data_2FYU
# 
_entry.id   2FYU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FYU         
RCSB  RCSB036474   
WWPDB D_1000036474 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QCR 'Original native bovine heart mitochondrial bc1'     unspecified 
PDB 1L0N 'Bovine heart mitochondrial bc1'                     unspecified 
PDB 1L0L 'Bovine heart mitochondrial bc1 with Famoxadone'     unspecified 
PDB 1SQX 'Bovine heart mitochondrial bc1 with Stigmatellin A' unspecified 
PDB 1SQV 'Bovine heart mitochondrial bc1 with UHDBT'          unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FYU 
_pdbx_database_status.recvd_initial_deposition_date   2006-02-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, D.'   1 
'Esser, L.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            103 
_citation.page_first                13045 
_citation.page_last                 13050 
_citation.year                      2006 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16924113 
_citation.pdbx_database_id_DOI      10.1073/pnas.0601149103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Esser, L.' 1 
primary 'Gong, X.'  2 
primary 'Yang, S.'  3 
primary 'Yu, L.'    4 
primary 'Yu, C.A.'  5 
primary 'Xia, D.'   6 
# 
_cell.entry_id           2FYU 
_cell.length_a           154.263 
_cell.length_b           154.263 
_cell.length_c           590.191 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2FYU 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial'   49266.254 1   1.10.2.2 ? Core1 ? 
2  polymer     nat 'Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial'   46575.469 1   1.10.2.2 ? Core2 ? 
3  polymer     nat 'Cytochrome b'                                                             42620.340 1   ?        ? 
'cytochrome b'                        ? 
4  polymer     nat 'Cytochrome c1, heme protein, mitochondrial'                               27323.277 1   ?        ? 
'cytochrome c1'                       ? 
5  polymer     nat 'Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial'      21640.580 1   1.10.2.2 ? 
'Iron-sulfur protein'                 ? 
6  polymer     nat 'Hypothetical protein LOC616871'                                           13371.190 1   ?        ? 'subunit 6' 
? 
7  polymer     nat 'Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C' 9606.027  1   1.10.2.2 ? 'subunit 7' 
? 
8  polymer     nat 'Ubiquinol-cytochrome c reductase complex 11 kDa protein'                  9189.116  1   1.10.2.2 ? 'subunit 8' 
? 
9  polymer     nat 'Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial'      7964.259  1   ?        ? 
'Iron-sulfur protein signal sequence' ? 
10 polymer     nat 'Ubiquinol-cytochrome c reductase complex 7.2 kDa protein'                 7209.311  1   1.10.2.2 ? 
'subunit 10'                          ? 
11 polymer     nat 'Ubiquinol-cytochrome c reductase complex 6.4 kDa protein'                 6527.604  1   1.10.2.2 ? 
'subunit 11'                          ? 
12 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                                          616.487   3   ?        ? ? ? 
13 non-polymer syn '(5S)-3-ANILINO-5-(2,4-DIFLUOROPHENYL)-5-METHYL-1,3-OXAZOLIDINE-2,4-DIONE' 318.275   1   ?        ? ? ? 
14 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                                               175.820   1   ?        ? ? ? 
15 water       nat water                                                                      18.015    267 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2  'Complex III subunit II'                                                                       
4  'Cytochrome c-1'                                                                               
5  RISP                                                                                           
7  'Ubiquinol-cytochrome c reductase complex 9.5 kDa protein, Complex III subunit VII'            
8  'Mitochondrial hinge protein, Cytochrome C1, nonheme 11 kDa protein, Complex III subunit VIII' 
10 'Cytochrome C1, nonheme 7 kDa protein, Complex III subunit X'                                  
11 'Complex III subunit XI'                                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVE
SMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQG
TPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQ
ICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLL
GAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIA
EVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
;
;TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVE
SMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQG
TPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQ
ICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLL
GAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIA
EVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
;
A ? 
2  'polypeptide(L)' no no 
;SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGA
SSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVI
ENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYH
GGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSG
LFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQ
QIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL
;
;SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGA
SSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVI
ENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYH
GGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSG
LFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQ
QIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL
;
B ? 
3  'polypeptide(L)' no no 
;MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIR
YMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL
VEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM
LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPL
SQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW
;
;MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIR
YMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL
VEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM
LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPL
SQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW
;
C ? 
4  'polypeptide(L)' no no 
;SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEM
FMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGM
APPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
K
;
;SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEM
FMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGM
APPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
K
;
D ? 
5  'polypeptide(L)' no no 
;SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSD
IPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC
HGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
;
;SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSD
IPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC
HGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
;
E ? 
6  'polypeptide(L)' no no 
;AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQW
TKYEEDKSYLEPYLKEVIRERKEREEWAKK
;
;AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQW
TKYEEDKSYLEPYLKEVIRERKEREEWAKK
;
F ? 
7  'polypeptide(L)' no no 
;GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEND
R
;
;GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEND
R
;
G ? 
8  'polypeptide(L)' no no GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK 
GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK H ? 
9  'polypeptide(L)' no no MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY 
MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY I ? 
10 'polypeptide(L)' no no VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK 
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK J ? 
11 'polypeptide(L)' no no MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD 
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD K ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   THR n 
1  2   ALA n 
1  3   THR n 
1  4   TYR n 
1  5   ALA n 
1  6   GLN n 
1  7   ALA n 
1  8   LEU n 
1  9   GLN n 
1  10  SER n 
1  11  VAL n 
1  12  PRO n 
1  13  GLU n 
1  14  THR n 
1  15  GLN n 
1  16  VAL n 
1  17  SER n 
1  18  GLN n 
1  19  LEU n 
1  20  ASP n 
1  21  ASN n 
1  22  GLY n 
1  23  LEU n 
1  24  ARG n 
1  25  VAL n 
1  26  ALA n 
1  27  SER n 
1  28  GLU n 
1  29  GLN n 
1  30  SER n 
1  31  SER n 
1  32  GLN n 
1  33  PRO n 
1  34  THR n 
1  35  CYS n 
1  36  THR n 
1  37  VAL n 
1  38  GLY n 
1  39  VAL n 
1  40  TRP n 
1  41  ILE n 
1  42  ASP n 
1  43  ALA n 
1  44  GLY n 
1  45  SER n 
1  46  ARG n 
1  47  TYR n 
1  48  GLU n 
1  49  SER n 
1  50  GLU n 
1  51  LYS n 
1  52  ASN n 
1  53  ASN n 
1  54  GLY n 
1  55  ALA n 
1  56  GLY n 
1  57  TYR n 
1  58  PHE n 
1  59  VAL n 
1  60  GLU n 
1  61  HIS n 
1  62  LEU n 
1  63  ALA n 
1  64  PHE n 
1  65  LYS n 
1  66  GLY n 
1  67  THR n 
1  68  LYS n 
1  69  ASN n 
1  70  ARG n 
1  71  PRO n 
1  72  GLY n 
1  73  ASN n 
1  74  ALA n 
1  75  LEU n 
1  76  GLU n 
1  77  LYS n 
1  78  GLU n 
1  79  VAL n 
1  80  GLU n 
1  81  SER n 
1  82  MET n 
1  83  GLY n 
1  84  ALA n 
1  85  HIS n 
1  86  LEU n 
1  87  ASN n 
1  88  ALA n 
1  89  TYR n 
1  90  SER n 
1  91  THR n 
1  92  ARG n 
1  93  GLU n 
1  94  HIS n 
1  95  THR n 
1  96  ALA n 
1  97  TYR n 
1  98  TYR n 
1  99  ILE n 
1  100 LYS n 
1  101 ALA n 
1  102 LEU n 
1  103 SER n 
1  104 LYS n 
1  105 ASP n 
1  106 LEU n 
1  107 PRO n 
1  108 LYS n 
1  109 ALA n 
1  110 VAL n 
1  111 GLU n 
1  112 LEU n 
1  113 LEU n 
1  114 ALA n 
1  115 ASP n 
1  116 ILE n 
1  117 VAL n 
1  118 GLN n 
1  119 ASN n 
1  120 CYS n 
1  121 SER n 
1  122 LEU n 
1  123 GLU n 
1  124 ASP n 
1  125 SER n 
1  126 GLN n 
1  127 ILE n 
1  128 GLU n 
1  129 LYS n 
1  130 GLU n 
1  131 ARG n 
1  132 ASP n 
1  133 VAL n 
1  134 ILE n 
1  135 LEU n 
1  136 GLN n 
1  137 GLU n 
1  138 LEU n 
1  139 GLN n 
1  140 GLU n 
1  141 ASN n 
1  142 ASP n 
1  143 THR n 
1  144 SER n 
1  145 MET n 
1  146 ARG n 
1  147 ASP n 
1  148 VAL n 
1  149 VAL n 
1  150 PHE n 
1  151 ASN n 
1  152 TYR n 
1  153 LEU n 
1  154 HIS n 
1  155 ALA n 
1  156 THR n 
1  157 ALA n 
1  158 PHE n 
1  159 GLN n 
1  160 GLY n 
1  161 THR n 
1  162 PRO n 
1  163 LEU n 
1  164 ALA n 
1  165 GLN n 
1  166 SER n 
1  167 VAL n 
1  168 GLU n 
1  169 GLY n 
1  170 PRO n 
1  171 SER n 
1  172 GLU n 
1  173 ASN n 
1  174 VAL n 
1  175 ARG n 
1  176 LYS n 
1  177 LEU n 
1  178 SER n 
1  179 ARG n 
1  180 ALA n 
1  181 ASP n 
1  182 LEU n 
1  183 THR n 
1  184 GLU n 
1  185 TYR n 
1  186 LEU n 
1  187 SER n 
1  188 ARG n 
1  189 HIS n 
1  190 TYR n 
1  191 LYS n 
1  192 ALA n 
1  193 PRO n 
1  194 ARG n 
1  195 MET n 
1  196 VAL n 
1  197 LEU n 
1  198 ALA n 
1  199 ALA n 
1  200 ALA n 
1  201 GLY n 
1  202 GLY n 
1  203 LEU n 
1  204 GLU n 
1  205 HIS n 
1  206 ARG n 
1  207 GLN n 
1  208 LEU n 
1  209 LEU n 
1  210 ASP n 
1  211 LEU n 
1  212 ALA n 
1  213 GLN n 
1  214 LYS n 
1  215 HIS n 
1  216 PHE n 
1  217 SER n 
1  218 GLY n 
1  219 LEU n 
1  220 SER n 
1  221 GLY n 
1  222 THR n 
1  223 TYR n 
1  224 ASP n 
1  225 GLU n 
1  226 ASP n 
1  227 ALA n 
1  228 VAL n 
1  229 PRO n 
1  230 THR n 
1  231 LEU n 
1  232 SER n 
1  233 PRO n 
1  234 CYS n 
1  235 ARG n 
1  236 PHE n 
1  237 THR n 
1  238 GLY n 
1  239 SER n 
1  240 GLN n 
1  241 ILE n 
1  242 CYS n 
1  243 HIS n 
1  244 ARG n 
1  245 GLU n 
1  246 ASP n 
1  247 GLY n 
1  248 LEU n 
1  249 PRO n 
1  250 LEU n 
1  251 ALA n 
1  252 HIS n 
1  253 VAL n 
1  254 ALA n 
1  255 ILE n 
1  256 ALA n 
1  257 VAL n 
1  258 GLU n 
1  259 GLY n 
1  260 PRO n 
1  261 GLY n 
1  262 TRP n 
1  263 ALA n 
1  264 HIS n 
1  265 PRO n 
1  266 ASP n 
1  267 ASN n 
1  268 VAL n 
1  269 ALA n 
1  270 LEU n 
1  271 GLN n 
1  272 VAL n 
1  273 ALA n 
1  274 ASN n 
1  275 ALA n 
1  276 ILE n 
1  277 ILE n 
1  278 GLY n 
1  279 HIS n 
1  280 TYR n 
1  281 ASP n 
1  282 CYS n 
1  283 THR n 
1  284 TYR n 
1  285 GLY n 
1  286 GLY n 
1  287 GLY n 
1  288 ALA n 
1  289 HIS n 
1  290 LEU n 
1  291 SER n 
1  292 SER n 
1  293 PRO n 
1  294 LEU n 
1  295 ALA n 
1  296 SER n 
1  297 ILE n 
1  298 ALA n 
1  299 ALA n 
1  300 THR n 
1  301 ASN n 
1  302 LYS n 
1  303 LEU n 
1  304 CYS n 
1  305 GLN n 
1  306 SER n 
1  307 PHE n 
1  308 GLN n 
1  309 THR n 
1  310 PHE n 
1  311 ASN n 
1  312 ILE n 
1  313 CYS n 
1  314 TYR n 
1  315 ALA n 
1  316 ASP n 
1  317 THR n 
1  318 GLY n 
1  319 LEU n 
1  320 LEU n 
1  321 GLY n 
1  322 ALA n 
1  323 HIS n 
1  324 PHE n 
1  325 VAL n 
1  326 CYS n 
1  327 ASP n 
1  328 HIS n 
1  329 MET n 
1  330 SER n 
1  331 ILE n 
1  332 ASP n 
1  333 ASP n 
1  334 MET n 
1  335 MET n 
1  336 PHE n 
1  337 VAL n 
1  338 LEU n 
1  339 GLN n 
1  340 GLY n 
1  341 GLN n 
1  342 TRP n 
1  343 MET n 
1  344 ARG n 
1  345 LEU n 
1  346 CYS n 
1  347 THR n 
1  348 SER n 
1  349 ALA n 
1  350 THR n 
1  351 GLU n 
1  352 SER n 
1  353 GLU n 
1  354 VAL n 
1  355 LEU n 
1  356 ARG n 
1  357 GLY n 
1  358 LYS n 
1  359 ASN n 
1  360 LEU n 
1  361 LEU n 
1  362 ARG n 
1  363 ASN n 
1  364 ALA n 
1  365 LEU n 
1  366 VAL n 
1  367 SER n 
1  368 HIS n 
1  369 LEU n 
1  370 ASP n 
1  371 GLY n 
1  372 THR n 
1  373 THR n 
1  374 PRO n 
1  375 VAL n 
1  376 CYS n 
1  377 GLU n 
1  378 ASP n 
1  379 ILE n 
1  380 GLY n 
1  381 ARG n 
1  382 SER n 
1  383 LEU n 
1  384 LEU n 
1  385 THR n 
1  386 TYR n 
1  387 GLY n 
1  388 ARG n 
1  389 ARG n 
1  390 ILE n 
1  391 PRO n 
1  392 LEU n 
1  393 ALA n 
1  394 GLU n 
1  395 TRP n 
1  396 GLU n 
1  397 SER n 
1  398 ARG n 
1  399 ILE n 
1  400 ALA n 
1  401 GLU n 
1  402 VAL n 
1  403 ASP n 
1  404 ALA n 
1  405 ARG n 
1  406 VAL n 
1  407 VAL n 
1  408 ARG n 
1  409 GLU n 
1  410 VAL n 
1  411 CYS n 
1  412 SER n 
1  413 LYS n 
1  414 TYR n 
1  415 PHE n 
1  416 TYR n 
1  417 ASP n 
1  418 GLN n 
1  419 CYS n 
1  420 PRO n 
1  421 ALA n 
1  422 VAL n 
1  423 ALA n 
1  424 GLY n 
1  425 PHE n 
1  426 GLY n 
1  427 PRO n 
1  428 ILE n 
1  429 GLU n 
1  430 GLN n 
1  431 LEU n 
1  432 PRO n 
1  433 ASP n 
1  434 TYR n 
1  435 ASN n 
1  436 ARG n 
1  437 ILE n 
1  438 ARG n 
1  439 SER n 
1  440 GLY n 
1  441 MET n 
1  442 PHE n 
1  443 TRP n 
1  444 LEU n 
1  445 ARG n 
1  446 PHE n 
2  1   SER n 
2  2   LEU n 
2  3   LYS n 
2  4   VAL n 
2  5   ALA n 
2  6   PRO n 
2  7   LYS n 
2  8   VAL n 
2  9   LYS n 
2  10  ALA n 
2  11  THR n 
2  12  GLU n 
2  13  ALA n 
2  14  PRO n 
2  15  ALA n 
2  16  GLY n 
2  17  VAL n 
2  18  PRO n 
2  19  PRO n 
2  20  HIS n 
2  21  PRO n 
2  22  GLN n 
2  23  ASP n 
2  24  LEU n 
2  25  GLU n 
2  26  PHE n 
2  27  THR n 
2  28  ARG n 
2  29  LEU n 
2  30  PRO n 
2  31  ASN n 
2  32  GLY n 
2  33  LEU n 
2  34  VAL n 
2  35  ILE n 
2  36  ALA n 
2  37  SER n 
2  38  LEU n 
2  39  GLU n 
2  40  ASN n 
2  41  TYR n 
2  42  ALA n 
2  43  PRO n 
2  44  ALA n 
2  45  SER n 
2  46  ARG n 
2  47  ILE n 
2  48  GLY n 
2  49  LEU n 
2  50  PHE n 
2  51  ILE n 
2  52  LYS n 
2  53  ALA n 
2  54  GLY n 
2  55  SER n 
2  56  ARG n 
2  57  TYR n 
2  58  GLU n 
2  59  ASN n 
2  60  SER n 
2  61  ASN n 
2  62  ASN n 
2  63  LEU n 
2  64  GLY n 
2  65  THR n 
2  66  SER n 
2  67  HIS n 
2  68  LEU n 
2  69  LEU n 
2  70  ARG n 
2  71  LEU n 
2  72  ALA n 
2  73  SER n 
2  74  SER n 
2  75  LEU n 
2  76  THR n 
2  77  THR n 
2  78  LYS n 
2  79  GLY n 
2  80  ALA n 
2  81  SER n 
2  82  SER n 
2  83  PHE n 
2  84  LYS n 
2  85  ILE n 
2  86  THR n 
2  87  ARG n 
2  88  GLY n 
2  89  ILE n 
2  90  GLU n 
2  91  ALA n 
2  92  VAL n 
2  93  GLY n 
2  94  GLY n 
2  95  LYS n 
2  96  LEU n 
2  97  SER n 
2  98  VAL n 
2  99  THR n 
2  100 SER n 
2  101 THR n 
2  102 ARG n 
2  103 GLU n 
2  104 ASN n 
2  105 MET n 
2  106 ALA n 
2  107 TYR n 
2  108 THR n 
2  109 VAL n 
2  110 GLU n 
2  111 CYS n 
2  112 LEU n 
2  113 ARG n 
2  114 ASP n 
2  115 ASP n 
2  116 VAL n 
2  117 ASP n 
2  118 ILE n 
2  119 LEU n 
2  120 MET n 
2  121 GLU n 
2  122 PHE n 
2  123 LEU n 
2  124 LEU n 
2  125 ASN n 
2  126 VAL n 
2  127 THR n 
2  128 THR n 
2  129 ALA n 
2  130 PRO n 
2  131 GLU n 
2  132 PHE n 
2  133 ARG n 
2  134 ARG n 
2  135 TRP n 
2  136 GLU n 
2  137 VAL n 
2  138 ALA n 
2  139 ALA n 
2  140 LEU n 
2  141 GLN n 
2  142 PRO n 
2  143 GLN n 
2  144 LEU n 
2  145 ARG n 
2  146 ILE n 
2  147 ASP n 
2  148 LYS n 
2  149 ALA n 
2  150 VAL n 
2  151 ALA n 
2  152 LEU n 
2  153 GLN n 
2  154 ASN n 
2  155 PRO n 
2  156 GLN n 
2  157 ALA n 
2  158 HIS n 
2  159 VAL n 
2  160 ILE n 
2  161 GLU n 
2  162 ASN n 
2  163 LEU n 
2  164 HIS n 
2  165 ALA n 
2  166 ALA n 
2  167 ALA n 
2  168 TYR n 
2  169 ARG n 
2  170 ASN n 
2  171 ALA n 
2  172 LEU n 
2  173 ALA n 
2  174 ASN n 
2  175 SER n 
2  176 LEU n 
2  177 TYR n 
2  178 CYS n 
2  179 PRO n 
2  180 ASP n 
2  181 TYR n 
2  182 ARG n 
2  183 ILE n 
2  184 GLY n 
2  185 LYS n 
2  186 VAL n 
2  187 THR n 
2  188 PRO n 
2  189 VAL n 
2  190 GLU n 
2  191 LEU n 
2  192 HIS n 
2  193 ASP n 
2  194 TYR n 
2  195 VAL n 
2  196 GLN n 
2  197 ASN n 
2  198 HIS n 
2  199 PHE n 
2  200 THR n 
2  201 SER n 
2  202 ALA n 
2  203 ARG n 
2  204 MET n 
2  205 ALA n 
2  206 LEU n 
2  207 ILE n 
2  208 GLY n 
2  209 LEU n 
2  210 GLY n 
2  211 VAL n 
2  212 SER n 
2  213 HIS n 
2  214 PRO n 
2  215 VAL n 
2  216 LEU n 
2  217 LYS n 
2  218 GLN n 
2  219 VAL n 
2  220 ALA n 
2  221 GLU n 
2  222 GLN n 
2  223 PHE n 
2  224 LEU n 
2  225 ASN n 
2  226 ILE n 
2  227 ARG n 
2  228 GLY n 
2  229 GLY n 
2  230 LEU n 
2  231 GLY n 
2  232 LEU n 
2  233 SER n 
2  234 GLY n 
2  235 ALA n 
2  236 LYS n 
2  237 ALA n 
2  238 LYS n 
2  239 TYR n 
2  240 HIS n 
2  241 GLY n 
2  242 GLY n 
2  243 GLU n 
2  244 ILE n 
2  245 ARG n 
2  246 GLU n 
2  247 GLN n 
2  248 ASN n 
2  249 GLY n 
2  250 ASP n 
2  251 SER n 
2  252 LEU n 
2  253 VAL n 
2  254 HIS n 
2  255 ALA n 
2  256 ALA n 
2  257 LEU n 
2  258 VAL n 
2  259 ALA n 
2  260 GLU n 
2  261 SER n 
2  262 ALA n 
2  263 ALA n 
2  264 ILE n 
2  265 GLY n 
2  266 SER n 
2  267 ALA n 
2  268 GLU n 
2  269 ALA n 
2  270 ASN n 
2  271 ALA n 
2  272 PHE n 
2  273 SER n 
2  274 VAL n 
2  275 LEU n 
2  276 GLN n 
2  277 HIS n 
2  278 VAL n 
2  279 LEU n 
2  280 GLY n 
2  281 ALA n 
2  282 GLY n 
2  283 PRO n 
2  284 HIS n 
2  285 VAL n 
2  286 LYS n 
2  287 ARG n 
2  288 GLY n 
2  289 SER n 
2  290 ASN n 
2  291 ALA n 
2  292 THR n 
2  293 SER n 
2  294 SER n 
2  295 LEU n 
2  296 TYR n 
2  297 GLN n 
2  298 ALA n 
2  299 VAL n 
2  300 ALA n 
2  301 LYS n 
2  302 GLY n 
2  303 VAL n 
2  304 HIS n 
2  305 GLN n 
2  306 PRO n 
2  307 PHE n 
2  308 ASP n 
2  309 VAL n 
2  310 SER n 
2  311 ALA n 
2  312 PHE n 
2  313 ASN n 
2  314 ALA n 
2  315 SER n 
2  316 TYR n 
2  317 SER n 
2  318 ASP n 
2  319 SER n 
2  320 GLY n 
2  321 LEU n 
2  322 PHE n 
2  323 GLY n 
2  324 PHE n 
2  325 TYR n 
2  326 THR n 
2  327 ILE n 
2  328 SER n 
2  329 GLN n 
2  330 ALA n 
2  331 ALA n 
2  332 SER n 
2  333 ALA n 
2  334 GLY n 
2  335 ASP n 
2  336 VAL n 
2  337 ILE n 
2  338 LYS n 
2  339 ALA n 
2  340 ALA n 
2  341 TYR n 
2  342 ASN n 
2  343 GLN n 
2  344 VAL n 
2  345 LYS n 
2  346 THR n 
2  347 ILE n 
2  348 ALA n 
2  349 GLN n 
2  350 GLY n 
2  351 ASN n 
2  352 LEU n 
2  353 SER n 
2  354 ASN n 
2  355 PRO n 
2  356 ASP n 
2  357 VAL n 
2  358 GLN n 
2  359 ALA n 
2  360 ALA n 
2  361 LYS n 
2  362 ASN n 
2  363 LYS n 
2  364 LEU n 
2  365 LYS n 
2  366 ALA n 
2  367 GLY n 
2  368 TYR n 
2  369 LEU n 
2  370 MET n 
2  371 SER n 
2  372 VAL n 
2  373 GLU n 
2  374 SER n 
2  375 SER n 
2  376 GLU n 
2  377 GLY n 
2  378 PHE n 
2  379 LEU n 
2  380 ASP n 
2  381 GLU n 
2  382 VAL n 
2  383 GLY n 
2  384 SER n 
2  385 GLN n 
2  386 ALA n 
2  387 LEU n 
2  388 ALA n 
2  389 ALA n 
2  390 GLY n 
2  391 SER n 
2  392 TYR n 
2  393 THR n 
2  394 PRO n 
2  395 PRO n 
2  396 SER n 
2  397 THR n 
2  398 VAL n 
2  399 LEU n 
2  400 GLN n 
2  401 GLN n 
2  402 ILE n 
2  403 ASP n 
2  404 ALA n 
2  405 VAL n 
2  406 ALA n 
2  407 ASP n 
2  408 ALA n 
2  409 ASP n 
2  410 VAL n 
2  411 ILE n 
2  412 ASN n 
2  413 ALA n 
2  414 ALA n 
2  415 LYS n 
2  416 LYS n 
2  417 PHE n 
2  418 VAL n 
2  419 SER n 
2  420 GLY n 
2  421 ARG n 
2  422 LYS n 
2  423 SER n 
2  424 MET n 
2  425 ALA n 
2  426 ALA n 
2  427 SER n 
2  428 GLY n 
2  429 ASN n 
2  430 LEU n 
2  431 GLY n 
2  432 HIS n 
2  433 THR n 
2  434 PRO n 
2  435 PHE n 
2  436 ILE n 
2  437 ASP n 
2  438 GLU n 
2  439 LEU n 
3  1   MET n 
3  2   THR n 
3  3   ASN n 
3  4   ILE n 
3  5   ARG n 
3  6   LYS n 
3  7   SER n 
3  8   HIS n 
3  9   PRO n 
3  10  LEU n 
3  11  MET n 
3  12  LYS n 
3  13  ILE n 
3  14  VAL n 
3  15  ASN n 
3  16  ASN n 
3  17  ALA n 
3  18  PHE n 
3  19  ILE n 
3  20  ASP n 
3  21  LEU n 
3  22  PRO n 
3  23  ALA n 
3  24  PRO n 
3  25  SER n 
3  26  ASN n 
3  27  ILE n 
3  28  SER n 
3  29  SER n 
3  30  TRP n 
3  31  TRP n 
3  32  ASN n 
3  33  PHE n 
3  34  GLY n 
3  35  SER n 
3  36  LEU n 
3  37  LEU n 
3  38  GLY n 
3  39  ILE n 
3  40  CYS n 
3  41  LEU n 
3  42  ILE n 
3  43  LEU n 
3  44  GLN n 
3  45  ILE n 
3  46  LEU n 
3  47  THR n 
3  48  GLY n 
3  49  LEU n 
3  50  PHE n 
3  51  LEU n 
3  52  ALA n 
3  53  MET n 
3  54  HIS n 
3  55  TYR n 
3  56  THR n 
3  57  SER n 
3  58  ASP n 
3  59  THR n 
3  60  THR n 
3  61  THR n 
3  62  ALA n 
3  63  PHE n 
3  64  SER n 
3  65  SER n 
3  66  VAL n 
3  67  THR n 
3  68  HIS n 
3  69  ILE n 
3  70  CYS n 
3  71  ARG n 
3  72  ASP n 
3  73  VAL n 
3  74  ASN n 
3  75  TYR n 
3  76  GLY n 
3  77  TRP n 
3  78  ILE n 
3  79  ILE n 
3  80  ARG n 
3  81  TYR n 
3  82  MET n 
3  83  HIS n 
3  84  ALA n 
3  85  ASN n 
3  86  GLY n 
3  87  ALA n 
3  88  SER n 
3  89  MET n 
3  90  PHE n 
3  91  PHE n 
3  92  ILE n 
3  93  CYS n 
3  94  LEU n 
3  95  TYR n 
3  96  MET n 
3  97  HIS n 
3  98  VAL n 
3  99  GLY n 
3  100 ARG n 
3  101 GLY n 
3  102 LEU n 
3  103 TYR n 
3  104 TYR n 
3  105 GLY n 
3  106 SER n 
3  107 TYR n 
3  108 THR n 
3  109 PHE n 
3  110 LEU n 
3  111 GLU n 
3  112 THR n 
3  113 TRP n 
3  114 ASN n 
3  115 ILE n 
3  116 GLY n 
3  117 VAL n 
3  118 ILE n 
3  119 LEU n 
3  120 LEU n 
3  121 LEU n 
3  122 THR n 
3  123 VAL n 
3  124 MET n 
3  125 ALA n 
3  126 THR n 
3  127 ALA n 
3  128 PHE n 
3  129 MET n 
3  130 GLY n 
3  131 TYR n 
3  132 VAL n 
3  133 LEU n 
3  134 PRO n 
3  135 TRP n 
3  136 GLY n 
3  137 GLN n 
3  138 MET n 
3  139 SER n 
3  140 PHE n 
3  141 TRP n 
3  142 GLY n 
3  143 ALA n 
3  144 THR n 
3  145 VAL n 
3  146 ILE n 
3  147 THR n 
3  148 ASN n 
3  149 LEU n 
3  150 LEU n 
3  151 SER n 
3  152 ALA n 
3  153 ILE n 
3  154 PRO n 
3  155 TYR n 
3  156 ILE n 
3  157 GLY n 
3  158 THR n 
3  159 ASN n 
3  160 LEU n 
3  161 VAL n 
3  162 GLU n 
3  163 TRP n 
3  164 ILE n 
3  165 TRP n 
3  166 GLY n 
3  167 GLY n 
3  168 PHE n 
3  169 SER n 
3  170 VAL n 
3  171 ASP n 
3  172 LYS n 
3  173 ALA n 
3  174 THR n 
3  175 LEU n 
3  176 THR n 
3  177 ARG n 
3  178 PHE n 
3  179 PHE n 
3  180 ALA n 
3  181 PHE n 
3  182 HIS n 
3  183 PHE n 
3  184 ILE n 
3  185 LEU n 
3  186 PRO n 
3  187 PHE n 
3  188 ILE n 
3  189 ILE n 
3  190 MET n 
3  191 ALA n 
3  192 ILE n 
3  193 ALA n 
3  194 MET n 
3  195 VAL n 
3  196 HIS n 
3  197 LEU n 
3  198 LEU n 
3  199 PHE n 
3  200 LEU n 
3  201 HIS n 
3  202 GLU n 
3  203 THR n 
3  204 GLY n 
3  205 SER n 
3  206 ASN n 
3  207 ASN n 
3  208 PRO n 
3  209 THR n 
3  210 GLY n 
3  211 ILE n 
3  212 SER n 
3  213 SER n 
3  214 ASP n 
3  215 VAL n 
3  216 ASP n 
3  217 LYS n 
3  218 ILE n 
3  219 PRO n 
3  220 PHE n 
3  221 HIS n 
3  222 PRO n 
3  223 TYR n 
3  224 TYR n 
3  225 THR n 
3  226 ILE n 
3  227 LYS n 
3  228 ASP n 
3  229 ILE n 
3  230 LEU n 
3  231 GLY n 
3  232 ALA n 
3  233 LEU n 
3  234 LEU n 
3  235 LEU n 
3  236 ILE n 
3  237 LEU n 
3  238 ALA n 
3  239 LEU n 
3  240 MET n 
3  241 LEU n 
3  242 LEU n 
3  243 VAL n 
3  244 LEU n 
3  245 PHE n 
3  246 ALA n 
3  247 PRO n 
3  248 ASP n 
3  249 LEU n 
3  250 LEU n 
3  251 GLY n 
3  252 ASP n 
3  253 PRO n 
3  254 ASP n 
3  255 ASN n 
3  256 TYR n 
3  257 THR n 
3  258 PRO n 
3  259 ALA n 
3  260 ASN n 
3  261 PRO n 
3  262 LEU n 
3  263 ASN n 
3  264 THR n 
3  265 PRO n 
3  266 PRO n 
3  267 HIS n 
3  268 ILE n 
3  269 LYS n 
3  270 PRO n 
3  271 GLU n 
3  272 TRP n 
3  273 TYR n 
3  274 PHE n 
3  275 LEU n 
3  276 PHE n 
3  277 ALA n 
3  278 TYR n 
3  279 ALA n 
3  280 ILE n 
3  281 LEU n 
3  282 ARG n 
3  283 SER n 
3  284 ILE n 
3  285 PRO n 
3  286 ASN n 
3  287 LYS n 
3  288 LEU n 
3  289 GLY n 
3  290 GLY n 
3  291 VAL n 
3  292 LEU n 
3  293 ALA n 
3  294 LEU n 
3  295 ALA n 
3  296 PHE n 
3  297 SER n 
3  298 ILE n 
3  299 LEU n 
3  300 ILE n 
3  301 LEU n 
3  302 ALA n 
3  303 LEU n 
3  304 ILE n 
3  305 PRO n 
3  306 LEU n 
3  307 LEU n 
3  308 HIS n 
3  309 THR n 
3  310 SER n 
3  311 LYS n 
3  312 GLN n 
3  313 ARG n 
3  314 SER n 
3  315 MET n 
3  316 MET n 
3  317 PHE n 
3  318 ARG n 
3  319 PRO n 
3  320 LEU n 
3  321 SER n 
3  322 GLN n 
3  323 CYS n 
3  324 LEU n 
3  325 PHE n 
3  326 TRP n 
3  327 ALA n 
3  328 LEU n 
3  329 VAL n 
3  330 ALA n 
3  331 ASP n 
3  332 LEU n 
3  333 LEU n 
3  334 THR n 
3  335 LEU n 
3  336 THR n 
3  337 TRP n 
3  338 ILE n 
3  339 GLY n 
3  340 GLY n 
3  341 GLN n 
3  342 PRO n 
3  343 VAL n 
3  344 GLU n 
3  345 HIS n 
3  346 PRO n 
3  347 TYR n 
3  348 ILE n 
3  349 THR n 
3  350 ILE n 
3  351 GLY n 
3  352 GLN n 
3  353 LEU n 
3  354 ALA n 
3  355 SER n 
3  356 VAL n 
3  357 LEU n 
3  358 TYR n 
3  359 PHE n 
3  360 LEU n 
3  361 LEU n 
3  362 ILE n 
3  363 LEU n 
3  364 VAL n 
3  365 LEU n 
3  366 MET n 
3  367 PRO n 
3  368 THR n 
3  369 ALA n 
3  370 GLY n 
3  371 THR n 
3  372 ILE n 
3  373 GLU n 
3  374 ASN n 
3  375 LYS n 
3  376 LEU n 
3  377 LEU n 
3  378 LYS n 
3  379 TRP n 
4  1   SER n 
4  2   ASP n 
4  3   LEU n 
4  4   GLU n 
4  5   LEU n 
4  6   HIS n 
4  7   PRO n 
4  8   PRO n 
4  9   SER n 
4  10  TYR n 
4  11  PRO n 
4  12  TRP n 
4  13  SER n 
4  14  HIS n 
4  15  ARG n 
4  16  GLY n 
4  17  LEU n 
4  18  LEU n 
4  19  SER n 
4  20  SER n 
4  21  LEU n 
4  22  ASP n 
4  23  HIS n 
4  24  THR n 
4  25  SER n 
4  26  ILE n 
4  27  ARG n 
4  28  ARG n 
4  29  GLY n 
4  30  PHE n 
4  31  GLN n 
4  32  VAL n 
4  33  TYR n 
4  34  LYS n 
4  35  GLN n 
4  36  VAL n 
4  37  CYS n 
4  38  SER n 
4  39  SER n 
4  40  CYS n 
4  41  HIS n 
4  42  SER n 
4  43  MET n 
4  44  ASP n 
4  45  TYR n 
4  46  VAL n 
4  47  ALA n 
4  48  TYR n 
4  49  ARG n 
4  50  HIS n 
4  51  LEU n 
4  52  VAL n 
4  53  GLY n 
4  54  VAL n 
4  55  CYS n 
4  56  TYR n 
4  57  THR n 
4  58  GLU n 
4  59  ASP n 
4  60  GLU n 
4  61  ALA n 
4  62  LYS n 
4  63  ALA n 
4  64  LEU n 
4  65  ALA n 
4  66  GLU n 
4  67  GLU n 
4  68  VAL n 
4  69  GLU n 
4  70  VAL n 
4  71  GLN n 
4  72  ASP n 
4  73  GLY n 
4  74  PRO n 
4  75  ASN n 
4  76  GLU n 
4  77  ASP n 
4  78  GLY n 
4  79  GLU n 
4  80  MET n 
4  81  PHE n 
4  82  MET n 
4  83  ARG n 
4  84  PRO n 
4  85  GLY n 
4  86  LYS n 
4  87  LEU n 
4  88  SER n 
4  89  ASP n 
4  90  TYR n 
4  91  PHE n 
4  92  PRO n 
4  93  LYS n 
4  94  PRO n 
4  95  TYR n 
4  96  PRO n 
4  97  ASN n 
4  98  PRO n 
4  99  GLU n 
4  100 ALA n 
4  101 ALA n 
4  102 ARG n 
4  103 ALA n 
4  104 ALA n 
4  105 ASN n 
4  106 ASN n 
4  107 GLY n 
4  108 ALA n 
4  109 LEU n 
4  110 PRO n 
4  111 PRO n 
4  112 ASP n 
4  113 LEU n 
4  114 SER n 
4  115 TYR n 
4  116 ILE n 
4  117 VAL n 
4  118 ARG n 
4  119 ALA n 
4  120 ARG n 
4  121 HIS n 
4  122 GLY n 
4  123 GLY n 
4  124 GLU n 
4  125 ASP n 
4  126 TYR n 
4  127 VAL n 
4  128 PHE n 
4  129 SER n 
4  130 LEU n 
4  131 LEU n 
4  132 THR n 
4  133 GLY n 
4  134 TYR n 
4  135 CYS n 
4  136 GLU n 
4  137 PRO n 
4  138 PRO n 
4  139 THR n 
4  140 GLY n 
4  141 VAL n 
4  142 SER n 
4  143 LEU n 
4  144 ARG n 
4  145 GLU n 
4  146 GLY n 
4  147 LEU n 
4  148 TYR n 
4  149 PHE n 
4  150 ASN n 
4  151 PRO n 
4  152 TYR n 
4  153 PHE n 
4  154 PRO n 
4  155 GLY n 
4  156 GLN n 
4  157 ALA n 
4  158 ILE n 
4  159 GLY n 
4  160 MET n 
4  161 ALA n 
4  162 PRO n 
4  163 PRO n 
4  164 ILE n 
4  165 TYR n 
4  166 ASN n 
4  167 GLU n 
4  168 VAL n 
4  169 LEU n 
4  170 GLU n 
4  171 PHE n 
4  172 ASP n 
4  173 ASP n 
4  174 GLY n 
4  175 THR n 
4  176 PRO n 
4  177 ALA n 
4  178 THR n 
4  179 MET n 
4  180 SER n 
4  181 GLN n 
4  182 VAL n 
4  183 ALA n 
4  184 LYS n 
4  185 ASP n 
4  186 VAL n 
4  187 CYS n 
4  188 THR n 
4  189 PHE n 
4  190 LEU n 
4  191 ARG n 
4  192 TRP n 
4  193 ALA n 
4  194 ALA n 
4  195 GLU n 
4  196 PRO n 
4  197 GLU n 
4  198 HIS n 
4  199 ASP n 
4  200 HIS n 
4  201 ARG n 
4  202 LYS n 
4  203 ARG n 
4  204 MET n 
4  205 GLY n 
4  206 LEU n 
4  207 LYS n 
4  208 MET n 
4  209 LEU n 
4  210 LEU n 
4  211 MET n 
4  212 MET n 
4  213 GLY n 
4  214 LEU n 
4  215 LEU n 
4  216 LEU n 
4  217 PRO n 
4  218 LEU n 
4  219 VAL n 
4  220 TYR n 
4  221 ALA n 
4  222 MET n 
4  223 LYS n 
4  224 ARG n 
4  225 HIS n 
4  226 LYS n 
4  227 TRP n 
4  228 SER n 
4  229 VAL n 
4  230 LEU n 
4  231 LYS n 
4  232 SER n 
4  233 ARG n 
4  234 LYS n 
4  235 LEU n 
4  236 ALA n 
4  237 TYR n 
4  238 ARG n 
4  239 PRO n 
4  240 PRO n 
4  241 LYS n 
5  1   SER n 
5  2   HIS n 
5  3   THR n 
5  4   ASP n 
5  5   ILE n 
5  6   LYS n 
5  7   VAL n 
5  8   PRO n 
5  9   ASP n 
5  10  PHE n 
5  11  SER n 
5  12  ASP n 
5  13  TYR n 
5  14  ARG n 
5  15  ARG n 
5  16  PRO n 
5  17  GLU n 
5  18  VAL n 
5  19  LEU n 
5  20  ASP n 
5  21  SER n 
5  22  THR n 
5  23  LYS n 
5  24  SER n 
5  25  SER n 
5  26  LYS n 
5  27  GLU n 
5  28  SER n 
5  29  SER n 
5  30  GLU n 
5  31  ALA n 
5  32  ARG n 
5  33  LYS n 
5  34  GLY n 
5  35  PHE n 
5  36  SER n 
5  37  TYR n 
5  38  LEU n 
5  39  VAL n 
5  40  THR n 
5  41  ALA n 
5  42  THR n 
5  43  THR n 
5  44  THR n 
5  45  VAL n 
5  46  GLY n 
5  47  VAL n 
5  48  ALA n 
5  49  TYR n 
5  50  ALA n 
5  51  ALA n 
5  52  LYS n 
5  53  ASN n 
5  54  VAL n 
5  55  VAL n 
5  56  SER n 
5  57  GLN n 
5  58  PHE n 
5  59  VAL n 
5  60  SER n 
5  61  SER n 
5  62  MET n 
5  63  SER n 
5  64  ALA n 
5  65  SER n 
5  66  ALA n 
5  67  ASP n 
5  68  VAL n 
5  69  LEU n 
5  70  ALA n 
5  71  MET n 
5  72  SER n 
5  73  LYS n 
5  74  ILE n 
5  75  GLU n 
5  76  ILE n 
5  77  LYS n 
5  78  LEU n 
5  79  SER n 
5  80  ASP n 
5  81  ILE n 
5  82  PRO n 
5  83  GLU n 
5  84  GLY n 
5  85  LYS n 
5  86  ASN n 
5  87  MET n 
5  88  ALA n 
5  89  PHE n 
5  90  LYS n 
5  91  TRP n 
5  92  ARG n 
5  93  GLY n 
5  94  LYS n 
5  95  PRO n 
5  96  LEU n 
5  97  PHE n 
5  98  VAL n 
5  99  ARG n 
5  100 HIS n 
5  101 ARG n 
5  102 THR n 
5  103 LYS n 
5  104 LYS n 
5  105 GLU n 
5  106 ILE n 
5  107 ASP n 
5  108 GLN n 
5  109 GLU n 
5  110 ALA n 
5  111 ALA n 
5  112 VAL n 
5  113 GLU n 
5  114 VAL n 
5  115 SER n 
5  116 GLN n 
5  117 LEU n 
5  118 ARG n 
5  119 ASP n 
5  120 PRO n 
5  121 GLN n 
5  122 HIS n 
5  123 ASP n 
5  124 LEU n 
5  125 GLU n 
5  126 ARG n 
5  127 VAL n 
5  128 LYS n 
5  129 LYS n 
5  130 PRO n 
5  131 GLU n 
5  132 TRP n 
5  133 VAL n 
5  134 ILE n 
5  135 LEU n 
5  136 ILE n 
5  137 GLY n 
5  138 VAL n 
5  139 CYS n 
5  140 THR n 
5  141 HIS n 
5  142 LEU n 
5  143 GLY n 
5  144 CYS n 
5  145 VAL n 
5  146 PRO n 
5  147 ILE n 
5  148 ALA n 
5  149 ASN n 
5  150 ALA n 
5  151 GLY n 
5  152 ASP n 
5  153 PHE n 
5  154 GLY n 
5  155 GLY n 
5  156 TYR n 
5  157 TYR n 
5  158 CYS n 
5  159 PRO n 
5  160 CYS n 
5  161 HIS n 
5  162 GLY n 
5  163 SER n 
5  164 HIS n 
5  165 TYR n 
5  166 ASP n 
5  167 ALA n 
5  168 SER n 
5  169 GLY n 
5  170 ARG n 
5  171 ILE n 
5  172 ARG n 
5  173 LYS n 
5  174 GLY n 
5  175 PRO n 
5  176 ALA n 
5  177 PRO n 
5  178 LEU n 
5  179 ASN n 
5  180 LEU n 
5  181 GLU n 
5  182 VAL n 
5  183 PRO n 
5  184 SER n 
5  185 TYR n 
5  186 GLU n 
5  187 PHE n 
5  188 THR n 
5  189 SER n 
5  190 ASP n 
5  191 ASP n 
5  192 MET n 
5  193 VAL n 
5  194 ILE n 
5  195 VAL n 
5  196 GLY n 
6  1   ALA n 
6  2   GLY n 
6  3   ARG n 
6  4   PRO n 
6  5   ALA n 
6  6   VAL n 
6  7   SER n 
6  8   ALA n 
6  9   SER n 
6  10  SER n 
6  11  ARG n 
6  12  TRP n 
6  13  LEU n 
6  14  GLU n 
6  15  GLY n 
6  16  ILE n 
6  17  ARG n 
6  18  LYS n 
6  19  TRP n 
6  20  TYR n 
6  21  TYR n 
6  22  ASN n 
6  23  ALA n 
6  24  ALA n 
6  25  GLY n 
6  26  PHE n 
6  27  ASN n 
6  28  LYS n 
6  29  LEU n 
6  30  GLY n 
6  31  LEU n 
6  32  MET n 
6  33  ARG n 
6  34  ASP n 
6  35  ASP n 
6  36  THR n 
6  37  ILE n 
6  38  HIS n 
6  39  GLU n 
6  40  ASN n 
6  41  ASP n 
6  42  ASP n 
6  43  VAL n 
6  44  LYS n 
6  45  GLU n 
6  46  ALA n 
6  47  ILE n 
6  48  ARG n 
6  49  ARG n 
6  50  LEU n 
6  51  PRO n 
6  52  GLU n 
6  53  ASN n 
6  54  LEU n 
6  55  TYR n 
6  56  ASP n 
6  57  ASP n 
6  58  ARG n 
6  59  VAL n 
6  60  PHE n 
6  61  ARG n 
6  62  ILE n 
6  63  LYS n 
6  64  ARG n 
6  65  ALA n 
6  66  LEU n 
6  67  ASP n 
6  68  LEU n 
6  69  SER n 
6  70  MET n 
6  71  ARG n 
6  72  GLN n 
6  73  GLN n 
6  74  ILE n 
6  75  LEU n 
6  76  PRO n 
6  77  LYS n 
6  78  GLU n 
6  79  GLN n 
6  80  TRP n 
6  81  THR n 
6  82  LYS n 
6  83  TYR n 
6  84  GLU n 
6  85  GLU n 
6  86  ASP n 
6  87  LYS n 
6  88  SER n 
6  89  TYR n 
6  90  LEU n 
6  91  GLU n 
6  92  PRO n 
6  93  TYR n 
6  94  LEU n 
6  95  LYS n 
6  96  GLU n 
6  97  VAL n 
6  98  ILE n 
6  99  ARG n 
6  100 GLU n 
6  101 ARG n 
6  102 LYS n 
6  103 GLU n 
6  104 ARG n 
6  105 GLU n 
6  106 GLU n 
6  107 TRP n 
6  108 ALA n 
6  109 LYS n 
6  110 LYS n 
7  1   GLY n 
7  2   ARG n 
7  3   GLN n 
7  4   PHE n 
7  5   GLY n 
7  6   HIS n 
7  7   LEU n 
7  8   THR n 
7  9   ARG n 
7  10  VAL n 
7  11  ARG n 
7  12  HIS n 
7  13  VAL n 
7  14  ILE n 
7  15  THR n 
7  16  TYR n 
7  17  SER n 
7  18  LEU n 
7  19  SER n 
7  20  PRO n 
7  21  PHE n 
7  22  GLU n 
7  23  GLN n 
7  24  ARG n 
7  25  ALA n 
7  26  PHE n 
7  27  PRO n 
7  28  HIS n 
7  29  TYR n 
7  30  PHE n 
7  31  SER n 
7  32  LYS n 
7  33  GLY n 
7  34  ILE n 
7  35  PRO n 
7  36  ASN n 
7  37  VAL n 
7  38  LEU n 
7  39  ARG n 
7  40  ARG n 
7  41  THR n 
7  42  ARG n 
7  43  ALA n 
7  44  CYS n 
7  45  ILE n 
7  46  LEU n 
7  47  ARG n 
7  48  VAL n 
7  49  ALA n 
7  50  PRO n 
7  51  PRO n 
7  52  PHE n 
7  53  VAL n 
7  54  ALA n 
7  55  PHE n 
7  56  TYR n 
7  57  LEU n 
7  58  VAL n 
7  59  TYR n 
7  60  THR n 
7  61  TRP n 
7  62  GLY n 
7  63  THR n 
7  64  GLN n 
7  65  GLU n 
7  66  PHE n 
7  67  GLU n 
7  68  LYS n 
7  69  SER n 
7  70  LYS n 
7  71  ARG n 
7  72  LYS n 
7  73  ASN n 
7  74  PRO n 
7  75  ALA n 
7  76  ALA n 
7  77  TYR n 
7  78  GLU n 
7  79  ASN n 
7  80  ASP n 
7  81  ARG n 
8  1   GLY n 
8  2   ASP n 
8  3   PRO n 
8  4   LYS n 
8  5   GLU n 
8  6   GLU n 
8  7   GLU n 
8  8   GLU n 
8  9   GLU n 
8  10  GLU n 
8  11  GLU n 
8  12  GLU n 
8  13  LEU n 
8  14  VAL n 
8  15  ASP n 
8  16  PRO n 
8  17  LEU n 
8  18  THR n 
8  19  THR n 
8  20  VAL n 
8  21  ARG n 
8  22  GLU n 
8  23  GLN n 
8  24  CYS n 
8  25  GLU n 
8  26  GLN n 
8  27  LEU n 
8  28  GLU n 
8  29  LYS n 
8  30  CYS n 
8  31  VAL n 
8  32  LYS n 
8  33  ALA n 
8  34  ARG n 
8  35  GLU n 
8  36  ARG n 
8  37  LEU n 
8  38  GLU n 
8  39  LEU n 
8  40  CYS n 
8  41  ASP n 
8  42  GLU n 
8  43  ARG n 
8  44  VAL n 
8  45  SER n 
8  46  SER n 
8  47  ARG n 
8  48  SER n 
8  49  GLN n 
8  50  THR n 
8  51  GLU n 
8  52  GLU n 
8  53  ASP n 
8  54  CYS n 
8  55  THR n 
8  56  GLU n 
8  57  GLU n 
8  58  LEU n 
8  59  LEU n 
8  60  ASP n 
8  61  PHE n 
8  62  LEU n 
8  63  HIS n 
8  64  ALA n 
8  65  ARG n 
8  66  ASP n 
8  67  HIS n 
8  68  CYS n 
8  69  VAL n 
8  70  ALA n 
8  71  HIS n 
8  72  LYS n 
8  73  LEU n 
8  74  PHE n 
8  75  ASN n 
8  76  SER n 
8  77  LEU n 
8  78  LYS n 
9  1   MET n 
9  2   LEU n 
9  3   SER n 
9  4   VAL n 
9  5   ALA n 
9  6   ALA n 
9  7   ARG n 
9  8   SER n 
9  9   GLY n 
9  10  PRO n 
9  11  PHE n 
9  12  ALA n 
9  13  PRO n 
9  14  VAL n 
9  15  LEU n 
9  16  SER n 
9  17  ALA n 
9  18  THR n 
9  19  SER n 
9  20  ARG n 
9  21  GLY n 
9  22  VAL n 
9  23  ALA n 
9  24  GLY n 
9  25  ALA n 
9  26  LEU n 
9  27  ARG n 
9  28  PRO n 
9  29  LEU n 
9  30  VAL n 
9  31  GLN n 
9  32  ALA n 
9  33  ALA n 
9  34  VAL n 
9  35  PRO n 
9  36  ALA n 
9  37  THR n 
9  38  SER n 
9  39  GLU n 
9  40  SER n 
9  41  PRO n 
9  42  VAL n 
9  43  LEU n 
9  44  ASP n 
9  45  LEU n 
9  46  LYS n 
9  47  ARG n 
9  48  SER n 
9  49  VAL n 
9  50  LEU n 
9  51  CYS n 
9  52  ARG n 
9  53  GLU n 
9  54  SER n 
9  55  LEU n 
9  56  ARG n 
9  57  GLY n 
9  58  GLN n 
9  59  ALA n 
9  60  ALA n 
9  61  GLY n 
9  62  ARG n 
9  63  PRO n 
9  64  LEU n 
9  65  VAL n 
9  66  ALA n 
9  67  SER n 
9  68  VAL n 
9  69  SER n 
9  70  LEU n 
9  71  ASN n 
9  72  VAL n 
9  73  PRO n 
9  74  ALA n 
9  75  SER n 
9  76  VAL n 
9  77  ARG n 
9  78  TYR n 
10 1   VAL n 
10 2   ALA n 
10 3   PRO n 
10 4   THR n 
10 5   LEU n 
10 6   THR n 
10 7   ALA n 
10 8   ARG n 
10 9   LEU n 
10 10  TYR n 
10 11  SER n 
10 12  LEU n 
10 13  LEU n 
10 14  PHE n 
10 15  ARG n 
10 16  ARG n 
10 17  THR n 
10 18  SER n 
10 19  THR n 
10 20  PHE n 
10 21  ALA n 
10 22  LEU n 
10 23  THR n 
10 24  ILE n 
10 25  VAL n 
10 26  VAL n 
10 27  GLY n 
10 28  ALA n 
10 29  LEU n 
10 30  PHE n 
10 31  PHE n 
10 32  GLU n 
10 33  ARG n 
10 34  ALA n 
10 35  PHE n 
10 36  ASP n 
10 37  GLN n 
10 38  GLY n 
10 39  ALA n 
10 40  ASP n 
10 41  ALA n 
10 42  ILE n 
10 43  TYR n 
10 44  GLU n 
10 45  HIS n 
10 46  ILE n 
10 47  ASN n 
10 48  GLU n 
10 49  GLY n 
10 50  LYS n 
10 51  LEU n 
10 52  TRP n 
10 53  LYS n 
10 54  HIS n 
10 55  ILE n 
10 56  LYS n 
10 57  HIS n 
10 58  LYS n 
10 59  TYR n 
10 60  GLU n 
10 61  ASN n 
10 62  LYS n 
11 1   MET n 
11 2   LEU n 
11 3   THR n 
11 4   ARG n 
11 5   PHE n 
11 6   LEU n 
11 7   GLY n 
11 8   PRO n 
11 9   ARG n 
11 10  TYR n 
11 11  ARG n 
11 12  GLN n 
11 13  LEU n 
11 14  ALA n 
11 15  ARG n 
11 16  ASN n 
11 17  TRP n 
11 18  VAL n 
11 19  PRO n 
11 20  THR n 
11 21  ALA n 
11 22  SER n 
11 23  LEU n 
11 24  TRP n 
11 25  GLY n 
11 26  ALA n 
11 27  VAL n 
11 28  GLY n 
11 29  ALA n 
11 30  VAL n 
11 31  GLY n 
11 32  LEU n 
11 33  VAL n 
11 34  TRP n 
11 35  ALA n 
11 36  THR n 
11 37  ASP n 
11 38  TRP n 
11 39  ARG n 
11 40  LEU n 
11 41  ILE n 
11 42  LEU n 
11 43  ASP n 
11 44  TRP n 
11 45  VAL n 
11 46  PRO n 
11 47  TYR n 
11 48  ILE n 
11 49  ASN n 
11 50  GLY n 
11 51  LYS n 
11 52  PHE n 
11 53  LYS n 
11 54  LYS n 
11 55  ASP n 
11 56  ASP n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? cattle 'Bos taurus' 9913 Bos ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP UQCR1_BOVIN P31800 1  
;TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVE
SMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQG
TPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQ
ICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLL
GAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIA
EVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF
;
35 ? 
