.721 -27.400 16.630 1.00 31.69 ? 348 MET A N     1 
ATOM   892  C CA    . MET A 1 140 ? -22.111 -26.884 16.693 1.00 31.24 ? 348 MET A CA    1 
ATOM   893  C C     . MET A 1 140 ? -22.607 -26.614 18.119 1.00 31.39 ? 348 MET A C     1 
ATOM   894  O O     . MET A 1 140 ? -22.348 -27.390 19.056 1.00 31.27 ? 348 MET A O     1 
ATOM   895  C CB    . MET A 1 140 ? -23.098 -27.799 15.941 1.00 30.79 ? 348 MET A CB    1 
ATOM   896  C CG    . MET A 1 140 ? -22.684 -28.071 14.479 1.00 29.75 ? 348 MET A CG    1 
ATOM   897  S SD    . MET A 1 140 ? -21.400 -29.372 14.226 1.00 33.37 ? 348 MET A SD    1 
ATOM   898  C CE    . MET A 1 140 ? -22.361 -30.845 14.577 1.00 31.61 ? 348 MET A CE    1 
ATOM   899  N N     . GLY A 1 141 ? -23.302 -25.483 18.262 1.00 31.00 ? 349 GLY A N     1 
ATOM   900  C CA    . GLY A 1 141 ? -23.884 -25.069 19.543 1.00 31.03 ? 349 GLY A CA    1 
ATOM   901  C C     . GLY A 1 141 ? -25.386 -25.148 19.440 1.00 31.10 ? 349 GLY A C     1 
ATOM   902  O O     . GLY A 1 141 ? -25.920 -25.529 18.409 1.00 29.60 ? 349 GLY A O     1 
ATOM   903  N N     . TYR A 1 142 ? -26.076 -24.825 20.530 1.00 32.31 ? 350 TYR A N     1 
ATOM   904  C CA    . TYR A 1 142 ? -27.538 -24.700 20.463 1.00 33.16 ? 350 TYR A CA    1 
ATOM   905  C C     . TYR A 1 142 ? -27.901 -23.757 19.327 1.00 32.78 ? 350 TYR A C     1 
ATOM   906  O O     . TYR A 1 142 ? -27.173 -22.783 19.095 1.00 31.84 ? 350 TYR A O     1 
ATOM   907  C CB    . TYR A 1 142 ? -28.079 -24.124 21.770 1.00 33.61 ? 350 TYR A CB    1 
ATOM   908  C CG    . TYR A 1 142 ? -27.681 -24.903 22.984 1.00 36.31 ? 350 TYR A CG    1 
ATOM   909  C CD1   . TYR A 1 142 ? -27.067 -24.262 24.071 1.00 35.65 ? 350 TYR A CD1   1 
ATOM   910  C CD2   . TYR A 1 142 ? -27.901 -26.292 23.051 1.00 35.75 ? 350 TYR A CD2   1 
ATOM   911  C CE1   . TYR A 1 142 ? -26.709 -24.972 25.209 1.00 37.42 ? 350 TYR A CE1   1 
ATOM   912  C CE2   . TYR A 1 142 ? -27.530 -27.011 24.167 1.00 37.20 ? 350 TYR A CE2   1 
ATOM   913  C CZ    . TYR A 1 142 ? -26.938 -26.345 25.241 1.00 37.30 ? 350 TYR A CZ    1 
ATOM   914  O OH    . TYR A 1 142 ? -26.591 -27.053 26.358 1.00 38.78 ? 350 TYR A OH    1 
ATOM   915  N N     . PHE A 1 143 ? -28.997 -24.052 18.625 1.00 32.15 ? 351 PHE A N     1 
ATOM   916  C CA    . PHE A 1 143 ? -29.440 -23.228 17.480 1.00 34.31 ? 351 PHE A CA    1 
ATOM   917  C C     . PHE A 1 143 ? -28.279 -23.060 16.474 1.00 34.52 ? 351 PHE A C     1 
ATOM   918  O O     . PHE A 1 143 ? -28.113 -22.007 15.842 1.00 34.20 ? 351 PHE A O     1 
ATOM   919  C CB    . PHE A 1 143 ? -29.970 -21.861 17.990 1.00 34.28 ? 351 PHE A CB    1 
ATOM   920  C CG    . PHE A 1 143 ? -30.810 -21.105 17.000 1.00 35.47 ? 351 PHE A CG    1 
ATOM   921  C CD1   . PHE A 1 143 ? -31.934 -21.682 16.408 1.00 37.04 ? 351 PHE A CD1   1 
ATOM   922  C CD2   . PHE A 1 143 ? -30.477 -19.798 16.658 1.00 36.26 ? 351 PHE A CD2   1 
ATOM   923  C CE1   . PHE A 1 143 ? -32.711 -20.960 15.494 1.00 35.53 ? 351 PHE A CE1   1 
ATOM   924  C CE2   . PHE A 1 143 ? -31.255 -19.077 15.738 1.00 34.44 ? 351 PHE A CE2   1 
ATOM   925  C CZ    . PHE A 1 143 ? -32.376 -19.662 15.178 1.00 34.74 ? 351 PHE A CZ    1 
ATOM   926  N N     . LEU A 1 144 ? -27.463 -24.123 16.377 1.00 34.89 ? 352 LEU A N     1 
ATOM   927  C CA    . LEU A 1 144 ? -26.302 -24.213 15.510 1.00 35.09 ? 352 LEU A CA    1 
ATOM   928  C C     . LEU A 1 144 ? -25.161 -23.290 15.898 1.00 34.92 ? 352 LEU A C     1 
ATOM   929  O O     . LEU A 1 144 ? -24.038 -23.728 16.057 1.00 34.99 ? 352 LEU A O     1 
ATOM   930  C CB    . LEU A 1 144 ? -26.660 -23.967 14.024 1.00 35.40 ? 352 LEU A CB    1 
ATOM   931  C CG    . LEU A 1 144 ? -26.019 -24.808 12.911 1.00 35.54 ? 352 LEU A CG    1 
ATOM   932  C CD1   . LEU A 1 144 ? -25.577 -24.024 11.647 1.00 36.41 ? 352 LEU A CD1   1 
ATOM   933  C CD2   . LEU A 1 144 ? -24.968 -25.840 13.359 1.00 37.10 ? 352 LEU A CD2   1 
ATOM   934  N N     . LEU A 1 145 ? -25.448 -22.005 16.020 1.00 36.08 ? 353 LEU A N     1 
ATOM   935  C CA    . LEU A 1 145 ? -24.386 -21.006 16.060 1.00 37.19 ? 353 LEU A CA    1 
ATOM   936  C C     . LEU A 1 145 ? -23.913 -20.552 17.443 1.00 38.52 ? 353 LEU A C     1 
ATOM   937  O O     . LEU A 1 145 ? -22.865 -19.910 17.548 1.00 39.18 ? 353 LEU A O     1 
ATOM   938  C CB    . LEU A 1 145 ? -24.787 -19.793 15.198 1.00 37.80 ? 353 LEU A CB    1 
ATOM   939  C CG    . LEU A 1 145 ? -24.875 -20.058 13.678 1.00 36.67 ? 353 LEU A CG    1 
ATOM   940  C CD1   . LEU A 1 145 ? -25.262 -18.746 13.001 1.00 38.41 ? 353 LEU A CD1   1 
ATOM   941  C CD2   . LEU A 1 145 ? -23.553 -20.610 13.104 1.00 38.36 ? 353 LEU A CD2   1 
ATOM   942  N N     . PHE A 1 146 ? -24.665 -20.862 18.496 1.00 39.50 ? 354 PHE A N     1 
ATOM   943  C CA    . PHE A 1 146 ? -24.247 -20.502 19.862 1.00 41.00 ? 354 PHE A CA    1 
ATOM   944  C C     . PHE A 1 146 ? -22.823 -20.979 20.173 1.00 41.33 ? 354 PHE A C     1 
ATOM   945  O O     . PHE A 1 146 ? -22.434 -22.092 19.789 1.00 40.80 ? 354 PHE A O     1 
ATOM   946  C CB    . PHE A 1 146 ? -25.227 -21.074 20.881 1.00 42.11 ? 354 PHE A CB    1 
ATOM   947  C CG    . PHE A 1 146 ? -24.913 -20.708 22.316 1.00 43.95 ? 354 PHE A CG    1 
ATOM   948  C CD1   . PHE A 1 146 ? -24.800 -19.373 22.710 1.00 43.81 ? 354 PHE A CD1   1 
ATOM   949  C CD2   . PHE A 1 146 ? -24.736 -21.710 23.282 1.00 44.72 ? 354 PHE A CD2   1 
ATOM   950  C CE1   . PHE A 1 146 ? -24.505 -19.041 24.049 1.00 45.38 ? 354 PHE A CE1   1 
ATOM   951  C CE2   . PHE A 1 146 ? -24.446 -21.384 24.611 1.00 43.84 ? 354 PHE A CE2   1 
ATOM   952  C CZ    . PHE A 1 146 ? -24.329 -20.054 24.993 1.00 44.13 ? 354 PHE A CZ    1 
ATOM   953  N N     . GLU A 1 147 ? -22.061 -20.138 20.879 1.00 41.14 ? 355 GLU A N     1 
ATOM   954  C CA    . GLU A 1 147 ? -20.612 -20.354 21.154 1.00 41.73 ? 355 GLU A CA    1 
ATOM   955  C C     . GLU A 1 147 ? -19.677 -19.843 20.054 1.00 40.63 ? 355 GLU A C     1 
ATOM   956  O O     . GLU A 1 147 ? -18.492 -19.616 20.310 1.00 40.34 ? 355 GLU A O     1 
ATOM   957  C CB    . GLU A 1 147 ? -20.255 -21.808 21.490 1.00 41.33 ? 355 GLU A CB    1 
ATOM   958  C CG    . GLU A 1 147 ? -21.232 -22.503 22.400 1.00 46.95 ? 355 GLU A CG    1 
ATOM   959  C CD    . GLU A 1 147 ? -20.581 -23.263 23.532 1.00 53.03 ? 355 GLU A CD    1 
ATOM   960  O OE1   . GLU A 1 147 ? -19.645 -24.077 23.271 1.00 55.76 ? 355 GLU A OE1   1 
ATOM   961  O OE2   . GLU A 1 147 ? -21.019 -23.038 24.686 1.00 54.07 ? 355 GLU A OE2   1 
ATOM   962  N N     . SER A 1 148 ? -20.215 -19.661 18.842 1.00 40.56 ? 356 SER A N     1 
ATOM   963  C CA    . SER A 1 148 ? -19.453 -19.176 17.679 1.00 39.58 ? 356 SER A CA    1 
ATOM   964  C C     . SER A 1 148 ? -18.197 -20.003 17.377 1.00 38.50 ? 356 SER A C     1 
ATOM   965  O O     . SER A 1 148 ? -17.171 -19.439 16.982 1.00 38.13 ? 356 SER A O     1 
ATOM   966  C CB    . SER A 1 148 ? -19.070 -17.703 17.864 1.00 40.12 ? 356 SER A CB    1 
ATOM   967  O OG    . SER A 1 148 ? -20.214 -16.932 18.200 1.00 41.39 ? 356 SER A OG    1 
ATOM   968  N N     . MET A 1 149 ? -18.260 -21.328 17.558 1.00 37.30 ? 357 MET A N     1 
ATOM   969  C CA    . MET A 1 149 ? -17.059 -22.176 17.253 1.00 36.40 ? 357 MET A CA    1 
ATOM   970  C C     . MET A 1 149 ? -16.817 -22.363 15.752 1.00 36.18 ? 357 MET A C     1 
ATOM   971  O O     . MET A 1 149 ? -15.691 -22.656 15.342 1.00 35.46 ? 357 MET A O     1 
ATOM   972  C CB    . MET A 1 149 ? -17.086 -23.513 18.008 1.00 36.70 ? 357 MET A CB    1 
ATOM   973  C CG    . MET A 1 149 ? -15.803 -24.370 17.851 1.00 35.40 ? 357 MET A CG    1 
ATOM   974  S SD    . MET A 1 149 ? -15.795 -25.844 18.899 1.00 36.81 ? 357 MET A SD    1 
ATOM   975  C CE    . MET A 1 149 ? -14.435 -26.786 18.159 1.00 33.36 ? 357 MET A CE    1 
ATOM   976  N N     . LEU A 1 150 ? -17.861 -22.199 14.933 1.00 36.82 ? 358 LEU A N     1 
ATOM   977  C CA    . LEU A 1 150 ? -17.694 -22.206 13.458 1.00 37.09 ? 358 LEU A CA    1 
ATOM   978  C C     . LEU A 1 150 ? -16.663 -21.178 13.003 1.00 37.15 ? 358 LEU A C     1 
ATOM   979  O O     . LEU A 1 150 ? -15.877 -21.453 12.105 1.00 36.58 ? 358 LEU A O     1 
ATOM   980  C CB    . LEU A 1 150 ? -19.020 -21.992 12.681 1.00 37.26 ? 358 LEU A CB    1 
ATOM   981  C CG    . LEU A 1 150 ? -18.976 -22.156 11.126 1.00 37.17 ? 358 LEU A CG    1 
ATOM   982  C CD1   . LEU A 1 150 ? -18.332 -23.460 10.672 1.00 35.63 ? 358 LEU A CD1   1 
ATOM   983  C CD2   . LEU A 1 150 ? -20.380 -22.065 10.539 1.00 37.08 ? 358 LEU A CD2   1 
ATOM   984  N N     . ASP A 1 151 ? -16.669 -19.997 13.613 1.00 37.68 ? 359 ASP A N     1 
ATOM   985  C CA    . ASP A 1 151 ? -15.599 -19.020 13.355 1.00 37.76 ? 359 ASP A CA    1 
ATOM   986  C C     . ASP A 1 151 ? -14.197 -19.635 13.428 1.00 38.00 ? 359 ASP A C     1 
ATOM   987  O O     . ASP A 1 151 ? -13.347 -19.366 12.566 1.00 37.06 ? 359 ASP A O     1 
ATOM   988  C CB    . ASP A 1 151 ? -15.719 -17.831 14.305 1.00 38.60 ? 359 ASP A CB    1 
ATOM   989  C CG    . ASP A 1 151 ? -17.070 -17.124 14.181 1.00 39.59 ? 359 ASP A CG    1 
ATOM   990  O OD1   . ASP A 1 151 ? -18.094 -17.782 13.882 1.00 43.11 ? 359 ASP A OD1   1 
ATOM   991  O OD2   . ASP A 1 151 ? -17.122 -15.913 14.388 1.00 41.90 ? 359 ASP A OD2   1 
ATOM   992  N N     . SER A 1 152 ? -13.963 -20.478 14.438 1.00 37.21 ? 360 SER A N     1 
ATOM   993  C CA    . SER A 1 152 ? -12.641 -21.099 14.629 1.00 37.44 ? 360 SER A CA    1 
ATOM   994  C C     . SER A 1 152 ? -12.291 -22.132 13.568 1.00 36.52 ? 360 SER A C     1 
ATOM   995  O O     . SER A 1 152 ? -11.132 -22.233 13.160 1.00 37.48 ? 360 SER A O     1 
ATOM   996  C CB    . SER A 1 152 ? -12.578 -21.750 15.999 1.00 37.40 ? 360 SER A CB    1 
ATOM   997  O OG    . SER A 1 152 ? -12.591 -20.718 16.958 1.00 38.07 ? 360 SER A OG    1 
ATOM   998  N N     . VAL A 1 153 ? -13.290 -22.919 13.164 1.00 35.80 ? 361 VAL A N     1 
ATOM   999  C CA    . VAL A 1 153 ? -13.180 -23.908 12.093 1.00 35.39 ? 361 VAL A CA    1 
ATOM   1000 C C     . VAL A 1 153 ? -12.891 -23.196 10.753 1.00 36.00 ? 361 VAL A C     1 
ATOM   1001 O O     . VAL A 1 153 ? -12.055 -23.643 9.953  1.00 36.04 ? 361 VAL A O     1 
ATOM   1002 C CB    . VAL A 1 153 ? -14.484 -24.790 12.017 1.00 35.06 ? 361 VAL A CB    1 
ATOM   1003 C CG1   . VAL A 1 153 ? -14.411 -25.850 10.897 1.00 34.43 ? 361 VAL A CG1   1 
ATOM   1004 C CG2   . VAL A 1 153 ? -14.727 -25.468 13.335 1.00 34.83 ? 361 VAL A CG2   1 
ATOM   1005 N N     . LEU A 1 154 ? -13.560 -22.066 10.537 1.00 35.49 ? 362 LEU A N     1 
ATOM   1006 C CA    . LEU A 1 154 ? -13.391 -21.287 9.315  1.00 36.24 ? 362 LEU A CA    1 
ATOM   1007 C C     . LEU A 1 154 ? -12.003 -20.679 9.281  1.00 35.71 ? 362 LEU A C     1 
ATOM   1008 O O     . LEU A 1 154 ? -11.358 -20.672 8.255  1.00 36.51 ? 362 LEU A O     1 
ATOM   1009 C CB    . LEU A 1 154 ? -14.491 -20.192 9.187  1.00 36.17 ? 362 LEU A CB    1 
ATOM   1010 C CG    . LEU A 1 154 ? -15.892 -20.786 8.921  1.00 38.16 ? 362 LEU A CG    1 
ATOM   1011 C CD1   . LEU A 1 154 ? -16.980 -19.667 8.769  1.00 36.35 ? 362 LEU A CD1   1 
ATOM   1012 C CD2   . LEU A 1 154 ? -15.876 -21.722 7.707  1.00 39.84 ? 362 LEU A CD2   1 
ATOM   1013 N N     . TYR A 1 155 ? -11.522 -20.223 10.422 1.00 35.43 ? 363 TYR A N     1 
ATOM   1014 C CA    . TYR A 1 155 ? -10.146 -19.812 10.527 1.00 35.35 ? 363 TYR A CA    1 
ATOM   1015 C C     . TYR A 1 155 ? -9.177  -20.921 10.089 1.00 35.92 ? 363 TYR A C     1 
ATOM   1016 O O     . TYR A 1 155 ? -8.270  -20.684 9.279  1.00 35.03 ? 363 TYR A O     1 
ATOM   1017 C CB    . TYR A 1 155 ? -9.833  -19.372 11.952 1.00 36.01 ? 363 TYR A CB    1 
ATOM   1018 C CG    . TYR A 1 155 ? -8.406  -18.894 12.066 1.00 38.02 ? 363 TYR A CG    1 
ATOM   1019 C CD1   . TYR A 1 155 ? -8.093  -17.539 12.013 1.00 38.70 ? 363 TYR A CD1   1 
ATOM   1020 C CD2   . TYR A 1 155 ? -7.355  -19.813 12.197 1.00 38.14 ? 363 TYR A CD2   1 
ATOM   1021 C CE1   . TYR A 1 155 ? -6.754  -17.108 12.103 1.00 40.48 ? 363 TYR A CE1   1 
ATOM   1022 C CE2   . TYR A 1 155 ? -6.037  -19.397 12.287 1.00 39.27 ? 363 TYR A CE2   1 
ATOM   1023 C CZ    . TYR A 1 155 ? -5.741  -18.055 12.234 1.00 39.71 ? 363 TYR A CZ    1 
ATOM   1024 O OH    . TYR A 1 155 ? -4.419  -17.680 12.329 1.00 41.35 ? 363 TYR A OH    1 
ATOM   1025 N N     . ALA A 1 156 ? -9.363  -22.125 10.632 1.00 35.57 ? 364 ALA A N     1 
ATOM   1026 C CA    . ALA A 1 156 ? -8.485  -23.265 10.311 1.00 36.40 ? 364 ALA A CA    1 
ATOM   1027 C C     . ALA A 1 156 ? -8.582  -23.615 8.820  1.00 36.41 ? 364 ALA A C     1 
ATOM   1028 O O     . ALA A 1 156 ? -7.601  -23.949 8.171  1.00 36.61 ? 364 ALA A O     1 
ATOM   1029 C CB    . ALA A 1 156 ? -8.834  -24.485 11.201 1.00 35.43 ? 364 ALA A CB    1 
ATOM   1030 N N     . LYS A 1 157 ? -9.791  -23.526 8.296  1.00 37.94 ? 365 LYS A N     1 
ATOM   1031 C CA    . LYS A 1 157 ? -10.076 -23.832 6.908  1.00 38.27 ? 365 LYS A CA    1 
ATOM   1032 C C     . LYS A 1 157 ? -9.323  -22.894 5.987  1.00 38.86 ? 365 LYS A C     1 
ATOM   1033 O O     . LYS A 1 157 ? -8.712  -23.346 5.008  1.00 39.25 ? 365 LYS A O     1 
ATOM   1034 C CB    . LYS A 1 157 ? -11.582 -23.703 6.660  1.00 38.58 ? 365 LYS A CB    1 
ATOM   1035 C CG    . LYS A 1 157 ? -12.074 -24.450 5.453  1.00 40.15 ? 365 LYS A CG    1 
ATOM   1036 C CD    . LYS A 1 157 ? -12.155 -23.570 4.281  1.00 40.74 ? 365 LYS A CD    1 
ATOM   1037 C CE    . LYS A 1 157 ? -13.560 -23.066 4.062  1.00 45.28 ? 365 LYS A CE    1 
ATOM   1038 N NZ    . LYS A 1 157 ? -13.535 -21.856 3.131  1.00 44.94 ? 365 LYS A NZ    1 
ATOM   1039 N N     . ASN A 1 158 ? -9.373  -21.597 6.298  1.00 38.87 ? 366 ASN A N     1 
ATOM   1040 C CA    . ASN A 1 158 ? -8.758  -20.580 5.454  1.00 38.77 ? 366 ASN A CA    1 
ATOM   1041 C C     . ASN A 1 158 ? -7.235  -20.611 5.545  1.00 38.68 ? 366 ASN A C     1 
ATOM   1042 O O     . ASN A 1 158 ? -6.557  -20.419 4.546  1.00 39.04 ? 366 ASN A O     1 
ATOM   1043 C CB    . ASN A 1 158 ? -9.306  -19.180 5.757  1.00 38.30 ? 366 ASN A CB    1 
ATOM   1044 C CG    . ASN A 1 158 ? -10.752 -19.003 5.303  1.00 39.05 ? 366 ASN A CG    1 
ATOM   1045 O OD1   . ASN A 1 158 ? -11.153 -19.467 4.228  1.00 41.56 ? 366 ASN A OD1   1 
ATOM   1046 N ND2   . ASN A 1 158 ? -11.537 -18.344 6.123  1.00 37.42 ? 366 ASN A ND2   1 
ATOM   1047 N N     . LYS A 1 159 ? -6.704  -20.882 6.729  1.00 38.30 ? 367 LYS A N     1 
ATOM   1048 C CA    . LYS A 1 159 ? -5.258  -20.918 6.912  1.00 38.28 ? 367 LYS A CA    1 
ATOM   1049 C C     . LYS A 1 159 ? -4.575  -22.260 6.537  1.00 38.09 ? 367 LYS A C     1 
ATOM   1050 O O     . LYS A 1 159 ? -3.424  -22.290 6.082  1.00 38.00 ? 367 LYS A O     1 
ATOM   1051 C CB    . LYS A 1 159 ? -4.925  -20.551 8.359  1.00 38.57 ? 367 LYS A CB    1 
ATOM   1052 C CG    . LYS A 1 159 ? -3.441  -20.305 8.521  1.00 40.75 ? 367 LYS A CG    1 
ATOM   1053 C CD    . LYS A 1 159 ? -3.015  -19.903 9.903  1.00 41.80 ? 367 LYS A CD    1 
ATOM   1054 C CE    . LYS A 1 159 ? -1.532  -19.552 9.833  1.00 43.28 ? 367 LYS A CE    1 
ATOM   1055 N NZ    . LYS A 1 159 ? -0.851  -19.675 11.131 1.00 47.27 ? 367 LYS A NZ    1 
ATOM   1056 N N     . TYR A 1 160 ? -5.271  -23.371 6.739  1.00 37.65 ? 368 TYR A N     1 
ATOM   1057 C CA    . TYR A 1 160 ? -4.608  -24.681 6.644  1.00 38.01 ? 368 TYR A CA    1 
ATOM   1058 C C     . TYR A 1 160 ? -5.158  -25.646 5.630  1.00 37.94 ? 368 TYR A C     1 
ATOM   1059 O O     . TYR A 1 160 ? -4.498  -26.636 5.326  1.00 38.29 ? 368 TYR A O     1 
ATOM   1060 C CB    . TYR A 1 160 ? -4.600  -25.398 7.995  1.00 38.29 ? 368 TYR A CB    1 
ATOM   1061 C CG    . TYR A 1 160 ? -3.850  -24.672 9.083  1.00 39.64 ? 368 TYR A CG    1 
ATOM   1062 C CD1   . TYR A 1 160 ? -4.524  -24.164 10.205 1.00 39.22 ? 368 TYR A CD1   1 
ATOM   1063 C CD2   . TYR A 1 160 ? -2.461  -24.502 9.010  1.00 39.96 ? 368 TYR A CD2   1 
ATOM   1064 C CE1   . TYR A 1 160 ? -3.827  -23.496 11.228 1.00 39.87 ? 368 TYR A CE1   1 
ATOM   1065 C CE2   . TYR A 1 160 ? -1.756  -23.835 10.027 1.00 41.29 ? 368 TYR A CE2   1 
ATOM   1066 C CZ    . TYR A 1 160 ? -2.448  -23.322 11.120 1.00 40.21 ? 368 TYR A CZ    1 
ATOM   1067 O OH    . TYR A 1 160 ? -1.746  -22.674 12.117 1.00 40.60 ? 368 TYR A OH    1 
ATOM   1068 N N     . LEU A 1 161 ? -6.351  -25.417 5.112  1.00 38.43 ? 369 LEU A N     1 
ATOM   1069 C CA    . LEU A 1 161 ? -6.870  -26.410 4.191  1.00 39.88 ? 369 LEU A CA    1 
ATOM   1070 C C     . LEU A 1 161 ? -6.140  -26.340 2.841  1.00 40.82 ? 369 LEU A C     1 
ATOM   1071 O O     . LEU A 1 161 ? -6.116  -25.291 2.194  1.00 40.75 ? 369 LEU A O     1 
ATOM   1072 C CB    . LEU A 1 161 ? -8.372  -26.324 4.035  1.00 39.29 ? 369 LEU A CB    1 
ATOM   1073 C CG    . LEU A 1 161 ? -9.003  -27.521 3.330  1.00 39.91 ? 369 LEU A CG    1 
ATOM   1074 C CD1   . LEU A 1 161 ? -8.855  -28.829 4.133  1.00 35.13 ? 369 LEU A CD1   1 
ATOM   1075 C CD2   . LEU A 1 161 ? -10.451 -27.213 3.039  1.00 36.93 ? 369 LEU A CD2   1 
ATOM   1076 N N     . ALA A 1 162 ? -5.515  -27.452 2.459  1.00 40.97 ? 370 ALA A N     1 
ATOM   1077 C CA    . ALA A 1 162 ? -4.865  -27.542 1.157  1.00 41.46 ? 370 ALA A CA    1 
ATOM   1078 C C     . ALA A 1 162 ? -5.880  -27.237 0.059  1.00 41.49 ? 370 ALA A C     1 
ATOM   1079 O O     . ALA A 1 162 ? -7.078  -27.523 0.186  1.00 41.37 ? 370 ALA A O     1 
ATOM   1080 C CB    . ALA A 1 162 ? -4.218  -28.935 0.950  1.00 41.07 ? 370 ALA A CB    1 
ATOM   1081 N N     . LYS A 1 163 ? -5.401  -26.607 -1.004 1.00 41.86 ? 371 LYS A N     1 
ATOM   1082 C CA    . LYS A 1 163 ? -6.213  -26.417 -2.187 1.00 42.41 ? 371 LYS A CA    1 
ATOM   1083 C C     . LYS A 1 163 ? -6.801  -27.778 -2.524 1.00 41.31 ? 371 LYS A C     1 
ATOM   1084 O O     . LYS A 1 163 ? -6.073  -28.752 -2.617 1.00 40.87 ? 371 LYS A O     1 
ATOM   1085 C CB    . LYS A 1 163 ? -5.335  -25.923 -3.347 1.00 42.75 ? 371 LYS A CB    1 
ATOM   1086 C CG    . LYS A 1 163 ? -6.123  -25.502 -4.584 1.00 43.69 ? 371 LYS A CG    1 
ATOM   1087 C CD    . LYS A 1 163 ? -5.201  -25.210 -5.778 1.00 44.60 ? 371 LYS A CD    1 
ATOM   1088 C CE    . LYS A 1 163 ? -5.853  -24.159 -6.690 1.00 46.42 ? 371 LYS A CE    1 
ATOM   1089 N NZ    . LYS A 1 163 ? -4.919  -23.676 -7.770 1.00 49.74 ? 371 LYS A NZ    1 
ATOM   1090 N N     . GLY A 1 164 ? -8.111  -27.849 -2.714 1.00 40.80 ? 372 GLY A N     1 
ATOM   1091 C CA    . GLY A 1 164 ? -8.743  -29.120 -3.071 1.00 40.06 ? 372 GLY A CA    1 
ATOM   1092 C C     . GLY A 1 164 ? -9.102  -29.984 -1.876 1.00 39.80 ? 372 GLY A C     1 
ATOM   1093 O O     . GLY A 1 164 ? -9.680  -31.061 -2.043 1.00 40.07 ? 372 GLY A O     1 
ATOM   1094 N N     . GLY A 1 165 ? -8.752  -29.528 -0.673 1.00 39.37 ? 373 GLY A N     1 
ATOM   1095 C CA    . GLY A 1 165 ? -9.087  -30.239 0.552  1.00 38.82 ? 373 GLY A CA    1 
ATOM   1096 C C     . GLY A 1 165 ? -10.552 -30.127 0.947  1.00 39.48 ? 373 GLY A C     1 
ATOM   1097 O O     . GLY A 1 165 ? -11.329 -29.431 0.299  1.00 38.73 ? 373 GLY A O     1 
ATOM   1098 N N     . SER A 1 166 ? -10.928 -30.771 2.054  1.00 39.05 ? 374 SER A N     1 
ATOM   1099 C CA    . SER A 1 166 ? -12.327 -30.765 2.470  1.00 38.50 ? 374 SER A CA    1 
ATOM   1100 C C     . SER A 1 166 ? -12.529 -30.567 3.972  1.00 37.95 ? 374 SER A C     1 
ATOM   1101 O O     . SER A 1 166 ? -11.673 -30.955 4.764  1.00 37.23 ? 374 SER A O     1 
ATOM   1102 C CB    . SER A 1 166 ? -12.969 -32.081 2.052  1.00 39.04 ? 374 SER A CB    1 
ATOM   1103 O OG    . SER A 1 166 ? -12.776 -32.329 0.672  1.00 39.30 ? 374 SER A OG    1 
ATOM   1104 N N     . VAL A 1 167 ? -13.680 -29.995 4.342  1.00 36.48 ? 375 VAL A N     1 
ATOM   1105 C CA    . VAL A 1 167 ? -14.030 -29.683 5.737  1.00 36.09 ? 375 VAL A CA    1 
ATOM   1106 C C     . VAL A 1 167 ? -15.363 -30.355 6.069  1.00 35.08 ? 375 VAL A C     1 
ATOM   1107 O O     . VAL A 1 167 ? -16.290 -30.363 5.225  1.00 35.61 ? 375 VAL A O     1 
ATOM   1108 C CB    . VAL A 1 167 ? -14.047 -28.122 5.986  1.00 36.10 ? 375 VAL A CB    1 
ATOM   1109 C CG1   . VAL A 1 167 ? -15.110 -27.432 5.136  1.00 38.19 ? 375 VAL A CG1   1 
ATOM   1110 C CG2   . VAL A 1 167 ? -14.202 -27.777 7.472  1.00 36.27 ? 375 VAL A CG2   1 
ATOM   1111 N N     . TYR A 1 168 ? -15.440 -30.978 7.248  1.00 34.10 ? 376 TYR A N     1 
ATOM   1112 C CA    . TYR A 1 168 ? -16.604 -31.774 7.622  1.00 34.25 ? 376 TYR A CA    1 
ATOM   1113 C C     . TYR A 1 168 ? -17.083 -31.521 9.051  1.00 33.75 ? 376 TYR A C     1 
ATOM   1114 O O     . TYR A 1 168 ? -16.255 -31.407 9.959  1.00 32.57 ? 376 TYR A O     1 
ATOM   1115 C CB    . TYR A 1 168 ? -16.327 -33.285 7.464  1.00 33.76 ? 376 TYR A CB    1 
ATOM   1116 C CG    . TYR A 1 168 ? -16.065 -33.706 6.039  1.00 34.63 ? 376 TYR A CG    1 
ATOM   1117 C CD1   . TYR A 1 168 ? -14.747 -33.944 5.590  1.00 31.93 ? 376 TYR A CD1   1 
ATOM   1118 C CD2   . TYR A 1 168 ? -17.111 -33.868 5.131  1.00 34.17 ? 376 TYR A CD2   1 
ATOM   1119 C CE1   . TYR A 1 168 ? -14.491 -34.321 4.302  1.00 33.63 ? 376 TYR A CE1   1 
ATOM   1120 C CE2   . TYR A 1 168 ? -16.845 -34.246 3.798  1.00 32.69 ? 376 TYR A CE2   1 
ATOM   1121 C CZ    . TYR A 1 168 ? -15.522 -34.478 3.412  1.00 32.64 ? 376 TYR A CZ    1 
ATOM   1122 O OH    . TYR A 1 168 ? -15.223 -34.857 2.135  1.00 33.41 ? 376 TYR A OH    1 
ATOM   1123 N N     . PRO A 1 169 ? -18.425 -31.496 9.275  1.00 33.84 ? 377 PRO A N     1 
ATOM   1124 C CA    . PRO A 1 169 ? -19.515 -31.585 8.304  1.00 34.05 ? 377 PRO A CA    1 
ATOM   1125 C C     . PRO A 1 169 ? -19.464 -30.431 7.323  1.00 34.64 ? 377 PRO A C     1 
ATOM   1126 O O     . PRO A 1 169 ? -18.952 -29.346 7.662  1.00 34.76 ? 377 PRO A O     1 
ATOM   1127 C CB    . PRO A 1 169 ? -20.785 -31.484 9.159  1.00 33.98 ? 377 PRO A CB    1 
ATOM   1128 C CG    . PRO A 1 169 ? -20.350 -30.866 10.485 1.00 33.28 ? 377 PRO A CG    1 
ATOM   1129 C CD    . PRO A 1 169 ? -18.938 -31.416 10.656 1.00 33.86 ? 377 PRO A CD    1 
ATOM   1130 N N     . ASP A 1 170 ? -19.986 -30.663 6.119  1.00 34.09 ? 378 ASP A N     1 
ATOM   1131 C CA    . ASP A 1 170 ? -19.776 -29.690 5.052  1.00 34.62 ? 378 ASP A CA    1 
ATOM   1132 C C     . ASP A 1 170 ? -20.983 -28.808 4.820  1.00 34.12 ? 378 ASP A C     1 
ATOM   1133 O O     . ASP A 1 170 ? -20.814 -27.667 4.452  1.00 35.03 ? 378 ASP A O     1 
ATOM   1134 C CB    . ASP A 1 170 ? -19.218 -30.313 3.735  1.00 34.11 ? 378 ASP A CB    1 
ATOM   1135 C CG    . ASP A 1 170 ? -20.051 -31.462 3.217  1.00 34.44 ? 378 ASP A CG    1 
ATOM   1136 O OD1   . ASP A 1 170 ? -20.302 -31.538 1.997  1.00 35.06 ? 378 ASP A OD1   1 
ATOM   1137 O OD2   . ASP A 1 170 ? -20.422 -32.324 4.007  1.00 36.82 ? 378 ASP A OD2   1 
ATOM   1138 N N     . ILE A 1 171 ? -22.187 -29.340 5.038  1.00 33.90 ? 379 ILE A N     1 
ATOM   1139 C CA    . ILE A 1 171 ? -23.414 -28.538 4.899  1.00 35.22 ? 379 ILE A CA    1 
ATOM   1140 C C     . ILE A 1 171 ? -24.254 -28.540 6.194  1.00 35.71 ? 379 ILE A C     1 
ATOM   1141 O O     . ILE A 1 171 ? -24.414 -29.589 6.835  1.00 35.16 ? 379 ILE A O     1 
ATOM   1142 C CB    . ILE A 1 171 ? -24.247 -28.950 3.625  1.00 34.87 ? 379 ILE A CB    1 
ATOM   1143 C CG1   . ILE A 1 171 ? -23.417 -28.645 2.357  1.00 36.72 ? 379 ILE A CG1   1 
ATOM   1144 C CG2   . ILE A 1 171 ? -25.634 -28.232 3.594  1.00 35.95 ? 379 ILE A CG2   1 
ATOM   1145 C CD1   . ILE A 1 171 ? -23.867 -29.318 1.079  1.00 36.20 ? 379 ILE A CD1   1 
ATOM   1146 N N     . CYS A 1 172 ? -24.792 -27.358 6.538  1.00 35.38 ? 380 CYS A N     1 
ATOM   1147 C CA    . CYS A 1 172 ? -25.596 -27.137 7.741  1.00 37.03 ? 380 CYS A CA    1 
ATOM   1148 C C     . CYS A 1 172 ? -26.803 -26.264 7.428  1.00 35.87 ? 380 CYS A C     1 
ATOM   1149 O O     . CYS A 1 172 ? -26.702 -25.335 6.647  1.00 36.07 ? 380 CYS A O     1 
ATOM   1150 C CB    . CYS A 1 172 ? -24.746 -26.464 8.848  1.00 36.00 ? 380 CYS A CB    1 
ATOM   1151 S SG    . CYS A 1 172 ? -23.384 -27.506 9.361  1.00 46.48 ? 380 CYS A SG    1 
ATOM   1152 N N     . THR A 1 173 ? -27.946 -26.576 8.029  1.00 36.14 ? 381 THR A N     1 
ATOM   1153 C CA    . THR A 1 173 ? -29.161 -25.762 7.862  1.00 35.53 ? 381 THR A CA    1 
ATOM   1154 C C     . THR A 1 173 ? -29.822 -25.495 9.227  1.00 35.32 ? 381 THR A C     1 
ATOM   1155 O O     . THR A 1 173 ? -29.567 -26.222 10.190 1.00 34.76 ? 381 THR A O     1 
ATOM   1156 C CB    . THR A 1 173 ? -30.201 -26.412 6.913  1.00 35.82 ? 381 THR A CB    1 