2  UNP UQCR2_BOVIN P23004 2  
;SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGA
SSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVI
ENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYH
GGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSG
LFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQ
QIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL
;
15 ? 
3  UNP CYB_BOVIN   P00157 3  
;MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIR
YMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL
VEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM
LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPL
SQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW
;
1  ? 
4  UNP CY1_BOVIN   P00125 4  
;SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEM
FMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGM
APPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP
K
;
1  ? 
5  UNP UCRI_BOVIN  P13272 5  
;SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSD
IPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC
HGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
;
79 ? 
6  UNP UCR6_BOVIN  P00129 6  
;AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQW
TKYEEDKSYLEPYLKEVIRERKEREEWAKK
;
1  ? 
7  UNP UCRQ_BOVIN  P13271 7  
;GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEND
R
;
1  ? 
8  UNP UCRH_BOVIN  P00126 8  GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK 1  ? 
9  UNP UCRI_BOVIN  P13272 9  MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY 1  ? 
10 UNP UCR10_BOVIN P00130 10 VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK 1  ? 
11 UNP UCR11_BOVIN P07552 11 MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD 1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  2FYU A 1 ? 446 ? P31800 35 ? 480 ? 1 446 
2  2  2FYU B 1 ? 439 ? P23004 15 ? 453 ? 1 439 
3  3  2FYU C 1 ? 379 ? P00157 1  ? 379 ? 1 379 
4  4  2FYU D 1 ? 241 ? P00125 1  ? 241 ? 1 241 
5  5  2FYU E 1 ? 196 ? P13272 79 ? 274 ? 1 196 
6  6  2FYU F 1 ? 110 ? P00129 1  ? 110 ? 1 110 
7  7  2FYU G 1 ? 81  ? P13271 1  ? 81  ? 1 81  
8  8  2FYU H 1 ? 78  ? P00126 1  ? 78  ? 1 78  
9  9  2FYU I 1 ? 78  ? P13272 1  ? 78  ? 1 78  
10 10 2FYU J 1 ? 62  ? P00130 1  ? 62  ? 1 62  
11 11 2FYU K 1 ? 56  ? P07552 1  ? 56  ? 1 56  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                    ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                   ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                 ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                            ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                   ? 'C3 H7 N O2 S'     121.158 
FDN non-polymer         . '(5S)-3-ANILINO-5-(2,4-DIFLUOROPHENYL)-5-METHYL-1,3-OXAZOLIDINE-2,4-DIONE' 
'5-(2,4-DIFLUORO-PHENYL)-5-METHYL-3-PHENYLAMINO-OXAZOLIDINE-2,4-DIONE' 'C16 H12 F2 N2 O3' 318.275 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'                                               ? 'Fe2 S2'           175.820 
GLN 'L-peptide linking' y GLUTAMINE                                                                  ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                            ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                    ? 'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                                          HEME 'C34 H32 Fe N4 O4' 
616.487 
HIS 'L-peptide linking' y HISTIDINE                                                                  ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                      ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                 ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                    ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                     ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                 ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                              ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                    ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                     ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                  ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                 ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                   ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                     ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2FYU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.64 
_exptl_crystal.density_percent_sol   66.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277.2 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_details    
;50 mM MOPS 7.2pH, 20 mM Ammonium acetate, 20% glycerol.Incubation with 2-5 mol excess of JG144.  Precipitant 12% PEG4000, 0.5 M KCl, 0.1% DHPC; Protein:PPT ratio 1:0.57, VAPOR DIFFUSION, SITTING DROP, temperature 277.2K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2004-07-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SAGITALLY FOCUSED Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0090 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0090 
# 
_reflns.entry_id                     2FYU 
_reflns.observed_criterion_sigma_I   -0.3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.26 
_reflns.number_obs                   157290 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         86.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.056 
_reflns.pdbx_netI_over_sigmaI        17.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.26 
_reflns_shell.d_res_low              2.34 
_reflns_shell.percent_possible_all   42.4 
_reflns_shell.Rmerge_I_obs           0.382 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      13582 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2FYU 
_refine.ls_number_reflns_obs                     157290 
_refine.ls_number_reflns_all                     157290 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.26 
_refine.ls_percent_reflns_obs                    96.89 
_refine.ls_R_factor_obs                          0.24916 
_refine.ls_R_factor_all                          0.24916 
_refine.ls_R_factor_R_work                       0.24843 
_refine.ls_R_factor_R_free                       0.28328 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  3230 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.932 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.B_iso_mean                               25.239 
_refine.aniso_B[1][1]                            2.36 
_refine.aniso_B[2][2]                            2.36 
_refine.aniso_B[3][3]                            -4.71 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1l0n 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.253 
_refine.pdbx_overall_ESU_R_Free                  0.216 
_refine.overall_SU_ML                            0.212 
_refine.overall_SU_B                             9.100 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16477 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         156 
_refine_hist.number_atoms_solvent             267 
_refine_hist.number_atoms_total               16900 
_refine_hist.d_res_high                       2.26 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.021  0.021  ? 17444 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.063  1.983  ? 23647 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       11.115 10.000 ? 2088  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.200  0.200  ? 2575  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.026  0.020  ? 13008 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.117  0.200  ? 7426  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.096  0.200  ? 621   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.094  0.200  ? 193   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.068  0.200  ? 18    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.592  0.400  ? 10459 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.514  3.801  ? 16826 'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.686  3.000  ? 6985  'X-RAY DIFFRACTION' ? 
r_scangle_it                 7.314  4.500  ? 6819  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.260 
_refine_ls_shell.d_res_low                        2.319 
_refine_ls_shell.number_reflns_R_work             10142 
_refine_ls_shell.R_factor_R_work                  0.316 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.31 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             200 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2FYU 
_struct.title                     'Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor' 
_struct.pdbx_descriptor           
;Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial (E.C.1.10.2.2), Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial (E.C.1.10.2.2), Cytochrome b, Cytochrome c1, heme protein, mitochondrial, Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial  (E.C.1.10.2.2), Hypothetical protein LOC616871, Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C (E.C.1.10.2.2), Ubiquinol-cytochrome c reductase complex 11 kDa protein (E.C.1.10.2.2), Ubiquinol-cytochrome c reductase complex 7.2 kDa protein (E.C.1.10.2.2), Ubiquinol-cytochrome c reductase complex 6.4 kDa protein (E.C.1.10.2.2)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FYU 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'Transmembrane helices, 11 protein complex, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 12 ? 
N N N 13 ? 
O N N 12 ? 
P N N 14 ? 
Q N N 15 ? 
R N N 15 ? 
S N N 15 ? 
T N N 15 ? 
U N N 15 ? 
V N N 15 ? 
W N N 15 ? 
X N N 15 ? 
Y N N 15 ? 
Z N N 15 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The second part of the biological assembly  (dimer) is generated by the two fold rotation axis: 1-x,1-y, z.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 3   ? SER A 10  ? THR A 3   SER A 10  1 ? 8  
HELX_P HELX_P2  2  GLY A 44  ? GLU A 48  ? GLY A 44  GLU A 48  5 ? 5  
HELX_P HELX_P3  3  GLY A 54  ? ALA A 63  ? GLY A 54  ALA A 63  1 ? 10 
HELX_P HELX_P4  4  ASN A 73  ? MET A 82  ? ASN A 73  MET A 82  1 ? 10 
HELX_P HELX_P5  5  ASP A 105 ? CYS A 120 ? ASP A 105 CYS A 120 1 ? 16 
HELX_P HELX_P6  6  GLU A 123 ? ASP A 142 ? GLU A 123 ASP A 142 1 ? 20 
HELX_P HELX_P7  7  SER A 144 ? PHE A 158 ? SER A 144 PHE A 158 1 ? 15 
HELX_P HELX_P8  8  THR A 161 ? GLN A 165 ? THR A 161 GLN A 165 5 ? 5  
HELX_P HELX_P9  9  PRO A 170 ? LEU A 177 ? PRO A 170 LEU A 177 1 ? 8  
HELX_P HELX_P10 10 SER A 178 ? TYR A 190 ? SER A 178 TYR A 190 1 ? 13 
HELX_P HELX_P11 11 LYS A 191 ? PRO A 193 ? LYS A 191 PRO A 193 5 ? 3  
HELX_P HELX_P12 12 GLU A 204 ? PHE A 216 ? GLU A 204 PHE A 216 1 ? 13 
HELX_P HELX_P13 13 ASP A 266 ? GLY A 278 ? ASP A 266 GLY A 278 1 ? 13 
HELX_P HELX_P14 14 SER A 292 ? LYS A 302 ? SER A 292 LYS A 302 1 ? 11 
HELX_P HELX_P15 15 SER A 330 ? ALA A 349 ? SER A 330 ALA A 349 1 ? 20 
HELX_P HELX_P16 16 THR A 350 ? LEU A 369 ? THR A 350 LEU A 369 1 ? 20 
HELX_P HELX_P17 17 GLY A 371 ? TYR A 386 ? GLY A 371 TYR A 386 1 ? 16 
HELX_P HELX_P18 18 PRO A 391 ? GLU A 401 ? PRO A 391 GLU A 401 1 ? 11 
HELX_P HELX_P19 19 ASP A 403 ? TYR A 416 ? ASP A 403 TYR A 416 1 ? 14 
HELX_P HELX_P20 20 ASP A 433 ? GLY A 440 ? ASP A 433 GLY A 440 1 ? 8  
HELX_P HELX_P21 21 GLY B 54  ? GLU B 58  ? GLY B 54  GLU B 58  5 ? 5  
HELX_P HELX_P22 22 GLY B 64  ? ALA B 72  ? GLY B 64  ALA B 72  1 ? 9  
HELX_P HELX_P23 23 SER B 81  ? VAL B 92  ? SER B 81  VAL B 92  1 ? 12 
HELX_P HELX_P24 24 ASP B 115 ? ALA B 129 ? ASP B 115 ALA B 129 1 ? 15 
HELX_P HELX_P25 25 ARG B 133 ? LEU B 152 ? ARG B 133 LEU B 152 1 ? 20 
HELX_P HELX_P26 26 ASN B 154 ? TYR B 168 ? ASN B 154 TYR B 168 1 ? 15 
HELX_P HELX_P27 27 PRO B 179 ? ILE B 183 ? PRO B 179 ILE B 183 5 ? 5  
HELX_P HELX_P28 28 THR B 187 ? PHE B 199 ? THR B 187 PHE B 199 1 ? 13 
HELX_P HELX_P29 29 THR B 200 ? ALA B 202 ? THR B 200 ALA B 202 5 ? 3  
HELX_P HELX_P30 30 SER B 212 ? LEU B 224 ? SER B 212 LEU B 224 1 ? 13 
HELX_P HELX_P31 31 SER B 266 ? GLY B 280 ? SER B 266 GLY B 280 1 ? 15 
HELX_P HELX_P32 32 SER B 293 ? VAL B 303 ? SER B 293 VAL B 303 1 ? 11 
HELX_P HELX_P33 33 SER B 332 ? GLN B 349 ? SER B 332 GLN B 349 1 ? 18 
HELX_P HELX_P34 34 SER B 353 ? VAL B 372 ? SER B 353 VAL B 372 1 ? 20 
HELX_P HELX_P35 35 SER B 374 ? GLY B 390 ? SER B 374 GLY B 390 1 ? 17 
HELX_P HELX_P36 36 PRO B 394 ? ALA B 404 ? PRO B 394 ALA B 404 1 ? 11 
HELX_P HELX_P37 37 ALA B 406 ? GLY B 420 ? ALA B 406 GLY B 420 1 ? 15 
HELX_P HELX_P38 38 ASN C 3   ? HIS C 8   ? ASN C 3   HIS C 8   1 ? 6  
HELX_P HELX_P39 39 HIS C 8   ? ILE C 19  ? HIS C 8   ILE C 19  1 ? 12 
HELX_P HELX_P40 40 SER C 28  ? TRP C 31  ? SER C 28  TRP C 31  5 ? 4  
HELX_P HELX_P41 41 ASN C 32  ? MET C 53  ? ASN C 32  MET C 53  1 ? 22 
HELX_P HELX_P42 42 THR C 61  ? ASP C 72  ? THR C 61  ASP C 72  1 ? 12 
HELX_P HELX_P43 43 TYR C 75  ? TYR C 104 ? TYR C 75  TYR C 104 1 ? 30 
HELX_P HELX_P44 44 GLY C 105 ? THR C 108 ? GLY C 105 THR C 108 5 ? 4  
HELX_P HELX_P45 45 PHE C 109 ? LEU C 133 ? PHE C 109 LEU C 133 1 ? 25 
HELX_P HELX_P46 46 GLY C 136 ? LEU C 149 ? GLY C 136 LEU C 149 1 ? 14 
HELX_P HELX_P47 47 LEU C 150 ? ILE C 153 ? LEU C 150 ILE C 153 5 ? 4  
HELX_P HELX_P48 48 ILE C 156 ? GLY C 166 ? ILE C 156 GLY C 166 1 ? 11 
HELX_P HELX_P49 49 ASP C 171 ? GLU C 202 ? ASP C 171 GLU C 202 1 ? 32 
HELX_P HELX_P50 50 PHE C 220 ? ALA C 246 ? PHE C 220 ALA C 246 1 ? 27 
HELX_P HELX_P51 51 ASP C 252 ? THR C 257 ? ASP C 252 THR C 257 5 ? 6  
HELX_P HELX_P52 52 GLU C 271 ? TYR C 273 ? GLU C 271 TYR C 273 5 ? 3  
HELX_P HELX_P53 53 PHE C 274 ? SER C 283 ? PHE C 274 SER C 283 1 ? 10 
HELX_P HELX_P54 54 ASN C 286 ? ILE C 300 ? ASN C 286 ILE C 300 1 ? 15 
HELX_P HELX_P55 55 LEU C 301 ? HIS C 308 ? LEU C 301 HIS C 308 5 ? 8  
HELX_P HELX_P56 56 ARG C 318 ? GLY C 340 ? ARG C 318 GLY C 340 1 ? 23 
HELX_P HELX_P57 57 GLU C 344 ? VAL C 364 ? GLU C 344 VAL C 364 1 ? 21 
HELX_P HELX_P58 58 VAL C 364 ? LEU C 377 ? VAL C 364 LEU C 377 1 ? 14 
HELX_P HELX_P59 59 ASP D 22  ? VAL D 36  ? ASP D 22  VAL D 36  1 ? 15 
HELX_P HELX_P60 60 ALA D 47  ? CYS D 55  ? ALA D 47  CYS D 55  1 ? 9  
HELX_P HELX_P61 61 THR D 57  ? GLU D 67  ? THR D 57  GLU D 67  1 ? 11 
HELX_P HELX_P62 62 ASN D 97  ? ASN D 105 ? ASN D 97  ASN D 105 1 ? 9  
HELX_P HELX_P63 63 GLY D 123 ? GLY D 133 ? GLY D 123 GLY D 133 1 ? 11 
HELX_P HELX_P64 64 THR D 178 ? GLU D 195 ? THR D 178 GLU D 195 1 ? 18 
HELX_P HELX_P65 65 GLU D 197 ? SER D 232 ? GLU D 197 SER D 232 1 ? 36 
HELX_P HELX_P66 66 SER E 1   ? ILE E 5   ? SER E 1   ILE E 5   5 ? 5  
HELX_P HELX_P67 67 ARG E 15  ? LEU E 19  ? ARG E 15  LEU E 19  5 ? 5  
HELX_P HELX_P68 68 SER E 25  ? SER E 63  ? SER E 25  SER E 63  1 ? 39 
HELX_P HELX_P69 69 SER E 65  ? ALA E 70  ? SER E 65  ALA E 70  1 ? 6  
HELX_P HELX_P70 70 SER E 79  ? ILE E 81  ? SER E 79  ILE E 81  5 ? 3  
HELX_P HELX_P71 71 THR E 102 ? ALA E 111 ? THR E 102 ALA E 111 1 ? 10 
HELX_P HELX_P72 72 SER F 7   ? GLY F 25  ? SER F 7   GLY F 25  1 ? 19 
HELX_P HELX_P73 73 PHE F 26  ? GLY F 30  ? PHE F 26  GLY F 30  5 ? 5  
HELX_P HELX_P74 74 MET F 32  ? ILE F 37  ? MET F 32  ILE F 37  5 ? 6  
HELX_P HELX_P75 75 ASN F 40  ? LEU F 50  ? ASN F 40  LEU F 50  1 ? 11 
HELX_P HELX_P76 76 PRO F 51  ? GLN F 72  ? PRO F 51  GLN F 72  1 ? 22 
HELX_P HELX_P77 77 PRO F 76  ? TRP F 80  ? PRO F 76  TRP F 80  5 ? 5  
HELX_P HELX_P78 78 LYS F 82  ? ASP F 86  ? LYS F 82  ASP F 86  5 ? 5  
HELX_P HELX_P79 79 LEU F 90  ? LYS F 110 ? LEU F 90  LYS F 110 1 ? 21 
HELX_P HELX_P80 80 PRO G 20  ? GLN G 23  ? PRO G 20  GLN G 23  5 ? 4  
HELX_P HELX_P81 81 LYS G 32  ? LYS G 70  ? LYS G 32  LYS G 70  1 ? 39 
HELX_P HELX_P82 82 ASP H 15  ? GLN H 26  ? ASP H 15  GLN H 26  1 ? 12 
HELX_P HELX_P83 83 LEU H 27  ? SER H 46  ? LEU H 27  SER H 46  1 ? 20 
HELX_P HELX_P84 84 CYS H 54  ? LEU H 73  ? CYS H 54  LEU H 73  1 ? 20 
HELX_P HELX_P85 85 PHE H 74  ? SER H 76  ? PHE H 74  SER H 76  5 ? 3  
HELX_P HELX_P86 86 VAL I 4   ? SER I 8   ? VAL I 4   SER I 8   5 ? 5  
HELX_P HELX_P87 87 LEU I 29  ? VAL I 34  ? LEU I 29  VAL I 34  1 ? 6  
HELX_P HELX_P88 88 THR J 4   ? PHE J 14  ? THR J 4   PHE J 14  1 ? 11 
HELX_P HELX_P89 89 ARG J 16  ? GLU J 48  ? ARG J 16  GLU J 48  1 ? 33 
HELX_P HELX_P90 90 MET K 1   ? LEU K 6   ? MET K 1   LEU K 6   5 ? 6  
HELX_P HELX_P91 91 GLY K 7   ? ASP K 37  ? GLY K 7   ASP K 37  1 ? 31 
HELX_P HELX_P92 92 TRP K 38  ? ASP K 43  ? TRP K 38  ASP K 43  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? E CYS 144 SG  ? ? ? 1_555 E CYS 160 SG  ? ? E CYS 144 E CYS 160 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf2  disulf ? ? H CYS 24  SG  ? ? ? 1_555 H CYS 68  SG  ? ? H CYS 24  H CYS 68  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf3  disulf ? ? H CYS 40  SG  ? ? ? 1_555 H CYS 54  SG  ? ? H CYS 40  H CYS 54  1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc1  metalc ? ? L HEM .   FE  ? ? ? 1_555 C HIS 83  NE2 ? ? C HEM 381 C HIS 83  1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc2  metalc ? ? L HEM .   FE  ? ? ? 1_555 C HIS 182 NE2 ? ? C HEM 381 C HIS 182 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc3  metalc ? ? M HEM .   FE  ? ? ? 1_555 C HIS 97  NE2 ? ? C HEM 382 C HIS 97  1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc4  metalc ? ? M HEM .   FE  ? ? ? 1_555 C HIS 196 NE2 ? ? C HEM 382 C HIS 196 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc5  metalc ? ? O HEM .   FE  ? ? ? 1_555 D HIS 41  NE2 ? ? D HEM 242 D HIS 41  1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc6  metalc ? ? O HEM .   FE  ? ? ? 1_555 D MET 160 SD  ? ? D HEM 242 D MET 160 1_555 ? ? ? ? ? ? ? 2.368 ? 
covale1  covale ? ? O HEM .   CAB ? ? ? 1_555 D CYS 37  SG  ? ? D HEM 242 D CYS 37  1_555 ? ? ? ? ? ? ? 3.086 ? 
covale2  covale ? ? O HEM .   CAC ? ? ? 1_555 D CYS 40  SG  ? ? D HEM 242 D CYS 40  1_555 ? ? ? ? ? ? ? 3.418 ? 
metalc7  metalc ? ? P FES .   FE2 ? ? ? 1_555 E HIS 141 ND1 ? ? E FES 200 E HIS 141 1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc8  metalc ? ? P FES .   FE2 ? ? ? 1_555 E HIS 161 ND1 ? ? E FES 200 E HIS 161 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc9  metalc ? ? P FES .   FE1 ? ? ? 1_555 E CYS 139 SG  ? ? E FES 200 E CYS 139 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc10 metalc ? ? P FES .   FE1 ? ? ? 1_555 E CYS 158 SG  ? ? E FES 200 E CYS 158 1_555 ? ? ? ? ? ? ? 2.170 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          HIS 
_struct_mon_prot_cis.label_seq_id           221 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           HIS 
_struct_mon_prot_cis.auth_seq_id            221 
_struct_mon_prot_cis.auth_asym_id           C 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    222 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     222 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    C 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       8.94 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 8 ? 
C ? 8 ? 
D ? 5 ? 
E ? 2 ? 
F ? 2 ? 
G ? 3 ? 
H ? 3 ? 
I ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 15  ? GLN A 18  ? GLN A 15  GLN A 18  
A 2 ARG A 24  ? GLN A 29  ? ARG A 24  GLN A 29  
A 3 MET A 195 ? GLY A 201 ? MET A 195 GLY A 201 
A 4 THR A 34  ? ILE A 41  ? THR A 34  ILE A 41  
A 5 THR A 95  ? LEU A 102 ? THR A 95  LEU A 102 
A 6 HIS A 85  ? SER A 90  ? HIS A 85  SER A 90  
B 1 HIS A 279 ? ASP A 281 ? HIS A 279 ASP A 281 
B 2 SER A 306 ? CYS A 313 ? SER A 306 CYS A 313 
B 3 GLY A 318 ? CYS A 326 ? GLY A 318 CYS A 326 
B 4 ALA A 251 ? GLY A 259 ? ALA A 251 GLY A 259 
B 5 ALA A 421 ? GLY A 426 ? ALA A 421 GLY A 426 
B 6 SER A 239 ? GLU A 245 ? SER A 239 GLU A 245 
B 7 ARG G 11  ? LEU G 18  ? ARG G 11  LEU G 18  
B 8 LYS D 234 ? TYR D 237 ? LYS D 234 TYR D 237 
C 1 GLU B 25  ? ARG B 28  ? GLU B 25  ARG B 28  
C 2 VAL B 34  ? LEU B 38  ? VAL B 34  LEU B 38  
C 3 MET B 204 ? LEU B 209 ? MET B 204 LEU B 209 
C 4 ALA B 44  ? ILE B 51  ? ALA B 44  ILE B 51  
C 5 MET B 105 ? LEU B 112 ? MET B 105 LEU B 112 
C 6 LYS B 95  ? SER B 100 ? LYS B 95  SER B 100 
C 7 ALA I 12  ? SER I 16  ? ALA I 12  SER I 16  
C 8 VAL I 22  ? GLY I 24  ? VAL I 22  GLY I 24  
D 1 GLY B 242 ? GLN B 247 ? GLY B 242 GLN B 247 
D 2 LYS B 422 ? GLY B 428 ? LYS B 422 GLY B 428 
D 3 LEU B 252 ? GLU B 260 ? LEU B 252 GLU B 260 
D 4 GLY B 320 ? GLN B 329 ? GLY B 320 GLN B 329 
D 5 PHE B 307 ? SER B 315 ? PHE B 307 SER B 315 
E 1 PRO C 22  ? PRO C 24  ? PRO C 22  PRO C 24  
E 2 LYS C 217 ? PRO C 219 ? LYS C 217 PRO C 219 
F 1 TYR D 148 ? PHE D 149 ? TYR D 148 PHE D 149 
F 2 ALA D 157 ? ILE D 158 ? ALA D 157 ILE D 158 
G 1 ILE E 74  ? LYS E 77  ? ILE E 74  LYS E 77  
G 2 MET E 192 ? VAL E 195 ? MET E 192 VAL E 195 
G 3 TYR E 185 ? PHE E 187 ? TYR E 185 PHE E 187 
H 1 ASN E 86  ? PHE E 89  ? ASN E 86  PHE E 89  
H 2 LEU E 96  ? HIS E 100 ? LEU E 96  HIS E 100 
H 3 TRP E 132 ? ILE E 136 ? TRP E 132 ILE E 136 
I 1 ILE E 147 ? ALA E 148 ? ILE E 147 ALA E 148 
I 2 TYR E 156 ? CYS E 158 ? TYR E 156 CYS E 158 
I 3 SER E 163 ? TYR E 165 ? SER E 163 TYR E 165 
I 4 ILE E 171 ? LYS E 173 ? ILE E 171 LYS E 173 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 17  ? N SER A 17  O VAL A 25  ? O VAL A 25  
A 2 3 N ARG A 24  ? N ARG A 24  O LEU A 197 ? O LEU A 197 
A 3 4 O VAL A 196 ? O VAL A 196 N TRP A 40  ? N TRP A 40  
A 4 5 N VAL A 37  ? N VAL A 37  O ILE A 99  ? O ILE A 99  
A 5 6 O LYS A 100 ? O LYS A 100 N HIS A 85  ? N HIS A 85  
B 1 2 N TYR A 280 ? N TYR A 280 O PHE A 307 ? O PHE A 307 
B 2 3 N ILE A 312 ? N ILE A 312 O LEU A 319 ? O LEU A 319 
B 3 4 O ALA A 322 ? O ALA A 322 N ILE A 255 ? N ILE A 255 
B 4 5 N ALA A 256 ? N ALA A 256 O ALA A 421 ? O ALA A 421 
B 5 6 O GLY A 426 ? O GLY A 426 N GLU A 245 ? N GLU A 245 
B 6 7 N GLN A 240 ? N GLN A 240 O SER G 17  ? O SER G 17  
B 7 8 O ILE G 14  ? O ILE G 14  N ALA D 236 ? N ALA D 236 
C 1 2 N THR B 27  ? N THR B 27  O ILE B 35  ? O ILE B 35  
C 2 3 N VAL B 34  ? N VAL B 34  O LEU B 206 ? O LEU B 206 
C 3 4 O LEU B 209 ? O LEU B 209 N ARG B 46  ? N ARG B 46  
C 4 5 N SER B 45  ? N SER B 45  O CYS B 111 ? O CYS B 111 
C 5 6 O THR B 108 ? O THR B 108 N SER B 97  ? N SER B 97  
C 6 7 N VAL B 98  ? N VAL B 98  O LEU I 15  ? O LEU I 15  
C 7 8 N VAL I 14  ? N VAL I 14  O VAL I 22  ? O VAL I 22  
D 1 2 N GLU B 246 ? N GLU B 246 O ALA B 426 ? O ALA B 426 
D 2 3 O SER B 423 ? O SER B 423 N VAL B 258 ? N VAL B 258 
D 3 4 N VAL B 253 ? N VAL B 253 O SER B 328 ? O SER B 328 
D 4 5 O LEU B 321 ? O LEU B 321 N ALA B 314 ? N ALA B 314 
E 1 2 N ALA C 23  ? N ALA C 23  O ILE C 218 ? O ILE C 218 
F 1 2 N TYR D 148 ? N TYR D 148 O ILE D 158 ? O ILE D 158 
G 1 2 N ILE E 76  ? N ILE E 76  O VAL E 193 ? O VAL E 193 
G 2 3 O ILE E 194 ? O ILE E 194 N GLU E 186 ? N GLU E 186 
H 1 2 N PHE E 89  ? N PHE E 89  O LEU E 96  ? O LEU E 96  
H 2 3 N PHE E 97  ? N PHE E 97  O LEU E 135 ? O LEU E 135 
I 1 2 N ILE E 147 ? N ILE E 147 O TYR E 157 ? O TYR E 157 
I 2 3 N TYR E 156 ? N TYR E 156 O TYR E 165 ? O TYR E 165 
I 3 4 N HIS E 164 ? N HIS E 164 O ARG E 172 ? O ARG E 172 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM C 381' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM C 382' 
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE FDN C 400' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE HEM D 242' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FES E 200' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 GLN C 44  ? GLN C 44   . ? 1_555 ? 
2  AC1 16 ILE C 45  ? ILE C 45   . ? 1_555 ? 
3  AC1 16 GLY C 48  ? GLY C 48   . ? 1_555 ? 
4  AC1 16 LEU C 51  ? LEU C 51   . ? 1_555 ? 
5  AC1 16 ARG C 80  ? ARG C 80   . ? 1_555 ? 
6  AC1 16 HIS C 83  ? HIS C 83   . ? 1_555 ? 
7  AC1 16 ALA C 87  ? ALA C 87   . ? 1_555 ? 
8  AC1 16 PHE C 90  ? PHE C 90   . ? 1_555 ? 
9  AC1 16 THR C 126 ? THR C 126  . ? 1_555 ? 
10 AC1 16 GLY C 130 ? GLY C 130  . ? 1_555 ? 
11 AC1 16 PRO C 134 ? PRO C 134  . ? 1_555 ? 
12 AC1 16 PHE C 179 ? PHE C 179  . ? 1_555 ? 
13 AC1 16 HIS C 182 ? HIS C 182  . ? 1_555 ? 
14 AC1 16 PHE C 183 ? PHE C 183  . ? 1_555 ? 
15 AC1 16 PRO C 186 ? PRO C 186  . ? 1_555 ? 
16 AC1 16 PHE C 187 ? PHE C 187  . ? 1_555 ? 
17 AC2 17 TRP C 31  ? TRP C 31   . ? 1_555 ? 
18 AC2 17 GLY C 34  ? GLY C 34   . ? 1_555 ? 
19 AC2 17 LEU C 37  ? LEU C 37   . ? 1_555 ? 
20 AC2 17 HIS C 97  ? HIS C 97   . ? 1_555 ? 
21 AC2 17 VAL C 98  ? VAL C 98   . ? 1_555 ? 
22 AC2 17 ARG C 100 ? ARG C 100  . ? 1_555 ? 
23 AC2 17 SER C 106 ? SER C 106  . ? 1_555 ? 
24 AC2 17 THR C 112 ? THR C 112  . ? 1_555 ? 
25 AC2 17 TRP C 113 ? TRP C 113  . ? 1_555 ? 
26 AC2 17 GLY C 116 ? GLY C 116  . ? 1_555 ? 
27 AC2 17 VAL C 117 ? VAL C 117  . ? 1_555 ? 
28 AC2 17 LEU C 119 ? LEU C 119  . ? 1_555 ? 
29 AC2 17 HIS C 196 ? HIS C 196  . ? 1_555 ? 
30 AC2 17 LEU C 200 ? LEU C 200  . ? 1_555 ? 
31 AC2 17 SER C 205 ? SER C 205  . ? 1_555 ? 
32 AC2 17 ASN C 206 ? ASN C 206  . ? 1_555 ? 
33 AC2 17 HOH S .   ? HOH C 1012 . ? 1_555 ? 
34 AC3 12 MET C 124 ? MET C 124  . ? 1_555 ? 
35 AC3 12 PHE C 128 ? PHE C 128  . ? 1_555 ? 
36 AC3 12 TYR C 131 ? TYR C 131  . ? 1_555 ? 
37 AC3 12 MET C 138 ? MET C 138  . ? 1_555 ? 
38 AC3 12 GLY C 142 ? GLY C 142  . ? 1_555 ? 
39 AC3 12 ILE C 146 ? ILE C 146  . ? 1_555 ? 
40 AC3 12 LYS C 269 ? LYS C 269  . ? 1_555 ? 
41 AC3 12 PRO C 270 ? PRO C 270  . ? 1_555 ? 
42 AC3 12 GLU C 271 ? GLU C 271  . ? 1_555 ? 
43 AC3 12 TYR C 273 ? TYR C 273  . ? 1_555 ? 
44 AC3 12 PHE C 274 ? PHE C 274  . ? 1_555 ? 
45 AC3 12 TYR C 278 ? TYR C 278  . ? 1_555 ? 
46 AC4 11 VAL D 36  ? VAL D 36   . ? 1_555 ? 
47 AC4 11 CYS D 37  ? CYS D 37   . ? 1_555 ? 
48 AC4 11 CYS D 40  ? CYS D 40   . ? 1_555 ? 
49 AC4 11 HIS D 41  ? HIS D 41   . ? 1_555 ? 
50 AC4 11 ASN D 105 ? ASN D 105  . ? 1_555 ? 
51 AC4 11 PRO D 111 ? PRO D 111  . ? 1_555 ? 
52 AC4 11 ARG D 120 ? ARG D 120  . ? 1_555 ? 
53 AC4 11 TYR D 126 ? TYR D 126  . ? 1_555 ? 
54 AC4 11 PHE D 153 ? PHE D 153  . ? 1_555 ? 
55 AC4 11 GLY D 159 ? GLY D 159  . ? 1_555 ? 
56 AC4 11 MET D 160 ? MET D 160  . ? 1_555 ? 
57 AC5 6  CYS E 139 ? CYS E 139  . ? 1_555 ? 
58 AC5 6  HIS E 141 ? HIS E 141  . ? 1_555 ? 
59 AC5 6  LEU E 142 ? LEU E 142  . ? 1_555 ? 
60 AC5 6  CYS E 158 ? CYS E 158  . ? 1_555 ? 
61 AC5 6  HIS E 161 ? HIS E 161  . ? 1_555 ? 
62 AC5 6  SER E 163 ? SER E 163  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FYU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FYU 
_atom_sites.fract_transf_matrix[1][1]   0.006482 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006482 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001694 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . THR A 1  1   ? 50.937  125.978 95.171  1.00 32.12 ? 1    THR A N   1 
ATOM   2     C  CA  . THR A 1  1   ? 50.846  124.473 95.164  1.00 32.32 ? 1    THR A CA  1 
ATOM   3     C  C   . THR A 1  1   ? 50.008  123.971 96.354  1.00 31.63 ? 1    THR A C   1 
ATOM   4     O  O   . THR A 1  1   ? 50.200  124.425 97.498  1.00 31.84 ? 1    THR A O   1 
ATOM   5     C  CB  . THR A 1  1   ? 52.275  123.803 95.149  1.00 32.71 ? 1    THR A CB  1 
ATOM   6     O  OG1 . THR A 1  1   ? 53.165  124.543 94.294  1.00 36.30 ? 1    THR A OG1 1 
ATOM   7     C  CG2 . THR A 1  1   ? 52.235  122.420 94.481  1.00 33.86 ? 1    THR A CG2 1 
ATOM   8     N  N   . ALA A 1  2   ? 49.106  123.023 96.059  1.00 30.71 ? 2    ALA A N   1 
ATOM   9     C  CA  . ALA A 1  2   ? 48.067  122.514 96.986  1.00 29.69 ? 2    ALA A CA  1 
ATOM   10    C  C   . ALA A 1  2   ? 48.630  121.823 98.238  1.00 29.02 ? 2    ALA A C   1 
ATOM   11    O  O   . ALA A 1  2   ? 49.791  121.394 98.239  1.00 29.44 ? 2    ALA A O   1 
ATOM   12    C  CB  . ALA A 1  2   ? 47.118  121.582 96.243  1.00 29.35 ? 2    ALA A CB  1 
ATOM   13    N  N   . THR A 1  3   ? 47.888  121.938 99.348  1.00 27.87 ? 3    THR A N   1 
ATOM   14    C  CA  . THR A 1  3   ? 48.130  121.145 100.575 1.00 26.71 ? 3    THR A CA  1 
ATOM   15    C  C   . THR A 1  3   ? 47.575  119.719 100.435 1.00 25.47 ? 3    THR A C   1 
ATOM   16    O  O   . THR A 1  3   ? 46.803  119.436 99.504  1.00 25.14 ? 3    THR A O   1 
ATOM   17    C  CB  . THR A 1  3   ? 47.534  121.839 101.839 1.00 26.91 ? 3    THR A CB  1 
ATOM   18    O  OG1 . THR A 1  3   ? 46.152  122.142 101.619 1.00 35.80 ? 3    THR A OG1 1 
ATOM   19    C  CG2 . THR A 1  3   ? 48.198  123.225 102.113 1.00 27.52 ? 3    THR A CG2 1 
ATOM   20    N  N   . TYR A 1  4   ? 48.071  118.810 101.289 1.00 24.85 ? 4    TYR A N   1 
ATOM   21    C  CA  . TYR A 1  4   ? 47.455  117.485 101.547 1.00 24.27 ? 4    TYR A CA  1 
ATOM   22    C  C   . TYR A 1  4   ? 45.944  117.540 101.857 1.00 24.59 ? 4    TYR A C   1 
ATOM   23    O  O   . TYR A 1  4   ? 45.174  116.770 101.271 1.00 24.87 ? 4    TYR A O   1 
ATOM   24    C  CB  . TYR A 1  4   ? 48.241  116.719 102.631 1.00 23.57 ? 4    TYR A CB  1 
ATOM   25    C  CG  . TYR A 1  4   ? 47.553  115.500 103.220 1.00 20.82 ? 4    TYR A CG  1 
ATOM   26    C  CD1 . TYR A 1  4   ? 47.475  114.276 102.491 1.00 10.42 ? 4    TYR A CD1 1 
ATOM   27    C  CD2 . TYR A 1  4   ? 47.027  115.533 104.539 1.00 21.48 ? 4    TYR A CD2 1 
ATOM   28    C  CE1 . TYR A 1  4   ? 46.838  113.127 103.046 1.00 19.56 ? 4    TYR A CE1 1 
ATOM   29    C  CE2 . TYR A 1  4   ? 46.381  114.371 105.111 1.00 15.36 ? 4    TYR A CE2 1 
ATOM   30    C  CZ  . TYR A 1  4   ? 46.327  113.175 104.369 1.00 17.77 ? 4    TYR A CZ  1 
ATOM   31    O  OH  . TYR A 1  4   ? 45.667  112.069 104.877 1.00 14.61 ? 4    TYR A OH  1 
ATOM   32    N  N   . ALA A 1  5   ? 45.551  118.488 102.725 1.00 24.81 ? 5    ALA A N   1 
ATOM   33    C  CA  . ALA A 1  5   ? 44.160  118.729 103.136 1.00 24.65 ? 5    ALA A CA  1 
ATOM   34    C  C   . ALA A 1  5   ? 43.237  119.115 101.973 1.00 24.58 ? 5    ALA A C   1 
ATOM   35    O  O   . ALA A 1  5   ? 42.176  118.506 101.813 1.00 24.67 ? 5    ALA A O   1 
ATOM   36    C  CB  . ALA A 1  5   ? 44.105  119.772 104.254 1.00 24.53 ? 5    ALA A CB  1 
ATOM   37    N  N   . GLN A 1  6   ? 43.707  120.043 101.124 1.00 24.52 ? 6    GLN A N   1 
ATOM   38    C  CA  . GLN A 1  6   ? 43.038  120.451 99.870  1.00 24.48 ? 6    GLN A CA  1 
ATOM   39    C  C   . GLN A 1  6   ? 42.885  119.304 98.866  1.00 24.63 ? 6    GLN A C   1 
ATOM   40    O  O   . GLN A 1  6   ? 41.808  119.144 98.271  1.00 25.02 ? 6    GLN A O   1 
ATOM   41    C  CB  . GLN A 1  6   ? 43.768  121.633 99.213  1.00 24.22 ? 6    GLN A CB  1 
ATOM   42    C  CG  . GLN A 1  6   ? 43.410  122.997 99.786  1.00 27.61 ? 6    GLN A CG  1 
ATOM   43    C  CD  . GLN A 1  6   ? 44.357  124.095 99.318  1.00 30.65 ? 6    GLN A CD  1 
ATOM   44    O  OE1 . GLN A 1  6   ? 45.452  124.246 99.859  1.00 32.85 ? 6    GLN A OE1 1 
ATOM   45    N  NE2 . GLN A 1  6   ? 43.932  124.864 98.321  1.00 27.00 ? 6    GLN A NE2 1 
ATOM   46    N  N   . ALA A 1  7   ? 43.930  118.463 98.777  1.00 24.20 ? 7    ALA A N   1 
ATOM   47    C  CA  . ALA A 1  7   ? 44.016  117.344 97.835  1.00 23.69 ? 7    ALA A CA  1 
ATOM   48    C  C   . ALA A 1  7   ? 42.991  116.253 98.109  1.00 23.75 ? 7    ALA A C   1 
ATOM   49    O  O   . ALA A 1  7   ? 42.427  115.683 97.156  1.00 23.92 ? 7    ALA A O   1 
ATOM   50    C  CB  . ALA A 1  7   ? 45.406  116.776 97.827  1.00 23.54 ? 7    ALA A CB  1 
ATOM   51    N  N   . LEU A 1  8   ? 42.684  116.050 99.399  1.00 23.67 ? 8    LEU A N   1 
ATOM   52    C  CA  . LEU A 1  8   ? 41.657  115.107 99.857  1.00 23.85 ? 8    LEU A CA  1 
ATOM   53    C  C   . LEU A 1  8   ? 40.241  115.531 99.522  1.00 24.31 ? 8    LEU A C   1 
ATOM   54    O  O   . LEU A 1  8   ? 39.408  114.677 99.196  1.00 24.60 ? 8    LEU A O   1 
ATOM   55    C  CB  . LEU A 1  8   ? 41.788  114.810 101.354 1.00 23.63 ? 8    LEU A CB  1 
ATOM   56    C  CG  . LEU A 1  8   ? 43.058  114.140 101.886 1.00 17.45 ? 8    LEU A CG  1 
ATOM   57    C  CD1 . LEU A 1  8   ? 43.088  114.335 103.347 1.00 19.47 ? 8    LEU A CD1 1 
ATOM   58    C  CD2 . LEU A 1  8   ? 43.188  112.652 101.540 1.00 15.89 ? 8    LEU A CD2 1 
ATOM   59    N  N   . GLN A 1  9   ? 39.983  116.841 99.630  1.00 24.75 ? 9    GLN A N   1 
ATOM   60    C  CA  . GLN A 1  9   ? 38.736  117.476 99.192  1.00 25.34 ? 9    GLN A CA  1 
ATOM   61    C  C   . GLN A 1  9   ? 38.510  117.412 97.679  1.00 25.99 ? 9    GLN A C   1 
ATOM   62    O  O   . GLN A 1  9   ? 37.365  117.215 97.236  1.00 26.36 ? 9    GLN A O   1 
ATOM   63    C  CB  . GLN A 1  9   ? 38.668  118.919 99.693  1.00 25.20 ? 9    GLN A CB  1 
ATOM   64    C  CG  . GLN A 1  9   ? 37.387  119.264 100.452 1.00 30.30 ? 9    GLN A CG  1 
ATOM   65    C  CD  . GLN A 1  9   ? 37.332  118.671 101.865 1.00 28.34 ? 9    GLN A CD  1 
ATOM   66    O  OE1 . GLN A 1  9   ? 36.589  117.721 102.109 1.00 23.03 ? 9    GLN A OE1 1 
ATOM   67    N  NE2 . GLN A 1  9   ? 38.022  119.308 102.809 1.00 30.27 ? 9    GLN A NE2 1 
ATOM   68    N  N   . SER A 1  10  ? 39.609  117.502 96.913  1.00 26.01 ? 10   SER A N   1 
ATOM   69    C  CA  . SER A 1  10  ? 39.593  117.438 95.445  1.00 26.11 ? 10   SER A CA  1 
ATOM   70    C  C   . SER A 1  10  ? 39.334  116.033 94.835  1.00 26.02 ? 10   SER A C   1 
ATOM   71    O  O   . SER A 1  10  ? 39.054  115.928 93.625  1.00 26.12 ? 10   SER A O   1 
ATOM   72    C  CB  . SER A 1  10  ? 40.837  118.138 94.855  1.00 26.17 ? 10   SER A CB  1 
ATOM   73    O  OG  . SER A 1  10  ? 41.769  117.225 94.293  1.00 32.79 ? 10   SER A OG  1 
ATOM   74    N  N   . VAL A 1  11  ? 39.479  114.978 95.660  1.00 25.74 ? 11   VAL A N   1 
ATOM   75    C  CA  . VAL A 1  11  ? 39.061  113.591 95.326  1.00 25.44 ? 11   VAL A CA  1 
ATOM   76    C  C   . VAL A 1  11  ? 37.516  113.553 95.148  1.00 25.12 ? 11   VAL A C   1 
ATOM   77    O  O   . VAL A 1  11  ? 36.805  113.901 96.107  1.00 25.46 ? 11   VAL A O   1 
ATOM   78    C  CB  . VAL A 1  11  ? 39.549  112.524 96.418  1.00 25.54 ? 11   VAL A CB  1 
ATOM   79    C  CG1 . VAL A 1  11  ? 38.947  111.103 96.165  1.00 19.38 ? 11   VAL A CG1 1 
ATOM   80    C  CG2 . VAL A 1  11  ? 41.082  112.441 96.473  1.00 22.39 ? 11   VAL A CG2 1 
ATOM   81    N  N   . PRO A 1  12  ? 37.012  113.153 93.951  1.00 24.59 ? 12   PRO A N   1 
ATOM   82    C  CA  . PRO A 1  12  ? 35.576  113.313 93.615  1.00 24.10 ? 12   PRO A CA  1 
ATOM   83    C  C   . PRO A 1  12  ? 34.653  112.341 94.362  1.00 23.45 ? 12   PRO A C   1 
ATOM   84    O  O   . PRO A 1  12  ? 35.094  111.246 94.738  1.00 23.40 ? 12   PRO A O   1 
ATOM   85    C  CB  . PRO A 1  12  ? 35.527  113.033 92.105  1.00 24.01 ? 12   PRO A CB  1 
ATOM   86    C  CG  . PRO A 1  12  ? 36.961  112.902 91.675  1.00 28.00 ? 12   PRO A CG  1 
ATOM   87    C  CD  . PRO A 1  12  ? 37.718  112.435 92.864  1.00 24.41 ? 12   PRO A CD  1 
ATOM   88    N  N   . GLU A 1  13  ? 33.423  112.798 94.634  1.00 22.82 ? 13   GLU A N   1 
ATOM   89    C  CA  . GLU A 1  13  ? 32.392  112.049 95.372  1.00 22.18 ? 13   GLU A CA  1 
ATOM   90    C  C   . GLU A 1  13  ? 31.984  110.756 94.655  1.00 21.27 ? 13   GLU A C   1 
ATOM   91    O  O   . GLU A 1  13  ? 31.786  110.753 93.432  1.00 21.33 ? 13   GLU A O   1 
ATOM   92    C  CB  . GLU A 1  13  ? 31.164  112.943 95.592  1.00 22.51 ? 13   GLU A CB  1 
ATOM   93    C  CG  . GLU A 1  13  ? 30.278  112.556 96.774  1.00 29.09 ? 13   GLU A CG  1 
ATOM   94    C  CD  . GLU A 1  13  ? 29.188  113.584 97.049  1.00 37.40 ? 13   GLU A CD  1 
ATOM   95    O  OE1 . GLU A 1  13  ? 28.233  113.698 96.238  1.00 36.54 ? 13   GLU A OE1 1 
ATOM   96    O  OE2 . GLU A 1  13  ? 29.294  114.290 98.074  1.00 40.03 ? 13   GLU A OE2 1 
ATOM   97    N  N   . THR A 1  14  ? 31.942  109.658 95.419  1.00 20.52 ? 14   THR A N   1 
ATOM   98    C  CA  . THR A 1  14  ? 31.305  108.408 94.993  1.00 19.72 ? 14   THR A CA  1 
ATOM   99    C  C   . THR A 1  14  ? 29.790  108.605 94.867  1.00 18.97 ? 14   THR A C   1 
ATOM   100   O  O   . THR A 1  14  ? 29.133  109.071 95.808  1.00 18.57 ? 14   THR A O   1 
ATOM   101   C  CB  . THR A 1  14  ? 31.694  107.213 95.928  1.00 19.60 ? 14   THR A CB  1 
ATOM   102   O  OG1 . THR A 1  14  ? 33.114  107.014 95.883  1.00 24.85 ? 14   THR A OG1 1 
ATOM   103   C  CG2 . THR A 1  14  ? 31.169  105.872 95.386  1.00 21.26 ? 14   THR A CG2 1 
ATOM   104   N  N   . GLN A 1  15  ? 29.330  108.480 93.624  1.00 18.86 ? 15   GLN A N   1 
ATOM   105   C  CA  . GLN A 1  15  ? 27.905  108.461 93.275  1.00 19.26 ? 15   GLN A CA  1 
ATOM   106   C  C   . GLN A 1  15  ? 27.314  107.069 93.521  1.00 18.94 ? 15   GLN A C   1 
ATOM   107   O  O   . GLN A 1  15  ? 27.997  106.063 93.309  1.00 18.42 ? 15   GLN A O   1 
ATOM   108   C  CB  . GLN A 1  15  ? 27.682  108.903 91.815  1.00 19.60 ? 15   GLN A CB  1 
ATOM   109   C  CG  . GLN A 1  15  ? 28.305  110.259 91.410  1.00 27.01 ? 15   GLN A CG  1 
ATOM   110   C  CD  . GLN A 1  15  ? 27.447  111.446 91.800  1.00 37.17 ? 15   GLN A CD  1 
ATOM   111   O  OE1 . GLN A 1  15  ? 26.661  111.941 90.989  1.00 43.23 ? 15   GLN A OE1 1 
ATOM   112   N  NE2 . GLN A 1  15  ? 27.651  111.956 93.012  1.00 37.95 ? 15   GLN A NE2 1 
ATOM   113   N  N   . VAL A 1  16  ? 26.160  107.050 94.200  1.00 18.92 ? 16   VAL A N   1 
ATOM   114   C  CA  . VAL A 1  16  ? 25.398  105.818 94.508  1.00 18.73 ? 16   VAL A CA  1 
ATOM   115   C  C   . VAL A 1  16  ? 23.945  105.989 94.029  1.00 18.97 ? 16   VAL A C   1 
ATOM   116   O  O   . VAL A 1  16  ? 23.310  107.030 94.286  1.00 18.60 ? 16   VAL A O   1 
ATOM   117   C  CB  . VAL A 1  16  ? 25.418  105.421 96.062  1.00 18.45 ? 16   VAL A CB  1 
ATOM   118   C  CG1 . VAL A 1  16  ? 24.870  104.006 96.283  1.00 10.48 ? 16   VAL A CG1 1 
ATOM   119   C  CG2 . VAL A 1  16  ? 26.825  105.520 96.690  1.00 18.51 ? 16   VAL A CG2 1 
ATOM   120   N  N   . SER A 1  17  ? 23.497  105.011 93.238  1.00 19.48 ? 17   SER A N   1 
ATOM   121   C  CA  . SER A 1  17  ? 22.077  104.741 92.991  1.00 20.14 ? 17   SER A CA  1 
ATOM   122   C  C   . SER A 1  17  ? 21.632  103.330 93.430  1.00 20.29 ? 17   SER A C   1 
ATOM   123   O  O   . SER A 1  17  ? 22.480  102.448 93.658  1.00 20.08 ? 17   SER A O   1 
ATOM   124   C  CB  . SER A 1  17  ? 21.749  104.991 91.518  1.00 20.45 ? 17   SER A CB  1 
ATOM   125   O  OG  . SER A 1  17  ? 21.935  106.361 91.175  1.00 25.38 ? 17   SER A OG  1 
ATOM   126   N  N   . GLN A 1  18  ? 20.332  103.202 93.734  1.00 20.70 ? 18   GLN A N   1 
ATOM   127   C  CA  . GLN A 1  18  ? 19.653  101.907 93.935  1.00 21.14 ? 18   GLN A CA  1 
ATOM   128   C  C   . GLN A 1  18  ? 18.636  101.631 92.833  1.00 21.54 ? 18   GLN A C   1 
ATOM   129   O  O   . GLN A 1  18  ? 17.885  102.529 92.428  1.00 21.65 ? 18   GLN A O   1 
ATOM   130   C  CB  . GLN A 1  18  ? 18.977  101.840 95.314  1.00 21.22 ? 18   GLN A CB  1 
ATOM   131   C  CG  . GLN A 1  18  ? 18.916  100.428 95.922  1.00 22.11 ? 18   GLN A CG  1 
ATOM   132   C  CD  . GLN A 1  18  ? 18.612  100.429 97.418  1.00 23.11 ? 18   GLN A CD  1 
ATOM   133   O  OE1 . GLN A 1  18  ? 19.491  100.709 98.235  1.00 26.77 ? 18   GLN A OE1 1 
ATOM   134   N  NE2 . GLN A 1  18  ? 17.394  100.042 97.778  1.00 25.52 ? 18   GLN A NE2 1 
ATOM   135   N  N   . LEU A 1  19  ? 18.728  100.423 92.271  1.00 21.96 ? 19   LEU A N   1 
ATOM   136   C  CA  . LEU A 1  19  ? 17.694  99.833  91.399  1.00 22.12 ? 19   LEU A CA  1 
ATOM   137   C  C   . LEU A 1  19  ? 16.472  99.370  92.200  1.00 22.03 ? 19   LEU A C   1 
ATOM   138   O  O   . LEU A 1  19  ? 16.550  99.225  93.434  1.00 21.90 ? 19   LEU A O   1 
ATOM   139   C  CB  . LEU A 1  19  ? 18.299  98.664  90.585  1.00 22.31 ? 19   LEU A CB  1 
ATOM   140   C  CG  . LEU A 1  19  ? 18.358  98.662  89.043  1.00 23.92 ? 19   LEU A CG  1 
ATOM   141   C  CD1 . LEU A 1  19  ? 19.274  99.744  88.432  1.00 14.19 ? 19   LEU A CD1 1 
ATOM   142   C  CD2 . LEU A 1  19  ? 18.767  97.283  88.547  1.00 21.44 ? 19   LEU A CD2 1 
ATOM   143   N  N   . ASP A 1  20  ? 15.334  99.235  91.498  1.00 22.20 ? 20   ASP A N   1 
ATOM   144   C  CA  . ASP A 1  20  ? 14.077  98.665  92.044  1.00 22.21 ? 20   ASP A CA  1 
ATOM   145   C  C   . ASP A 1  20  ? 14.214  97.215  92.550  1.00 21.97 ? 20   ASP A C   1 
ATOM   146   O  O   . ASP A 1  20  ? 13.497  96.811  93.469  1.00 21.98 ? 20   ASP A O   1 
ATOM   147   C  CB  . ASP A 1  20  ? 12.937  98.782  91.025  1.00 22.50 ? 20   ASP A CB  1 
ATOM   148   C  CG  . ASP A 1  20  ? 12.634  100.224 90.644  1.00 28.89 ? 20   ASP A CG  1 
ATOM   149   O  OD1 . ASP A 1  20  ? 11.839  100.875 91.357  1.00 33.64 ? 20   ASP A OD1 1 
ATOM   150   O  OD2 . ASP A 1  20  ? 13.167  100.797 89.667  1.00 30.12 ? 20   ASP A OD2 1 
ATOM   151   N  N   . ASN A 1  21  ? 15.016  96.418  91.829  1.00 21.88 ? 21   ASN A N   1 
ATOM   152   C  CA  . ASN A 1  21  ? 15.832  95.291  92.345  1.00 21.87 ? 21   ASN A CA  1 
ATOM   153   C  C   . ASN A 1  21  ? 16.186  95.215  93.846  1.00 21.57 ? 21   ASN A C   1 
ATOM   154   O  O   . ASN A 1  21  ? 16.004  94.162  94.472  1.00 21.29 ? 21   ASN A O   1 
ATOM   155   C  CB  . ASN A 1  21  ? 17.126  95.179  91.517  1.00 22.02 ? 21   ASN A CB  1 
ATOM   156   C  CG  . ASN A 1  21  ? 16.983  94.255  90.334  1.00 30.32 ? 21   ASN A CG  1 
ATOM   157   O  OD1 . ASN A 1  21  ? 17.413  93.109  90.380  1.00 35.21 ? 21   ASN A OD1 1 
ATOM   158   N  ND2 . ASN A 1  21  ? 16.387  94.756  89.253  1.00 37.94 ? 21   ASN A ND2 1 
ATOM   159   N  N   . GLY A 1  22  ? 16.688  96.327  94.397  1.00 21.65 ? 22   GLY A N   1 
ATOM   160   C  CA  . GLY A 1  22  ? 17.579  96.318  95.555  1.00 21.77 ? 22   GLY A CA  1 
ATOM   161   C  C   . GLY A 1  22  ? 19.075  96.367  95.243  1.00 21.63 ? 22   GLY A C   1 
ATOM   162   O  O   . GLY A 1  22  ? 19.872  96.594  96.162  1.00 22.15 ? 22   GLY A O   1 
ATOM   163   N  N   . LEU A 1  23  ? 19.439  96.152  93.967  1.00 20.97 ? 23   LEU A N   1 
ATOM   164   C  CA  . LEU A 1  23  ? 20.825  96.206  93.468  1.00 20.68 ? 23   LEU A CA  1 
ATOM   165   C  C   . LEU A 1  23  ? 21.357  97.644  93.482  1.00 20.25 ? 23   LEU A C   1 
ATOM   166   O  O   . LEU A 1  23  ? 20.719  98.556  92.913  1.00 20.54 ? 23   LEU A O   1 
ATOM   167   C  CB  . LEU A 1  23  ? 20.909  95.562  92.059  1.00 20.62 ? 23   LEU A CB  1 
ATOM   168   C  CG  . LEU A 1  23  ? 22.151  95.285  91.176  1.00 18.03 ? 23   LEU A CG  1 
ATOM   169   C  CD1 . LEU A 1  23  ? 22.474  96.420  90.230  1.00 21.62 ? 23   LEU A CD1 1 
ATOM   170   C  CD2 . LEU A 1  23  ? 23.413  94.743  91.857  1.00 20.27 ? 23   LEU A CD2 1 
ATOM   171   N  N   . ARG A 1  24  ? 22.351  97.865  94.349  1.00 19.22 ? 24   ARG A N   1 
ATOM   172   C  CA  . ARG A 1  24  ? 23.088  99.131  94.415  1.00 18.45 ? 24   ARG A CA  1 
ATOM   173   C  C   . ARG A 1  24  ? 24.108  99.245  93.297  1.00 18.02 ? 24   ARG A C   1 
ATOM   174   O  O   . ARG A 1  24  ? 24.748  98.253  92.917  1.00 17.71 ? 24   ARG A O   1 
ATOM   175   C  CB  . ARG A 1  24  ? 23.742  99.340  95.779  1.00 18.05 ? 24   ARG A CB  1 
ATOM   176   C  CG  . ARG A 1  24  ? 22.762  99.804  96.851  1.00 16.61 ? 24   ARG A CG  1 
ATOM   177   C  CD  . ARG A 1  24  ? 23.181  99.506  98.283  1.00 16.03 ? 24   ARG A CD  1 
ATOM   178   N  NE  . ARG A 1  24  ? 23.219  98.066  98.579  1.00 9.70  ? 24   ARG A NE  1 
ATOM   179   C  CZ  . ARG A 1  24  ? 23.858  97.496  99.608  1.00 17.37 ? 24   ARG A CZ  1 
ATOM   180   N  NH1 . ARG A 1  24  ? 24.475  98.225  100.544 1.00 21.66 ? 24   ARG A NH1 1 
ATOM   181   N  NH2 . ARG A 1  24  ? 23.824  96.175  99.735  1.00 18.99 ? 24   ARG A NH2 1 
ATOM   182   N  N   . VAL A 1  25  ? 24.120  100.428 92.684  1.00 17.88 ? 25   VAL A N   1 
ATOM   183   C  CA  . VAL A 1  25  ? 24.947  100.748 91.516  1.00 17.84 ? 25   VAL A CA  1 
ATOM   184   C  C   . VAL A 1  25  ? 25.739  102.036 91.792  1.00 17.64 ? 25   VAL A C   1 
ATOM   185   O  O   . VAL A 1  25  ? 25.146  103.106 92.017  1.00 17.51 ? 25   VAL A O   1 
ATOM   186   C  CB  . VAL A 1  25  ? 24.110  100.744 90.146  1.00 17.81 ? 25   VAL A CB  1 
ATOM   187   C  CG1 . VAL A 1  25  ? 22.778  101.511 90.248  1.00 24.28 ? 25   VAL A CG1 1 
ATOM   188   C  CG2 . VAL A 1  25  ? 24.934  101.242 88.947  1.00 17.93 ? 25   VAL A CG2 1 
ATOM   189   N  N   . ALA A 1  26  ? 27.066  101.885 91.889  1.00 17.38 ? 26   ALA A N   1 
ATOM   190   C  CA  . ALA A 1  26  ? 27.948  102.928 92.440  1.00 17.22 ? 26   ALA A CA  1 
ATOM   191   C  C   . ALA A 1  26  ? 29.277  103.134 91.710  1.00 17.13 ? 26   ALA A C   1 
ATOM   192   O  O   . ALA A 1  26  ? 29.886  102.168 91.234  1.00 16.86 ? 26   ALA A O   1 
ATOM   193   C  CB  . ALA A 1  26  ? 28.158  102.725 93.936  1.00 17.18 ? 26   ALA A CB  1 
ATOM   194   N  N   . SER A 1  27  ? 29.695  104.408 91.611  1.00 17.42 ? 27   SER A N   1 
ATOM   195   C  CA  . SER A 1  27  ? 30.825  104.839 90.758  1.00 17.46 ? 27   SER A CA  1 
ATOM   196   C  C   . SER A 1  27  ? 31.648  106.022 91.276  1.00 17.72 ? 27   SER A C   1 
ATOM   197   O  O   . SER A 1  27  ? 31.115  106.910 91.949  1.00 17.27 ? 27   SER A O   1 
ATOM   198   C  CB  . SER A 1  27  ? 30.376  105.092 89.310  1.00 17.20 ? 27   SER A CB  1 
ATOM   199   O  OG  . SER A 1  27  ? 29.525  106.218 89.231  1.00 15.16 ? 27   SER A OG  1 
ATOM   200   N  N   . GLU A 1  28  ? 32.961  105.963 91.005  1.00 18.49 ? 28   GLU A N   1 
ATOM   201   C  CA  . GLU A 1  28  ? 33.872  107.105 91.081  1.00 18.84 ? 28   GLU A CA  1 
ATOM   202   C  C   . GLU A 1  28  ? 34.455  107.454 89.700  1.00 19.39 ? 28   GLU A C   1 
ATOM   203   O  O   . GLU A 1  28  ? 35.318  106.733 89.170  1.00 19.82 ? 28   GLU A O   1 
ATOM   204   C  CB  . GLU A 1  28  ? 34.974  106.849 92.123  1.00 18.91 ? 28   GLU A CB  1 
ATOM   205   C  CG  . GLU A 1  28  ? 35.693  108.113 92.600  1.00 14.94 ? 28   GLU A CG  1 
ATOM   206   C  CD  . GLU A 1  28  ? 37.062  107.822 93.159  1.00 18.99 ? 28   GLU A CD  1 
ATOM   207   O  OE1 . GLU A 1  28  ? 38.065  108.083 92.453  1.00 26.22 ? 28   GLU A OE1 1 
ATOM   208   O  OE2 . GLU A 1  28  ? 37.139  107.352 94.314  1.00 9.25  ? 28   GLU A OE2 1 
ATOM   209   N  N   . GLN A 1  29  ? 33.960  108.562 89.142  1.00 19.85 ? 29   GLN A N   1 
ATOM   210   C  CA  . GLN A 1  29  ? 34.388  109.117 87.849  1.00 20.63 ? 29   GLN A CA  1 
ATOM   211   C  C   . GLN A 1  29  ? 35.802  109.725 87.963  1.00 21.11 ? 29   GLN A C   1 
ATOM   212   O  O   . GLN A 1  29  ? 36.087  110.493 88.902  1.00 20.63 ? 29   GLN A O   1 
ATOM   213   C  CB  . GLN A 1  29  ? 33.340  110.153 87.356  1.00 21.07 ? 29   GLN A CB  1 
ATOM   214   C  CG  . GLN A 1  29  ? 33.748  111.049 86.147  1.00 28.10 ? 29   GLN A CG  1 
ATOM   215   C  CD  . GLN A 1  29  ? 32.580  111.503 85.268  1.00 29.53 ? 29   GLN A CD  1 
ATOM   216   O  OE1 . GLN A 1  29  ? 31.578  112.033 85.759  1.00 31.82 ? 29   GLN A OE1 1 
ATOM   217   N  NE2 . GLN A 1  29  ? 32.752  111.369 83.957  1.00 30.38 ? 29   GLN A NE2 1 
ATOM   218   N  N   . SER A 1  30  ? 36.685  109.288 87.052  1.00 21.87 ? 30   SER A N   1 
ATOM   219   C  CA  . SER A 1  30  ? 37.993  109.921 86.780  1.00 22.27 ? 30   SER A CA  1 
ATOM   220   C  C   . SER A 1  30  ? 38.238  110.157 85.266  1.00 22.87 ? 30   SER A C   1 
ATOM   221   O  O   . SER A 1  30  ? 37.339  109.914 84.446  1.00 22.85 ? 30   SER A O   1 
ATOM   222   C  CB  . SER A 1  30  ? 39.121  109.108 87.429  1.00 22.19 ? 30   SER A CB  1 
ATOM   223   O  OG  . SER A 1  30  ? 39.437  107.957 86.660  1.00 27.63 ? 30   SER A OG  1 
ATOM   224   N  N   . SER A 1  31  ? 39.425  110.696 84.934  1.00 23.53 ? 31   SER A N   1 
ATOM   225   C  CA  . SER A 1  31  ? 39.850  111.022 83.551  1.00 23.84 ? 31   SER A CA  1 
ATOM   226   C  C   . SER A 1  31  ? 40.288  109.822 82.685  1.00 23.69 ? 31   SER A C   1 
ATOM   227   O  O   . SER A 1  31  ? 40.197  109.892 81.450  1.00 23.99 ? 31   SER A O   1 
ATOM   228   C  CB  . SER A 1  31  ? 40.953  112.087 83.565  1.00 23.97 ? 31   SER A CB  1 
ATOM   229   O  OG  . SER A 1  31  ? 40.567  113.219 84.331  1.00 33.09 ? 31   SER A OG  1 
ATOM   230   N  N   . GLN A 1  32  ? 40.576  108.693 83.347  1.00 23.22 ? 32   GLN A N   1 
ATOM   231   C  CA  . GLN A 1  32  ? 41.298  107.535 82.792  1.00 22.73 ? 32   GLN A CA  1 
ATOM   232   C  C   . GLN A 1  32  ? 40.676  106.942 81.488  1.00 21.77 ? 32   GLN A C   1 
ATOM   233   O  O   . GLN A 1  32  ? 39.452  106.845 81.416  1.00 21.99 ? 32   GLN A O   1 
ATOM   234   C  CB  . GLN A 1  32  ? 41.379  106.454 83.864  1.00 23.13 ? 32   GLN A CB  1 
ATOM   235   C  CG  . GLN A 1  32  ? 42.786  105.927 84.137  1.00 36.14 ? 32   GLN A CG  1 
ATOM   236   C  CD  . GLN A 1  32  ? 43.571  106.785 85.109  1.00 36.51 ? 32   GLN A CD  1 
ATOM   237   O  OE1 . GLN A 1  32  ? 44.609  107.337 84.742  1.00 43.46 ? 32   GLN A OE1 1 
ATOM   238   N  NE2 . GLN A 1  32  ? 43.146  106.806 86.372  1.00 37.42 ? 32   GLN A NE2 1 
ATOM   239   N  N   . PRO A 1  33  ? 41.490  106.562 80.471  1.00 20.56 ? 33   PRO A N   1 
ATOM   240   C  CA  . PRO A 1  33  ? 40.975  105.771 79.326  1.00 19.47 ? 33   PRO A CA  1 
ATOM   241   C  C   . PRO A 1  33  ? 40.500  104.338 79.678  1.00 18.84 ? 33   PRO A C   1 
ATOM   242   O  O   . PRO A 1  33  ? 39.870  103.700 78.828  1.00 18.91 ? 33   PRO A O   1 
ATOM   243   C  CB  . PRO A 1  33  ? 42.163  105.724 78.356  1.00 19.10 ? 33   PRO A CB  1 
ATOM   244   C  CG  . PRO A 1  33  ? 43.353  105.960 79.202  1.00 21.65 ? 33   PRO A CG  1 
ATOM   245   C  CD  . PRO A 1  33  ? 42.913  106.919 80.266  1.00 20.53 ? 33   PRO A CD  1 
ATOM   246   N  N   . THR A 1  34  ? 40.841  103.853 80.878  1.00 18.38 ? 34   THR A N   1 
ATOM   247   C  CA  . THR A 1  34  ? 40.521  102.500 81.357  1.00 18.32 ? 34   THR A CA  1 
ATOM   248   C  C   . THR A 1  34  ? 39.596  102.532 82.579  1.00 18.57 ? 34   THR A C   1 
ATOM   249   O  O   . THR A 1  34  ? 39.450  103.576 83.251  1.00 19.57 ? 34   THR A O   1 
ATOM   250   C  CB  . THR A 1  34  ? 41.818  101.699 81.688  1.00 18.51 ? 34   THR A CB  1 
ATOM   251   O  OG1 . THR A 1  34  ? 42.592  102.407 82.660  1.00 22.16 ? 34   THR A OG1 1 
ATOM   252   C  CG2 . THR A 1  34  ? 42.759  101.599 80.475  1.00 8.86  ? 34   THR A CG2 1 
ATOM   253   N  N   . CYS A 1  35  ? 38.948  101.394 82.832  1.00 17.66 ? 35   CYS A N   1 
ATOM   254   C  CA  . CYS A 1  35  ? 38.073  101.204 83.982  1.00 16.95 ? 35   CYS A CA  1 
ATOM   255   C  C   . CYS A 1  35  ? 38.240  99.825  84.624  1.00 15.72 ? 35   CYS A C   1 
ATOM   256   O  O   . CYS A 1  35  ? 38.942  98.956  84.079  1.00 15.38 ? 35   CYS A O   1 
ATOM   257   C  CB  . CYS A 1  35  ? 36.618  101.452 83.580  1.00 17.50 ? 35   CYS A CB  1 
ATOM   258   S  SG  . CYS A 1  35  ? 35.983  100.163 82.514  1.00 26.14 ? 35   CYS A SG  1 
ATOM   259   N  N   . THR A 1  36  ? 37.819  99.754  85.887  1.00 15.02 ? 36   THR A N   1 
ATOM   260   C  CA  . THR A 1  36  ? 37.409  98.514  86.543  1.00 14.44 ? 36   THR A CA  1 
ATOM   261   C  C   . THR A 1  36  ? 35.909  98.569  86.876  1.00 14.03 ? 36   THR A C   1 
ATOM   262   O  O   . THR A 1  36  ? 35.379  99.644  87.161  1.00 13.60 ? 36   THR A O   1 
ATOM   263   C  CB  . THR A 1  36  ? 38.306  98.229  87.781  1.00 14.41 ? 36   THR A CB  1 
ATOM   264   O  OG1 . THR A 1  36  ? 39.684  98.163  87.359  1.00 4.69  ? 36   THR A OG1 1 
ATOM   265   C  CG2 . THR A 1  36  ? 38.055  96.813  88.379  1.00 10.22 ? 36   THR A CG2 1 
ATOM   266   N  N   . VAL A 1  37  ? 35.232  97.489  86.484  1.00 14.21 ? 37   VAL A N   1 
ATOM   267   C  CA  . VAL A 1  37  ? 33.802  97.217  86.741  1.00 14.14 ? 37   VAL A CA  1 
ATOM   268   C  C   . VAL A 1  37  ? 33.679  95.870  87.411  1.00 14.35 ? 37   VAL A C   1 
ATOM   269   O  O   . VAL A 1  37  ? 34.304  94.905  86.977  1.00 14.17 ? 37   VAL A O   1 
ATOM   270   C  CB  . VAL A 1  37  ? 32.920  97.118  85.448  1.00 14.14 ? 37   VAL A CB  1 
ATOM   271   C  CG1 . VAL A 1  37  ? 31.827  98.144  85.449  1.00 16.26 ? 37   VAL A CG1 1 
ATOM   272   C  CG2 . VAL A 1  37  ? 33.729  97.071  84.147  1.00 18.71 ? 37   VAL A CG2 1 
ATOM   273   N  N   . GLY A 1  38  ? 32.705  95.759  88.303  1.00 14.94 ? 38   GLY A N   1 
ATOM   274   C  CA  . GLY A 1  38  ? 32.474  94.518  89.005  1.00 14.73 ? 38   GLY A CA  1 
ATOM   275   C  C   . GLY A 1  38  ? 31.244  94.424  89.849  1.00 14.39 ? 38   GLY A C   1 
ATOM   276   O  O   . GLY A 1  38  ? 30.658  95.441  90.227  1.00 14.43 ? 38   GLY A O   1 
ATOM   277   N  N   . VAL A 1  39  ? 30.974  93.185  90.262  1.00 14.42 ? 39   VAL A N   1 
ATOM   278   C  CA  . VAL A 1  39  ? 29.875  92.813  91.157  1.00 14.09 ? 39   VAL A CA  1 
ATOM   279   C  C   . VAL A 1  39  ? 30.481  92.341  92.478  1.00 14.58 ? 39   VAL A C   1 
ATOM   280   O  O   . VAL A 1  39  ? 31.291  91.402  92.497  1.00 14.69 ? 39   VAL A O   1 
ATOM   281   C  CB  . VAL A 1  39  ? 28.948  91.706  90.518  1.00 13.93 ? 39   VAL A CB  1 
ATOM   282   C  CG1 . VAL A 1  39  ? 27.886  91.221  91.508  1.00 15.90 ? 39   VAL A CG1 1 
ATOM   283   C  CG2 . VAL A 1  39  ? 28.270  92.224  89.250  1.00 13.47 ? 39   VAL A CG2 1 
ATOM   284   N  N   . TRP A 1  40  ? 30.113  93.029  93.561  1.00 15.18 ? 40   TRP A N   1 
ATOM   285   C  CA  . TRP A 1  40  ? 30.443  92.618  94.938  1.00 15.70 ? 40   TRP A CA  1 
ATOM   286   C  C   . TRP A 1  40  ? 29.217  92.039  95.632  1.00 15.98 ? 40   TRP A C   1 
ATOM   287   O  O   . TRP A 1  40  ? 28.132  92.653  95.591  1.00 15.83 ? 40   TRP A O   1 
ATOM   288   C  CB  . TRP A 1  40  ? 31.033  93.795  95.726  1.00 15.87 ? 40   TRP A CB  1 
ATOM   289   C  CG  . TRP A 1  40  ? 32.539  93.875  95.613  1.00 18.37 ? 40   TRP A CG  1 
ATOM   290   C  CD1 . TRP A 1  40  ? 33.450  93.476  96.551  1.00 19.17 ? 40   TRP A CD1 1 
ATOM   291   C  CD2 . TRP A 1  40  ? 33.301  94.242  94.451  1.00 23.10 ? 40   TRP A CD2 1 
ATOM   292   N  NE1 . TRP A 1  40  ? 34.730  93.577  96.056  1.00 18.21 ? 40   TRP A NE1 1 
ATOM   293   C  CE2 . TRP A 1  40  ? 34.680  94.075  94.782  1.00 21.87 ? 40   TRP A CE2 1 
ATOM   294   C  CE3 . TRP A 1  40  ? 32.967  94.728  93.157  1.00 22.39 ? 40   TRP A CE3 1 
ATOM   295   C  CZ2 . TRP A 1  40  ? 35.716  94.220  93.823  1.00 22.29 ? 40   TRP A CZ2 1 
ATOM   296   C  CZ3 . TRP A 1  40  ? 34.015  95.008  92.242  1.00 26.68 ? 40   TRP A CZ3 1 
ATOM   297   C  CH2 . TRP A 1  40  ? 35.378  94.762  92.593  1.00 27.45 ? 40   TRP A CH2 1 
ATOM   298   N  N   . ILE A 1  41  ? 29.366  90.800  96.129  1.00 16.05 ? 41   ILE A N   1 
ATOM   299   C  CA  . ILE A 1  41  ? 28.276  90.020  96.776  1.00 16.16 ? 41   ILE A CA  1 
ATOM   300   C  C   . ILE A 1  41  ? 28.617  89.778  98.258  1.00 16.23 ? 41   ILE A C   1 
ATOM   301   O  O   . ILE A 1  41  ? 29.758  89.381  98.585  1.00 16.29 ? 41   ILE A O   1 
ATOM   302   C  CB  . ILE A 1  41  ? 27.996  88.631  96.026  1.00 16.08 ? 41   ILE A CB  1 
ATOM   303   C  CG1 . ILE A 1  41  ? 27.886  88.805  94.501  1.00 14.59 ? 41   ILE A CG1 1 
ATOM   304   C  CG2 . ILE A 1  41  ? 26.679  87.982  96.504  1.00 16.00 ? 41   ILE A CG2 1 
ATOM   305   C  CD1 . ILE A 1  41  ? 28.710  87.819  93.726  1.00 2.00  ? 41   ILE A CD1 1 
ATOM   306   N  N   . ASP A 1  42  ? 27.613  89.994  99.126  1.00 16.07 ? 42   ASP A N   1 
ATOM   307   C  CA  . ASP A 1  42  ? 27.603  89.529  100.528 1.00 15.85 ? 42   ASP A CA  1 
ATOM   308   C  C   . ASP A 1  42  ? 27.408  87.995  100.606 1.00 15.45 ? 42   ASP A C   1 
ATOM   309   O  O   . ASP A 1  42  ? 26.344  87.497  100.992 1.00 15.21 ? 42   ASP A O   1 
ATOM   310   C  CB  . ASP A 1  42  ? 26.549  90.310  101.373 1.00 15.95 ? 42   ASP A CB  1 
ATOM   311   C  CG  . ASP A 1  42  ? 27.174  91.370  102.308 1.00 25.76 ? 42   ASP A CG  1 
ATOM   312   O  OD1 . ASP A 1  42  ? 26.482  92.372  102.590 1.00 33.66 ? 42   ASP A OD1 1 
ATOM   313   O  OD2 . ASP A 1  42  ? 28.281  91.262  102.886 1.00 28.06 ? 42   ASP A OD2 1 
ATOM   314   N  N   . ALA A 1  43  ? 28.443  87.262  100.185 1.00 15.69 ? 43   ALA A N   1 
ATOM   315   C  CA  . ALA A 1  43  ? 28.466  85.794  100.200 1.00 16.28 ? 43   ALA A CA  1 
ATOM   316   C  C   . ALA A 1  43  ? 29.878  85.287  100.378 1.00 16.50 ? 43   ALA A C   1 
ATOM   317   O  O   . ALA A 1  43  ? 30.805  85.810  99.779  1.00 17.29 ? 43   ALA A O   1 
ATOM   318   C  CB  . ALA A 1  43  ? 27.831  85.209  98.908  1.00 16.36 ? 43   ALA A CB  1 
ATOM   319   N  N   . GLY A 1  44  ? 30.016  84.256  101.205 1.00 16.23 ? 44   GLY A N   1 
ATOM   320   C  CA  . GLY A 1  44  ? 31.277  83.569  101.464 1.00 15.83 ? 44   GLY A CA  1 
ATOM   321   C  C   . GLY A 1  44  ? 31.069  82.431  102.448 1.00 15.67 ? 44   GLY A C   1 
ATOM   322   O  O   . GLY A 1  44  ? 29.944  82.249  102.941 1.00 15.83 ? 44   GLY A O   1 
ATOM   323   N  N   . SER A 1  45  ? 32.179  81.825  102.883 1.00 15.38 ? 45   SER A N   1 
ATOM   324   C  CA  . SER A 1  45  ? 32.180  80.632  103.754 1.00 14.96 ? 45   SER A CA  1 
ATOM   325   C  C   . SER A 1  45  ? 31.507  80.774  105.141 1.00 14.44 ? 45   SER A C   1 
ATOM   326   O  O   . SER A 1  45  ? 31.017  79.776  105.692 1.00 14.35 ? 45   SER A O   1 