ATOM   1157 O OG1   . THR A 1 173 ? -30.799 -27.533 7.561  1.00 36.38 ? 381 THR A OG1   1 
ATOM   1158 C CG2   . THR A 1 173 ? -29.594 -26.846 5.580  1.00 36.00 ? 381 THR A CG2   1 
ATOM   1159 N N     . ILE A 1 174 ? -30.644 -24.441 9.290  1.00 34.22 ? 382 ILE A N     1 
ATOM   1160 C CA    . ILE A 1 174 ? -31.325 -24.004 10.512 1.00 34.16 ? 382 ILE A CA    1 
ATOM   1161 C C     . ILE A 1 174 ? -32.776 -23.837 10.076 1.00 34.78 ? 382 ILE A C     1 
ATOM   1162 O O     . ILE A 1 174 ? -33.028 -23.300 8.995  1.00 35.05 ? 382 ILE A O     1 
ATOM   1163 C CB    . ILE A 1 174 ? -30.799 -22.649 11.065 1.00 34.19 ? 382 ILE A CB    1 
ATOM   1164 C CG1   . ILE A 1 174 ? -29.271 -22.686 11.291 1.00 31.29 ? 382 ILE A CG1   1 
ATOM   1165 C CG2   . ILE A 1 174 ? -31.501 -22.292 12.403 1.00 32.65 ? 382 ILE A CG2   1 
ATOM   1166 C CD1   . ILE A 1 174 ? -28.688 -21.420 11.856 1.00 33.81 ? 382 ILE A CD1   1 
ATOM   1167 N N     . SER A 1 175 ? -33.693 -24.378 10.867 1.00 34.26 ? 383 SER A N     1 
ATOM   1168 C CA    . SER A 1 175 ? -35.125 -24.271 10.591 1.00 34.73 ? 383 SER A CA    1 
ATOM   1169 C C     . SER A 1 175 ? -35.870 -23.732 11.799 1.00 34.72 ? 383 SER A C     1 
ATOM   1170 O O     . SER A 1 175 ? -35.383 -23.841 12.929 1.00 34.93 ? 383 SER A O     1 
ATOM   1171 C CB    . SER A 1 175 ? -35.680 -25.646 10.216 1.00 34.38 ? 383 SER A CB    1 
ATOM   1172 O OG    . SER A 1 175 ? -34.890 -26.224 9.199  1.00 34.83 ? 383 SER A OG    1 
ATOM   1173 N N     . LEU A 1 176 ? -37.043 -23.138 11.555 1.00 34.84 ? 384 LEU A N     1 
ATOM   1174 C CA    . LEU A 1 176 ? -37.951 -22.746 12.616 1.00 33.53 ? 384 LEU A CA    1 
ATOM   1175 C C     . LEU A 1 176 ? -39.256 -23.535 12.503 1.00 33.83 ? 384 LEU A C     1 
ATOM   1176 O O     . LEU A 1 176 ? -39.606 -23.998 11.425 1.00 33.33 ? 384 LEU A O     1 
ATOM   1177 C CB    . LEU A 1 176 ? -38.221 -21.243 12.558 1.00 34.46 ? 384 LEU A CB    1 
ATOM   1178 C CG    . LEU A 1 176 ? -37.034 -20.274 12.736 1.00 32.06 ? 384 LEU A CG    1 
ATOM   1179 C CD1   . LEU A 1 176 ? -37.576 -18.859 12.642 1.00 35.06 ? 384 LEU A CD1   1 
ATOM   1180 C CD2   . LEU A 1 176 ? -36.343 -20.482 14.081 1.00 32.21 ? 384 LEU A CD2   1 
ATOM   1181 N N     . VAL A 1 177 ? -39.949 -23.726 13.620 1.00 34.18 ? 385 VAL A N     1 
ATOM   1182 C CA    . VAL A 1 177 ? -41.265 -24.382 13.612 1.00 34.84 ? 385 VAL A CA    1 
ATOM   1183 C C     . VAL A 1 177 ? -42.142 -23.711 14.692 1.00 35.19 ? 385 VAL A C     1 
ATOM   1184 O O     . VAL A 1 177 ? -41.651 -23.381 15.791 1.00 34.80 ? 385 VAL A O     1 
ATOM   1185 C CB    . VAL A 1 177 ? -41.144 -25.939 13.774 1.00 35.08 ? 385 VAL A CB    1 
ATOM   1186 C CG1   . VAL A 1 177 ? -40.616 -26.347 15.179 1.00 36.56 ? 385 VAL A CG1   1 
ATOM   1187 C CG2   . VAL A 1 177 ? -42.479 -26.640 13.492 1.00 34.81 ? 385 VAL A CG2   1 
ATOM   1188 N N     . ALA A 1 178 ? -43.418 -23.475 14.365 1.00 34.90 ? 386 ALA A N     1 
ATOM   1189 C CA    . ALA A 1 178 ? -44.351 -22.873 15.296 1.00 34.96 ? 386 ALA A CA    1 
ATOM   1190 C C     . ALA A 1 178 ? -44.771 -23.906 16.340 1.00 35.27 ? 386 ALA A C     1 
ATOM   1191 O O     . ALA A 1 178 ? -44.946 -25.091 16.031 1.00 35.68 ? 386 ALA A O     1 
ATOM   1192 C CB    . ALA A 1 178 ? -45.586 -22.294 14.557 1.00 34.31 ? 386 ALA A CB    1 
ATOM   1193 N N     . VAL A 1 179 ? -44.941 -23.453 17.574 1.00 35.25 ? 387 VAL A N     1 
ATOM   1194 C CA    . VAL A 1 179 ? -45.333 -24.331 18.674 1.00 35.78 ? 387 VAL A CA    1 
ATOM   1195 C C     . VAL A 1 179 ? -46.596 -23.751 19.330 1.00 36.63 ? 387 VAL A C     1 
ATOM   1196 O O     . VAL A 1 179 ? -46.727 -22.529 19.450 1.00 34.94 ? 387 VAL A O     1 
ATOM   1197 C CB    . VAL A 1 179 ? -44.211 -24.392 19.736 1.00 35.84 ? 387 VAL A CB    1 
ATOM   1198 C CG1   . VAL A 1 179 ? -44.584 -25.330 20.940 1.00 35.95 ? 387 VAL A CG1   1 
ATOM   1199 C CG2   . VAL A 1 179 ? -42.861 -24.778 19.094 1.00 35.29 ? 387 VAL A CG2   1 
ATOM   1200 N N     . SER A 1 180 ? -47.506 -24.635 19.744 1.00 37.24 ? 388 SER A N     1 
ATOM   1201 C CA    . SER A 1 180 ? -48.576 -24.276 20.666 1.00 37.86 ? 388 SER A CA    1 
ATOM   1202 C C     . SER A 1 180 ? -48.489 -25.158 21.913 1.00 38.42 ? 388 SER A C     1 
ATOM   1203 O O     . SER A 1 180 ? -48.700 -26.372 21.855 1.00 38.48 ? 388 SER A O     1 
ATOM   1204 C CB    . SER A 1 180 ? -49.955 -24.432 20.009 1.00 38.06 ? 388 SER A CB    1 
ATOM   1205 O OG    . SER A 1 180 ? -50.987 -24.357 20.987 1.00 39.29 ? 388 SER A OG    1 
ATOM   1206 N N     . ASP A 1 181 ? -48.144 -24.555 23.040 1.00 38.43 ? 389 ASP A N     1 
ATOM   1207 C CA    . ASP A 1 181 ? -48.212 -25.262 24.307 1.00 38.61 ? 389 ASP A CA    1 
ATOM   1208 C C     . ASP A 1 181 ? -48.606 -24.233 25.375 1.00 38.09 ? 389 ASP A C     1 
ATOM   1209 O O     . ASP A 1 181 ? -47.750 -23.642 26.030 1.00 37.19 ? 389 ASP A O     1 
ATOM   1210 C CB    . ASP A 1 181 ? -46.883 -25.975 24.606 1.00 38.68 ? 389 ASP A CB    1 
ATOM   1211 C CG    . ASP A 1 181 ? -46.979 -26.979 25.755 1.00 40.94 ? 389 ASP A CG    1 
ATOM   1212 O OD1   . ASP A 1 181 ? -47.898 -26.896 26.637 1.00 39.56 ? 389 ASP A OD1   1 
ATOM   1213 O OD2   . ASP A 1 181 ? -46.078 -27.848 25.796 1.00 40.33 ? 389 ASP A OD2   1 
ATOM   1214 N N     . VAL A 1 182 ? -49.916 -24.006 25.525 1.00 37.82 ? 390 VAL A N     1 
ATOM   1215 C CA    . VAL A 1 182 ? -50.376 -22.954 26.418 1.00 37.18 ? 390 VAL A CA    1 
ATOM   1216 C C     . VAL A 1 182 ? -50.071 -23.308 27.873 1.00 36.92 ? 390 VAL A C     1 
ATOM   1217 O O     . VAL A 1 182 ? -49.677 -22.441 28.655 1.00 36.04 ? 390 VAL A O     1 
ATOM   1218 C CB    . VAL A 1 182 ? -51.877 -22.520 26.208 1.00 38.36 ? 390 VAL A CB    1 
ATOM   1219 C CG1   . VAL A 1 182 ? -52.366 -22.798 24.819 1.00 39.13 ? 390 VAL A CG1   1 
ATOM   1220 C CG2   . VAL A 1 182 ? -52.824 -23.092 27.291 1.00 38.53 ? 390 VAL A CG2   1 
ATOM   1221 N N     . ASN A 1 183 ? -50.185 -24.599 28.209 1.00 36.09 ? 391 ASN A N     1 
ATOM   1222 C CA    . ASN A 1 183 ? -49.941 -25.050 29.571 1.00 36.86 ? 391 ASN A CA    1 
ATOM   1223 C C     . ASN A 1 183 ? -48.496 -24.896 30.015 1.00 37.22 ? 391 ASN A C     1 
ATOM   1224 O O     . ASN A 1 183 ? -48.251 -24.472 31.142 1.00 36.62 ? 391 ASN A O     1 
ATOM   1225 C CB    . ASN A 1 183 ? -50.442 -26.485 29.765 1.00 36.54 ? 391 ASN A CB    1 
ATOM   1226 C CG    . ASN A 1 183 ? -51.923 -26.606 29.503 1.00 38.49 ? 391 ASN A CG    1 
ATOM   1227 O OD1   . ASN A 1 183 ? -52.611 -25.599 29.324 1.00 39.23 ? 391 ASN A OD1   1 
ATOM   1228 N ND2   . ASN A 1 183 ? -52.435 -27.840 29.484 1.00 36.82 ? 391 ASN A ND2   1 
ATOM   1229 N N     . LYS A 1 184 ? -47.560 -25.224 29.122 1.00 38.21 ? 392 LYS A N     1 
ATOM   1230 C CA    . LYS A 1 184 ? -46.120 -25.030 29.370 1.00 39.71 ? 392 LYS A CA    1 
ATOM   1231 C C     . LYS A 1 184 ? -45.787 -23.543 29.464 1.00 39.90 ? 392 LYS A C     1 
ATOM   1232 O O     . LYS A 1 184 ? -45.075 -23.115 30.380 1.00 38.86 ? 392 LYS A O     1 
ATOM   1233 C CB    . LYS A 1 184 ? -45.304 -25.663 28.260 1.00 40.25 ? 392 LYS A CB    1 
ATOM   1234 C CG    . LYS A 1 184 ? -43.863 -25.952 28.616 1.00 44.40 ? 392 LYS A CG    1 
ATOM   1235 C CD    . LYS A 1 184 ? -43.702 -27.416 28.987 1.00 48.78 ? 392 LYS A CD    1 
ATOM   1236 C CE    . LYS A 1 184 ? -42.989 -28.204 27.897 1.00 50.39 ? 392 LYS A CE    1 
ATOM   1237 N NZ    . LYS A 1 184 ? -41.582 -28.544 28.323 1.00 53.86 ? 392 LYS A NZ    1 
ATOM   1238 N N     . HIS A 1 185 ? -46.286 -22.763 28.498 1.00 40.61 ? 393 HIS A N     1 
ATOM   1239 C CA    . HIS A 1 185 ? -46.176 -21.300 28.551 1.00 42.28 ? 393 HIS A CA    1 
ATOM   1240 C C     . HIS A 1 185 ? -46.561 -20.755 29.936 1.00 42.95 ? 393 HIS A C     1 
ATOM   1241 O O     . HIS A 1 185 ? -45.829 -19.943 30.512 1.00 43.35 ? 393 HIS A O     1 
ATOM   1242 C CB    . HIS A 1 185 ? -47.045 -20.652 27.458 1.00 42.05 ? 393 HIS A CB    1 
ATOM   1243 C CG    . HIS A 1 185 ? -46.603 -19.275 27.061 1.00 43.18 ? 393 HIS A CG    1 
ATOM   1244 N ND1   . HIS A 1 185 ? -47.059 -18.137 27.694 1.00 42.37 ? 393 HIS A ND1   1 
ATOM   1245 C CD2   . HIS A 1 185 ? -45.753 -18.855 26.093 1.00 43.31 ? 393 HIS A CD2   1 
ATOM   1246 C CE1   . HIS A 1 185 ? -46.510 -17.074 27.132 1.00 44.51 ? 393 HIS A CE1   1 
ATOM   1247 N NE2   . HIS A 1 185 ? -45.714 -17.481 26.156 1.00 45.63 ? 393 HIS A NE2   1 
ATOM   1248 N N     . ALA A 1 186 ? -47.689 -21.233 30.470 1.00 44.39 ? 394 ALA A N     1 
ATOM   1249 C CA    . ALA A 1 186 ? -48.254 -20.774 31.752 1.00 45.44 ? 394 ALA A CA    1 
ATOM   1250 C C     . ALA A 1 186 ? -47.448 -21.226 32.960 1.00 46.65 ? 394 ALA A C     1 
ATOM   1251 O O     . ALA A 1 186 ? -47.333 -20.513 33.968 1.00 46.79 ? 394 ALA A O     1 
ATOM   1252 C CB    . ALA A 1 186 ? -49.675 -21.243 31.891 1.00 45.58 ? 394 ALA A CB    1 
ATOM   1253 N N     . ASP A 1 187 ? -46.870 -22.414 32.856 1.00 46.71 ? 395 ASP A N     1 
ATOM   1254 C CA    . ASP A 1 187 ? -46.068 -22.951 33.930 1.00 46.99 ? 395 ASP A CA    1 
ATOM   1255 C C     . ASP A 1 187 ? -44.844 -22.075 34.148 1.00 45.49 ? 395 ASP A C     1 
ATOM   1256 O O     . ASP A 1 187 ? -44.427 -21.846 35.284 1.00 46.22 ? 395 ASP A O     1 
ATOM   1257 C CB    . ASP A 1 187 ? -45.614 -24.359 33.577 1.00 48.12 ? 395 ASP A CB    1 
ATOM   1258 C CG    . ASP A 1 187 ? -45.858 -25.317 34.683 1.00 52.41 ? 395 ASP A CG    1 
ATOM   1259 O OD1   . ASP A 1 187 ? -45.145 -25.231 35.707 1.00 56.97 ? 395 ASP A OD1   1 
ATOM   1260 O OD2   . ASP A 1 187 ? -46.777 -26.157 34.534 1.00 57.81 ? 395 ASP A OD2   1 
ATOM   1261 N N     . ARG A 1 188 ? -44.275 -21.607 33.051 1.00 43.20 ? 396 ARG A N     1 
ATOM   1262 C CA    . ARG A 1 188 ? -43.061 -20.823 33.092 1.00 41.82 ? 396 ARG A CA    1 
ATOM   1263 C C     . ARG A 1 188 ? -43.334 -19.335 33.325 1.00 39.46 ? 396 ARG A C     1 
ATOM   1264 O O     . ARG A 1 188 ? -42.625 -18.708 34.097 1.00 39.65 ? 396 ARG A O     1 
ATOM   1265 C CB    . ARG A 1 188 ? -42.249 -21.013 31.802 1.00 40.74 ? 396 ARG A CB    1 
ATOM   1266 C CG    . ARG A 1 188 ? -40.818 -20.459 31.862 1.00 41.74 ? 396 ARG A CG    1 
ATOM   1267 C CD    . ARG A 1 188 ? -40.068 -20.735 30.561 1.00 44.22 ? 396 ARG A CD    1 
ATOM   1268 N NE    . ARG A 1 188 ? -39.325 -21.995 30.585 1.00 50.29 ? 396 ARG A NE    1 
ATOM   1269 C CZ    . ARG A 1 188 ? -39.683 -23.112 29.959 1.00 52.36 ? 396 ARG A CZ    1 
ATOM   1270 N NH1   . ARG A 1 188 ? -40.800 -23.169 29.227 1.00 54.52 ? 396 ARG A NH1   1 
ATOM   1271 N NH2   . ARG A 1 188 ? -38.908 -24.183 30.066 1.00 52.53 ? 396 ARG A NH2   1 
ATOM   1272 N N     . ILE A 1 189 ? -44.343 -18.786 32.658 1.00 37.68 ? 397 ILE A N     1 
ATOM   1273 C CA    . ILE A 1 189 ? -44.540 -17.324 32.629 1.00 36.76 ? 397 ILE A CA    1 
ATOM   1274 C C     . ILE A 1 189 ? -45.529 -16.881 33.714 1.00 35.01 ? 397 ILE A C     1 
ATOM   1275 O O     . ILE A 1 189 ? -45.242 -15.980 34.528 1.00 33.92 ? 397 ILE A O     1 
ATOM   1276 C CB    . ILE A 1 189 ? -45.017 -16.830 31.229 1.00 37.21 ? 397 ILE A CB    1 
ATOM   1277 C CG1   . ILE A 1 189 ? -44.028 -17.204 30.118 1.00 39.73 ? 397 ILE A CG1   1 
ATOM   1278 C CG2   . ILE A 1 189 ? -45.312 -15.327 31.239 1.00 36.37 ? 397 ILE A CG2   1 
ATOM   1279 C CD1   . ILE A 1 189 ? -42.694 -16.535 30.228 1.00 45.73 ? 397 ILE A CD1   1 
ATOM   1280 N N     . ALA A 1 190 ? -46.685 -17.533 33.732 1.00 32.16 ? 398 ALA A N     1 
ATOM   1281 C CA    . ALA A 1 190 ? -47.725 -17.205 34.672 1.00 33.10 ? 398 ALA A CA    1 
ATOM   1282 C C     . ALA A 1 190 ? -47.357 -17.562 36.117 1.00 31.70 ? 398 ALA A C     1 
ATOM   1283 O O     . ALA A 1 190 ? -48.005 -17.095 37.042 1.00 31.75 ? 398 ALA A O     1 
ATOM   1284 C CB    . ALA A 1 190 ? -49.036 -17.854 34.269 1.00 31.44 ? 398 ALA A CB    1 
ATOM   1285 N N     . PHE A 1 191 ? -46.328 -18.398 36.293 1.00 31.67 ? 399 PHE A N     1 
ATOM   1286 C CA    . PHE A 1 191 ? -45.744 -18.642 37.594 1.00 31.39 ? 399 PHE A CA    1 
ATOM   1287 C C     . PHE A 1 191 ? -45.579 -17.360 38.418 1.00 30.34 ? 399 PHE A C     1 
ATOM   1288 O O     . PHE A 1 191 ? -45.838 -17.332 39.641 1.00 29.53 ? 399 PHE A O     1 
ATOM   1289 C CB    . PHE A 1 191 ? -44.360 -19.287 37.472 1.00 32.34 ? 399 PHE A CB    1 
ATOM   1290 C CG    . PHE A 1 191 ? -43.663 -19.431 38.796 1.00 34.51 ? 399 PHE A CG    1 
ATOM   1291 C CD1   . PHE A 1 191 ? -44.097 -20.386 39.733 1.00 34.22 ? 399 PHE A CD1   1 
ATOM   1292 C CD2   . PHE A 1 191 ? -42.565 -18.618 39.108 1.00 34.64 ? 399 PHE A CD2   1 
ATOM   1293 C CE1   . PHE A 1 191 ? -43.456 -20.507 40.984 1.00 36.71 ? 399 PHE A CE1   1 
ATOM   1294 C CE2   . PHE A 1 191 ? -41.932 -18.726 40.340 1.00 35.19 ? 399 PHE A CE2   1 
ATOM   1295 C CZ    . PHE A 1 191 ? -42.367 -19.670 41.276 1.00 35.15 ? 399 PHE A CZ    1 
ATOM   1296 N N     . TRP A 1 192 ? -45.143 -16.307 37.740 1.00 29.87 ? 400 TRP A N     1 
ATOM   1297 C CA    . TRP A 1 192 ? -44.764 -15.058 38.401 1.00 29.72 ? 400 TRP A CA    1 
ATOM   1298 C C     . TRP A 1 192 ? -45.916 -14.193 38.858 1.00 29.45 ? 400 TRP A C     1 
ATOM   1299 O O     . TRP A 1 192 ? -45.705 -13.169 39.477 1.00 29.74 ? 400 TRP A O     1 
ATOM   1300 C CB    . TRP A 1 192 ? -43.847 -14.262 37.468 1.00 29.54 ? 400 TRP A CB    1 
ATOM   1301 C CG    . TRP A 1 192 ? -42.563 -14.999 37.197 1.00 29.34 ? 400 TRP A CG    1 
ATOM   1302 C CD1   . TRP A 1 192 ? -42.196 -15.630 36.033 1.00 30.09 ? 400 TRP A CD1   1 
ATOM   1303 C CD2   . TRP A 1 192 ? -41.488 -15.168 38.106 1.00 27.82 ? 400 TRP A CD2   1 
ATOM   1304 N NE1   . TRP A 1 192 ? -40.951 -16.211 36.196 1.00 30.19 ? 400 TRP A NE1   1 
ATOM   1305 C CE2   . TRP A 1 192 ? -40.503 -15.937 37.459 1.00 28.50 ? 400 TRP A CE2   1 
ATOM   1306 C CE3   . TRP A 1 192 ? -41.265 -14.755 39.436 1.00 26.85 ? 400 TRP A CE3   1 
ATOM   1307 C CZ2   . TRP A 1 192 ? -39.307 -16.280 38.073 1.00 27.80 ? 400 TRP A CZ2   1 
ATOM   1308 C CZ3   . TRP A 1 192 ? -40.083 -15.098 40.036 1.00 28.90 ? 400 TRP A CZ3   1 
ATOM   1309 C CH2   . TRP A 1 192 ? -39.123 -15.867 39.369 1.00 30.10 ? 400 TRP A CH2   1 
ATOM   1310 N N     . ASP A 1 193 ? -47.147 -14.558 38.545 1.00 29.57 ? 401 ASP A N     1 
ATOM   1311 C CA    . ASP A 1 193 ? -48.255 -13.692 38.955 1.00 30.74 ? 401 ASP A CA    1 
ATOM   1312 C C     . ASP A 1 193 ? -48.629 -13.699 40.423 1.00 30.91 ? 401 ASP A C     1 
ATOM   1313 O O     . ASP A 1 193 ? -49.028 -12.649 40.941 1.00 31.33 ? 401 ASP A O     1 
ATOM   1314 C CB    . ASP A 1 193 ? -49.468 -13.906 38.076 1.00 30.77 ? 401 ASP A CB    1 
ATOM   1315 C CG    . ASP A 1 193 ? -49.197 -13.430 36.654 1.00 32.92 ? 401 ASP A CG    1 
ATOM   1316 O OD1   . ASP A 1 193 ? -48.518 -12.375 36.480 1.00 35.98 ? 401 ASP A OD1   1 
ATOM   1317 O OD2   . ASP A 1 193 ? -49.576 -14.139 35.742 1.00 31.91 ? 401 ASP A OD2   1 
ATOM   1318 N N     . ASP A 1 194 ? -48.484 -14.858 41.071 1.00 30.35 ? 402 ASP A N     1 
ATOM   1319 C CA    . ASP A 1 194 ? -48.789 -15.033 42.499 1.00 29.51 ? 402 ASP A CA    1 
ATOM   1320 C C     . ASP A 1 194 ? -47.692 -15.898 43.054 1.00 28.86 ? 402 ASP A C     1 
ATOM   1321 O O     . ASP A 1 194 ? -47.747 -17.117 42.923 1.00 28.67 ? 402 ASP A O     1 
ATOM   1322 C CB    . ASP A 1 194 ? -50.116 -15.783 42.700 1.00 28.87 ? 402 ASP A CB    1 
ATOM   1323 C CG    . ASP A 1 194 ? -50.527 -15.920 44.184 1.00 34.22 ? 402 ASP A CG    1 
ATOM   1324 O OD1   . ASP A 1 194 ? -49.803 -15.445 45.083 1.00 33.35 ? 402 ASP A OD1   1 
ATOM   1325 O OD2   . ASP A 1 194 ? -51.606 -16.513 44.438 1.00 34.92 ? 402 ASP A OD2   1 
ATOM   1326 N N     . VAL A 1 195 ? -46.699 -15.297 43.690 1.00 28.17 ? 403 VAL A N     1 
ATOM   1327 C CA    . VAL A 1 195 ? -45.675 -16.137 44.333 1.00 28.54 ? 403 VAL A CA    1 
ATOM   1328 C C     . VAL A 1 195 ? -45.692 -16.008 45.866 1.00 28.44 ? 403 VAL A C     1 
ATOM   1329 O O     . VAL A 1 195 ? -45.367 -14.952 46.450 1.00 27.49 ? 403 VAL A O     1 
ATOM   1330 C CB    . VAL A 1 195 ? -44.280 -16.178 43.620 1.00 29.45 ? 403 VAL A CB    1 
ATOM   1331 C CG1   . VAL A 1 195 ? -44.256 -15.526 42.181 1.00 30.15 ? 403 VAL A CG1   1 
ATOM   1332 C CG2   . VAL A 1 195 ? -43.108 -15.875 44.514 1.00 28.85 ? 403 VAL A CG2   1 
ATOM   1333 N N     . TYR A 1 196 ? -46.214 -17.060 46.487 1.00 27.90 ? 404 TYR A N     1 
ATOM   1334 C CA    . TYR A 1 196 ? -46.483 -17.088 47.932 1.00 28.84 ? 404 TYR A CA    1 
ATOM   1335 C C     . TYR A 1 196 ? -47.282 -15.848 48.389 1.00 28.06 ? 404 TYR A C     1 
ATOM   1336 O O     . TYR A 1 196 ? -47.015 -15.246 49.445 1.00 28.22 ? 404 TYR A O     1 
ATOM   1337 C CB    . TYR A 1 196 ? -45.166 -17.293 48.719 1.00 29.82 ? 404 TYR A CB    1 
ATOM   1338 C CG    . TYR A 1 196 ? -44.492 -18.610 48.319 1.00 31.70 ? 404 TYR A CG    1 
ATOM   1339 C CD1   . TYR A 1 196 ? -43.547 -18.632 47.309 1.00 33.12 ? 404 TYR A CD1   1 
ATOM   1340 C CD2   . TYR A 1 196 ? -44.851 -19.830 48.910 1.00 34.54 ? 404 TYR A CD2   1 
ATOM   1341 C CE1   . TYR A 1 196 ? -42.930 -19.801 46.898 1.00 36.06 ? 404 TYR A CE1   1 
ATOM   1342 C CE2   . TYR A 1 196 ? -44.209 -21.058 48.504 1.00 34.57 ? 404 TYR A CE2   1 
ATOM   1343 C CZ    . TYR A 1 196 ? -43.246 -21.007 47.494 1.00 34.53 ? 404 TYR A CZ    1 
ATOM   1344 O OH    . TYR A 1 196 ? -42.578 -22.124 47.000 1.00 37.04 ? 404 TYR A OH    1 
ATOM   1345 N N     . GLY A 1 197 ? -48.201 -15.412 47.537 1.00 27.24 ? 405 GLY A N     1 
ATOM   1346 C CA    . GLY A 1 197 ? -49.154 -14.359 47.936 1.00 26.19 ? 405 GLY A CA    1 
ATOM   1347 C C     . GLY A 1 197 ? -48.770 -13.009 47.382 1.00 26.10 ? 405 GLY A C     1 
ATOM   1348 O O     . GLY A 1 197 ? -49.544 -12.045 47.492 1.00 25.98 ? 405 GLY A O     1 
ATOM   1349 N N     . PHE A 1 198 ? -47.590 -12.928 46.765 1.00 24.55 ? 406 PHE A N     1 
ATOM   1350 C CA    . PHE A 1 198 ? -47.111 -11.652 46.193 1.00 24.70 ? 406 PHE A CA    1 
ATOM   1351 C C     . PHE A 1 198 ? -47.095 -11.634 44.660 1.00 25.65 ? 406 PHE A C     1 
ATOM   1352 O O     . PHE A 1 198 ? -46.712 -12.622 44.033 1.00 25.54 ? 406 PHE A O     1 
ATOM   1353 C CB    . PHE A 1 198 ? -45.714 -11.342 46.730 1.00 23.17 ? 406 PHE A CB    1 
ATOM   1354 C CG    . PHE A 1 198 ? -45.650 -11.349 48.249 1.00 25.23 ? 406 PHE A CG    1 
ATOM   1355 C CD1   . PHE A 1 198 ? -45.121 -12.445 48.942 1.00 25.52 ? 406 PHE A CD1   1 
ATOM   1356 C CD2   . PHE A 1 198 ? -46.155 -10.275 48.983 1.00 24.02 ? 406 PHE A CD2   1 
ATOM   1357 C CE1   . PHE A 1 198 ? -45.093 -12.450 50.350 1.00 25.75 ? 406 PHE A CE1   1 
ATOM   1358 C CE2   . PHE A 1 198 ? -46.146 -10.277 50.403 1.00 24.06 ? 406 PHE A CE2   1 
ATOM   1359 C CZ    . PHE A 1 198 ? -45.628 -11.369 51.069 1.00 27.24 ? 406 PHE A CZ    1 
ATOM   1360 N N     . LYS A 1 199 ? -47.449 -10.480 44.080 1.00 26.06 ? 407 LYS A N     1 
ATOM   1361 C CA    . LYS A 1 199 ? -47.351 -10.251 42.639 1.00 28.20 ? 407 LYS A CA    1 
ATOM   1362 C C     . LYS A 1 199 ? -45.885 -10.151 42.224 1.00 27.40 ? 407 LYS A C     1 
ATOM   1363 O O     . LYS A 1 199 ? -45.116 -9.381  42.793 1.00 26.34 ? 407 LYS A O     1 
ATOM   1364 C CB    . LYS A 1 199 ? -48.007 -8.916  42.245 1.00 28.32 ? 407 LYS A CB    1 
ATOM   1365 C CG    . LYS A 1 199 ? -49.457 -8.736  42.649 1.00 31.70 ? 407 LYS A CG    1 
ATOM   1366 C CD    . LYS A 1 199 ? -50.049 -7.424  42.034 1.00 32.27 ? 407 LYS A CD    1 
ATOM   1367 C CE    . LYS A 1 199 ? -49.983 -7.336  40.462 1.00 41.48 ? 407 LYS A CE    1 
ATOM   1368 N NZ    . LYS A 1 199 ? -51.085 -6.391  39.911 1.00 41.14 ? 407 LYS A NZ    1 
ATOM   1369 N N     . MET A 1 200 ? -45.495 -10.896 41.204 1.00 27.25 ? 408 MET A N     1 
ATOM   1370 C CA    . MET A 1 200 ? -44.125 -10.715 40.649 1.00 27.09 ? 408 MET A CA    1 
ATOM   1371 C C     . MET A 1 200 ? -44.182 -10.673 39.131 1.00 27.00 ? 408 MET A C     1 
ATOM   1372 O O     . MET A 1 200 ? -43.247 -11.089 38.440 1.00 26.60 ? 408 MET A O     1 
ATOM   1373 C CB    . MET A 1 200 ? -43.177 -11.837 41.126 1.00 27.99 ? 408 MET A CB    1 
ATOM   1374 C CG    . MET A 1 200 ? -42.873 -11.877 42.648 1.00 25.20 ? 408 MET A CG    1 
ATOM   1375 S SD    . MET A 1 200 ? -41.488 -12.999 42.905 1.00 26.97 ? 408 MET A SD    1 
ATOM   1376 C CE    . MET A 1 200 ? -41.377 -12.972 44.719 1.00 25.74 ? 408 MET A CE    1 
ATOM   1377 N N     . SER A 1 201 ? -45.252 -10.074 38.611 1.00 26.94 ? 409 SER A N     1 
ATOM   1378 C CA    . SER A 1 201 ? -45.573 -10.150 37.181 1.00 27.50 ? 409 SER A CA    1 
ATOM   1379 C C     . SER A 1 201 ? -44.564 -9.425  36.294 1.00 27.84 ? 409 SER A C     1 
ATOM   1380 O O     . SER A 1 201 ? -44.397 -9.768  35.132 1.00 27.87 ? 409 SER A O     1 
ATOM   1381 C CB    . SER A 1 201 ? -46.971 -9.557  36.917 1.00 27.92 ? 409 SER A CB    1 
ATOM   1382 O OG    . SER A 1 201 ? -47.907 -10.163 37.783 1.00 31.49 ? 409 SER A OG    1 
ATOM   1383 N N     . CYS A 1 202 ? -43.905 -8.422  36.851 1.00 28.16 ? 410 CYS A N     1 
ATOM   1384 C CA    . CYS A 1 202 ? -42.817 -7.725  36.163 1.00 29.09 ? 410 CYS A CA    1 
ATOM   1385 C C     . CYS A 1 202 ? -41.647 -8.639  35.804 1.00 29.19 ? 410 CYS A C     1 
ATOM   1386 O O     . CYS A 1 202 ? -40.865 -8.335  34.886 1.00 29.42 ? 410 CYS A O     1 
ATOM   1387 C CB    . CYS A 1 202 ? -42.325 -6.545  37.027 1.00 29.27 ? 410 CYS A CB    1 
ATOM   1388 S SG    . CYS A 1 202 ? -41.918 -6.996  38.745 1.00 32.79 ? 410 CYS A SG    1 
ATOM   1389 N N     . MET A 1 203 ? -41.529 -9.767  36.495 1.00 29.11 ? 411 MET A N     1 
ATOM   1390 C CA    . MET A 1 203 ? -40.552 -10.808 36.111 1.00 28.92 ? 411 MET A CA    1 
ATOM   1391 C C     . MET A 1 203 ? -40.764 -11.413 34.716 1.00 30.09 ? 411 MET A C     1 
ATOM   1392 O O     . MET A 1 203 ? -39.814 -11.967 34.132 1.00 30.12 ? 411 MET A O     1 
ATOM   1393 C CB    . MET A 1 203 ? -40.484 -11.937 37.148 1.00 28.31 ? 411 MET A CB    1 
ATOM   1394 C CG    . MET A 1 203 ? -39.710 -11.613 38.446 1.00 31.95 ? 411 MET A CG    1 
ATOM   1395 S SD    . MET A 1 203 ? -37.942 -11.247 38.233 1.00 34.36 ? 411 MET A SD    1 
ATOM   1396 C CE    . MET A 1 203 ? -37.232 -12.856 38.152 1.00 31.20 ? 411 MET A CE    1 
ATOM   1397 N N     . LYS A 1 204 ? -41.987 -11.347 34.184 1.00 30.78 ? 412 LYS A N     1 
ATOM   1398 C CA    . LYS A 1 204 ? -42.269 -11.911 32.848 1.00 31.49 ? 412 LYS A CA    1 
ATOM   1399 C C     . LYS A 1 204 ? -41.437 -11.274 31.745 1.00 32.99 ? 412 LYS A C     1 
ATOM   1400 O O     . LYS A 1 204 ? -41.040 -11.947 30.792 1.00 32.38 ? 412 LYS A O     1 
ATOM   1401 C CB    . LYS A 1 204 ? -43.757 -11.805 32.499 1.00 30.12 ? 412 LYS A CB    1 
ATOM   1402 C CG    . LYS A 1 204 ? -44.674 -12.671 33.382 1.00 29.69 ? 412 LYS A CG    1 
ATOM   1403 C CD    . LYS A 1 204 ? -46.117 -12.323 33.081 1.00 31.54 ? 412 LYS A CD    1 
ATOM   1404 C CE    . LYS A 1 204 ? -47.047 -13.175 33.871 1.00 31.84 ? 412 LYS A CE    1 
ATOM   1405 N NZ    . LYS A 1 204 ? -48.491 -12.778 33.552 1.00 28.27 ? 412 LYS A NZ    1 
ATOM   1406 N N     . LYS A 1 205 ? -41.216 -9.964  31.881 1.00 34.70 ? 413 LYS A N     1 
ATOM   1407 C CA    . LYS A 1 205 ? -40.342 -9.172  31.043 1.00 37.02 ? 413 LYS A CA    1 
ATOM   1408 C C     . LYS A 1 205 ? -38.896 -9.651  31.096 1.00 37.25 ? 413 LYS A C     1 
ATOM   1409 O O     . LYS A 1 205 ? -38.149 -9.454  30.135 1.00 38.56 ? 413 LYS A O     1 
ATOM   1410 C CB    . LYS A 1 205 ? -40.442 -7.683  31.425 1.00 37.35 ? 413 LYS A CB    1 
ATOM   1411 C CG    . LYS A 1 205 ? -41.856 -7.101  31.204 1.00 39.69 ? 413 LYS A CG    1 
ATOM   1412 C CD    . LYS A 1 205 ? -41.986 -5.615  31.628 1.00 40.95 ? 413 LYS A CD    1 
ATOM   1413 C CE    . LYS A 1 205 ? -42.486 -5.405  33.111 1.00 44.61 ? 413 LYS A CE    1 
ATOM   1414 N NZ    . LYS A 1 205 ? -44.007 -5.548  33.400 1.00 41.63 ? 413 LYS A NZ    1 
ATOM   1415 N N     . ALA A 1 206 ? -38.505 -10.296 32.189 1.00 36.31 ? 414 ALA A N     1 
ATOM   1416 C CA    . ALA A 1 206 ? -37.167 -10.861 32.297 1.00 36.60 ? 414 ALA A CA    1 
ATOM   1417 C C     . ALA A 1 206 ? -37.103 -12.283 31.740 1.00 36.63 ? 414 ALA A C     1 
ATOM   1418 O O     . ALA A 1 206 ? -36.039 -12.754 31.350 1.00 36.40 ? 414 ALA A O     1 
ATOM   1419 C CB    . ALA A 1 206 ? -36.691 -10.831 33.776 1.00 35.45 ? 414 ALA A CB    1 
ATOM   1420 N N     . VAL A 1 207 ? -38.242 -12.974 31.729 1.00 36.67 ? 415 VAL A N     1 
ATOM   1421 C CA    . VAL A 1 207 ? -38.306 -14.361 31.271 1.00 37.57 ? 415 VAL A CA    1 
ATOM   1422 C C     . VAL A 1 207 ? -38.320 -14.470 29.750 1.00 36.65 ? 415 VAL A C     1 