ATOM   327   C  CB  . SER A 1  45  ? 33.580  80.006  103.859 1.00 14.72 ? 45   SER A CB  1 
ATOM   328   O  OG  . SER A 1  45  ? 34.426  80.785  104.680 1.00 31.19 ? 45   SER A OG  1 
ATOM   329   N  N   . ARG A 1  46  ? 31.445  82.014  105.657 1.00 13.98 ? 46   ARG A N   1 
ATOM   330   C  CA  . ARG A 1  46  ? 30.658  82.362  106.852 1.00 14.02 ? 46   ARG A CA  1 
ATOM   331   C  C   . ARG A 1  46  ? 29.139  82.103  106.711 1.00 14.38 ? 46   ARG A C   1 
ATOM   332   O  O   . ARG A 1  46  ? 28.470  81.879  107.718 1.00 14.21 ? 46   ARG A O   1 
ATOM   333   C  CB  . ARG A 1  46  ? 30.934  83.811  107.304 1.00 13.65 ? 46   ARG A CB  1 
ATOM   334   C  CG  . ARG A 1  46  ? 30.587  84.107  108.769 1.00 12.12 ? 46   ARG A CG  1 
ATOM   335   C  CD  . ARG A 1  46  ? 30.563  85.569  109.133 1.00 12.15 ? 46   ARG A CD  1 
ATOM   336   N  NE  . ARG A 1  46  ? 29.806  85.770  110.373 1.00 15.88 ? 46   ARG A NE  1 
ATOM   337   C  CZ  . ARG A 1  46  ? 30.028  86.715  111.288 1.00 14.03 ? 46   ARG A CZ  1 
ATOM   338   N  NH1 . ARG A 1  46  ? 31.030  87.593  111.174 1.00 25.52 ? 46   ARG A NH1 1 
ATOM   339   N  NH2 . ARG A 1  46  ? 29.254  86.754  112.360 1.00 13.08 ? 46   ARG A NH2 1 
ATOM   340   N  N   . TYR A 1  47  ? 28.612  82.241  105.484 1.00 14.63 ? 47   TYR A N   1 
ATOM   341   C  CA  . TYR A 1  47  ? 27.214  81.890  105.135 1.00 14.29 ? 47   TYR A CA  1 
ATOM   342   C  C   . TYR A 1  47  ? 26.948  80.393  104.942 1.00 14.90 ? 47   TYR A C   1 
ATOM   343   O  O   . TYR A 1  47  ? 25.780  79.960  104.983 1.00 14.48 ? 47   TYR A O   1 
ATOM   344   C  CB  . TYR A 1  47  ? 26.737  82.674  103.906 1.00 13.61 ? 47   TYR A CB  1 
ATOM   345   C  CG  . TYR A 1  47  ? 26.640  84.169  104.122 1.00 10.70 ? 47   TYR A CG  1 
ATOM   346   C  CD1 . TYR A 1  47  ? 25.449  84.757  104.608 1.00 11.64 ? 47   TYR A CD1 1 
ATOM   347   C  CD2 . TYR A 1  47  ? 27.742  85.020  103.813 1.00 8.84  ? 47   TYR A CD2 1 
ATOM   348   C  CE1 . TYR A 1  47  ? 25.354  86.185  104.797 1.00 18.26 ? 47   TYR A CE1 1 
ATOM   349   C  CE2 . TYR A 1  47  ? 27.664  86.425  103.999 1.00 11.15 ? 47   TYR A CE2 1 
ATOM   350   C  CZ  . TYR A 1  47  ? 26.469  86.999  104.475 1.00 15.06 ? 47   TYR A CZ  1 
ATOM   351   O  OH  . TYR A 1  47  ? 26.390  88.363  104.623 1.00 21.15 ? 47   TYR A OH  1 
ATOM   352   N  N   . GLU A 1  48  ? 28.015  79.610  104.733 1.00 15.86 ? 48   GLU A N   1 
ATOM   353   C  CA  . GLU A 1  48  ? 27.875  78.162  104.523 1.00 16.82 ? 48   GLU A CA  1 
ATOM   354   C  C   . GLU A 1  48  ? 27.922  77.244  105.756 1.00 17.08 ? 48   GLU A C   1 
ATOM   355   O  O   . GLU A 1  48  ? 28.396  77.676  106.821 1.00 17.35 ? 48   GLU A O   1 
ATOM   356   C  CB  . GLU A 1  48  ? 28.572  77.629  103.246 1.00 16.99 ? 48   GLU A CB  1 
ATOM   357   C  CG  . GLU A 1  48  ? 30.046  77.886  103.064 1.00 29.52 ? 48   GLU A CG  1 
ATOM   358   C  CD  . GLU A 1  48  ? 30.436  78.205  101.618 1.00 33.49 ? 48   GLU A CD  1 
ATOM   359   O  OE1 . GLU A 1  48  ? 31.254  77.469  101.055 1.00 28.61 ? 48   GLU A OE1 1 
ATOM   360   O  OE2 . GLU A 1  48  ? 30.076  79.284  101.103 1.00 41.09 ? 48   GLU A OE2 1 
ATOM   361   N  N   . SER A 1  49  ? 27.080  76.205  105.699 1.00 17.03 ? 49   SER A N   1 
ATOM   362   C  CA  . SER A 1  49  ? 27.058  75.097  106.663 1.00 17.64 ? 49   SER A CA  1 
ATOM   363   C  C   . SER A 1  49  ? 28.175  74.074  106.372 1.00 18.65 ? 49   SER A C   1 
ATOM   364   O  O   . SER A 1  49  ? 28.735  74.070  105.258 1.00 18.59 ? 49   SER A O   1 
ATOM   365   C  CB  . SER A 1  49  ? 25.678  74.417  106.639 1.00 17.60 ? 49   SER A CB  1 
ATOM   366   O  OG  . SER A 1  49  ? 25.509  73.656  105.454 1.00 14.47 ? 49   SER A OG  1 
ATOM   367   N  N   . GLU A 1  50  ? 28.423  73.177  107.347 1.00 19.47 ? 50   GLU A N   1 
ATOM   368   C  CA  . GLU A 1  50  ? 29.296  71.993  107.216 1.00 20.81 ? 50   GLU A CA  1 
ATOM   369   C  C   . GLU A 1  50  ? 29.136  71.181  105.920 1.00 21.60 ? 50   GLU A C   1 
ATOM   370   O  O   . GLU A 1  50  ? 30.142  70.835  105.309 1.00 22.17 ? 50   GLU A O   1 
ATOM   371   C  CB  . GLU A 1  50  ? 29.126  71.069  108.421 1.00 21.64 ? 50   GLU A CB  1 
ATOM   372   C  CG  . GLU A 1  50  ? 30.378  70.908  109.263 1.00 33.98 ? 50   GLU A CG  1 
ATOM   373   C  CD  . GLU A 1  50  ? 30.200  71.460  110.662 1.00 38.25 ? 50   GLU A CD  1 
ATOM   374   O  OE1 . GLU A 1  50  ? 29.659  70.741  111.530 1.00 40.93 ? 50   GLU A OE1 1 
ATOM   375   O  OE2 . GLU A 1  50  ? 30.553  72.636  110.878 1.00 50.62 ? 50   GLU A OE2 1 
ATOM   376   N  N   . LYS A 1  51  ? 27.878  70.969  105.491 1.00 21.63 ? 51   LYS A N   1 
ATOM   377   C  CA  . LYS A 1  51  ? 27.509  70.264  104.247 1.00 21.79 ? 51   LYS A CA  1 
ATOM   378   C  C   . LYS A 1  51  ? 27.744  71.098  102.974 1.00 21.80 ? 51   LYS A C   1 
ATOM   379   O  O   . LYS A 1  51  ? 28.089  70.542  101.931 1.00 22.54 ? 51   LYS A O   1 
ATOM   380   C  CB  . LYS A 1  51  ? 26.043  69.817  104.319 1.00 21.82 ? 51   LYS A CB  1 
ATOM   381   C  CG  . LYS A 1  51  ? 25.769  68.408  103.795 1.00 31.64 ? 51   LYS A CG  1 
ATOM   382   C  CD  . LYS A 1  51  ? 24.263  68.161  103.613 1.00 23.28 ? 51   LYS A CD  1 
ATOM   383   C  CE  . LYS A 1  51  ? 23.972  66.711  103.242 1.00 25.95 ? 51   LYS A CE  1 
ATOM   384   N  NZ  . LYS A 1  51  ? 22.501  66.414  103.277 1.00 23.89 ? 51   LYS A NZ  1 
ATOM   385   N  N   . ASN A 1  52  ? 27.432  72.395  103.056 1.00 21.06 ? 52   ASN A N   1 
ATOM   386   C  CA  . ASN A 1  52  ? 27.609  73.406  101.990 1.00 20.15 ? 52   ASN A CA  1 
ATOM   387   C  C   . ASN A 1  52  ? 29.075  73.872  101.739 1.00 19.03 ? 52   ASN A C   1 
ATOM   388   O  O   . ASN A 1  52  ? 29.357  74.520  100.712 1.00 18.20 ? 52   ASN A O   1 
ATOM   389   C  CB  . ASN A 1  52  ? 26.788  74.642  102.384 1.00 20.31 ? 52   ASN A CB  1 
ATOM   390   C  CG  . ASN A 1  52  ? 25.597  74.880  101.496 1.00 28.68 ? 52   ASN A CG  1 
ATOM   391   O  OD1 . ASN A 1  52  ? 25.499  75.950  100.898 1.00 24.89 ? 52   ASN A OD1 1 
ATOM   392   N  ND2 . ASN A 1  52  ? 24.558  74.050  101.661 1.00 37.42 ? 52   ASN A ND2 1 
ATOM   393   N  N   . ASN A 1  53  ? 29.945  73.704  102.743 1.00 18.31 ? 53   ASN A N   1 
ATOM   394   C  CA  . ASN A 1  53  ? 31.242  74.419  102.813 1.00 16.89 ? 53   ASN A CA  1 
ATOM   395   C  C   . ASN A 1  53  ? 32.199  74.114  101.650 1.00 16.86 ? 53   ASN A C   1 
ATOM   396   O  O   . ASN A 1  53  ? 32.411  72.958  101.313 1.00 16.48 ? 53   ASN A O   1 
ATOM   397   C  CB  . ASN A 1  53  ? 31.888  74.248  104.200 1.00 16.10 ? 53   ASN A CB  1 
ATOM   398   C  CG  . ASN A 1  53  ? 33.225  74.996  104.365 1.00 12.09 ? 53   ASN A CG  1 
ATOM   399   O  OD1 . ASN A 1  53  ? 34.135  74.452  104.976 1.00 20.87 ? 53   ASN A OD1 1 
ATOM   400   N  ND2 . ASN A 1  53  ? 33.284  76.285  103.974 1.00 3.08  ? 53   ASN A ND2 1 
ATOM   401   N  N   . GLY A 1  54  ? 32.597  75.179  100.944 1.00 17.38 ? 54   GLY A N   1 
ATOM   402   C  CA  . GLY A 1  54  ? 33.326  75.120  99.678  1.00 17.28 ? 54   GLY A CA  1 
ATOM   403   C  C   . GLY A 1  54  ? 32.533  75.384  98.402  1.00 17.09 ? 54   GLY A C   1 
ATOM   404   O  O   . GLY A 1  54  ? 33.137  75.392  97.311  1.00 16.97 ? 54   GLY A O   1 
ATOM   405   N  N   . ALA A 1  55  ? 31.229  75.679  98.540  1.00 17.58 ? 55   ALA A N   1 
ATOM   406   C  CA  . ALA A 1  55  ? 30.293  75.844  97.400  1.00 17.99 ? 55   ALA A CA  1 
ATOM   407   C  C   . ALA A 1  55  ? 30.558  77.106  96.610  1.00 18.83 ? 55   ALA A C   1 
ATOM   408   O  O   . ALA A 1  55  ? 30.610  77.045  95.378  1.00 19.46 ? 55   ALA A O   1 
ATOM   409   C  CB  . ALA A 1  55  ? 28.840  75.801  97.847  1.00 17.71 ? 55   ALA A CB  1 
ATOM   410   N  N   . GLY A 1  56  ? 30.747  78.231  97.327  1.00 18.77 ? 56   GLY A N   1 
ATOM   411   C  CA  . GLY A 1  56  ? 31.112  79.520  96.754  1.00 18.98 ? 56   GLY A CA  1 
ATOM   412   C  C   . GLY A 1  56  ? 32.393  79.499  95.950  1.00 19.47 ? 56   GLY A C   1 
ATOM   413   O  O   . GLY A 1  56  ? 32.421  80.005  94.821  1.00 19.48 ? 56   GLY A O   1 
ATOM   414   N  N   . TYR A 1  57  ? 33.391  78.792  96.490  1.00 20.05 ? 57   TYR A N   1 
ATOM   415   C  CA  . TYR A 1  57  ? 34.666  78.520  95.823  1.00 20.31 ? 57   TYR A CA  1 
ATOM   416   C  C   . TYR A 1  57  ? 34.529  77.655  94.584  1.00 20.12 ? 57   TYR A C   1 
ATOM   417   O  O   . TYR A 1  57  ? 35.248  77.883  93.607  1.00 20.38 ? 57   TYR A O   1 
ATOM   418   C  CB  . TYR A 1  57  ? 35.670  77.901  96.800  1.00 20.58 ? 57   TYR A CB  1 
ATOM   419   C  CG  . TYR A 1  57  ? 37.091  77.844  96.285  1.00 15.86 ? 57   TYR A CG  1 
ATOM   420   C  CD1 . TYR A 1  57  ? 37.890  79.020  96.221  1.00 11.10 ? 57   TYR A CD1 1 
ATOM   421   C  CD2 . TYR A 1  57  ? 37.673  76.604  95.921  1.00 9.44  ? 57   TYR A CD2 1 
ATOM   422   C  CE1 . TYR A 1  57  ? 39.246  78.967  95.777  1.00 13.47 ? 57   TYR A CE1 1 
ATOM   423   C  CE2 . TYR A 1  57  ? 39.037  76.532  95.485  1.00 21.25 ? 57   TYR A CE2 1 
ATOM   424   C  CZ  . TYR A 1  57  ? 39.805  77.722  95.424  1.00 20.15 ? 57   TYR A CZ  1 
ATOM   425   O  OH  . TYR A 1  57  ? 41.117  77.666  95.057  1.00 30.40 ? 57   TYR A OH  1 
ATOM   426   N  N   . PHE A 1  58  ? 33.676  76.618  94.672  1.00 19.88 ? 58   PHE A N   1 
ATOM   427   C  CA  . PHE A 1  58  ? 33.261  75.802  93.529  1.00 18.66 ? 58   PHE A CA  1 
ATOM   428   C  C   . PHE A 1  58  ? 32.569  76.625  92.435  1.00 18.24 ? 58   PHE A C   1 
ATOM   429   O  O   . PHE A 1  58  ? 32.924  76.487  91.267  1.00 18.50 ? 58   PHE A O   1 
ATOM   430   C  CB  . PHE A 1  58  ? 32.366  74.646  93.985  1.00 18.54 ? 58   PHE A CB  1 
ATOM   431   C  CG  . PHE A 1  58  ? 32.660  73.321  93.320  1.00 10.55 ? 58   PHE A CG  1 
ATOM   432   C  CD1 . PHE A 1  58  ? 33.009  72.197  94.117  1.00 5.34  ? 58   PHE A CD1 1 
ATOM   433   C  CD2 . PHE A 1  58  ? 32.414  73.130  91.927  1.00 5.26  ? 58   PHE A CD2 1 
ATOM   434   C  CE1 . PHE A 1  58  ? 33.206  70.890  93.521  1.00 13.90 ? 58   PHE A CE1 1 
ATOM   435   C  CE2 . PHE A 1  58  ? 32.602  71.823  91.303  1.00 11.50 ? 58   PHE A CE2 1 
ATOM   436   C  CZ  . PHE A 1  58  ? 33.013  70.710  92.107  1.00 5.72  ? 58   PHE A CZ  1 
ATOM   437   N  N   . VAL A 1  59  ? 31.682  77.548  92.840  1.00 17.90 ? 59   VAL A N   1 
ATOM   438   C  CA  . VAL A 1  59  ? 30.993  78.500  91.931  1.00 17.82 ? 59   VAL A CA  1 
ATOM   439   C  C   . VAL A 1  59  ? 31.973  79.438  91.199  1.00 18.11 ? 59   VAL A C   1 
ATOM   440   O  O   . VAL A 1  59  ? 31.886  79.561  89.975  1.00 18.10 ? 59   VAL A O   1 
ATOM   441   C  CB  . VAL A 1  59  ? 29.773  79.243  92.638  1.00 17.54 ? 59   VAL A CB  1 
ATOM   442   C  CG1 . VAL A 1  59  ? 29.221  80.424  91.810  1.00 10.15 ? 59   VAL A CG1 1 
ATOM   443   C  CG2 . VAL A 1  59  ? 28.622  78.247  92.917  1.00 14.03 ? 59   VAL A CG2 1 
ATOM   444   N  N   . GLU A 1  60  ? 32.998  79.907  91.928  1.00 18.73 ? 60   GLU A N   1 
ATOM   445   C  CA  . GLU A 1  60  ? 34.155  80.650  91.378  1.00 18.91 ? 60   GLU A CA  1 
ATOM   446   C  C   . GLU A 1  60  ? 34.902  79.933  90.240  1.00 18.61 ? 60   GLU A C   1 
ATOM   447   O  O   . GLU A 1  60  ? 35.267  80.568  89.247  1.00 18.98 ? 60   GLU A O   1 
ATOM   448   C  CB  . GLU A 1  60  ? 35.139  81.042  92.488  1.00 19.19 ? 60   GLU A CB  1 
ATOM   449   C  CG  . GLU A 1  60  ? 35.984  82.266  92.150  1.00 23.88 ? 60   GLU A CG  1 
ATOM   450   C  CD  . GLU A 1  60  ? 37.224  82.400  93.009  1.00 24.96 ? 60   GLU A CD  1 
ATOM   451   O  OE1 . GLU A 1  60  ? 37.108  82.889  94.139  1.00 33.87 ? 60   GLU A OE1 1 
ATOM   452   O  OE2 . GLU A 1  60  ? 38.332  82.256  92.479  1.00 26.91 ? 60   GLU A OE2 1 
ATOM   453   N  N   . HIS A 1  61  ? 35.018  78.611  90.354  1.00 17.91 ? 61   HIS A N   1 
ATOM   454   C  CA  . HIS A 1  61  ? 35.651  77.762  89.349  1.00 17.62 ? 61   HIS A CA  1 
ATOM   455   C  C   . HIS A 1  61  ? 34.812  77.548  88.088  1.00 17.85 ? 61   HIS A C   1 
ATOM   456   O  O   . HIS A 1  61  ? 35.344  77.111  87.052  1.00 18.14 ? 61   HIS A O   1 
ATOM   457   C  CB  . HIS A 1  61  ? 35.993  76.430  89.978  1.00 17.66 ? 61   HIS A CB  1 
ATOM   458   C  CG  . HIS A 1  61  ? 37.310  76.418  90.672  1.00 17.98 ? 61   HIS A CG  1 
ATOM   459   N  ND1 . HIS A 1  61  ? 38.363  75.650  90.229  1.00 14.59 ? 61   HIS A ND1 1 
ATOM   460   C  CD2 . HIS A 1  61  ? 37.750  77.070  91.778  1.00 6.06  ? 61   HIS A CD2 1 
ATOM   461   C  CE1 . HIS A 1  61  ? 39.400  75.840  91.019  1.00 18.52 ? 61   HIS A CE1 1 
ATOM   462   N  NE2 . HIS A 1  61  ? 39.033  76.638  92.008  1.00 20.03 ? 61   HIS A NE2 1 
ATOM   463   N  N   . LEU A 1  62  ? 33.507  77.822  88.194  1.00 17.49 ? 62   LEU A N   1 
ATOM   464   C  CA  . LEU A 1  62  ? 32.537  77.564  87.126  1.00 17.14 ? 62   LEU A CA  1 
ATOM   465   C  C   . LEU A 1  62  ? 32.034  78.828  86.439  1.00 16.88 ? 62   LEU A C   1 
ATOM   466   O  O   . LEU A 1  62  ? 31.811  78.809  85.214  1.00 16.18 ? 62   LEU A O   1 
ATOM   467   C  CB  . LEU A 1  62  ? 31.377  76.700  87.638  1.00 16.94 ? 62   LEU A CB  1 
ATOM   468   C  CG  . LEU A 1  62  ? 31.713  75.262  88.091  1.00 17.97 ? 62   LEU A CG  1 
ATOM   469   C  CD1 . LEU A 1  62  ? 30.769  74.840  89.172  1.00 17.52 ? 62   LEU A CD1 1 
ATOM   470   C  CD2 . LEU A 1  62  ? 31.675  74.258  86.945  1.00 20.27 ? 62   LEU A CD2 1 
ATOM   471   N  N   . ALA A 1  63  ? 32.137  79.947  87.178  1.00 17.35 ? 63   ALA A N   1 
ATOM   472   C  CA  . ALA A 1  63  ? 31.654  81.288  86.808  1.00 18.44 ? 63   ALA A CA  1 
ATOM   473   C  C   . ALA A 1  63  ? 32.102  81.808  85.433  1.00 19.28 ? 63   ALA A C   1 
ATOM   474   O  O   . ALA A 1  63  ? 31.312  82.450  84.722  1.00 19.29 ? 63   ALA A O   1 
ATOM   475   C  CB  . ALA A 1  63  ? 32.050  82.271  87.879  1.00 18.80 ? 63   ALA A CB  1 
ATOM   476   N  N   . PHE A 1  64  ? 33.327  81.440  85.039  1.00 20.16 ? 64   PHE A N   1 
ATOM   477   C  CA  . PHE A 1  64  ? 33.964  81.924  83.806  1.00 21.07 ? 64   PHE A CA  1 
ATOM   478   C  C   . PHE A 1  64  ? 33.980  80.918  82.650  1.00 22.31 ? 64   PHE A C   1 
ATOM   479   O  O   . PHE A 1  64  ? 34.351  81.283  81.517  1.00 23.35 ? 64   PHE A O   1 
ATOM   480   C  CB  . PHE A 1  64  ? 35.380  82.454  84.091  1.00 20.84 ? 64   PHE A CB  1 
ATOM   481   C  CG  . PHE A 1  64  ? 35.451  83.585  85.120  1.00 17.80 ? 64   PHE A CG  1 
ATOM   482   C  CD1 . PHE A 1  64  ? 36.680  83.841  85.770  1.00 14.01 ? 64   PHE A CD1 1 
ATOM   483   C  CD2 . PHE A 1  64  ? 34.359  84.488  85.346  1.00 16.30 ? 64   PHE A CD2 1 
ATOM   484   C  CE1 . PHE A 1  64  ? 36.820  84.933  86.685  1.00 16.00 ? 64   PHE A CE1 1 
ATOM   485   C  CE2 . PHE A 1  64  ? 34.446  85.508  86.345  1.00 20.55 ? 64   PHE A CE2 1 
ATOM   486   C  CZ  . PHE A 1  64  ? 35.695  85.778  86.961  1.00 17.65 ? 64   PHE A CZ  1 
ATOM   487   N  N   . LYS A 1  65  ? 33.359  79.757  82.879  1.00 22.21 ? 65   LYS A N   1 
ATOM   488   C  CA  . LYS A 1  65  ? 33.560  78.561  82.055  1.00 22.57 ? 65   LYS A CA  1 
ATOM   489   C  C   . LYS A 1  65  ? 32.347  78.201  81.160  1.00 22.83 ? 65   LYS A C   1 
ATOM   490   O  O   . LYS A 1  65  ? 32.406  77.231  80.380  1.00 23.12 ? 65   LYS A O   1 
ATOM   491   C  CB  . LYS A 1  65  ? 34.006  77.373  82.934  1.00 22.91 ? 65   LYS A CB  1 
ATOM   492   C  CG  . LYS A 1  65  ? 35.327  77.601  83.696  1.00 15.75 ? 65   LYS A CG  1 
ATOM   493   C  CD  . LYS A 1  65  ? 36.497  76.924  83.025  1.00 21.12 ? 65   LYS A CD  1 
ATOM   494   C  CE  . LYS A 1  65  ? 37.648  76.749  83.985  1.00 18.13 ? 65   LYS A CE  1 
ATOM   495   N  NZ  . LYS A 1  65  ? 38.908  76.513  83.211  1.00 30.29 ? 65   LYS A NZ  1 
ATOM   496   N  N   . GLY A 1  66  ? 31.274  79.001  81.273  1.00 22.71 ? 66   GLY A N   1 
ATOM   497   C  CA  . GLY A 1  66  ? 30.160  79.032  80.334  1.00 22.67 ? 66   GLY A CA  1 
ATOM   498   C  C   . GLY A 1  66  ? 28.872  79.567  80.939  1.00 22.88 ? 66   GLY A C   1 
ATOM   499   O  O   . GLY A 1  66  ? 28.580  79.304  82.119  1.00 22.90 ? 66   GLY A O   1 
ATOM   500   N  N   . THR A 1  67  ? 28.158  80.383  80.150  1.00 23.14 ? 67   THR A N   1 
ATOM   501   C  CA  . THR A 1  67  ? 26.756  80.799  80.421  1.00 23.51 ? 67   THR A CA  1 
ATOM   502   C  C   . THR A 1  67  ? 25.770  80.253  79.365  1.00 24.19 ? 67   THR A C   1 
ATOM   503   O  O   . THR A 1  67  ? 26.178  79.529  78.437  1.00 24.26 ? 67   THR A O   1 
ATOM   504   C  CB  . THR A 1  67  ? 26.608  82.365  80.541  1.00 23.36 ? 67   THR A CB  1 
ATOM   505   O  OG1 . THR A 1  67  ? 26.935  82.986  79.292  1.00 21.49 ? 67   THR A OG1 1 
ATOM   506   C  CG2 . THR A 1  67  ? 27.582  82.976  81.551  1.00 23.57 ? 67   THR A CG2 1 
ATOM   507   N  N   . LYS A 1  68  ? 24.473  80.501  79.602  1.00 24.86 ? 68   LYS A N   1 
ATOM   508   C  CA  . LYS A 1  68  ? 23.376  80.154  78.691  1.00 25.63 ? 68   LYS A CA  1 
ATOM   509   C  C   . LYS A 1  68  ? 23.436  80.833  77.308  1.00 25.81 ? 68   LYS A C   1 
ATOM   510   O  O   . LYS A 1  68  ? 23.008  80.228  76.304  1.00 25.98 ? 68   LYS A O   1 
ATOM   511   C  CB  . LYS A 1  68  ? 22.031  80.422  79.367  1.00 26.10 ? 68   LYS A CB  1 
ATOM   512   C  CG  . LYS A 1  68  ? 21.413  79.194  80.028  1.00 36.60 ? 68   LYS A CG  1 
ATOM   513   C  CD  . LYS A 1  68  ? 21.270  79.382  81.538  1.00 38.97 ? 68   LYS A CD  1 
ATOM   514   C  CE  . LYS A 1  68  ? 21.048  78.046  82.242  1.00 41.97 ? 68   LYS A CE  1 
ATOM   515   N  NZ  . LYS A 1  68  ? 20.389  78.210  83.572  1.00 42.72 ? 68   LYS A NZ  1 
ATOM   516   N  N   . ASN A 1  69  ? 23.927  82.083  77.279  1.00 25.55 ? 69   ASN A N   1 
ATOM   517   C  CA  . ASN A 1  69  ? 24.065  82.901  76.047  1.00 25.40 ? 69   ASN A CA  1 
ATOM   518   C  C   . ASN A 1  69  ? 25.427  82.768  75.343  1.00 24.86 ? 69   ASN A C   1 
ATOM   519   O  O   . ASN A 1  69  ? 25.515  82.946  74.114  1.00 24.54 ? 69   ASN A O   1 
ATOM   520   C  CB  . ASN A 1  69  ? 23.761  84.392  76.311  1.00 25.67 ? 69   ASN A CB  1 
ATOM   521   C  CG  . ASN A 1  69  ? 22.466  84.613  77.078  1.00 29.63 ? 69   ASN A CG  1 
ATOM   522   O  OD1 . ASN A 1  69  ? 22.491  84.817  78.290  1.00 31.68 ? 69   ASN A OD1 1 
ATOM   523   N  ND2 . ASN A 1  69  ? 21.329  84.580  76.373  1.00 28.15 ? 69   ASN A ND2 1 
ATOM   524   N  N   . ARG A 1  70  ? 26.484  82.644  76.154  1.00 24.62 ? 70   ARG A N   1 
ATOM   525   C  CA  . ARG A 1  70  ? 27.843  82.337  75.689  1.00 24.12 ? 70   ARG A CA  1 
ATOM   526   C  C   . ARG A 1  70  ? 28.270  80.966  76.280  1.00 23.45 ? 70   ARG A C   1 
ATOM   527   O  O   . ARG A 1  70  ? 28.627  80.914  77.461  1.00 23.73 ? 70   ARG A O   1 
ATOM   528   C  CB  . ARG A 1  70  ? 28.827  83.460  76.085  1.00 24.10 ? 70   ARG A CB  1 
ATOM   529   C  CG  . ARG A 1  70  ? 28.584  84.810  75.419  1.00 25.60 ? 70   ARG A CG  1 
ATOM   530   C  CD  . ARG A 1  70  ? 28.651  85.976  76.392  1.00 23.27 ? 70   ARG A CD  1 
ATOM   531   N  NE  . ARG A 1  70  ? 28.220  87.240  75.777  1.00 18.95 ? 70   ARG A NE  1 
ATOM   532   C  CZ  . ARG A 1  70  ? 27.152  87.971  76.142  1.00 22.51 ? 70   ARG A CZ  1 
ATOM   533   N  NH1 . ARG A 1  70  ? 26.371  87.617  77.164  1.00 28.17 ? 70   ARG A NH1 1 
ATOM   534   N  NH2 . ARG A 1  70  ? 26.848  89.066  75.458  1.00 16.84 ? 70   ARG A NH2 1 
ATOM   535   N  N   . PRO A 1  71  ? 28.077  79.850  75.537  1.00 22.88 ? 71   PRO A N   1 
ATOM   536   C  CA  . PRO A 1  71  ? 28.465  78.517  76.050  1.00 22.30 ? 71   PRO A CA  1 
ATOM   537   C  C   . PRO A 1  71  ? 29.960  78.235  75.905  1.00 21.56 ? 71   PRO A C   1 
ATOM   538   O  O   . PRO A 1  71  ? 30.575  78.668  74.907  1.00 21.41 ? 71   PRO A O   1 
ATOM   539   C  CB  . PRO A 1  71  ? 27.640  77.535  75.187  1.00 22.23 ? 71   PRO A CB  1 
ATOM   540   C  CG  . PRO A 1  71  ? 26.780  78.392  74.290  1.00 20.68 ? 71   PRO A CG  1 
ATOM   541   C  CD  . PRO A 1  71  ? 27.440  79.732  74.204  1.00 22.73 ? 71   PRO A CD  1 
ATOM   542   N  N   . GLY A 1  72  ? 30.500  77.462  76.860  1.00 21.00 ? 72   GLY A N   1 
ATOM   543   C  CA  . GLY A 1  72  ? 31.898  77.031  76.877  1.00 20.67 ? 72   GLY A CA  1 
ATOM   544   C  C   . GLY A 1  72  ? 32.877  78.192  77.012  1.00 20.37 ? 72   GLY A C   1 
ATOM   545   O  O   . GLY A 1  72  ? 32.700  79.058  77.892  1.00 19.79 ? 72   GLY A O   1 
ATOM   546   N  N   . ASN A 1  73  ? 33.749  78.310  76.002  1.00 20.49 ? 73   ASN A N   1 
ATOM   547   C  CA  . ASN A 1  73  ? 34.859  79.277  75.975  1.00 20.40 ? 73   ASN A CA  1 
ATOM   548   C  C   . ASN A 1  73  ? 34.528  80.668  75.388  1.00 20.79 ? 73   ASN A C   1 
ATOM   549   O  O   . ASN A 1  73  ? 35.438  81.471  75.131  1.00 21.61 ? 73   ASN A O   1 
ATOM   550   C  CB  . ASN A 1  73  ? 36.139  78.632  75.354  1.00 20.31 ? 73   ASN A CB  1 
ATOM   551   C  CG  . ASN A 1  73  ? 36.162  78.605  73.771  1.00 21.50 ? 73   ASN A CG  1 
ATOM   552   O  OD1 . ASN A 1  73  ? 35.201  78.966  73.064  1.00 19.11 ? 73   ASN A OD1 1 
ATOM   553   N  ND2 . ASN A 1  73  ? 37.281  78.122  73.240  1.00 20.03 ? 73   ASN A ND2 1 
ATOM   554   N  N   . ALA A 1  74  ? 33.247  80.884  75.071  1.00 20.45 ? 74   ALA A N   1 
ATOM   555   C  CA  . ALA A 1  74  ? 32.787  82.035  74.279  1.00 20.11 ? 74   ALA A CA  1 
ATOM   556   C  C   . ALA A 1  74  ? 32.922  83.372  75.012  1.00 20.10 ? 74   ALA A C   1 
ATOM   557   O  O   . ALA A 1  74  ? 33.285  84.379  74.383  1.00 20.32 ? 74   ALA A O   1 
ATOM   558   C  CB  . ALA A 1  74  ? 31.361  81.816  73.784  1.00 19.96 ? 74   ALA A CB  1 
ATOM   559   N  N   . LEU A 1  75  ? 32.702  83.347  76.338  1.00 19.99 ? 75   LEU A N   1 
ATOM   560   C  CA  . LEU A 1  75  ? 32.979  84.472  77.255  1.00 19.83 ? 75   LEU A CA  1 
ATOM   561   C  C   . LEU A 1  75  ? 34.462  84.856  77.340  1.00 19.54 ? 75   LEU A C   1 
ATOM   562   O  O   . LEU A 1  75  ? 34.786  86.060  77.295  1.00 19.83 ? 75   LEU A O   1 
ATOM   563   C  CB  . LEU A 1  75  ? 32.364  84.219  78.656  1.00 19.94 ? 75   LEU A CB  1 
ATOM   564   C  CG  . LEU A 1  75  ? 32.894  84.859  79.961  1.00 27.16 ? 75   LEU A CG  1 
ATOM   565   C  CD1 . LEU A 1  75  ? 32.572  86.362  80.101  1.00 24.51 ? 75   LEU A CD1 1 
ATOM   566   C  CD2 . LEU A 1  75  ? 32.365  84.090  81.135  1.00 31.88 ? 75   LEU A CD2 1 
ATOM   567   N  N   . GLU A 1  76  ? 35.319  83.843  77.554  1.00 18.93 ? 76   GLU A N   1 
ATOM   568   C  CA  . GLU A 1  76  ? 36.792  83.930  77.455  1.00 18.97 ? 76   GLU A CA  1 
ATOM   569   C  C   . GLU A 1  76  ? 37.251  84.642  76.178  1.00 18.68 ? 76   GLU A C   1 
ATOM   570   O  O   . GLU A 1  76  ? 37.910  85.686  76.270  1.00 18.78 ? 76   GLU A O   1 
ATOM   571   C  CB  . GLU A 1  76  ? 37.406  82.528  77.481  1.00 19.23 ? 76   GLU A CB  1 
ATOM   572   C  CG  . GLU A 1  76  ? 38.147  82.137  78.737  1.00 32.31 ? 76   GLU A CG  1 
ATOM   573   C  CD  . GLU A 1  76  ? 38.429  80.644  78.791  1.00 41.06 ? 76   GLU A CD  1 
ATOM   574   O  OE1 . GLU A 1  76  ? 39.202  80.140  77.931  1.00 38.76 ? 76   GLU A OE1 1 
ATOM   575   O  OE2 . GLU A 1  76  ? 37.865  79.972  79.689  1.00 45.30 ? 76   GLU A OE2 1 
ATOM   576   N  N   . LYS A 1  77  ? 36.692  84.191  75.039  1.00 18.35 ? 77   LYS A N   1 
ATOM   577   C  CA  . LYS A 1  77  ? 36.966  84.696  73.689  1.00 17.83 ? 77   LYS A CA  1 
ATOM   578   C  C   . LYS A 1  77  ? 36.642  86.191  73.535  1.00 17.40 ? 77   LYS A C   1 
ATOM   579   O  O   . LYS A 1  77  ? 37.457  86.921  72.991  1.00 17.47 ? 77   LYS A O   1 
ATOM   580   C  CB  . LYS A 1  77  ? 36.196  83.872  72.646  1.00 17.77 ? 77   LYS A CB  1 
ATOM   581   C  CG  . LYS A 1  77  ? 36.881  82.601  72.195  1.00 22.85 ? 77   LYS A CG  1 
ATOM   582   C  CD  . LYS A 1  77  ? 36.511  82.233  70.743  1.00 17.56 ? 77   LYS A CD  1 
ATOM   583   C  CE  . LYS A 1  77  ? 37.511  81.229  70.160  1.00 21.51 ? 77   LYS A CE  1 
ATOM   584   N  NZ  . LYS A 1  77  ? 36.864  80.136  69.375  1.00 20.50 ? 77   LYS A NZ  1 
ATOM   585   N  N   . GLU A 1  78  ? 35.536  86.637  74.150  1.00 17.12 ? 78   GLU A N   1 
ATOM   586   C  CA  . GLU A 1  78  ? 35.078  88.037  74.129  1.00 17.27 ? 78   GLU A CA  1 
ATOM   587   C  C   . GLU A 1  78  ? 35.922  88.962  75.015  1.00 17.32 ? 78   GLU A C   1 
ATOM   588   O  O   . GLU A 1  78  ? 36.207  90.096  74.618  1.00 17.85 ? 78   GLU A O   1 
ATOM   589   C  CB  . GLU A 1  78  ? 33.606  88.133  74.543  1.00 17.36 ? 78   GLU A CB  1 
ATOM   590   C  CG  . GLU A 1  78  ? 32.641  88.287  73.388  1.00 23.18 ? 78   GLU A CG  1 
ATOM   591   C  CD  . GLU A 1  78  ? 31.204  88.365  73.853  1.00 28.52 ? 78   GLU A CD  1 
ATOM   592   O  OE1 . GLU A 1  78  ? 30.756  89.484  74.191  1.00 31.73 ? 78   GLU A OE1 1 
ATOM   593   O  OE2 . GLU A 1  78  ? 30.526  87.310  73.877  1.00 25.38 ? 78   GLU A OE2 1 
ATOM   594   N  N   . VAL A 1  79  ? 36.236  88.503  76.235  1.00 17.10 ? 79   VAL A N   1 
ATOM   595   C  CA  . VAL A 1  79  ? 37.080  89.238  77.200  1.00 17.15 ? 79   VAL A CA  1 
ATOM   596   C  C   . VAL A 1  79  ? 38.497  89.467  76.619  1.00 17.49 ? 79   VAL A C   1 
ATOM   597   O  O   . VAL A 1  79  ? 38.953  90.622  76.539  1.00 17.25 ? 79   VAL A O   1 
ATOM   598   C  CB  . VAL A 1  79  ? 37.114  88.538  78.618  1.00 16.89 ? 79   VAL A CB  1 
ATOM   599   C  CG1 . VAL A 1  79  ? 38.140  89.209  79.571  1.00 10.55 ? 79   VAL A CG1 1 
ATOM   600   C  CG2 . VAL A 1  79  ? 35.719  88.541  79.274  1.00 12.06 ? 79   VAL A CG2 1 
ATOM   601   N  N   . GLU A 1  80  ? 39.099  88.376  76.120  1.00 17.75 ? 80   GLU A N   1 
ATOM   602   C  CA  . GLU A 1  80  ? 40.430  88.367  75.518  1.00 18.22 ? 80   GLU A CA  1 
ATOM   603   C  C   . GLU A 1  80  ? 40.539  89.268  74.277  1.00 18.36 ? 80   GLU A C   1 
ATOM   604   O  O   . GLU A 1  80  ? 41.400  90.156  74.264  1.00 18.64 ? 80   GLU A O   1 
ATOM   605   C  CB  . GLU A 1  80  ? 40.869  86.937  75.209  1.00 18.62 ? 80   GLU A CB  1 
ATOM   606   C  CG  . GLU A 1  80  ? 41.448  86.175  76.398  1.00 26.02 ? 80   GLU A CG  1 
ATOM   607   C  CD  . GLU A 1  80  ? 41.602  84.671  76.152  1.00 29.32 ? 80   GLU A CD  1 
ATOM   608   O  OE1 . GLU A 1  80  ? 40.985  83.880  76.894  1.00 27.24 ? 80   GLU A OE1 1 
ATOM   609   O  OE2 . GLU A 1  80  ? 42.471  84.274  75.349  1.00 35.69 ? 80   GLU A OE2 1 
ATOM   610   N  N   . SER A 1  81  ? 39.528  89.194  73.391  1.00 18.23 ? 81   SER A N   1 
ATOM   611   C  CA  . SER A 1  81  ? 39.474  89.940  72.113  1.00 18.14 ? 81   SER A CA  1 
ATOM   612   C  C   . SER A 1  81  ? 39.442  91.463  72.252  1.00 17.89 ? 81   SER A C   1 
ATOM   613   O  O   . SER A 1  81  ? 39.962  92.173  71.374  1.00 18.19 ? 81   SER A O   1 
ATOM   614   C  CB  . SER A 1  81  ? 38.294  89.486  71.256  1.00 18.47 ? 81   SER A CB  1 
ATOM   615   O  OG  . SER A 1  81  ? 38.663  88.413  70.405  1.00 26.94 ? 81   SER A OG  1 
ATOM   616   N  N   . MET A 1  82  ? 38.789  91.950  73.316  1.00 17.43 ? 82   MET A N   1 
ATOM   617   C  CA  . MET A 1  82  ? 38.788  93.383  73.666  1.00 17.23 ? 82   MET A CA  1 
ATOM   618   C  C   . MET A 1  82  ? 39.981  93.887  74.522  1.00 16.98 ? 82   MET A C   1 
ATOM   619   O  O   . MET A 1  82  ? 40.152  95.105  74.708  1.00 17.21 ? 82   MET A O   1 
ATOM   620   C  CB  . MET A 1  82  ? 37.414  93.855  74.178  1.00 17.06 ? 82   MET A CB  1 
ATOM   621   C  CG  . MET A 1  82  ? 36.978  93.311  75.519  1.00 21.41 ? 82   MET A CG  1 
ATOM   622   S  SD  . MET A 1  82  ? 35.324  93.878  75.939  1.00 36.29 ? 82   MET A SD  1 
ATOM   623   C  CE  . MET A 1  82  ? 35.023  92.903  77.369  1.00 30.37 ? 82   MET A CE  1 
ATOM   624   N  N   . GLY A 1  83  ? 40.885  92.962  74.854  1.00 16.43 ? 83   GLY A N   1 
ATOM   625   C  CA  . GLY A 1  83  ? 42.038  93.234  75.693  1.00 16.00 ? 83   GLY A CA  1 
ATOM   626   C  C   . GLY A 1  83  ? 41.739  93.392  77.170  1.00 15.71 ? 83   GLY A C   1 
ATOM   627   O  O   . GLY A 1  83  ? 42.595  93.873  77.916  1.00 15.81 ? 83   GLY A O   1 
ATOM   628   N  N   . ALA A 1  84  ? 40.581  92.883  77.595  1.00 15.58 ? 84   ALA A N   1 
ATOM   629   C  CA  . ALA A 1  84  ? 40.101  92.995  78.962  1.00 15.92 ? 84   ALA A CA  1 
ATOM   630   C  C   . ALA A 1  84  ? 40.656  91.877  79.864  1.00 16.77 ? 84   ALA A C   1 
ATOM   631   O  O   . ALA A 1  84  ? 41.152  90.858  79.365  1.00 16.72 ? 84   ALA A O   1 
ATOM   632   C  CB  . ALA A 1  84  ? 38.582  93.014  78.977  1.00 16.00 ? 84   ALA A CB  1 
ATOM   633   N  N   . HIS A 1  85  ? 40.646  92.123  81.175  1.00 17.46 ? 85   HIS A N   1 
ATOM   634   C  CA  . HIS A 1  85  ? 41.019  91.137  82.193  1.00 18.37 ? 85   HIS A CA  1 
ATOM   635   C  C   . HIS A 1  85  ? 39.848  90.838  83.097  1.00 18.77 ? 85   HIS A C   1 
ATOM   636   O  O   . HIS A 1  85  ? 39.145  91.762  83.529  1.00 19.63 ? 85   HIS A O   1 
ATOM   637   C  CB  . HIS A 1  85  ? 42.223  91.629  83.014  1.00 18.98 ? 85   HIS A CB  1 
ATOM   638   C  CG  . HIS A 1  85  ? 43.515  91.574  82.265  1.00 25.01 ? 85   HIS A CG  1 
ATOM   639   N  ND1 . HIS A 1  85  ? 44.426  90.559  82.456  1.00 25.37 ? 85   HIS A ND1 1 
ATOM   640   C  CD2 . HIS A 1  85  ? 43.940  92.260  81.176  1.00 24.01 ? 85   HIS A CD2 1 
ATOM   641   C  CE1 . HIS A 1  85  ? 45.400  90.676  81.570  1.00 34.36 ? 85   HIS A CE1 1 
ATOM   642   N  NE2 . HIS A 1  85  ? 45.150  91.728  80.811  1.00 31.04 ? 85   HIS A NE2 1 
ATOM   643   N  N   . LEU A 1  86  ? 39.582  89.545  83.278  1.00 17.85 ? 86   LEU A N   1 
ATOM   644   C  CA  . LEU A 1  86  ? 38.478  89.046  84.081  1.00 17.39 ? 86   LEU A CA  1 
ATOM   645   C  C   . LEU A 1  86  ? 39.003  88.254  85.277  1.00 17.11 ? 86   LEU A C   1 
ATOM   646   O  O   . LEU A 1  86  ? 39.784  87.297  85.108  1.00 17.10 ? 86   LEU A O   1 
ATOM   647   C  CB  . LEU A 1  86  ? 37.534  88.196  83.195  1.00 17.70 ? 86   LEU A CB  1 
ATOM   648   C  CG  . LEU A 1  86  ? 36.294  87.455  83.718  1.00 17.78 ? 86   LEU A CG  1 
ATOM   649   C  CD1 . LEU A 1  86  ? 35.232  88.386  84.303  1.00 19.79 ? 86   LEU A CD1 1 
ATOM   650   C  CD2 . LEU A 1  86  ? 35.700  86.590  82.625  1.00 23.51 ? 86   LEU A CD2 1 
ATOM   651   N  N   . ASN A 1  87  ? 38.593  88.688  86.472  1.00 17.06 ? 87   ASN A N   1 
ATOM   652   C  CA  . ASN A 1  87  ? 39.062  88.137  87.755  1.00 17.64 ? 87   ASN A CA  1 
ATOM   653   C  C   . ASN A 1  87  ? 37.970  87.974  88.806  1.00 18.32 ? 87   ASN A C   1 
ATOM   654   O  O   . ASN A 1  87  ? 36.874  88.544  88.678  1.00 18.50 ? 87   ASN A O   1 
ATOM   655   C  CB  . ASN A 1  87  ? 40.239  88.960  88.305  1.00 18.01 ? 87   ASN A CB  1 
ATOM   656   C  CG  . ASN A 1  87  ? 41.264  88.103  89.062  1.00 28.07 ? 87   ASN A CG  1 
ATOM   657   O  OD1 . ASN A 1  87  ? 41.385  88.203  90.281  1.00 30.82 ? 87   ASN A OD1 1 
ATOM   658   N  ND2 . ASN A 1  87  ? 42.064  87.329  88.324  1.00 39.31 ? 87   ASN A ND2 1 
ATOM   659   N  N   . ALA A 1  88  ? 38.263  87.124  89.796  1.00 19.04 ? 88   ALA A N   1 
ATOM   660   C  CA  . ALA A 1  88  ? 37.363  86.765  90.893  1.00 19.43 ? 88   ALA A CA  1 
ATOM   661   C  C   . ALA A 1  88  ? 38.126  86.483  92.178  1.00 20.27 ? 88   ALA A C   1 
ATOM   662   O  O   . ALA A 1  88  ? 39.277  86.045  92.126  1.00 20.08 ? 88   ALA A O   1 
ATOM   663   C  CB  . ALA A 1  88  ? 36.523  85.551  90.508  1.00 18.85 ? 88   ALA A CB  1 
ATOM   664   N  N   . TYR A 1  89  ? 37.473  86.735  93.323  1.00 21.25 ? 89   TYR A N   1 
ATOM   665   C  CA  . TYR A 1  89  ? 37.902  86.221  94.644  1.00 21.87 ? 89   TYR A CA  1 
ATOM   666   C  C   . TYR A 1  89  ? 36.731  85.906  95.581  1.00 22.70 ? 89   TYR A C   1 
ATOM   667   O  O   . TYR A 1  89  ? 35.611  86.421  95.392  1.00 22.81 ? 89   TYR A O   1 
ATOM   668   C  CB  . TYR A 1  89  ? 38.947  87.145  95.322  1.00 21.59 ? 89   TYR A CB  1 
ATOM   669   C  CG  . TYR A 1  89  ? 38.474  88.558  95.628  1.00 15.60 ? 89   TYR A CG  1 
ATOM   670   C  CD1 . TYR A 1  89  ? 38.846  89.637  94.798  1.00 20.90 ? 89   TYR A CD1 1 
ATOM   671   C  CD2 . TYR A 1  89  ? 37.736  88.842  96.812  1.00 21.20 ? 89   TYR A CD2 1 
ATOM   672   C  CE1 . TYR A 1  89  ? 38.421  90.983  95.098  1.00 23.75 ? 89   TYR A CE1 1 
ATOM   673   C  CE2 . TYR A 1  89  ? 37.279  90.152  97.102  1.00 24.01 ? 89   TYR A CE2 1 
ATOM   674   C  CZ  . TYR A 1  89  ? 37.670  91.218  96.272  1.00 24.22 ? 89   TYR A CZ  1 
ATOM   675   O  OH  . TYR A 1  89  ? 37.192  92.471  96.545  1.00 33.36 ? 89   TYR A OH  1 
ATOM   676   N  N   . SER A 1  90  ? 36.974  84.948  96.482  1.00 23.22 ? 90   SER A N   1 
ATOM   677   C  CA  . SER A 1  90  ? 36.096  84.645  97.620  1.00 23.19 ? 90   SER A CA  1 
ATOM   678   C  C   . SER A 1  90  ? 36.864  84.658  98.940  1.00 23.44 ? 90   SER A C   1 
ATOM   679   O  O   . SER A 1  90  ? 37.942  84.042  99.050  1.00 23.38 ? 90   SER A O   1 
ATOM   680   C  CB  . SER A 1  90  ? 35.329  83.327  97.443  1.00 23.02 ? 90   SER A CB  1 
ATOM   681   O  OG  . SER A 1  90  ? 35.818  82.504  96.391  1.00 16.74 ? 90   SER A OG  1 
ATOM   682   N  N   . THR A 1  91  ? 36.468  85.610  99.788  1.00 23.44 ? 91   THR A N   1 
ATOM   683   C  CA  . THR A 1  91  ? 36.815  85.630  101.215 1.00 23.02 ? 91   THR A CA  1 
ATOM   684   C  C   . THR A 1  91  ? 35.723  84.889  102.031 1.00 22.65 ? 91   THR A C   1 
ATOM   685   O  O   . THR A 1  91  ? 34.790  84.283  101.453 1.00 23.05 ? 91   THR A O   1 
ATOM   686   C  CB  . THR A 1  91  ? 37.024  87.112  101.727 1.00 23.30 ? 91   THR A CB  1 
ATOM   687   O  OG1 . THR A 1  91  ? 35.822  87.864  101.533 1.00 34.80 ? 91   THR A OG1 1 
ATOM   688   C  CG2 . THR A 1  91  ? 38.083  87.884  100.906 1.00 22.44 ? 91   THR A CG2 1 
ATOM   689   N  N   . ARG A 1  92  ? 35.862  84.920  103.363 1.00 21.80 ? 92   ARG A N   1 
ATOM   690   C  CA  . ARG A 1  92  ? 34.853  84.410  104.315 1.00 20.48 ? 92   ARG A CA  1 
ATOM   691   C  C   . ARG A 1  92  ? 33.508  85.149  104.317 1.00 20.20 ? 92   ARG A C   1 
ATOM   692   O  O   . ARG A 1  92  ? 32.464  84.507  104.465 1.00 20.49 ? 92   ARG A O   1 
ATOM   693   C  CB  . ARG A 1  92  ? 35.443  84.295  105.723 1.00 19.86 ? 92   ARG A CB  1 
ATOM   694   C  CG  . ARG A 1  92  ? 36.461  83.174  105.835 1.00 4.51  ? 92   ARG A CG  1 
ATOM   695   C  CD  . ARG A 1  92  ? 36.990  82.897  107.224 1.00 13.73 ? 92   ARG A CD  1 
ATOM   696   N  NE  . ARG A 1  92  ? 37.898  81.727  107.252 1.00 10.51 ? 92   ARG A NE  1 
ATOM   697   C  CZ  . ARG A 1  92  ? 39.187  81.713  106.870 1.00 13.31 ? 92   ARG A CZ  1 
ATOM   698   N  NH1 . ARG A 1  92  ? 39.783  82.789  106.356 1.00 17.09 ? 92   ARG A NH1 1 
ATOM   699   N  NH2 . ARG A 1  92  ? 39.886  80.597  106.997 1.00 9.63  ? 92   ARG A NH2 1 
ATOM   700   N  N   . GLU A 1  93  ? 33.533  86.421  103.910 1.00 20.11 ? 93   GLU A N   1 
ATOM   701   C  CA  . GLU A 1  93  ? 32.376  87.325  103.960 1.00 20.02 ? 93   GLU A CA  1 
ATOM   702   C  C   . GLU A 1  93  ? 31.886  87.821  102.585 1.00 19.60 ? 93   GLU A C   1 
ATOM   703   O  O   . GLU A 1  93  ? 30.715  88.206  102.449 1.00 20.14 ? 93   GLU A O   1 
ATOM   704   C  CB  . GLU A 1  93  ? 32.683  88.507  104.877 1.00 20.26 ? 93   GLU A CB  1 
ATOM   705   C  CG  . GLU A 1  93  ? 31.528  88.932  105.750 1.00 29.87 ? 93   GLU A CG  1 
ATOM   706   C  CD  . GLU A 1  93  ? 31.968  89.454  107.104 1.00 30.16 ? 93   GLU A CD  1 
ATOM   707   O  OE1 . GLU A 1  93  ? 31.774  88.741  108.114 1.00 26.43 ? 93   GLU A OE1 1 
ATOM   708   O  OE2 . GLU A 1  93  ? 32.345  90.638  107.176 1.00 34.27 ? 93   GLU A OE2 1 
ATOM   709   N  N   . HIS A 1  94  ? 32.804  87.894  101.613 1.00 18.87 ? 94   HIS A N   1 
ATOM   710   C  CA  . HIS A 1  94  ? 32.612  88.643  100.354 1.00 18.14 ? 94   HIS A CA  1 
ATOM   711   C  C   . HIS A 1  94  ? 33.100  87.850  99.136  1.00 17.47 ? 94   HIS A C   1 
ATOM   712   O  O   . HIS A 1  94  ? 34.187  87.235  99.172  1.00 17.95 ? 94   HIS A O   1 
ATOM   713   C  CB  . HIS A 1  94  ? 33.326  90.017  100.385 1.00 17.97 ? 94   HIS A CB  1 
ATOM   714   C  CG  . HIS A 1  94  ? 33.105  90.811  101.639 1.00 23.73 ? 94   HIS A CG  1 
ATOM   715   N  ND1 . HIS A 1  94  ? 31.852  91.200  102.070 1.00 24.04 ? 94   HIS A ND1 1 
ATOM   716   C  CD2 . HIS A 1  94  ? 33.989  91.373  102.499 1.00 28.44 ? 94   HIS A CD2 1 
ATOM   717   C  CE1 . HIS A 1  94  ? 31.973  91.952  103.149 1.00 26.22 ? 94   HIS A CE1 1 
ATOM   718   N  NE2 . HIS A 1  94  ? 33.259  92.078  103.428 1.00 29.94 ? 94   HIS A NE2 1 
ATOM   719   N  N   . THR A 1  95  ? 32.232  87.769  98.127  1.00 16.41 ? 95   THR A N   1 
ATOM   720   C  CA  . THR A 1  95  ? 32.598  87.331  96.763  1.00 15.69 ? 95   THR A CA  1 
ATOM   721   C  C   . THR A 1  95  ? 32.600  88.526  95.802  1.00 14.38 ? 95   THR A C   1 
ATOM   722   O  O   . THR A 1  95  ? 31.657  89.329  95.812  1.00 14.04 ? 95   THR A O   1 
ATOM   723   C  CB  . THR A 1  95  ? 31.612  86.209  96.234  1.00 15.57 ? 95   THR A CB  1 
ATOM   724   O  OG1 . THR A 1  95  ? 31.371  85.237  97.256  1.00 18.06 ? 95   THR A OG1 1 
ATOM   725   C  CG2 . THR A 1  95  ? 32.263  85.375  95.119  1.00 15.70 ? 95   THR A CG2 1 
ATOM   726   N  N   . ALA A 1  96  ? 33.553  88.509  94.865  1.00 13.98 ? 96   ALA A N   1 
ATOM   727   C  CA  . ALA A 1  96  ? 33.701  89.542  93.825  1.00 14.16 ? 96   ALA A CA  1 
ATOM   728   C  C   . ALA A 1  96  ? 34.039  88.990  92.449  1.00 14.23 ? 96   ALA A C   1 
ATOM   729   O  O   . ALA A 1  96  ? 34.821  88.053  92.334  1.00 15.13 ? 96   ALA A O   1 
ATOM   730   C  CB  . ALA A 1  96  ? 34.722  90.576  94.242  1.00 14.30 ? 96   ALA A CB  1 
ATOM   731   N  N   . TYR A 1  97  ? 33.407  89.561  91.425  1.00 13.76 ? 97   TYR A N   1 
ATOM   732   C  CA  . TYR A 1  97  ? 33.729  89.317  90.010  1.00 13.58 ? 97   TYR A CA  1 
ATOM   733   C  C   . TYR A 1  97  ? 33.925  90.661  89.322  1.00 14.01 ? 97   TYR A C   1 
ATOM   734   O  O   . TYR A 1  97  ? 33.046  91.532  89.404  1.00 13.63 ? 97   TYR A O   1 
ATOM   735   C  CB  . TYR A 1  97  ? 32.588  88.538  89.320  1.00 13.23 ? 97   TYR A CB  1 
ATOM   736   C  CG  . TYR A 1  97  ? 32.213  87.229  89.986  1.00 16.13 ? 97   TYR A CG  1 
ATOM   737   C  CD1 . TYR A 1  97  ? 31.020  87.113  90.744  1.00 17.73 ? 97   TYR A CD1 1 
ATOM   738   C  CD2 . TYR A 1  97  ? 32.994  86.066  89.783  1.00 16.67 ? 97   TYR A CD2 1 
ATOM   739   C  CE1 . TYR A 1  97  ? 30.634  85.849  91.325  1.00 16.80 ? 97   TYR A CE1 1 
ATOM   740   C  CE2 . TYR A 1  97  ? 32.659  84.821  90.425  1.00 18.91 ? 97   TYR A CE2 1 
ATOM   741   C  CZ  . TYR A 1  97  ? 31.478  84.723  91.163  1.00 17.49 ? 97   TYR A CZ  1 
ATOM   742   O  OH  . TYR A 1  97  ? 31.150  83.511  91.721  1.00 27.13 ? 97   TYR A OH  1 
ATOM   743   N  N   . TYR A 1  98  ? 35.108  90.857  88.735  1.00 14.93 ? 98   TYR A N   1 
ATOM   744   C  CA  . TYR A 1  98  ? 35.490  92.152  88.137  1.00 15.84 ? 98   TYR A CA  1 
ATOM   745   C  C   . TYR A 1  98  ? 36.236  92.080  86.800  1.00 16.94 ? 98   TYR A C   1 
ATOM   746   O  O   . TYR A 1  98  ? 36.852  91.043  86.481  1.00 18.20 ? 98   TYR A O   1 
ATOM   747   C  CB  . TYR A 1  98  ? 36.170  93.100  89.156  1.00 15.36 ? 98   TYR A CB  1 
ATOM   748   C  CG  . TYR A 1  98  ? 37.512  92.635  89.665  1.00 23.13 ? 98   TYR A CG  1 
ATOM   749   C  CD1 . TYR A 1  98  ? 38.715  93.058  89.037  1.00 25.83 ? 98   TYR A CD1 1 
ATOM   750   C  CD2 . TYR A 1  98  ? 37.604  91.808  90.818  1.00 24.80 ? 98   TYR A CD2 1 
ATOM   751   C  CE1 . TYR A 1  98  ? 39.990  92.590  89.499  1.00 24.29 ? 98   TYR A CE1 1 
ATOM   752   C  CE2 . TYR A 1  98  ? 38.869  91.348  91.301  1.00 23.03 ? 98   TYR A CE2 1 
ATOM   753   C  CZ  . TYR A 1  98  ? 40.049  91.754  90.644  1.00 29.24 ? 98   TYR A CZ  1 
ATOM   754   O  OH  . TYR A 1  98  ? 41.266  91.292  91.096  1.00 34.11 ? 98   TYR A OH  1 
ATOM   755   N  N   . ILE A 1  99  ? 35.980  93.091  85.958  1.00 16.27 ? 99   ILE A N   1 
ATOM   756   C  CA  . ILE A 1  99  ? 36.639  93.274  84.666  1.00 15.72 ? 99   ILE A CA  1 
ATOM   757   C  C   . ILE A 1  99  ? 37.467  94.558  84.707  1.00 15.65 ? 99   ILE A C   1 
ATOM   758   O  O   . ILE A 1  99  ? 36.952  95.616  85.090  1.00 15.91 ? 99   ILE A O   1 
ATOM   759   C  CB  . ILE A 1  99  ? 35.595  93.265  83.441  1.00 15.64 ? 99   ILE A CB  1 
ATOM   760   C  CG1 . ILE A 1  99  ? 34.819  91.938  83.403  1.00 11.13 ? 99   ILE A CG1 1 
ATOM   761   C  CG2 . ILE A 1  99  ? 36.337  93.462  82.062  1.00 7.53  ? 99   ILE A CG2 1 
ATOM   762   C  CD1 . ILE A 1  99  ? 33.587  91.898  82.529  1.00 21.33 ? 99   ILE A CD1 1 
ATOM   763   N  N   . LYS A 1  100 ? 38.767  94.423  84.427  1.00 15.07 ? 100  LYS A N   1 
ATOM   764   C  CA  . LYS A 1  100 ? 39.584  95.529  83.904  1.00 14.93 ? 100  LYS A CA  1 
ATOM   765   C  C   . LYS A 1  100 ? 39.373  95.596  82.391  1.00 15.55 ? 100  LYS A C   1 
ATOM   766   O  O   . LYS A 1  100 ? 39.559  94.590  81.701  1.00 15.70 ? 100  LYS A O   1 
ATOM   767   C  CB  . LYS A 1  100 ? 41.074  95.334  84.222  1.00 14.27 ? 100  LYS A CB  1 
ATOM   768   C  CG  . LYS A 1  100 ? 41.446  95.362  85.701  1.00 2.00  ? 100  LYS A CG  1 
ATOM   769   C  CD  . LYS A 1  100 ? 42.965  95.189  85.901  1.00 10.32 ? 100  LYS A CD  1 
ATOM   770   C  CE  . LYS A 1  100 ? 43.807  96.523  85.900  1.00 8.16  ? 100  LYS A CE  1 
ATOM   771   N  NZ  . LYS A 1  100 ? 43.054  97.832  86.040  1.00 13.27 ? 100  LYS A NZ  1 
ATOM   772   N  N   . ALA A 1  101 ? 38.803  96.710  81.927  1.00 15.45 ? 101  ALA A N   1 
ATOM   773   C  CA  . ALA A 1  101 ? 38.610  96.977  80.499  1.00 15.74 ? 101  ALA A CA  1 
ATOM   774   C  C   . ALA A 1  101 ? 38.859  98.453  80.161  1.00 16.70 ? 101  ALA A C   1 
ATOM   775   O  O   . ALA A 1  101 ? 38.910  99.293  81.068  1.00 17.43 ? 101  ALA A O   1 
ATOM   776   C  CB  . ALA A 1  101 ? 37.197  96.546  80.063  1.00 15.22 ? 101  ALA A CB  1 
ATOM   777   N  N   . LEU A 1  102 ? 39.131  98.731  78.874  1.00 16.73 ? 102  LEU A N   1 
ATOM   778   C  CA  . LEU A 1  102 ? 38.893  100.044 78.232  1.00 17.32 ? 102  LEU A CA  1 
ATOM   779   C  C   . LEU A 1  102 ? 37.523  100.641 78.545  1.00 17.97 ? 102  LEU A C   1 
ATOM   780   O  O   . LEU A 1  102 ? 36.515  99.908  78.576  1.00 18.49 ? 102  LEU A O   1 
ATOM   781   C  CB  . LEU A 1  102 ? 39.050  99.906  76.709  1.00 17.10 ? 102  LEU A CB  1 
ATOM   782   C  CG  . LEU A 1  102 ? 40.232  100.466 75.904  1.00 14.95 ? 102  LEU A CG  1 
ATOM   783   C  CD1 . LEU A 1  102 ? 41.608  100.326 76.551  1.00 10.27 ? 102  LEU A CD1 1 
ATOM   784   C  CD2 . LEU A 1  102 ? 40.235  99.835  74.531  1.00 13.08 ? 102  LEU A CD2 1 
ATOM   785   N  N   . SER A 1  103 ? 37.508  101.959 78.788  1.00 18.00 ? 103  SER A N   1 
ATOM   786   C  CA  . SER A 1  103 ? 36.297  102.723 79.162  1.00 18.15 ? 103  SER A CA  1 
ATOM   787   C  C   . SER A 1  103 ? 35.171  102.654 78.131  1.00 18.50 ? 103  SER A C   1 
ATOM   788   O  O   . SER A 1  103 ? 33.999  102.502 78.505  1.00 18.44 ? 103  SER A O   1 
ATOM   789   C  CB  . SER A 1  103 ? 36.637  104.190 79.461  1.00 17.70 ? 103  SER A CB  1 
ATOM   790   O  OG  . SER A 1  103 ? 37.329  104.300 80.687  1.00 15.52 ? 103  SER A OG  1 
ATOM   791   N  N   . LYS A 1  104 ? 35.553  102.714 76.843  1.00 18.85 ? 104  LYS A N   1 
ATOM   792   C  CA  . LYS A 1  104 ? 34.665  102.473 75.687  1.00 18.92 ? 104  LYS A CA  1 
ATOM   793   C  C   . LYS A 1  104 ? 34.002  101.077 75.624  1.00 18.77 ? 104  LYS A C   1 
ATOM   794   O  O   . LYS A 1  104 ? 33.010  100.904 74.918  1.00 19.11 ? 104  LYS A O   1 
ATOM   795   C  CB  . LYS A 1  104 ? 35.358  102.845 74.355  1.00 19.12 ? 104  LYS A CB  1 
ATOM   796   C  CG  . LYS A 1  104 ? 36.623  102.032 73.972  1.00 22.06 ? 104  LYS A CG  1 
ATOM   797   C  CD  . LYS A 1  104 ? 36.956  102.214 72.482  1.00 27.35 ? 104  LYS A CD  1 
ATOM   798   C  CE  . LYS A 1  104 ? 37.719  101.017 71.895  1.00 29.70 ? 104  LYS A CE  1 
ATOM   799   N  NZ  . LYS A 1  104 ? 36.863  99.799  71.656  1.00 26.57 ? 104  LYS A NZ  1 
ATOM   800   N  N   . ASP A 1  105 ? 34.569  100.113 76.361  1.00 18.59 ? 105  ASP A N   1 
ATOM   801   C  CA  . ASP A 1  105 ? 34.065  98.737  76.468  1.00 18.41 ? 105  ASP A CA  1 
ATOM   802   C  C   . ASP A 1  105 ? 33.212  98.449  77.736  1.00 17.60 ? 105  ASP A C   1 
ATOM   803   O  O   . ASP A 1  105 ? 32.829  97.283  77.979  1.00 16.96 ? 105  ASP A O   1 
ATOM   804   C  CB  . ASP A 1  105 ? 35.230  97.726  76.330  1.00 18.58 ? 105  ASP A CB  1 
ATOM   805   C  CG  . ASP A 1  105 ? 35.916  97.779  74.962  1.00 25.01 ? 105  ASP A CG  1 
ATOM   806   O  OD1 . ASP A 1  105 ? 35.246  97.554  73.929  1.00 31.15 ? 105  ASP A OD1 1 
ATOM   807   O  OD2 . ASP A 1  105 ? 37.154  97.876  74.840  1.00 28.66 ? 105  ASP A OD2 1 
ATOM   808   N  N   . LEU A 1  106 ? 32.888  99.512  78.498  1.00 17.19 ? 106  LEU A N   1 
ATOM   809   C  CA  . LEU A 1  106 ? 31.985  99.435  79.666  1.00 17.03 ? 106  LEU A CA  1 
ATOM   810   C  C   . LEU A 1  106 ? 30.572  98.792  79.426  1.00 16.67 ? 106  LEU A C   1 
ATOM   811   O  O   . LEU A 1  106 ? 30.189  97.959  80.268  1.00 16.71 ? 106  LEU A O   1 
ATOM   812   C  CB  . LEU A 1  106 ? 31.913  100.766 80.447  1.00 17.01 ? 106  LEU A CB  1 
ATOM   813   C  CG  . LEU A 1  106 ? 31.280  100.812 81.850  1.00 21.11 ? 106  LEU A CG  1 
ATOM   814   C  CD1 . LEU A 1  106 ? 32.325  100.948 82.923  1.00 27.06 ? 106  LEU A CD1 1 
ATOM   815   C  CD2 . LEU A 1  106 ? 30.272  101.932 81.965  1.00 23.18 ? 106  LEU A CD2 1 
ATOM   816   N  N   . PRO A 1  107 ? 29.863  99.072  78.289  1.00 15.88 ? 107  PRO A N   1 
ATOM   817   C  CA  . PRO A 1  107 ? 28.617  98.341  77.980  1.00 15.28 ? 107  PRO A CA  1 
ATOM   818   C  C   . PRO A 1  107 ? 28.696  96.815  77.874  1.00 15.29 ? 107  PRO A C   1 
ATOM   819   O  O   . PRO A 1  107 ? 27.901  96.170  78.587  1.00 15.48 ? 107  PRO A O   1 
ATOM   820   C  CB  . PRO A 1  107 ? 28.129  98.990  76.684  1.00 15.22 ? 107  PRO A CB  1 
ATOM   821   C  CG  . PRO A 1  107 ? 28.613  100.396 76.781  1.00 17.10 ? 107  PRO A CG  1 
ATOM   822   C  CD  . PRO A 1  107 ? 29.976  100.261 77.395  1.00 15.58 ? 107  PRO A CD  1 
ATOM   823   N  N   . LYS A 1  108 ? 29.702  96.269  77.170  1.00 14.89 ? 108  LYS A N   1 
ATOM   824   C  CA  . LYS A 1  108 ? 29.900  94.816  77.084  1.00 14.63 ? 108  LYS A CA  1 
ATOM   825   C  C   . LYS A 1  108 ? 30.412  94.188  78.372  1.00 14.74 ? 108  LYS A C   1 
ATOM   826   O  O   . LYS A 1  108 ? 29.951  93.096  78.739  1.00 14.63 ? 108  LYS A O   1 
ATOM   827   C  CB  . LYS A 1  108 ? 30.749  94.403  75.873  1.00 14.87 ? 108  LYS A CB  1 
ATOM   828   C  CG  . LYS A 1  108 ? 30.282  93.088  75.167  1.00 23.15 ? 108  LYS A CG  1 
ATOM   829   C  CD  . LYS A 1  108 ? 29.161  93.340  74.116  1.00 30.02 ? 108  LYS A CD  1 
ATOM   830   C  CE  . LYS A 1  108 ? 29.074  92.232  73.066  1.00 37.44 ? 108  LYS A CE  1 
ATOM   831   N  NZ  . LYS A 1  108 ? 28.073  91.160  73.397  1.00 33.57 ? 108  LYS A NZ  1 
ATOM   832   N  N   . ALA A 1  109 ? 31.307  94.907  79.077  1.00 14.57 ? 109  ALA A N   1 
ATOM   833   C  CA  . ALA A 1  109 ? 31.789  94.535  80.416  1.00 14.43 ? 109  ALA A CA  1 
ATOM   834   C  C   . ALA A 1  109 ? 30.681  94.353  81.465  1.00 14.72 ? 109  ALA A C   1 
ATOM   835   O  O   . ALA A 1  109 ? 30.625  93.294  82.101  1.00 15.23 ? 109  ALA A O   1 
ATOM   836   C  CB  . ALA A 1  109 ? 32.841  95.496  80.899  1.00 14.54 ? 109  ALA A CB  1 
ATOM   837   N  N   . VAL A 1  110 ? 29.710  95.282  81.488  1.00 14.34 ? 110  VAL A N   1 
ATOM   838   C  CA  . VAL A 1  110 ? 28.528  95.189  82.373  1.00 14.51 ? 110  VAL A CA  1 
ATOM   839   C  C   . VAL A 1  110 ? 27.597  94.030  81.928  1.00 14.88 ? 110  VAL A C   1 
ATOM   840   O  O   . VAL A 1  110 ? 27.182  93.215  82.774  1.00 15.09 ? 110  VAL A O   1 
ATOM   841   C  CB  . VAL A 1  110 ? 27.768  96.581  82.542  1.00 14.27 ? 110  VAL A CB  1 
ATOM   842   C  CG1 . VAL A 1  110 ? 26.449  96.435  83.354  1.00 12.76 ? 110  VAL A CG1 1 
ATOM   843   C  CG2 . VAL A 1  110 ? 28.666  97.614  83.246  1.00 8.67  ? 110  VAL A CG2 1 
ATOM   844   N  N   . GLU A 1  111 ? 27.351  93.947  80.608  1.00 15.08 ? 111  GLU A N   1 
ATOM   845   C  CA  . GLU A 1  111 ? 26.648  92.835  79.945  1.00 15.48 ? 111  GLU A CA  1 
ATOM   846   C  C   . GLU A 1  111 ? 27.176  91.432  80.315  1.00 16.06 ? 111  GLU A C   1 
ATOM   847   O  O   . GLU A 1  111 ? 26.399  90.606  80.818  1.00 16.51 ? 111  GLU A O   1 
ATOM   848   C  CB  . GLU A 1  111 ? 26.618  93.027  78.422  1.00 15.29 ? 111  GLU A CB  1 
ATOM   849   C  CG  . GLU A 1  111 ? 25.342  92.526  77.750  1.00 18.64 ? 111  GLU A CG  1 
ATOM   850   C  CD  . GLU A 1  111 ? 25.519  92.127  76.291  1.00 21.94 ? 111  GLU A CD  1 
ATOM   851   O  OE1 . GLU A 1  111 ? 26.107  92.905  75.505  1.00 23.14 ? 111  GLU A OE1 1 
ATOM   852   O  OE2 . GLU A 1  111 ? 24.942  91.088  75.898  1.00 25.58 ? 111  GLU A OE2 1 
ATOM   853   N  N   . LEU A 1  112 ? 28.506  91.267  80.276  1.00 15.94 ? 112  LEU A N   1 
ATOM   854   C  CA  . LEU A 1  112 ? 29.165  89.999  80.621  1.00 15.97 ? 112  LEU A CA  1 
ATOM   855   C  C   . LEU A 1  112 ? 29.077  89.633  82.106  1.00 16.71 ? 112  LEU A C   1 
ATOM   856   O  O   . LEU A 1  112 ? 28.775  88.478  82.431  1.00 16.71 ? 112  LEU A O   1 
ATOM   857   C  CB  . LEU A 1  112 ? 30.617  89.957  80.133  1.00 15.48 ? 112  LEU A CB  1 
ATOM   858   C  CG  . LEU A 1  112 ? 30.961  90.033  78.638  1.00 11.28 ? 112  LEU A CG  1 
ATOM   859   C  CD1 . LEU A 1  112 ? 32.420  90.338  78.493  1.00 12.78 ? 112  LEU A CD1 1 
ATOM   860   C  CD2 . LEU A 1  112 ? 30.608  88.794  77.842  1.00 13.93 ? 112  LEU A CD2 1 
ATOM   861   N  N   . LEU A 1  113 ? 29.213  90.649  82.975  1.00 17.19 ? 113  LEU A N   1 
ATOM   862   C  CA  . LEU A 1  113 ? 29.126  90.506  84.437  1.00 17.65 ? 113  LEU A CA  1 
ATOM   863   C  C   . LEU A 1  113 ? 27.746  90.052  84.911  1.00 18.23 ? 113  LEU A C   1 
ATOM   864   O  O   . LEU A 1  113 ? 27.650  89.115  85.716  1.00 18.03 ? 113  LEU A O   1 
ATOM   865   C  CB  . LEU A 1  113 ? 29.550  91.810  85.146  1.00 17.63 ? 113  LEU A CB  1 
ATOM   866   C  CG  . LEU A 1  113 ? 30.907  92.065  85.851  1.00 17.77 ? 113  LEU A CG  1 
ATOM   867   C  CD1 . LEU A 1  113 ? 31.993  90.935  85.861  1.00 9.48  ? 113  LEU A CD1 1 
ATOM   868   C  CD2 . LEU A 1  113 ? 31.505  93.393  85.408  1.00 20.34 ? 113  LEU A CD2 1 
ATOM   869   N  N   . ALA A 1  114 ? 26.702  90.629  84.297  1.00 19.06 ? 114  ALA A N   1 
ATOM   870   C  CA  . ALA A 1  114 ? 25.295  90.222  84.467  1.00 19.43 ? 114  ALA A CA  1 
ATOM   871   C  C   . ALA A 1  114 ? 25.027  88.776  84.040  1.00 19.54 ? 114  ALA A C   1 
ATOM   872   O  O   . ALA A 1  114 ? 24.401  88.026  84.785  1.00 19.65 ? 114  ALA A O   1 
ATOM   873   C  CB  . ALA A 1  114 ? 24.384  91.175  83.718  1.00 19.62 ? 114  ALA A CB  1 
ATOM   874   N  N   . ASP A 1  115 ? 25.652  88.376  82.926  1.00 19.54 ? 115  ASP A N   1 
ATOM   875   C  CA  . ASP A 1  115 ? 25.552  87.038  82.353  1.00 19.57 ? 115  ASP A CA  1 
ATOM   876   C  C   . ASP A 1  115 ? 26.223  85.972  83.215  1.00 19.98 ? 115  ASP A C   1 
ATOM   877   O  O   . ASP A 1  115 ? 25.607  84.935  83.471  1.00 20.06 ? 115  ASP A O   1 
ATOM   878   C  CB  . ASP A 1  115 ? 26.106  87.035  80.922  1.00 19.51 ? 115  ASP A CB  1 
ATOM   879   C  CG  . ASP A 1  115 ? 25.622  85.850  80.079  1.00 25.28 ? 115  ASP A CG  1 
ATOM   880   O  OD1 . ASP A 1  115 ? 24.601  85.177  80.399  1.00 30.73 ? 115  ASP A OD1 1 
ATOM   881   O  OD2 . ASP A 1  115 ? 26.190  85.560  79.007  1.00 27.76 ? 115  ASP A OD2 1 
ATOM   882   N  N   . ILE A 1  116 ? 27.397  86.310  83.784  1.00 20.44 ? 116  ILE A N   1 
ATOM   883   C  CA  . ILE A 1  116 ? 28.116  85.479  84.778  1.00 20.50 ? 116  ILE A CA  1 
ATOM   884   C  C   . ILE A 1  116 ? 27.278  85.266  86.051  1.00 20.64 ? 116  ILE A C   1 
ATOM   885   O  O   . ILE A 1  116 ? 26.953  84.115  86.389  1.00 20.47 ? 116  ILE A O   1 
ATOM   886   C  CB  . ILE A 1  116 ? 29.557  86.044  85.096  1.00 20.42 ? 116  ILE A CB  1 
ATOM   887   C  CG1 . ILE A 1  116 ? 30.469  85.937  83.859  1.00 26.22 ? 116  ILE A CG1 1 
ATOM   888   C  CG2 . ILE A 1  116 ? 30.223  85.279  86.293  1.00 24.61 ? 116  ILE A CG2 1 
ATOM   889   C  CD1 . ILE A 1  116 ? 31.543  87.049  83.741  1.00 30.50 ? 116  ILE A CD1 1 
ATOM   890   N  N   . VAL A 1  117 ? 26.792  86.376  86.612  1.00 20.88 ? 117  VAL A N   1 
ATOM   891   C  CA  . VAL A 1  117 ? 26.233  86.427  87.965  1.00 21.26 ? 117  VAL A CA  1 
ATOM   892   C  C   . VAL A 1  117 ? 24.802  85.824  88.083  1.00 21.52 ? 117  VAL A C   1 
ATOM   893   O  O   . VAL A 1  117 ? 24.363  85.486  89.190  1.00 21.75 ? 117  VAL A O   1 
ATOM   894   C  CB  . VAL A 1  117 ? 26.376  87.871  88.553  1.00 21.41 ? 117  VAL A CB  1 
ATOM   895   C  CG1 . VAL A 1  117 ? 25.171  88.772  88.238  1.00 27.01 ? 117  VAL A CG1 1 
ATOM   896   C  CG2 . VAL A 1  117 ? 26.733  87.856  90.012  1.00 24.72 ? 117  VAL A CG2 1 
ATOM   897   N  N   . GLN A 1  118 ? 24.104  85.728  86.940  1.00 21.55 ? 118  GLN A N   1 
ATOM   898   C  CA  . GLN A 1  118 ? 22.686  85.325  86.845  1.00 21.94 ? 118  GLN A CA  1 
ATOM   899   C  C   . GLN A 1  118 ? 22.510  83.995  86.104  1.00 21.91 ? 118  GLN A C   1 
ATOM   900   O  O   . GLN A 1  118 ? 21.703  83.158  86.520  1.00 21.50 ? 118  GLN A O   1 
ATOM   901   C  CB  . GLN A 1  118 ? 21.842  86.407  86.141  1.00 21.91 ? 118  GLN A CB  1 
ATOM   902   C  CG  . GLN A 1  118 ? 21.714  87.729  86.890  1.00 24.09 ? 118  GLN A CG  1 
ATOM   903   C  CD  . GLN A 1  118 ? 21.040  88.806  86.063  1.00 26.16 ? 118  GLN A CD  1 
ATOM   904   O  OE1 . GLN A 1  118 ? 19.823  88.781  85.876  1.00 35.64 ? 118  GLN A OE1 1 
ATOM   905   N  NE2 . GLN A 1  118 ? 21.810  89.795  85.639  1.00 22.92 ? 118  GLN A NE2 1 
ATOM   906   N  N   . ASN A 1  119 ? 23.275  83.824  85.016  1.00 22.43 ? 119  ASN A N   1 
ATOM   907   C  CA  . ASN A 1  119 ? 22.999  82.836  83.964  1.00 22.94 ? 119  ASN A CA  1 
ATOM   908   C  C   . ASN A 1  119 ? 24.130  81.805  83.754  1.00 23.36 ? 119  ASN A C   1 
ATOM   909   O  O   . ASN A 1  119 ? 24.218  81.176  82.685  1.00 23.56 ? 119  ASN A O   1 
ATOM   910   C  CB  . ASN A 1  119 ? 22.606  83.538  82.641  1.00 22.82 ? 119  ASN A CB  1 
ATOM   911   C  CG  . ASN A 1  119 ? 21.379  84.436  82.778  1.00 25.45 ? 119  ASN A CG  1 
ATOM   912   O  OD1 . ASN A 1  119 ? 21.457  85.634  82.493  1.00 29.86 ? 119  ASN A OD1 1 
ATOM   913   N  ND2 . ASN A 1  119 ? 20.216  83.837  83.065  1.00 18.07 ? 119  ASN A ND2 1 
ATOM   914   N  N   . CYS A 1  120 ? 24.871  81.531  84.838  1.00 23.76 ? 120  CYS A N   1 
ATOM   915   C  CA  . CYS A 1  120 ? 25.930  80.512  84.884  1.00 24.18 ? 120  CYS A CA  1 
ATOM   916   C  C   . CYS A 1  120 ? 25.373  79.099  84.643  1.00 24.11 ? 120  CYS A C   1 
ATOM   917   O  O   . CYS A 1  120 ? 24.371  78.703  85.264  1.00 24.13 ? 120  CYS A O   1 
ATOM   918   C  CB  . CYS A 1  120 ? 26.684  80.587  86.212  1.00 24.34 ? 120  CYS A CB  1 
ATOM   919   S  SG  . CYS A 1  120 ? 28.013  79.377  86.385  1.00 44.30 ? 120  CYS A SG  1 
ATOM   920   N  N   . SER A 1  121 ? 26.004  78.402  83.687  1.00 23.83 ? 121  SER A N   1 
ATOM   921   C  CA  . SER A 1  121 ? 25.530  77.137  83.107  1.00 23.41 ? 121  SER A CA  1 
ATOM   922   C  C   . SER A 1  121 ? 25.507  75.971  84.093  1.00 23.18 ? 121  SER A C   1 
ATOM   923   O  O   . SER A 1  121 ? 24.491  75.255  84.172  1.00 23.24 ? 121  SER A O   1 
ATOM   924   C  CB  . SER A 1  121 ? 26.373  76.761  81.885  1.00 23.47 ? 121  SER A CB  1 
ATOM   925   O  OG  . SER A 1  121 ? 25.941  77.450  80.731  1.00 23.14 ? 121  SER A OG  1 
ATOM   926   N  N   . LEU A 1  122 ? 26.564  75.897  84.925  1.00 22.69 ? 122  LEU A N   1 
ATOM   927   C  CA  . LEU A 1  122 ? 26.987  74.717  85.711  1.00 22.40 ? 122  LEU A CA  1 
ATOM   928   C  C   . LEU A 1  122 ? 26.779  73.361  85.021  1.00 22.73 ? 122  LEU A C   1 
ATOM   929   O  O   . LEU A 1  122 ? 25.963  72.539  85.469  1.00 23.04 ? 122  LEU A O   1 
ATOM   930   C  CB  . LEU A 1  122 ? 26.437  74.738  87.166  1.00 22.34 ? 122  LEU A CB  1 
ATOM   931   C  CG  . LEU A 1  122 ? 26.174  76.007  88.001  1.00 23.88 ? 122  LEU A CG  1 
ATOM   932   C  CD1 . LEU A 1  122 ? 25.060  75.735  88.987  1.00 27.04 ? 122  LEU A CD1 1 
ATOM   933   C  CD2 . LEU A 1  122 ? 27.409  76.485  88.737  1.00 17.75 ? 122  LEU A CD2 1 
ATOM   934   N  N   . GLU A 1  123 ? 27.375  73.225  83.831  1.00 22.94 ? 123  GLU A N   1 
ATOM   935   C  CA  . GLU A 1  123 ? 27.310  71.979  83.038  1.00 23.34 ? 123  GLU A CA  1 
ATOM   936   C  C   . GLU A 1  123 ? 28.007  70.849  83.785  1.00 23.35 ? 123  GLU A C   1 
ATOM   937   O  O   . GLU A 1  123 ? 29.073  71.069  84.348  1.00 23.05 ? 123  GLU A O   1 
ATOM   938   C  CB  . GLU A 1  123 ? 27.913  72.154  81.627  1.00 23.69 ? 123  GLU A CB  1 
ATOM   939   C  CG  . GLU A 1  123 ? 27.203  73.158  80.692  1.00 29.50 ? 123  GLU A CG  1 
ATOM   940   C  CD  . GLU A 1  123 ? 25.766  72.785  80.290  1.00 34.40 ? 123  GLU A CD  1 
ATOM   941   O  OE1 . GLU A 1  123 ? 25.448  71.580  80.109  1.00 34.03 ? 123  GLU A OE1 1 
ATOM   942   O  OE2 . GLU A 1  123 ? 24.969  73.723  80.067  1.00 35.67 ? 123  GLU A OE2 1 
ATOM   943   N  N   . ASP A 1  124 ? 27.302  69.716  83.929  1.00 23.81 ? 124  ASP A N   1 
ATOM   944   C  CA  . ASP A 1  124 ? 27.704  68.567  84.777  1.00 24.16 ? 124  ASP A CA  1 
ATOM   945   C  C   . ASP A 1  124 ? 29.130  68.024  84.505  1.00 24.05 ? 124  ASP A C   1 
ATOM   946   O  O   . ASP A 1  124 ? 29.859  67.681  85.453  1.00 24.04 ? 124  ASP A O   1 
ATOM   947   C  CB  . ASP A 1  124 ? 26.668  67.435  84.692  1.00 24.53 ? 124  ASP A CB  1 
ATOM   948   C  CG  . ASP A 1  124 ? 25.293  67.851  85.216  1.00 34.87 ? 124  ASP A CG  1 
ATOM   949   O  OD1 . ASP A 1  124 ? 24.408  68.155  84.388  1.00 40.85 ? 124  ASP A OD1 1 
ATOM   950   O  OD2 . ASP A 1  124 ? 25.002  67.895  86.433  1.00 38.51 ? 124  ASP A OD2 1 
ATOM   951   N  N   . SER A 1  125 ? 29.513  68.006  83.220  1.00 23.89 ? 125  SER A N   1 
ATOM   952   C  CA  . SER A 1  125 ? 30.880  67.729  82.760  1.00 23.88 ? 125  SER A CA  1 
ATOM   953   C  C   . SER A 1  125 ? 31.933  68.742  83.252  1.00 23.94 ? 125  SER A C   1 
ATOM   954   O  O   . SER A 1  125 ? 33.070  68.345  83.548  1.00 23.88 ? 125  SER A O   1 
ATOM   955   C  CB  . SER A 1  125 ? 30.922  67.607  81.235  1.00 23.77 ? 125  SER A CB  1 
ATOM   956   O  OG  . SER A 1  125 ? 30.465  68.799  80.618  1.00 26.28 ? 125  SER A OG  1 
ATOM   957   N  N   . GLN A 1  126 ? 31.549  70.029  83.322  1.00 23.98 ? 126  GLN A N   1 
ATOM   958   C  CA  . GLN A 1  126 ? 32.386  71.089  83.896  1.00 24.28 ? 126  GLN A CA  1 
ATOM   959   C  C   . GLN A 1  126 ? 32.603  70.962  85.402  1.00 24.44 ? 126  GLN A C   1 
ATOM   960   O  O   . GLN A 1  126 ? 33.764  71.015  85.839  1.00 25.08 ? 126  GLN A O   1 
ATOM   961   C  CB  . GLN A 1  126 ? 31.894  72.505  83.534  1.00 24.45 ? 126  GLN A CB  1 
ATOM   962   C  CG  . GLN A 1  126 ? 32.516  73.149  82.254  1.00 26.65 ? 126  GLN A CG  1 
ATOM   963   C  CD  . GLN A 1  126 ? 34.045  73.380  82.285  1.00 25.93 ? 126  GLN A CD  1 
ATOM   964   O  OE1 . GLN A 1  126 ? 34.664  73.431  81.225  1.00 28.56 ? 126  GLN A OE1 1 
ATOM   965   N  NE2 . GLN A 1  126 ? 34.612  73.651  83.466  1.00 27.45 ? 126  GLN A NE2 1 
ATOM   966   N  N   . ILE A 1  127 ? 31.516  70.729  86.171  1.00 24.00 ? 127  ILE A N   1 
ATOM   967   C  CA  . ILE A 1  127 ? 31.593  70.433  87.633  1.00 23.88 ? 127  ILE A CA  1 
ATOM   968   C  C   . ILE A 1  127 ? 32.558  69.291  88.010  1.00 23.66 ? 127  ILE A C   1 
ATOM   969   O  O   . ILE A 1  127 ? 33.376  69.452  88.929  1.00 23.49 ? 127  ILE A O   1 
ATOM   970   C  CB  . ILE A 1  127 ? 30.160  70.422  88.442  1.00 23.82 ? 127  ILE A CB  1 
ATOM   971   C  CG1 . ILE A 1  127 ? 29.963  69.250  89.443  1.00 20.74 ? 127  ILE A CG1 1 
ATOM   972   C  CG2 . ILE A 1  127 ? 28.933  71.004  87.667  1.00 15.05 ? 127  ILE A CG2 1 
ATOM   973   C  CD1 . ILE A 1  127 ? 29.353  67.911  88.865  1.00 41.80 ? 127  ILE A CD1 1 
ATOM   974   N  N   . GLU A 1  128 ? 32.537  68.231  87.191  1.00 23.62 ? 128  GLU A N   1 
ATOM   975   C  CA  . GLU A 1  128 ? 33.462  67.095  87.287  1.00 23.56 ? 128  GLU A CA  1 
ATOM   976   C  C   . GLU A 1  128 ? 34.933  67.440  86.998  1.00 23.18 ? 128  GLU A C   1 
ATOM   977   O  O   . GLU A 1  128 ? 35.829  66.947  87.705  1.00 23.22 ? 128  GLU A O   1 
ATOM   978   C  CB  . GLU A 1  128 ? 32.983  65.930  86.416  1.00 23.52 ? 128  GLU A CB  1 
ATOM   979   C  CG  . GLU A 1  128 ? 33.045  64.549  87.079  1.00 33.14 ? 128  GLU A CG  1 
ATOM   980   C  CD  . GLU A 1  128 ? 32.150  64.372  88.322  1.00 33.38 ? 128  GLU A CD  1 
ATOM   981   O  OE1 . GLU A 1  128 ? 31.039  64.960  88.414  1.00 30.97 ? 128  GLU A OE1 1 
ATOM   982   O  OE2 . GLU A 1  128 ? 32.597  63.680  89.258  1.00 36.11 ? 128  GLU A OE2 1 
ATOM   983   N  N   . LYS A 1  129 ? 35.170  68.273  85.974  1.00 22.60 ? 129  LYS A N   1 
ATOM   984   C  CA  . LYS A 1  129 ? 36.516  68.776  85.655  1.00 22.50 ? 129  LYS A CA  1 
ATOM   985   C  C   . LYS A 1  129 ? 37.115  69.635  86.777  1.00 22.14 ? 129  LYS A C   1 
ATOM   986   O  O   . LYS A 1  129 ? 38.222  69.340  87.243  1.00 21.99 ? 129  LYS A O   1 
ATOM   987   C  CB  . LYS A 1  129 ? 36.535  69.504  84.315  1.00 22.55 ? 129  LYS A CB  1 
ATOM   988   C  CG  . LYS A 1  129 ? 36.958  68.615  83.157  1.00 29.55 ? 129  LYS A CG  1 
ATOM   989   C  CD  . LYS A 1  129 ? 37.186  69.418  81.876  1.00 33.80 ? 129  LYS A CD  1 
ATOM   990   C  CE  . LYS A 1  129 ? 36.456  68.788  80.691  1.00 33.72 ? 129  LYS A CE  1 
ATOM   991   N  NZ  . LYS A 1  129 ? 36.632  69.586  79.442  1.00 37.04 ? 129  LYS A NZ  1 
ATOM   992   N  N   . GLU A 1  130 ? 36.257  70.485  87.357  1.00 21.97 ? 130  GLU A N   1 
ATOM   993   C  CA  . GLU A 1  130 ? 36.599  71.411  88.431  1.00 21.86 ? 130  GLU A CA  1 
ATOM   994   C  C   . GLU A 1  130 ? 36.890  70.749  89.775  1.00 22.17 ? 130  GLU A C   1 
ATOM   995   O  O   . GLU A 1  130 ? 37.689  71.274  90.553  1.00 22.94 ? 130  GLU A O   1 
ATOM   996   C  CB  . GLU A 1  130 ? 35.520  72.502  88.589  1.00 21.78 ? 130  GLU A CB  1 
ATOM   997   C  CG  . GLU A 1  130 ? 35.368  73.524  87.439  1.00 25.38 ? 130  GLU A CG  1 
ATOM   998   C  CD  . GLU A 1  130 ? 36.680  73.994  86.794  1.00 22.47 ? 130  GLU A CD  1 
ATOM   999   O  OE1 . GLU A 1  130 ? 37.567  74.501  87.517  1.00 25.35 ? 130  GLU A OE1 1 
ATOM   1000  O  OE2 . GLU A 1  130 ? 36.837  73.804  85.564  1.00 23.40 ? 130  GLU A OE2 1 
ATOM   1001  N  N   . ARG A 1  131 ? 36.183  69.653  90.062  1.00 21.81 ? 131  ARG A N   1 
ATOM   1002  C  CA  . ARG A 1  131 ? 36.465  68.740  91.184  1.00 21.38 ? 131  ARG A CA  1 
ATOM   1003  C  C   . ARG A 1  131 ? 37.965  68.405  91.356  1.00 21.01 ? 131  ARG A C   1 
ATOM   1004  O  O   . ARG A 1  131 ? 38.546  68.770  92.382  1.00 20.62 ? 131  ARG A O   1 
ATOM   1005  C  CB  . ARG A 1  131 ? 35.623  67.472  91.037  1.00 20.85 ? 131  ARG A CB  1 
ATOM   1006  C  CG  . ARG A 1  131 ? 35.329  66.726  92.305  1.00 14.04 ? 131  ARG A CG  1 
ATOM   1007  C  CD  . ARG A 1  131 ? 34.345  65.573  92.100  1.00 22.04 ? 131  ARG A CD  1 
ATOM   1008  N  NE  . ARG A 1  131 ? 33.055  65.889  92.720  1.00 22.95 ? 131  ARG A NE  1 
ATOM   1009  C  CZ  . ARG A 1  131 ? 31.975  66.354  92.095  1.00 20.05 ? 131  ARG A CZ  1 
ATOM   1010  N  NH1 . ARG A 1  131 ? 31.865  66.334  90.776  1.00 23.54 ? 131  ARG A NH1 1 
ATOM   1011  N  NH2 . ARG A 1  131 ? 30.948  66.758  92.810  1.00 19.58 ? 131  ARG A NH2 1 
ATOM   1012  N  N   . ASP A 1  132 ? 38.591  67.925  90.266  1.00 21.03 ? 132  ASP A N   1 
ATOM   1013  C  CA  . ASP A 1  132 ? 40.024  67.597  90.215  1.00 20.68 ? 132  ASP A CA  1 
ATOM   1014  C  C   . ASP A 1  132 ? 40.946  68.810  90.307  1.00 20.41 ? 132  ASP A C   1 
ATOM   1015  O  O   . ASP A 1  132 ? 42.022  68.707  90.907  1.00 20.42 ? 132  ASP A O   1 
ATOM   1016  C  CB  . ASP A 1  132 ? 40.361  66.768  88.973  1.00 20.77 ? 132  ASP A CB  1 
ATOM   1017  C  CG  . ASP A 1  132 ? 39.828  65.323  89.047  1.00 33.06 ? 132  ASP A CG  1 
ATOM   1018  O  OD1 . ASP A 1  132 ? 40.083  64.613  90.058  1.00 36.36 ? 132  ASP A OD1 1 
ATOM   1019  O  OD2 . ASP A 1  132 ? 39.260  64.770  88.074  1.00 29.42 ? 132  ASP A OD2 1 
ATOM   1020  N  N   . VAL A 1  133 ? 40.512  69.941  89.723  1.00 20.27 ? 133  VAL A N   1 
ATOM   1021  C  CA  . VAL A 1  133 ? 41.227  71.236  89.785  1.00 20.06 ? 133  VAL A CA  1 
ATOM   1022  C  C   . VAL A 1  133 ? 41.292  71.783  91.227  1.00 19.99 ? 133  VAL A C   1 
ATOM   1023  O  O   . VAL A 1  133 ? 42.395  72.045  91.708  1.00 20.27 ? 133  VAL A O   1 
ATOM   1024  C  CB  . VAL A 1  133 ? 40.696  72.306  88.722  1.00 20.07 ? 133  VAL A CB  1 
ATOM   1025  C  CG1 . VAL A 1  133 ? 41.399  73.688  88.865  1.00 11.39 ? 133  VAL A CG1 1 
ATOM   1026  C  CG2 . VAL A 1  133 ? 40.898  71.811  87.288  1.00 16.89 ? 133  VAL A CG2 1 
ATOM   1027  N  N   . ILE A 1  134 ? 40.137  71.830  91.919  1.00 19.70 ? 134  ILE A N   1 
ATOM   1028  C  CA  . ILE A 1  134 ? 40.036  72.239  93.347  1.00 19.38 ? 134  ILE A CA  1 
ATOM   1029  C  C   . ILE A 1  134 ? 40.887  71.373  94.289  1.00 19.14 ? 134  ILE A C   1 
ATOM   1030  O  O   . ILE A 1  134 ? 41.669  71.938  95.070  1.00 19.27 ? 134  ILE A O   1 
ATOM   1031  C  CB  . ILE A 1  134 ? 38.538  72.383  93.864  1.00 19.00 ? 134  ILE A CB  1 
ATOM   1032  C  CG1 . ILE A 1  134 ? 37.791  73.459  93.067  1.00 13.28 ? 134  ILE A CG1 1 
ATOM   1033  C  CG2 . ILE A 1  134 ? 38.510  72.846  95.374  1.00 23.96 ? 134  ILE A CG2 1 
ATOM   1034  C  CD1 . ILE A 1  134 ? 36.298  73.286  92.985  1.00 10.78 ? 134  ILE A CD1 1 
ATOM   1035  N  N   . LEU A 1  135 ? 40.805  70.036  94.134  1.00 18.22 ? 135  LEU A N   1 
ATOM   1036  C  CA  . LEU A 1  135 ? 41.636  69.084  94.909  1.00 17.87 ? 135  LEU A CA  1 
ATOM   1037  C  C   . LEU A 1  135 ? 43.152  69.289  94.794  1.00 17.96 ? 135  LEU A C   1 
ATOM   1038  O  O   . LEU A 1  135 ? 43.848  69.284  95.817  1.00 17.89 ? 135  LEU A O   1 
ATOM   1039  C  CB  . LEU A 1  135 ? 41.273  67.617  94.628  1.00 17.49 ? 135  LEU A CB  1 
ATOM   1040  C  CG  . LEU A 1  135 ? 39.918  67.010  95.039  1.00 18.13 ? 135  LEU A CG  1 
ATOM   1041  C  CD1 . LEU A 1  135 ? 39.792  65.613  94.428  1.00 2.00  ? 135  LEU A CD1 1 
ATOM   1042  C  CD2 . LEU A 1  135 ? 39.689  66.941  96.573  1.00 21.21 ? 135  LEU A CD2 1 
ATOM   1043  N  N   . GLN A 1  136 ? 43.617  69.611  93.577  1.00 18.19 ? 136  GLN A N   1 
ATOM   1044  C  CA  . GLN A 1  136 ? 45.032  69.927  93.308  1.00 18.26 ? 136  GLN A CA  1 
ATOM   1045  C  C   . GLN A 1  136 ? 45.458  71.249  93.939  1.00 18.25 ? 136  GLN A C   1 
ATOM   1046  O  O   . GLN A 1  136 ? 46.588  71.357  94.447  1.00 18.63 ? 136  GLN A O   1 
ATOM   1047  C  CB  . GLN A 1  136 ? 45.346  69.927  91.798  1.00 18.51 ? 136  GLN A CB  1 