ATOM   1423 O O     . VAL A 1 207 ? -37.544 -15.231 29.178 1.00 35.45 ? 415 VAL A O     1 
ATOM   1424 C CB    . VAL A 1 207 ? -39.550 -15.092 31.840 1.00 37.75 ? 415 VAL A CB    1 
ATOM   1425 C CG1   . VAL A 1 207 ? -39.702 -16.514 31.213 1.00 40.22 ? 415 VAL A CG1   1 
ATOM   1426 C CG2   . VAL A 1 207 ? -39.439 -15.166 33.319 1.00 39.01 ? 415 VAL A CG2   1 
ATOM   1427 N N     . ILE A 1 208 ? -39.219 -13.714 29.114 1.00 36.22 ? 416 ILE A N     1 
ATOM   1428 C CA    . ILE A 1 208 ? -39.467 -13.822 27.689 1.00 35.80 ? 416 ILE A CA    1 
ATOM   1429 C C     . ILE A 1 208 ? -38.170 -13.822 26.836 1.00 35.81 ? 416 ILE A C     1 
ATOM   1430 O O     . ILE A 1 208 ? -38.000 -14.698 25.990 1.00 36.50 ? 416 ILE A O     1 
ATOM   1431 C CB    . ILE A 1 208 ? -40.514 -12.756 27.193 1.00 35.86 ? 416 ILE A CB    1 
ATOM   1432 C CG1   . ILE A 1 208 ? -41.944 -13.157 27.600 1.00 35.75 ? 416 ILE A CG1   1 
ATOM   1433 C CG2   . ILE A 1 208 ? -40.415 -12.557 25.697 1.00 34.05 ? 416 ILE A CG2   1 
ATOM   1434 C CD1   . ILE A 1 208 ? -42.317 -14.611 27.249 1.00 35.24 ? 416 ILE A CD1   1 
ATOM   1435 N N     . PRO A 1 209 ? -37.258 -12.858 27.066 1.00 35.77 ? 417 PRO A N     1 
ATOM   1436 C CA    . PRO A 1 209 ? -36.055 -12.735 26.233 1.00 35.45 ? 417 PRO A CA    1 
ATOM   1437 C C     . PRO A 1 209 ? -35.018 -13.873 26.355 1.00 36.20 ? 417 PRO A C     1 
ATOM   1438 O O     . PRO A 1 209 ? -34.098 -13.930 25.538 1.00 36.46 ? 417 PRO A O     1 
ATOM   1439 C CB    . PRO A 1 209 ? -35.437 -11.423 26.719 1.00 35.53 ? 417 PRO A CB    1 
ATOM   1440 C CG    . PRO A 1 209 ? -36.584 -10.692 27.386 1.00 36.32 ? 417 PRO A CG    1 
ATOM   1441 C CD    . PRO A 1 209 ? -37.318 -11.773 28.061 1.00 34.93 ? 417 PRO A CD    1 
ATOM   1442 N N     . GLU A 1 210 ? -35.145 -14.750 27.346 1.00 34.91 ? 418 GLU A N     1 
ATOM   1443 C CA    . GLU A 1 210 ? -34.173 -15.838 27.492 1.00 35.22 ? 418 GLU A CA    1 
ATOM   1444 C C     . GLU A 1 210 ? -34.660 -17.034 26.697 1.00 34.21 ? 418 GLU A C     1 
ATOM   1445 O O     . GLU A 1 210 ? -35.681 -17.650 27.045 1.00 32.92 ? 418 GLU A O     1 
ATOM   1446 C CB    . GLU A 1 210 ? -33.926 -16.179 28.987 1.00 35.31 ? 418 GLU A CB    1 
ATOM   1447 C CG    . GLU A 1 210 ? -33.672 -14.906 29.822 1.00 40.50 ? 418 GLU A CG    1 
ATOM   1448 C CD    . GLU A 1 210 ? -32.748 -15.098 31.017 1.00 46.13 ? 418 GLU A CD    1 
ATOM   1449 O OE1   . GLU A 1 210 ? -32.682 -16.210 31.581 1.00 47.84 ? 418 GLU A OE1   1 
ATOM   1450 O OE2   . GLU A 1 210 ? -32.085 -14.103 31.397 1.00 50.54 ? 418 GLU A OE2   1 
ATOM   1451 N N     . ALA A 1 211 ? -33.959 -17.341 25.597 1.00 33.98 ? 419 ALA A N     1 
ATOM   1452 C CA    . ALA A 1 211 ? -34.288 -18.524 24.811 1.00 34.06 ? 419 ALA A CA    1 
ATOM   1453 C C     . ALA A 1 211 ? -34.118 -19.714 25.714 1.00 34.38 ? 419 ALA A C     1 
ATOM   1454 O O     . ALA A 1 211 ? -33.187 -19.758 26.509 1.00 34.22 ? 419 ALA A O     1 
ATOM   1455 C CB    . ALA A 1 211 ? -33.380 -18.646 23.602 1.00 34.66 ? 419 ALA A CB    1 
ATOM   1456 N N     . VAL A 1 212 ? -35.001 -20.694 25.575 1.00 34.82 ? 420 VAL A N     1 
ATOM   1457 C CA    . VAL A 1 212 ? -34.941 -21.907 26.383 1.00 34.97 ? 420 VAL A CA    1 
ATOM   1458 C C     . VAL A 1 212 ? -34.427 -23.074 25.531 1.00 34.88 ? 420 VAL A C     1 
ATOM   1459 O O     . VAL A 1 212 ? -34.828 -23.243 24.393 1.00 34.25 ? 420 VAL A O     1 
ATOM   1460 C CB    . VAL A 1 212 ? -36.339 -22.234 26.945 1.00 36.00 ? 420 VAL A CB    1 
ATOM   1461 C CG1   . VAL A 1 212 ? -36.351 -23.570 27.697 1.00 36.27 ? 420 VAL A CG1   1 
ATOM   1462 C CG2   . VAL A 1 212 ? -36.784 -21.126 27.887 1.00 36.94 ? 420 VAL A CG2   1 
ATOM   1463 N N     . VAL A 1 213 ? -33.524 -23.865 26.080 1.00 34.99 ? 421 VAL A N     1 
ATOM   1464 C CA    . VAL A 1 213 ? -33.055 -25.071 25.400 1.00 35.26 ? 421 VAL A CA    1 
ATOM   1465 C C     . VAL A 1 213 ? -33.797 -26.250 26.073 1.00 35.44 ? 421 VAL A C     1 
ATOM   1466 O O     . VAL A 1 213 ? -33.596 -26.506 27.246 1.00 36.06 ? 421 VAL A O     1 
ATOM   1467 C CB    . VAL A 1 213 ? -31.528 -25.243 25.534 1.00 35.10 ? 421 VAL A CB    1 
ATOM   1468 C CG1   . VAL A 1 213 ? -31.061 -26.607 24.973 1.00 35.29 ? 421 VAL A CG1   1 
ATOM   1469 C CG2   . VAL A 1 213 ? -30.773 -24.076 24.900 1.00 34.70 ? 421 VAL A CG2   1 
ATOM   1470 N N     . GLU A 1 214 ? -34.654 -26.933 25.331 1.00 35.68 ? 422 GLU A N     1 
ATOM   1471 C CA    . GLU A 1 214 ? -35.443 -28.047 25.854 1.00 37.24 ? 422 GLU A CA    1 
ATOM   1472 C C     . GLU A 1 214 ? -35.899 -28.943 24.728 1.00 37.19 ? 422 GLU A C     1 
ATOM   1473 O O     . GLU A 1 214 ? -35.946 -28.518 23.582 1.00 37.17 ? 422 GLU A O     1 
ATOM   1474 C CB    . GLU A 1 214 ? -36.690 -27.526 26.596 1.00 37.63 ? 422 GLU A CB    1 
ATOM   1475 C CG    . GLU A 1 214 ? -37.553 -26.654 25.740 1.00 37.90 ? 422 GLU A CG    1 
ATOM   1476 C CD    . GLU A 1 214 ? -38.725 -26.022 26.497 1.00 40.32 ? 422 GLU A CD    1 
ATOM   1477 O OE1   . GLU A 1 214 ? -39.515 -25.320 25.835 1.00 41.97 ? 422 GLU A OE1   1 
ATOM   1478 O OE2   . GLU A 1 214 ? -38.829 -26.194 27.746 1.00 43.02 ? 422 GLU A OE2   1 
ATOM   1479 N N     . VAL A 1 215 ? -36.265 -30.174 25.059 1.00 38.72 ? 423 VAL A N     1 
ATOM   1480 C CA    . VAL A 1 215 ? -36.822 -31.078 24.076 1.00 40.20 ? 423 VAL A CA    1 
ATOM   1481 C C     . VAL A 1 215 ? -38.323 -30.820 24.005 1.00 40.95 ? 423 VAL A C     1 
ATOM   1482 O O     . VAL A 1 215 ? -39.007 -30.851 25.029 1.00 41.08 ? 423 VAL A O     1 
ATOM   1483 C CB    . VAL A 1 215 ? -36.534 -32.562 24.397 1.00 40.39 ? 423 VAL A CB    1 
ATOM   1484 C CG1   . VAL A 1 215 ? -37.158 -33.479 23.340 1.00 40.35 ? 423 VAL A CG1   1 
ATOM   1485 C CG2   . VAL A 1 215 ? -35.017 -32.818 24.509 1.00 41.08 ? 423 VAL A CG2   1 
ATOM   1486 N N     . LEU A 1 216 ? -38.818 -30.563 22.795 1.00 41.75 ? 424 LEU A N     1 
ATOM   1487 C CA    . LEU A 1 216 ? -40.236 -30.284 22.541 1.00 43.07 ? 424 LEU A CA    1 
ATOM   1488 C C     . LEU A 1 216 ? -41.030 -31.552 22.303 1.00 43.57 ? 424 LEU A C     1 
ATOM   1489 O O     . LEU A 1 216 ? -40.564 -32.444 21.610 1.00 43.98 ? 424 LEU A O     1 
ATOM   1490 C CB    . LEU A 1 216 ? -40.349 -29.418 21.294 1.00 43.06 ? 424 LEU A CB    1 
ATOM   1491 C CG    . LEU A 1 216 ? -40.752 -27.944 21.306 1.00 44.86 ? 424 LEU A CG    1 
ATOM   1492 C CD1   . LEU A 1 216 ? -40.598 -27.246 22.646 1.00 42.04 ? 424 LEU A CD1   1 
ATOM   1493 C CD2   . LEU A 1 216 ? -39.946 -27.243 20.235 1.00 43.76 ? 424 LEU A CD2   1 
ATOM   1494 N N     . ASP A 1 217 ? -42.233 -31.631 22.864 1.00 44.65 ? 425 ASP A N     1 
ATOM   1495 C CA    . ASP A 1 217 ? -43.165 -32.706 22.539 1.00 45.41 ? 425 ASP A CA    1 
ATOM   1496 C C     . ASP A 1 217 ? -43.633 -32.507 21.101 1.00 45.37 ? 425 ASP A C     1 
ATOM   1497 O O     . ASP A 1 217 ? -44.253 -31.484 20.802 1.00 45.65 ? 425 ASP A O     1 
ATOM   1498 C CB    . ASP A 1 217 ? -44.367 -32.650 23.489 1.00 46.34 ? 425 ASP A CB    1 
ATOM   1499 C CG    . ASP A 1 217 ? -45.419 -33.732 23.202 1.00 48.74 ? 425 ASP A CG    1 
ATOM   1500 O OD1   . ASP A 1 217 ? -45.388 -34.396 22.138 1.00 49.31 ? 425 ASP A OD1   1 
ATOM   1501 O OD2   . ASP A 1 217 ? -46.305 -33.905 24.072 1.00 53.62 ? 425 ASP A OD2   1 
ATOM   1502 N N     . PRO A 1 218 ? -43.363 -33.481 20.201 1.00 45.76 ? 426 PRO A N     1 
ATOM   1503 C CA    . PRO A 1 218 ? -43.716 -33.192 18.812 1.00 45.87 ? 426 PRO A CA    1 
ATOM   1504 C C     . PRO A 1 218 ? -45.219 -32.983 18.604 1.00 45.88 ? 426 PRO A C     1 
ATOM   1505 O O     . PRO A 1 218 ? -45.592 -32.332 17.647 1.00 45.67 ? 426 PRO A O     1 
ATOM   1506 C CB    . PRO A 1 218 ? -43.177 -34.395 18.033 1.00 45.82 ? 426 PRO A CB    1 
ATOM   1507 C CG    . PRO A 1 218 ? -43.022 -35.473 19.038 1.00 46.05 ? 426 PRO A CG    1 
ATOM   1508 C CD    . PRO A 1 218 ? -42.759 -34.817 20.353 1.00 45.77 ? 426 PRO A CD    1 
ATOM   1509 N N     . LYS A 1 219 ? -46.058 -33.482 19.522 1.00 46.74 ? 427 LYS A N     1 
ATOM   1510 C CA    . LYS A 1 219 ? -47.514 -33.187 19.532 1.00 47.22 ? 427 LYS A CA    1 
ATOM   1511 C C     . LYS A 1 219 ? -47.848 -31.689 19.531 1.00 46.56 ? 427 LYS A C     1 
ATOM   1512 O O     . LYS A 1 219 ? -48.915 -31.280 19.056 1.00 46.19 ? 427 LYS A O     1 
ATOM   1513 C CB    . LYS A 1 219 ? -48.199 -33.817 20.755 1.00 47.38 ? 427 LYS A CB    1 
ATOM   1514 C CG    . LYS A 1 219 ? -48.793 -35.210 20.549 1.00 49.05 ? 427 LYS A CG    1 
ATOM   1515 C CD    . LYS A 1 219 ? -49.947 -35.501 21.572 1.00 49.47 ? 427 LYS A CD    1 
ATOM   1516 C CE    . LYS A 1 219 ? -49.560 -35.174 23.034 1.00 52.91 ? 427 LYS A CE    1 
ATOM   1517 N NZ    . LYS A 1 219 ? -48.380 -35.984 23.516 1.00 53.75 ? 427 LYS A NZ    1 
ATOM   1518 N N     . THR A 1 220 ? -46.946 -30.879 20.084 1.00 46.10 ? 428 THR A N     1 
ATOM   1519 C CA    . THR A 1 220 ? -47.188 -29.442 20.265 1.00 45.38 ? 428 THR A CA    1 
ATOM   1520 C C     . THR A 1 220 ? -46.772 -28.609 19.040 1.00 44.88 ? 428 THR A C     1 
ATOM   1521 O O     . THR A 1 220 ? -46.924 -27.384 19.016 1.00 44.75 ? 428 THR A O     1 
ATOM   1522 C CB    . THR A 1 220 ? -46.526 -28.913 21.557 1.00 45.18 ? 428 THR A CB    1 
ATOM   1523 O OG1   . THR A 1 220 ? -45.108 -28.849 21.391 1.00 46.08 ? 428 THR A OG1   1 
ATOM   1524 C CG2   . THR A 1 220 ? -46.880 -29.817 22.751 1.00 45.27 ? 428 THR A CG2   1 
ATOM   1525 N N     . LEU A 1 221 ? -46.276 -29.287 18.011 1.00 44.65 ? 429 LEU A N     1 
ATOM   1526 C CA    . LEU A 1 221 ? -45.887 -28.629 16.762 1.00 44.36 ? 429 LEU A CA    1 
ATOM   1527 C C     . LEU A 1 221 ? -47.133 -28.278 15.938 1.00 44.72 ? 429 LEU A C     1 
ATOM   1528 O O     . LEU A 1 221 ? -47.980 -29.139 15.671 1.00 44.69 ? 429 LEU A O     1 
ATOM   1529 C CB    . LEU A 1 221 ? -44.960 -29.535 15.969 1.00 44.30 ? 429 LEU A CB    1 
ATOM   1530 C CG    . LEU A 1 221 ? -43.461 -29.599 16.246 1.00 43.54 ? 429 LEU A CG    1 
ATOM   1531 C CD1   . LEU A 1 221 ? -43.023 -29.183 17.648 1.00 43.24 ? 429 LEU A CD1   1 
ATOM   1532 C CD2   . LEU A 1 221 ? -42.941 -31.007 15.896 1.00 44.53 ? 429 LEU A CD2   1 
ATOM   1533 N N     . ILE A 1 222 ? -47.249 -27.011 15.551 1.00 44.48 ? 430 ILE A N     1 
ATOM   1534 C CA    . ILE A 1 222 ? -48.446 -26.553 14.840 1.00 44.69 ? 430 ILE A CA    1 
ATOM   1535 C C     . ILE A 1 222 ? -48.198 -25.959 13.445 1.00 44.74 ? 430 ILE A C     1 
ATOM   1536 O O     . ILE A 1 222 ? -49.128 -25.447 12.829 1.00 45.30 ? 430 ILE A O     1 
ATOM   1537 C CB    . ILE A 1 222 ? -49.285 -25.564 15.666 1.00 44.21 ? 430 ILE A CB    1 
ATOM   1538 C CG1   . ILE A 1 222 ? -48.436 -24.365 16.100 1.00 42.70 ? 430 ILE A CG1   1 
ATOM   1539 C CG2   . ILE A 1 222 ? -49.990 -26.299 16.836 1.00 44.88 ? 430 ILE A CG2   1 
ATOM   1540 C CD1   . ILE A 1 222 ? -49.263 -23.114 16.446 1.00 42.25 ? 430 ILE A CD1   1 
ATOM   1541 N N     . SER A 1 223 ? -46.961 -26.000 12.968 1.00 44.56 ? 431 SER A N     1 
ATOM   1542 C CA    . SER A 1 223 ? -46.685 -25.681 11.560 1.00 44.52 ? 431 SER A CA    1 
ATOM   1543 C C     . SER A 1 223 ? -45.784 -26.731 10.905 1.00 44.67 ? 431 SER A C     1 
ATOM   1544 O O     . SER A 1 223 ? -45.219 -27.591 11.590 1.00 44.08 ? 431 SER A O     1 
ATOM   1545 C CB    . SER A 1 223 ? -46.080 -24.282 11.413 1.00 44.40 ? 431 SER A CB    1 
ATOM   1546 O OG    . SER A 1 223 ? -44.671 -24.291 11.602 1.00 44.43 ? 431 SER A OG    1 
ATOM   1547 N N     . GLU A 1 224 ? -45.680 -26.682 9.575  1.00 44.46 ? 432 GLU A N     1 
ATOM   1548 C CA    . GLU A 1 224 ? -44.571 -27.319 8.880  1.00 45.75 ? 432 GLU A CA    1 
ATOM   1549 C C     . GLU A 1 224 ? -43.340 -26.477 9.206  1.00 44.19 ? 432 GLU A C     1 
ATOM   1550 O O     . GLU A 1 224 ? -43.484 -25.291 9.458  1.00 43.52 ? 432 GLU A O     1 
ATOM   1551 C CB    . GLU A 1 224 ? -44.798 -27.314 7.348  1.00 45.71 ? 432 GLU A CB    1 
ATOM   1552 C CG    . GLU A 1 224 ? -46.253 -27.545 6.931  1.00 47.94 ? 432 GLU A CG    1 
ATOM   1553 C CD    . GLU A 1 224 ? -46.394 -27.966 5.478  1.00 48.66 ? 432 GLU A CD    1 
ATOM   1554 O OE1   . GLU A 1 224 ? -45.472 -27.677 4.667  1.00 50.94 ? 432 GLU A OE1   1 
ATOM   1555 O OE2   . GLU A 1 224 ? -47.429 -28.598 5.162  1.00 51.59 ? 432 GLU A OE2   1 
ATOM   1556 N N     . PRO A 1 225 ? -42.133 -27.076 9.178  1.00 44.30 ? 433 PRO A N     1 
ATOM   1557 C CA    . PRO A 1 225 ? -40.900 -26.287 9.425  1.00 44.00 ? 433 PRO A CA    1 
ATOM   1558 C C     . PRO A 1 225 ? -40.593 -25.320 8.287  1.00 43.29 ? 433 PRO A C     1 
ATOM   1559 O O     . PRO A 1 225 ? -41.153 -25.466 7.212  1.00 43.43 ? 433 PRO A O     1 
ATOM   1560 C CB    . PRO A 1 225 ? -39.796 -27.347 9.498  1.00 44.30 ? 433 PRO A CB    1 
ATOM   1561 C CG    . PRO A 1 225 ? -40.482 -28.670 9.550  1.00 45.07 ? 433 PRO A CG    1 
ATOM   1562 C CD    . PRO A 1 225 ? -41.830 -28.496 8.925  1.00 44.83 ? 433 PRO A CD    1 
ATOM   1563 N N     . CYS A 1 226 ? -39.722 -24.341 8.526  1.00 42.58 ? 434 CYS A N     1 
ATOM   1564 C CA    . CYS A 1 226 ? -39.281 -23.413 7.489  1.00 40.93 ? 434 CYS A CA    1 
ATOM   1565 C C     . CYS A 1 226 ? -37.776 -23.241 7.651  1.00 39.22 ? 434 CYS A C     1 
ATOM   1566 O O     . CYS A 1 226 ? -37.306 -22.973 8.756  1.00 37.48 ? 434 CYS A O     1 
ATOM   1567 C CB    . CYS A 1 226 ? -40.006 -22.060 7.610  1.00 41.42 ? 434 CYS A CB    1 
ATOM   1568 S SG    . CYS A 1 226 ? -39.660 -20.841 6.256  1.00 46.57 ? 434 CYS A SG    1 
ATOM   1569 N N     . GLY A 1 227 ? -37.023 -23.480 6.576  1.00 37.60 ? 435 GLY A N     1 
ATOM   1570 C CA    . GLY A 1 227 ? -35.557 -23.341 6.602  1.00 36.20 ? 435 GLY A CA    1 
ATOM   1571 C C     . GLY A 1 227 ? -35.304 -21.857 6.662  1.00 35.40 ? 435 GLY A C     1 
ATOM   1572 O O     . GLY A 1 227 ? -36.020 -21.119 6.036  1.00 36.21 ? 435 GLY A O     1 
ATOM   1573 N N     . ILE A 1 228 ? -34.323 -21.407 7.436  1.00 34.81 ? 436 ILE A N     1 
ATOM   1574 C CA    . ILE A 1 228 ? -34.012 -19.971 7.549  1.00 33.45 ? 436 ILE A CA    1 
ATOM   1575 C C     . ILE A 1 228 ? -32.571 -19.659 7.241  1.00 32.74 ? 436 ILE A C     1 
ATOM   1576 O O     . ILE A 1 228 ? -32.149 -18.486 7.179  1.00 31.60 ? 436 ILE A O     1 
ATOM   1577 C CB    . ILE A 1 228 ? -34.373 -19.347 8.964  1.00 33.46 ? 436 ILE A CB    1 
ATOM   1578 C CG1   . ILE A 1 228 ? -33.666 -20.107 10.116 1.00 33.27 ? 436 ILE A CG1   1 
ATOM   1579 C CG2   . ILE A 1 228 ? -35.920 -19.198 9.157  1.00 32.16 ? 436 ILE A CG2   1 
ATOM   1580 C CD1   . ILE A 1 228 ? -33.718 -19.343 11.467 1.00 33.73 ? 436 ILE A CD1   1 
ATOM   1581 N N     . LYS A 1 229 ? -31.797 -20.716 7.033  1.00 33.36 ? 437 LYS A N     1 
ATOM   1582 C CA    . LYS A 1 229 ? -30.381 -20.562 6.753  1.00 33.37 ? 437 LYS A CA    1 
ATOM   1583 C C     . LYS A 1 229 ? -29.797 -21.872 6.190  1.00 34.40 ? 437 LYS A C     1 
ATOM   1584 O O     . LYS A 1 229 ? -30.022 -22.947 6.733  1.00 33.97 ? 437 LYS A O     1 
ATOM   1585 C CB    . LYS A 1 229 ? -29.625 -20.144 8.016  1.00 32.07 ? 437 LYS A CB    1 
ATOM   1586 C CG    . LYS A 1 229 ? -28.150 -19.772 7.826  1.00 32.44 ? 437 LYS A CG    1 
ATOM   1587 C CD    . LYS A 1 229 ? -27.983 -18.600 6.895  1.00 32.50 ? 437 LYS A CD    1 
ATOM   1588 C CE    . LYS A 1 229 ? -26.605 -17.934 7.081  1.00 33.29 ? 437 LYS A CE    1 
ATOM   1589 N NZ    . LYS A 1 229 ? -26.425 -16.908 6.014  1.00 32.43 ? 437 LYS A NZ    1 
ATOM   1590 N N     . HIS A 1 230 ? -29.070 -21.739 5.089  1.00 34.65 ? 438 HIS A N     1 
ATOM   1591 C CA    . HIS A 1 230 ? -28.313 -22.807 4.491  1.00 36.36 ? 438 HIS A CA    1 
ATOM   1592 C C     . HIS A 1 230 ? -26.836 -22.374 4.600  1.00 36.33 ? 438 HIS A C     1 
ATOM   1593 O O     . HIS A 1 230 ? -26.492 -21.243 4.250  1.00 36.19 ? 438 HIS A O     1 
ATOM   1594 C CB    . HIS A 1 230 ? -28.747 -23.010 3.018  1.00 37.41 ? 438 HIS A CB    1 
ATOM   1595 C CG    . HIS A 1 230 ? -27.802 -23.879 2.243  1.00 41.50 ? 438 HIS A CG    1 
ATOM   1596 N ND1   . HIS A 1 230 ? -28.108 -25.172 1.868  1.00 45.39 ? 438 HIS A ND1   1 
ATOM   1597 C CD2   . HIS A 1 230 ? -26.527 -23.656 1.829  1.00 42.90 ? 438 HIS A CD2   1 
ATOM   1598 C CE1   . HIS A 1 230 ? -27.065 -25.704 1.252  1.00 43.36 ? 438 HIS A CE1   1 
ATOM   1599 N NE2   . HIS A 1 230 ? -26.093 -24.806 1.216  1.00 42.19 ? 438 HIS A NE2   1 
ATOM   1600 N N     . ILE A 1 231 ? -25.983 -23.231 5.157  1.00 36.13 ? 439 ILE A N     1 
ATOM   1601 C CA    . ILE A 1 231 ? -24.555 -22.920 5.259  1.00 36.45 ? 439 ILE A CA    1 
ATOM   1602 C C     . ILE A 1 231 ? -23.702 -23.976 4.532  1.00 37.39 ? 439 ILE A C     1 
ATOM   1603 O O     . ILE A 1 231 ? -23.784 -25.163 4.836  1.00 36.82 ? 439 ILE A O     1 
ATOM   1604 C CB    . ILE A 1 231 ? -24.097 -22.756 6.726  1.00 36.75 ? 439 ILE A CB    1 
ATOM   1605 C CG1   . ILE A 1 231 ? -24.845 -21.578 7.374  1.00 36.26 ? 439 ILE A CG1   1 
ATOM   1606 C CG2   . ILE A 1 231 ? -22.593 -22.438 6.810  1.00 35.81 ? 439 ILE A CG2   1 
ATOM   1607 C CD1   . ILE A 1 231 ? -24.886 -21.624 8.884  1.00 34.74 ? 439 ILE A CD1   1 
ATOM   1608 N N     . ASP A 1 232 ? -22.883 -23.512 3.586  1.00 37.30 ? 440 ASP A N     1 
ATOM   1609 C CA    . ASP A 1 232 ? -21.913 -24.349 2.883  1.00 37.94 ? 440 ASP A CA    1 
ATOM   1610 C C     . ASP A 1 232 ? -20.563 -24.045 3.527  1.00 37.88 ? 440 ASP A C     1 
ATOM   1611 O O     . ASP A 1 232 ? -20.046 -22.955 3.348  1.00 36.81 ? 440 ASP A O     1 
ATOM   1612 C CB    . ASP A 1 232 ? -21.917 -23.961 1.395  1.00 37.68 ? 440 ASP A CB    1 
ATOM   1613 C CG    . ASP A 1 232 ? -20.903 -24.737 0.578  1.00 39.68 ? 440 ASP A CG    1 
ATOM   1614 O OD1   . ASP A 1 232 ? -21.200 -25.050 -0.593 1.00 42.50 ? 440 ASP A OD1   1 
ATOM   1615 O OD2   . ASP A 1 232 ? -19.794 -25.027 1.078  1.00 45.90 ? 440 ASP A OD2   1 
ATOM   1616 N N     . CYS A 1 233 ? -19.998 -24.990 4.276  1.00 39.51 ? 441 CYS A N     1 
ATOM   1617 C CA    . CYS A 1 233 ? -18.816 -24.700 5.132  1.00 41.10 ? 441 CYS A CA    1 
ATOM   1618 C C     . CYS A 1 233 ? -17.543 -24.530 4.309  1.00 41.96 ? 441 CYS A C     1 
ATOM   1619 O O     . CYS A 1 233 ? -16.470 -24.148 4.836  1.00 42.18 ? 441 CYS A O     1 
ATOM   1620 C CB    . CYS A 1 233 ? -18.610 -25.794 6.212  1.00 41.63 ? 441 CYS A CB    1 
ATOM   1621 S SG    . CYS A 1 233 ? -20.049 -26.043 7.368  1.00 43.38 ? 441 CYS A SG    1 
ATOM   1622 N N     . HIS A 1 234 ? -17.655 -24.842 3.020  1.00 41.88 ? 442 HIS A N     1 
ATOM   1623 C CA    . HIS A 1 234 ? -16.539 -24.702 2.114  1.00 41.84 ? 442 HIS A CA    1 
ATOM   1624 C C     . HIS A 1 234 ? -16.385 -23.274 1.597  1.00 42.00 ? 442 HIS A C     1 
ATOM   1625 O O     . HIS A 1 234 ? -15.281 -22.847 1.241  1.00 42.02 ? 442 HIS A O     1 
ATOM   1626 C CB    . HIS A 1 234 ? -16.679 -25.673 0.947  1.00 42.28 ? 442 HIS A CB    1 
ATOM   1627 C CG    . HIS A 1 234 ? -16.212 -27.053 1.277  1.00 43.05 ? 442 HIS A CG    1 
ATOM   1628 N ND1   . HIS A 1 234 ? -17.078 -28.072 1.619  1.00 43.32 ? 442 HIS A ND1   1 
ATOM   1629 C CD2   . HIS A 1 234 ? -14.962 -27.570 1.362  1.00 43.28 ? 442 HIS A CD2   1 
ATOM   1630 C CE1   . HIS A 1 234 ? -16.377 -29.168 1.871  1.00 43.24 ? 442 HIS A CE1   1 
ATOM   1631 N NE2   . HIS A 1 234 ? -15.093 -28.886 1.735  1.00 42.01 ? 442 HIS A NE2   1 
ATOM   1632 N N     . THR A 1 235 ? -17.489 -22.541 1.531  1.00 41.54 ? 443 THR A N     1 
ATOM   1633 C CA    . THR A 1 235 ? -17.437 -21.240 0.875  1.00 41.19 ? 443 THR A CA    1 
ATOM   1634 C C     . THR A 1 235 ? -17.997 -20.118 1.732  1.00 40.54 ? 443 THR A C     1 
ATOM   1635 O O     . THR A 1 235 ? -17.879 -18.941 1.360  1.00 40.50 ? 443 THR A O     1 
ATOM   1636 C CB    . THR A 1 235 ? -18.132 -21.268 -0.525 1.00 41.47 ? 443 THR A CB    1 
ATOM   1637 O OG1   . THR A 1 235 ? -19.539 -21.504 -0.355 1.00 41.61 ? 443 THR A OG1   1 
ATOM   1638 C CG2   . THR A 1 235 ? -17.507 -22.362 -1.454 1.00 41.84 ? 443 THR A CG2   1 
ATOM   1639 N N     . THR A 1 236 ? -18.590 -20.471 2.872  1.00 39.57 ? 444 THR A N     1 
ATOM   1640 C CA    . THR A 1 236 ? -19.172 -19.482 3.779  1.00 38.98 ? 444 THR A CA    1 
ATOM   1641 C C     . THR A 1 236 ? -18.065 -18.663 4.444  1.00 39.25 ? 444 THR A C     1 
ATOM   1642 O O     . THR A 1 236 ? -16.944 -19.130 4.522  1.00 38.57 ? 444 THR A O     1 
ATOM   1643 C CB    . THR A 1 236 ? -20.034 -20.158 4.850  1.00 39.03 ? 444 THR A CB    1 
ATOM   1644 O OG1   . THR A 1 236 ? -20.778 -19.170 5.526  1.00 38.76 ? 444 THR A OG1   1 
ATOM   1645 C CG2   . THR A 1 236 ? -19.181 -20.915 5.882  1.00 38.31 ? 444 THR A CG2   1 
ATOM   1646 N N     . SER A 1 237 ? -18.375 -17.443 4.896  1.00 39.52 ? 445 SER A N     1 
ATOM   1647 C CA    . SER A 1 237 ? -17.404 -16.628 5.640  1.00 40.12 ? 445 SER A CA    1 
ATOM   1648 C C     . SER A 1 237 ? -18.042 -16.299 6.989  1.00 40.85 ? 445 SER A C     1 
ATOM   1649 O O     . SER A 1 237 ? -19.277 -16.449 7.134  1.00 41.40 ? 445 SER A O     1 
ATOM   1650 C CB    . SER A 1 237 ? -17.091 -15.350 4.847  1.00 39.98 ? 445 SER A CB    1 
ATOM   1651 O OG    . SER A 1 237 ? -18.201 -14.456 4.917  1.00 40.61 ? 445 SER A OG    1 
ATOM   1652 N N     . ILE A 1 238 ? -17.271 -15.834 7.977  1.00 41.19 ? 446 ILE A N     1 
ATOM   1653 C CA    . ILE A 1 238 ? -17.919 -15.509 9.271  1.00 42.37 ? 446 ILE A CA    1 
ATOM   1654 C C     . ILE A 1 238 ? -18.995 -14.422 9.090  1.00 42.15 ? 446 ILE A C     1 
ATOM   1655 O O     . ILE A 1 238 ? -20.051 -14.429 9.755  1.00 42.08 ? 446 ILE A O     1 
ATOM   1656 C CB    . ILE A 1 238 ? -16.912 -15.238 10.474 1.00 43.20 ? 446 ILE A CB    1 
ATOM   1657 C CG1   . ILE A 1 238 ? -16.386 -13.817 10.501 1.00 44.68 ? 446 ILE A CG1   1 
ATOM   1658 C CG2   . ILE A 1 238 ? -15.754 -16.257 10.471 1.00 43.72 ? 446 ILE A CG2   1 
ATOM   1659 C CD1   . ILE A 1 238 ? -17.296 -12.889 11.249 1.00 49.78 ? 446 ILE A CD1   1 
ATOM   1660 N N     . SER A 1 239 ? -18.741 -13.537 8.130  1.00 41.55 ? 447 SER A N     1 
ATOM   1661 C CA    . SER A 1 239 ? -19.688 -12.507 7.723  1.00 41.70 ? 447 SER A CA    1 
ATOM   1662 C C     . SER A 1 239 ? -21.086 -13.066 7.449  1.00 41.41 ? 447 SER A C     1 
ATOM   1663 O O     . SER A 1 239 ? -22.083 -12.472 7.866  1.00 41.06 ? 447 SER A O     1 
ATOM   1664 C CB    . SER A 1 239 ? -19.176 -11.845 6.451  1.00 41.85 ? 447 SER A CB    1 
ATOM   1665 O OG    . SER A 1 239 ? -19.693 -10.550 6.355  1.00 45.19 ? 447 SER A OG    1 
ATOM   1666 N N     . ASP A 1 240 ? -21.158 -14.209 6.761  1.00 41.45 ? 448 ASP A N     1 
ATOM   1667 C CA    . ASP A 1 240 ? -22.448 -14.831 6.411  1.00 42.34 ? 448 ASP A CA    1 
ATOM   1668 C C     . ASP A 1 240 ? -23.223 -15.414 7.607  1.00 42.28 ? 448 ASP A C     1 
ATOM   1669 O O     . ASP A 1 240 ? -24.393 -15.790 7.474  1.00 41.08 ? 448 ASP A O     1 
ATOM   1670 C CB    . ASP A 1 240 ? -22.259 -15.921 5.350  1.00 42.27 ? 448 ASP A CB    1 
ATOM   1671 C CG    . ASP A 1 240 ? -21.540 -15.422 4.122  1.00 43.84 ? 448 ASP A CG    1 
ATOM   1672 O OD1   . ASP A 1 240 ? -20.488 -16.017 3.798  1.00 43.81 ? 448 ASP A OD1   1 
ATOM   1673 O OD2   . ASP A 1 240 ? -22.017 -14.447 3.493  1.00 43.23 ? 448 ASP A OD2   1 
ATOM   1674 N N     . LEU A 1 241 ? -22.566 -15.483 8.764  1.00 43.03 ? 449 LEU A N     1 
ATOM   1675 C CA    . LEU A 1 241 ? -23.156 -16.101 9.967  1.00 44.03 ? 449 LEU A CA    1 
ATOM   1676 C C     . LEU A 1 241 ? -23.983 -15.112 10.791 1.00 44.80 ? 449 LEU A C     1 
ATOM   1677 O O     . LEU A 1 241 ? -24.539 -15.470 11.833 1.00 46.30 ? 449 LEU A O     1 
ATOM   1678 C CB    . LEU A 1 241 ? -22.062 -16.775 10.822 1.00 44.03 ? 449 LEU A CB    1 
ATOM   1679 C CG    . LEU A 1 241 ? -21.172 -17.768 10.063 1.00 43.39 ? 449 LEU A CG    1 
ATOM   1680 C CD1   . LEU A 1 241 ? -20.105 -18.321 10.980 1.00 42.90 ? 449 LEU A CD1   1 
ATOM   1681 C CD2   . LEU A 1 241 ? -21.985 -18.922 9.410  1.00 45.47 ? 449 LEU A CD2   1 
ATOM   1682 N N     . GLU A 1 242 ? -24.026 -13.876 10.294 1.00 45.12 ? 450 GLU A N     1 
ATOM   1683 C CA    . GLU A 1 242 ? -24.876 -12.754 10.734 1.00 45.16 ? 450 GLU A CA    1 
ATOM   1684 C C     . GLU A 1 242 ? -25.915 -12.615 9.655  1.00 44.03 ? 450 GLU A C     1 
ATOM   1685 O O     . GLU A 1 242 ? -25.587 -12.245 8.532  1.00 43.52 ? 450 GLU A O     1 
ATOM   1686 C CB    . GLU A 1 242 ? -24.031 -11.470 10.706 1.00 45.58 ? 450 GLU A CB    1 
ATOM   1687 C CG    . GLU A 1 242 ? -24.097 -10.618 11.961 1.00 50.17 ? 450 GLU A CG    1 
ATOM   1688 C CD    . GLU A 1 242 ? -23.392 -11.242 13.144 1.00 53.94 ? 450 GLU A CD    1 
ATOM   1689 O OE1   . GLU A 1 242 ? -23.252 -10.547 14.171 1.00 56.84 ? 450 GLU A OE1   1 
ATOM   1690 O OE2   . GLU A 1 242 ? -22.987 -12.425 13.063 1.00 55.73 ? 450 GLU A OE2   1 
ATOM   1691 N N     . PHE A 1 243 ? -27.168 -12.934 9.942  1.00 43.39 ? 451 PHE A N     1 
ATOM   1692 C CA    . PHE A 1 243 ? -28.097 -13.068 8.833  1.00 42.29 ? 451 PHE A CA    1 
ATOM   1693 C C     . PHE A 1 243 ? -29.532 -12.742 9.195  1.00 41.86 ? 451 PHE A C     1 
ATOM   1694 O O     . PHE A 1 243 ? -29.916 -12.840 10.367 1.00 40.22 ? 451 PHE A O     1 
ATOM   1695 C CB    . PHE A 1 243 ? -27.972 -14.478 8.250  1.00 41.84 ? 451 PHE A CB    1 
ATOM   1696 C CG    . PHE A 1 243 ? -28.566 -15.550 9.107  1.00 40.87 ? 451 PHE A CG    1 
ATOM   1697 C CD1   . PHE A 1 243 ? -29.887 -15.939 8.922  1.00 40.54 ? 451 PHE A CD1   1 
ATOM   1698 C CD2   . PHE A 1 243 ? -27.794 -16.209 10.067 1.00 40.31 ? 451 PHE A CD2   1 
ATOM   1699 C CE1   . PHE A 1 243 ? -30.452 -16.963 9.701  1.00 41.52 ? 451 PHE A CE1   1 
ATOM   1700 C CE2   . PHE A 1 243 ? -28.338 -17.232 10.830 1.00 39.71 ? 451 PHE A CE2   1 
ATOM   1701 C CZ    . PHE A 1 243 ? -29.677 -17.607 10.649 1.00 39.33 ? 451 PHE A CZ    1 
ATOM   1702 N N     . SER A 1 244 ? -30.289 -12.300 8.186  1.00 42.18 ? 452 SER A N     1 
ATOM   1703 C CA    . SER A 1 244 ? -31.734 -12.137 8.272  1.00 42.58 ? 452 SER A CA    1 
ATOM   1704 C C     . SER A 1 244 ? -32.456 -13.163 7.393  1.00 42.41 ? 452 SER A C     1 
ATOM   1705 O O     . SER A 1 244 ? -31.911 -13.629 6.399  1.00 42.34 ? 452 SER A O     1 
ATOM   1706 C CB    . SER A 1 244 ? -32.145 -10.731 7.830  1.00 43.14 ? 452 SER A CB    1 
ATOM   1707 O OG    . SER A 1 244 ? -31.665 -9.776  8.755  1.00 45.93 ? 452 SER A OG    1 
ATOM   1708 N N     . SER A 1 245 ? -33.695 -13.492 7.740  1.00 42.35 ? 453 SER A N     1 
ATOM   1709 C CA    . SER A 1 245 ? -34.460 -14.387 6.892  1.00 43.17 ? 453 SER A CA    1 
ATOM   1710 C C     . SER A 1 245 ? -35.936 -14.159 7.094  1.00 43.30 ? 453 SER A C     1 
ATOM   1711 O O     . SER A 1 245 ? -36.415 -13.959 8.218  1.00 42.56 ? 453 SER A O     1 
ATOM   1712 C CB    . SER A 1 245 ? -34.075 -15.865 7.102  1.00 43.61 ? 453 SER A CB    1 
ATOM   1713 O OG    . SER A 1 245 ? -34.868 -16.714 6.282  1.00 46.15 ? 453 SER A OG    1 
ATOM   1714 N N     . ASP A 1 246 ? -36.638 -14.133 5.980  1.00 42.62 ? 454 ASP A N     1 
ATOM   1715 C CA    . ASP A 1 246 ? -38.067 -14.116 5.995  1.00 44.01 ? 454 ASP A CA    1 
ATOM   1716 C C     . ASP A 1 246 ? -38.430 -15.552 6.238  1.00 44.04 ? 454 ASP A C     1 
ATOM   1717 O O     . ASP A 1 246 ? -37.650 -16.463 5.911  1.00 45.86 ? 454 ASP A O     1 
ATOM   1718 C CB    . ASP A 1 246 ? -38.587 -13.626 4.640  1.00 44.09 ? 454 ASP A CB    1 
ATOM   1719 C CG    . ASP A 1 246 ? -38.223 -12.167 4.369  1.00 45.66 ? 454 ASP A CG    1 
ATOM   1720 O OD1   . ASP A 1 246 ? -37.600 -11.518 5.221  1.00 48.76 ? 454 ASP A OD1   1 
ATOM   1721 O OD2   . ASP A 1 246 ? -38.568 -11.651 3.293  1.00 51.05 ? 454 ASP A OD2   1 
ATOM   1722 N N     . PHE A 1 247 ? -39.571 -15.789 6.844  1.00 43.52 ? 455 PHE A N     1 
ATOM   1723 C CA    . PHE A 1 247 ? -40.014 -17.162 6.962  1.00 43.98 ? 455 PHE A CA    1 
ATOM   1724 C C     . PHE A 1 247 ? -41.520 -17.203 6.832  1.00 44.22 ? 455 PHE A C     1 
ATOM   1725 O O     . PHE A 1 247 ? -42.196 -16.217 7.111  1.00 44.29 ? 455 PHE A O     1 
ATOM   1726 C CB    . PHE A 1 247 ? -39.497 -17.840 8.274  1.00 43.64 ? 455 PHE A CB    1 
ATOM   1727 C CG    . PHE A 1 247 ? -39.962 -17.184 9.561  1.00 43.42 ? 455 PHE A CG    1 
ATOM   1728 C CD1   . PHE A 1 247 ? -41.233 -17.449 10.079 1.00 44.01 ? 455 PHE A CD1   1 
ATOM   1729 C CD2   . PHE A 1 247 ? -39.118 -16.336 10.273 1.00 41.96 ? 455 PHE A CD2   1 
ATOM   1730 C CE1   . PHE A 1 247 ? -41.663 -16.852 11.281 1.00 46.08 ? 455 PHE A CE1   1 
ATOM   1731 C CE2   . PHE A 1 247 ? -39.535 -15.734 11.491 1.00 41.75 ? 455 PHE A CE2   1 
ATOM   1732 C CZ    . PHE A 1 247 ? -40.801 -15.985 11.987 1.00 43.86 ? 455 PHE A CZ    1 
ATOM   1733 N N     . THR A 1 248 ? -42.026 -18.347 6.395  1.00 44.75 ? 456 THR A N     1 
ATOM   1734 C CA    . THR A 1 248 ? -43.450 -18.608 6.393  1.00 45.58 ? 456 THR A CA    1 
ATOM   1735 C C     . THR A 1 248 ? -43.690 -19.977 7.008  1.00 46.39 ? 456 THR A C     1 
ATOM   1736 O O     . THR A 1 248 ? -43.046 -20.974 6.647  1.00 47.18 ? 456 THR A O     1 
ATOM   1737 C CB    . THR A 1 248 ? -44.056 -18.559 4.953  1.00 45.86 ? 456 THR A CB    1 
ATOM   1738 O OG1   . THR A 1 248 ? -43.566 -17.403 4.259  1.00 45.33 ? 456 THR A OG1   1 
ATOM   1739 C CG2   . THR A 1 248 ? -45.595 -18.504 5.000  1.00 45.12 ? 456 THR A CG2   1 
ATOM   1740 N N     . LEU A 1 249 ? -44.603 -20.023 7.951  1.00 47.32 ? 457 LEU A N     1 
ATOM   1741 C CA    . LEU A 1 249 ? -44.896 -21.271 8.596  1.00 48.66 ? 457 LEU A CA    1 
ATOM   1742 C C     . LEU A 1 249 ? -46.285 -21.722 8.141  1.00 49.23 ? 457 LEU A C     1 
ATOM   1743 O O     . LEU A 1 249 ? -47.270 -20.998 8.313  1.00 49.38 ? 457 LEU A O     1 
ATOM   1744 C CB    . LEU A 1 249 ? -44.751 -21.122 10.125 1.00 48.56 ? 457 LEU A CB    1 
ATOM   1745 C CG    . LEU A 1 249 ? -43.324 -20.803 10.626 1.00 48.16 ? 457 LEU A CG    1 
ATOM   1746 C CD1   . LEU A 1 249 ? -43.292 -20.173 12.020 1.00 48.50 ? 457 LEU A CD1   1 
ATOM   1747 C CD2   . LEU A 1 249 ? -42.359 -22.011 10.569 1.00 49.38 ? 457 LEU A CD2   1 
ATOM   1748 N N     . LYS A 1 250 ? -46.360 -22.891 7.508  1.00 49.68 ? 458 LYS A N     1 
ATOM   1749 C CA    . LYS A 1 250 ? -47.670 -23.360 7.085  1.00 50.87 ? 458 LYS A CA    1 
ATOM   1750 C C     . LYS A 1 250 ? -48.336 -24.100 8.239  1.00 50.64 ? 458 LYS A C     1 
ATOM   1751 O O     . LYS A 1 250 ? -47.966 -25.224 8.588  1.00 50.46 ? 458 LYS A O     1 
ATOM   1752 C CB    . LYS A 1 250 ? -47.661 -24.151 5.770  1.00 50.67 ? 458 LYS A CB    1 
ATOM   1753 C CG    . LYS A 1 250 ? -48.947 -23.898 4.949  1.00 52.16 ? 458 LYS A CG    1 
ATOM   1754 C CD    . LYS A 1 250 ? -48.966 -24.625 3.606  1.00 52.54 ? 458 LYS A CD    1 
ATOM   1755 C CE    . LYS A 1 250 ? -49.805 -25.924 3.650  1.00 54.73 ? 458 LYS A CE    1 
ATOM   1756 N NZ    . LYS A 1 250 ? -49.916 -26.586 2.304  1.00 55.08 ? 458 LYS A NZ    1 
ATOM   1757 N N     A ILE A 1 251 ? -49.316 -23.433 8.834  0.50 50.89 ? 459 ILE A N     1 
ATOM   1758 N N     B ILE A 1 251 ? -49.324 -23.438 8.825  0.50 50.65 ? 459 ILE A N     1 
ATOM   1759 C CA    A ILE A 1 251 ? -50.018 -23.950 10.001 0.50 51.30 ? 459 ILE A CA    1 
ATOM   1760 C CA    B ILE A 1 251 ? -50.021 -23.932 10.006 0.50 50.85 ? 459 ILE A CA    1 
ATOM   1761 C C     A ILE A 1 251 ? -50.799 -25.208 9.639  0.50 51.66 ? 459 ILE A C     1 
ATOM   1762 C C     B ILE A 1 251 ? -50.845 -25.181 9.680  0.50 51.40 ? 459 ILE A C     1 
ATOM   1763 O O     A ILE A 1 251 ? -51.511 -25.243 8.636  0.50 51.75 ? 459 ILE A O     1 
ATOM   1764 O O     B ILE A 1 251 ? -51.638 -25.179 8.742  0.50 51.53 ? 459 ILE A O     1 
ATOM   1765 C CB    A ILE A 1 251 ? -50.945 -22.888 10.626 0.50 51.27 ? 459 ILE A CB    1 
ATOM   1766 C CB    B ILE A 1 251 ? -50.907 -22.823 10.618 0.50 50.58 ? 459 ILE A CB    1 
ATOM   1767 C CG1   A ILE A 1 251 ? -50.130 -21.699 11.141 0.50 51.85 ? 459 ILE A CG1   1 
ATOM   1768 C CG1   B ILE A 1 251 ? -50.067 -21.572 10.960 0.50 50.23 ? 459 ILE A CG1   1 
ATOM   1769 C CG2   A ILE A 1 251 ? -51.767 -23.481 11.765 0.50 51.11 ? 459 ILE A CG2   1 
ATOM   1770 C CG2   B ILE A 1 251 ? -51.708 -23.354 11.816 0.50 50.45 ? 459 ILE A CG2   1 
ATOM   1771 C CD1   A ILE A 1 251 ? -50.115 -20.524 10.217 0.50 52.73 ? 459 ILE A CD1   1 
ATOM   1772 C CD1   B ILE A 1 251 ? -48.959 -21.769 12.021 0.50 47.69 ? 459 ILE A CD1   1 
ATOM   1773 N N     . THR A 1 252 ? -50.637 -26.239 10.455 1.00 51.70 ? 460 THR A N     1 
ATOM   1774 C CA    . THR A 1 252 ? -51.228 -27.536 10.183 1.00 52.66 ? 460 THR A CA    1 
ATOM   1775 C C     . THR A 1 252 ? -52.372 -27.803 11.156 1.00 53.06 ? 460 THR A C     1 
ATOM   1776 O O     . THR A 1 252 ? -53.111 -28.792 11.029 1.00 53.13 ? 460 THR A O     1 
ATOM   1777 C CB    . THR A 1 252 ? -50.147 -28.607 10.328 1.00 52.77 ? 460 THR A CB    1 
ATOM   1778 O OG1   . THR A 1 252 ? -48.915 -28.067 9.838  1.00 53.73 ? 460 THR A OG1   1 
ATOM   1779 C CG2   . THR A 1 252 ? -50.505 -29.865 9.520  1.00 53.94 ? 460 THR A CG2   1 
ATOM   1780 N N     . ARG A 1 253 ? -52.523 -26.901 12.121 1.00 52.86 ? 461 ARG A N     1 
ATOM   1781 C CA    . ARG A 1 253 ? -53.451 -27.112 13.202 1.00 53.28 ? 461 ARG A CA    1 
ATOM   1782 C C     . ARG A 1 253 ? -53.949 -25.777 13.738 1.00 53.03 ? 461 ARG A C     1 
ATOM   1783 O O     . ARG A 1 253 ? -53.177 -24.992 14.292 1.00 53.29 ? 461 ARG A O     1 
ATOM   1784 C CB    . ARG A 1 253 ? -52.752 -27.914 14.298 1.00 53.30 ? 461 ARG A CB    1 
ATOM   1785 C CG    . ARG A 1 253 ? -53.535 -29.103 14.779 1.00 54.41 ? 461 ARG A CG    1 
ATOM   1786 C CD    . ARG A 1 253 ? -54.093 -28.887 16.171 1.00 56.20 ? 461 ARG A CD    1 
ATOM   1787 N NE    . ARG A 1 253 ? -53.130 -29.055 17.269 1.00 58.07 ? 461 ARG A NE    1 
ATOM   1788 C CZ    . ARG A 1 253 ? -51.990 -29.755 17.238 1.00 59.73 ? 461 ARG A CZ    1 
ATOM   1789 N NH1   . ARG A 1 253 ? -51.229 -29.810 18.327 1.00 59.26 ? 461 ARG A NH1   1 
ATOM   1790 N NH2   . ARG A 1 253 ? -51.599 -30.404 16.147 1.00 61.24 ? 461 ARG A NH2   1 
ATOM   1791 N N     . THR A 1 254 ? -55.241 -25.521 13.545 1.00 52.87 ? 462 THR A N     1 
ATOM   1792 C CA    . THR A 1 254 ? -55.924 -24.388 14.174 1.00 52.57 ? 462 THR A CA    1 
ATOM   1793 C C     . THR A 1 254 ? -55.750 -24.513 15.688 1.00 51.91 ? 462 THR A C     1 
ATOM   1794 O O     . THR A 1 254 ? -56.057 -25.563 16.268 1.00 52.33 ? 462 THR A O     1 
ATOM   1795 C CB    . THR A 1 254 ? -57.433 -24.346 13.787 1.00 52.59 ? 462 THR A CB    1 
ATOM   1796 O OG1   . THR A 1 254 ? -57.566 -24.511 12.373 1.00 53.47 ? 462 THR A OG1   1 
ATOM   1797 C CG2   . THR A 1 254 ? -58.070 -23.017 14.175 1.00 52.40 ? 462 THR A CG2   1 
ATOM   1798 N N     . SER A 1 255 ? -55.222 -23.453 16.306 1.00 51.08 ? 463 SER A N     1 
ATOM   1799 C CA    . SER A 1 255 ? -54.820 -23.433 17.723 1.00 49.84 ? 463 SER A CA    1 
ATOM   1800 C C     . SER A 1 255 ? -54.199 -22.075 18.081 1.00 48.72 ? 463 SER A C     1 
ATOM   1801 O O     . SER A 1 255 ? -54.454 -21.091 17.383 1.00 48.94 ? 463 SER A O     1 
ATOM   1802 C CB    . SER A 1 255 ? -53.866 -24.587 18.067 1.00 50.41 ? 463 SER A CB    1 
ATOM   1803 O OG    . SER A 1 255 ? -52.510 -24.264 17.838 1.00 51.07 ? 463 SER A OG    1 
ATOM   1804 N N     . MET A 1 256 ? -53.421 -22.016 19.169 1.00 47.21 ? 464 MET A N     1 
ATOM   1805 C CA    . MET A 1 256 ? -52.700 -20.782 19.567 1.00 46.26 ? 464 MET A CA    1 
ATOM   1806 C C     . MET A 1 256 ? -51.173 -20.926 19.671 1.00 44.20 ? 464 MET A C     1 
ATOM   1807 O O     . MET A 1 256 ? -50.646 -21.779 20.408 1.00 42.73 ? 464 MET A O     1 
ATOM   1808 C CB    . MET A 1 256 ? -53.271 -20.141 20.845 1.00 46.28 ? 464 MET A CB    1 
ATOM   1809 C CG    . MET A 1 256 ? -54.284 -18.994 20.544 1.00 46.84 ? 464 MET A CG    1 
ATOM   1810 S SD    . MET A 1 256 ? -54.095 -17.566 21.647 1.00 51.33 ? 464 MET A SD    1 
ATOM   1811 C CE    . MET A 1 256 ? -54.917 -16.352 20.685 1.00 48.00 ? 464 MET A CE    1 
ATOM   1812 N N     . CYS A 1 257 ? -50.488 -20.071 18.920 1.00 42.22 ? 465 CYS A N     1 
ATOM   1813 C CA    . CYS A 1 257 ? -49.044 -20.033 18.867 1.00 40.86 ? 465 CYS A CA    1 
ATOM   1814 C C     . CYS A 1 257 ? -48.492 -19.388 20.126 1.00 39.95 ? 465 CYS A C     1 
ATOM   1815 O O     . CYS A 1 257 ? -48.751 -18.222 20.388 1.00 39.07 ? 465 CYS A O     1 
ATOM   1816 C CB    . CYS A 1 257 ? -48.575 -19.259 17.633 1.00 40.95 ? 465 CYS A CB    1 
ATOM   1817 S SG    . CYS A 1 257 ? -46.823 -19.565 17.310 1.00 40.88 ? 465 CYS A SG    1 
ATOM   1818 N N     . THR A 1 258 ? -47.738 -20.164 20.903 1.00 38.51 ? 466 THR A N     1 
ATOM   1819 C CA    . THR A 1 258 ? -47.181 -19.694 22.166 1.00 38.02 ? 466 THR A CA    1 
ATOM   1820 C C     . THR A 1 258 ? -45.661 -19.514 22.072 1.00 38.06 ? 466 THR A C     1 
ATOM   1821 O O     . THR A 1 258 ? -45.068 -18.783 22.852 1.00 37.60 ? 466 THR A O     1 
ATOM   1822 C CB    . THR A 1 258 ? -47.517 -20.672 23.317 1.00 37.65 ? 466 THR A CB    1 
ATOM   1823 O OG1   . THR A 1 258 ? -46.994 -21.957 22.987 1.00 36.70 ? 466 THR A OG1   1 
ATOM   1824 C CG2   . THR A 1 258 ? -49.055 -20.813 23.511 1.00 36.91 ? 466 THR A CG2   1 
ATOM   1825 N N     . ALA A 1 259 ? -45.037 -20.160 21.083 1.00 38.25 ? 467 ALA A N     1 
ATOM   1826 C CA    . ALA A 1 259 ? -43.582 -20.067 20.886 1.00 37.68 ? 467 ALA A CA    1 
ATOM   1827 C C     . ALA A 1 259 ? -43.164 -20.392 19.440 1.00 37.52 ? 467 ALA A C     1 
ATOM   1828 O O     . ALA A 1 259 ? -43.916 -21.042 18.679 1.00 36.34 ? 467 ALA A O     1 
ATOM   1829 C CB    . ALA A 1 259 ? -42.836 -21.013 21.848 1.00 37.95 ? 467 ALA A CB    1 
ATOM   1830 N N     . ILE A 1 260 ? -41.955 -19.947 19.096 1.00 36.66 ? 468 ILE A N     1 
ATOM   1831 C CA    . ILE A 1 260 ? -41.251 -20.406 17.902 1.00 36.74 ? 468 ILE A CA    1 
ATOM   1832 C C     . ILE A 1 260 ? -40.018 -21.202 18.339 1.00 36.46 ? 468 ILE A C     1 
ATOM   1833 O O     . ILE A 1 260 ? -39.264 -20.770 19.209 1.00 36.93 ? 468 ILE A O     1 
ATOM   1834 C CB    . ILE A 1 260 ? -40.842 -19.244 16.943 1.00 36.65 ? 468 ILE A CB    1 
ATOM   1835 C CG1   . ILE A 1 260 ? -42.057 -18.355 16.568 1.00 38.18 ? 468 ILE A CG1   1 
ATOM   1836 C CG2   . ILE A 1 260 ? -40.144 -19.787 15.697 1.00 36.47 ? 468 ILE A CG2   1 
ATOM   1837 C CD1   . ILE A 1 260 ? -43.175 -19.069 15.764 1.00 36.41 ? 468 ILE A CD1   1 
ATOM   1838 N N     . ALA A 1 261 ? -39.851 -22.384 17.762 1.00 35.78 ? 469 ALA A N     1 
ATOM   1839 C CA    . ALA A 1 261 ? -38.676 -23.202 18.034 1.00 36.20 ? 469 ALA A CA    1 
ATOM   1840 C C     . ALA A 1 261 ? -37.666 -23.191 16.895 1.00 36.08 ? 469 ALA A C     1 
ATOM   1841 O O     . ALA A 1 261 ? -38.041 -23.184 15.714 1.00 35.56 ? 469 ALA A O     1 
ATOM   1842 C CB    . ALA A 1 261 ? -39.084 -24.628 18.346 1.00 35.57 ? 469 ALA A CB    1 
ATOM   1843 N N     . GLY A 1 262 ? -36.378 -23.251 17.264 1.00 36.73 ? 470 GLY A N     1 
ATOM   1844 C CA    . GLY A 1 262 ? -35.305 -23.407 16.311 1.00 36.35 ? 470 GLY A CA    1 
ATOM   1845 C C     . GLY A 1 262 ? -34.512 -24.708 16.485 1.00 37.23 ? 470 GLY A C     1 
ATOM   1846 O O     . GLY A 1 262 ? -34.404 -25.264 17.595 1.00 35.94 ? 470 GLY A O     1 
ATOM   1847 N N     . TYR A 1 263 ? -33.966 -25.181 15.364 1.00 37.06 ? 471 TYR A N     1 
ATOM   1848 C CA    . TYR A 1 263 ? -33.150 -26.395 15.284 1.00 37.28 ? 471 TYR A CA    1 
ATOM   1849 C C     . TYR A 1 263 ? -32.315 -26.390 14.013 1.00 37.62 ? 471 TYR A C     1 
ATOM   1850 O O     . TYR A 1 263 ? -32.460 -25.495 13.181 1.00 37.41 ? 471 TYR A O     1 
ATOM   1851 C CB    . TYR A 1 263 ? -33.981 -27.681 15.353 1.00 37.62 ? 471 TYR A CB    1 
ATOM   1852 C CG    . TYR A 1 263 ? -34.943 -27.941 14.194 1.00 39.11 ? 471 TYR A CG    1 
ATOM   1853 C CD1   . TYR A 1 263 ? -34.561 -28.696 13.056 1.00 37.83 ? 471 TYR A CD1   1 
ATOM   1854 C CD2   . TYR A 1 263 ? -36.256 -27.451 14.256 1.00 36.77 ? 471 TYR A CD2   1 
ATOM   1855 C CE1   . TYR A 1 263 ? -35.500 -28.936 11.994 1.00 38.90 ? 471 TYR A CE1   1 
ATOM   1856 C CE2   . TYR A 1 263 ? -37.153 -27.678 13.254 1.00 38.65 ? 471 TYR A CE2   1 
ATOM   1857 C CZ    . TYR A 1 263 ? -36.789 -28.413 12.128 1.00 40.53 ? 471 TYR A CZ    1 
ATOM   1858 O OH    . TYR A 1 263 ? -37.774 -28.595 11.176 1.00 41.48 ? 471 TYR A OH    1 
ATOM   1859 N N     . PHE A 1 264 ? -31.468 -27.409 13.872 1.00 35.90 ? 472 PHE A N     1 
ATOM   1860 C CA    . PHE A 1 264 ? -30.527 -27.465 12.779 1.00 36.40 ? 472 PHE A CA    1 
ATOM   1861 C C     . PHE A 1 264 ? -30.298 -28.898 12.286 1.00 36.19 ? 472 PHE A C     1 
ATOM   1862 O O     . PHE A 1 264 ? -30.427 -29.849 13.049 1.00 35.62 ? 472 PHE A O     1 
ATOM   1863 C CB    . PHE A 1 264 ? -29.204 -26.774 13.158 1.00 34.94 ? 472 PHE A CB    1 
ATOM   1864 C CG    . PHE A 1 264 ? -28.445 -27.427 14.306 1.00 36.08 ? 472 PHE A CG    1 
ATOM   1865 C CD1   . PHE A 1 264 ? -27.528 -28.461 14.069 1.00 34.28 ? 472 PHE A CD1   1 
ATOM   1866 C CD2   . PHE A 1 264 ? -28.600 -26.969 15.612 1.00 32.01 ? 472 PHE A CD2   1 
ATOM   1867 C CE1   . PHE A 1 264 ? -26.819 -29.040 15.119 1.00 36.66 ? 472 PHE A CE1   1 
ATOM   1868 C CE2   . PHE A 1 264 ? -27.878 -27.531 16.673 1.00 35.09 ? 472 PHE A CE2   1 
ATOM   1869 C CZ    . PHE A 1 264 ? -26.990 -28.560 16.436 1.00 33.05 ? 472 PHE A CZ    1 
ATOM   1870 N N     . ASP A 1 265 ? -29.995 -29.031 10.991 1.00 36.31 ? 473 ASP A N     1 
ATOM   1871 C CA    . ASP A 1 265 ? -29.603 -30.313 10.406 1.00 36.41 ? 473 ASP A CA    1 
ATOM   1872 C C     . ASP A 1 265 ? -28.151 -30.240 9.956  1.00 35.52 ? 473 ASP A C     1 
ATOM   1873 O O     . ASP A 1 265 ? -27.678 -29.191 9.537  1.00 35.82 ? 473 ASP A O     1 
ATOM   1874 C CB    . ASP A 1 265 ? -30.508 -30.653 9.213  1.00 36.97 ? 473 ASP A CB    1 
ATOM   1875 C CG    . ASP A 1 265 ? -31.987 -30.882 9.613  1.00 38.00 ? 473 ASP A CG    1 
ATOM   1876 O OD1   . ASP A 1 265 ? -32.340 -30.982 10.800 1.00 41.70 ? 473 ASP A OD1   1 
ATOM   1877 O OD2   . ASP A 1 265 ? -32.811 -30.974 8.708  1.00 43.99 ? 473 ASP A OD2   1 
ATOM   1878 N N     . ILE A 1 266 ? -27.456 -31.373 10.035 1.00 35.43 ? 474 ILE A N     1 
ATOM   1879 C CA    . ILE A 1 266 ? -26.029 -31.455 9.728  1.00 35.37 ? 474 ILE A CA    1 
ATOM   1880 C C     . ILE A 1 266 ? -25.845 -32.532 8.642  1.00 35.35 ? 474 ILE A C     1 
ATOM   1881 O O     . ILE A 1 266 ? -26.437 -33.617 8.720  1.00 36.37 ? 474 ILE A O     1 
ATOM   1882 C CB    . ILE A 1 266 ? -25.218 -31.826 11.033 1.00 35.94 ? 474 ILE A CB    1 
ATOM   1883 C CG1   . ILE A 1 266 ? -25.472 -30.811 12.179 1.00 35.23 ? 474 ILE A CG1   1 
ATOM   1884 C CG2   . ILE A 1 266 ? -23.714 -32.034 10.748 1.00 33.86 ? 474 ILE A CG2   1 
ATOM   1885 C CD1   . ILE A 1 266 ? -24.947 -29.333 11.959 1.00 33.93 ? 474 ILE A CD1   1 
ATOM   1886 N N     . TYR A 1 267 ? -25.029 -32.233 7.640  1.00 34.99 ? 475 TYR A N     1 
ATOM   1887 C CA    . TYR A 1 267 ? -24.853 -33.102 6.467  1.00 34.85 ? 475 TYR A CA    1 
ATOM   1888 C C     . TYR A 1 267 ? -23.381 -33.376 6.254  1.00 34.11 ? 475 TYR A C     1 
ATOM   1889 O O     . TYR A 1 267 ? -22.573 -32.452 6.312  1.00 32.72 ? 475 TYR A O     1 
ATOM   1890 C CB    . TYR A 1 267 ? -25.391 -32.420 5.204  1.00 35.55 ? 475 TYR A CB    1 
ATOM   1891 C CG    . TYR A 1 267 ? -26.876 -32.150 5.234  1.00 36.33 ? 475 TYR A CG    1 
ATOM   1892 C CD1   . TYR A 1 267 ? -27.393 -30.992 5.816  1.00 38.00 ? 475 TYR A CD1   1 
ATOM   1893 C CD2   . TYR A 1 267 ? -27.763 -33.081 4.724  1.00 37.33 ? 475 TYR A CD2   1 
ATOM   1894 C CE1   . TYR A 1 267 ? -28.766 -30.754 5.850  1.00 35.91 ? 475 TYR A CE1   1 
ATOM   1895 C CE2   . TYR A 1 267 ? -29.114 -32.859 4.748  1.00 39.11 ? 475 TYR A CE2   1 
ATOM   1896 C CZ    . TYR A 1 267 ? -29.612 -31.701 5.328  1.00 38.19 ? 475 TYR A CZ    1 
ATOM   1897 O OH    . TYR A 1 267 ? -30.961 -31.505 5.331  1.00 38.74 ? 475 TYR A OH    1 
ATOM   1898 N N     . PHE A 1 268 ? -23.051 -34.648 6.006  1.00 33.47 ? 476 PHE A N     1 
ATOM   1899 C CA    . PHE A 1 268 ? -21.740 -35.033 5.511  1.00 34.48 ? 476 PHE A CA    1 
ATOM   1900 C C     . PHE A 1 268 ? -21.954 -35.533 4.070  1.00 35.02 ? 476 PHE A C     1 
ATOM   1901 O O     . PHE A 1 268 ? -22.540 -36.611 3.861  1.00 35.16 ? 476 PHE A O     1 
ATOM   1902 C CB    . PHE A 1 268 ? -21.132 -36.148 6.367  1.00 33.36 ? 476 PHE A CB    1 
ATOM   1903 C CG    . PHE A 1 268 ? -20.964 -35.789 7.832  1.00 35.10 ? 476 PHE A CG    1 
ATOM   1904 C CD1   . PHE A 1 268 ? -22.044 -35.890 8.720  1.00 32.99 ? 476 PHE A CD1   1 
ATOM   1905 C CD2   . PHE A 1 268 ? -19.736 -35.368 8.327  1.00 34.56 ? 476 PHE A CD2   1 
ATOM   1906 C CE1   . PHE A 1 268 ? -21.892 -35.589 10.092 1.00 35.01 ? 476 PHE A CE1   1 
ATOM   1907 C CE2   . PHE A 1 268 ? -19.590 -35.042 9.715  1.00 32.53 ? 476 PHE A CE2   1 
ATOM   1908 C CZ    . PHE A 1 268 ? -20.655 -35.160 10.574 1.00 32.27 ? 476 PHE A CZ    1 
ATOM   1909 N N     . GLU A 1 269 ? -21.492 -34.754 3.092  1.00 35.58 ? 477 GLU A N     1 
ATOM   1910 C CA    . GLU A 1 269 ? -21.843 -34.973 1.668  1.00 37.01 ? 477 GLU A CA    1 
ATOM   1911 C C     . GLU A 1 269 ? -20.649 -35.072 0.724  1.00 36.01 ? 477 GLU A C     1 
ATOM   1912 O O     . GLU A 1 269 ? -20.574 -35.990 -0.098 1.00 34.81 ? 477 GLU A O     1 
ATOM   1913 C CB    . GLU A 1 269 ? -22.753 -33.842 1.132  1.00 37.44 ? 477 GLU A CB    1 
ATOM   1914 C CG    . GLU A 1 269 ? -24.223 -33.905 1.539  1.00 39.82 ? 477 GLU A CG    1 
ATOM   1915 C CD    . GLU A 1 269 ? -25.057 -32.829 0.846  1.00 42.01 ? 477 GLU A CD    1 
ATOM   1916 O OE1   . GLU A 1 269 ? -26.216 -32.607 1.288  1.00 48.63 ? 477 GLU A OE1   1 
ATOM   1917 O OE2   . GLU A 1 269 ? -24.555 -32.205 -0.132 1.00 45.02 ? 477 GLU A OE2   1 
ATOM   1918 N N     . LYS A 1 270 ? -19.746 -34.101 0.800  1.00 35.27 ? 478 LYS A N     1 
ATOM   1919 C CA    . LYS A 1 270 ? -18.719 -33.952 -0.212 1.00 35.49 ? 478 LYS A CA    1 
ATOM   1920 C C     . LYS A 1 270 ? -17.812 -35.193 -0.273 1.00 35.51 ? 478 LYS A C     1 
ATOM   1921 O O     . LYS A 1 270 ? -17.272 -35.596 0.756  1.00 34.71 ? 478 LYS A O     1 
ATOM   1922 C CB    . LYS A 1 270 ? -17.853 -32.730 0.084  1.00 35.79 ? 478 LYS A CB    1 
ATOM   1923 C CG    . LYS A 1 270 ? -16.760 -32.545 -0.920 1.00 36.18 ? 478 LYS A CG    1 
ATOM   1924 C CD    . LYS A 1 270 ? -15.783 -31.432 -0.538 1.00 36.86 ? 478 LYS A CD    1 
ATOM   1925 C CE    . LYS A 1 270 ? -14.656 -31.358 -1.585 1.00 36.62 ? 478 LYS A CE    1 
ATOM   1926 N NZ    . LYS A 1 270 ? -13.798 -30.141 -1.429 1.00 38.54 ? 478 LYS A NZ    1 
ATOM   1927 N N     . ASN A 1 271 ? -17.647 -35.754 -1.476 1.00 35.28 ? 479 ASN A N     1 
ATOM   1928 C CA    . ASN A 1 271 ? -16.756 -36.901 -1.737 1.00 36.58 ? 479 ASN A CA    1 
ATOM   1929 C C     . ASN A 1 271 ? -17.283 -38.167 -1.041 1.00 37.34 ? 479 ASN A C     1 
ATOM   1930 O O     . ASN A 1 271 ? -16.581 -39.171 -0.949 1.00 36.69 ? 479 ASN A O     1 
ATOM   1931 C CB    . ASN A 1 271 ? -15.297 -36.586 -1.331 1.00 35.56 ? 479 ASN A CB    1 
ATOM   1932 C CG    . ASN A 1 271 ? -14.563 -35.634 -2.335 1.00 38.74 ? 479 ASN A CG    1 
ATOM   1933 O OD1   . ASN A 1 271 ? -13.470 -35.102 -2.047 1.00 39.53 ? 479 ASN A OD1   1 
ATOM   1934 N ND2   . ASN A 1 271 ? -15.151 -35.442 -3.504 1.00 38.51 ? 479 ASN A ND2   1 
ATOM   1935 N N     . CYS A 1 272 ? -18.527 -38.125 -0.559 1.00 38.35 ? 480 CYS A N     1 
ATOM   1936 C CA    . CYS A 1 272 ? -19.093 -39.298 0.138  1.00 40.62 ? 480 CYS A CA    1 
ATOM   1937 C C     . CYS A 1 272 ? -19.867 -40.270 -0.776 1.00 41.87 ? 480 CYS A C     1 
ATOM   1938 O O     . CYS A 1 272 ? -20.801 -39.873 -1.440 1.00 42.64 ? 480 CYS A O     1 
ATOM   1939 C CB    . CYS A 1 272 ? -19.993 -38.857 1.310  1.00 39.79 ? 480 CYS A CB    1 
ATOM   1940 S SG    . CYS A 1 272 ? -19.146 -37.940 2.617  1.00 39.20 ? 480 CYS A SG    1 
ATOM   1941 N N     . HIS A 1 273 ? -19.513 -41.551 -0.804 1.00 44.43 ? 481 HIS A N     1 
ATOM   1942 C CA    . HIS A 1 273 ? -20.484 -42.495 -1.379 1.00 45.69 ? 481 HIS A CA    1 
ATOM   1943 C C     . HIS A 1 273 ? -21.550 -42.893 -0.374 1.00 46.30 ? 481 HIS A C     1 
ATOM   1944 O O     . HIS A 1 273 ? -22.700 -43.145 -0.751 1.00 47.23 ? 481 HIS A O     1 
ATOM   1945 C CB    . HIS A 1 273 ? -19.863 -43.673 -2.131 1.00 46.72 ? 481 HIS A CB    1 
ATOM   1946 C CG    . HIS A 1 273 ? -19.175 -44.691 -1.279 1.00 48.04 ? 481 HIS A CG    1 
ATOM   1947 N ND1   . HIS A 1 273 ? -19.262 -46.044 -1.540 1.00 50.45 ? 481 HIS A ND1   1 
ATOM   1948 C CD2   . HIS A 1 273 ? -18.367 -44.565 -0.199 1.00 49.51 ? 481 HIS A CD2   1 
ATOM   1949 C CE1   . HIS A 1 273 ? -18.532 -46.710 -0.664 1.00 50.89 ? 481 HIS A CE1   1 
ATOM   1950 N NE2   . HIS A 1 273 ? -17.991 -45.835 0.171  1.00 52.29 ? 481 HIS A NE2   1 
ATOM   1951 N N     . ASN A 1 274 ? -21.180 -42.895 0.905  1.00 45.58 ? 482 ASN A N     1 
ATOM   1952 C CA    . ASN A 1 274 ? -22.141 -43.103 1.969  1.00 45.34 ? 482 ASN A CA    1 
ATOM   1953 C C     . ASN A 1 274 ? -22.358 -41.814 2.744  1.00 44.89 ? 482 ASN A C     1 