ATOM   1048  C  CG  . GLN A 1  136 ? 45.355  68.547  91.086  1.00 35.95 ? 136  GLN A CG  1 
ATOM   1049  C  CD  . GLN A 1  136 ? 46.459  67.595  91.562  1.00 49.68 ? 136  GLN A CD  1 
ATOM   1050  O  OE1 . GLN A 1  136 ? 46.160  66.554  92.152  1.00 53.54 ? 136  GLN A OE1 1 
ATOM   1051  N  NE2 . GLN A 1  136 ? 47.710  67.885  91.193  1.00 52.24 ? 136  GLN A NE2 1 
ATOM   1052  N  N   . GLU A 1  137 ? 44.547  72.238  93.910  1.00 17.52 ? 137  GLU A N   1 
ATOM   1053  C  CA  . GLU A 1  137 ? 44.710  73.521  94.613  1.00 17.08 ? 137  GLU A CA  1 
ATOM   1054  C  C   . GLU A 1  137 ? 44.802  73.383  96.131  1.00 18.00 ? 137  GLU A C   1 
ATOM   1055  O  O   . GLU A 1  137 ? 45.605  74.079  96.745  1.00 18.33 ? 137  GLU A O   1 
ATOM   1056  C  CB  . GLU A 1  137 ? 43.623  74.516  94.243  1.00 15.84 ? 137  GLU A CB  1 
ATOM   1057  C  CG  . GLU A 1  137 ? 43.693  74.986  92.797  1.00 16.10 ? 137  GLU A CG  1 
ATOM   1058  C  CD  . GLU A 1  137 ? 42.519  75.853  92.375  1.00 25.38 ? 137  GLU A CD  1 
ATOM   1059  O  OE1 . GLU A 1  137 ? 42.578  76.397  91.254  1.00 30.15 ? 137  GLU A OE1 1 
ATOM   1060  O  OE2 . GLU A 1  137 ? 41.541  76.005  93.144  1.00 25.39 ? 137  GLU A OE2 1 
ATOM   1061  N  N   . LEU A 1  138 ? 44.081  72.400  96.694  1.00 18.37 ? 138  LEU A N   1 
ATOM   1062  C  CA  . LEU A 1  138 ? 44.217  72.007  98.109  1.00 18.86 ? 138  LEU A CA  1 
ATOM   1063  C  C   . LEU A 1  138 ? 45.581  71.423  98.459  1.00 19.94 ? 138  LEU A C   1 
ATOM   1064  O  O   . LEU A 1  138 ? 46.180  71.838  99.454  1.00 20.21 ? 138  LEU A O   1 
ATOM   1065  C  CB  . LEU A 1  138 ? 43.072  71.085  98.573  1.00 17.90 ? 138  LEU A CB  1 
ATOM   1066  C  CG  . LEU A 1  138 ? 41.628  71.617  98.550  1.00 13.52 ? 138  LEU A CG  1 
ATOM   1067  C  CD1 . LEU A 1  138 ? 40.632  70.558  99.054  1.00 10.02 ? 138  LEU A CD1 1 
ATOM   1068  C  CD2 . LEU A 1  138 ? 41.438  72.933  99.295  1.00 2.00  ? 138  LEU A CD2 1 
ATOM   1069  N  N   . GLN A 1  139 ? 46.086  70.549  97.576  1.00 20.67 ? 139  GLN A N   1 
ATOM   1070  C  CA  . GLN A 1  139 ? 47.436  69.971  97.644  1.00 21.72 ? 139  GLN A CA  1 
ATOM   1071  C  C   . GLN A 1  139 ? 48.535  71.033  97.552  1.00 21.74 ? 139  GLN A C   1 
ATOM   1072  O  O   . GLN A 1  139 ? 49.510  70.970  98.307  1.00 21.87 ? 139  GLN A O   1 
ATOM   1073  C  CB  . GLN A 1  139 ? 47.621  68.938  96.535  1.00 22.30 ? 139  GLN A CB  1 
ATOM   1074  C  CG  . GLN A 1  139 ? 47.427  67.491  96.961  1.00 34.56 ? 139  GLN A CG  1 
ATOM   1075  C  CD  . GLN A 1  139 ? 47.780  66.489  95.857  1.00 40.41 ? 139  GLN A CD  1 
ATOM   1076  O  OE1 . GLN A 1  139 ? 46.964  65.621  95.532  1.00 48.46 ? 139  GLN A OE1 1 
ATOM   1077  N  NE2 . GLN A 1  139 ? 49.045  66.502  95.406  1.00 41.09 ? 139  GLN A NE2 1 
ATOM   1078  N  N   . GLU A 1  140 ? 48.311  72.023  96.675  1.00 21.68 ? 140  GLU A N   1 
ATOM   1079  C  CA  . GLU A 1  140 ? 49.132  73.223  96.529  1.00 21.97 ? 140  GLU A CA  1 
ATOM   1080  C  C   . GLU A 1  140 ? 49.124  74.111  97.767  1.00 21.65 ? 140  GLU A C   1 
ATOM   1081  O  O   . GLU A 1  140 ? 50.198  74.500  98.216  1.00 21.87 ? 140  GLU A O   1 
ATOM   1082  C  CB  . GLU A 1  140 ? 48.662  74.050  95.339  1.00 22.61 ? 140  GLU A CB  1 
ATOM   1083  C  CG  . GLU A 1  140 ? 49.119  73.594  93.965  1.00 24.83 ? 140  GLU A CG  1 
ATOM   1084  C  CD  . GLU A 1  140 ? 48.372  74.303  92.829  1.00 30.90 ? 140  GLU A CD  1 
ATOM   1085  O  OE1 . GLU A 1  140 ? 47.607  75.289  93.072  1.00 27.37 ? 140  GLU A OE1 1 
ATOM   1086  O  OE2 . GLU A 1  140 ? 48.617  73.925  91.667  1.00 31.28 ? 140  GLU A OE2 1 
ATOM   1087  N  N   . ASN A 1  141 ? 47.914  74.488  98.246  1.00 21.31 ? 141  ASN A N   1 
ATOM   1088  C  CA  . ASN A 1  141 ? 47.703  75.372  99.419  1.00 21.05 ? 141  ASN A CA  1 
ATOM   1089  C  C   . ASN A 1  141 ? 48.385  74.832  100.691 1.00 21.24 ? 141  ASN A C   1 
ATOM   1090  O  O   . ASN A 1  141 ? 48.966  75.620  101.468 1.00 22.02 ? 141  ASN A O   1 
ATOM   1091  C  CB  . ASN A 1  141 ? 46.193  75.589  99.727  1.00 20.86 ? 141  ASN A CB  1 
ATOM   1092  C  CG  . ASN A 1  141 ? 45.425  76.459  98.666  1.00 21.79 ? 141  ASN A CG  1 
ATOM   1093  O  OD1 . ASN A 1  141 ? 44.199  76.579  98.776  1.00 29.64 ? 141  ASN A OD1 1 
ATOM   1094  N  ND2 . ASN A 1  141 ? 46.078  76.837  97.562  1.00 15.02 ? 141  ASN A ND2 1 
ATOM   1095  N  N   . ASP A 1  142 ? 48.353  73.494  100.847 1.00 19.78 ? 142  ASP A N   1 
ATOM   1096  C  CA  . ASP A 1  142 ? 49.113  72.731  101.853 1.00 18.87 ? 142  ASP A CA  1 
ATOM   1097  C  C   . ASP A 1  142 ? 50.609  73.039  101.994 1.00 17.84 ? 142  ASP A C   1 
ATOM   1098  O  O   . ASP A 1  142 ? 51.166  72.895  103.084 1.00 17.51 ? 142  ASP A O   1 
ATOM   1099  C  CB  . ASP A 1  142 ? 48.918  71.226  101.620 1.00 18.14 ? 142  ASP A CB  1 
ATOM   1100  C  CG  . ASP A 1  142 ? 47.709  70.659  102.354 1.00 26.20 ? 142  ASP A CG  1 
ATOM   1101  O  OD1 . ASP A 1  142 ? 47.668  69.415  102.513 1.00 36.50 ? 142  ASP A OD1 1 
ATOM   1102  O  OD2 . ASP A 1  142 ? 46.709  71.330  102.713 1.00 25.86 ? 142  ASP A OD2 1 
ATOM   1103  N  N   . THR A 1  143 ? 51.258  73.360  100.877 1.00 18.02 ? 143  THR A N   1 
ATOM   1104  C  CA  . THR A 1  143 ? 52.684  73.745  100.869 1.00 19.08 ? 143  THR A CA  1 
ATOM   1105  C  C   . THR A 1  143 ? 52.947  75.204  101.299 1.00 19.12 ? 143  THR A C   1 
ATOM   1106  O  O   . THR A 1  143 ? 54.108  75.567  101.556 1.00 19.67 ? 143  THR A O   1 
ATOM   1107  C  CB  . THR A 1  143 ? 53.384  73.438  99.495  1.00 19.49 ? 143  THR A CB  1 
ATOM   1108  O  OG1 . THR A 1  143 ? 52.840  74.286  98.471  1.00 17.58 ? 143  THR A OG1 1 
ATOM   1109  C  CG2 . THR A 1  143 ? 53.105  71.985  99.011  1.00 11.38 ? 143  THR A CG2 1 
ATOM   1110  N  N   . SER A 1  144 ? 51.889  76.028  101.350 1.00 19.05 ? 144  SER A N   1 
ATOM   1111  C  CA  . SER A 1  144 ? 51.989  77.437  101.771 1.00 19.03 ? 144  SER A CA  1 
ATOM   1112  C  C   . SER A 1  144 ? 51.758  77.545  103.273 1.00 19.25 ? 144  SER A C   1 
ATOM   1113  O  O   . SER A 1  144 ? 50.606  77.717  103.736 1.00 19.80 ? 144  SER A O   1 
ATOM   1114  C  CB  . SER A 1  144 ? 51.004  78.317  101.004 1.00 19.28 ? 144  SER A CB  1 
ATOM   1115  O  OG  . SER A 1  144 ? 50.809  79.559  101.678 1.00 22.33 ? 144  SER A OG  1 
ATOM   1116  N  N   . MET A 1  145 ? 52.861  77.614  104.010 1.00 18.53 ? 145  MET A N   1 
ATOM   1117  C  CA  . MET A 1  145 ? 52.833  77.661  105.475 1.00 18.38 ? 145  MET A CA  1 
ATOM   1118  C  C   . MET A 1  145 ? 52.062  78.841  106.056 1.00 18.99 ? 145  MET A C   1 
ATOM   1119  O  O   . MET A 1  145 ? 51.259  78.631  106.965 1.00 19.61 ? 145  MET A O   1 
ATOM   1120  C  CB  . MET A 1  145 ? 54.231  77.579  106.052 1.00 18.14 ? 145  MET A CB  1 
ATOM   1121  C  CG  . MET A 1  145 ? 54.905  76.222  105.899 1.00 14.88 ? 145  MET A CG  1 
ATOM   1122  S  SD  . MET A 1  145 ? 56.438  76.122  106.827 1.00 20.01 ? 145  MET A SD  1 
ATOM   1123  C  CE  . MET A 1  145 ? 55.814  75.802  108.481 1.00 9.52  ? 145  MET A CE  1 
ATOM   1124  N  N   . ARG A 1  146 ? 52.107  79.981  105.344 1.00 19.62 ? 146  ARG A N   1 
ATOM   1125  C  CA  . ARG A 1  146 ? 51.296  81.188  105.622 1.00 19.85 ? 146  ARG A CA  1 
ATOM   1126  C  C   . ARG A 1  146 ? 49.774  80.930  105.535 1.00 19.83 ? 146  ARG A C   1 
ATOM   1127  O  O   . ARG A 1  146 ? 49.057  81.152  106.526 1.00 20.11 ? 146  ARG A O   1 
ATOM   1128  C  CB  . ARG A 1  146 ? 51.722  82.369  104.724 1.00 19.47 ? 146  ARG A CB  1 
ATOM   1129  C  CG  . ARG A 1  146 ? 51.282  83.761  105.234 1.00 25.37 ? 146  ARG A CG  1 
ATOM   1130  C  CD  . ARG A 1  146 ? 51.290  84.877  104.167 1.00 40.90 ? 146  ARG A CD  1 
ATOM   1131  N  NE  . ARG A 1  146 ? 50.541  86.085  104.582 1.00 40.69 ? 146  ARG A NE  1 
ATOM   1132  C  CZ  . ARG A 1  146 ? 49.201  86.264  104.484 1.00 52.51 ? 146  ARG A CZ  1 
ATOM   1133  N  NH1 . ARG A 1  146 ? 48.393  85.315  103.985 1.00 49.44 ? 146  ARG A NH1 1 
ATOM   1134  N  NH2 . ARG A 1  146 ? 48.659  87.398  104.926 1.00 50.60 ? 146  ARG A NH2 1 
ATOM   1135  N  N   . ASP A 1  147 ? 49.318  80.377  104.403 1.00 19.76 ? 147  ASP A N   1 
ATOM   1136  C  CA  . ASP A 1  147 ? 47.893  80.034  104.190 1.00 20.31 ? 147  ASP A CA  1 
ATOM   1137  C  C   . ASP A 1  147 ? 47.341  79.022  105.198 1.00 19.89 ? 147  ASP A C   1 
ATOM   1138  O  O   . ASP A 1  147 ? 46.324  79.301  105.832 1.00 20.15 ? 147  ASP A O   1 
ATOM   1139  C  CB  . ASP A 1  147 ? 47.650  79.584  102.740 1.00 21.15 ? 147  ASP A CB  1 
ATOM   1140  C  CG  . ASP A 1  147 ? 47.662  80.760  101.731 1.00 26.54 ? 147  ASP A CG  1 
ATOM   1141  O  OD1 . ASP A 1  147 ? 48.438  81.720  101.888 1.00 27.53 ? 147  ASP A OD1 1 
ATOM   1142  O  OD2 . ASP A 1  147 ? 46.940  80.782  100.717 1.00 42.98 ? 147  ASP A OD2 1 
ATOM   1143  N  N   . VAL A 1  148 ? 48.192  78.045  105.542 1.00 19.72 ? 148  VAL A N   1 
ATOM   1144  C  CA  . VAL A 1  148 ? 47.950  77.024  106.566 1.00 19.43 ? 148  VAL A CA  1 
ATOM   1145  C  C   . VAL A 1  148 ? 47.766  77.616  107.984 1.00 19.49 ? 148  VAL A C   1 
ATOM   1146  O  O   . VAL A 1  148 ? 46.686  77.399  108.556 1.00 19.40 ? 148  VAL A O   1 
ATOM   1147  C  CB  . VAL A 1  148 ? 48.995  75.838  106.520 1.00 19.25 ? 148  VAL A CB  1 
ATOM   1148  C  CG1 . VAL A 1  148 ? 48.622  74.723  107.500 1.00 16.10 ? 148  VAL A CG1 1 
ATOM   1149  C  CG2 . VAL A 1  148 ? 49.073  75.225  105.134 1.00 16.31 ? 148  VAL A CG2 1 
ATOM   1150  N  N   . VAL A 1  149 ? 48.738  78.414  108.492 1.00 19.38 ? 149  VAL A N   1 
ATOM   1151  C  CA  . VAL A 1  149 ? 48.574  79.106  109.817 1.00 19.54 ? 149  VAL A CA  1 
ATOM   1152  C  C   . VAL A 1  149 ? 47.390  80.031  109.977 1.00 19.28 ? 149  VAL A C   1 
ATOM   1153  O  O   . VAL A 1  149 ? 46.741  80.009  111.012 1.00 19.57 ? 149  VAL A O   1 
ATOM   1154  C  CB  . VAL A 1  149 ? 49.831  79.798  110.475 1.00 19.61 ? 149  VAL A CB  1 
ATOM   1155  C  CG1 . VAL A 1  149 ? 50.607  78.869  111.343 1.00 11.73 ? 149  VAL A CG1 1 
ATOM   1156  C  CG2 . VAL A 1  149 ? 50.667  80.665  109.523 1.00 24.15 ? 149  VAL A CG2 1 
ATOM   1157  N  N   . PHE A 1  150 ? 47.042  80.732  108.909 1.00 19.64 ? 150  PHE A N   1 
ATOM   1158  C  CA  . PHE A 1  150 ? 45.840  81.559  108.881 1.00 19.96 ? 150  PHE A CA  1 
ATOM   1159  C  C   . PHE A 1  150 ? 44.515  80.807  108.830 1.00 20.67 ? 150  PHE A C   1 
ATOM   1160  O  O   . PHE A 1  150 ? 43.559  81.198  109.547 1.00 21.88 ? 150  PHE A O   1 
ATOM   1161  C  CB  . PHE A 1  150 ? 45.948  82.627  107.815 1.00 19.82 ? 150  PHE A CB  1 
ATOM   1162  C  CG  . PHE A 1  150 ? 46.727  83.828  108.261 1.00 21.63 ? 150  PHE A CG  1 
ATOM   1163  C  CD1 . PHE A 1  150 ? 48.132  83.870  108.106 1.00 23.52 ? 150  PHE A CD1 1 
ATOM   1164  C  CD2 . PHE A 1  150 ? 46.076  84.894  108.932 1.00 25.00 ? 150  PHE A CD2 1 
ATOM   1165  C  CE1 . PHE A 1  150 ? 48.891  84.986  108.567 1.00 18.44 ? 150  PHE A CE1 1 
ATOM   1166  C  CE2 . PHE A 1  150 ? 46.819  86.025  109.388 1.00 22.79 ? 150  PHE A CE2 1 
ATOM   1167  C  CZ  . PHE A 1  150 ? 48.228  86.065  109.197 1.00 22.13 ? 150  PHE A CZ  1 
ATOM   1168  N  N   . ASN A 1  151 ? 44.486  79.681  108.097 1.00 19.06 ? 151  ASN A N   1 
ATOM   1169  C  CA  . ASN A 1  151 ? 43.394  78.723  108.232 1.00 18.53 ? 151  ASN A CA  1 
ATOM   1170  C  C   . ASN A 1  151 ? 43.238  78.086  109.606 1.00 17.84 ? 151  ASN A C   1 
ATOM   1171  O  O   . ASN A 1  151 ? 42.148  78.175  110.177 1.00 18.12 ? 151  ASN A O   1 
ATOM   1172  C  CB  . ASN A 1  151 ? 43.312  77.708  107.071 1.00 18.57 ? 151  ASN A CB  1 
ATOM   1173  C  CG  . ASN A 1  151 ? 42.867  78.359  105.745 1.00 18.21 ? 151  ASN A CG  1 
ATOM   1174  O  OD1 . ASN A 1  151 ? 41.987  79.244  105.707 1.00 13.95 ? 151  ASN A OD1 1 
ATOM   1175  N  ND2 . ASN A 1  151 ? 43.510  77.960  104.665 1.00 14.88 ? 151  ASN A ND2 1 
ATOM   1176  N  N   . TYR A 1  152 ? 44.380  77.765  110.224 1.00 16.89 ? 152  TYR A N   1 
ATOM   1177  C  CA  . TYR A 1  152 ? 44.476  77.275  111.606 1.00 16.25 ? 152  TYR A CA  1 
ATOM   1178  C  C   . TYR A 1  152 ? 44.047  78.289  112.667 1.00 16.26 ? 152  TYR A C   1 
ATOM   1179  O  O   . TYR A 1  152 ? 43.339  77.919  113.620 1.00 16.51 ? 152  TYR A O   1 
ATOM   1180  C  CB  . TYR A 1  152 ? 45.904  76.774  111.900 1.00 16.39 ? 152  TYR A CB  1 
ATOM   1181  C  CG  . TYR A 1  152 ? 46.324  75.432  111.274 1.00 10.85 ? 152  TYR A CG  1 
ATOM   1182  C  CD1 . TYR A 1  152 ? 47.619  74.940  111.509 1.00 2.00  ? 152  TYR A CD1 1 
ATOM   1183  C  CD2 . TYR A 1  152 ? 45.390  74.573  110.608 1.00 8.48  ? 152  TYR A CD2 1 
ATOM   1184  C  CE1 . TYR A 1  152 ? 48.061  73.717  110.952 1.00 10.95 ? 152  TYR A CE1 1 
ATOM   1185  C  CE2 . TYR A 1  152 ? 45.807  73.300  110.080 1.00 12.19 ? 152  TYR A CE2 1 
ATOM   1186  C  CZ  . TYR A 1  152 ? 47.148  72.887  110.282 1.00 6.68  ? 152  TYR A CZ  1 
ATOM   1187  O  OH  . TYR A 1  152 ? 47.606  71.753  109.705 1.00 16.91 ? 152  TYR A OH  1 
ATOM   1188  N  N   . LEU A 1  153 ? 44.501  79.546  112.510 1.00 16.07 ? 153  LEU A N   1 
ATOM   1189  C  CA  . LEU A 1  153 ? 44.067  80.675  113.332 1.00 16.20 ? 153  LEU A CA  1 
ATOM   1190  C  C   . LEU A 1  153 ? 42.550  80.901  113.339 1.00 16.33 ? 153  LEU A C   1 
ATOM   1191  O  O   . LEU A 1  153 ? 41.956  80.802  114.405 1.00 16.90 ? 153  LEU A O   1 
ATOM   1192  C  CB  . LEU A 1  153 ? 44.852  81.969  113.009 1.00 16.28 ? 153  LEU A CB  1 
ATOM   1193  C  CG  . LEU A 1  153 ? 44.787  83.128  114.020 1.00 23.97 ? 153  LEU A CG  1 
ATOM   1194  C  CD1 . LEU A 1  153 ? 45.614  82.912  115.297 1.00 17.15 ? 153  LEU A CD1 1 
ATOM   1195  C  CD2 . LEU A 1  153 ? 45.176  84.421  113.348 1.00 27.12 ? 153  LEU A CD2 1 
ATOM   1196  N  N   . HIS A 1  154 ? 41.932  80.945  112.148 1.00 16.26 ? 154  HIS A N   1 
ATOM   1197  C  CA  . HIS A 1  154 ? 40.455  80.934  111.994 1.00 16.03 ? 154  HIS A CA  1 
ATOM   1198  C  C   . HIS A 1  154 ? 39.779  79.709  112.616 1.00 16.22 ? 154  HIS A C   1 
ATOM   1199  O  O   . HIS A 1  154 ? 38.869  79.877  113.457 1.00 17.33 ? 154  HIS A O   1 
ATOM   1200  C  CB  . HIS A 1  154 ? 40.036  81.106  110.537 1.00 15.20 ? 154  HIS A CB  1 
ATOM   1201  C  CG  . HIS A 1  154 ? 40.234  82.496  110.016 1.00 19.42 ? 154  HIS A CG  1 
ATOM   1202  N  ND1 . HIS A 1  154 ? 41.452  82.950  109.545 1.00 18.21 ? 154  HIS A ND1 1 
ATOM   1203  C  CD2 . HIS A 1  154 ? 39.378  83.542  109.917 1.00 8.47  ? 154  HIS A CD2 1 
ATOM   1204  C  CE1 . HIS A 1  154 ? 41.320  84.193  109.119 1.00 13.79 ? 154  HIS A CE1 1 
ATOM   1205  N  NE2 . HIS A 1  154 ? 40.090  84.597  109.396 1.00 20.29 ? 154  HIS A NE2 1 
ATOM   1206  N  N   . ALA A 1  155 ? 40.387  78.533  112.403 1.00 14.98 ? 155  ALA A N   1 
ATOM   1207  C  CA  . ALA A 1  155 ? 39.830  77.246  112.856 1.00 13.97 ? 155  ALA A CA  1 
ATOM   1208  C  C   . ALA A 1  155 ? 39.866  77.079  114.394 1.00 14.35 ? 155  ALA A C   1 
ATOM   1209  O  O   . ALA A 1  155 ? 38.933  76.556  114.962 1.00 13.73 ? 155  ALA A O   1 
ATOM   1210  C  CB  . ALA A 1  155 ? 40.509  76.080  112.157 1.00 12.78 ? 155  ALA A CB  1 
ATOM   1211  N  N   . THR A 1  156 ? 40.878  77.660  115.050 1.00 15.12 ? 156  THR A N   1 
ATOM   1212  C  CA  . THR A 1  156 ? 40.944  77.675  116.510 1.00 14.91 ? 156  THR A CA  1 
ATOM   1213  C  C   . THR A 1  156 ? 40.248  78.837  117.207 1.00 15.18 ? 156  THR A C   1 
ATOM   1214  O  O   . THR A 1  156 ? 39.562  78.611  118.196 1.00 15.86 ? 156  THR A O   1 
ATOM   1215  C  CB  . THR A 1  156 ? 42.377  77.347  117.048 1.00 15.30 ? 156  THR A CB  1 
ATOM   1216  O  OG1 . THR A 1  156 ? 42.288  76.940  118.407 1.00 10.14 ? 156  THR A OG1 1 
ATOM   1217  C  CG2 . THR A 1  156 ? 43.351  78.605  117.089 1.00 2.00  ? 156  THR A CG2 1 
ATOM   1218  N  N   . ALA A 1  157 ? 40.404  80.061  116.668 1.00 15.65 ? 157  ALA A N   1 
ATOM   1219  C  CA  . ALA A 1  157 ? 39.768  81.289  117.197 1.00 15.84 ? 157  ALA A CA  1 
ATOM   1220  C  C   . ALA A 1  157 ? 38.260  81.252  117.133 1.00 16.47 ? 157  ALA A C   1 
ATOM   1221  O  O   . ALA A 1  157 ? 37.612  81.651  118.084 1.00 16.54 ? 157  ALA A O   1 
ATOM   1222  C  CB  . ALA A 1  157 ? 40.273  82.531  116.487 1.00 15.78 ? 157  ALA A CB  1 
ATOM   1223  N  N   . PHE A 1  158 ? 37.734  80.622  116.081 1.00 17.87 ? 158  PHE A N   1 
ATOM   1224  C  CA  . PHE A 1  158 ? 36.297  80.564  115.782 1.00 18.63 ? 158  PHE A CA  1 
ATOM   1225  C  C   . PHE A 1  158 ? 35.678  79.146  115.771 1.00 19.44 ? 158  PHE A C   1 
ATOM   1226  O  O   . PHE A 1  158 ? 34.565  78.972  115.276 1.00 20.10 ? 158  PHE A O   1 
ATOM   1227  C  CB  . PHE A 1  158 ? 36.005  81.339  114.471 1.00 18.59 ? 158  PHE A CB  1 
ATOM   1228  C  CG  . PHE A 1  158 ? 36.374  82.805  114.517 1.00 15.17 ? 158  PHE A CG  1 
ATOM   1229  C  CD1 . PHE A 1  158 ? 35.681  83.706  115.375 1.00 12.05 ? 158  PHE A CD1 1 
ATOM   1230  C  CD2 . PHE A 1  158 ? 37.397  83.303  113.678 1.00 13.36 ? 158  PHE A CD2 1 
ATOM   1231  C  CE1 . PHE A 1  158 ? 36.000  85.087  115.397 1.00 15.46 ? 158  PHE A CE1 1 
ATOM   1232  C  CE2 . PHE A 1  158 ? 37.744  84.693  113.689 1.00 17.99 ? 158  PHE A CE2 1 
ATOM   1233  C  CZ  . PHE A 1  158 ? 37.054  85.584  114.573 1.00 15.84 ? 158  PHE A CZ  1 
ATOM   1234  N  N   . GLN A 1  159 ? 36.480  78.135  116.135 1.00 19.86 ? 159  GLN A N   1 
ATOM   1235  C  CA  . GLN A 1  159 ? 36.045  76.819  116.694 1.00 20.12 ? 159  GLN A CA  1 
ATOM   1236  C  C   . GLN A 1  159 ? 34.710  76.104  116.319 1.00 21.05 ? 159  GLN A C   1 
ATOM   1237  O  O   . GLN A 1  159 ? 34.723  75.044  115.627 1.00 22.12 ? 159  GLN A O   1 
ATOM   1238  C  CB  . GLN A 1  159 ? 36.298  76.779  118.187 1.00 20.10 ? 159  GLN A CB  1 
ATOM   1239  C  CG  . GLN A 1  159 ? 37.531  76.052  118.510 1.00 18.21 ? 159  GLN A CG  1 
ATOM   1240  C  CD  . GLN A 1  159 ? 37.898  76.117  119.963 1.00 10.18 ? 159  GLN A CD  1 
ATOM   1241  O  OE1 . GLN A 1  159 ? 37.254  75.480  120.798 1.00 8.62  ? 159  GLN A OE1 1 
ATOM   1242  N  NE2 . GLN A 1  159 ? 39.046  76.693  120.237 1.00 14.13 ? 159  GLN A NE2 1 
ATOM   1243  N  N   . GLY A 1  160 ? 33.610  76.550  116.929 1.00 20.41 ? 160  GLY A N   1 
ATOM   1244  C  CA  . GLY A 1  160 ? 32.290  75.943  116.710 1.00 19.38 ? 160  GLY A CA  1 
ATOM   1245  C  C   . GLY A 1  160 ? 31.411  76.757  115.776 1.00 18.44 ? 160  GLY A C   1 
ATOM   1246  O  O   . GLY A 1  160 ? 30.224  76.514  115.710 1.00 18.07 ? 160  GLY A O   1 
ATOM   1247  N  N   . THR A 1  161 ? 31.994  77.772  115.123 1.00 18.29 ? 161  THR A N   1 
ATOM   1248  C  CA  . THR A 1  161 ? 31.244  78.794  114.364 1.00 17.96 ? 161  THR A CA  1 
ATOM   1249  C  C   . THR A 1  161 ? 31.549  78.654  112.843 1.00 17.96 ? 161  THR A C   1 
ATOM   1250  O  O   . THR A 1  161 ? 32.555  78.003  112.502 1.00 17.95 ? 161  THR A O   1 
ATOM   1251  C  CB  . THR A 1  161 ? 31.538  80.248  114.889 1.00 17.95 ? 161  THR A CB  1 
ATOM   1252  O  OG1 . THR A 1  161 ? 32.826  80.693  114.434 1.00 21.35 ? 161  THR A OG1 1 
ATOM   1253  C  CG2 . THR A 1  161 ? 31.620  80.340  116.434 1.00 12.93 ? 161  THR A CG2 1 
ATOM   1254  N  N   . PRO A 1  162 ? 30.707  79.202  111.932 1.00 17.97 ? 162  PRO A N   1 
ATOM   1255  C  CA  . PRO A 1  162 ? 31.026  79.147  110.485 1.00 17.91 ? 162  PRO A CA  1 
ATOM   1256  C  C   . PRO A 1  162 ? 32.285  79.907  110.013 1.00 17.89 ? 162  PRO A C   1 
ATOM   1257  O  O   . PRO A 1  162 ? 32.829  79.521  108.968 1.00 18.08 ? 162  PRO A O   1 
ATOM   1258  C  CB  . PRO A 1  162 ? 29.762  79.697  109.820 1.00 17.97 ? 162  PRO A CB  1 
ATOM   1259  C  CG  . PRO A 1  162 ? 29.047  80.434  110.889 1.00 19.89 ? 162  PRO A CG  1 
ATOM   1260  C  CD  . PRO A 1  162 ? 29.310  79.662  112.128 1.00 17.99 ? 162  PRO A CD  1 
ATOM   1261  N  N   . LEU A 1  163 ? 32.798  80.837  110.827 1.00 17.63 ? 163  LEU A N   1 
ATOM   1262  C  CA  . LEU A 1  163 ? 34.080  81.524  110.590 1.00 17.62 ? 163  LEU A CA  1 
ATOM   1263  C  C   . LEU A 1  163 ? 35.338  80.662  110.785 1.00 18.14 ? 163  LEU A C   1 
ATOM   1264  O  O   . LEU A 1  163 ? 36.435  81.039  110.286 1.00 19.65 ? 163  LEU A O   1 
ATOM   1265  C  CB  . LEU A 1  163 ? 34.162  82.799  111.431 1.00 17.33 ? 163  LEU A CB  1 
ATOM   1266  C  CG  . LEU A 1  163 ? 34.487  84.214  110.923 1.00 23.25 ? 163  LEU A CG  1 
ATOM   1267  C  CD1 . LEU A 1  163 ? 34.219  84.555  109.439 1.00 27.14 ? 163  LEU A CD1 1 
ATOM   1268  C  CD2 . LEU A 1  163 ? 33.819  85.206  111.808 1.00 19.56 ? 163  LEU A CD2 1 
ATOM   1269  N  N   . ALA A 1  164 ? 35.191  79.543  111.516 1.00 17.12 ? 164  ALA A N   1 
ATOM   1270  C  CA  . ALA A 1  164 ? 36.206  78.463  111.617 1.00 16.62 ? 164  ALA A CA  1 
ATOM   1271  C  C   . ALA A 1  164 ? 36.576  77.811  110.283 1.00 16.54 ? 164  ALA A C   1 
ATOM   1272  O  O   . ALA A 1  164 ? 37.669  77.241  110.160 1.00 16.68 ? 164  ALA A O   1 
ATOM   1273  C  CB  . ALA A 1  164 ? 35.765  77.379  112.620 1.00 15.93 ? 164  ALA A CB  1 
ATOM   1274  N  N   . GLN A 1  165 ? 35.588  77.732  109.382 1.00 16.53 ? 165  GLN A N   1 
ATOM   1275  C  CA  . GLN A 1  165 ? 35.718  77.099  108.067 1.00 16.16 ? 165  GLN A CA  1 
ATOM   1276  C  C   . GLN A 1  165 ? 36.564  77.962  107.153 1.00 16.22 ? 165  GLN A C   1 
ATOM   1277  O  O   . GLN A 1  165 ? 36.497  79.220  107.196 1.00 16.27 ? 165  GLN A O   1 
ATOM   1278  C  CB  . GLN A 1  165 ? 34.340  76.842  107.430 1.00 16.51 ? 165  GLN A CB  1 
ATOM   1279  C  CG  . GLN A 1  165 ? 33.378  75.931  108.255 1.00 2.00  ? 165  GLN A CG  1 
ATOM   1280  C  CD  . GLN A 1  165 ? 31.899  75.973  107.787 1.00 17.38 ? 165  GLN A CD  1 
ATOM   1281  O  OE1 . GLN A 1  165 ? 31.393  77.017  107.351 1.00 18.49 ? 165  GLN A OE1 1 
ATOM   1282  N  NE2 . GLN A 1  165 ? 31.189  74.846  107.965 1.00 12.65 ? 165  GLN A NE2 1 
ATOM   1283  N  N   . SER A 1  166 ? 37.469  77.277  106.451 1.00 15.91 ? 166  SER A N   1 
ATOM   1284  C  CA  . SER A 1  166 ? 38.104  77.759  105.226 1.00 15.10 ? 166  SER A CA  1 
ATOM   1285  C  C   . SER A 1  166 ? 37.086  78.079  104.125 1.00 15.20 ? 166  SER A C   1 
ATOM   1286  O  O   . SER A 1  166 ? 36.013  77.441  104.048 1.00 15.95 ? 166  SER A O   1 
ATOM   1287  C  CB  . SER A 1  166 ? 39.113  76.714  104.729 1.00 14.78 ? 166  SER A CB  1 
ATOM   1288  O  OG  . SER A 1  166 ? 38.447  75.596  104.154 1.00 19.79 ? 166  SER A OG  1 
ATOM   1289  N  N   . VAL A 1  167 ? 37.529  78.923  103.193 1.00 15.03 ? 167  VAL A N   1 
ATOM   1290  C  CA  . VAL A 1  167 ? 36.825  79.275  101.952 1.00 15.31 ? 167  VAL A CA  1 
ATOM   1291  C  C   . VAL A 1  167 ? 36.622  78.049  101.029 1.00 16.03 ? 167  VAL A C   1 
ATOM   1292  O  O   . VAL A 1  167 ? 35.510  77.807  100.562 1.00 16.77 ? 167  VAL A O   1 
ATOM   1293  C  CB  . VAL A 1  167 ? 37.554  80.476  101.195 1.00 14.74 ? 167  VAL A CB  1 
ATOM   1294  C  CG1 . VAL A 1  167 ? 36.861  80.816  99.851  1.00 2.07  ? 167  VAL A CG1 1 
ATOM   1295  C  CG2 . VAL A 1  167 ? 37.591  81.719  102.077 1.00 7.54  ? 167  VAL A CG2 1 
ATOM   1296  N  N   . GLU A 1  168 ? 37.685  77.268  100.842 1.00 16.32 ? 168  GLU A N   1 
ATOM   1297  C  CA  . GLU A 1  168 ? 37.751  76.203  99.827  1.00 16.63 ? 168  GLU A CA  1 
ATOM   1298  C  C   . GLU A 1  168 ? 37.068  74.924  100.322 1.00 17.13 ? 168  GLU A C   1 
ATOM   1299  O  O   . GLU A 1  168 ? 36.712  74.055  99.515  1.00 17.06 ? 168  GLU A O   1 
ATOM   1300  C  CB  . GLU A 1  168 ? 39.206  75.909  99.433  1.00 16.53 ? 168  GLU A CB  1 
ATOM   1301  C  CG  . GLU A 1  168 ? 40.028  77.114  98.952  1.00 19.36 ? 168  GLU A CG  1 
ATOM   1302  C  CD  . GLU A 1  168 ? 40.825  77.838  100.048 1.00 26.51 ? 168  GLU A CD  1 
ATOM   1303  O  OE1 . GLU A 1  168 ? 40.687  77.527  101.263 1.00 26.51 ? 168  GLU A OE1 1 
ATOM   1304  O  OE2 . GLU A 1  168 ? 41.554  78.786  99.685  1.00 28.25 ? 168  GLU A OE2 1 
ATOM   1305  N  N   . GLY A 1  169 ? 36.959  74.787  101.651 1.00 17.63 ? 169  GLY A N   1 
ATOM   1306  C  CA  . GLY A 1  169 ? 36.208  73.701  102.288 1.00 17.82 ? 169  GLY A CA  1 
ATOM   1307  C  C   . GLY A 1  169 ? 37.024  72.411  102.387 1.00 18.04 ? 169  GLY A C   1 
ATOM   1308  O  O   . GLY A 1  169 ? 38.092  72.332  101.761 1.00 18.83 ? 169  GLY A O   1 
ATOM   1309  N  N   . PRO A 1  170 ? 36.542  71.390  103.116 1.00 17.96 ? 170  PRO A N   1 
ATOM   1310  C  CA  . PRO A 1  170 ? 37.270  70.111  103.194 1.00 17.52 ? 170  PRO A CA  1 
ATOM   1311  C  C   . PRO A 1  170 ? 37.192  69.314  101.879 1.00 17.21 ? 170  PRO A C   1 
ATOM   1312  O  O   . PRO A 1  170 ? 36.293  69.581  101.055 1.00 16.65 ? 170  PRO A O   1 
ATOM   1313  C  CB  . PRO A 1  170 ? 36.559  69.377  104.332 1.00 17.75 ? 170  PRO A CB  1 
ATOM   1314  C  CG  . PRO A 1  170 ? 35.131  69.873  104.282 1.00 22.50 ? 170  PRO A CG  1 
ATOM   1315  C  CD  . PRO A 1  170 ? 35.221  71.298  103.791 1.00 18.34 ? 170  PRO A CD  1 
ATOM   1316  N  N   . SER A 1  171 ? 38.155  68.403  101.682 1.00 17.57 ? 171  SER A N   1 
ATOM   1317  C  CA  . SER A 1  171 ? 38.261  67.565  100.478 1.00 17.84 ? 171  SER A CA  1 
ATOM   1318  C  C   . SER A 1  171 ? 37.054  66.666  100.180 1.00 18.63 ? 171  SER A C   1 
ATOM   1319  O  O   . SER A 1  171 ? 36.728  66.474  99.001  1.00 18.79 ? 171  SER A O   1 
ATOM   1320  C  CB  . SER A 1  171 ? 39.565  66.763  100.458 1.00 17.87 ? 171  SER A CB  1 
ATOM   1321  O  OG  . SER A 1  171 ? 39.744  65.996  101.637 1.00 22.25 ? 171  SER A OG  1 
ATOM   1322  N  N   . GLU A 1  172 ? 36.362  66.195  101.235 1.00 19.12 ? 172  GLU A N   1 
ATOM   1323  C  CA  . GLU A 1  172 ? 35.139  65.370  101.092 1.00 20.11 ? 172  GLU A CA  1 
ATOM   1324  C  C   . GLU A 1  172 ? 33.956  66.137  100.510 1.00 19.83 ? 172  GLU A C   1 
ATOM   1325  O  O   . GLU A 1  172 ? 33.254  65.605  99.650  1.00 19.95 ? 172  GLU A O   1 
ATOM   1326  C  CB  . GLU A 1  172 ? 34.758  64.632  102.393 1.00 20.43 ? 172  GLU A CB  1 
ATOM   1327  C  CG  . GLU A 1  172 ? 33.800  63.425  102.238 1.00 33.15 ? 172  GLU A CG  1 
ATOM   1328  C  CD  . GLU A 1  172 ? 34.277  62.305  101.286 1.00 37.00 ? 172  GLU A CD  1 
ATOM   1329  O  OE1 . GLU A 1  172 ? 35.484  61.932  101.306 1.00 34.32 ? 172  GLU A OE1 1 
ATOM   1330  O  OE2 . GLU A 1  172 ? 33.408  61.730  100.579 1.00 28.64 ? 172  GLU A OE2 1 
ATOM   1331  N  N   . ASN A 1  173 ? 33.805  67.392  100.940 1.00 19.25 ? 173  ASN A N   1 
ATOM   1332  C  CA  . ASN A 1  173 ? 32.870  68.361  100.362 1.00 19.26 ? 173  ASN A CA  1 
ATOM   1333  C  C   . ASN A 1  173 ? 33.123  68.698  98.892  1.00 19.57 ? 173  ASN A C   1 
ATOM   1334  O  O   . ASN A 1  173 ? 32.173  68.784  98.117  1.00 19.93 ? 173  ASN A O   1 
ATOM   1335  C  CB  . ASN A 1  173 ? 32.882  69.640  101.191 1.00 18.86 ? 173  ASN A CB  1 
ATOM   1336  C  CG  . ASN A 1  173 ? 31.902  69.622  102.370 1.00 18.18 ? 173  ASN A CG  1 
ATOM   1337  O  OD1 . ASN A 1  173 ? 31.566  70.682  102.863 1.00 26.81 ? 173  ASN A OD1 1 
ATOM   1338  N  ND2 . ASN A 1  173 ? 31.603  68.441  102.933 1.00 18.96 ? 173  ASN A ND2 1 
ATOM   1339  N  N   . VAL A 1  174 ? 34.404  68.765  98.512  1.00 19.43 ? 174  VAL A N   1 
ATOM   1340  C  CA  . VAL A 1  174 ? 34.848  68.996  97.131  1.00 19.65 ? 174  VAL A CA  1 
ATOM   1341  C  C   . VAL A 1  174 ? 34.419  67.824  96.235  1.00 20.35 ? 174  VAL A C   1 
ATOM   1342  O  O   . VAL A 1  174 ? 33.811  68.047  95.177  1.00 21.11 ? 174  VAL A O   1 
ATOM   1343  C  CB  . VAL A 1  174 ? 36.400  69.296  97.051  1.00 19.67 ? 174  VAL A CB  1 
ATOM   1344  C  CG1 . VAL A 1  174 ? 36.901  69.391  95.596  1.00 15.54 ? 174  VAL A CG1 1 
ATOM   1345  C  CG2 . VAL A 1  174 ? 36.756  70.617  97.816  1.00 18.90 ? 174  VAL A CG2 1 
ATOM   1346  N  N   . ARG A 1  175 ? 34.592  66.601  96.745  1.00 20.11 ? 175  ARG A N   1 
ATOM   1347  C  CA  . ARG A 1  175 ? 34.223  65.402  96.014  1.00 19.65 ? 175  ARG A CA  1 
ATOM   1348  C  C   . ARG A 1  175 ? 32.733  65.021  95.975  1.00 19.53 ? 175  ARG A C   1 
ATOM   1349  O  O   . ARG A 1  175 ? 32.317  64.286  95.042  1.00 19.28 ? 175  ARG A O   1 
ATOM   1350  C  CB  . ARG A 1  175 ? 35.172  64.238  96.283  1.00 19.71 ? 175  ARG A CB  1 
ATOM   1351  C  CG  . ARG A 1  175 ? 35.116  63.601  97.674  1.00 24.39 ? 175  ARG A CG  1 
ATOM   1352  C  CD  . ARG A 1  175 ? 36.484  63.221  98.303  1.00 30.74 ? 175  ARG A CD  1 
ATOM   1353  N  NE  . ARG A 1  175 ? 37.563  62.906  97.351  1.00 27.82 ? 175  ARG A NE  1 
ATOM   1354  C  CZ  . ARG A 1  175 ? 38.876  62.980  97.608  1.00 31.87 ? 175  ARG A CZ  1 
ATOM   1355  N  NH1 . ARG A 1  175 ? 39.342  63.411  98.787  1.00 26.01 ? 175  ARG A NH1 1 
ATOM   1356  N  NH2 . ARG A 1  175 ? 39.736  62.630  96.659  1.00 33.05 ? 175  ARG A NH2 1 
ATOM   1357  N  N   . LYS A 1  176 ? 31.923  65.631  96.865  1.00 19.43 ? 176  LYS A N   1 
ATOM   1358  C  CA  . LYS A 1  176 ? 30.464  65.359  96.932  1.00 19.81 ? 176  LYS A CA  1 
ATOM   1359  C  C   . LYS A 1  176 ? 29.449  66.526  96.831  1.00 19.83 ? 176  LYS A C   1 
ATOM   1360  O  O   . LYS A 1  176 ? 28.228  66.290  96.897  1.00 19.78 ? 176  LYS A O   1 
ATOM   1361  C  CB  . LYS A 1  176 ? 30.091  64.276  97.992  1.00 19.83 ? 176  LYS A CB  1 
ATOM   1362  C  CG  . LYS A 1  176 ? 30.211  64.689  99.468  1.00 29.28 ? 176  LYS A CG  1 
ATOM   1363  C  CD  . LYS A 1  176 ? 28.891  65.169  100.092 1.00 39.10 ? 176  LYS A CD  1 
ATOM   1364  C  CE  . LYS A 1  176 ? 29.089  66.476  100.895 1.00 38.27 ? 176  LYS A CE  1 
ATOM   1365  N  NZ  . LYS A 1  176 ? 29.436  66.230  102.333 1.00 32.00 ? 176  LYS A NZ  1 
ATOM   1366  N  N   . LEU A 1  177 ? 29.942  67.742  96.549  1.00 20.12 ? 177  LEU A N   1 
ATOM   1367  C  CA  . LEU A 1  177 ? 29.081  68.863  96.121  1.00 20.49 ? 177  LEU A CA  1 
ATOM   1368  C  C   . LEU A 1  177 ? 28.448  68.595  94.738  1.00 21.01 ? 177  LEU A C   1 
ATOM   1369  O  O   . LEU A 1  177 ? 29.172  68.380  93.755  1.00 21.36 ? 177  LEU A O   1 
ATOM   1370  C  CB  . LEU A 1  177 ? 29.835  70.209  96.142  1.00 20.55 ? 177  LEU A CB  1 
ATOM   1371  C  CG  . LEU A 1  177 ? 29.881  71.050  97.435  1.00 18.87 ? 177  LEU A CG  1 
ATOM   1372  C  CD1 . LEU A 1  177 ? 31.154  71.897  97.482  1.00 26.83 ? 177  LEU A CD1 1 
ATOM   1373  C  CD2 . LEU A 1  177 ? 28.672  71.948  97.596  1.00 19.64 ? 177  LEU A CD2 1 
ATOM   1374  N  N   . SER A 1  178 ? 27.124  68.393  94.733  1.00 21.03 ? 178  SER A N   1 
ATOM   1375  C  CA  . SER A 1  178 ? 26.332  68.250  93.491  1.00 21.30 ? 178  SER A CA  1 
ATOM   1376  C  C   . SER A 1  178 ? 25.983  69.604  92.838  1.00 21.38 ? 178  SER A C   1 
ATOM   1377  O  O   . SER A 1  178 ? 26.294  70.672  93.410  1.00 21.47 ? 178  SER A O   1 
ATOM   1378  C  CB  . SER A 1  178 ? 25.084  67.387  93.731  1.00 21.18 ? 178  SER A CB  1 
ATOM   1379  O  OG  . SER A 1  178 ? 24.166  68.050  94.580  1.00 27.73 ? 178  SER A OG  1 
ATOM   1380  N  N   . ARG A 1  179 ? 25.470  69.546  91.593  1.00 21.06 ? 179  ARG A N   1 
ATOM   1381  C  CA  . ARG A 1  179 ? 24.871  70.694  90.887  1.00 21.14 ? 179  ARG A CA  1 
ATOM   1382  C  C   . ARG A 1  179 ? 23.730  71.387  91.659  1.00 21.68 ? 179  ARG A C   1 
ATOM   1383  O  O   . ARG A 1  179 ? 23.669  72.634  91.685  1.00 21.94 ? 179  ARG A O   1 
ATOM   1384  C  CB  . ARG A 1  179 ? 24.421  70.296  89.477  1.00 21.02 ? 179  ARG A CB  1 
ATOM   1385  C  CG  . ARG A 1  179 ? 24.468  71.431  88.445  1.00 22.43 ? 179  ARG A CG  1 
ATOM   1386  C  CD  . ARG A 1  179 ? 23.431  71.315  87.323  1.00 29.41 ? 179  ARG A CD  1 
ATOM   1387  N  NE  . ARG A 1  179 ? 22.686  72.569  87.113  1.00 35.10 ? 179  ARG A NE  1 
ATOM   1388  C  CZ  . ARG A 1  179 ? 22.617  73.269  85.966  1.00 41.58 ? 179  ARG A CZ  1 
ATOM   1389  N  NH1 . ARG A 1  179 ? 23.252  72.874  84.862  1.00 47.16 ? 179  ARG A NH1 1 
ATOM   1390  N  NH2 . ARG A 1  179 ? 21.886  74.377  85.920  1.00 42.72 ? 179  ARG A NH2 1 
ATOM   1391  N  N   . ALA A 1  180 ? 22.924  70.574  92.361  1.00 21.81 ? 180  ALA A N   1 
ATOM   1392  C  CA  . ALA A 1  180 ? 21.774  71.013  93.166  1.00 22.26 ? 180  ALA A CA  1 
ATOM   1393  C  C   . ALA A 1  180 ? 22.156  71.800  94.422  1.00 22.84 ? 180  ALA A C   1 
ATOM   1394  O  O   . ALA A 1  180 ? 21.478  72.789  94.748  1.00 22.95 ? 180  ALA A O   1 
ATOM   1395  C  CB  . ALA A 1  180 ? 20.863  69.818  93.519  1.00 22.13 ? 180  ALA A CB  1 
ATOM   1396  N  N   . ASP A 1  181 ? 23.234  71.366  95.107  1.00 23.18 ? 181  ASP A N   1 
ATOM   1397  C  CA  . ASP A 1  181 ? 23.900  72.131  96.190  1.00 23.50 ? 181  ASP A CA  1 
ATOM   1398  C  C   . ASP A 1  181 ? 24.336  73.542  95.771  1.00 23.77 ? 181  ASP A C   1 
ATOM   1399  O  O   . ASP A 1  181 ? 24.213  74.494  96.572  1.00 24.06 ? 181  ASP A O   1 
ATOM   1400  C  CB  . ASP A 1  181 ? 25.128  71.387  96.749  1.00 23.50 ? 181  ASP A CB  1 
ATOM   1401  C  CG  . ASP A 1  181 ? 24.786  70.071  97.436  1.00 29.05 ? 181  ASP A CG  1 
ATOM   1402  O  OD1 . ASP A 1  181 ? 23.973  70.067  98.396  1.00 33.04 ? 181  ASP A OD1 1 
ATOM   1403  O  OD2 . ASP A 1  181 ? 25.455  69.032  97.223  1.00 26.47 ? 181  ASP A OD2 1 
ATOM   1404  N  N   . LEU A 1  182 ? 24.857  73.652  94.537  1.00 23.58 ? 182  LEU A N   1 
ATOM   1405  C  CA  . LEU A 1  182 ? 25.388  74.906  93.979  1.00 23.63 ? 182  LEU A CA  1 
ATOM   1406  C  C   . LEU A 1  182 ? 24.297  75.853  93.492  1.00 23.69 ? 182  LEU A C   1 
ATOM   1407  O  O   . LEU A 1  182 ? 24.350  77.050  93.792  1.00 23.76 ? 182  LEU A O   1 