ATOM   1954 O O     . ASN A 1 274 ? -21.615 -41.511 3.693  1.00 44.17 ? 482 ASN A O     1 
ATOM   1955 C CB    . ASN A 1 274 ? -21.700 -44.242 2.881  1.00 45.47 ? 482 ASN A CB    1 
ATOM   1956 C CG    . ASN A 1 274 ? -21.547 -45.540 2.132  1.00 47.16 ? 482 ASN A CG    1 
ATOM   1957 O OD1   . ASN A 1 274 ? -22.525 -46.085 1.641  1.00 50.93 ? 482 ASN A OD1   1 
ATOM   1958 N ND2   . ASN A 1 274 ? -20.315 -46.033 2.021  1.00 45.92 ? 482 ASN A ND2   1 
ATOM   1959 N N     . ARG A 1 275 ? -23.371 -41.061 2.299  1.00 43.81 ? 483 ARG A N     1 
ATOM   1960 C CA    . ARG A 1 275 ? -23.698 -39.748 2.838  1.00 43.70 ? 483 ARG A CA    1 
ATOM   1961 C C     . ARG A 1 275 ? -24.474 -39.837 4.154  1.00 41.95 ? 483 ARG A C     1 
ATOM   1962 O O     . ARG A 1 275 ? -25.333 -40.719 4.336  1.00 42.49 ? 483 ARG A O     1 
ATOM   1963 C CB    . ARG A 1 275 ? -24.489 -38.928 1.817  1.00 43.57 ? 483 ARG A CB    1 
ATOM   1964 C CG    . ARG A 1 275 ? -23.613 -38.428 0.653  1.00 45.22 ? 483 ARG A CG    1 
ATOM   1965 C CD    . ARG A 1 275 ? -24.389 -37.592 -0.341 1.00 46.93 ? 483 ARG A CD    1 
ATOM   1966 N NE    . ARG A 1 275 ? -23.513 -36.925 -1.310 1.00 53.09 ? 483 ARG A NE    1 
ATOM   1967 C CZ    . ARG A 1 275 ? -23.899 -35.966 -2.157 1.00 54.95 ? 483 ARG A CZ    1 
ATOM   1968 N NH1   . ARG A 1 275 ? -25.158 -35.524 -2.175 1.00 54.31 ? 483 ARG A NH1   1 
ATOM   1969 N NH2   . ARG A 1 275 ? -23.011 -35.444 -2.990 1.00 55.03 ? 483 ARG A NH2   1 
ATOM   1970 N N     . VAL A 1 276 ? -24.154 -38.929 5.070  1.00 39.51 ? 484 VAL A N     1 
ATOM   1971 C CA    . VAL A 1 276 ? -24.646 -39.030 6.432  1.00 36.98 ? 484 VAL A CA    1 
ATOM   1972 C C     . VAL A 1 276 ? -25.338 -37.717 6.799  1.00 36.52 ? 484 VAL A C     1 
ATOM   1973 O O     . VAL A 1 276 ? -24.862 -36.631 6.473  1.00 35.86 ? 484 VAL A O     1 
ATOM   1974 C CB    . VAL A 1 276 ? -23.519 -39.372 7.435  1.00 37.49 ? 484 VAL A CB    1 
ATOM   1975 C CG1   . VAL A 1 276 ? -24.038 -39.307 8.890  1.00 33.67 ? 484 VAL A CG1   1 
ATOM   1976 C CG2   . VAL A 1 276 ? -22.919 -40.756 7.125  1.00 36.04 ? 484 VAL A CG2   1 
ATOM   1977 N N     . VAL A 1 277 ? -26.489 -37.819 7.440  1.00 36.56 ? 485 VAL A N     1 
ATOM   1978 C CA    . VAL A 1 277 ? -27.193 -36.623 7.900  1.00 36.45 ? 485 VAL A CA    1 
ATOM   1979 C C     . VAL A 1 277 ? -27.739 -36.884 9.307  1.00 36.74 ? 485 VAL A C     1 
ATOM   1980 O O     . VAL A 1 277 ? -28.151 -37.997 9.624  1.00 37.71 ? 485 VAL A O     1 
ATOM   1981 C CB    . VAL A 1 277 ? -28.330 -36.243 6.913  1.00 36.73 ? 485 VAL A CB    1 
ATOM   1982 C CG1   . VAL A 1 277 ? -29.241 -37.442 6.663  1.00 36.43 ? 485 VAL A CG1   1 
ATOM   1983 C CG2   . VAL A 1 277 ? -29.154 -35.032 7.429  1.00 38.17 ? 485 VAL A CG2   1 
ATOM   1984 N N     . PHE A 1 278 ? -27.713 -35.880 10.171 1.00 36.05 ? 486 PHE A N     1 
ATOM   1985 C CA    . PHE A 1 278 ? -28.553 -35.974 11.351 1.00 36.35 ? 486 PHE A CA    1 
ATOM   1986 C C     . PHE A 1 278 ? -29.331 -34.696 11.556 1.00 36.39 ? 486 PHE A C     1 
ATOM   1987 O O     . PHE A 1 278 ? -28.880 -33.609 11.168 1.00 37.03 ? 486 PHE A O     1 
ATOM   1988 C CB    . PHE A 1 278 ? -27.799 -36.469 12.610 1.00 35.63 ? 486 PHE A CB    1 
ATOM   1989 C CG    . PHE A 1 278 ? -26.852 -35.466 13.230 1.00 37.62 ? 486 PHE A CG    1 
ATOM   1990 C CD1   . PHE A 1 278 ? -27.299 -34.574 14.204 1.00 37.74 ? 486 PHE A CD1   1 
ATOM   1991 C CD2   . PHE A 1 278 ? -25.497 -35.456 12.882 1.00 36.83 ? 486 PHE A CD2   1 
ATOM   1992 C CE1   . PHE A 1 278 ? -26.414 -33.666 14.798 1.00 38.92 ? 486 PHE A CE1   1 
ATOM   1993 C CE2   . PHE A 1 278 ? -24.596 -34.569 13.468 1.00 37.69 ? 486 PHE A CE2   1 
ATOM   1994 C CZ    . PHE A 1 278 ? -25.053 -33.659 14.425 1.00 37.35 ? 486 PHE A CZ    1 
ATOM   1995 N N     . SER A 1 279 ? -30.510 -34.841 12.144 1.00 37.21 ? 487 SER A N     1 
ATOM   1996 C CA    . SER A 1 279 ? -31.323 -33.691 12.536 1.00 37.43 ? 487 SER A CA    1 
ATOM   1997 C C     . SER A 1 279 ? -31.398 -33.538 14.057 1.00 37.19 ? 487 SER A C     1 
ATOM   1998 O O     . SER A 1 279 ? -31.374 -34.537 14.809 1.00 37.31 ? 487 SER A O     1 
ATOM   1999 C CB    . SER A 1 279 ? -32.737 -33.796 11.967 1.00 37.46 ? 487 SER A CB    1 
ATOM   2000 O OG    . SER A 1 279 ? -33.452 -32.594 12.232 1.00 37.63 ? 487 SER A OG    1 
ATOM   2001 N N     . THR A 1 280 ? -31.494 -32.287 14.506 1.00 36.59 ? 488 THR A N     1 
ATOM   2002 C CA    . THR A 1 280 ? -31.715 -32.016 15.925 1.00 35.91 ? 488 THR A CA    1 
ATOM   2003 C C     . THR A 1 280 ? -33.169 -31.478 16.116 1.00 37.09 ? 488 THR A C     1 
ATOM   2004 O O     . THR A 1 280 ? -33.515 -30.959 17.169 1.00 36.85 ? 488 THR A O     1 
ATOM   2005 C CB    . THR A 1 280 ? -30.687 -31.008 16.521 1.00 35.56 ? 488 THR A CB    1 
ATOM   2006 O OG1   . THR A 1 280 ? -30.844 -29.745 15.902 1.00 34.71 ? 488 THR A OG1   1 
ATOM   2007 C CG2   . THR A 1 280 ? -29.205 -31.484 16.348 1.00 32.43 ? 488 THR A CG2   1 
ATOM   2008 N N     . GLY A 1 281 ? -34.010 -31.645 15.098 1.00 37.01 ? 489 GLY A N     1 
ATOM   2009 C CA    . GLY A 1 281 ? -35.427 -31.276 15.206 1.00 37.38 ? 489 GLY A CA    1 
ATOM   2010 C C     . GLY A 1 281 ? -36.292 -32.137 16.118 1.00 37.89 ? 489 GLY A C     1 
ATOM   2011 O O     . GLY A 1 281 ? -35.915 -33.264 16.456 1.00 37.46 ? 489 GLY A O     1 
ATOM   2012 N N     . PRO A 1 282 ? -37.465 -31.599 16.540 1.00 37.61 ? 490 PRO A N     1 
ATOM   2013 C CA    . PRO A 1 282 ? -38.373 -32.247 17.509 1.00 39.00 ? 490 PRO A CA    1 
ATOM   2014 C C     . PRO A 1 282 ? -38.986 -33.534 16.980 1.00 40.12 ? 490 PRO A C     1 
ATOM   2015 O O     . PRO A 1 282 ? -39.447 -34.373 17.770 1.00 40.99 ? 490 PRO A O     1 
ATOM   2016 C CB    . PRO A 1 282 ? -39.477 -31.209 17.734 1.00 38.56 ? 490 PRO A CB    1 
ATOM   2017 C CG    . PRO A 1 282 ? -39.375 -30.280 16.585 1.00 37.74 ? 490 PRO A CG    1 
ATOM   2018 C CD    . PRO A 1 282 ? -37.961 -30.290 16.102 1.00 37.83 ? 490 PRO A CD    1 
ATOM   2019 N N     . GLN A 1 283 ? -38.973 -33.677 15.657 1.00 41.39 ? 491 GLN A N     1 
ATOM   2020 C CA    . GLN A 1 283 ? -39.471 -34.867 14.989 1.00 42.39 ? 491 GLN A CA    1 
ATOM   2021 C C     . GLN A 1 283 ? -38.453 -36.009 15.040 1.00 42.10 ? 491 GLN A C     1 
ATOM   2022 O O     . GLN A 1 283 ? -38.802 -37.174 14.806 1.00 42.39 ? 491 GLN A O     1 
ATOM   2023 C CB    . GLN A 1 283 ? -39.831 -34.538 13.538 1.00 43.17 ? 491 GLN A CB    1 
ATOM   2024 C CG    . GLN A 1 283 ? -40.982 -33.551 13.389 1.00 46.37 ? 491 GLN A CG    1 
ATOM   2025 C CD    . GLN A 1 283 ? -42.337 -34.191 13.664 1.00 51.39 ? 491 GLN A CD    1 
ATOM   2026 O OE1   . GLN A 1 283 ? -42.480 -35.040 14.557 1.00 52.70 ? 491 GLN A OE1   1 
ATOM   2027 N NE2   . GLN A 1 283 ? -43.340 -33.796 12.885 1.00 51.60 ? 491 GLN A NE2   1 
ATOM   2028 N N     . SER A 1 284 ? -37.209 -35.683 15.373 1.00 41.15 ? 492 SER A N     1 
ATOM   2029 C CA    . SER A 1 284 ? -36.130 -36.687 15.419 1.00 41.48 ? 492 SER A CA    1 
ATOM   2030 C C     . SER A 1 284 ? -35.720 -37.037 16.842 1.00 40.69 ? 492 SER A C     1 
ATOM   2031 O O     . SER A 1 284 ? -35.939 -36.264 17.763 1.00 40.85 ? 492 SER A O     1 
ATOM   2032 C CB    . SER A 1 284 ? -34.900 -36.178 14.671 1.00 40.49 ? 492 SER A CB    1 
ATOM   2033 O OG    . SER A 1 284 ? -35.249 -35.773 13.378 1.00 40.40 ? 492 SER A OG    1 
ATOM   2034 N N     . THR A 1 285 ? -35.105 -38.207 16.987 1.00 40.49 ? 493 THR A N     1 
ATOM   2035 C CA    . THR A 1 285 ? -34.420 -38.623 18.202 1.00 39.97 ? 493 THR A CA    1 
ATOM   2036 C C     . THR A 1 285 ? -33.709 -37.438 18.835 1.00 39.37 ? 493 THR A C     1 
ATOM   2037 O O     . THR A 1 285 ? -32.993 -36.698 18.156 1.00 38.93 ? 493 THR A O     1 
ATOM   2038 C CB    . THR A 1 285 ? -33.393 -39.739 17.869 1.00 40.51 ? 493 THR A CB    1 
ATOM   2039 O OG1   . THR A 1 285 ? -34.072 -40.797 17.192 1.00 41.60 ? 493 THR A OG1   1 
ATOM   2040 C CG2   . THR A 1 285 ? -32.751 -40.293 19.122 1.00 40.14 ? 493 THR A CG2   1 
ATOM   2041 N N     . LYS A 1 286 ? -33.948 -37.228 20.126 1.00 38.74 ? 494 LYS A N     1 
ATOM   2042 C CA    . LYS A 1 286 ? -33.288 -36.145 20.840 1.00 38.35 ? 494 LYS A CA    1 
ATOM   2043 C C     . LYS A 1 286 ? -31.760 -36.267 20.823 1.00 36.51 ? 494 LYS A C     1 
ATOM   2044 O O     . LYS A 1 286 ? -31.174 -37.360 20.847 1.00 36.86 ? 494 LYS A O     1 
ATOM   2045 C CB    . LYS A 1 286 ? -33.811 -36.001 22.284 1.00 38.59 ? 494 LYS A CB    1 
ATOM   2046 C CG    . LYS A 1 286 ? -33.610 -37.226 23.154 1.00 40.62 ? 494 LYS A CG    1 
ATOM   2047 C CD    . LYS A 1 286 ? -34.032 -36.937 24.601 1.00 41.62 ? 494 LYS A CD    1 
ATOM   2048 C CE    . LYS A 1 286 ? -33.461 -37.966 25.579 1.00 47.36 ? 494 LYS A CE    1 
ATOM   2049 N NZ    . LYS A 1 286 ? -34.007 -39.363 25.343 1.00 50.00 ? 494 LYS A NZ    1 
ATOM   2050 N N     . THR A 1 287 ? -31.130 -35.113 20.755 1.00 35.59 ? 495 THR A N     1 
ATOM   2051 C CA    . THR A 1 287 ? -29.702 -34.992 20.890 1.00 34.89 ? 495 THR A CA    1 
ATOM   2052 C C     . THR A 1 287 ? -29.460 -34.107 22.099 1.00 33.54 ? 495 THR A C     1 
ATOM   2053 O O     . THR A 1 287 ? -30.408 -33.642 22.726 1.00 33.95 ? 495 THR A O     1 
ATOM   2054 C CB    . THR A 1 287 ? -29.080 -34.361 19.638 1.00 34.21 ? 495 THR A CB    1 
ATOM   2055 O OG1   . THR A 1 287 ? -29.507 -32.999 19.541 1.00 35.11 ? 495 THR A OG1   1 
ATOM   2056 C CG2   . THR A 1 287 ? -29.479 -35.114 18.382 1.00 34.10 ? 495 THR A CG2   1 
ATOM   2057 N N     . HIS A 1 288 ? -28.203 -33.838 22.416 1.00 33.16 ? 496 HIS A N     1 
ATOM   2058 C CA    . HIS A 1 288 ? -27.904 -32.991 23.572 1.00 33.78 ? 496 HIS A CA    1 
ATOM   2059 C C     . HIS A 1 288 ? -28.167 -31.514 23.285 1.00 33.37 ? 496 HIS A C     1 
ATOM   2060 O O     . HIS A 1 288 ? -28.233 -30.703 24.207 1.00 33.55 ? 496 HIS A O     1 
ATOM   2061 C CB    . HIS A 1 288 ? -26.464 -33.204 24.052 1.00 32.97 ? 496 HIS A CB    1 
ATOM   2062 C CG    . HIS A 1 288 ? -25.421 -32.521 23.221 1.00 36.22 ? 496 HIS A CG    1 
ATOM   2063 N ND1   . HIS A 1 288 ? -24.965 -33.035 22.021 1.00 36.56 ? 496 HIS A ND1   1 
ATOM   2064 C CD2   . HIS A 1 288 ? -24.703 -31.387 23.437 1.00 39.01 ? 496 HIS A CD2   1 
ATOM   2065 C CE1   . HIS A 1 288 ? -24.017 -32.251 21.537 1.00 34.51 ? 496 HIS A CE1   1 
ATOM   2066 N NE2   . HIS A 1 288 ? -23.844 -31.243 22.370 1.00 36.14 ? 496 HIS A NE2   1 
ATOM   2067 N N     . TRP A 1 289 ? -28.279 -31.165 22.000 1.00 33.27 ? 497 TRP A N     1 
ATOM   2068 C CA    . TRP A 1 289 ? -28.654 -29.805 21.588 1.00 33.15 ? 497 TRP A CA    1 
ATOM   2069 C C     . TRP A 1 289 ? -30.129 -29.529 21.795 1.00 32.89 ? 497 TRP A C     1 
ATOM   2070 O O     . TRP A 1 289 ? -30.541 -28.384 21.819 1.00 32.74 ? 497 TRP A O     1 
ATOM   2071 C CB    . TRP A 1 289 ? -28.330 -29.587 20.116 1.00 33.12 ? 497 TRP A CB    1 
ATOM   2072 C CG    . TRP A 1 289 ? -26.853 -29.474 19.832 1.00 32.00 ? 497 TRP A CG    1 
ATOM   2073 C CD1   . TRP A 1 289 ? -26.038 -28.417 20.121 1.00 33.41 ? 497 TRP A CD1   1 
ATOM   2074 C CD2   . TRP A 1 289 ? -26.020 -30.477 19.232 1.00 33.71 ? 497 TRP A CD2   1 
ATOM   2075 N NE1   . TRP A 1 289 ? -24.752 -28.690 19.727 1.00 33.53 ? 497 TRP A NE1   1 
ATOM   2076 C CE2   . TRP A 1 289 ? -24.714 -29.939 19.158 1.00 32.38 ? 497 TRP A CE2   1 
ATOM   2077 C CE3   . TRP A 1 289 ? -26.257 -31.766 18.730 1.00 31.75 ? 497 TRP A CE3   1 
ATOM   2078 C CZ2   . TRP A 1 289 ? -23.638 -30.650 18.614 1.00 32.75 ? 497 TRP A CZ2   1 
ATOM   2079 C CZ3   . TRP A 1 289 ? -25.181 -32.479 18.165 1.00 33.86 ? 497 TRP A CZ3   1 
ATOM   2080 C CH2   . TRP A 1 289 ? -23.889 -31.919 18.126 1.00 33.52 ? 497 TRP A CH2   1 
ATOM   2081 N N     . LYS A 1 290 ? -30.930 -30.591 21.896 1.00 33.27 ? 498 LYS A N     1 
ATOM   2082 C CA    . LYS A 1 290 ? -32.393 -30.481 22.074 1.00 32.63 ? 498 LYS A CA    1 
ATOM   2083 C C     . LYS A 1 290 ? -32.997 -29.556 21.014 1.00 33.75 ? 498 LYS A C     1 
ATOM   2084 O O     . LYS A 1 290 ? -32.707 -29.699 19.820 1.00 34.24 ? 498 LYS A O     1 
ATOM   2085 C CB    . LYS A 1 290 ? -32.732 -30.049 23.522 1.00 32.59 ? 498 LYS A CB    1 
ATOM   2086 C CG    . LYS A 1 290 ? -31.944 -30.841 24.595 1.00 30.46 ? 498 LYS A CG    1 
ATOM   2087 C CD    . LYS A 1 290 ? -32.338 -30.438 26.020 1.00 34.91 ? 498 LYS A CD    1 
ATOM   2088 C CE    . LYS A 1 290 ? -31.628 -31.329 27.022 1.00 37.68 ? 498 LYS A CE    1 
ATOM   2089 N NZ    . LYS A 1 290 ? -32.014 -30.923 28.421 1.00 42.45 ? 498 LYS A NZ    1 
ATOM   2090 N N     . GLN A 1 291 ? -33.856 -28.627 21.426 1.00 33.44 ? 499 GLN A N     1 
ATOM   2091 C CA    . GLN A 1 291 ? -34.303 -27.536 20.537 1.00 34.03 ? 499 GLN A CA    1 
ATOM   2092 C C     . GLN A 1 291 ? -34.172 -26.191 21.276 1.00 34.04 ? 499 GLN A C     1 
ATOM   2093 O O     . GLN A 1 291 ? -34.111 -26.147 22.512 1.00 34.25 ? 499 GLN A O     1 
ATOM   2094 C CB    . GLN A 1 291 ? -35.751 -27.750 20.090 1.00 34.25 ? 499 GLN A CB    1 
ATOM   2095 C CG    . GLN A 1 291 ? -35.942 -28.856 19.099 1.00 34.30 ? 499 GLN A CG    1 
ATOM   2096 C CD    . GLN A 1 291 ? -36.161 -30.195 19.747 1.00 36.55 ? 499 GLN A CD    1 
ATOM   2097 O OE1   . GLN A 1 291 ? -37.094 -30.373 20.540 1.00 36.66 ? 499 GLN A OE1   1 
ATOM   2098 N NE2   . GLN A 1 291 ? -35.302 -31.158 19.419 1.00 33.96 ? 499 GLN A NE2   1 
ATOM   2099 N N     . THR A 1 292 ? -34.070 -25.106 20.517 1.00 33.63 ? 500 THR A N     1 
ATOM   2100 C CA    . THR A 1 292 ? -34.043 -23.755 21.099 1.00 34.63 ? 500 THR A CA    1 
ATOM   2101 C C     . THR A 1 292 ? -35.435 -23.135 20.931 1.00 34.32 ? 500 THR A C     1 
ATOM   2102 O O     . THR A 1 292 ? -35.996 -23.148 19.837 1.00 34.50 ? 500 THR A O     1 
ATOM   2103 C CB    . THR A 1 292 ? -32.948 -22.913 20.447 1.00 34.27 ? 500 THR A CB    1 
ATOM   2104 O OG1   . THR A 1 292 ? -31.695 -23.591 20.628 1.00 35.92 ? 500 THR A OG1   1 
ATOM   2105 C CG2   . THR A 1 292 ? -32.878 -21.510 21.065 1.00 34.55 ? 500 THR A CG2   1 
ATOM   2106 N N     . VAL A 1 293 ? -35.993 -22.631 22.024 1.00 34.31 ? 501 VAL A N     1 
ATOM   2107 C CA    . VAL A 1 293 ? -37.385 -22.207 22.042 1.00 34.67 ? 501 VAL A CA    1 
ATOM   2108 C C     . VAL A 1 293 ? -37.461 -20.729 22.428 1.00 34.53 ? 501 VAL A C     1 
ATOM   2109 O O     . VAL A 1 293 ? -36.978 -20.343 23.488 1.00 35.00 ? 501 VAL A O     1 
ATOM   2110 C CB    . VAL A 1 293 ? -38.204 -23.100 22.990 1.00 34.75 ? 501 VAL A CB    1 
ATOM   2111 C CG1   . VAL A 1 293 ? -39.674 -22.638 23.098 1.00 34.68 ? 501 VAL A CG1   1 
ATOM   2112 C CG2   . VAL A 1 293 ? -38.129 -24.557 22.556 1.00 34.99 ? 501 VAL A CG2   1 
ATOM   2113 N N     . PHE A 1 294 ? -38.034 -19.917 21.541 1.00 34.77 ? 502 PHE A N     1 
ATOM   2114 C CA    . PHE A 1 294 ? -38.285 -18.491 21.790 1.00 35.27 ? 502 PHE A CA    1 
ATOM   2115 C C     . PHE A 1 294 ? -39.751 -18.316 22.165 1.00 35.17 ? 502 PHE A C     1 
ATOM   2116 O O     . PHE A 1 294 ? -40.645 -18.431 21.334 1.00 34.24 ? 502 PHE A O     1 
ATOM   2117 C CB    . PHE A 1 294 ? -37.894 -17.631 20.570 1.00 35.97 ? 502 PHE A CB    1 
ATOM   2118 C CG    . PHE A 1 294 ? -36.568 -18.030 19.945 1.00 37.16 ? 502 PHE A CG    1 
ATOM   2119 C CD1   . PHE A 1 294 ? -36.525 -18.956 18.900 1.00 37.07 ? 502 PHE A CD1   1 
ATOM   2120 C CD2   . PHE A 1 294 ? -35.370 -17.493 20.408 1.00 36.48 ? 502 PHE A CD2   1 
ATOM   2121 C CE1   . PHE A 1 294 ? -35.299 -19.355 18.322 1.00 37.09 ? 502 PHE A CE1   1 
ATOM   2122 C CE2   . PHE A 1 294 ? -34.137 -17.890 19.853 1.00 38.27 ? 502 PHE A CE2   1 
ATOM   2123 C CZ    . PHE A 1 294 ? -34.103 -18.820 18.801 1.00 37.09 ? 502 PHE A CZ    1 
ATOM   2124 N N     . LEU A 1 295 ? -39.991 -18.081 23.453 1.00 35.66 ? 503 LEU A N     1 
ATOM   2125 C CA    . LEU A 1 295 ? -41.349 -17.854 23.956 1.00 36.25 ? 503 LEU A CA    1 
ATOM   2126 C C     . LEU A 1 295 ? -41.894 -16.536 23.461 1.00 36.24 ? 503 LEU A C     1 
ATOM   2127 O O     . LEU A 1 295 ? -41.215 -15.518 23.486 1.00 36.66 ? 503 LEU A O     1 
ATOM   2128 C CB    . LEU A 1 295 ? -41.367 -17.859 25.492 1.00 35.26 ? 503 LEU A CB    1 
ATOM   2129 C CG    . LEU A 1 295 ? -40.715 -19.105 26.088 1.00 38.56 ? 503 LEU A CG    1 
ATOM   2130 C CD1   . LEU A 1 295 ? -40.307 -18.885 27.570 1.00 40.31 ? 503 LEU A CD1   1 
ATOM   2131 C CD2   . LEU A 1 295 ? -41.666 -20.317 25.882 1.00 38.05 ? 503 LEU A CD2   1 
ATOM   2132 N N     . LEU A 1 296 ? -43.143 -16.563 23.037 1.00 36.87 ? 504 LEU A N     1 
ATOM   2133 C CA    . LEU A 1 296 ? -43.857 -15.333 22.671 1.00 37.17 ? 504 LEU A CA    1 
ATOM   2134 C C     . LEU A 1 296 ? -44.395 -14.578 23.880 1.00 37.39 ? 504 LEU A C     1 
ATOM   2135 O O     . LEU A 1 296 ? -45.162 -15.132 24.686 1.00 36.84 ? 504 LEU A O     1 
ATOM   2136 C CB    . LEU A 1 296 ? -44.994 -15.646 21.680 1.00 36.51 ? 504 LEU A CB    1 
ATOM   2137 C CG    . LEU A 1 296 ? -44.609 -16.365 20.362 1.00 38.08 ? 504 LEU A CG    1 
ATOM   2138 C CD1   . LEU A 1 296 ? -45.813 -16.398 19.420 1.00 39.39 ? 504 LEU A CD1   1 
ATOM   2139 C CD2   . LEU A 1 296 ? -43.408 -15.749 19.645 1.00 40.60 ? 504 LEU A CD2   1 
ATOM   2140 N N     . GLU A 1 297 ? -44.012 -13.307 23.986 1.00 38.03 ? 505 GLU A N     1 
ATOM   2141 C CA    . GLU A 1 297 ? -44.641 -12.388 24.951 1.00 39.75 ? 505 GLU A CA    1 
ATOM   2142 C C     . GLU A 1 297 ? -46.167 -12.369 24.818 1.00 40.17 ? 505 GLU A C     1 
ATOM   2143 O O     . GLU A 1 297 ? -46.877 -12.457 25.810 1.00 40.04 ? 505 GLU A O     1 
ATOM   2144 C CB    . GLU A 1 297 ? -44.099 -10.975 24.775 1.00 40.39 ? 505 GLU A CB    1 
ATOM   2145 C CG    . GLU A 1 297 ? -44.332 -10.090 25.974 1.00 44.02 ? 505 GLU A CG    1 
ATOM   2146 C CD    . GLU A 1 297 ? -44.834 -8.735  25.585 1.00 48.14 ? 505 GLU A CD    1 
ATOM   2147 O OE1   . GLU A 1 297 ? -44.273 -8.161  24.623 1.00 50.58 ? 505 GLU A OE1   1 
ATOM   2148 O OE2   . GLU A 1 297 ? -45.791 -8.248  26.232 1.00 48.88 ? 505 GLU A OE2   1 
ATOM   2149 N N     . LYS A 1 298 ? -46.661 -12.267 23.582 1.00 41.23 ? 506 LYS A N     1 
ATOM   2150 C CA    . LYS A 1 298 ? -48.092 -12.305 23.296 1.00 42.79 ? 506 LYS A CA    1 
ATOM   2151 C C     . LYS A 1 298 ? -48.467 -13.444 22.340 1.00 42.18 ? 506 LYS A C     1 
ATOM   2152 O O     . LYS A 1 298 ? -48.406 -13.272 21.131 1.00 42.13 ? 506 LYS A O     1 
ATOM   2153 C CB    . LYS A 1 298 ? -48.550 -10.952 22.725 1.00 42.79 ? 506 LYS A CB    1 
ATOM   2154 C CG    . LYS A 1 298 ? -48.215 -9.766  23.645 1.00 45.16 ? 506 LYS A CG    1 
ATOM   2155 C CD    . LYS A 1 298 ? -48.761 -8.421  23.161 1.00 45.95 ? 506 LYS A CD    1 
ATOM   2156 C CE    . LYS A 1 298 ? -47.836 -7.274  23.660 1.00 50.69 ? 506 LYS A CE    1 
ATOM   2157 N NZ    . LYS A 1 298 ? -47.972 -5.975  22.897 1.00 50.62 ? 506 LYS A NZ    1 
ATOM   2158 N N     . PRO A 1 299 ? -48.866 -14.614 22.874 1.00 42.11 ? 507 PRO A N     1 
ATOM   2159 C CA    . PRO A 1 299 ? -49.354 -15.675 21.993 1.00 42.57 ? 507 PRO A CA    1 
ATOM   2160 C C     . PRO A 1 299 ? -50.578 -15.251 21.144 1.00 43.58 ? 507 PRO A C     1 
ATOM   2161 O O     . PRO A 1 299 ? -51.326 -14.347 21.543 1.00 43.17 ? 507 PRO A O     1 
ATOM   2162 C CB    . PRO A 1 299 ? -49.752 -16.775 22.974 1.00 42.29 ? 507 PRO A CB    1 
ATOM   2163 C CG    . PRO A 1 299 ? -48.940 -16.498 24.194 1.00 41.82 ? 507 PRO A CG    1 
ATOM   2164 C CD    . PRO A 1 299 ? -48.890 -15.025 24.292 1.00 42.17 ? 507 PRO A CD    1 
ATOM   2165 N N     . PHE A 1 300 ? -50.793 -15.911 20.005 1.00 44.38 ? 508 PHE A N     1 
ATOM   2166 C CA    . PHE A 1 300 ? -51.836 -15.488 19.051 1.00 45.80 ? 508 PHE A CA    1 
ATOM   2167 C C     . PHE A 1 300 ? -52.408 -16.665 18.241 1.00 46.54 ? 508 PHE A C     1 
ATOM   2168 O O     . PHE A 1 300 ? -51.738 -17.702 18.041 1.00 46.49 ? 508 PHE A O     1 
ATOM   2169 C CB    . PHE A 1 300 ? -51.317 -14.372 18.130 1.00 45.90 ? 508 PHE A CB    1 
ATOM   2170 C CG    . PHE A 1 300 ? -50.177 -14.803 17.231 1.00 47.21 ? 508 PHE A CG    1 
ATOM   2171 C CD1   . PHE A 1 300 ? -50.413 -15.124 15.888 1.00 49.38 ? 508 PHE A CD1   1 
ATOM   2172 C CD2   . PHE A 1 300 ? -48.878 -14.894 17.717 1.00 47.95 ? 508 PHE A CD2   1 
ATOM   2173 C CE1   . PHE A 1 300 ? -49.377 -15.523 15.046 1.00 48.56 ? 508 PHE A CE1   1 
ATOM   2174 C CE2   . PHE A 1 300 ? -47.828 -15.303 16.881 1.00 47.56 ? 508 PHE A CE2   1 
ATOM   2175 C CZ    . PHE A 1 300 ? -48.083 -15.613 15.543 1.00 48.00 ? 508 PHE A CZ    1 
ATOM   2176 N N     . SER A 1 301 ? -53.650 -16.513 17.788 1.00 47.42 ? 509 SER A N     1 
ATOM   2177 C CA    . SER A 1 301 ? -54.345 -17.602 17.102 1.00 48.18 ? 509 SER A CA    1 
ATOM   2178 C C     . SER A 1 301 ? -53.928 -17.739 15.649 1.00 49.25 ? 509 SER A C     1 
ATOM   2179 O O     . SER A 1 301 ? -53.343 -16.830 15.044 1.00 49.85 ? 509 SER A O     1 
ATOM   2180 C CB    . SER A 1 301 ? -55.874 -17.463 17.200 1.00 48.61 ? 509 SER A CB    1 
ATOM   2181 O OG    . SER A 1 301 ? -56.341 -16.582 16.201 1.00 45.63 ? 509 SER A OG    1 
ATOM   2182 N N     . VAL A 1 302 ? -54.306 -18.874 15.081 1.00 49.84 ? 510 VAL A N     1 
ATOM   2183 C CA    . VAL A 1 302 ? -53.678 -19.392 13.912 1.00 50.86 ? 510 VAL A CA    1 
ATOM   2184 C C     . VAL A 1 302 ? -54.674 -20.438 13.378 1.00 51.61 ? 510 VAL A C     1 
ATOM   2185 O O     . VAL A 1 302 ? -55.391 -21.059 14.183 1.00 51.15 ? 510 VAL A O     1 
ATOM   2186 C CB    . VAL A 1 302 ? -52.279 -19.942 14.385 1.00 51.20 ? 510 VAL A CB    1 
ATOM   2187 C CG1   . VAL A 1 302 ? -52.147 -21.445 14.281 1.00 50.88 ? 510 VAL A CG1   1 
ATOM   2188 C CG2   . VAL A 1 302 ? -51.121 -19.168 13.763 1.00 51.09 ? 510 VAL A CG2   1 
ATOM   2189 N N     . LYS A 1 303 ? -54.766 -20.586 12.047 1.00 52.32 ? 511 LYS A N     1 
ATOM   2190 C CA    . LYS A 1 303 ? -55.705 -21.537 11.412 1.00 52.85 ? 511 LYS A CA    1 
ATOM   2191 C C     . LYS A 1 303 ? -54.999 -22.527 10.498 1.00 53.19 ? 511 LYS A C     1 
ATOM   2192 O O     . LYS A 1 303 ? -54.080 -22.157 9.755  1.00 52.59 ? 511 LYS A O     1 
ATOM   2193 C CB    . LYS A 1 303 ? -56.777 -20.814 10.574 1.00 53.43 ? 511 LYS A CB    1 
ATOM   2194 C CG    . LYS A 1 303 ? -57.630 -19.817 11.330 1.00 54.46 ? 511 LYS A CG    1 
ATOM   2195 C CD    . LYS A 1 303 ? -57.112 -18.392 11.145 1.00 56.68 ? 511 LYS A CD    1 
ATOM   2196 C CE    . LYS A 1 303 ? -57.904 -17.632 10.082 1.00 56.96 ? 511 LYS A CE    1 
ATOM   2197 N NZ    . LYS A 1 303 ? -59.325 -17.425 10.499 1.00 57.49 ? 511 LYS A NZ    1 
ATOM   2198 N N     . ALA A 1 304 ? -55.451 -23.777 10.516 1.00 53.45 ? 512 ALA A N     1 
ATOM   2199 C CA    . ALA A 1 304 ? -54.858 -24.789 9.644  1.00 53.96 ? 512 ALA A CA    1 
ATOM   2200 C C     . ALA A 1 304 ? -54.904 -24.312 8.181  1.00 54.00 ? 512 ALA A C     1 
ATOM   2201 O O     . ALA A 1 304 ? -55.917 -23.761 7.737  1.00 54.15 ? 512 ALA A O     1 
ATOM   2202 C CB    . ALA A 1 304 ? -55.566 -26.133 9.817  1.00 54.17 ? 512 ALA A CB    1 
ATOM   2203 N N     . GLY A 1 305 ? -53.805 -24.501 7.450  1.00 54.01 ? 513 GLY A N     1 
ATOM   2204 C CA    . GLY A 1 305 ? -53.684 -24.040 6.055  1.00 53.94 ? 513 GLY A CA    1 
ATOM   2205 C C     . GLY A 1 305 ? -53.087 -22.642 5.879  1.00 53.89 ? 513 GLY A C     1 
ATOM   2206 O O     . GLY A 1 305 ? -52.438 -22.354 4.867  1.00 54.29 ? 513 GLY A O     1 
ATOM   2207 N N     . GLU A 1 306 ? -53.327 -21.771 6.854  1.00 53.36 ? 514 GLU A N     1 
ATOM   2208 C CA    . GLU A 1 306 ? -52.748 -20.424 6.903  1.00 53.24 ? 514 GLU A CA    1 
ATOM   2209 C C     . GLU A 1 306 ? -51.226 -20.382 6.677  1.00 52.62 ? 514 GLU A C     1 
ATOM   2210 O O     . GLU A 1 306 ? -50.503 -21.297 7.089  1.00 52.84 ? 514 GLU A O     1 
ATOM   2211 C CB    . GLU A 1 306 ? -53.062 -19.794 8.255  1.00 52.55 ? 514 GLU A CB    1 
ATOM   2212 C CG    . GLU A 1 306 ? -52.689 -18.326 8.367  1.00 54.31 ? 514 GLU A CG    1 
ATOM   2213 C CD    . GLU A 1 306 ? -52.618 -17.838 9.797  1.00 55.22 ? 514 GLU A CD    1 
ATOM   2214 O OE1   . GLU A 1 306 ? -53.247 -18.463 10.685 1.00 56.06 ? 514 GLU A OE1   1 
ATOM   2215 O OE2   . GLU A 1 306 ? -51.924 -16.825 10.031 1.00 56.00 ? 514 GLU A OE2   1 
ATOM   2216 N N     . ALA A 1 307 ? -50.749 -19.308 6.049  1.00 51.91 ? 515 ALA A N     1 
ATOM   2217 C CA    . ALA A 1 307 ? -49.312 -19.117 5.821  1.00 51.12 ? 515 ALA A CA    1 
ATOM   2218 C C     . ALA A 1 307 ? -48.803 -17.985 6.706  1.00 50.91 ? 515 ALA A C     1 
ATOM   2219 O O     . ALA A 1 307 ? -48.900 -16.807 6.330  1.00 50.79 ? 515 ALA A O     1 