ATOM   1408  C  CB  . LEU A 1  182 ? 26.456  74.649  92.884  1.00 23.62 ? 182  LEU A CB  1 
ATOM   1409  C  CG  . LEU A 1  182 ? 27.702  73.768  93.173  1.00 23.94 ? 182  LEU A CG  1 
ATOM   1410  C  CD1 . LEU A 1  182 ? 28.482  73.442  91.912  1.00 20.31 ? 182  LEU A CD1 1 
ATOM   1411  C  CD2 . LEU A 1  182 ? 28.631  74.294  94.263  1.00 20.60 ? 182  LEU A CD2 1 
ATOM   1412  N  N   . THR A 1  183 ? 23.311  75.294  92.774  1.00 23.87 ? 183  THR A N   1 
ATOM   1413  C  CA  . THR A 1  183 ? 22.064  75.971  92.366  1.00 24.31 ? 183  THR A CA  1 
ATOM   1414  C  C   . THR A 1  183 ? 21.314  76.617  93.551  1.00 24.47 ? 183  THR A C   1 
ATOM   1415  O  O   . THR A 1  183 ? 21.032  77.824  93.498  1.00 24.80 ? 183  THR A O   1 
ATOM   1416  C  CB  . THR A 1  183 ? 21.150  74.986  91.568  1.00 24.51 ? 183  THR A CB  1 
ATOM   1417  O  OG1 . THR A 1  183 ? 21.914  74.365  90.525  1.00 27.47 ? 183  THR A OG1 1 
ATOM   1418  C  CG2 . THR A 1  183 ? 20.051  75.733  90.789  1.00 35.86 ? 183  THR A CG2 1 
ATOM   1419  N  N   . GLU A 1  184 ? 21.171  75.852  94.649  1.00 24.30 ? 184  GLU A N   1 
ATOM   1420  C  CA  . GLU A 1  184 ? 20.638  76.319  95.944  1.00 24.31 ? 184  GLU A CA  1 
ATOM   1421  C  C   . GLU A 1  184 ? 21.442  77.463  96.608  1.00 23.98 ? 184  GLU A C   1 
ATOM   1422  O  O   . GLU A 1  184 ? 20.824  78.406  97.123  1.00 23.80 ? 184  GLU A O   1 
ATOM   1423  C  CB  . GLU A 1  184 ? 20.429  75.137  96.910  1.00 24.50 ? 184  GLU A CB  1 
ATOM   1424  C  CG  . GLU A 1  184 ? 19.559  75.436  98.134  1.00 34.22 ? 184  GLU A CG  1 
ATOM   1425  C  CD  . GLU A 1  184 ? 20.323  75.336  99.454  1.00 40.17 ? 184  GLU A CD  1 
ATOM   1426  O  OE1 . GLU A 1  184 ? 19.919  74.487  100.289 1.00 36.34 ? 184  GLU A OE1 1 
ATOM   1427  O  OE2 . GLU A 1  184 ? 21.312  76.109  99.671  1.00 37.06 ? 184  GLU A OE2 1 
ATOM   1428  N  N   . TYR A 1  185 ? 22.785  77.356  96.611  1.00 23.94 ? 185  TYR A N   1 
ATOM   1429  C  CA  . TYR A 1  185 ? 23.709  78.457  97.024  1.00 24.13 ? 185  TYR A CA  1 
ATOM   1430  C  C   . TYR A 1  185 ? 23.481  79.756  96.216  1.00 24.06 ? 185  TYR A C   1 
ATOM   1431  O  O   . TYR A 1  185 ? 23.132  80.781  96.806  1.00 23.89 ? 185  TYR A O   1 
ATOM   1432  C  CB  . TYR A 1  185 ? 25.191  78.013  96.981  1.00 24.09 ? 185  TYR A CB  1 
ATOM   1433  C  CG  . TYR A 1  185 ? 26.202  79.045  97.498  1.00 22.98 ? 185  TYR A CG  1 
ATOM   1434  C  CD1 . TYR A 1  185 ? 26.886  79.917  96.600  1.00 26.28 ? 185  TYR A CD1 1 
ATOM   1435  C  CD2 . TYR A 1  185 ? 26.559  79.088  98.870  1.00 22.04 ? 185  TYR A CD2 1 
ATOM   1436  C  CE1 . TYR A 1  185 ? 27.813  80.916  97.085  1.00 17.19 ? 185  TYR A CE1 1 
ATOM   1437  C  CE2 . TYR A 1  185 ? 27.479  80.073  99.369  1.00 22.58 ? 185  TYR A CE2 1 
ATOM   1438  C  CZ  . TYR A 1  185 ? 28.129  80.954  98.464  1.00 26.66 ? 185  TYR A CZ  1 
ATOM   1439  O  OH  . TYR A 1  185 ? 29.070  81.861  98.940  1.00 29.97 ? 185  TYR A OH  1 
ATOM   1440  N  N   . LEU A 1  186 ? 23.457  79.619  94.882  1.00 24.05 ? 186  LEU A N   1 
ATOM   1441  C  CA  . LEU A 1  186 ? 23.229  80.722  93.935  1.00 23.95 ? 186  LEU A CA  1 
ATOM   1442  C  C   . LEU A 1  186 ? 21.843  81.363  94.048  1.00 23.67 ? 186  LEU A C   1 
ATOM   1443  O  O   . LEU A 1  186 ? 21.737  82.597  94.030  1.00 23.77 ? 186  LEU A O   1 
ATOM   1444  C  CB  . LEU A 1  186 ? 23.498  80.278  92.488  1.00 24.04 ? 186  LEU A CB  1 
ATOM   1445  C  CG  . LEU A 1  186 ? 24.956  80.090  92.049  1.00 31.32 ? 186  LEU A CG  1 
ATOM   1446  C  CD1 . LEU A 1  186 ? 25.023  78.978  91.020  1.00 35.32 ? 186  LEU A CD1 1 
ATOM   1447  C  CD2 . LEU A 1  186 ? 25.559  81.379  91.489  1.00 29.12 ? 186  LEU A CD2 1 
ATOM   1448  N  N   . SER A 1  187 ? 20.815  80.524  94.246  1.00 23.12 ? 187  SER A N   1 
ATOM   1449  C  CA  . SER A 1  187 ? 19.441  80.969  94.519  1.00 22.70 ? 187  SER A CA  1 
ATOM   1450  C  C   . SER A 1  187 ? 19.290  81.767  95.820  1.00 22.18 ? 187  SER A C   1 
ATOM   1451  O  O   . SER A 1  187 ? 18.788  82.903  95.780  1.00 22.11 ? 187  SER A O   1 
ATOM   1452  C  CB  . SER A 1  187 ? 18.457  79.801  94.475  1.00 22.79 ? 187  SER A CB  1 
ATOM   1453  O  OG  . SER A 1  187 ? 17.164  80.260  94.134  1.00 29.90 ? 187  SER A OG  1 
ATOM   1454  N  N   . ARG A 1  188 ? 19.868  81.240  96.912  1.00 21.85 ? 188  ARG A N   1 
ATOM   1455  C  CA  . ARG A 1  188 ? 19.783  81.843  98.258  1.00 21.69 ? 188  ARG A CA  1 
ATOM   1456  C  C   . ARG A 1  188 ? 20.606  83.114  98.434  1.00 20.96 ? 188  ARG A C   1 
ATOM   1457  O  O   . ARG A 1  188 ? 20.140  84.062  99.076  1.00 20.51 ? 188  ARG A O   1 
ATOM   1458  C  CB  . ARG A 1  188 ? 20.122  80.830  99.358  1.00 22.13 ? 188  ARG A CB  1 
ATOM   1459  C  CG  . ARG A 1  188 ? 18.972  79.867  99.701  1.00 35.64 ? 188  ARG A CG  1 
ATOM   1460  C  CD  . ARG A 1  188 ? 18.218  80.215  100.993 1.00 47.18 ? 188  ARG A CD  1 
ATOM   1461  N  NE  . ARG A 1  188 ? 18.246  79.119  101.978 1.00 53.19 ? 188  ARG A NE  1 
ATOM   1462  C  CZ  . ARG A 1  188 ? 19.225  78.880  102.872 1.00 53.70 ? 188  ARG A CZ  1 
ATOM   1463  N  NH1 . ARG A 1  188 ? 20.344  79.615  102.916 1.00 48.98 ? 188  ARG A NH1 1 
ATOM   1464  N  NH2 . ARG A 1  188 ? 19.102  77.847  103.694 1.00 54.38 ? 188  ARG A NH2 1 
ATOM   1465  N  N   . HIS A 1  189 ? 21.758  83.169  97.756  1.00 21.05 ? 189  HIS A N   1 
ATOM   1466  C  CA  . HIS A 1  189 ? 22.806  84.159  98.035  1.00 20.67 ? 189  HIS A CA  1 
ATOM   1467  C  C   . HIS A 1  189 ? 22.976  85.265  97.005  1.00 20.46 ? 189  HIS A C   1 
ATOM   1468  O  O   . HIS A 1  189 ? 23.053  86.434  97.390  1.00 20.71 ? 189  HIS A O   1 
ATOM   1469  C  CB  . HIS A 1  189 ? 24.134  83.490  98.397  1.00 20.67 ? 189  HIS A CB  1 
ATOM   1470  C  CG  . HIS A 1  189 ? 24.057  82.641  99.628  1.00 16.92 ? 189  HIS A CG  1 
ATOM   1471  N  ND1 . HIS A 1  189 ? 23.918  83.178  100.888 1.00 14.23 ? 189  HIS A ND1 1 
ATOM   1472  C  CD2 . HIS A 1  189 ? 23.943  81.300  99.778  1.00 18.15 ? 189  HIS A CD2 1 
ATOM   1473  C  CE1 . HIS A 1  189 ? 23.763  82.204  101.767 1.00 19.23 ? 189  HIS A CE1 1 
ATOM   1474  N  NE2 . HIS A 1  189 ? 23.779  81.054  101.118 1.00 17.43 ? 189  HIS A NE2 1 
ATOM   1475  N  N   . TYR A 1  190 ? 22.824  84.924  95.716  1.00 20.18 ? 190  TYR A N   1 
ATOM   1476  C  CA  . TYR A 1  190 ? 23.015  85.878  94.603  1.00 19.77 ? 190  TYR A CA  1 
ATOM   1477  C  C   . TYR A 1  190 ? 21.724  86.686  94.330  1.00 19.64 ? 190  TYR A C   1 
ATOM   1478  O  O   . TYR A 1  190 ? 21.144  86.657  93.229  1.00 19.73 ? 190  TYR A O   1 
ATOM   1479  C  CB  . TYR A 1  190 ? 23.618  85.189  93.345  1.00 19.64 ? 190  TYR A CB  1 
ATOM   1480  C  CG  . TYR A 1  190 ? 25.129  84.882  93.377  1.00 25.64 ? 190  TYR A CG  1 
ATOM   1481  C  CD1 . TYR A 1  190 ? 25.911  85.021  92.203  1.00 25.98 ? 190  TYR A CD1 1 
ATOM   1482  C  CD2 . TYR A 1  190 ? 25.746  84.270  94.518  1.00 25.25 ? 190  TYR A CD2 1 
ATOM   1483  C  CE1 . TYR A 1  190 ? 27.308  84.668  92.197  1.00 23.56 ? 190  TYR A CE1 1 
ATOM   1484  C  CE2 . TYR A 1  190 ? 27.128  83.950  94.535  1.00 18.40 ? 190  TYR A CE2 1 
ATOM   1485  C  CZ  . TYR A 1  190 ? 27.896  84.145  93.380  1.00 23.86 ? 190  TYR A CZ  1 
ATOM   1486  O  OH  . TYR A 1  190 ? 29.218  83.767  93.407  1.00 21.03 ? 190  TYR A OH  1 
ATOM   1487  N  N   . LYS A 1  191 ? 21.285  87.380  95.383  1.00 19.70 ? 191  LYS A N   1 
ATOM   1488  C  CA  . LYS A 1  191 ? 20.073  88.205  95.409  1.00 19.91 ? 191  LYS A CA  1 
ATOM   1489  C  C   . LYS A 1  191 ? 20.470  89.679  95.387  1.00 20.19 ? 191  LYS A C   1 
ATOM   1490  O  O   . LYS A 1  191 ? 21.451  90.086  96.048  1.00 20.32 ? 191  LYS A O   1 
ATOM   1491  C  CB  . LYS A 1  191 ? 19.246  87.899  96.666  1.00 19.98 ? 191  LYS A CB  1 
ATOM   1492  C  CG  . LYS A 1  191 ? 18.460  86.580  96.613  1.00 28.50 ? 191  LYS A CG  1 
ATOM   1493  C  CD  . LYS A 1  191 ? 17.790  86.269  97.956  1.00 35.41 ? 191  LYS A CD  1 
ATOM   1494  C  CE  . LYS A 1  191 ? 17.032  84.939  97.921  1.00 37.28 ? 191  LYS A CE  1 
ATOM   1495  N  NZ  . LYS A 1  191 ? 16.287  84.676  99.193  1.00 34.53 ? 191  LYS A NZ  1 
ATOM   1496  N  N   . ALA A 1  192 ? 19.712  90.452  94.609  1.00 20.20 ? 192  ALA A N   1 
ATOM   1497  C  CA  . ALA A 1  192 ? 19.977  91.871  94.329  1.00 20.13 ? 192  ALA A CA  1 
ATOM   1498  C  C   . ALA A 1  192 ? 20.246  92.840  95.521  1.00 20.20 ? 192  ALA A C   1 
ATOM   1499  O  O   . ALA A 1  192 ? 21.235  93.582  95.415  1.00 20.15 ? 192  ALA A O   1 
ATOM   1500  C  CB  . ALA A 1  192 ? 18.951  92.444  93.354  1.00 20.00 ? 192  ALA A CB  1 
ATOM   1501  N  N   . PRO A 1  193 ? 19.509  92.767  96.677  1.00 20.33 ? 193  PRO A N   1 
ATOM   1502  C  CA  . PRO A 1  193 ? 19.876  93.582  97.864  1.00 20.26 ? 193  PRO A CA  1 
ATOM   1503  C  C   . PRO A 1  193 ? 21.236  93.257  98.493  1.00 20.35 ? 193  PRO A C   1 
ATOM   1504  O  O   . PRO A 1  193 ? 21.860  94.175  99.031  1.00 20.74 ? 193  PRO A O   1 
ATOM   1505  C  CB  . PRO A 1  193 ? 18.749  93.287  98.859  1.00 19.92 ? 193  PRO A CB  1 
ATOM   1506  C  CG  . PRO A 1  193 ? 17.622  92.927  98.022  1.00 20.15 ? 193  PRO A CG  1 
ATOM   1507  C  CD  . PRO A 1  193 ? 18.210  92.091  96.934  1.00 20.26 ? 193  PRO A CD  1 
ATOM   1508  N  N   . ARG A 1  194 ? 21.734  92.044  98.248  1.00 20.26 ? 194  ARG A N   1 
ATOM   1509  C  CA  . ARG A 1  194 ? 23.005  91.537  98.787  1.00 20.39 ? 194  ARG A CA  1 
ATOM   1510  C  C   . ARG A 1  194 ? 24.192  91.763  97.826  1.00 19.91 ? 194  ARG A C   1 
ATOM   1511  O  O   . ARG A 1  194 ? 25.349  91.422  98.156  1.00 19.90 ? 194  ARG A O   1 
ATOM   1512  C  CB  . ARG A 1  194 ? 22.868  90.046  99.125  1.00 20.97 ? 194  ARG A CB  1 
ATOM   1513  C  CG  . ARG A 1  194 ? 21.885  89.721  100.242 1.00 26.38 ? 194  ARG A CG  1 
ATOM   1514  C  CD  . ARG A 1  194 ? 21.380  88.312  100.179 1.00 37.15 ? 194  ARG A CD  1 
ATOM   1515  N  NE  . ARG A 1  194 ? 22.014  87.464  101.195 1.00 43.88 ? 194  ARG A NE  1 
ATOM   1516  C  CZ  . ARG A 1  194 ? 23.173  86.804  101.063 1.00 46.36 ? 194  ARG A CZ  1 
ATOM   1517  N  NH1 . ARG A 1  194 ? 23.921  86.890  99.963  1.00 46.30 ? 194  ARG A NH1 1 
ATOM   1518  N  NH2 . ARG A 1  194 ? 23.589  86.049  102.057 1.00 49.53 ? 194  ARG A NH2 1 
ATOM   1519  N  N   . MET A 1  195 ? 23.892  92.334  96.650  1.00 19.31 ? 195  MET A N   1 
ATOM   1520  C  CA  . MET A 1  195 ? 24.890  92.656  95.634  1.00 18.53 ? 195  MET A CA  1 
ATOM   1521  C  C   . MET A 1  195 ? 24.970  94.098  95.115  1.00 17.81 ? 195  MET A C   1 
ATOM   1522  O  O   . MET A 1  195 ? 23.990  94.861  95.224  1.00 17.78 ? 195  MET A O   1 
ATOM   1523  C  CB  . MET A 1  195 ? 25.049  91.567  94.553  1.00 18.54 ? 195  MET A CB  1 
ATOM   1524  C  CG  . MET A 1  195 ? 23.800  91.125  93.837  1.00 25.97 ? 195  MET A CG  1 
ATOM   1525  S  SD  . MET A 1  195 ? 24.170  89.875  92.600  1.00 31.83 ? 195  MET A SD  1 
ATOM   1526  C  CE  . MET A 1  195 ? 24.095  90.898  91.152  1.00 34.68 ? 195  MET A CE  1 
ATOM   1527  N  N   . VAL A 1  196 ? 26.219  94.509  94.836  1.00 17.16 ? 196  VAL A N   1 
ATOM   1528  C  CA  . VAL A 1  196 ? 26.621  95.893  94.487  1.00 16.51 ? 196  VAL A CA  1 
ATOM   1529  C  C   . VAL A 1  196 ? 27.359  95.832  93.136  1.00 15.85 ? 196  VAL A C   1 
ATOM   1530  O  O   . VAL A 1  196 ? 28.301  95.048  92.985  1.00 16.01 ? 196  VAL A O   1 
ATOM   1531  C  CB  . VAL A 1  196 ? 27.589  96.530  95.599  1.00 16.91 ? 196  VAL A CB  1 
ATOM   1532  C  CG1 . VAL A 1  196 ? 28.007  97.995  95.255  1.00 18.82 ? 196  VAL A CG1 1 
ATOM   1533  C  CG2 . VAL A 1  196 ? 26.980  96.458  97.020  1.00 13.91 ? 196  VAL A CG2 1 
ATOM   1534  N  N   . LEU A 1  197 ? 26.940  96.674  92.184  1.00 15.15 ? 197  LEU A N   1 
ATOM   1535  C  CA  . LEU A 1  197 ? 27.702  96.920  90.952  1.00 14.51 ? 197  LEU A CA  1 
ATOM   1536  C  C   . LEU A 1  197 ? 28.561  98.190  91.028  1.00 13.91 ? 197  LEU A C   1 
ATOM   1537  O  O   . LEU A 1  197 ? 28.040  99.334  91.017  1.00 14.12 ? 197  LEU A O   1 
ATOM   1538  C  CB  . LEU A 1  197 ? 26.809  96.860  89.698  1.00 14.54 ? 197  LEU A CB  1 
ATOM   1539  C  CG  . LEU A 1  197 ? 27.345  97.297  88.321  1.00 13.98 ? 197  LEU A CG  1 
ATOM   1540  C  CD1 . LEU A 1  197 ? 28.005  96.148  87.560  1.00 8.49  ? 197  LEU A CD1 1 
ATOM   1541  C  CD2 . LEU A 1  197 ? 26.207  97.889  87.536  1.00 6.61  ? 197  LEU A CD2 1 
ATOM   1542  N  N   . ALA A 1  198 ? 29.876  97.961  91.057  1.00 12.75 ? 198  ALA A N   1 
ATOM   1543  C  CA  . ALA A 1  198 ? 30.875  99.000  91.309  1.00 12.17 ? 198  ALA A CA  1 
ATOM   1544  C  C   . ALA A 1  198 ? 31.688  99.299  90.057  1.00 12.26 ? 198  ALA A C   1 
ATOM   1545  O  O   . ALA A 1  198 ? 32.015  98.374  89.289  1.00 12.14 ? 198  ALA A O   1 
ATOM   1546  C  CB  . ALA A 1  198 ? 31.783  98.598  92.450  1.00 12.00 ? 198  ALA A CB  1 
ATOM   1547  N  N   . ALA A 1  199 ? 31.990  100.589 89.846  1.00 12.43 ? 199  ALA A N   1 
ATOM   1548  C  CA  . ALA A 1  199 ? 32.957  101.023 88.828  1.00 13.08 ? 199  ALA A CA  1 
ATOM   1549  C  C   . ALA A 1  199 ? 33.861  102.184 89.234  1.00 13.90 ? 199  ALA A C   1 
ATOM   1550  O  O   . ALA A 1  199 ? 33.435  103.092 89.959  1.00 14.24 ? 199  ALA A O   1 
ATOM   1551  C  CB  . ALA A 1  199 ? 32.259  101.306 87.487  1.00 13.16 ? 199  ALA A CB  1 
ATOM   1552  N  N   . ALA A 1  200 ? 35.116  102.135 88.780  1.00 14.33 ? 200  ALA A N   1 
ATOM   1553  C  CA  . ALA A 1  200 ? 36.021  103.301 88.826  1.00 14.59 ? 200  ALA A CA  1 
ATOM   1554  C  C   . ALA A 1  200 ? 36.751  103.525 87.512  1.00 14.97 ? 200  ALA A C   1 
ATOM   1555  O  O   . ALA A 1  200 ? 37.208  102.555 86.879  1.00 14.40 ? 200  ALA A O   1 
ATOM   1556  C  CB  . ALA A 1  200 ? 36.999  103.196 89.987  1.00 13.96 ? 200  ALA A CB  1 
ATOM   1557  N  N   . GLY A 1  201 ? 36.594  104.748 86.997  1.00 15.74 ? 201  GLY A N   1 
ATOM   1558  C  CA  . GLY A 1  201 ? 37.431  105.290 85.934  1.00 17.11 ? 201  GLY A CA  1 
ATOM   1559  C  C   . GLY A 1  201 ? 36.717  106.287 85.041  1.00 18.53 ? 201  GLY A C   1 
ATOM   1560  O  O   . GLY A 1  201 ? 35.912  107.105 85.527  1.00 18.44 ? 201  GLY A O   1 
ATOM   1561  N  N   . GLY A 1  202 ? 36.919  106.126 83.727  1.00 19.78 ? 202  GLY A N   1 
ATOM   1562  C  CA  . GLY A 1  202 ? 36.503  107.094 82.716  1.00 21.00 ? 202  GLY A CA  1 
ATOM   1563  C  C   . GLY A 1  202 ? 35.094  106.885 82.217  1.00 22.34 ? 202  GLY A C   1 
ATOM   1564  O  O   . GLY A 1  202 ? 34.875  106.794 80.997  1.00 22.91 ? 202  GLY A O   1 
ATOM   1565  N  N   . LEU A 1  203 ? 34.145  107.024 83.146  1.00 22.84 ? 203  LEU A N   1 
ATOM   1566  C  CA  . LEU A 1  203 ? 32.715  106.778 82.924  1.00 23.32 ? 203  LEU A CA  1 
ATOM   1567  C  C   . LEU A 1  203 ? 31.848  107.814 83.651  1.00 23.72 ? 203  LEU A C   1 
ATOM   1568  O  O   . LEU A 1  203 ? 32.279  108.396 84.641  1.00 23.92 ? 203  LEU A O   1 
ATOM   1569  C  CB  . LEU A 1  203 ? 32.344  105.341 83.346  1.00 23.36 ? 203  LEU A CB  1 
ATOM   1570  C  CG  . LEU A 1  203 ? 32.527  104.876 84.803  1.00 24.90 ? 203  LEU A CG  1 
ATOM   1571  C  CD1 . LEU A 1  203 ? 31.226  104.302 85.318  1.00 25.02 ? 203  LEU A CD1 1 
ATOM   1572  C  CD2 . LEU A 1  203 ? 33.677  103.885 84.963  1.00 19.12 ? 203  LEU A CD2 1 
ATOM   1573  N  N   . GLU A 1  204 ? 30.670  108.093 83.098  1.00 24.37 ? 204  GLU A N   1 
ATOM   1574  C  CA  . GLU A 1  204 ? 29.570  108.739 83.836  1.00 24.84 ? 204  GLU A CA  1 
ATOM   1575  C  C   . GLU A 1  204 ? 28.735  107.715 84.620  1.00 24.53 ? 204  GLU A C   1 
ATOM   1576  O  O   . GLU A 1  204 ? 28.596  106.551 84.184  1.00 24.37 ? 204  GLU A O   1 
ATOM   1577  C  CB  . GLU A 1  204 ? 28.687  109.538 82.881  1.00 25.21 ? 204  GLU A CB  1 
ATOM   1578  C  CG  . GLU A 1  204 ? 29.182  110.955 82.619  1.00 39.06 ? 204  GLU A CG  1 
ATOM   1579  C  CD  . GLU A 1  204 ? 28.421  111.650 81.496  1.00 47.73 ? 204  GLU A CD  1 
ATOM   1580  O  OE1 . GLU A 1  204 ? 27.245  112.040 81.708  1.00 45.81 ? 204  GLU A OE1 1 
ATOM   1581  O  OE2 . GLU A 1  204 ? 29.011  111.834 80.406  1.00 52.18 ? 204  GLU A OE2 1 
ATOM   1582  N  N   . HIS A 1  205 ? 28.253  108.142 85.800  1.00 24.22 ? 205  HIS A N   1 
ATOM   1583  C  CA  . HIS A 1  205 ? 27.354  107.351 86.673  1.00 23.93 ? 205  HIS A CA  1 
ATOM   1584  C  C   . HIS A 1  205 ? 26.029  106.954 85.997  1.00 23.75 ? 205  HIS A C   1 
ATOM   1585  O  O   . HIS A 1  205 ? 25.585  105.804 86.152  1.00 23.60 ? 205  HIS A O   1 
ATOM   1586  C  CB  . HIS A 1  205 ? 27.080  108.093 87.988  1.00 23.82 ? 205  HIS A CB  1 
ATOM   1587  C  CG  . HIS A 1  205 ? 26.196  107.341 88.940  1.00 22.49 ? 205  HIS A CG  1 
ATOM   1588  N  ND1 . HIS A 1  205 ? 26.663  106.325 89.745  1.00 20.95 ? 205  HIS A ND1 1 
ATOM   1589  C  CD2 . HIS A 1  205 ? 24.872  107.452 89.204  1.00 17.37 ? 205  HIS A CD2 1 
ATOM   1590  C  CE1 . HIS A 1  205 ? 25.677  105.881 90.504  1.00 17.28 ? 205  HIS A CE1 1 
ATOM   1591  N  NE2 . HIS A 1  205 ? 24.573  106.522 90.169  1.00 16.70 ? 205  HIS A NE2 1 
ATOM   1592  N  N   . ARG A 1  206 ? 25.388  107.941 85.345  1.00 23.67 ? 206  ARG A N   1 
ATOM   1593  C  CA  . ARG A 1  206 ? 24.166  107.794 84.522  1.00 23.80 ? 206  ARG A CA  1 
ATOM   1594  C  C   . ARG A 1  206 ? 24.211  106.597 83.545  1.00 23.65 ? 206  ARG A C   1 
ATOM   1595  O  O   . ARG A 1  206 ? 23.297  105.752 83.557  1.00 23.50 ? 206  ARG A O   1 
ATOM   1596  C  CB  . ARG A 1  206 ? 23.891  109.100 83.750  1.00 23.91 ? 206  ARG A CB  1 
ATOM   1597  C  CG  . ARG A 1  206 ? 22.620  109.849 84.150  1.00 33.91 ? 206  ARG A CG  1 
ATOM   1598  C  CD  . ARG A 1  206 ? 22.201  110.931 83.141  1.00 35.70 ? 206  ARG A CD  1 
ATOM   1599  N  NE  . ARG A 1  206 ? 21.346  111.973 83.738  1.00 40.43 ? 206  ARG A NE  1 
ATOM   1600  C  CZ  . ARG A 1  206 ? 21.390  113.296 83.464  1.00 39.52 ? 206  ARG A CZ  1 
ATOM   1601  N  NH1 . ARG A 1  206 ? 22.289  113.818 82.623  1.00 35.52 ? 206  ARG A NH1 1 
ATOM   1602  N  NH2 . ARG A 1  206 ? 20.532  114.112 84.068  1.00 36.54 ? 206  ARG A NH2 1 
ATOM   1603  N  N   . GLN A 1  207 ? 25.364  106.454 82.871  1.00 23.58 ? 207  GLN A N   1 
ATOM   1604  C  CA  . GLN A 1  207 ? 25.660  105.388 81.909  1.00 23.57 ? 207  GLN A CA  1 
ATOM   1605  C  C   . GLN A 1  207 ? 25.728  104.004 82.575  1.00 23.40 ? 207  GLN A C   1 
ATOM   1606  O  O   . GLN A 1  207 ? 25.128  103.050 82.062  1.00 23.54 ? 207  GLN A O   1 
ATOM   1607  C  CB  . GLN A 1  207 ? 26.965  105.707 81.172  1.00 23.79 ? 207  GLN A CB  1 
ATOM   1608  C  CG  . GLN A 1  207 ? 27.070  105.124 79.777  1.00 34.84 ? 207  GLN A CG  1 
ATOM   1609  C  CD  . GLN A 1  207 ? 28.465  105.259 79.208  1.00 40.85 ? 207  GLN A CD  1 
ATOM   1610  O  OE1 . GLN A 1  207 ? 29.352  104.447 79.506  1.00 35.58 ? 207  GLN A OE1 1 
ATOM   1611  N  NE2 . GLN A 1  207 ? 28.685  106.320 78.432  1.00 42.81 ? 207  GLN A NE2 1 
ATOM   1612  N  N   . LEU A 1  208 ? 26.397  103.939 83.739  1.00 23.06 ? 208  LEU A N   1 
ATOM   1613  C  CA  . LEU A 1  208 ? 26.431  102.768 84.624  1.00 22.65 ? 208  LEU A CA  1 
ATOM   1614  C  C   . LEU A 1  208 ? 25.055  102.344 85.168  1.00 22.66 ? 208  LEU A C   1 
ATOM   1615  O  O   . LEU A 1  208 ? 24.742  101.143 85.171  1.00 22.43 ? 208  LEU A O   1 
ATOM   1616  C  CB  . LEU A 1  208 ? 27.423  102.988 85.780  1.00 22.32 ? 208  LEU A CB  1 
ATOM   1617  C  CG  . LEU A 1  208 ? 28.414  101.939 86.329  1.00 25.35 ? 208  LEU A CG  1 
ATOM   1618  C  CD1 . LEU A 1  208 ? 28.475  101.998 87.853  1.00 24.15 ? 208  LEU A CD1 1 
ATOM   1619  C  CD2 . LEU A 1  208 ? 28.329  100.477 85.808  1.00 14.34 ? 208  LEU A CD2 1 
ATOM   1620  N  N   . LEU A 1  209 ? 24.257  103.332 85.611  1.00 22.84 ? 209  LEU A N   1 
ATOM   1621  C  CA  . LEU A 1  209 ? 22.850  103.147 86.020  1.00 23.10 ? 209  LEU A CA  1 
ATOM   1622  C  C   . LEU A 1  209 ? 21.951  102.582 84.910  1.00 22.97 ? 209  LEU A C   1 
ATOM   1623  O  O   . LEU A 1  209 ? 21.130  101.694 85.183  1.00 22.65 ? 209  LEU A O   1 
ATOM   1624  C  CB  . LEU A 1  209 ? 22.247  104.465 86.552  1.00 23.29 ? 209  LEU A CB  1 
ATOM   1625  C  CG  . LEU A 1  209 ? 21.353  104.580 87.807  1.00 28.89 ? 209  LEU A CG  1 
ATOM   1626  C  CD1 . LEU A 1  209 ? 20.684  105.964 87.856  1.00 30.10 ? 209  LEU A CD1 1 
ATOM   1627  C  CD2 . LEU A 1  209 ? 20.293  103.474 88.027  1.00 30.88 ? 209  LEU A CD2 1 
ATOM   1628  N  N   . ASP A 1  210 ? 22.098  103.129 83.690  1.00 23.21 ? 210  ASP A N   1 
ATOM   1629  C  CA  . ASP A 1  210 ? 21.362  102.691 82.487  1.00 23.56 ? 210  ASP A CA  1 
ATOM   1630  C  C   . ASP A 1  210 ? 21.648  101.228 82.125  1.00 23.31 ? 210  ASP A C   1 
ATOM   1631  O  O   . ASP A 1  210 ? 20.701  100.429 81.966  1.00 23.14 ? 210  ASP A O   1 
ATOM   1632  C  CB  . ASP A 1  210 ? 21.634  103.623 81.295  1.00 23.79 ? 210  ASP A CB  1 
ATOM   1633  C  CG  . ASP A 1  210 ? 20.575  104.699 81.144  1.00 35.11 ? 210  ASP A CG  1 
ATOM   1634  O  OD1 . ASP A 1  210 ? 19.546  104.439 80.480  1.00 42.54 ? 210  ASP A OD1 1 
ATOM   1635  O  OD2 . ASP A 1  210 ? 20.666  105.827 81.679  1.00 38.66 ? 210  ASP A OD2 1 
ATOM   1636  N  N   . LEU A 1  211 ? 22.932  100.859 82.207  1.00 23.24 ? 211  LEU A N   1 
ATOM   1637  C  CA  . LEU A 1  211 ? 23.396  99.480  81.982  1.00 23.15 ? 211  LEU A CA  1 
ATOM   1638  C  C   . LEU A 1  211 ? 22.983  98.492  83.078  1.00 23.31 ? 211  LEU A C   1 
ATOM   1639  O  O   . LEU A 1  211 ? 22.625  97.341  82.766  1.00 23.24 ? 211  LEU A O   1 
ATOM   1640  C  CB  . LEU A 1  211 ? 24.903  99.431  81.712  1.00 22.81 ? 211  LEU A CB  1 
ATOM   1641  C  CG  . LEU A 1  211 ? 25.463  100.125 80.458  1.00 22.25 ? 211  LEU A CG  1 
ATOM   1642  C  CD1 . LEU A 1  211 ? 26.942  100.454 80.644  1.00 15.98 ? 211  LEU A CD1 1 
ATOM   1643  C  CD2 . LEU A 1  211 ? 25.195  99.370  79.147  1.00 18.80 ? 211  LEU A CD2 1 
ATOM   1644  N  N   . ALA A 1  212 ? 22.962  98.978  84.331  1.00 23.52 ? 212  ALA A N   1 
ATOM   1645  C  CA  . ALA A 1  212 ? 22.353  98.287  85.474  1.00 24.07 ? 212  ALA A CA  1 
ATOM   1646  C  C   . ALA A 1  212 ? 20.851  97.990  85.298  1.00 25.12 ? 212  ALA A C   1 
ATOM   1647  O  O   . ALA A 1  212 ? 20.433  96.843  85.495  1.00 25.16 ? 212  ALA A O   1 
ATOM   1648  C  CB  . ALA A 1  212 ? 22.623  99.035  86.768  1.00 23.71 ? 212  ALA A CB  1 
ATOM   1649  N  N   . GLN A 1  213 ? 20.090  98.976  84.801  1.00 25.96 ? 213  GLN A N   1 
ATOM   1650  C  CA  . GLN A 1  213 ? 18.678  98.779  84.438  1.00 27.08 ? 213  GLN A CA  1 
ATOM   1651  C  C   . GLN A 1  213 ? 18.426  97.901  83.200  1.00 27.75 ? 213  GLN A C   1 
ATOM   1652  O  O   . GLN A 1  213 ? 17.388  97.226  83.135  1.00 27.84 ? 213  GLN A O   1 
ATOM   1653  C  CB  . GLN A 1  213 ? 17.908  100.102 84.357  1.00 27.36 ? 213  GLN A CB  1 
ATOM   1654  C  CG  . GLN A 1  213 ? 16.509  100.017 84.991  1.00 34.45 ? 213  GLN A CG  1 
ATOM   1655  C  CD  . GLN A 1  213 ? 16.089  101.298 85.698  1.00 37.34 ? 213  GLN A CD  1 
ATOM   1656  O  OE1 . GLN A 1  213 ? 16.662  101.671 86.730  1.00 37.84 ? 213  GLN A OE1 1 
ATOM   1657  N  NE2 . GLN A 1  213 ? 15.039  101.932 85.190  1.00 35.11 ? 213  GLN A NE2 1 
ATOM   1658  N  N   . LYS A 1  214 ? 19.369  97.916  82.243  1.00 28.24 ? 214  LYS A N   1 
ATOM   1659  C  CA  . LYS A 1  214 ? 19.340  97.042  81.054  1.00 28.74 ? 214  LYS A CA  1 
ATOM   1660  C  C   . LYS A 1  214 ? 19.527  95.552  81.377  1.00 29.19 ? 214  LYS A C   1 
ATOM   1661  O  O   . LYS A 1  214 ? 18.688  94.728  80.985  1.00 29.37 ? 214  LYS A O   1 
ATOM   1662  C  CB  . LYS A 1  214 ? 20.351  97.507  79.996  1.00 28.79 ? 214  LYS A CB  1 
ATOM   1663  C  CG  . LYS A 1  214 ? 19.965  97.163  78.555  1.00 28.77 ? 214  LYS A CG  1 
ATOM   1664  C  CD  . LYS A 1  214 ? 20.761  97.988  77.558  1.00 33.38 ? 214  LYS A CD  1 
ATOM   1665  C  CE  . LYS A 1  214 ? 20.206  97.832  76.146  1.00 40.76 ? 214  LYS A CE  1 
ATOM   1666  N  NZ  . LYS A 1  214 ? 21.175  97.164  75.223  1.00 42.93 ? 214  LYS A NZ  1 
ATOM   1667  N  N   . HIS A 1  215 ? 20.517  95.251  82.223  1.00 29.52 ? 215  HIS A N   1 
ATOM   1668  C  CA  . HIS A 1  215 ? 21.119  93.915  82.301  1.00 29.96 ? 215  HIS A CA  1 
ATOM   1669  C  C   . HIS A 1  215 ? 20.910  93.175  83.628  1.00 30.81 ? 215  HIS A C   1 
ATOM   1670  O  O   . HIS A 1  215 ? 20.978  91.936  83.659  1.00 30.78 ? 215  HIS A O   1 
ATOM   1671  C  CB  . HIS A 1  215 ? 22.604  93.956  81.901  1.00 29.63 ? 215  HIS A CB  1 
ATOM   1672  C  CG  . HIS A 1  215 ? 22.845  94.424  80.495  1.00 24.70 ? 215  HIS A CG  1 
ATOM   1673  N  ND1 . HIS A 1  215 ? 23.595  95.542  80.205  1.00 23.89 ? 215  HIS A ND1 1 
ATOM   1674  C  CD2 . HIS A 1  215 ? 22.393  93.958  79.305  1.00 29.56 ? 215  HIS A CD2 1 
ATOM   1675  C  CE1 . HIS A 1  215 ? 23.624  95.726  78.897  1.00 25.37 ? 215  HIS A CE1 1 
ATOM   1676  N  NE2 . HIS A 1  215 ? 22.863  94.807  78.332  1.00 27.63 ? 215  HIS A NE2 1 
ATOM   1677  N  N   . PHE A 1  216 ? 20.567  93.930  84.682  1.00 31.77 ? 216  PHE A N   1 
ATOM   1678  C  CA  . PHE A 1  216 ? 20.360  93.405  86.045  1.00 32.61 ? 216  PHE A CA  1 
ATOM   1679  C  C   . PHE A 1  216 ? 18.895  93.428  86.528  1.00 34.14 ? 216  PHE A C   1 
ATOM   1680  O  O   . PHE A 1  216 ? 18.594  92.902  87.617  1.00 34.26 ? 216  PHE A O   1 
ATOM   1681  C  CB  . PHE A 1  216 ? 21.291  94.111  87.047  1.00 32.05 ? 216  PHE A CB  1 
ATOM   1682  C  CG  . PHE A 1  216 ? 22.735  93.710  86.929  1.00 19.90 ? 216  PHE A CG  1 
ATOM   1683  C  CD1 . PHE A 1  216 ? 23.606  94.404  86.051  1.00 17.56 ? 216  PHE A CD1 1 
ATOM   1684  C  CD2 . PHE A 1  216 ? 23.274  92.715  87.788  1.00 18.29 ? 216  PHE A CD2 1 
ATOM   1685  C  CE1 . PHE A 1  216 ? 25.008  94.077  85.983  1.00 14.37 ? 216  PHE A CE1 1 
ATOM   1686  C  CE2 . PHE A 1  216 ? 24.673  92.383  87.751  1.00 16.36 ? 216  PHE A CE2 1 
ATOM   1687  C  CZ  . PHE A 1  216 ? 25.537  93.065  86.834  1.00 12.00 ? 216  PHE A CZ  1 
ATOM   1688  N  N   . SER A 1  217 ? 18.000  93.977  85.685  1.00 35.67 ? 217  SER A N   1 
ATOM   1689  C  CA  . SER A 1  217 ? 16.529  93.915  85.844  1.00 37.16 ? 217  SER A CA  1 
ATOM   1690  C  C   . SER A 1  217 ? 15.979  92.483  85.902  1.00 38.49 ? 217  SER A C   1 
ATOM   1691  O  O   . SER A 1  217 ? 16.408  91.612  85.126  1.00 38.51 ? 217  SER A O   1 
ATOM   1692  C  CB  . SER A 1  217 ? 15.838  94.697  84.725  1.00 37.14 ? 217  SER A CB  1 
ATOM   1693  O  OG  . SER A 1  217 ? 14.469  94.908  85.017  1.00 40.16 ? 217  SER A OG  1 
ATOM   1694  N  N   . GLY A 1  218 ? 15.129  92.243  86.907  1.00 39.86 ? 218  GLY A N   1 
ATOM   1695  C  CA  . GLY A 1  218 ? 14.526  90.941  87.180  1.00 41.41 ? 218  GLY A CA  1 
ATOM   1696  C  C   . GLY A 1  218 ? 15.485  89.877  87.703  1.00 42.84 ? 218  GLY A C   1 
ATOM   1697  O  O   . GLY A 1  218 ? 15.577  88.790  87.108  1.00 42.78 ? 218  GLY A O   1 
ATOM   1698  N  N   . LEU A 1  219 ? 16.301  90.252  88.699  1.00 44.19 ? 219  LEU A N   1 
ATOM   1699  C  CA  . LEU A 1  219 ? 16.862  89.311  89.683  1.00 45.49 ? 219  LEU A CA  1 
ATOM   1700  C  C   . LEU A 1  219 ? 15.890  89.012  90.839  1.00 46.72 ? 219  LEU A C   1 
ATOM   1701  O  O   . LEU A 1  219 ? 15.619  87.834  91.135  1.00 46.80 ? 219  LEU A O   1 
ATOM   1702  C  CB  . LEU A 1  219 ? 18.196  89.822  90.228  1.00 45.48 ? 219  LEU A CB  1 
ATOM   1703  C  CG  . LEU A 1  219 ? 19.464  89.323  89.541  1.00 50.38 ? 219  LEU A CG  1 
ATOM   1704  C  CD1 . LEU A 1  219 ? 20.412  90.486  89.282  1.00 52.37 ? 219  LEU A CD1 1 
ATOM   1705  C  CD2 . LEU A 1  219 ? 20.157  88.239  90.367  1.00 49.18 ? 219  LEU A CD2 1 
ATOM   1706  N  N   . SER A 1  220 ? 15.274  90.078  91.371  1.00 47.67 ? 220  SER A N   1 
ATOM   1707  C  CA  . SER A 1  220 ? 14.483  90.058  92.616  1.00 48.35 ? 220  SER A CA  1 
ATOM   1708  C  C   . SER A 1  220 ? 13.100  90.760  92.501  1.00 49.26 ? 220  SER A C   1 
ATOM   1709  O  O   . SER A 1  220 ? 12.256  90.605  93.403  1.00 49.41 ? 220  SER A O   1 
ATOM   1710  C  CB  . SER A 1  220 ? 15.314  90.652  93.770  1.00 48.11 ? 220  SER A CB  1 
ATOM   1711  O  OG  . SER A 1  220 ? 14.642  90.551  95.016  1.00 40.02 ? 220  SER A OG  1 
ATOM   1712  N  N   . GLY A 1  221 ? 12.804  91.307  91.308  1.00 49.99 ? 221  GLY A N   1 
ATOM   1713  C  CA  . GLY A 1  221 ? 11.746  92.301  91.089  1.00 50.69 ? 221  GLY A CA  1 
ATOM   1714  C  C   . GLY A 1  221 ? 10.290  91.834  91.128  1.00 51.45 ? 221  GLY A C   1 
ATOM   1715  O  O   . GLY A 1  221 ? 9.393   92.615  90.763  1.00 51.51 ? 221  GLY A O   1 
ATOM   1716  N  N   . THR A 1  222 ? 10.085  90.528  91.349  1.00 52.02 ? 222  THR A N   1 
ATOM   1717  C  CA  . THR A 1  222 ? 8.860   89.978  91.974  1.00 52.51 ? 222  THR A CA  1 
ATOM   1718  C  C   . THR A 1  222 ? 9.106   88.987  93.141  1.00 52.97 ? 222  THR A C   1 
ATOM   1719  O  O   . THR A 1  222 ? 8.205   88.795  93.983  1.00 52.99 ? 222  THR A O   1 
ATOM   1720  C  CB  . THR A 1  222 ? 7.858   89.375  90.914  1.00 52.51 ? 222  THR A CB  1 
ATOM   1721  O  OG1 . THR A 1  222 ? 8.509   89.158  89.650  1.00 51.83 ? 222  THR A OG1 1 
ATOM   1722  C  CG2 . THR A 1  222 ? 6.751   90.377  90.583  1.00 50.74 ? 222  THR A CG2 1 
ATOM   1723  N  N   . TYR A 1  223 ? 10.362  88.521  93.278  1.00 53.35 ? 223  TYR A N   1 
ATOM   1724  C  CA  . TYR A 1  223 ? 10.724  87.357  94.109  1.00 53.74 ? 223  TYR A CA  1 
ATOM   1725  C  C   . TYR A 1  223 ? 11.112  87.676  95.582  1.00 53.87 ? 223  TYR A C   1 
ATOM   1726  O  O   . TYR A 1  223 ? 10.224  87.683  96.448  1.00 53.95 ? 223  TYR A O   1 
ATOM   1727  C  CB  . TYR A 1  223 ? 11.727  86.423  93.378  1.00 53.94 ? 223  TYR A CB  1 
ATOM   1728  C  CG  . TYR A 1  223 ? 12.004  85.095  94.081  1.00 60.11 ? 223  TYR A CG  1 
ATOM   1729  C  CD1 . TYR A 1  223 ? 13.233  84.884  94.773  1.00 61.60 ? 223  TYR A CD1 1 
ATOM   1730  C  CD2 . TYR A 1  223 ? 11.049  84.029  94.050  1.00 61.72 ? 223  TYR A CD2 1 
ATOM   1731  C  CE1 . TYR A 1  223 ? 13.504  83.638  95.455  1.00 62.33 ? 223  TYR A CE1 1 
ATOM   1732  C  CE2 . TYR A 1  223 ? 11.300  82.781  94.735  1.00 63.85 ? 223  TYR A CE2 1 
ATOM   1733  C  CZ  . TYR A 1  223 ? 12.533  82.602  95.426  1.00 64.61 ? 223  TYR A CZ  1 
ATOM   1734  O  OH  . TYR A 1  223 ? 12.786  81.416  96.081  1.00 64.73 ? 223  TYR A OH  1 
ATOM   1735  N  N   . ASP A 1  224 ? 12.364  88.121  95.809  1.00 53.91 ? 224  ASP A N   1 
ATOM   1736  C  CA  . ASP A 1  224 ? 13.085  88.045  97.117  1.00 53.93 ? 224  ASP A CA  1 
ATOM   1737  C  C   . ASP A 1  224 ? 12.863  86.829  98.051  1.00 53.99 ? 224  ASP A C   1 
ATOM   1738  O  O   . ASP A 1  224 ? 13.810  86.058  98.278  1.00 53.88 ? 224  ASP A O   1 
ATOM   1739  C  CB  . ASP A 1  224 ? 13.150  89.398  97.878  1.00 53.96 ? 224  ASP A CB  1 
ATOM   1740  C  CG  . ASP A 1  224 ? 11.802  90.118  97.953  1.00 54.74 ? 224  ASP A CG  1 
ATOM   1741  O  OD1 . ASP A 1  224 ? 10.923  89.690  98.736  1.00 52.72 ? 224  ASP A OD1 1 
ATOM   1742  O  OD2 . ASP A 1  224 ? 11.581  91.187  97.346  1.00 55.84 ? 224  ASP A OD2 1 
ATOM   1743  N  N   . GLU A 1  225 ? 11.669  86.758  98.679  1.00 54.12 ? 225  GLU A N   1 
ATOM   1744  C  CA  . GLU A 1  225 ? 11.006  85.512  99.161  1.00 54.10 ? 225  GLU A CA  1 
ATOM   1745  C  C   . GLU A 1  225 ? 11.580  84.851  100.444 1.00 54.28 ? 225  GLU A C   1 
ATOM   1746  O  O   . GLU A 1  225 ? 12.719  85.140  100.848 1.00 54.10 ? 225  GLU A O   1 
ATOM   1747  C  CB  . GLU A 1  225 ? 10.760  84.497  98.003  1.00 54.03 ? 225  GLU A CB  1 
ATOM   1748  C  CG  . GLU A 1  225 ? 9.389   83.796  97.978  1.00 53.36 ? 225  GLU A CG  1 
ATOM   1749  C  CD  . GLU A 1  225 ? 8.200   84.744  97.842  1.00 51.65 ? 225  GLU A CD  1 
ATOM   1750  O  OE1 . GLU A 1  225 ? 7.461   84.909  98.837  1.00 47.44 ? 225  GLU A OE1 1 
ATOM   1751  O  OE2 . GLU A 1  225 ? 8.003   85.316  96.747  1.00 53.13 ? 225  GLU A OE2 1 
ATOM   1752  N  N   . ASP A 1  226 ? 10.760  83.986  101.069 1.00 54.67 ? 226  ASP A N   1 
ATOM   1753  C  CA  . ASP A 1  226 ? 10.933  83.480  102.444 1.00 54.92 ? 226  ASP A CA  1 
ATOM   1754  C  C   . ASP A 1  226 ? 12.130  82.522  102.649 1.00 55.13 ? 226  ASP A C   1 
ATOM   1755  O  O   . ASP A 1  226 ? 12.627  81.918  101.678 1.00 55.39 ? 226  ASP A O   1 
ATOM   1756  C  CB  . ASP A 1  226 ? 9.624   82.846  102.938 1.00 54.97 ? 226  ASP A CB  1 
ATOM   1757  C  CG  . ASP A 1  226 ? 8.918   83.701  103.973 1.00 56.68 ? 226  ASP A CG  1 
ATOM   1758  O  OD1 . ASP A 1  226 ? 9.354   83.710  105.148 1.00 57.09 ? 226  ASP A OD1 1 
ATOM   1759  O  OD2 . ASP A 1  226 ? 7.929   84.410  103.700 1.00 55.22 ? 226  ASP A OD2 1 
ATOM   1760  N  N   . ALA A 1  227 ? 12.462  82.284  103.932 1.00 54.84 ? 227  ALA A N   1 
ATOM   1761  C  CA  . ALA A 1  227 ? 13.783  81.827  104.413 1.00 54.37 ? 227  ALA A CA  1 
ATOM   1762  C  C   . ALA A 1  227 ? 15.008  82.575  103.846 1.00 53.86 ? 227  ALA A C   1 
ATOM   1763  O  O   . ALA A 1  227 ? 15.434  82.328  102.701 1.00 54.00 ? 227  ALA A O   1 
ATOM   1764  C  CB  . ALA A 1  227 ? 13.934  80.275  104.318 1.00 54.40 ? 227  ALA A CB  1 
ATOM   1765  N  N   . VAL A 1  228 ? 15.342  83.675  104.530 1.00 53.16 ? 228  VAL A N   1 
ATOM   1766  C  CA  . VAL A 1  228 ? 16.742  84.150  104.700 1.00 52.33 ? 228  VAL A CA  1 
ATOM   1767  C  C   . VAL A 1  228 ? 17.215  83.846  106.160 1.00 51.56 ? 228  VAL A C   1 