ATOM   2220 C CB    . ALA A 1 307 ? -49.047 -18.817 4.371  1.00 51.32 ? 515 ALA A CB    1 
ATOM   2221 N N     . LEU A 1 308 ? -48.287 -18.353 7.888  1.00 49.96 ? 516 LEU A N     1 
ATOM   2222 C CA    . LEU A 1 308 ? -47.827 -17.398 8.917  1.00 49.12 ? 516 LEU A CA    1 
ATOM   2223 C C     . LEU A 1 308 ? -46.501 -16.749 8.544  1.00 47.79 ? 516 LEU A C     1 
ATOM   2224 O O     . LEU A 1 308 ? -45.501 -17.427 8.425  1.00 47.75 ? 516 LEU A O     1 
ATOM   2225 C CB    . LEU A 1 308 ? -47.641 -18.108 10.262 1.00 48.92 ? 516 LEU A CB    1 
ATOM   2226 C CG    . LEU A 1 308 ? -47.873 -17.414 11.620 1.00 50.75 ? 516 LEU A CG    1 
ATOM   2227 C CD1   . LEU A 1 308 ? -46.860 -17.955 12.642 1.00 48.48 ? 516 LEU A CD1   1 
ATOM   2228 C CD2   . LEU A 1 308 ? -47.862 -15.868 11.589 1.00 50.52 ? 516 LEU A CD2   1 
ATOM   2229 N N     . LYS A 1 309 ? -46.490 -15.429 8.430  1.00 47.09 ? 517 LYS A N     1 
ATOM   2230 C CA    . LYS A 1 309 ? -45.335 -14.722 7.898  1.00 47.53 ? 517 LYS A CA    1 
ATOM   2231 C C     . LYS A 1 309 ? -44.529 -13.966 8.950  1.00 46.16 ? 517 LYS A C     1 
ATOM   2232 O O     . LYS A 1 309 ? -45.077 -13.371 9.863  1.00 45.62 ? 517 LYS A O     1 
ATOM   2233 C CB    . LYS A 1 309 ? -45.774 -13.777 6.780  1.00 47.72 ? 517 LYS A CB    1 
ATOM   2234 C CG    . LYS A 1 309 ? -46.485 -14.488 5.621  1.00 49.19 ? 517 LYS A CG    1 
ATOM   2235 C CD    . LYS A 1 309 ? -46.947 -13.495 4.535  1.00 50.34 ? 517 LYS A CD    1 
ATOM   2236 C CE    . LYS A 1 309 ? -45.785 -13.115 3.589  1.00 55.37 ? 517 LYS A CE    1 
ATOM   2237 N NZ    . LYS A 1 309 ? -44.573 -12.594 4.317  1.00 56.53 ? 517 LYS A NZ    1 
ATOM   2238 N N     . GLY A 1 310 ? -43.210 -13.978 8.811  1.00 45.29 ? 518 GLY A N     1 
ATOM   2239 C CA    . GLY A 1 310 ? -42.389 -13.300 9.789  1.00 43.80 ? 518 GLY A CA    1 
ATOM   2240 C C     . GLY A 1 310 ? -40.948 -13.154 9.367  1.00 42.99 ? 518 GLY A C     1 
ATOM   2241 O O     . GLY A 1 310 ? -40.571 -13.559 8.274  1.00 41.90 ? 518 GLY A O     1 
ATOM   2242 N N     . LYS A 1 311 ? -40.154 -12.565 10.252 1.00 42.21 ? 519 LYS A N     1 
ATOM   2243 C CA    . LYS A 1 311 ? -38.755 -12.305 9.962  1.00 42.42 ? 519 LYS A CA    1 
ATOM   2244 C C     . LYS A 1 311 ? -37.923 -12.676 11.184 1.00 41.82 ? 519 LYS A C     1 
ATOM   2245 O O     . LYS A 1 311 ? -38.346 -12.460 12.326 1.00 41.18 ? 519 LYS A O     1 
ATOM   2246 C CB    . LYS A 1 311 ? -38.556 -10.837 9.599  1.00 42.85 ? 519 LYS A CB    1 
ATOM   2247 C CG    . LYS A 1 311 ? -37.129 -10.478 9.274  1.00 44.73 ? 519 LYS A CG    1 
ATOM   2248 C CD    . LYS A 1 311 ? -36.892 -8.986  9.273  1.00 48.02 ? 519 LYS A CD    1 
ATOM   2249 C CE    . LYS A 1 311 ? -35.369 -8.717  9.155  1.00 50.93 ? 519 LYS A CE    1 
ATOM   2250 N NZ    . LYS A 1 311 ? -35.010 -7.273  9.372  1.00 53.75 ? 519 LYS A NZ    1 
ATOM   2251 N N     . VAL A 1 312 ? -36.743 -13.238 10.926 1.00 40.71 ? 520 VAL A N     1 
ATOM   2252 C CA    . VAL A 1 312 ? -35.781 -13.573 11.979 1.00 40.33 ? 520 VAL A CA    1 
ATOM   2253 C C     . VAL A 1 312 ? -34.447 -12.913 11.643 1.00 40.17 ? 520 VAL A C     1 
ATOM   2254 O O     . VAL A 1 312 ? -34.069 -12.860 10.466 1.00 40.17 ? 520 VAL A O     1 
ATOM   2255 C CB    . VAL A 1 312 ? -35.612 -15.124 12.177 1.00 40.05 ? 520 VAL A CB    1 
ATOM   2256 C CG1   . VAL A 1 312 ? -35.101 -15.834 10.903 1.00 38.65 ? 520 VAL A CG1   1 
ATOM   2257 C CG2   . VAL A 1 312 ? -34.688 -15.455 13.369 1.00 40.01 ? 520 VAL A CG2   1 
ATOM   2258 N N     . THR A 1 313 ? -33.753 -12.426 12.671 1.00 40.08 ? 521 THR A N     1 
ATOM   2259 C CA    . THR A 1 313 ? -32.395 -11.876 12.546 1.00 41.24 ? 521 THR A CA    1 
ATOM   2260 C C     . THR A 1 313 ? -31.475 -12.522 13.602 1.00 41.91 ? 521 THR A C     1 
ATOM   2261 O O     . THR A 1 313 ? -31.814 -12.566 14.779 1.00 41.84 ? 521 THR A O     1 
ATOM   2262 C CB    . THR A 1 313 ? -32.418 -10.329 12.669 1.00 42.01 ? 521 THR A CB    1 
ATOM   2263 O OG1   . THR A 1 313 ? -33.184 -9.795  11.580 1.00 42.62 ? 521 THR A OG1   1 
ATOM   2264 C CG2   . THR A 1 313 ? -31.012 -9.730  12.622 1.00 41.53 ? 521 THR A CG2   1 
ATOM   2265 N N     . VAL A 1 314 ? -30.324 -13.038 13.172 1.00 42.06 ? 522 VAL A N     1 
ATOM   2266 C CA    . VAL A 1 314 ? -29.387 -13.714 14.068 1.00 42.66 ? 522 VAL A CA    1 
ATOM   2267 C C     . VAL A 1 314 ? -28.050 -12.996 14.016 1.00 44.38 ? 522 VAL A C     1 
ATOM   2268 O O     . VAL A 1 314 ? -27.417 -12.908 12.960 1.00 45.01 ? 522 VAL A O     1 
ATOM   2269 C CB    . VAL A 1 314 ? -29.174 -15.186 13.673 1.00 42.62 ? 522 VAL A CB    1 
ATOM   2270 C CG1   . VAL A 1 314 ? -28.231 -15.877 14.654 1.00 41.45 ? 522 VAL A CG1   1 
ATOM   2271 C CG2   . VAL A 1 314 ? -30.522 -15.932 13.545 1.00 40.97 ? 522 VAL A CG2   1 
ATOM   2272 N N     . HIS A 1 315 ? -27.628 -12.461 15.152 1.00 45.46 ? 523 HIS A N     1 
ATOM   2273 C CA    . HIS A 1 315 ? -26.395 -11.713 15.233 1.00 47.36 ? 523 HIS A CA    1 
ATOM   2274 C C     . HIS A 1 315 ? -25.659 -12.155 16.466 1.00 48.19 ? 523 HIS A C     1 
ATOM   2275 O O     . HIS A 1 315 ? -26.281 -12.604 17.433 1.00 48.12 ? 523 HIS A O     1 
ATOM   2276 C CB    . HIS A 1 315 ? -26.692 -10.216 15.314 1.00 47.76 ? 523 HIS A CB    1 
ATOM   2277 C CG    . HIS A 1 315 ? -27.128 -9.606  14.012 1.00 50.17 ? 523 HIS A CG    1 
ATOM   2278 N ND1   . HIS A 1 315 ? -27.436 -8.267  13.885 1.00 53.63 ? 523 HIS A ND1   1 
ATOM   2279 C CD2   . HIS A 1 315 ? -27.294 -10.144 12.776 1.00 52.32 ? 523 HIS A CD2   1 
ATOM   2280 C CE1   . HIS A 1 315 ? -27.790 -8.011  12.635 1.00 53.03 ? 523 HIS A CE1   1 
ATOM   2281 N NE2   . HIS A 1 315 ? -27.702 -9.131  11.938 1.00 51.72 ? 523 HIS A NE2   1 
ATOM   2282 N N     . LYS A 1 316 ? -24.330 -12.057 16.422 1.00 49.16 ? 524 LYS A N     1 
ATOM   2283 C CA    . LYS A 1 316 ? -23.504 -12.202 17.614 1.00 49.83 ? 524 LYS A CA    1 
ATOM   2284 C C     . LYS A 1 316 ? -23.908 -11.106 18.602 1.00 51.28 ? 524 LYS A C     1 
ATOM   2285 O O     . LYS A 1 316 ? -24.172 -9.966  18.189 1.00 50.54 ? 524 LYS A O     1 
ATOM   2286 C CB    . LYS A 1 316 ? -22.018 -12.042 17.269 1.00 49.54 ? 524 LYS A CB    1 
ATOM   2287 C CG    . LYS A 1 316 ? -21.353 -13.295 16.675 1.00 49.21 ? 524 LYS A CG    1 
ATOM   2288 C CD    . LYS A 1 316 ? -19.968 -12.959 16.079 1.00 48.90 ? 524 LYS A CD    1 
ATOM   2289 C CE    . LYS A 1 316 ? -19.109 -14.197 15.834 1.00 45.31 ? 524 LYS A CE    1 
ATOM   2290 N NZ    . LYS A 1 316 ? -19.725 -15.156 14.841 1.00 45.96 ? 524 LYS A NZ    1 
ATOM   2291 N N     . ASN A 1 317 ? -23.960 -11.464 19.889 1.00 52.68 ? 525 ASN A N     1 
ATOM   2292 C CA    . ASN A 1 317 ? -24.032 -10.480 20.962 1.00 54.93 ? 525 ASN A CA    1 
ATOM   2293 C C     . ASN A 1 317 ? -22.755 -9.635  20.923 1.00 56.14 ? 525 ASN A C     1 
ATOM   2294 O O     . ASN A 1 317 ? -21.643 -10.159 21.091 1.00 56.44 ? 525 ASN A O     1 
ATOM   2295 C CB    . ASN A 1 317 ? -24.220 -11.176 22.324 1.00 55.03 ? 525 ASN A CB    1 
ATOM   2296 C CG    . ASN A 1 317 ? -24.239 -10.195 23.509 1.00 56.78 ? 525 ASN A CG    1 
ATOM   2297 O OD1   . ASN A 1 317 ? -23.259 -9.484  23.775 1.00 57.91 ? 525 ASN A OD1   1 
ATOM   2298 N ND2   . ASN A 1 317 ? -25.350 -10.178 24.237 1.00 56.26 ? 525 ASN A ND2   1 
ATOM   2299 N N     . LYS A 1 318 ? -22.923 -8.335  20.678 1.00 57.58 ? 526 LYS A N     1 
ATOM   2300 C CA    . LYS A 1 318 ? -21.809 -7.374  20.559 1.00 59.08 ? 526 LYS A CA    1 
ATOM   2301 C C     . LYS A 1 318 ? -20.818 -7.355  21.744 1.00 59.68 ? 526 LYS A C     1 
ATOM   2302 O O     . LYS A 1 318 ? -19.616 -7.145  21.542 1.00 60.24 ? 526 LYS A O     1 
ATOM   2303 C CB    . LYS A 1 318 ? -22.331 -5.957  20.250 1.00 59.33 ? 526 LYS A CB    1 
ATOM   2304 C CG    . LYS A 1 318 ? -23.321 -5.358  21.271 1.00 60.72 ? 526 LYS A CG    1 
ATOM   2305 C CD    . LYS A 1 318 ? -24.806 -5.693  20.972 1.00 62.73 ? 526 LYS A CD    1 
ATOM   2306 C CE    . LYS A 1 318 ? -25.288 -6.975  21.681 1.00 62.00 ? 526 LYS A CE    1 
ATOM   2307 N NZ    . LYS A 1 318 ? -26.639 -7.421  21.203 1.00 60.97 ? 526 LYS A NZ    1 
ATOM   2308 N N     . LYS A 1 319 ? -21.312 -7.586  22.961 1.00 60.17 ? 527 LYS A N     1 
ATOM   2309 C CA    . LYS A 1 319 ? -20.445 -7.641  24.147 1.00 60.75 ? 527 LYS A CA    1 
ATOM   2310 C C     . LYS A 1 319 ? -19.686 -8.972  24.240 1.00 60.89 ? 527 LYS A C     1 
ATOM   2311 O O     . LYS A 1 319 ? -18.484 -8.980  24.525 1.00 61.05 ? 527 LYS A O     1 
ATOM   2312 C CB    . LYS A 1 319 ? -21.234 -7.368  25.437 1.00 61.27 ? 527 LYS A CB    1 
ATOM   2313 C CG    . LYS A 1 319 ? -21.729 -5.917  25.588 1.00 62.11 ? 527 LYS A CG    1 
ATOM   2314 C CD    . LYS A 1 319 ? -23.054 -5.675  24.851 1.00 63.34 ? 527 LYS A CD    1 
ATOM   2315 C CE    . LYS A 1 319 ? -23.406 -4.184  24.776 1.00 63.67 ? 527 LYS A CE    1 
ATOM   2316 N NZ    . LYS A 1 319 ? -23.770 -3.596  26.107 1.00 64.05 ? 527 LYS A NZ    1 
ATOM   2317 N N     . ASP A 1 320 ? -20.387 -10.085 24.000 1.00 60.30 ? 528 ASP A N     1 
ATOM   2318 C CA    . ASP A 1 320 ? -19.767 -11.417 23.976 1.00 60.03 ? 528 ASP A CA    1 
ATOM   2319 C C     . ASP A 1 320 ? -20.110 -12.142 22.673 1.00 58.92 ? 528 ASP A C     1 
ATOM   2320 O O     . ASP A 1 320 ? -21.234 -12.645 22.519 1.00 58.77 ? 528 ASP A O     1 
ATOM   2321 C CB    . ASP A 1 320 ? -20.206 -12.257 25.180 1.00 60.55 ? 528 ASP A CB    1 
ATOM   2322 C CG    . ASP A 1 320 ? -19.590 -13.659 25.188 1.00 62.63 ? 528 ASP A CG    1 
ATOM   2323 O OD1   . ASP A 1 320 ? -18.650 -13.942 24.398 1.00 64.74 ? 528 ASP A OD1   1 
ATOM   2324 O OD2   . ASP A 1 320 ? -20.048 -14.490 26.006 1.00 65.28 ? 528 ASP A OD2   1 
ATOM   2325 N N     . PRO A 1 321 ? -19.137 -12.208 21.740 1.00 57.85 ? 529 PRO A N     1 
ATOM   2326 C CA    . PRO A 1 321 ? -19.357 -12.790 20.417 1.00 57.07 ? 529 PRO A CA    1 
ATOM   2327 C C     . PRO A 1 321 ? -19.700 -14.291 20.469 1.00 56.15 ? 529 PRO A C     1 
ATOM   2328 O O     . PRO A 1 321 ? -20.170 -14.838 19.472 1.00 56.20 ? 529 PRO A O     1 
ATOM   2329 C CB    . PRO A 1 321 ? -18.022 -12.550 19.698 1.00 57.16 ? 529 PRO A CB    1 
ATOM   2330 C CG    . PRO A 1 321 ? -17.019 -12.433 20.789 1.00 57.40 ? 529 PRO A CG    1 
ATOM   2331 C CD    . PRO A 1 321 ? -17.746 -11.752 21.910 1.00 57.86 ? 529 PRO A CD    1 
ATOM   2332 N N     . ARG A 1 322 ? -19.483 -14.937 21.618 1.00 54.70 ? 530 ARG A N     1 
ATOM   2333 C CA    . ARG A 1 322 ? -19.955 -16.312 21.821 1.00 53.82 ? 530 ARG A CA    1 
ATOM   2334 C C     . ARG A 1 322 ? -21.482 -16.397 22.042 1.00 53.09 ? 530 ARG A C     1 
ATOM   2335 O O     . ARG A 1 322 ? -22.113 -17.428 21.770 1.00 53.80 ? 530 ARG A O     1 
ATOM   2336 C CB    . ARG A 1 322 ? -19.189 -17.007 22.949 1.00 53.54 ? 530 ARG A CB    1 
ATOM   2337 C CG    . ARG A 1 322 ? -17.710 -17.213 22.638 1.00 53.38 ? 530 ARG A CG    1 
ATOM   2338 C CD    . ARG A 1 322 ? -17.208 -18.477 23.280 1.00 54.40 ? 530 ARG A CD    1 
ATOM   2339 N NE    . ARG A 1 322 ? -15.758 -18.644 23.142 1.00 54.59 ? 530 ARG A NE    1 
ATOM   2340 C CZ    . ARG A 1 322 ? -15.161 -19.347 22.178 1.00 54.83 ? 530 ARG A CZ    1 
ATOM   2341 N NH1   . ARG A 1 322 ? -15.886 -19.955 21.234 1.00 52.66 ? 530 ARG A NH1   1 
ATOM   2342 N NH2   . ARG A 1 322 ? -13.827 -19.444 22.161 1.00 54.61 ? 530 ARG A NH2   1 
ATOM   2343 N N     . SER A 1 323 ? -22.081 -15.313 22.514 1.00 51.93 ? 531 SER A N     1 
ATOM   2344 C CA    . SER A 1 323 ? -23.521 -15.294 22.726 1.00 51.10 ? 531 SER A CA    1 
ATOM   2345 C C     . SER A 1 323 ? -24.270 -14.832 21.478 1.00 50.26 ? 531 SER A C     1 
ATOM   2346 O O     . SER A 1 323 ? -23.729 -14.091 20.651 1.00 50.65 ? 531 SER A O     1 
ATOM   2347 C CB    . SER A 1 323 ? -23.873 -14.418 23.926 1.00 51.30 ? 531 SER A CB    1 
ATOM   2348 O OG    . SER A 1 323 ? -23.413 -15.029 25.118 1.00 52.67 ? 531 SER A OG    1 
ATOM   2349 N N     . LEU A 1 324 ? -25.519 -15.272 21.345 1.00 48.40 ? 532 LEU A N     1 
ATOM   2350 C CA    . LEU A 1 324 ? -26.317 -14.904 20.192 1.00 47.14 ? 532 LEU A CA    1 
ATOM   2351 C C     . LEU A 1 324 ? -27.414 -13.931 20.591 1.00 45.60 ? 532 LEU A C     1 
ATOM   2352 O O     . LEU A 1 324 ? -27.851 -13.906 21.734 1.00 45.17 ? 532 LEU A O     1 
ATOM   2353 C CB    . LEU A 1 324 ? -26.950 -16.133 19.537 1.00 46.60 ? 532 LEU A CB    1 
ATOM   2354 C CG    . LEU A 1 324 ? -26.082 -17.069 18.709 1.00 48.08 ? 532 LEU A CG    1 
ATOM   2355 C CD1   . LEU A 1 324 ? -26.961 -18.147 18.054 1.00 46.25 ? 532 LEU A CD1   1 
ATOM   2356 C CD2   . LEU A 1 324 ? -25.278 -16.315 17.637 1.00 49.21 ? 532 LEU A CD2   1 
ATOM   2357 N N     . THR A 1 325 ? -27.836 -13.143 19.619 1.00 44.62 ? 533 THR A N     1 
ATOM   2358 C CA    . THR A 1 325 ? -29.032 -12.329 19.716 1.00 43.68 ? 533 THR A CA    1 
ATOM   2359 C C     . THR A 1 325 ? -29.902 -12.755 18.547 1.00 42.75 ? 533 THR A C     1 
ATOM   2360 O O     . THR A 1 325 ? -29.442 -12.818 17.412 1.00 42.39 ? 533 THR A O     1 
ATOM   2361 C CB    . THR A 1 325 ? -28.662 -10.859 19.651 1.00 44.51 ? 533 THR A CB    1 
ATOM   2362 O OG1   . THR A 1 325 ? -27.837 -10.544 20.791 1.00 44.56 ? 533 THR A OG1   1 
ATOM   2363 C CG2   . THR A 1 325 ? -29.911 -9.988  19.665 1.00 44.01 ? 533 THR A CG2   1 
ATOM   2364 N N     . VAL A 1 326 ? -31.142 -13.114 18.836 1.00 41.46 ? 534 VAL A N     1 
ATOM   2365 C CA    . VAL A 1 326 ? -32.065 -13.565 17.805 1.00 40.42 ? 534 VAL A CA    1 
ATOM   2366 C C     . VAL A 1 326 ? -33.330 -12.715 17.916 1.00 40.20 ? 534 VAL A C     1 
ATOM   2367 O O     . VAL A 1 326 ? -33.972 -12.692 18.962 1.00 39.68 ? 534 VAL A O     1 
ATOM   2368 C CB    . VAL A 1 326 ? -32.411 -15.049 17.940 1.00 39.83 ? 534 VAL A CB    1 
ATOM   2369 C CG1   . VAL A 1 326 ? -33.471 -15.441 16.887 1.00 39.42 ? 534 VAL A CG1   1 
ATOM   2370 C CG2   . VAL A 1 326 ? -31.141 -15.934 17.801 1.00 39.62 ? 534 VAL A CG2   1 
ATOM   2371 N N     . THR A 1 327 ? -33.664 -12.008 16.838 1.00 39.71 ? 535 THR A N     1 
ATOM   2372 C CA    . THR A 1 327 ? -34.814 -11.095 16.821 1.00 38.64 ? 535 THR A CA    1 
ATOM   2373 C C     . THR A 1 327 ? -35.920 -11.664 15.938 1.00 39.12 ? 535 THR A C     1 
ATOM   2374 O O     . THR A 1 327 ? -35.716 -11.879 14.739 1.00 39.07 ? 535 THR A O     1 
ATOM   2375 C CB    . THR A 1 327 ? -34.390 -9.687  16.332 1.00 38.91 ? 535 THR A CB    1 
ATOM   2376 O OG1   . THR A 1 327 ? -33.292 -9.209  17.128 1.00 38.34 ? 535 THR A OG1   1 
ATOM   2377 C CG2   . THR A 1 327 ? -35.551 -8.691  16.409 1.00 37.87 ? 535 THR A CG2   1 
ATOM   2378 N N     . LEU A 1 328 ? -37.075 -11.935 16.536 1.00 39.17 ? 536 LEU A N     1 
ATOM   2379 C CA    . LEU A 1 328 ? -38.245 -12.442 15.830 1.00 40.83 ? 536 LEU A CA    1 
ATOM   2380 C C     . LEU A 1 328 ? -39.311 -11.360 15.624 1.00 40.66 ? 536 LEU A C     1 
ATOM   2381 O O     . LEU A 1 328 ? -39.740 -10.709 16.577 1.00 39.17 ? 536 LEU A O     1 
ATOM   2382 C CB    . LEU A 1 328 ? -38.875 -13.604 16.606 1.00 40.45 ? 536 LEU A CB    1 
ATOM   2383 C CG    . LEU A 1 328 ? -38.171 -14.966 16.629 1.00 44.34 ? 536 LEU A CG    1 
ATOM   2384 C CD1   . LEU A 1 328 ? -36.764 -14.865 17.215 1.00 47.37 ? 536 LEU A CD1   1 
ATOM   2385 C CD2   . LEU A 1 328 ? -39.006 -15.964 17.450 1.00 43.34 ? 536 LEU A CD2   1 
ATOM   2386 N N     . THR A 1 329 ? -39.735 -11.177 14.374 1.00 42.04 ? 537 THR A N     1 
ATOM   2387 C CA    . THR A 1 329 ? -40.867 -10.302 14.084 1.00 42.70 ? 537 THR A CA    1 
ATOM   2388 C C     . THR A 1 329 ? -41.971 -11.183 13.566 1.00 43.72 ? 537 THR A C     1 
ATOM   2389 O O     . THR A 1 329 ? -41.762 -11.969 12.655 1.00 43.86 ? 537 THR A O     1 
ATOM   2390 C CB    . THR A 1 329 ? -40.521 -9.214  13.079 1.00 43.05 ? 537 THR A CB    1 
ATOM   2391 O OG1   . THR A 1 329 ? -39.461 -8.409  13.608 1.00 42.71 ? 537 THR A OG1   1 
ATOM   2392 C CG2   . THR A 1 329 ? -41.761 -8.299  12.826 1.00 42.78 ? 537 THR A CG2   1 
ATOM   2393 N N     . LEU A 1 330 ? -43.151 -11.044 14.153 1.00 44.83 ? 538 LEU A N     1 
ATOM   2394 C CA    . LEU A 1 330 ? -44.259 -11.936 13.894 1.00 45.66 ? 538 LEU A CA    1 
ATOM   2395 C C     . LEU A 1 330 ? -45.521 -11.296 14.460 1.00 45.75 ? 538 LEU A C     1 
ATOM   2396 O O     . LEU A 1 330 ? -45.469 -10.656 15.507 1.00 44.89 ? 538 LEU A O     1 
ATOM   2397 C CB    . LEU A 1 330 ? -43.996 -13.256 14.628 1.00 46.12 ? 538 LEU A CB    1 
ATOM   2398 C CG    . LEU A 1 330 ? -44.787 -14.515 14.275 1.00 47.19 ? 538 LEU A CG    1 
ATOM   2399 C CD1   . LEU A 1 330 ? -44.337 -15.124 12.949 1.00 47.74 ? 538 LEU A CD1   1 
ATOM   2400 C CD2   . LEU A 1 330 ? -44.611 -15.517 15.399 1.00 47.35 ? 538 LEU A CD2   1 
ATOM   2401 N N     . ASN A 1 331 ? -46.650 -11.512 13.790 1.00 45.31 ? 539 ASN A N     1 
ATOM   2402 C CA    . ASN A 1 331 ? -47.956 -11.048 14.261 1.00 46.26 ? 539 ASN A CA    1 
ATOM   2403 C C     . ASN A 1 331 ? -47.912 -9.599  14.729 1.00 45.82 ? 539 ASN A C     1 
ATOM   2404 O O     . ASN A 1 331 ? -48.596 -9.236  15.680 1.00 45.67 ? 539 ASN A O     1 
ATOM   2405 C CB    . ASN A 1 331 ? -48.514 -11.960 15.373 1.00 46.08 ? 539 ASN A CB    1 
ATOM   2406 C CG    . ASN A 1 331 ? -50.001 -11.674 15.689 1.00 47.21 ? 539 ASN A CG    1 
ATOM   2407 O OD1   . ASN A 1 331 ? -50.421 -11.603 16.858 1.00 46.20 ? 539 ASN A OD1   1 
ATOM   2408 N ND2   . ASN A 1 331 ? -50.790 -11.547 14.646 1.00 45.65 ? 539 ASN A ND2   1 
ATOM   2409 N N     . ASN A 1 332 ? -47.056 -8.812  14.073 1.00 46.03 ? 540 ASN A N     1 
ATOM   2410 C CA    . ASN A 1 332 ? -46.921 -7.349  14.259 1.00 46.57 ? 540 ASN A CA    1 
ATOM   2411 C C     . ASN A 1 332 ? -46.223 -6.863  15.519 1.00 46.08 ? 540 ASN A C     1 
ATOM   2412 O O     . ASN A 1 332 ? -46.504 -5.769  16.023 1.00 45.50 ? 540 ASN A O     1 
ATOM   2413 C CB    . ASN A 1 332 ? -48.250 -6.619  14.057 1.00 47.06 ? 540 ASN A CB    1 
ATOM   2414 C CG    . ASN A 1 332 ? -48.619 -6.514  12.607 1.00 49.71 ? 540 ASN A CG    1 
ATOM   2415 O OD1   . ASN A 1 332 ? -47.831 -6.022  11.779 1.00 51.90 ? 540 ASN A OD1   1 
ATOM   2416 N ND2   . ASN A 1 332 ? -49.809 -7.002  12.269 1.00 51.99 ? 540 ASN A ND2   1 
ATOM   2417 N N     A SER A 1 333 ? -45.294 -7.679  16.003 0.50 45.62 ? 541 SER A N     1 
ATOM   2418 N N     B SER A 1 333 ? -45.314 -7.684  16.030 0.50 45.55 ? 541 SER A N     1 
ATOM   2419 C CA    A SER A 1 333 ? -44.478 -7.354  17.167 0.50 45.23 ? 541 SER A CA    1 
ATOM   2420 C CA    B SER A 1 333 ? -44.467 -7.308  17.159 0.50 45.09 ? 541 SER A CA    1 
ATOM   2421 C C     A SER A 1 333 ? -43.062 -7.891  16.950 0.50 45.05 ? 541 SER A C     1 
ATOM   2422 C C     B SER A 1 333 ? -43.070 -7.901  16.980 0.50 44.99 ? 541 SER A C     1 
ATOM   2423 O O     A SER A 1 333 ? -42.874 -8.884  16.244 0.50 44.51 ? 541 SER A O     1 
ATOM   2424 O O     B SER A 1 333 ? -42.904 -8.936  16.330 0.50 44.49 ? 541 SER A O     1 
ATOM   2425 C CB    A SER A 1 333 ? -45.091 -7.952  18.431 0.50 45.27 ? 541 SER A CB    1 
ATOM   2426 C CB    B SER A 1 333 ? -45.089 -7.723  18.496 0.50 45.11 ? 541 SER A CB    1 
ATOM   2427 O OG    A SER A 1 333 ? -44.598 -7.298  19.584 0.50 45.94 ? 541 SER A OG    1 
ATOM   2428 O OG    B SER A 1 333 ? -45.689 -9.002  18.422 0.50 45.17 ? 541 SER A OG    1 
ATOM   2429 N N     . THR A 1 334 ? -42.077 -7.212  17.538 1.00 44.89 ? 542 THR A N     1 
ATOM   2430 C CA    . THR A 1 334 ? -40.676 -7.600  17.430 1.00 44.34 ? 542 THR A CA    1 
ATOM   2431 C C     . THR A 1 334 ? -40.101 -7.861  18.820 1.00 44.28 ? 542 THR A C     1 
ATOM   2432 O O     . THR A 1 334 ? -40.331 -7.071  19.730 1.00 43.97 ? 542 THR A O     1 
ATOM   2433 C CB    . THR A 1 334 ? -39.866 -6.488  16.747 1.00 44.61 ? 542 THR A CB    1 
ATOM   2434 O OG1   . THR A 1 334 ? -40.311 -6.355  15.388 1.00 44.38 ? 542 THR A OG1   1 
ATOM   2435 C CG2   . THR A 1 334 ? -38.360 -6.790  16.752 1.00 43.76 ? 542 THR A CG2   1 
ATOM   2436 N N     . GLN A 1 335 ? -39.334 -8.953  18.964 1.00 43.64 ? 543 GLN A N     1 
ATOM   2437 C CA    . GLN A 1 335 ? -38.672 -9.277  20.222 1.00 43.30 ? 543 GLN A CA    1 
ATOM   2438 C C     . GLN A 1 335 ? -37.289 -9.868  20.024 1.00 43.45 ? 543 GLN A C     1 
ATOM   2439 O O     . GLN A 1 335 ? -37.087 -10.780 19.193 1.00 42.83 ? 543 GLN A O     1 
ATOM   2440 C CB    . GLN A 1 335 ? -39.530 -10.240 21.056 1.00 43.30 ? 543 GLN A CB    1 
ATOM   2441 C CG    . GLN A 1 335 ? -38.881 -10.677 22.368 1.00 42.87 ? 543 GLN A CG    1 
ATOM   2442 C CD    . GLN A 1 335 ? -38.802 -9.554  23.406 1.00 44.34 ? 543 GLN A CD    1 
ATOM   2443 O OE1   . GLN A 1 335 ? -37.716 -9.192  23.880 1.00 44.44 ? 543 GLN A OE1   1 
ATOM   2444 N NE2   . GLN A 1 335 ? -39.959 -9.008  23.767 1.00 42.01 ? 543 GLN A NE2   1 
ATOM   2445 N N     . THR A 1 336 ? -36.346 -9.344  20.803 1.00 43.24 ? 544 THR A N     1 
ATOM   2446 C CA    . THR A 1 336 ? -34.968 -9.818  20.817 1.00 43.44 ? 544 THR A CA    1 
ATOM   2447 C C     . THR A 1 336 ? -34.774 -10.834 21.938 1.00 43.16 ? 544 THR A C     1 
ATOM   2448 O O     . THR A 1 336 ? -35.214 -10.613 23.071 1.00 43.46 ? 544 THR A O     1 
ATOM   2449 C CB    . THR A 1 336 ? -33.994 -8.616  20.970 1.00 44.14 ? 544 THR A CB    1 
ATOM   2450 O OG1   . THR A 1 336 ? -34.112 -7.761  19.819 1.00 44.95 ? 544 THR A OG1   1 
ATOM   2451 C CG2   . THR A 1 336 ? -32.565 -9.075  21.096 1.00 42.23 ? 544 THR A CG2   1 
ATOM   2452 N N     . TYR A 1 337 ? -34.145 -11.957 21.593 1.00 42.15 ? 545 TYR A N     1 
ATOM   2453 C CA    . TYR A 1 337 ? -33.872 -13.049 22.502 1.00 41.25 ? 545 TYR A CA    1 
ATOM   2454 C C     . TYR A 1 337 ? -32.364 -13.224 22.624 1.00 42.04 ? 545 TYR A C     1 
ATOM   2455 O O     . TYR A 1 337 ? -31.625 -12.954 21.680 1.00 41.41 ? 545 TYR A O     1 
ATOM   2456 C CB    . TYR A 1 337 ? -34.494 -14.361 21.997 1.00 40.48 ? 545 TYR A CB    1 
ATOM   2457 C CG    . TYR A 1 337 ? -36.003 -14.330 21.884 1.00 39.93 ? 545 TYR A CG    1 
ATOM   2458 C CD1   . TYR A 1 337 ? -36.616 -13.899 20.708 1.00 37.95 ? 545 TYR A CD1   1 
ATOM   2459 C CD2   . TYR A 1 337 ? -36.817 -14.701 22.960 1.00 37.24 ? 545 TYR A CD2   1 
ATOM   2460 C CE1   . TYR A 1 337 ? -38.002 -13.836 20.587 1.00 37.40 ? 545 TYR A CE1   1 
ATOM   2461 C CE2   . TYR A 1 337 ? -38.223 -14.656 22.847 1.00 39.26 ? 545 TYR A CE2   1 
ATOM   2462 C CZ    . TYR A 1 337 ? -38.803 -14.214 21.659 1.00 38.13 ? 545 TYR A CZ    1 
ATOM   2463 O OH    . TYR A 1 337 ? -40.175 -14.156 21.515 1.00 39.98 ? 545 TYR A OH    1 
ATOM   2464 N N     . GLY A 1 338 ? -31.916 -13.669 23.791 1.00 42.58 ? 546 GLY A N     1 
ATOM   2465 C CA    . GLY A 1 338 ? -30.534 -14.074 23.965 1.00 44.20 ? 546 GLY A CA    1 
ATOM   2466 C C     . GLY A 1 338 ? -30.410 -15.566 24.227 1.00 45.99 ? 546 GLY A C     1 
ATOM   2467 O O     . GLY A 1 338 ? -31.213 -16.167 24.942 1.00 45.04 ? 546 GLY A O     1 
ATOM   2468 N N     . LEU A 1 339 ? -29.399 -16.162 23.614 1.00 48.56 ? 547 LEU A N     1 
ATOM   2469 C CA    . LEU A 1 339 ? -28.943 -17.496 23.963 1.00 51.18 ? 547 LEU A CA    1 
ATOM   2470 C C     . LEU A 1 339 ? -27.747 -17.239 24.821 1.00 53.14 ? 547 LEU A C     1 
ATOM   2471 O O     . LEU A 1 339 ? -26.765 -16.649 24.353 1.00 53.65 ? 547 LEU A O     1 
ATOM   2472 C CB    . LEU A 1 339 ? -28.517 -18.310 22.729 1.00 51.33 ? 547 LEU A CB    1 
ATOM   2473 C CG    . LEU A 1 339 ? -29.526 -19.237 22.064 1.00 50.77 ? 547 LEU A CG    1 
ATOM   2474 C CD1   . LEU A 1 339 ? -30.417 -18.413 21.131 1.00 50.64 ? 547 LEU A CD1   1 
ATOM   2475 C CD2   . LEU A 1 339 ? -28.801 -20.278 21.276 1.00 48.90 ? 547 LEU A CD2   1 
ATOM   2476 N N     . GLN A 1 340 ? -27.862 -17.684 26.069 1.00 54.74 ? 548 GLN A N     1 
ATOM   2477 C CA    . GLN A 1 340 ? -26.950 -17.394 27.171 1.00 56.48 ? 548 GLN A CA    1 
ATOM   2478 C C     . GLN A 1 340 ? -25.707 -16.607 26.822 1.00 56.97 ? 548 GLN A C     1 
ATOM   2479 O O     . GLN A 1 340 ? -25.520 -15.518 27.363 1.00 57.88 ? 548 GLN A O     1 
ATOM   2480 C CB    . GLN A 1 340 ? -26.577 -18.678 27.922 1.00 56.78 ? 548 GLN A CB    1 
ATOM   2481 C CG    . GLN A 1 340 ? -26.881 -18.607 29.418 1.00 59.10 ? 548 GLN A CG    1 
ATOM   2482 C CD    . GLN A 1 340 ? -28.384 -18.696 29.750 1.00 61.66 ? 548 GLN A CD    1 
ATOM   2483 O OE1   . GLN A 1 340 ? -28.837 -19.675 30.339 1.00 62.83 ? 548 GLN A OE1   1 
ATOM   2484 N NE2   . GLN A 1 340 ? -29.152 -17.667 29.382 1.00 62.32 ? 548 GLN A NE2   1 
HETATM 2485 N N     . SAH B 2 .   ? -14.061 -33.292 19.241 1.00 28.29 ? 549 SAH A N     1 
HETATM 2486 C CA    . SAH B 2 .   ? -14.632 -33.669 20.560 1.00 28.95 ? 549 SAH A CA    1 
HETATM 2487 C CB    . SAH B 2 .   ? -15.055 -32.485 21.452 1.00 27.43 ? 549 SAH A CB    1 
HETATM 2488 C CG    . SAH B 2 .   ? -16.081 -31.536 20.841 1.00 27.92 ? 549 SAH A CG    1 
HETATM 2489 S SD    . SAH B 2 .   ? -16.474 -30.247 22.082 1.00 32.63 ? 549 SAH A SD    1 
HETATM 2490 C C     . SAH B 2 .   ? -15.839 -34.519 20.310 1.00 29.58 ? 549 SAH A C     1 
HETATM 2491 O O     . SAH B 2 .   ? -16.323 -34.518 19.169 1.00 30.58 ? 549 SAH A O     1 
HETATM 2492 O OXT   . SAH B 2 .   ? -16.309 -35.216 21.234 1.00 31.20 ? 549 SAH A OXT   1 
HETATM 2493 C "C5'" . SAH B 2 .   ? -15.481 -28.898 21.366 1.00 31.16 ? 549 SAH A "C5'" 1 
HETATM 2494 C "C4'" . SAH B 2 .   ? -14.049 -28.792 21.883 1.00 30.15 ? 549 SAH A "C4'" 1 
HETATM 2495 O "O4'" . SAH B 2 .   ? -13.423 -27.743 21.174 1.00 30.82 ? 549 SAH A "O4'" 1 
HETATM 2496 C "C3'" . SAH B 2 .   ? -13.871 -28.422 23.347 1.00 29.53 ? 549 SAH A "C3'" 1 
HETATM 2497 O "O3'" . SAH B 2 .   ? -13.014 -29.369 23.964 1.00 31.01 ? 549 SAH A "O3'" 1 
HETATM 2498 C "C2'" . SAH B 2 .   ? -13.223 -27.023 23.368 1.00 30.32 ? 549 SAH A "C2'" 1 
HETATM 2499 O "O2'" . SAH B 2 .   ? -12.239 -26.910 24.356 1.00 32.22 ? 549 SAH A "O2'" 1 
HETATM 2500 C "C1'" . SAH B 2 .   ? -12.552 -27.008 21.989 1.00 32.83 ? 549 SAH A "C1'" 1 
HETATM 2501 N N9    . SAH B 2 .   ? -12.421 -25.692 21.326 1.00 33.91 ? 549 SAH A N9    1 
HETATM 2502 C C8    . SAH B 2 .   ? -13.402 -24.741 21.143 1.00 36.45 ? 549 SAH A C8    1 
HETATM 2503 N N7    . SAH B 2 .   ? -12.850 -23.687 20.492 1.00 36.41 ? 549 SAH A N7    1 
HETATM 2504 C C5    . SAH B 2 .   ? -11.542 -23.942 20.265 1.00 35.54 ? 549 SAH A C5    1 
HETATM 2505 C C6    . SAH B 2 .   ? -10.523 -23.217 19.625 1.00 36.19 ? 549 SAH A C6    1 
HETATM 2506 N N6    . SAH B 2 .   ? -10.744 -21.991 19.096 1.00 35.71 ? 549 SAH A N6    1 
HETATM 2507 N N1    . SAH B 2 .   ? -9.258  -23.780 19.543 1.00 36.74 ? 549 SAH A N1    1 
HETATM 2508 C C2    . SAH B 2 .   ? -9.003  -25.024 20.094 1.00 35.92 ? 549 SAH A C2    1 
HETATM 2509 N N3    . SAH B 2 .   ? -10.033 -25.734 20.703 1.00 35.80 ? 549 SAH A N3    1 
HETATM 2510 C C4    . SAH B 2 .   ? -11.276 -25.207 20.779 1.00 35.32 ? 549 SAH A C4    1 
HETATM 2511 O O     . HOH C 3 .   ? -12.274 -35.421 18.572 1.00 24.84 ? 550 HOH A O     1 
HETATM 2512 O O     . HOH C 3 .   ? -32.072 -32.371 19.569 1.00 31.69 ? 551 HOH A O     1 
HETATM 2513 O O     . HOH C 3 .   ? -14.676 -35.374 23.521 1.00 25.45 ? 552 HOH A O     1 
HETATM 2514 O O     . HOH C 3 .   ? 0.456   -45.835 16.959 1.00 33.55 ? 553 HOH A O     1 
HETATM 2515 O O     . HOH C 3 .   ? -20.466 -22.937 18.196 1.00 33.45 ? 554 HOH A O     1 
HETATM 2516 O O     . HOH C 3 .   ? -37.787 -17.182 25.282 1.00 35.78 ? 555 HOH A O     1 
HETATM 2517 O O     . HOH C 3 .   ? -31.569 -28.051 17.984 1.00 28.27 ? 556 HOH A O     1 
HETATM 2518 O O     . HOH C 3 .   ? -38.180 -32.028 13.440 1.00 38.96 ? 557 HOH A O     1 
HETATM 2519 O O     . HOH C 3 .   ? -46.711 -19.530 45.472 1.00 33.68 ? 558 HOH A O     1 
HETATM 2520 O O     . HOH C 3 .   ? -29.760 -19.321 3.692  1.00 34.34 ? 559 HOH A O     1 
HETATM 2521 O O     . HOH C 3 .   ? -17.885 -37.123 39.239 1.00 37.56 ? 560 HOH A O     1 
HETATM 2522 O O     . HOH C 3 .   ? -33.585 -34.076 17.621 1.00 32.22 ? 561 HOH A O     1 
HETATM 2523 O O     . HOH C 3 .   ? -13.841 -31.468 16.938 1.00 27.94 ? 562 HOH A O     1 
HETATM 2524 O O     . HOH C 3 .   ? -51.039 -26.956 26.377 1.00 44.70 ? 563 HOH A O     1 
HETATM 2525 O O     . HOH C 3 .   ? -42.761 -29.693 24.833 1.00 43.77 ? 564 HOH A O     1 
HETATM 2526 O O     . HOH C 3 .   ? -31.843 -36.843 15.853 1.00 33.17 ? 565 HOH A O     1 
HETATM 2527 O O     . HOH C 3 .   ? -3.989  -44.713 10.493 1.00 27.52 ? 566 HOH A O     1 
HETATM 2528 O O     . HOH C 3 .   ? -30.527 -26.213 19.763 1.00 32.35 ? 567 HOH A O     1 
HETATM 2529 O O     . HOH C 3 .   ? -20.705 -21.614 15.429 1.00 40.34 ? 568 HOH A O     1 
HETATM 2530 O O     . HOH C 3 .   ? -19.771 -28.657 19.778 1.00 38.46 ? 569 HOH A O     1 
HETATM 2531 O O     . HOH C 3 .   ? -9.344  -26.193 30.558 1.00 47.04 ? 570 HOH A O     1 
HETATM 2532 O O     . HOH C 3 .   ? 5.057   -36.088 11.364 1.00 30.18 ? 571 HOH A O     1 
HETATM 2533 O O     . HOH C 3 .   ? -28.596 -38.711 20.783 1.00 39.05 ? 572 HOH A O     1 
HETATM 2534 O O     . HOH C 3 .   ? -45.102 -11.704 21.084 1.00 41.64 ? 573 HOH A O     1 
HETATM 2535 O O     . HOH C 3 .   ? -32.632 -27.310 9.681  1.00 37.28 ? 574 HOH A O     1 
HETATM 2536 O O     . HOH C 3 .   ? -0.182  -39.547 23.164 1.00 35.57 ? 575 HOH A O     1 
HETATM 2537 O O     . HOH C 3 .   ? -38.897 -34.272 20.496 1.00 35.64 ? 576 HOH A O     1 
HETATM 2538 O O     . HOH C 3 .   ? -48.839 -13.569 31.013 1.00 43.92 ? 577 HOH A O     1 
HETATM 2539 O O     . HOH C 3 .   ? -45.135 -22.189 24.717 1.00 48.21 ? 578 HOH A O     1 
HETATM 2540 O O     . HOH C 3 .   ? -25.947 -36.975 25.925 1.00 37.11 ? 579 HOH A O     1 
HETATM 2541 O O     . HOH C 3 .   ? -23.243 -19.214 4.644  1.00 38.04 ? 580 HOH A O     1 
HETATM 2542 O O     . HOH C 3 .   ? -22.893 -20.744 2.481  1.00 40.07 ? 581 HOH A O     1 
HETATM 2543 O O     . HOH C 3 .   ? -14.103 -21.169 19.511 1.00 42.56 ? 582 HOH A O     1 
HETATM 2544 O O     . HOH C 3 .   ? -46.123 -18.976 41.757 1.00 32.04 ? 583 HOH A O     1 
HETATM 2545 O O     . HOH C 3 .   ? -12.884 -35.113 0.813  1.00 43.95 ? 584 HOH A O     1 
HETATM 2546 O O     . HOH C 3 .   ? -36.146 -34.217 19.880 1.00 38.70 ? 585 HOH A O     1 
HETATM 2547 O O     . HOH C 3 .   ? -28.836 -15.701 5.106  1.00 38.28 ? 586 HOH A O     1 
HETATM 2548 O O     . HOH C 3 .   ? 0.398   -38.440 20.593 1.00 33.87 ? 587 HOH A O     1 
HETATM 2549 O O     . HOH C 3 .   ? -14.522 -15.875 6.863  1.00 43.38 ? 588 HOH A O     1 
HETATM 2550 O O     . HOH C 3 .   ? -39.035 -8.312  27.620 1.00 44.20 ? 589 HOH A O     1 
HETATM 2551 O O     . HOH C 3 .   ? -2.249  -43.966 28.571 1.00 38.53 ? 590 HOH A O     1 
HETATM 2552 O O     . HOH C 3 .   ? -8.365  -49.567 20.972 1.00 42.62 ? 591 HOH A O     1 
HETATM 2553 O O     . HOH C 3 .   ? -50.926 -10.451 40.202 1.00 48.53 ? 592 HOH A O     1 
HETATM 2554 O O     . HOH C 3 .   ? -32.239 -29.249 6.316  1.00 39.11 ? 593 HOH A O     1 
HETATM 2555 O O     . HOH C 3 .   ? -11.199 -27.318 -1.548 1.00 50.66 ? 594 HOH A O     1 
HETATM 2556 O O     . HOH C 3 .   ? -9.931  -36.341 1.492  1.00 39.95 ? 595 HOH A O     1 
HETATM 2557 O O     . HOH C 3 .   ? -14.227 -47.844 16.650 1.00 38.22 ? 596 HOH A O     1 
HETATM 2558 O O     . HOH C 3 .   ? -32.368 -17.850 33.449 1.00 45.45 ? 597 HOH A O     1 
HETATM 2559 O O     . HOH C 3 .   ? -45.197 -8.717  11.537 1.00 48.89 ? 598 HOH A O     1 
HETATM 2560 O O     . HOH C 3 .   ? -5.398  -22.818 25.074 1.00 50.86 ? 599 HOH A O     1 
HETATM 2561 O O     . HOH C 3 .   ? -27.557 -40.423 7.613  1.00 42.28 ? 600 HOH A O     1 
HETATM 2562 O O     . HOH C 3 .   ? -43.441 -5.758  14.649 1.00 56.55 ? 601 HOH A O     1 
HETATM 2563 O O     . HOH C 3 .   ? -45.720 -12.407 28.907 1.00 48.15 ? 602 HOH A O     1 
HETATM 2564 O O     . HOH C 3 .   ? -31.273 -37.896 13.180 1.00 50.71 ? 603 HOH A O     1 
HETATM 2565 O O     . HOH C 3 .   ? -30.552 -10.252 16.290 1.00 45.59 ? 604 HOH A O     1 
HETATM 2566 O O     . HOH C 3 .   ? -7.576  -41.706 0.367  1.00 34.81 ? 605 HOH A O     1 
HETATM 2567 O O     . HOH C 3 .   ? -0.425  -22.480 6.636  1.00 54.06 ? 606 HOH A O     1 
HETATM 2568 O O     . HOH C 3 .   ? -36.029 -38.989 21.233 1.00 57.39 ? 607 HOH A O     1 
HETATM 2569 O O     . HOH C 3 .   ? -17.504 -28.086 9.731  1.00 53.33 ? 608 HOH A O     1 
HETATM 2570 O O     . HOH C 3 .   ? -34.740 -39.723 14.289 1.00 48.00 ? 609 HOH A O     1 
HETATM 2571 O O     . HOH C 3 .   ? -51.495 -25.968 23.980 1.00 46.40 ? 610 HOH A O     1 
HETATM 2572 O O     . HOH C 3 .   ? -41.611 -24.138 26.524 1.00 54.18 ? 611 HOH A O     1 
HETATM 2573 O O     . HOH C 3 .   ? -31.784 -34.936 24.936 1.00 58.82 ? 612 HOH A O     1 
HETATM 2574 O O     . HOH C 3 .   ? -44.073 -27.443 23.859 1.00 45.73 ? 613 HOH A O     1 
HETATM 2575 O O     . HOH C 3 .   ? -9.207  -49.868 18.390 1.00 46.46 ? 614 HOH A O     1 
HETATM 2576 O O     . HOH C 3 .   ? -11.746 -49.393 17.403 1.00 47.09 ? 615 HOH A O     1 
HETATM 2577 O O     . HOH C 3 .   ? -4.374  -36.646 31.548 1.00 48.52 ? 616 HOH A O     1 
HETATM 2578 O O     . HOH C 3 .   ? -19.308 -26.236 -1.918 1.00 40.20 ? 617 HOH A O     1 
HETATM 2579 O O     . HOH C 3 .   ? 5.407   -47.317 14.659 1.00 39.14 ? 618 HOH A O     1 
HETATM 2580 O O     . HOH C 3 .   ? -6.404  -48.614 18.514 1.00 48.18 ? 619 HOH A O     1 
HETATM 2581 O O     . HOH C 3 .   ? -20.308 -29.705 0.106  1.00 40.64 ? 620 HOH A O     1 
HETATM 2582 O O     . HOH C 3 .   ? -18.205 -34.481 -3.916 1.00 49.06 ? 621 HOH A O     1 
HETATM 2583 O O     . HOH C 3 .   ? -38.476 -24.189 4.211  1.00 46.57 ? 622 HOH A O     1 
HETATM 2584 O O     . HOH C 3 .   ? -28.299 -40.719 22.518 1.00 43.07 ? 623 HOH A O     1 
HETATM 2585 O O     . HOH C 3 .   ? -30.777 -17.991 27.368 1.00 54.63 ? 624 HOH A O     1 
HETATM 2586 O O     . HOH C 3 .   ? 6.564   -32.166 13.777 1.00 48.38 ? 625 HOH A O     1 
HETATM 2587 O O     . HOH C 3 .   ? -35.186 -10.805 5.823  1.00 75.30 ? 626 HOH A O     1 
HETATM 2588 O O     . HOH C 3 .   ? -5.876  -48.465 10.607 1.00 51.21 ? 627 HOH A O     1 
HETATM 2589 O O     . HOH C 3 .   ? -28.914 -12.195 5.236  1.00 54.56 ? 628 HOH A O     1 
HETATM 2590 O O     . HOH C 3 .   ? 3.741   -34.278 9.765  1.00 51.88 ? 629 HOH A O     1 
HETATM 2591 O O     . HOH C 3 .   ? -25.016 -14.979 2.893  1.00 47.40 ? 630 HOH A O     1 
HETATM 2592 O O     . HOH C 3 .   ? 3.612   -29.458 5.543  1.00 47.85 ? 631 HOH A O     1 
HETATM 2593 O O     . HOH C 3 .   ? 2.331   -38.599 17.196 1.00 49.00 ? 632 HOH A O     1 
HETATM 2594 O O     . HOH C 3 .   ? -42.917 -4.798  18.581 1.00 56.74 ? 633 HOH A O     1 
HETATM 2595 O O     . HOH C 3 .   ? -25.066 -17.301 3.620  1.00 46.71 ? 634 HOH A O     1 
HETATM 2596 O O     . HOH C 3 .   ? 4.183   -33.275 14.354 1.00 45.21 ? 635 HOH A O     1 
HETATM 2597 O O     . HOH C 3 .   ? -31.042 -17.169 5.034  1.00 42.47 ? 636 HOH A O     1 
HETATM 2598 O O     . HOH C 3 .   ? 5.733   -44.483 19.951 1.00 42.81 ? 637 HOH A O     1 
HETATM 2599 O O     . HOH C 3 .   ? -32.570 -24.687 4.977  1.00 52.47 ? 638 HOH A O     1 
HETATM 2600 O O     . HOH C 3 .   ? -44.256 -8.194  32.995 1.00 48.37 ? 639 HOH A O     1 
HETATM 2601 O O     . HOH C 3 .   ? -21.973 -30.998 -1.162 1.00 58.11 ? 640 HOH A O     1 
HETATM 2602 O O     . HOH C 3 .   ? -8.659  -47.100 5.268  1.00 48.19 ? 641 HOH A O     1 
HETATM 2603 O O     . HOH C 3 .   ? -36.074 -30.836 27.900 1.00 46.05 ? 642 HOH A O     1 
HETATM 2604 O O     . HOH C 3 .   ? -50.534 -28.057 21.552 1.00 55.50 ? 643 HOH A O     1 
HETATM 2605 O O     . HOH C 3 .   ? -14.013 -40.610 -1.124 1.00 47.39 ? 644 HOH A O     1 
HETATM 2606 O O     . HOH C 3 .   ? -20.737 -18.921 14.555 1.00 40.07 ? 645 HOH A O     1 
HETATM 2607 O O     . HOH C 3 .   ? -33.859 -11.354 30.574 1.00 47.03 ? 646 HOH A O     1 
HETATM 2608 O O     . HOH C 3 .   ? -42.493 -12.264 22.116 1.00 50.01 ? 647 HOH A O     1 
HETATM 2609 O O     . HOH C 3 .   ? -39.537 -36.100 21.930 1.00 49.36 ? 648 HOH A O     1 
HETATM 2610 O O     . HOH C 3 .   ? -34.275 -32.942 28.101 1.00 59.15 ? 649 HOH A O     1 
HETATM 2611 O O     . HOH C 3 .   ? -2.959  -46.758 9.090  1.00 45.89 ? 650 HOH A O     1 
HETATM 2612 O O     . HOH C 3 .   ? -2.355  -19.020 13.125 1.00 49.65 ? 651 HOH A O     1 
HETATM 2613 O O     . HOH C 3 .   ? -32.055 -20.249 3.432  1.00 43.98 ? 652 HOH A O     1 
HETATM 2614 O O     . HOH C 3 .   ? -49.108 -14.082 8.491  1.00 56.20 ? 653 HOH A O     1 
HETATM 2615 O O     . HOH C 3 .   ? -27.163 -12.822 24.187 1.00 54.94 ? 654 HOH A O     1 
HETATM 2616 O O     . HOH C 3 .   ? -23.749 -25.626 22.759 1.00 48.30 ? 655 HOH A O     1 
HETATM 2617 O O     . HOH C 3 .   ? 0.004   -43.559 10.190 1.00 46.73 ? 656 HOH A O     1 
HETATM 2618 O O     . HOH C 3 .   ? -37.343 -20.769 3.151  1.00 52.69 ? 657 HOH A O     1 
HETATM 2619 O O     . HOH C 3 .   ? -7.450  -18.112 8.430  1.00 54.25 ? 658 HOH A O     1 
HETATM 2620 O O     . HOH C 3 .   ? 2.064   -23.910 10.159 1.00 60.67 ? 659 HOH A O     1 
HETATM 2621 O O     . HOH C 3 .   ? 2.160   -48.036 20.671 1.00 54.33 ? 660 HOH A O     1 
HETATM 2622 O O     . HOH C 3 .   ? -52.897 -12.054 20.784 1.00 50.43 ? 661 HOH A O     1 
HETATM 2623 O O     . HOH C 3 .   ? -18.669 -47.907 17.780 1.00 48.78 ? 662 HOH A O     1 
HETATM 2624 O O     . HOH C 3 .   ? -3.394  -20.763 22.256 1.00 50.60 ? 663 HOH A O     1 
HETATM 2625 O O     . HOH C 3 .   ? -22.741 -35.564 31.709 1.00 54.56 ? 664 HOH A O     1 
HETATM 2626 O O     . HOH C 3 .   ? -2.920  -21.359 14.171 1.00 45.54 ? 665 HOH A O     1 
HETATM 2627 O O     . HOH C 3 .   ? -44.271 -3.282  37.178 1.00 42.05 ? 666 HOH A O     1 
HETATM 2628 O O     . HOH C 3 .   ? -3.208  -45.569 12.992 1.00 40.60 ? 667 HOH A O     1 
HETATM 2629 O O     . HOH C 3 .   ? -33.486 -12.910 33.826 1.00 57.46 ? 668 HOH A O     1 
HETATM 2630 O O     . HOH C 3 .   ? 4.697   -25.668 9.833  1.00 62.21 ? 669 HOH A O     1 
HETATM 2631 O O     . HOH C 3 .   ? 1.770   -39.037 24.928 1.00 54.49 ? 670 HOH A O     1 
HETATM 2632 O O     . HOH C 3 .   ? -20.324 -13.626 12.198 1.00 52.92 ? 671 HOH A O     1 
HETATM 2633 O O     . HOH C 3 .   ? -20.753 -28.783 24.136 1.00 48.30 ? 672 HOH A O     1 
HETATM 2634 O O     . HOH C 3 .   ? -47.043 -12.487 11.247 1.00 44.52 ? 673 HOH A O     1 
HETATM 2635 O O     . HOH C 3 .   ? 0.718   -35.933 21.009 1.00 45.61 ? 674 HOH A O     1 
HETATM 2636 O O     . HOH C 3 .   ? 2.387   -47.172 17.609 1.00 64.92 ? 675 HOH A O     1 
HETATM 2637 O O     . HOH C 3 .   ? -3.864  -50.204 26.607 1.00 53.89 ? 676 HOH A O     1 
HETATM 2638 O O     . HOH C 3 .   ? -45.071 -8.884  30.575 1.00 53.95 ? 677 HOH A O     1 
HETATM 2639 O O     . HOH C 3 .   ? 3.005   -36.172 20.168 1.00 49.49 ? 678 HOH A O     1 
HETATM 2640 O O     . HOH C 3 .   ? 0.843   -46.835 23.733 1.00 42.87 ? 679 HOH A O     1 
HETATM 2641 O O     . HOH C 3 .   ? -19.119 -11.550 13.097 1.00 69.84 ? 680 HOH A O     1 
HETATM 2642 O O     . HOH C 3 .   ? -50.518 -17.165 49.767 1.00 59.53 ? 681 HOH A O     1 
HETATM 2643 O O     . HOH C 3 .   ? -45.491 -12.063 18.209 1.00 52.32 ? 682 HOH A O     1 
HETATM 2644 O O     . HOH C 3 .   ? -57.479 -21.170 17.077 1.00 57.96 ? 683 HOH A O     1 
HETATM 2645 O O     . HOH C 3 .   ? -36.084 -33.376 12.478 1.00 49.53 ? 684 HOH A O     1 
HETATM 2646 O O     . HOH C 3 .   ? 0.750   -22.806 12.140 1.00 43.82 ? 685 HOH A O     1 
HETATM 2647 O O     . HOH C 3 .   ? -43.154 -24.878 24.512 1.00 46.49 ? 686 HOH A O     1 
HETATM 2648 O O     . HOH C 3 .   ? -29.435 -15.052 27.285 1.00 67.91 ? 687 HOH A O     1 
HETATM 2649 O O     . HOH C 3 .   ? -10.767 -32.978 -0.836 1.00 48.69 ? 688 HOH A O     1 
HETATM 2650 O O     . HOH C 3 .   ? -4.920  -47.506 13.227 1.00 53.11 ? 689 HOH A O     1 
HETATM 2651 O O     . HOH C 3 .   ? -15.721 -28.213 -2.000 1.00 45.42 ? 690 HOH A O     1 
HETATM 2652 O O     . HOH C 3 .   ? -31.426 -27.548 28.573 1.00 46.62 ? 691 HOH A O     1 
HETATM 2653 O O     . HOH C 3 .   ? -37.166 -29.924 9.072  1.00 57.13 ? 692 HOH A O     1 
HETATM 2654 O O     . HOH C 3 .   ? -36.873 -6.585  22.026 1.00 49.76 ? 693 HOH A O     1 
HETATM 2655 O O     . HOH C 3 .   ? 5.710   -42.520 21.214 1.00 50.84 ? 694 HOH A O     1 
HETATM 2656 O O     . HOH C 3 .   ? -52.808 -27.575 19.370 1.00 60.27 ? 695 HOH A O     1 
HETATM 2657 O O     . HOH C 3 .   ? -48.499 -4.423  17.174 1.00 66.81 ? 696 HOH A O     1 
HETATM 2658 O O     . HOH C 3 .   ? -0.277  -42.505 28.554 1.00 44.73 ? 697 HOH A O     1 
HETATM 2659 O O     . HOH C 3 .   ? 2.568   -46.095 25.634 1.00 56.68 ? 698 HOH A O     1 
HETATM 2660 O O     . HOH C 3 .   ? -8.846  -34.235 1.011  1.00 53.12 ? 699 HOH A O     1 
HETATM 2661 O O     . HOH C 3 .   ? -30.698 -25.953 2.415  1.00 49.46 ? 700 HOH A O     1 
HETATM 2662 O O     . HOH C 3 .   ? -24.568 -43.784 5.518  1.00 54.64 ? 701 HOH A O     1 
HETATM 2663 O O     . HOH C 3 .   ? -48.446 -17.777 30.017 1.00 55.54 ? 702 HOH A O     1 
HETATM 2664 O O     . HOH C 3 .   ? -25.148 -48.342 17.158 1.00 73.48 ? 703 HOH A O     1 
HETATM 2665 O O     . HOH C 3 .   ? -32.348 -34.313 8.414  1.00 54.56 ? 704 HOH A O     1 
HETATM 2666 O O     . HOH C 3 .   ? -33.083 -20.753 29.876 1.00 57.32 ? 705 HOH A O     1 
HETATM 2667 O O     . HOH C 3 .   ? -12.139 -29.913 35.551 1.00 74.81 ? 706 HOH A O     1 
HETATM 2668 O O     . HOH C 3 .   ? -32.429 -23.253 28.781 1.00 46.37 ? 707 HOH A O     1 
HETATM 2669 O O     . HOH C 3 .   ? -43.619 -22.202 44.540 1.00 50.58 ? 708 HOH A O     1 
HETATM 2670 O O     . HOH C 3 .   ? -51.990 -16.664 47.018 1.00 47.10 ? 709 HOH A O     1 
HETATM 2671 O O     . HOH C 3 .   ? -5.879  -32.570 -0.249 1.00 51.58 ? 710 HOH A O     1 
HETATM 2672 O O     . HOH C 3 .   ? -18.383 -16.017 1.434  1.00 57.68 ? 711 HOH A O     1 
HETATM 2673 O O     . HOH C 3 .   ? -20.237 -14.037 1.001  1.00 66.07 ? 712 HOH A O     1 
HETATM 2674 O O     . HOH C 3 .   ? -28.560 -33.851 27.471 1.00 52.89 ? 713 HOH A O     1 
HETATM 2675 O O     . HOH C 3 .   ? -13.286 -47.691 7.711  1.00 51.44 ? 714 HOH A O     1 
HETATM 2676 O O     . HOH C 3 .   ? -9.502  -25.686 -2.653 1.00 61.98 ? 715 HOH A O     1 
HETATM 2677 O O     . HOH C 3 .   ? -15.972 -48.864 4.871  1.00 46.09 ? 716 HOH A O     1 
HETATM 2678 O O     . HOH C 3 .   ? -2.734  -26.193 -1.188 1.00 69.89 ? 717 HOH A O     1 
HETATM 2679 O O     . HOH C 3 .   ? -42.222 -11.340 18.672 1.00 54.14 ? 718 HOH A O     1 
HETATM 2680 O O     . HOH C 3 .   ? -14.180 -17.867 5.034  1.00 72.06 ? 719 HOH A O     1 
HETATM 2681 O O     . HOH C 3 .   ? -47.622 -11.348 19.066 1.00 52.85 ? 720 HOH A O     1 
HETATM 2682 O O     . HOH C 3 .   ? -35.786 -7.692  30.407 1.00 65.38 ? 721 HOH A O     1 
HETATM 2683 O O     . HOH C 3 .   ? -2.139  -31.944 1.817  1.00 55.96 ? 722 HOH A O     1 
HETATM 2684 O O     . HOH C 3 .   ? -10.116 -50.625 23.111 1.00 55.91 ? 723 HOH A O     1 
HETATM 2685 O O     . HOH C 3 .   ? -16.852 -12.268 4.139  1.00 55.74 ? 724 HOH A O     1 
HETATM 2686 O O     . HOH C 3 .   ? -23.843 -14.791 14.413 1.00 59.99 ? 725 HOH A O     1 
HETATM 2687 O O     . HOH C 3 .   ? -55.959 -26.940 18.417 1.00 59.83 ? 726 HOH A O     1 
HETATM 2688 O O     . HOH C 3 .   ? -22.216 -16.726 15.191 1.00 51.48 ? 727 HOH A O     1 
HETATM 2689 O O     . HOH C 3 .   ? -41.715 -4.563  15.030 1.00 47.24 ? 728 HOH A O     1 
HETATM 2690 O O     . HOH C 3 .   ? -41.944 -7.616  22.086 1.00 63.13 ? 729 HOH A O     1 
HETATM 2691 O O     . HOH C 3 .   ? -36.744 -10.358 12.855 1.00 65.23 ? 730 HOH A O     1 
HETATM 2692 O O     . HOH C 3 .   ? -22.712 -48.189 18.109 1.00 78.22 ? 731 HOH A O     1 
HETATM 2693 O O     . HOH C 3 .   ? -18.641 -25.027 21.354 1.00 49.39 ? 732 HOH A O     1 
HETATM 2694 O O     . HOH C 3 .   ? -12.455 -19.892 30.599 1.00 52.46 ? 733 HOH A O     1 
HETATM 2695 O O     . HOH C 3 .   ? -19.955 -27.579 1.522  1.00 48.27 ? 734 HOH A O     1 
HETATM 2696 O O     . HOH C 3 .   ? -16.579 -23.530 22.321 1.00 56.80 ? 735 HOH A O     1 
HETATM 2697 O O     . HOH C 3 .   ? -15.703 -42.113 -0.327 1.00 54.27 ? 736 HOH A O     1 
HETATM 2698 O O     . HOH C 3 .   ? -9.813  -45.947 0.898  1.00 54.48 ? 737 HOH A O     1 
HETATM 2699 O O     . HOH C 3 .   ? -15.330 -21.587 30.523 1.00 55.05 ? 738 HOH A O     1 
HETATM 2700 O O     . HOH C 3 .   ? -16.166 -21.476 25.291 1.00 60.27 ? 739 HOH A O     1 
HETATM 2701 O O     . HOH C 3 .   ? -16.202 -12.779 6.679  1.00 52.62 ? 740 HOH A O     1 
HETATM 2702 O O     . HOH C 3 .   ? -10.238 -27.644 33.073 1.00 74.62 ? 741 HOH A O     1 
HETATM 2703 O O     . HOH C 3 .   ? -12.049 -47.568 -0.530 1.00 63.79 ? 742 HOH A O     1 
HETATM 2704 O O     . HOH C 3 .   ? -0.637  -45.670 14.587 1.00 45.18 ? 743 HOH A O     1 
HETATM 2705 O O     . HOH C 3 .   ? -24.177 -41.393 34.961 1.00 54.86 ? 744 HOH A O     1 
HETATM 2706 O O     . HOH C 3 .   ? -9.519  -42.181 -2.758 1.00 66.41 ? 745 HOH A O     1 
HETATM 2707 O O     . HOH C 3 .   ? -4.878  -50.805 23.121 1.00 55.34 ? 746 HOH A O     1 
HETATM 2708 O O     . HOH C 3 .   ? 1.644   -19.392 9.972  1.00 69.08 ? 747 HOH A O     1 
HETATM 2709 O O     . HOH C 3 .   ? 0.675   -42.448 -0.008 1.00 56.53 ? 748 HOH A O     1 
HETATM 2710 O O     . HOH C 3 .   ? -28.373 -30.329 1.466  1.00 57.03 ? 749 HOH A O     1 
HETATM 2711 O O     . HOH C 3 .   ? -2.468  -36.959 -0.581 1.00 51.83 ? 750 HOH A O     1 
HETATM 2712 O O     . HOH C 3 .   ? -25.597 -6.881  15.074 1.00 69.74 ? 751 HOH A O     1 
HETATM 2713 O O     . HOH C 3 .   ? -25.509 -42.591 10.844 1.00 61.16 ? 752 HOH A O     1 
HETATM 2714 O O     . HOH C 3 .   ? -57.129 -28.369 13.013 1.00 66.02 ? 753 HOH A O     1 
HETATM 2715 O O     . HOH C 3 .   ? -7.568  -38.434 -3.424 1.00 68.97 ? 754 HOH A O     1 
HETATM 2716 O O     . HOH C 3 .   ? -18.214 -9.994  10.221 1.00 58.11 ? 755 HOH A O     1 
HETATM 2717 O O     . HOH C 3 .   ? -39.883 -30.307 12.707 1.00 60.36 ? 756 HOH A O     1 
HETATM 2718 O O     . HOH C 3 .   ? -13.086 -25.218 0.198  1.00 58.95 ? 757 HOH A O     1 
HETATM 2719 O O     . HOH C 3 .   ? -12.244 -18.904 19.743 1.00 58.90 ? 758 HOH A O     1 
HETATM 2720 O O     . HOH C 3 .   ? -5.010  -38.965 31.909 1.00 44.22 ? 759 HOH A O     1 
HETATM 2721 O O     . HOH C 3 .   ? -27.553 -22.036 27.557 1.00 57.22 ? 760 HOH A O     1 
HETATM 2722 O O     . HOH C 3 .   ? -16.448 -22.008 33.036 1.00 56.37 ? 761 HOH A O     1 
HETATM 2723 O O     . HOH C 3 .   ? -11.732 -18.154 28.896 1.00 71.85 ? 762 HOH A O     1 
HETATM 2724 O O     . HOH C 3 .   ? -18.235 -28.509 -1.618 1.00 38.15 ? 763 HOH A O     1 
HETATM 2725 O O     . HOH C 3 .   ? -12.189 -17.187 15.560 1.00 50.08 ? 764 HOH A O     1 
HETATM 2726 O O     . HOH C 3 .   ? -28.734 -9.547  9.205  1.00 61.88 ? 765 HOH A O     1 
HETATM 2727 O O     . HOH C 3 .   ? -41.606 -11.659 6.138  1.00 58.76 ? 766 HOH A O     1 
HETATM 2728 O O     . HOH C 3 .   ? -31.676 -39.752 22.403 1.00 56.32 ? 767 HOH A O     1 
HETATM 2729 O O     . HOH C 3 .   ? 1.142   -43.030 -2.560 1.00 69.64 ? 768 HOH A O     1 
HETATM 2730 O O     . HOH C 3 .   ? -19.758 -48.918 19.662 1.00 57.62 ? 769 HOH A O     1 
HETATM 2731 O O     . HOH C 3 .   ? -21.949 -31.738 26.330 1.00 68.33 ? 770 HOH A O     1 
HETATM 2732 O O     . HOH C 3 .   ? -31.246 -12.888 27.190 1.00 58.42 ? 771 HOH A O     1 
HETATM 2733 O O     . HOH C 3 .   ? -45.665 -5.630  36.180 1.00 53.56 ? 772 HOH A O     1 
HETATM 2734 O O     . HOH C 3 .   ? 5.706   -27.048 5.100  1.00 92.35 ? 773 HOH A O     1 
HETATM 2735 O O     . HOH C 3 .   ? -21.691 -11.687 4.585  1.00 60.43 ? 774 HOH A O     1 
HETATM 2736 O O     . HOH C 3 .   ? -0.256  -32.484 3.364  1.00 68.38 ? 775 HOH A O     1 
HETATM 2737 O O     . HOH C 3 .   ? -0.732  -45.101 8.104  1.00 62.95 ? 776 HOH A O     1 
HETATM 2738 O O     . HOH C 3 .   ? -61.507 -19.094 9.463  1.00 60.93 ? 777 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   209 ?   ?   ?   A . n 
A 1 2   GLY 2   210 ?   ?   ?   A . n 
A 1 3   SER 3   211 ?   ?   ?   A . n 
A 1 4   SER 4   212 ?   ?   ?   A . n 
A 1 5   HIS 5   213 ?   ?   ?   A . n 
A 1 6   HIS 6   214 ?   ?   ?   A . n 
A 1 7   HIS 7   215 ?   ?   ?   A . n 
A 1 8   HIS 8   216 ?   ?   ?   A . n 
A 1 9   HIS 9   217 ?   ?   ?   A . n 
A 1 10  HIS 10  218 ?   ?   ?   A . n 
A 1 11  SER 11  219 ?   ?   ?   A . n 
A 1 12  SER 12  220 ?   ?   ?   A . n 
A 1 13  GLY 13  221 ?   ?   ?   A . n 
A 1 14  LEU 14  222 ?   ?   ?   A . n 
A 1 15  VAL 15  223 ?   ?   ?   A . n 
A 1 16  PRO 16  224 ?   ?   ?   A . n 
A 1 17  ARG 17  225 ?   ?   ?   A . n 
A 1 18  GLY 18  226 ?   ?   ?   A . n 
A 1 19  SER 19  227 ?   ?   ?   A . n 
A 1 20  ASP 20  228 ?   ?   ?   A . n 
A 1 21  LEU 21  229 ?   ?   ?   A . n 
A 1 22  GLN 22  230 ?   ?   ?   A . n 
A 1 23  GLU 23  231 ?   ?   ?   A . n 
A 1 24  ASP 24  232 ?   ?   ?   A . n 
A 1 25  GLU 25  233 ?   ?   ?   A . n 
A 1 26  ASP 26  234 ?   ?   ?   A . n 
A 1 27  GLY 27  235 ?   ?   ?   A . n 
A 1 28  VAL 28  236 ?   ?   ?   A . n 
A 1 29  TYR 29  237 ?   ?   ?   A . n 
A 1 30  PHE 30  238 238 PHE GLY A . n 
A 1 31  SER 31  239 239 SER SER A . n 
A 1 32  SER 32  240 240 SER SER A . n 
A 1 33  TYR 33  241 241 TYR TYR A . n 
A 1 34  GLY 34  242 242 GLY GLY A . n 
A 1 35  HIS 35  243 243 HIS HIS A . n 
A 1 36  TYR 36  244 244 TYR TYR A . n 
A 1 37  GLY 37  245 245 GLY GLY A . n 
A 1 38  ILE 38  246 246 ILE ILE A . n 
A 1 39  HIS 39  247 247 HIS HIS A . n 
A 1 40  GLU 40  248 248 GLU GLU A . n 
A 1 41  GLU 41  249 249 GLU GLU A . n 
A 1 42  MET 42  250 250 MET MET A . n 
A 1 43  LEU 43  251 251 LEU LEU A . n 
A 1 44  LYS 44  252 252 LYS LYS A . n 
A 1 45  ASP 45  253 253 ASP ASP A . n 
A 1 46  LYS 46  254 254 LYS LYS A . n 
A 1 47  ILE 47  255 255 ILE ILE A . n 
A 1 48  ARG 48  256 256 ARG ARG A . n 
A 1 49  THR 49  257 257 THR THR A . n 
A 1 50  GLU 50  258 258 GLU GLU A . n 
A 1 51  SER 51  259 259 SER SER A . n 
A 1 52  TYR 52  260 260 TYR TYR A . n 
A 1 53  ARG 53  261 261 ARG ARG A . n 
A 1 54  ASP 54  262 262 ASP ASP A . n 
A 1 55  PHE 55  263 263 PHE PHE A . n 
A 1 56  ILE 56  264 264 ILE ILE A . n 
A 1 57  TYR 57  265 265 TYR TYR A . n 
A 1 58  GLN 58  266 266 GLN GLN A . n 
A 1 59  ASN 59  267 267 ASN ASN A . n 
A 1 60  PRO 60  268 268 PRO PRO A . n 
A 1 61  HIS 61  269 269 HIS HIS A . n 
A 1 62  ILE 62  270 270 ILE ILE A . n 
A 1 63  PHE 63  271 271 PHE PHE A . n 
A 1 64  LYS 64  272 272 LYS LYS A . n 
A 1 65  ASP 65  273 273 ASP ASP A . n 
A 1 66  LYS 66  274 274 LYS LYS A . n 
A 1 67  VAL 67  275 275 VAL VAL A . n 
A 1 68  VAL 68  276 276 VAL VAL A . n 
A 1 69  LEU 69  277 277 LEU LEU A . n 
A 1 70  ASP 70  278 278 ASP ASP A . n 
A 1 71  VAL 71  279 279 VAL VAL A . n 
A 1 72  GLY 72  280 280 GLY GLY A . n 
A 1 73  CYS 73  281 281 CYS CYS A . n 
A 1 74  GLY 74  282 282 GLY GLY A . n 
A 1 75  THR 75  283 283 THR THR A . n 
A 1 76  GLY 76  284 284 GLY GLY A . n 
A 1 77  ILE 77  285 285 ILE ILE A . n 
A 1 78  LEU 78  286 286 LEU LEU A . n 
A 1 79  SER 79  287 287 SER SER A . n 
A 1 80  MET 80  288 288 MET MET A . n 
A 1 81  PHE 81  289 289 PHE PHE A . n 
A 1 82  ALA 82  290 290 ALA ALA A . n 
A 1 83  ALA 83  291 291 ALA ALA A . n 
A 1 84  LYS 84  292 292 LYS LYS A . n 
A 1 85  ALA 85  293 293 ALA ALA A . n 
A 1 86  GLY 86  294 294 GLY GLY A . n 
A 1 87  ALA 87  295 295 ALA ALA A . n 
A 1 88  LYS 88  296 296 LYS LYS A . n 
A 1 89  LYS 89  297 297 LYS LYS A . n 
A 1 90  VAL 90  298 298 VAL VAL A . n 
A 1 91  LEU 91  299 299 LEU LEU A . n 
A 1 92  GLY 92  300 300 GLY GLY A . n 
A 1 93  VAL 93  301 301 VAL VAL A . n 
A 1 94  ASP 94  302 302 ASP ASP A . n 
A 1 95  GLN 95  303 303 GLN GLN A . n 
A 1 96  SER 96  304 304 SER SER A . n 
A 1 97  GLU 97  305 305 GLU GLU A . n 
A 1 98  ILE 98  306 306 ILE ILE A . n 
A 1 99  LEU 99  307 307 LEU LEU A . n 
A 1 100 TYR 100 308 308 TYR TYR A . n 
A 1 101 GLN 101 309 309 GLN GLN A . n 
A 1 102 ALA 102 310 310 ALA ALA A . n 
A 1 103 MET 103 311 311 MET MET A . n 
A 1 104 ASP 104 312 312 ASP ASP A . n 
A 1 105 ILE 105 313 313 ILE ILE A . n 
A 1 106 ILE 106 314 314 ILE ILE A . n 
A 1 107 ARG 107 315 315 ARG ARG A . n 
A 1 108 LEU 108 316 316 LEU LEU A . n 
A 1 109 ASN 109 317 317 ASN ASN A . n 
A 1 110 LYS 110 318 318 LYS LYS A . n 
A 1 111 LEU 111 319 319 LEU LEU A . n 
A 1 112 GLU 112 320 320 GLU GLU A . n 
A 1 113 ASP 113 321 321 ASP ASP A . n 
A 1 114 THR 114 322 322 THR THR A . n 
A 1 115 ILE 115 323 323 ILE ILE A . n 
A 1 116 THR 116 324 324 THR THR A . n 
A 1 117 LEU 117 325 325 LEU LEU A . n 
A 1 118 ILE 118 326 326 ILE ILE A . n 
A 1 119 LYS 119 327 327 LYS LYS A . n 
A 1 120 GLY 120 328 328 GLY GLY A . n 
A 1 121 LYS 121 329 329 LYS LYS A . n 
A 1 122 ILE 122 330 330 ILE ILE A . n 
A 1 123 GLU 123 331 331 GLU GLU A . n 
A 1 124 GLU 124 332 332 GLU GLU A . n 
A 1 125 VAL 125 333 333 VAL VAL A . n 
A 1 126 HIS 126 334 334 HIS HIS A . n 
A 1 127 LEU 127 335 335 LEU LEU A . n 
A 1 128 PRO 128 336 336 PRO PRO A . n 
A 1 129 VAL 129 337 337 VAL VAL A . n 
A 1 130 GLU 130 338 338 GLU GLU A . n 
A 1 131 LYS 131 339 339 LYS LYS A . n 
A 1 132 VAL 132 340 340 VAL VAL A . n 
A 1 133 ASP 133 341 341 ASP ASP A . n 
A 1 134 VAL 134 342 342 VAL VAL A . n 
A 1 135 ILE 135 343 343 ILE ILE A . n 
A 1 136 ILE 136 344 344 ILE ILE A . n 
A 1 137 SER 137 345 345 SER SER A . n 
A 1 138 GLU 138 346 346 GLU GLU A . n 
A 1 139 TRP 139 347 347 TRP TRP A . n 
A 1 140 MET 140 348 348 MET MET A . n 
A 1 141 GLY 141 349 349 GLY GLY A . n 
A 1 142 TYR 142 350 350 TYR TYR A . n 
A 1 143 PHE 143 351 351 PHE PHE A . n 
A 1 144 LEU 144 352 352 LEU LEU A . n 
A 1 145 LEU 145 353 353 LEU LEU A . n 
A 1 146 PHE 146 354 354 PHE PHE A . n 
A 1 147 GLU 147 355 355 GLU GLU A . n 
A 1 148 SER 148 356 356 SER SER A . n 
A 1 149 MET 149 357 357 MET MET A . n 
A 1 150 LEU 150 358 358 LEU LEU A . n 
A 1 151 ASP 151 359 359 ASP ASP A . n 
A 1 152 SER 152 360 360 SER SER A . n 
A 1 153 VAL 153 361 361 VAL VAL A . n 
A 1 154 LEU 154 362 362 LEU LEU A . n 
A 1 155 TYR 155 363 363 TYR TYR A . n 
A 1 156 ALA 156 364 364 ALA ALA A . n 
A 1 157 LYS 157 365 365 LYS LYS A . n 
A 1 158 ASN 158 366 366 ASN ASN A . n 
A 1 159 LYS 159 367 367 LYS LYS A . n 
A 1 160 TYR 160 368 368 TYR TYR A . n 
A 1 161 LEU 161 369 369 LEU LEU A . n 
A 1 162 ALA 162 370 370 ALA ALA A . n 
A 1 163 LYS 163 371 371 LYS LYS A . n 
A 1 164 GLY 164 372 372 GLY GLY A . n 
A 1 165 GLY 165 373 373 GLY GLY A . n 
A 1 166 SER 166 374 374 SER SER A . n 
A 1 167 VAL 167 375 375 VAL VAL A . n 
A 1 168 TYR 168 376 376 TYR TYR A . n 
A 1 169 PRO 169 377 377 PRO PRO A . n 
A 1 170 ASP 170 378 378 ASP ASP A . n 
A 1 171 ILE 171 379 379 ILE ILE A . n 
A 1 172 CYS 172 380 380 CYS CYS A . n 
A 1 173 THR 173 381 381 THR THR A . n 
A 1 174 ILE 174 382 382 ILE ILE A . n 
A 1 175 SER 175 383 383 SER SER A . n 
A 1 176 LEU 176 384 384 LEU LEU A . n 
A 1 177 VAL 177 385 385 VAL VAL A . n 
A 1 178 ALA 178 386 386 ALA ALA A . n 
A 1 179 VAL 179 387 387 VAL VAL A . n 
A 1 180 SER 180 388 388 SER SER A . n 
A 1 181 ASP 181 389 389 ASP ASP A . n 
A 1 182 VAL 182 390 390 VAL VAL A . n 
A 1 183 ASN 183 391 391 ASN ASN A . n 
A 1 184 LYS 184 392 392 LYS LYS A . n 
A 1 185 HIS 185 393 393 HIS HIS A . n 
A 1 186 ALA 186 394 394 ALA ALA A . n 
A 1 187 ASP 187 395 395 ASP ASP A . n 
A 1 188 ARG 188 396 396 ARG ARG A . n 
A 1 189 ILE 189 397 397 ILE ILE A . n 
A 1 190 ALA 190 398 398 ALA ALA A . n 
A 1 191 PHE 191 399 399 PHE PHE A . n 
A 1 192 TRP 192 400 400 TRP TRP A . n 
A 1 193 ASP 193 401 401 ASP ASP A . n 
A 1 194 ASP 194 402 402 ASP ASP A . n 
A 1 195 VAL 195 403 403 VAL VAL A . n 
A 1 196 TYR 196 404 404 TYR TYR A . n 
A 1 197 GLY 197 405 405 GLY GLY A . n 
A 1 198 PHE 198 406 406 PHE PHE A . n 
A 1 199 LYS 199 407 407 LYS LYS A . n 
A 1 200 MET 200 408 408 MET MET A . n 
A 1 201 SER 201 409 409 SER SER A . n 
A 1 202 CYS 202 410 410 CYS CYS A . n 
A 1 203 MET 203 411 411 MET MET A . n 
A 1 204 LYS 204 412 412 LYS LYS A . n 
A 1 205 LYS 205 413 413 LYS LYS A . n 
A 1 206 ALA 206 414 414 ALA ALA A . n 
A 1 207 VAL 207 415 415 VAL VAL A . n 
A 1 208 ILE 208 416 416 ILE ILE A . n 
A 1 209 PRO 209 417 417 PRO PRO A . n 
A 1 210 GLU 210 418 418 GLU GLU A . n 
A 1 211 ALA 211 419 419 ALA ALA A . n 
A 1 212 VAL 212 420 420 VAL VAL A . n 
A 1 213 VAL 213 421 421 VAL VAL A . n 
A 1 214 GLU 214 422 422 GLU GLU A . n 
A 1 215 VAL 215 423 423 VAL VAL A . n 
A 1 216 LEU 216 424 424 LEU LEU A . n 
A 1 217 ASP 217 425 425 ASP ASP A . n 
A 1 218 PRO 218 426 426 PRO PRO A . n 
A 1 219 LYS 219 427 427 LYS LYS A . n 
A 1 220 THR 220 428 428 THR THR A . n 
A 1 221 LEU 221 429 429 LEU LEU A . n 
A 1 222 ILE 222 430 430 ILE ILE A . n 
A 1 223 SER 223 431 431 SER SER A . n 
A 1 224 GLU 224 432 432 GLU GLU A . n 
A 1 225 PRO 225 433 433 PRO PRO A . n 
A 1 226 CYS 226 434 434 CYS CYS A . n 
A 1 227 GLY 227 435 435 GLY GLY A . n 
A 1 228 ILE 228 436 436 ILE ILE A . n 
A 1 229 LYS 229 437 437 LYS LYS A . n 
A 1 230 HIS 230 438 438 HIS HIS A . n 
A 1 231 ILE 231 439 439 ILE ILE A . n 
A 1 232 ASP 232 440 440 ASP ASP A . n 
A 1 233 CYS 233 441 441 CYS CYS A . n 
A 1 234 HIS 234 442 442 HIS HIS A . n 
A 1 235 THR 235 443 443 THR THR A . n 
A 1 236 THR 236 444 444 THR THR A . n 
A 1 237 SER 237 445 445 SER SER A . n 
A 1 238 ILE 238 446 446 ILE ILE A . n 
A 1 239 SER 239 447 447 SER SER A . n 
A 1 240 ASP 240 448 448 ASP ASP A . n 
A 1 241 LEU 241 449 449 LEU LEU A . n 
A 1 242 GLU 242 450 450 GLU GLU A . n 
A 1 243 PHE 243 451 451 PHE PHE A . n 
A 1 244 SER 244 452 452 SER SER A . n 
A 1 245 SER 245 453 453 SER SER A . n 
A 1 246 ASP 246 454 454 ASP ASP A . n 
A 1 247 PHE 247 455 455 PHE PHE A . n 
A 1 248 THR 248 456 456 THR THR A . n 
A 1 249 LEU 249 457 457 LEU LEU A . n 
A 1 250 LYS 250 458 458 LYS LYS A . n 
A 1 251 ILE 251 459 459 ILE ILE A . n 
A 1 252 THR 252 460 460 THR THR A . n 
A 1 253 ARG 253 461 461 ARG ARG A . n 
A 1 254 THR 254 462 462 THR THR A . n 
A 1 255 SER 255 463 463 SER SER A . n 
A 1 256 MET 256 464 464 MET MET A . n 
A 1 257 CYS 257 465 465 CYS CYS A . n 
A 1 258 THR 258 466 466 THR THR A . n 
A 1 259 ALA 259 467 467 ALA ALA A . n 
A 1 260 ILE 260 468 468 ILE ILE A . n 
A 1 261 ALA 261 469 469 ALA ALA A . n 
A 1 262 GLY 262 470 470 GLY GLY A . n 
A 1 263 TYR 263 471 471 TYR TYR A . n 
A 1 264 PHE 264 472 472 PHE PHE A . n 
A 1 265 ASP 265 473 473 ASP ASP A . n 
A 1 266 ILE 266 474 474 ILE ILE A . n 
A 1 267 TYR 267 475 475 TYR TYR A . n 
A 1 268 PHE 268 476 476 PHE PHE A . n 
A 1 269 GLU 269 477 477 GLU GLU A . n 
A 1 270 LYS 270 478 478 LYS LYS A . n 
A 1 271 ASN 271 479 479 ASN ASN A . n 
A 1 272 CYS 272 480 480 CYS CYS A . n 
A 1 273 HIS 273 481 481 HIS HIS A . n 
A 1 274 ASN 274 482 482 ASN ASN A . n 
A 1 275 ARG 275 483 483 ARG ARG A . n 
A 1 276 VAL 276 484 484 VAL VAL A . n 
A 1 277 VAL 277 485 485 VAL VAL A . n 
A 1 278 PHE 278 486 486 PHE PHE A . n 
A 1 279 SER 279 487 487 SER SER A . n 
A 1 280 THR 280 488 488 THR THR A . n 
A 1 281 GLY 281 489 489 GLY GLY A . n 
A 1 282 PRO 282 490 490 PRO PRO A . n 
A 1 283 GLN 283 491 491 GLN GLN A . n 
A 1 284 SER 284 492 492 SER SER A . n 
A 1 285 THR 285 493 493 THR THR A . n 
A 1 286 LYS 286 494 494 LYS LYS A . n 
A 1 287 THR 287 495 495 THR THR A . n 
A 1 288 HIS 288 496 496 HIS HIS A . n 
A 1 289 TRP 289 497 497 TRP TRP A . n 
A 1 290 LYS 290 498 498 LYS LYS A . n 
A 1 291 GLN 291 499 499 GLN GLN A . n 
A 1 292 THR 292 500 500 THR THR A . n 
A 1 293 VAL 293 501 501 VAL VAL A . n 
A 1 294 PHE 294 502 502 PHE PHE A . n 
A 1 295 LEU 295 503 503 LEU LEU A . n 
A 1 296 LEU 296 504 504 LEU LEU A . n 
A 1 297 GLU 297 505 505 GLU GLU A . n 
A 1 298 LYS 298 506 506 LYS LYS A . n 
A 1 299 PRO 299 507 507 PRO PRO A . n 
A 1 300 PHE 300 508 508 PHE PHE A . n 
A 1 301 SER 301 509 509 SER SER A . n 
A 1 302 VAL 302 510 510 VAL VAL A . n 
A 1 303 LYS 303 511 511 LYS LYS A . n 
A 1 304 ALA 304 512 512 ALA ALA A . n 
A 1 305 GLY 305 513 513 GLY GLY A . n 
A 1 306 GLU 306 514 514 GLU GLU A . n 
A 1 307 ALA 307 515 515 ALA ALA A . n 
A 1 308 LEU 308 516 516 LEU LEU A . n 
A 1 309 LYS 309 517 517 LYS LYS A . n 
A 1 310 GLY 310 518 518 GLY GLY A . n 
A 1 311 LYS 311 519 519 LYS LYS A . n 
A 1 312 VAL 312 520 520 VAL VAL A . n 
A 1 313 THR 313 521 521 THR THR A . n 
A 1 314 VAL 314 522 522 VAL VAL A . n 
A 1 315 HIS 315 523 523 HIS HIS A . n 
A 1 316 LYS 316 524 524 LYS LYS A . n 
A 1 317 ASN 317 525 525 ASN ASN A . n 
A 1 318 LYS 318 526 526 LYS LYS A . n 
A 1 319 LYS 319 527 527 LYS LYS A . n 
A 1 320 ASP 320 528 528 ASP ASP A . n 
A 1 321 PRO 321 529 529 PRO PRO A . n 
A 1 322 ARG 322 530 530 ARG ARG A . n 
A 1 323 SER 323 531 531 SER SER A . n 
A 1 324 LEU 324 532 532 LEU LEU A . n 
A 1 325 THR 325 533 533 THR THR A . n 
A 1 326 VAL 326 534 534 VAL VAL A . n 
A 1 327 THR 327 535 535 THR THR A . n 
A 1 328 LEU 328 536 536 LEU LEU A . n 
A 1 329 THR 329 537 537 THR THR A . n 
A 1 330 LEU 330 538 538 LEU LEU A . n 
A 1 331 ASN 331 539 539 ASN ASN A . n 
A 1 332 ASN 332 540 540 ASN ASN A . n 
A 1 333 SER 333 541 541 SER SER A . n 
A 1 334 THR 334 542 542 THR THR A . n 
A 1 335 GLN 335 543 543 GLN GLN A . n 
A 1 336 THR 336 544 544 THR THR A . n 
A 1 337 TYR 337 545 545 TYR TYR A . n 
A 1 338 GLY 338 546 546 GLY GLY A . n 
A 1 339 LEU 339 547 547 LEU LEU A . n 
A 1 340 GLN 340 548 548 GLN GLN A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SAH 1   549 100 SAH SAH A . 
C 3 HOH 1   550 1   HOH HOH A . 
C 3 HOH 2   551 2   HOH HOH A . 
C 3 HOH 3   552 3   HOH HOH A . 
C 3 HOH 4   553 4   HOH HOH A . 
C 3 HOH 5   554 5   HOH HOH A . 
C 3 HOH 6   555 6   HOH HOH A . 
C 3 HOH 7   556 7   HOH HOH A . 
C 3 HOH 8   557 8   HOH HOH A . 
C 3 HOH 9   558 9   HOH HOH A . 
C 3 HOH 10  559 10  HOH HOH A . 
C 3 HOH 11  560 11  HOH HOH A . 
C 3 HOH 12  561 12  HOH HOH A . 
C 3 HOH 13  562 13  HOH HOH A . 
C 3 HOH 14  563 14  HOH HOH A . 
C 3 HOH 15  564 15  HOH HOH A . 
C 3 HOH 16  565 16  HOH HOH A . 
C 3 HOH 17  566 17  HOH HOH A . 
C 3 HOH 18  567 18  HOH HOH A . 
C 3 HOH 19  568 19  HOH HOH A . 
C 3 HOH 20  569 20  HOH HOH A . 
C 3 HOH 21  570 21  HOH HOH A . 
C 3 HOH 22  571 22  HOH HOH A . 
C 3 HOH 23  572 23  HOH HOH A . 
C 3 HOH 24  573 24  HOH HOH A . 
C 3 HOH 25  574 25  HOH HOH A . 
C 3 HOH 26  575 26  HOH HOH A . 
C 3 HOH 27  576 27  HOH HOH A . 
C 3 HOH 28  577 28  HOH HOH A . 
C 3 HOH 29  578 29  HOH HOH A . 
C 3 HOH 30  579 30  HOH HOH A . 
C 3 HOH 31  580 31  HOH HOH A . 
C 3 HOH 32  581 32  HOH HOH A . 
C 3 HOH 33  582 33  HOH HOH A . 
C 3 HOH 34  583 34  HOH HOH A . 
C 3 HOH 35  584 35  HOH HOH A . 
C 3 HOH 36  585 36  HOH HOH A . 
C 3 HOH 37  586 37  HOH HOH A . 
C 3 HOH 38  587 38  HOH HOH A . 
C 3 HOH 39  588 39  HOH HOH A . 
C 3 HOH 40  589 40  HOH HOH A . 
C 3 HOH 41  590 41  HOH HOH A . 
C 3 HOH 42  591 42  HOH HOH A . 
C 3 HOH 43  592 43  HOH HOH A . 
C 3 HOH 44  593 44  HOH HOH A . 
C 3 HOH 45  594 45  HOH HOH A . 
C 3 HOH 46  595 46  HOH HOH A . 
C 3 HOH 47  596 47  HOH HOH A . 
C 3 HOH 48  597 48  HOH HOH A . 
C 3 HOH 49  598 49  HOH HOH A . 
C 3 HOH 50  599 50  HOH HOH A . 
C 3 HOH 51  600 51  HOH HOH A . 
C 3 HOH 52  601 52  HOH HOH A . 
C 3 HOH 53  602 53  HOH HOH A . 
C 3 HOH 54  603 54  HOH HOH A . 
C 3 HOH 55  604 55  HOH HOH A . 
C 3 HOH 56  605 56  HOH HOH A . 
C 3 HOH 57  606 57  HOH HOH A . 
C 3 HOH 58  607 58  HOH HOH A . 
C 3 HOH 59  608 59  HOH HOH A . 
C 3 HOH 60  609 60  HOH HOH A . 
C 3 HOH 61  610 61  HOH HOH A . 
C 3 HOH 62  611 62  HOH HOH A . 
C 3 HOH 63  612 63  HOH HOH A . 
C 3 HOH 64  613 64  HOH HOH A . 
C 3 HOH 65  614 65  HOH HOH A . 
C 3 HOH 66  615 66  HOH HOH A . 
C 3 HOH 67  616 67  HOH HOH A . 
C 3 HOH 68  617 68  HOH HOH A . 
C 3 HOH 69  618 69  HOH HOH A . 
C 3 HOH 70  619 70  HOH HOH A . 
C 3 HOH 71  620 71  HOH HOH A . 
C 3 HOH 72  621 72  HOH HOH A . 
C 3 HOH 73  622 73  HOH HOH A . 
C 3 HOH 74  623 74  HOH HOH A . 
C 3 HOH 75  624 75  HOH HOH A . 
C 3 HOH 76  625 76  HOH HOH A . 
C 3 HOH 77  626 77  HOH HOH A . 
C 3 HOH 78  627 78  HOH HOH A . 
C 3 HOH 79  628 79  HOH HOH A . 
C 3 HOH 80  629 80  HOH HOH A . 
C 3 HOH 81  630 81  HOH HOH A . 
C 3 HOH 82  631 82  HOH HOH A . 
C 3 HOH 83  632 83  HOH HOH A . 
C 3 HOH 84  633 84  HOH HOH A . 
C 3 HOH 85  634 85  HOH HOH A . 
C 3 HOH 86  635 86  HOH HOH A . 
C 3 HOH 87  636 87  HOH HOH A . 
C 3 HOH 88  637 88  HOH HOH A . 
C 3 HOH 89  638 89  HOH HOH A . 
C 3 HOH 90  639 90  HOH HOH A . 
C 3 HOH 91  640 91  HOH HOH A . 
C 3 HOH 92  641 92  HOH HOH A . 
C 3 HOH 93  642 93  HOH HOH A . 
C 3 HOH 94  643 94  HOH HOH A . 
C 3 HOH 95  644 95  HOH HOH A . 
C 3 HOH 96  645 96  HOH HOH A . 
C 3 HOH 97  646 97  HOH HOH A . 
C 3 HOH 98  647 98  HOH HOH A . 
C 3 HOH 99  648 99  HOH HOH A . 
C 3 HOH 100 649 100 HOH HOH A . 
C 3 HOH 101 650 101 HOH HOH A . 
C 3 HOH 102 651 102 HOH HOH A . 
C 3 HOH 103 652 103 HOH HOH A . 
C 3 HOH 104 653 104 HOH HOH A . 
C 3 HOH 105 654 105 HOH HOH A . 
C 3 HOH 106 655 106 HOH HOH A . 
C 3 HOH 107 656 107 HOH HOH A . 
C 3 HOH 108 657 108 HOH HOH A . 
C 3 HOH 109 658 109 HOH HOH A . 
C 3 HOH 110 659 110 HOH HOH A . 
C 3 HOH 111 660 111 HOH HOH A . 
C 3 HOH 112 661 112 HOH HOH A . 
C 3 HOH 113 662 113 HOH HOH A . 
C 3 HOH 114 663 114 HOH HOH A . 
C 3 HOH 115 664 115 HOH HOH A . 
C 3 HOH 116 665 116 HOH HOH A . 
C 3 HOH 117 666 117 HOH HOH A . 
C 3 HOH 118 667 118 HOH HOH A . 
C 3 HOH 119 668 119 HOH HOH A . 
C 3 HOH 120 669 120 HOH HOH A . 
C 3 HOH 121 670 121 HOH HOH A . 
C 3 HOH 122 671 122 HOH HOH A . 
C 3 HOH 123 672 123 HOH HOH A . 
C 3 HOH 124 673 124 HOH HOH A . 
C 3 HOH 125 674 125 HOH HOH A . 
C 3 HOH 126 675 126 HOH HOH A . 
C 3 HOH 127 676 127 HOH HOH A . 
C 3 HOH 128 677 128 HOH HOH A . 
C 3 HOH 129 678 129 HOH HOH A . 
C 3 HOH 130 679 130 HOH HOH A . 
C 3 HOH 131 680 131 HOH HOH A . 
C 3 HOH 132 681 132 HOH HOH A . 
C 3 HOH 133 682 133 HOH HOH A . 
C 3 HOH 134 683 134 HOH HOH A . 
C 3 HOH 135 684 135 HOH HOH A . 
C 3 HOH 136 685 136 HOH HOH A . 
C 3 HOH 137 686 137 HOH HOH A . 
C 3 HOH 138 687 138 HOH HOH A . 
C 3 HOH 139 688 139 HOH HOH A . 
C 3 HOH 140 689 140 HOH HOH A . 
C 3 HOH 141 690 141 HOH HOH A . 
C 3 HOH 142 691 142 HOH HOH A . 
C 3 HOH 143 692 143 HOH HOH A . 
C 3 HOH 144 693 144 HOH HOH A . 
C 3 HOH 145 694 145 HOH HOH A . 
C 3 HOH 146 695 146 HOH HOH A . 
C 3 HOH 147 696 147 HOH HOH A . 
C 3 HOH 148 697 148 HOH HOH A . 
C 3 HOH 149 698 149 HOH HOH A . 
C 3 HOH 150 699 150 HOH HOH A . 
C 3 HOH 151 700 151 HOH HOH A . 
C 3 HOH 152 701 152 HOH HOH A . 
C 3 HOH 153 702 153 HOH HOH A . 
C 3 HOH 154 703 154 HOH HOH A . 
C 3 HOH 155 704 155 HOH HOH A . 
C 3 HOH 156 705 156 HOH HOH A . 
C 3 HOH 157 706 157 HOH HOH A . 
C 3 HOH 158 707 158 HOH HOH A . 
C 3 HOH 159 708 159 HOH HOH A . 
C 3 HOH 160 709 160 HOH HOH A . 
C 3 HOH 161 710 161 HOH HOH A . 
C 3 HOH 162 711 162 HOH HOH A . 
C 3 HOH 163 712 163 HOH HOH A . 
C 3 HOH 164 713 164 HOH HOH A . 
C 3 HOH 165 714 165 HOH HOH A . 
C 3 HOH 166 715 166 HOH HOH A . 
C 3 HOH 167 716 167 HOH HOH A . 
C 3 HOH 168 717 168 HOH HOH A . 
C 3 HOH 169 718 169 HOH HOH A . 
C 3 HOH 170 719 170 HOH HOH A . 
C 3 HOH 171 720 171 HOH HOH A . 
C 3 HOH 172 721 172 HOH HOH A . 
C 3 HOH 173 722 173 HOH HOH A . 
C 3 HOH 174 723 174 HOH HOH A . 
C 3 HOH 175 724 175 HOH HOH A . 
C 3 HOH 176 725 176 HOH HOH A . 
C 3 HOH 177 726 177 HOH HOH A . 
C 3 HOH 178 727 178 HOH HOH A . 
C 3 HOH 179 728 179 HOH HOH A . 
C 3 HOH 180 729 180 HOH HOH A . 
C 3 HOH 181 730 181 HOH HOH A . 
C 3 HOH 182 731 182 HOH HOH A . 
C 3 HOH 183 732 183 HOH HOH A . 
C 3 HOH 184 733 184 HOH HOH A . 
C 3 HOH 185 734 185 HOH HOH A . 
C 3 HOH 186 735 186 HOH HOH A . 
C 3 HOH 187 736 187 HOH HOH A . 
C 3 HOH 188 737 188 HOH HOH A . 
C 3 HOH 189 738 189 HOH HOH A . 
C 3 HOH 190 739 190 HOH HOH A . 
C 3 HOH 191 740 191 HOH HOH A . 
C 3 HOH 192 741 192 HOH HOH A . 
C 3 HOH 193 742 193 HOH HOH A . 
C 3 HOH 194 743 194 HOH HOH A . 
C 3 HOH 195 744 195 HOH HOH A . 
C 3 HOH 196 745 196 HOH HOH A . 
C 3 HOH 197 746 197 HOH HOH A . 
C 3 HOH 198 747 198 HOH HOH A . 
C 3 HOH 199 748 199 HOH HOH A . 
C 3 HOH 200 749 200 HOH HOH A . 
C 3 HOH 201 750 201 HOH HOH A . 
C 3 HOH 202 751 202 HOH HOH A . 
C 3 HOH 203 752 203 HOH HOH A . 
C 3 HOH 204 753 204 HOH HOH A . 
C 3 HOH 205 754 205 HOH HOH A . 
C 3 HOH 206 755 206 HOH HOH A . 
C 3 HOH 207 756 207 HOH HOH A . 
C 3 HOH 208 757 208 HOH HOH A . 
C 3 HOH 209 758 209 HOH HOH A . 
C 3 HOH 210 759 210 HOH HOH A . 
C 3 HOH 211 760 211 HOH HOH A . 
C 3 HOH 212 761 212 HOH HOH A . 
C 3 HOH 213 762 213 HOH HOH A . 
C 3 HOH 214 763 214 HOH HOH A . 
C 3 HOH 215 764 215 HOH HOH A . 
C 3 HOH 216 765 216 HOH HOH A . 
C 3 HOH 217 766 217 HOH HOH A . 
C 3 HOH 218 767 218 HOH HOH A . 
C 3 HOH 219 768 219 HOH HOH A . 
C 3 HOH 220 769 220 HOH HOH A . 
C 3 HOH 221 770 221 HOH HOH A . 
C 3 HOH 222 771 222 HOH HOH A . 
C 3 HOH 223 772 223 HOH HOH A . 
C 3 HOH 224 773 224 HOH HOH A . 
C 3 HOH 225 774 225 HOH HOH A . 
C 3 HOH 226 775 226 HOH HOH A . 
C 3 HOH 227 776 227 HOH HOH A . 
C 3 HOH 228 777 228 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?        monomeric 1 
2 software_defined_assembly PISA,PQS dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C 
2 1,2 A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 3520  ? 
2 MORE         -33   ? 
2 'SSA (A^2)'  25860 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 68.4200000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-03-14 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -15.4604 -37.6789 16.8621 -0.0060 -0.0299 -0.0081 0.0324  0.0278  -0.0023 0.7783 0.8019 1.0140 -0.6390 -0.2775 -0.1825 
0.1023 -0.0099 -0.0108 -0.0419 -0.0792 0.0409  -0.0456 -0.0210 -0.0231 'X-RAY DIFFRACTION' 
2 ? refined -3.4243  -34.0167 18.6334 -0.0179 -0.0373 0.0227  -0.0170 0.0462  -0.0113 1.2690 1.1413 0.9562 -1.0446 -0.0915 -0.3386 
0.0779 -0.0554 0.1756  0.0032  -0.0215 -0.2428 -0.0467 0.1662  -0.0564 'X-RAY DIFFRACTION' 
3 ? refined -20.1673 -25.3742 11.7495 0.0363  -0.0105 -0.0296 0.0885  0.0294  0.0166  2.1602 0.4092 0.6112 -0.7999 -0.7901 0.1018  
0.0899 0.0483  0.1333  -0.1471 -0.1339 -0.0922 -0.0843 -0.1331 0.0440  'X-RAY DIFFRACTION' 
4 ? refined -41.3358 -20.1325 27.2067 -0.0341 0.0114  -0.0101 0.0576  -0.0171 -0.0139 0.7841 0.4574 1.5765 -0.3297 -0.9464 0.7700  
0.0639 0.0705  -0.0417 0.0421  -0.0820 -0.0099 -0.0448 -0.0609 0.0181  'X-RAY DIFFRACTION' 
5 ? refined -31.6662 -26.1447 9.0973  -0.0246 0.0543  -0.0380 0.0806  -0.0135 -0.0306 0.3659 0.8480 0.9155 -0.5427 -0.1342 0.0059  
0.0093 0.0732  -0.0295 -0.1470 -0.0307 -0.0046 0.0555  -0.1721 0.0214  'X-RAY DIFFRACTION' 
6 ? refined -36.4063 -17.4061 18.1966 0.0002  0.0451  -0.0730 0.1140  0.0114  -0.0264 1.3781 0.9136 0.8937 -0.4136 -0.4292 -0.2161 
0.0211 0.0549  0.0717  0.1027  0.0703  -0.0602 -0.1484 -0.1742 -0.0915 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 238 A 30  A 290 A 82  ? 'X-RAY DIFFRACTION' ? 
2 2 A 291 A 83  A 340 A 132 ? 'X-RAY DIFFRACTION' ? 
3 3 A 341 A 133 A 390 A 182 ? 'X-RAY DIFFRACTION' ? 
4 4 A 391 A 183 A 440 A 232 ? 'X-RAY DIFFRACTION' ? 
5 5 A 441 A 233 A 490 A 282 ? 'X-RAY DIFFRACTION' ? 
6 6 A 491 A 283 A 548 A 340 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0019 ? 1 
DENZO     'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
MOLREP    phasing          .        ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    601 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    728 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              307 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              307 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              307 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                99.96 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            -15.34 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 352 ? ? 67.87   -54.34  
2 1 GLU A 355 ? ? 86.00   -20.19  
3 1 SER A 463 ? ? 177.61  -159.84 
4 1 GLU A 477 ? ? -127.16 -50.88  
5 1 THR A 493 ? ? -37.43  128.86  
6 1 LYS A 498 ? ? 51.56   -132.95 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A PHE 238 ? CB  ? A PHE 30 CB  
2 1 Y 1 A PHE 238 ? CG  ? A PHE 30 CG  
3 1 Y 1 A PHE 238 ? CD1 ? A PHE 30 CD1 
4 1 Y 1 A PHE 238 ? CD2 ? A PHE 30 CD2 
5 1 Y 1 A PHE 238 ? CE1 ? A PHE 30 CE1 
6 1 Y 1 A PHE 238 ? CE2 ? A PHE 30 CE2 
7 1 Y 1 A PHE 238 ? CZ  ? A PHE 30 CZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 209 ? A MET 1  
2  1 Y 1 A GLY 210 ? A GLY 2  
3  1 Y 1 A SER 211 ? A SER 3  
4  1 Y 1 A SER 212 ? A SER 4  
5  1 Y 1 A HIS 213 ? A HIS 5  
6  1 Y 1 A HIS 214 ? A HIS 6  
7  1 Y 1 A HIS 215 ? A HIS 7  
8  1 Y 1 A HIS 216 ? A HIS 8  
9  1 Y 1 A HIS 217 ? A HIS 9  
10 1 Y 1 A HIS 218 ? A HIS 10 
11 1 Y 1 A SER 219 ? A SER 11 
12 1 Y 1 A SER 220 ? A SER 12 
13 1 Y 1 A GLY 221 ? A GLY 13 
14 1 Y 1 A LEU 222 ? A LEU 14 
15 1 Y 1 A VAL 223 ? A VAL 15 
16 1 Y 1 A PRO 224 ? A PRO 16 
17 1 Y 1 A ARG 225 ? A ARG 17 
18 1 Y 1 A GLY 226 ? A GLY 18 
19 1 Y 1 A SER 227 ? A SER 19 
20 1 Y 1 A ASP 228 ? A ASP 20 
21 1 Y 1 A LEU 229 ? A LEU 21 
22 1 Y 1 A GLN 230 ? A GLN 22 
23 1 Y 1 A GLU 231 ? A GLU 23 
24 1 Y 1 A ASP 232 ? A ASP 24 
25 1 Y 1 A GLU 233 ? A GLU 25 
26 1 Y 1 A ASP 234 ? A ASP 26 
27 1 Y 1 A GLY 235 ? A GLY 27 
28 1 Y 1 A VAL 236 ? A VAL 28 
29 1 Y 1 A TYR 237 ? A TYR 29 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 S-ADENOSYL-L-HOMOCYSTEINE SAH 
3 water                     HOH 
#