ATOM   1768  O  O   . VAL A 1  228 ? 16.366  83.725  107.066 1.00 51.52 ? 228  VAL A O   1 
ATOM   1769  C  CB  . VAL A 1  228 ? 16.949  85.708  104.380 1.00 52.22 ? 228  VAL A CB  1 
ATOM   1770  C  CG1 . VAL A 1  228 ? 18.388  85.994  103.919 1.00 48.21 ? 228  VAL A CG1 1 
ATOM   1771  C  CG2 . VAL A 1  228 ? 15.951  86.252  103.322 1.00 52.05 ? 228  VAL A CG2 1 
ATOM   1772  N  N   . PRO A 1  229 ? 18.519  83.561  106.353 1.00 50.81 ? 229  PRO A N   1 
ATOM   1773  C  CA  . PRO A 1  229 ? 19.222  84.009  107.572 1.00 49.76 ? 229  PRO A CA  1 
ATOM   1774  C  C   . PRO A 1  229 ? 20.067  85.281  107.399 1.00 48.35 ? 229  PRO A C   1 
ATOM   1775  O  O   . PRO A 1  229 ? 20.704  85.479  106.347 1.00 48.26 ? 229  PRO A O   1 
ATOM   1776  C  CB  . PRO A 1  229 ? 20.118  82.806  107.937 1.00 49.92 ? 229  PRO A CB  1 
ATOM   1777  C  CG  . PRO A 1  229 ? 19.862  81.751  106.865 1.00 51.96 ? 229  PRO A CG  1 
ATOM   1778  C  CD  . PRO A 1  229 ? 19.262  82.465  105.692 1.00 50.93 ? 229  PRO A CD  1 
ATOM   1779  N  N   . THR A 1  230 ? 19.973  86.167  108.401 1.00 46.83 ? 230  THR A N   1 
ATOM   1780  C  CA  . THR A 1  230 ? 21.081  87.057  108.821 1.00 45.28 ? 230  THR A CA  1 
ATOM   1781  C  C   . THR A 1  230 ? 22.244  86.241  109.449 1.00 43.20 ? 230  THR A C   1 
ATOM   1782  O  O   . THR A 1  230 ? 22.051  85.075  109.850 1.00 43.51 ? 230  THR A O   1 
ATOM   1783  C  CB  . THR A 1  230 ? 20.575  88.170  109.828 1.00 45.54 ? 230  THR A CB  1 
ATOM   1784  O  OG1 . THR A 1  230 ? 19.185  88.460  109.608 1.00 53.70 ? 230  THR A OG1 1 
ATOM   1785  C  CG2 . THR A 1  230 ? 21.254  89.519  109.541 1.00 47.75 ? 230  THR A CG2 1 
ATOM   1786  N  N   . LEU A 1  231 ? 23.446  86.834  109.478 1.00 40.59 ? 231  LEU A N   1 
ATOM   1787  C  CA  . LEU A 1  231 ? 24.602  86.250  110.171 1.00 37.95 ? 231  LEU A CA  1 
ATOM   1788  C  C   . LEU A 1  231 ? 24.479  86.265  111.693 1.00 35.51 ? 231  LEU A C   1 
ATOM   1789  O  O   . LEU A 1  231 ? 24.292  87.330  112.308 1.00 35.08 ? 231  LEU A O   1 
ATOM   1790  C  CB  . LEU A 1  231 ? 25.930  86.875  109.706 1.00 37.84 ? 231  LEU A CB  1 
ATOM   1791  C  CG  . LEU A 1  231 ? 26.441  86.615  108.280 1.00 30.20 ? 231  LEU A CG  1 
ATOM   1792  C  CD1 . LEU A 1  231 ? 27.538  87.607  107.935 1.00 35.21 ? 231  LEU A CD1 1 
ATOM   1793  C  CD2 . LEU A 1  231 ? 26.920  85.174  108.036 1.00 30.78 ? 231  LEU A CD2 1 
ATOM   1794  N  N   . SER A 1  232 ? 24.415  85.053  112.256 1.00 33.79 ? 232  SER A N   1 
ATOM   1795  C  CA  . SER A 1  232 ? 24.683  84.792  113.679 1.00 32.27 ? 232  SER A CA  1 
ATOM   1796  C  C   . SER A 1  232 ? 26.105  85.264  114.096 1.00 30.52 ? 232  SER A C   1 
ATOM   1797  O  O   . SER A 1  232 ? 27.050  85.071  113.307 1.00 30.09 ? 232  SER A O   1 
ATOM   1798  C  CB  . SER A 1  232 ? 24.485  83.304  114.004 1.00 32.29 ? 232  SER A CB  1 
ATOM   1799  O  OG  . SER A 1  232 ? 25.440  82.488  113.332 1.00 32.08 ? 232  SER A OG  1 
ATOM   1800  N  N   . PRO A 1  233 ? 26.258  85.886  115.294 1.00 29.24 ? 233  PRO A N   1 
ATOM   1801  C  CA  . PRO A 1  233 ? 27.596  86.238  115.826 1.00 27.99 ? 233  PRO A CA  1 
ATOM   1802  C  C   . PRO A 1  233 ? 28.486  85.016  116.098 1.00 26.76 ? 233  PRO A C   1 
ATOM   1803  O  O   . PRO A 1  233 ? 27.963  83.908  116.328 1.00 26.96 ? 233  PRO A O   1 
ATOM   1804  C  CB  . PRO A 1  233 ? 27.280  86.976  117.135 1.00 27.92 ? 233  PRO A CB  1 
ATOM   1805  C  CG  . PRO A 1  233 ? 25.867  87.428  116.992 1.00 27.36 ? 233  PRO A CG  1 
ATOM   1806  C  CD  . PRO A 1  233 ? 25.193  86.352  116.214 1.00 29.16 ? 233  PRO A CD  1 
ATOM   1807  N  N   . CYS A 1  234 ? 29.784  85.190  115.863 1.00 25.34 ? 234  CYS A N   1 
ATOM   1808  C  CA  . CYS A 1  234 ? 30.760  84.118  115.999 1.00 24.33 ? 234  CYS A CA  1 
ATOM   1809  C  C   . CYS A 1  234 ? 31.590  84.327  117.243 1.00 23.22 ? 234  CYS A C   1 
ATOM   1810  O  O   . CYS A 1  234 ? 32.234  85.381  117.406 1.00 22.95 ? 234  CYS A O   1 
ATOM   1811  C  CB  . CYS A 1  234 ? 31.633  84.002  114.748 1.00 24.55 ? 234  CYS A CB  1 
ATOM   1812  S  SG  . CYS A 1  234 ? 30.710  83.476  113.289 1.00 25.22 ? 234  CYS A SG  1 
ATOM   1813  N  N   . ARG A 1  235 ? 31.302  83.466  118.223 1.00 22.08 ? 235  ARG A N   1 
ATOM   1814  C  CA  . ARG A 1  235 ? 32.149  83.213  119.394 1.00 21.05 ? 235  ARG A CA  1 
ATOM   1815  C  C   . ARG A 1  235 ? 33.627  83.056  119.037 1.00 19.94 ? 235  ARG A C   1 
ATOM   1816  O  O   . ARG A 1  235 ? 33.964  82.314  118.099 1.00 20.30 ? 235  ARG A O   1 
ATOM   1817  C  CB  . ARG A 1  235 ? 31.640  81.974  120.128 1.00 21.09 ? 235  ARG A CB  1 
ATOM   1818  C  CG  . ARG A 1  235 ? 32.373  81.622  121.404 1.00 21.62 ? 235  ARG A CG  1 
ATOM   1819  C  CD  . ARG A 1  235 ? 31.997  80.295  121.971 1.00 16.92 ? 235  ARG A CD  1 
ATOM   1820  N  NE  . ARG A 1  235 ? 32.448  79.181  121.126 1.00 15.36 ? 235  ARG A NE  1 
ATOM   1821  C  CZ  . ARG A 1  235 ? 32.015  77.921  121.206 1.00 14.14 ? 235  ARG A CZ  1 
ATOM   1822  N  NH1 . ARG A 1  235 ? 31.281  77.508  122.235 1.00 12.15 ? 235  ARG A NH1 1 
ATOM   1823  N  NH2 . ARG A 1  235 ? 32.415  77.041  120.300 1.00 15.69 ? 235  ARG A NH2 1 
ATOM   1824  N  N   . PHE A 1  236 ? 34.430  83.940  119.641 1.00 18.69 ? 236  PHE A N   1 
ATOM   1825  C  CA  . PHE A 1  236 ? 35.882  83.807  119.776 1.00 18.01 ? 236  PHE A CA  1 
ATOM   1826  C  C   . PHE A 1  236 ? 36.226  82.951  120.996 1.00 17.26 ? 236  PHE A C   1 
ATOM   1827  O  O   . PHE A 1  236 ? 35.701  83.199  122.091 1.00 17.20 ? 236  PHE A O   1 
ATOM   1828  C  CB  . PHE A 1  236 ? 36.526  85.204  119.906 1.00 18.14 ? 236  PHE A CB  1 
ATOM   1829  C  CG  . PHE A 1  236 ? 38.041  85.214  119.848 1.00 20.73 ? 236  PHE A CG  1 
ATOM   1830  C  CD1 . PHE A 1  236 ? 38.697  85.627  118.668 1.00 22.37 ? 236  PHE A CD1 1 
ATOM   1831  C  CD2 . PHE A 1  236 ? 38.821  85.021  121.025 1.00 20.90 ? 236  PHE A CD2 1 
ATOM   1832  C  CE1 . PHE A 1  236 ? 40.133  85.751  118.624 1.00 25.31 ? 236  PHE A CE1 1 
ATOM   1833  C  CE2 . PHE A 1  236 ? 40.255  85.003  120.964 1.00 17.93 ? 236  PHE A CE2 1 
ATOM   1834  C  CZ  . PHE A 1  236 ? 40.904  85.443  119.789 1.00 19.68 ? 236  PHE A CZ  1 
ATOM   1835  N  N   . THR A 1  237 ? 37.246  82.098  120.822 1.00 16.72 ? 237  THR A N   1 
ATOM   1836  C  CA  . THR A 1  237 ? 37.857  81.299  121.890 1.00 16.99 ? 237  THR A CA  1 
ATOM   1837  C  C   . THR A 1  237 ? 39.368  81.489  121.912 1.00 18.08 ? 237  THR A C   1 
ATOM   1838  O  O   . THR A 1  237 ? 40.075  81.241  120.889 1.00 18.38 ? 237  THR A O   1 
ATOM   1839  C  CB  . THR A 1  237 ? 37.500  79.785  121.739 1.00 16.86 ? 237  THR A CB  1 
ATOM   1840  O  OG1 . THR A 1  237 ? 36.095  79.639  121.553 1.00 20.54 ? 237  THR A OG1 1 
ATOM   1841  C  CG2 . THR A 1  237 ? 37.752  79.027  123.027 1.00 15.95 ? 237  THR A CG2 1 
ATOM   1842  N  N   . GLY A 1  238 ? 39.841  81.988  123.065 1.00 18.05 ? 238  GLY A N   1 
ATOM   1843  C  CA  . GLY A 1  238 ? 41.214  81.838  123.527 1.00 17.58 ? 238  GLY A CA  1 
ATOM   1844  C  C   . GLY A 1  238 ? 41.634  80.379  123.596 1.00 17.80 ? 238  GLY A C   1 
ATOM   1845  O  O   . GLY A 1  238 ? 41.015  79.562  124.326 1.00 17.35 ? 238  GLY A O   1 
ATOM   1846  N  N   . SER A 1  239 ? 42.572  80.043  122.701 1.00 17.85 ? 239  SER A N   1 
ATOM   1847  C  CA  . SER A 1  239 ? 42.922  78.673  122.306 1.00 17.43 ? 239  SER A CA  1 
ATOM   1848  C  C   . SER A 1  239 ? 44.262  78.615  121.535 1.00 18.34 ? 239  SER A C   1 
ATOM   1849  O  O   . SER A 1  239 ? 44.879  79.659  121.236 1.00 17.87 ? 239  SER A O   1 
ATOM   1850  C  CB  . SER A 1  239 ? 41.793  78.034  121.489 1.00 17.04 ? 239  SER A CB  1 
ATOM   1851  O  OG  . SER A 1  239 ? 41.458  78.792  120.345 1.00 9.58  ? 239  SER A OG  1 
ATOM   1852  N  N   . GLN A 1  240 ? 44.734  77.383  121.304 1.00 19.31 ? 240  GLN A N   1 
ATOM   1853  C  CA  . GLN A 1  240 ? 46.012  77.085  120.642 1.00 19.75 ? 240  GLN A CA  1 
ATOM   1854  C  C   . GLN A 1  240 ? 45.849  75.836  119.780 1.00 20.26 ? 240  GLN A C   1 
ATOM   1855  O  O   . GLN A 1  240 ? 45.176  74.868  120.183 1.00 20.60 ? 240  GLN A O   1 
ATOM   1856  C  CB  . GLN A 1  240 ? 47.129  76.899  121.687 1.00 19.73 ? 240  GLN A CB  1 
ATOM   1857  C  CG  . GLN A 1  240 ? 48.546  76.930  121.134 1.00 21.76 ? 240  GLN A CG  1 
ATOM   1858  C  CD  . GLN A 1  240 ? 49.594  77.383  122.163 1.00 30.37 ? 240  GLN A CD  1 
ATOM   1859  O  OE1 . GLN A 1  240 ? 49.600  78.541  122.566 1.00 40.05 ? 240  GLN A OE1 1 
ATOM   1860  N  NE2 . GLN A 1  240 ? 50.581  76.539  122.415 1.00 29.91 ? 240  GLN A NE2 1 
ATOM   1861  N  N   . ILE A 1  241 ? 46.295  75.959  118.532 1.00 20.33 ? 241  ILE A N   1 
ATOM   1862  C  CA  . ILE A 1  241 ? 46.577  74.818  117.648 1.00 20.03 ? 241  ILE A CA  1 
ATOM   1863  C  C   . ILE A 1  241 ? 48.086  74.761  117.315 1.00 19.15 ? 241  ILE A C   1 
ATOM   1864  O  O   . ILE A 1  241 ? 48.662  75.756  116.864 1.00 19.23 ? 241  ILE A O   1 
ATOM   1865  C  CB  . ILE A 1  241 ? 45.632  74.842  116.374 1.00 20.48 ? 241  ILE A CB  1 
ATOM   1866  C  CG1 . ILE A 1  241 ? 45.847  73.613  115.478 1.00 24.25 ? 241  ILE A CG1 1 
ATOM   1867  C  CG2 . ILE A 1  241 ? 45.733  76.194  115.599 1.00 30.25 ? 241  ILE A CG2 1 
ATOM   1868  C  CD1 . ILE A 1  241 ? 44.773  73.402  114.417 1.00 30.83 ? 241  ILE A CD1 1 
ATOM   1869  N  N   . CYS A 1  242 ? 48.689  73.582  117.531 1.00 18.11 ? 242  CYS A N   1 
ATOM   1870  C  CA  . CYS A 1  242 ? 50.126  73.349  117.357 1.00 16.76 ? 242  CYS A CA  1 
ATOM   1871  C  C   . CYS A 1  242 ? 50.413  72.179  116.416 1.00 16.40 ? 242  CYS A C   1 
ATOM   1872  O  O   . CYS A 1  242 ? 50.433  71.001  116.856 1.00 17.29 ? 242  CYS A O   1 
ATOM   1873  C  CB  . CYS A 1  242 ? 50.820  73.156  118.718 1.00 16.35 ? 242  CYS A CB  1 
ATOM   1874  S  SG  . CYS A 1  242 ? 50.933  74.641  119.739 1.00 32.67 ? 242  CYS A SG  1 
ATOM   1875  N  N   . HIS A 1  243 ? 50.552  72.485  115.116 1.00 15.81 ? 243  HIS A N   1 
ATOM   1876  C  CA  . HIS A 1  243 ? 50.987  71.498  114.114 1.00 15.79 ? 243  HIS A CA  1 
ATOM   1877  C  C   . HIS A 1  243 ? 52.499  71.379  114.096 1.00 16.49 ? 243  HIS A C   1 
ATOM   1878  O  O   . HIS A 1  243 ? 53.190  72.133  113.411 1.00 17.15 ? 243  HIS A O   1 
ATOM   1879  C  CB  . HIS A 1  243 ? 50.379  71.765  112.723 1.00 15.19 ? 243  HIS A CB  1 
ATOM   1880  C  CG  . HIS A 1  243 ? 50.448  70.597  111.764 1.00 20.05 ? 243  HIS A CG  1 
ATOM   1881  N  ND1 . HIS A 1  243 ? 49.519  70.425  110.759 1.00 21.15 ? 243  HIS A ND1 1 
ATOM   1882  C  CD2 . HIS A 1  243 ? 51.404  69.658  111.540 1.00 15.76 ? 243  HIS A CD2 1 
ATOM   1883  C  CE1 . HIS A 1  243 ? 49.843  69.375  110.025 1.00 17.36 ? 243  HIS A CE1 1 
ATOM   1884  N  NE2 . HIS A 1  243 ? 50.967  68.871  110.500 1.00 19.72 ? 243  HIS A NE2 1 
ATOM   1885  N  N   . ARG A 1  244 ? 53.005  70.509  114.963 1.00 17.16 ? 244  ARG A N   1 
ATOM   1886  C  CA  . ARG A 1  244 ? 54.433  70.226  115.045 1.00 18.22 ? 244  ARG A CA  1 
ATOM   1887  C  C   . ARG A 1  244 ? 54.881  69.403  113.822 1.00 18.81 ? 244  ARG A C   1 
ATOM   1888  O  O   . ARG A 1  244 ? 54.316  68.329  113.542 1.00 18.74 ? 244  ARG A O   1 
ATOM   1889  C  CB  . ARG A 1  244 ? 54.791  69.565  116.398 1.00 17.96 ? 244  ARG A CB  1 
ATOM   1890  C  CG  . ARG A 1  244 ? 56.182  68.936  116.489 1.00 20.20 ? 244  ARG A CG  1 
ATOM   1891  C  CD  . ARG A 1  244 ? 57.358  69.911  116.764 1.00 12.13 ? 244  ARG A CD  1 
ATOM   1892  N  NE  . ARG A 1  244 ? 57.697  69.883  118.166 1.00 18.49 ? 244  ARG A NE  1 
ATOM   1893  C  CZ  . ARG A 1  244 ? 58.511  69.025  118.786 1.00 15.82 ? 244  ARG A CZ  1 
ATOM   1894  N  NH1 . ARG A 1  244 ? 59.720  68.743  118.298 1.00 6.73  ? 244  ARG A NH1 1 
ATOM   1895  N  NH2 . ARG A 1  244 ? 58.301  68.852  120.080 1.00 17.25 ? 244  ARG A NH2 1 
ATOM   1896  N  N   . GLU A 1  245 ? 55.827  69.988  113.073 1.00 19.11 ? 245  GLU A N   1 
ATOM   1897  C  CA  . GLU A 1  245 ? 56.446  69.400  111.882 1.00 18.91 ? 245  GLU A CA  1 
ATOM   1898  C  C   . GLU A 1  245 ? 57.920  69.822  111.760 1.00 19.24 ? 245  GLU A C   1 
ATOM   1899  O  O   . GLU A 1  245 ? 58.244  70.846  111.124 1.00 19.71 ? 245  GLU A O   1 
ATOM   1900  C  CB  . GLU A 1  245 ? 55.657  69.761  110.588 1.00 18.77 ? 245  GLU A CB  1 
ATOM   1901  C  CG  . GLU A 1  245 ? 55.499  68.644  109.546 1.00 20.62 ? 245  GLU A CG  1 
ATOM   1902  C  CD  . GLU A 1  245 ? 56.798  68.108  108.912 1.00 24.88 ? 245  GLU A CD  1 
ATOM   1903  O  OE1 . GLU A 1  245 ? 57.641  67.538  109.627 1.00 25.68 ? 245  GLU A OE1 1 
ATOM   1904  O  OE2 . GLU A 1  245 ? 56.799  67.907  107.683 1.00 30.11 ? 245  GLU A OE2 1 
ATOM   1905  N  N   . ASP A 1  246 ? 58.807  68.978  112.297 1.00 19.33 ? 246  ASP A N   1 
ATOM   1906  C  CA  . ASP A 1  246 ? 60.260  69.228  112.319 1.00 19.46 ? 246  ASP A CA  1 
ATOM   1907  C  C   . ASP A 1  246 ? 60.998  69.077  110.996 1.00 19.88 ? 246  ASP A C   1 
ATOM   1908  O  O   . ASP A 1  246 ? 62.138  69.553  110.867 1.00 20.63 ? 246  ASP A O   1 
ATOM   1909  C  CB  . ASP A 1  246 ? 60.939  68.413  113.420 1.00 19.41 ? 246  ASP A CB  1 
ATOM   1910  C  CG  . ASP A 1  246 ? 60.686  68.982  114.811 1.00 27.93 ? 246  ASP A CG  1 
ATOM   1911  O  OD1 . ASP A 1  246 ? 59.995  70.019  114.934 1.00 22.96 ? 246  ASP A OD1 1 
ATOM   1912  O  OD2 . ASP A 1  246 ? 61.060  68.402  115.848 1.00 25.59 ? 246  ASP A OD2 1 
ATOM   1913  N  N   . GLY A 1  247 ? 60.341  68.443  110.022 1.00 19.44 ? 247  GLY A N   1 
ATOM   1914  C  CA  . GLY A 1  247 ? 60.812  68.348  108.648 1.00 20.32 ? 247  GLY A CA  1 
ATOM   1915  C  C   . GLY A 1  247 ? 60.837  69.656  107.886 1.00 21.28 ? 247  GLY A C   1 
ATOM   1916  O  O   . GLY A 1  247 ? 61.526  69.765  106.868 1.00 22.45 ? 247  GLY A O   1 
ATOM   1917  N  N   . LEU A 1  248 ? 60.074  70.632  108.375 1.00 21.13 ? 248  LEU A N   1 
ATOM   1918  C  CA  . LEU A 1  248 ? 59.921  71.934  107.764 1.00 20.46 ? 248  LEU A CA  1 
ATOM   1919  C  C   . LEU A 1  248 ? 60.975  72.921  108.275 1.00 20.35 ? 248  LEU A C   1 
ATOM   1920  O  O   . LEU A 1  248 ? 61.292  72.875  109.466 1.00 21.17 ? 248  LEU A O   1 
ATOM   1921  C  CB  . LEU A 1  248 ? 58.492  72.454  107.974 1.00 20.19 ? 248  LEU A CB  1 
ATOM   1922  C  CG  . LEU A 1  248 ? 57.352  71.674  107.286 1.00 25.60 ? 248  LEU A CG  1 
ATOM   1923  C  CD1 . LEU A 1  248 ? 56.061  72.219  107.748 1.00 26.22 ? 248  LEU A CD1 1 
ATOM   1924  C  CD2 . LEU A 1  248 ? 57.389  71.610  105.721 1.00 20.65 ? 248  LEU A CD2 1 
ATOM   1925  N  N   . PRO A 1  249 ? 61.627  73.702  107.381 1.00 19.33 ? 249  PRO A N   1 
ATOM   1926  C  CA  . PRO A 1  249 ? 62.859  74.425  107.776 1.00 18.02 ? 249  PRO A CA  1 
ATOM   1927  C  C   . PRO A 1  249 ? 62.633  75.673  108.666 1.00 17.67 ? 249  PRO A C   1 
ATOM   1928  O  O   . PRO A 1  249 ? 63.607  76.133  109.281 1.00 18.17 ? 249  PRO A O   1 
ATOM   1929  C  CB  . PRO A 1  249 ? 63.511  74.787  106.428 1.00 17.91 ? 249  PRO A CB  1 
ATOM   1930  C  CG  . PRO A 1  249 ? 62.358  74.905  105.443 1.00 20.34 ? 249  PRO A CG  1 
ATOM   1931  C  CD  . PRO A 1  249 ? 61.335  73.880  105.931 1.00 19.16 ? 249  PRO A CD  1 
ATOM   1932  N  N   . LEU A 1  250 ? 61.447  76.283  108.593 1.00 16.44 ? 250  LEU A N   1 
ATOM   1933  C  CA  . LEU A 1  250 ? 61.093  77.457  109.402 1.00 16.55 ? 250  LEU A CA  1 
ATOM   1934  C  C   . LEU A 1  250 ? 59.689  77.386  110.013 1.00 17.37 ? 250  LEU A C   1 
ATOM   1935  O  O   . LEU A 1  250 ? 58.768  76.815  109.411 1.00 17.46 ? 250  LEU A O   1 
ATOM   1936  C  CB  . LEU A 1  250 ? 61.259  78.763  108.605 1.00 15.67 ? 250  LEU A CB  1 
ATOM   1937  C  CG  . LEU A 1  250 ? 62.654  79.188  108.054 1.00 22.84 ? 250  LEU A CG  1 
ATOM   1938  C  CD1 . LEU A 1  250 ? 62.527  80.245  107.025 1.00 23.89 ? 250  LEU A CD1 1 
ATOM   1939  C  CD2 . LEU A 1  250 ? 63.627  79.633  109.121 1.00 13.23 ? 250  LEU A CD2 1 
ATOM   1940  N  N   . ALA A 1  251 ? 59.588  77.867  111.254 1.00 17.34 ? 251  ALA A N   1 
ATOM   1941  C  CA  . ALA A 1  251 ? 58.343  77.940  112.013 1.00 17.54 ? 251  ALA A CA  1 
ATOM   1942  C  C   . ALA A 1  251 ? 57.483  79.119  111.579 1.00 17.95 ? 251  ALA A C   1 
ATOM   1943  O  O   . ALA A 1  251 ? 57.998  80.218  111.367 1.00 18.09 ? 251  ALA A O   1 
ATOM   1944  C  CB  . ALA A 1  251 ? 58.660  78.029  113.492 1.00 17.21 ? 251  ALA A CB  1 
ATOM   1945  N  N   . HIS A 1  252 ? 56.184  78.863  111.433 1.00 17.78 ? 252  HIS A N   1 
ATOM   1946  C  CA  . HIS A 1  252 ? 55.161  79.901  111.263 1.00 17.94 ? 252  HIS A CA  1 
ATOM   1947  C  C   . HIS A 1  252 ? 54.288  79.957  112.503 1.00 17.78 ? 252  HIS A C   1 
ATOM   1948  O  O   . HIS A 1  252 ? 53.836  78.906  113.009 1.00 16.83 ? 252  HIS A O   1 
ATOM   1949  C  CB  . HIS A 1  252 ? 54.286  79.592  110.036 1.00 18.30 ? 252  HIS A CB  1 
ATOM   1950  C  CG  . HIS A 1  252 ? 54.852  80.096  108.747 1.00 23.75 ? 252  HIS A CG  1 
ATOM   1951  N  ND1 . HIS A 1  252 ? 56.009  79.582  108.189 1.00 24.87 ? 252  HIS A ND1 1 
ATOM   1952  C  CD2 . HIS A 1  252 ? 54.353  80.966  107.842 1.00 13.57 ? 252  HIS A CD2 1 
ATOM   1953  C  CE1 . HIS A 1  252 ? 56.233  80.175  107.034 1.00 14.80 ? 252  HIS A CE1 1 
ATOM   1954  N  NE2 . HIS A 1  252 ? 55.219  80.984  106.777 1.00 17.50 ? 252  HIS A NE2 1 
ATOM   1955  N  N   . VAL A 1  253 ? 54.195  81.165  113.074 1.00 18.34 ? 253  VAL A N   1 
ATOM   1956  C  CA  . VAL A 1  253 ? 53.305  81.469  114.222 1.00 18.37 ? 253  VAL A CA  1 
ATOM   1957  C  C   . VAL A 1  253 ? 52.378  82.671  113.879 1.00 18.35 ? 253  VAL A C   1 
ATOM   1958  O  O   . VAL A 1  253 ? 52.833  83.653  113.305 1.00 18.01 ? 253  VAL A O   1 
ATOM   1959  C  CB  . VAL A 1  253 ? 54.133  81.752  115.537 1.00 18.16 ? 253  VAL A CB  1 
ATOM   1960  C  CG1 . VAL A 1  253 ? 53.246  81.938  116.750 1.00 13.11 ? 253  VAL A CG1 1 
ATOM   1961  C  CG2 . VAL A 1  253 ? 55.183  80.647  115.812 1.00 4.33  ? 253  VAL A CG2 1 
ATOM   1962  N  N   . ALA A 1  254 ? 51.074  82.493  114.115 1.00 18.20 ? 254  ALA A N   1 
ATOM   1963  C  CA  . ALA A 1  254 ? 50.085  83.573  114.097 1.00 17.30 ? 254  ALA A CA  1 
ATOM   1964  C  C   . ALA A 1  254 ? 49.317  83.646  115.399 1.00 18.92 ? 254  ALA A C   1 
ATOM   1965  O  O   . ALA A 1  254 ? 48.952  82.614  115.986 1.00 19.34 ? 254  ALA A O   1 
ATOM   1966  C  CB  . ALA A 1  254 ? 49.157  83.423  112.946 1.00 16.11 ? 254  ALA A CB  1 
ATOM   1967  N  N   . ILE A 1  255 ? 49.213  84.872  115.912 1.00 19.91 ? 255  ILE A N   1 
ATOM   1968  C  CA  . ILE A 1  255 ? 48.623  85.160  117.219 1.00 20.72 ? 255  ILE A CA  1 
ATOM   1969  C  C   . ILE A 1  255 ? 47.700  86.375  117.106 1.00 21.69 ? 255  ILE A C   1 
ATOM   1970  O  O   . ILE A 1  255 ? 48.093  87.429  116.569 1.00 22.49 ? 255  ILE A O   1 
ATOM   1971  C  CB  . ILE A 1  255 ? 49.743  85.311  118.353 1.00 20.91 ? 255  ILE A CB  1 
ATOM   1972  C  CG1 . ILE A 1  255 ? 49.152  85.852  119.679 1.00 24.62 ? 255  ILE A CG1 1 
ATOM   1973  C  CG2 . ILE A 1  255 ? 50.927  86.160  117.877 1.00 24.22 ? 255  ILE A CG2 1 
ATOM   1974  C  CD1 . ILE A 1  255 ? 49.846  85.417  120.943 1.00 11.91 ? 255  ILE A CD1 1 
ATOM   1975  N  N   . ALA A 1  256 ? 46.478  86.201  117.590 1.00 21.85 ? 256  ALA A N   1 
ATOM   1976  C  CA  . ALA A 1  256 ? 45.452  87.239  117.550 1.00 22.28 ? 256  ALA A CA  1 
ATOM   1977  C  C   . ALA A 1  256 ? 44.541  87.233  118.773 1.00 21.75 ? 256  ALA A C   1 
ATOM   1978  O  O   . ALA A 1  256 ? 44.111  86.165  119.244 1.00 21.48 ? 256  ALA A O   1 
ATOM   1979  C  CB  . ALA A 1  256 ? 44.624  87.126  116.267 1.00 22.84 ? 256  ALA A CB  1 
ATOM   1980  N  N   . VAL A 1  257 ? 44.224  88.436  119.242 1.00 20.85 ? 257  VAL A N   1 
ATOM   1981  C  CA  . VAL A 1  257 ? 43.045  88.697  120.104 1.00 20.44 ? 257  VAL A CA  1 
ATOM   1982  C  C   . VAL A 1  257 ? 41.775  88.985  119.266 1.00 20.59 ? 257  VAL A C   1 
ATOM   1983  O  O   . VAL A 1  257 ? 41.874  89.205  118.039 1.00 20.63 ? 257  VAL A O   1 
ATOM   1984  C  CB  . VAL A 1  257 ? 43.327  89.826  121.172 1.00 20.05 ? 257  VAL A CB  1 
ATOM   1985  C  CG1 . VAL A 1  257 ? 44.377  89.370  122.163 1.00 9.87  ? 257  VAL A CG1 1 
ATOM   1986  C  CG2 . VAL A 1  257 ? 43.750  91.168  120.513 1.00 25.22 ? 257  VAL A CG2 1 
ATOM   1987  N  N   . GLU A 1  258 ? 40.595  88.931  119.907 1.00 20.85 ? 258  GLU A N   1 
ATOM   1988  C  CA  . GLU A 1  258 ? 39.347  89.370  119.274 1.00 21.12 ? 258  GLU A CA  1 
ATOM   1989  C  C   . GLU A 1  258 ? 39.303  90.855  118.940 1.00 21.63 ? 258  GLU A C   1 
ATOM   1990  O  O   . GLU A 1  258 ? 39.164  91.716  119.836 1.00 22.22 ? 258  GLU A O   1 
ATOM   1991  C  CB  . GLU A 1  258 ? 38.106  88.930  120.036 1.00 21.51 ? 258  GLU A CB  1 
ATOM   1992  C  CG  . GLU A 1  258 ? 36.865  88.837  119.138 1.00 24.56 ? 258  GLU A CG  1 
ATOM   1993  C  CD  . GLU A 1  258 ? 35.547  88.686  119.888 1.00 29.48 ? 258  GLU A CD  1 
ATOM   1994  O  OE1 . GLU A 1  258 ? 34.498  88.963  119.262 1.00 33.12 ? 258  GLU A OE1 1 
ATOM   1995  O  OE2 . GLU A 1  258 ? 35.533  88.184  121.042 1.00 25.10 ? 258  GLU A OE2 1 
ATOM   1996  N  N   . GLY A 1  259 ? 39.417  91.129  117.637 1.00 21.34 ? 259  GLY A N   1 
ATOM   1997  C  CA  . GLY A 1  259 ? 39.010  92.395  117.044 1.00 21.85 ? 259  GLY A CA  1 
ATOM   1998  C  C   . GLY A 1  259 ? 37.510  92.698  117.166 1.00 22.52 ? 259  GLY A C   1 
ATOM   1999  O  O   . GLY A 1  259 ? 36.708  91.752  117.301 1.00 22.72 ? 259  GLY A O   1 
ATOM   2000  N  N   . PRO A 1  260 ? 37.108  93.973  117.039 1.00 23.35 ? 260  PRO A N   1 
ATOM   2001  C  CA  . PRO A 1  260 ? 35.701  94.283  116.753 1.00 24.56 ? 260  PRO A CA  1 
ATOM   2002  C  C   . PRO A 1  260 ? 35.415  94.154  115.236 1.00 26.33 ? 260  PRO A C   1 
ATOM   2003  O  O   . PRO A 1  260 ? 36.353  93.891  114.438 1.00 27.67 ? 260  PRO A O   1 
ATOM   2004  C  CB  . PRO A 1  260 ? 35.560  95.712  117.259 1.00 24.34 ? 260  PRO A CB  1 
ATOM   2005  C  CG  . PRO A 1  260 ? 36.933  96.336  117.059 1.00 23.71 ? 260  PRO A CG  1 
ATOM   2006  C  CD  . PRO A 1  260 ? 37.936  95.206  117.045 1.00 23.60 ? 260  PRO A CD  1 
ATOM   2007  N  N   . GLY A 1  261 ? 34.151  94.298  114.852 1.00 26.25 ? 261  GLY A N   1 
ATOM   2008  C  CA  . GLY A 1  261 ? 33.763  94.336  113.449 1.00 25.85 ? 261  GLY A CA  1 
ATOM   2009  C  C   . GLY A 1  261 ? 34.248  95.492  112.601 1.00 25.38 ? 261  GLY A C   1 
ATOM   2010  O  O   . GLY A 1  261 ? 34.734  96.484  113.136 1.00 24.72 ? 261  GLY A O   1 
ATOM   2011  N  N   . TRP A 1  262 ? 34.195  95.285  111.273 1.00 25.93 ? 262  TRP A N   1 
ATOM   2012  C  CA  . TRP A 1  262 ? 34.093  96.321  110.207 1.00 26.38 ? 262  TRP A CA  1 
ATOM   2013  C  C   . TRP A 1  262 ? 33.555  97.700  110.608 1.00 26.16 ? 262  TRP A C   1 
ATOM   2014  O  O   . TRP A 1  262 ? 34.242  98.711  110.400 1.00 26.26 ? 262  TRP A O   1 
ATOM   2015  C  CB  . TRP A 1  262 ? 33.255  95.796  109.024 1.00 27.00 ? 262  TRP A CB  1 
ATOM   2016  C  CG  . TRP A 1  262 ? 33.906  94.726  108.195 1.00 39.06 ? 262  TRP A CG  1 
ATOM   2017  C  CD1 . TRP A 1  262 ? 33.434  93.460  108.002 1.00 37.03 ? 262  TRP A CD1 1 
ATOM   2018  C  CD2 . TRP A 1  262 ? 35.000  94.886  107.269 1.00 41.94 ? 262  TRP A CD2 1 
ATOM   2019  N  NE1 . TRP A 1  262 ? 34.243  92.769  107.129 1.00 45.31 ? 262  TRP A NE1 1 
ATOM   2020  C  CE2 . TRP A 1  262 ? 35.203  93.618  106.640 1.00 42.27 ? 262  TRP A CE2 1 
ATOM   2021  C  CE3 . TRP A 1  262 ? 35.878  95.956  106.944 1.00 43.26 ? 262  TRP A CE3 1 
ATOM   2022  C  CZ2 . TRP A 1  262 ? 36.224  93.392  105.665 1.00 43.04 ? 262  TRP A CZ2 1 
ATOM   2023  C  CZ3 . TRP A 1  262 ? 36.930  95.724  105.992 1.00 40.83 ? 262  TRP A CZ3 1 
ATOM   2024  C  CH2 . TRP A 1  262 ? 37.082  94.449  105.369 1.00 42.64 ? 262  TRP A CH2 1 
ATOM   2025  N  N   . ALA A 1  263 ? 32.383  97.701  111.265 1.00 25.99 ? 263  ALA A N   1 
ATOM   2026  C  CA  . ALA A 1  263 ? 31.626  98.904  111.632 1.00 25.91 ? 263  ALA A CA  1 
ATOM   2027  C  C   . ALA A 1  263 ? 32.314  99.831  112.650 1.00 25.43 ? 263  ALA A C   1 
ATOM   2028  O  O   . ALA A 1  263 ? 32.150  101.053 112.567 1.00 25.54 ? 263  ALA A O   1 
ATOM   2029  C  CB  . ALA A 1  263 ? 30.231  98.515  112.127 1.00 26.07 ? 263  ALA A CB  1 
ATOM   2030  N  N   . HIS A 1  264 ? 33.141  99.246  113.529 1.00 24.81 ? 264  HIS A N   1 
ATOM   2031  C  CA  . HIS A 1  264 ? 33.513  99.830  114.824 1.00 24.47 ? 264  HIS A CA  1 
ATOM   2032  C  C   . HIS A 1  264 ? 34.574  100.944 114.659 1.00 24.27 ? 264  HIS A C   1 
ATOM   2033  O  O   . HIS A 1  264 ? 35.606  100.679 114.012 1.00 24.34 ? 264  HIS A O   1 
ATOM   2034  C  CB  . HIS A 1  264 ? 34.024  98.739  115.770 1.00 24.34 ? 264  HIS A CB  1 
ATOM   2035  C  CG  . HIS A 1  264 ? 33.799  99.036  117.222 1.00 27.71 ? 264  HIS A CG  1 
ATOM   2036  N  ND1 . HIS A 1  264 ? 34.564  99.940  117.927 1.00 26.07 ? 264  HIS A ND1 1 
ATOM   2037  C  CD2 . HIS A 1  264 ? 32.918  98.519  118.111 1.00 34.39 ? 264  HIS A CD2 1 
ATOM   2038  C  CE1 . HIS A 1  264 ? 34.125  100.009 119.173 1.00 23.02 ? 264  HIS A CE1 1 
ATOM   2039  N  NE2 . HIS A 1  264 ? 33.141  99.143  119.315 1.00 30.31 ? 264  HIS A NE2 1 
ATOM   2040  N  N   . PRO A 1  265 ? 34.354  102.147 115.259 1.00 24.22 ? 265  PRO A N   1 
ATOM   2041  C  CA  . PRO A 1  265 ? 35.263  103.304 115.068 1.00 24.03 ? 265  PRO A CA  1 
ATOM   2042  C  C   . PRO A 1  265 ? 36.709  103.098 115.519 1.00 24.06 ? 265  PRO A C   1 
ATOM   2043  O  O   . PRO A 1  265 ? 37.579  103.740 114.924 1.00 25.12 ? 265  PRO A O   1 
ATOM   2044  C  CB  . PRO A 1  265 ? 34.620  104.409 115.914 1.00 23.82 ? 265  PRO A CB  1 
ATOM   2045  C  CG  . PRO A 1  265 ? 33.207  104.015 116.047 1.00 21.11 ? 265  PRO A CG  1 
ATOM   2046  C  CD  . PRO A 1  265 ? 33.220  102.529 116.143 1.00 24.40 ? 265  PRO A CD  1 
ATOM   2047  N  N   . ASP A 1  266 ? 36.960  102.198 116.478 1.00 23.35 ? 266  ASP A N   1 
ATOM   2048  C  CA  . ASP A 1  266 ? 38.315  101.993 117.015 1.00 22.97 ? 266  ASP A CA  1 
ATOM   2049  C  C   . ASP A 1  266 ? 39.286  101.037 116.316 1.00 21.88 ? 266  ASP A C   1 
ATOM   2050  O  O   . ASP A 1  266 ? 40.492  101.016 116.639 1.00 21.32 ? 266  ASP A O   1 
ATOM   2051  C  CB  . ASP A 1  266 ? 38.420  102.033 118.554 1.00 23.65 ? 266  ASP A CB  1 
ATOM   2052  C  CG  . ASP A 1  266 ? 37.358  101.233 119.261 1.00 28.77 ? 266  ASP A CG  1 
ATOM   2053  O  OD1 . ASP A 1  266 ? 36.747  101.829 120.157 1.00 12.48 ? 266  ASP A OD1 1 
ATOM   2054  O  OD2 . ASP A 1  266 ? 37.297  99.982  119.237 1.00 36.33 ? 266  ASP A OD2 1 
ATOM   2055  N  N   . ASN A 1  267 ? 38.811  100.505 115.180 1.00 21.15 ? 267  ASN A N   1 
ATOM   2056  C  CA  . ASN A 1  267 ? 39.638  99.989  114.085 1.00 20.37 ? 267  ASN A CA  1 
ATOM   2057  C  C   . ASN A 1  267 ? 40.739  100.908 113.588 1.00 20.12 ? 267  ASN A C   1 
ATOM   2058  O  O   . ASN A 1  267 ? 41.835  100.423 113.303 1.00 20.33 ? 267  ASN A O   1 
ATOM   2059  C  CB  . ASN A 1  267 ? 38.769  99.580  112.908 1.00 20.19 ? 267  ASN A CB  1 
ATOM   2060  C  CG  . ASN A 1  267 ? 38.246  98.176  113.032 1.00 16.28 ? 267  ASN A CG  1 
ATOM   2061  O  OD1 . ASN A 1  267 ? 39.013  97.218  113.204 1.00 24.31 ? 267  ASN A OD1 1 
ATOM   2062  N  ND2 . ASN A 1  267 ? 36.954  98.024  112.808 1.00 6.18  ? 267  ASN A ND2 1 
ATOM   2063  N  N   . VAL A 1  268 ? 40.470  102.228 113.600 1.00 19.29 ? 268  VAL A N   1 
ATOM   2064  C  CA  . VAL A 1  268 ? 41.400  103.265 113.121 1.00 18.79 ? 268  VAL A CA  1 
ATOM   2065  C  C   . VAL A 1  268 ? 42.636  103.392 114.057 1.00 18.60 ? 268  VAL A C   1 
ATOM   2066  O  O   . VAL A 1  268 ? 43.778  103.313 113.582 1.00 18.57 ? 268  VAL A O   1 
ATOM   2067  C  CB  . VAL A 1  268 ? 40.661  104.634 112.846 1.00 18.70 ? 268  VAL A CB  1 
ATOM   2068  C  CG1 . VAL A 1  268 ? 41.644  105.778 112.520 1.00 23.63 ? 268  VAL A CG1 1 
ATOM   2069  C  CG2 . VAL A 1  268 ? 39.641  104.494 111.693 1.00 7.41  ? 268  VAL A CG2 1 
ATOM   2070  N  N   . ALA A 1  269 ? 42.379  103.541 115.365 1.00 18.36 ? 269  ALA A N   1 
ATOM   2071  C  CA  . ALA A 1  269 ? 43.403  103.598 116.419 1.00 18.32 ? 269  ALA A CA  1 
ATOM   2072  C  C   . ALA A 1  269 ? 44.198  102.294 116.617 1.00 19.20 ? 269  ALA A C   1 
ATOM   2073  O  O   . ALA A 1  269 ? 45.388  102.331 116.996 1.00 19.95 ? 269  ALA A O   1 
ATOM   2074  C  CB  . ALA A 1  269 ? 42.788  104.043 117.714 1.00 17.88 ? 269  ALA A CB  1 
ATOM   2075  N  N   . LEU A 1  270 ? 43.539  101.157 116.374 1.00 19.39 ? 270  LEU A N   1 
ATOM   2076  C  CA  . LEU A 1  270 ? 44.191  99.837  116.330 1.00 19.64 ? 270  LEU A CA  1 
ATOM   2077  C  C   . LEU A 1  270 ? 45.179  99.690  115.183 1.00 20.37 ? 270  LEU A C   1 
ATOM   2078  O  O   . LEU A 1  270 ? 46.266  99.123  115.363 1.00 20.48 ? 270  LEU A O   1 
ATOM   2079  C  CB  . LEU A 1  270 ? 43.152  98.705  116.307 1.00 19.02 ? 270  LEU A CB  1 
ATOM   2080  C  CG  . LEU A 1  270 ? 42.393  98.337  117.596 1.00 16.22 ? 270  LEU A CG  1 
ATOM   2081  C  CD1 . LEU A 1  270 ? 41.357  97.251  117.304 1.00 19.72 ? 270  LEU A CD1 1 
ATOM   2082  C  CD2 . LEU A 1  270 ? 43.295  97.905  118.770 1.00 14.26 ? 270  LEU A CD2 1 
ATOM   2083  N  N   . GLN A 1  271 ? 44.840  100.327 114.060 1.00 20.86 ? 271  GLN A N   1 
ATOM   2084  C  CA  . GLN A 1  271 ? 45.672  100.360 112.867 1.00 21.10 ? 271  GLN A CA  1 
ATOM   2085  C  C   . GLN A 1  271 ? 46.872  101.283 112.974 1.00 21.12 ? 271  GLN A C   1 
ATOM   2086  O  O   . GLN A 1  271 ? 47.972  100.895 112.545 1.00 21.48 ? 271  GLN A O   1 
ATOM   2087  C  CB  . GLN A 1  271 ? 44.833  100.634 111.621 1.00 21.57 ? 271  GLN A CB  1 
ATOM   2088  C  CG  . GLN A 1  271 ? 43.992  99.407  111.200 1.00 31.36 ? 271  GLN A CG  1 
ATOM   2089  C  CD  . GLN A 1  271 ? 44.631  98.533  110.153 1.00 33.82 ? 271  GLN A CD  1 
ATOM   2090  O  OE1 . GLN A 1  271 ? 44.013  98.313  109.121 1.00 47.57 ? 271  GLN A OE1 1 
ATOM   2091  N  NE2 . GLN A 1  271 ? 45.698  97.818  110.524 1.00 40.92 ? 271  GLN A NE2 1 
ATOM   2092  N  N   . VAL A 1  272 ? 46.672  102.457 113.614 1.00 20.36 ? 272  VAL A N   1 
ATOM   2093  C  CA  . VAL A 1  272 ? 47.749  103.344 114.108 1.00 19.75 ? 272  VAL A CA  1 
ATOM   2094  C  C   . VAL A 1  272 ? 48.787  102.566 114.952 1.00 20.04 ? 272  VAL A C   1 
ATOM   2095  O  O   . VAL A 1  272 ? 50.006  102.650 114.679 1.00 20.24 ? 272  VAL A O   1 
ATOM   2096  C  CB  . VAL A 1  272 ? 47.194  104.615 114.895 1.00 19.08 ? 272  VAL A CB  1 
ATOM   2097  C  CG1 . VAL A 1  272 ? 48.342  105.467 115.500 1.00 10.75 ? 272  VAL A CG1 1 
ATOM   2098  C  CG2 . VAL A 1  272 ? 46.359  105.500 113.998 1.00 6.83  ? 272  VAL A CG2 1 
ATOM   2099  N  N   . ALA A 1  273 ? 48.275  101.790 115.918 1.00 19.67 ? 273  ALA A N   1 
ATOM   2100  C  CA  . ALA A 1  273 ? 49.069  100.960 116.811 1.00 19.96 ? 273  ALA A CA  1 
ATOM   2101  C  C   . ALA A 1  273 ? 49.836  99.847  116.077 1.00 19.98 ? 273  ALA A C   1 
ATOM   2102  O  O   . ALA A 1  273 ? 51.032  99.652  116.316 1.00 20.11 ? 273  ALA A O   1 
ATOM   2103  C  CB  . ALA A 1  273 ? 48.194  100.392 117.871 1.00 20.11 ? 273  ALA A CB  1 
ATOM   2104  N  N   . ASN A 1  274 ? 49.145  99.176  115.153 1.00 20.16 ? 274  ASN A N   1 
ATOM   2105  C  CA  . ASN A 1  274 ? 49.709  98.116  114.300 1.00 19.30 ? 274  ASN A CA  1 
ATOM   2106  C  C   . ASN A 1  274 ? 50.803  98.601  113.361 1.00 18.70 ? 274  ASN A C   1 
ATOM   2107  O  O   . ASN A 1  274 ? 51.767  97.877  113.128 1.00 18.66 ? 274  ASN A O   1 
ATOM   2108  C  CB  . ASN A 1  274 ? 48.585  97.424  113.512 1.00 18.74 ? 274  ASN A CB  1 
ATOM   2109  C  CG  . ASN A 1  274 ? 47.966  96.222  114.254 1.00 23.62 ? 274  ASN A CG  1 
ATOM   2110  O  OD1 . ASN A 1  274 ? 47.051  95.575  113.722 1.00 31.16 ? 274  ASN A OD1 1 
ATOM   2111  N  ND2 . ASN A 1  274 ? 48.522  95.851  115.418 1.00 17.15 ? 274  ASN A ND2 1 
ATOM   2112  N  N   . ALA A 1  275 ? 50.648  99.834  112.851 1.00 18.50 ? 275  ALA A N   1 
ATOM   2113  C  CA  . ALA A 1  275 ? 51.656  100.518 112.037 1.00 18.85 ? 275  ALA A CA  1 
ATOM   2114  C  C   . ALA A 1  275 ? 52.961  100.830 112.807 1.00 18.74 ? 275  ALA A C   1 
ATOM   2115  O  O   . ALA A 1  275 ? 54.042  100.752 112.220 1.00 18.69 ? 275  ALA A O   1 
ATOM   2116  C  CB  . ALA A 1  275 ? 51.062  101.806 111.399 1.00 19.54 ? 275  ALA A CB  1 
ATOM   2117  N  N   . ILE A 1  276 ? 52.824  101.205 114.093 1.00 19.18 ? 276  ILE A N   1 
ATOM   2118  C  CA  . ILE A 1  276 ? 53.934  101.411 115.060 1.00 18.92 ? 276  ILE A CA  1 
ATOM   2119  C  C   . ILE A 1  276 ? 54.770  100.125 115.240 1.00 19.49 ? 276  ILE A C   1 
ATOM   2120  O  O   . ILE A 1  276 ? 56.007  100.193 115.217 1.00 19.44 ? 276  ILE A O   1 
ATOM   2121  C  CB  . ILE A 1  276 ? 53.418  101.988 116.469 1.00 18.06 ? 276  ILE A CB  1 
ATOM   2122  C  CG1 . ILE A 1  276 ? 52.790  103.375 116.299 1.00 16.75 ? 276  ILE A CG1 1 
ATOM   2123  C  CG2 . ILE A 1  276 ? 54.572  102.053 117.533 1.00 14.70 ? 276  ILE A CG2 1 
ATOM   2124  C  CD1 . ILE A 1  276 ? 51.812  103.827 117.412 1.00 14.58 ? 276  ILE A CD1 1 
ATOM   2125  N  N   . ILE A 1  277 ? 54.100  98.988  115.467 1.00 19.77 ? 277  ILE A N   1 
ATOM   2126  C  CA  . ILE A 1  277 ? 54.785  97.688  115.481 1.00 20.63 ? 277  ILE A CA  1 
ATOM   2127  C  C   . ILE A 1  277 ? 55.284  97.343  114.053 1.00 20.94 ? 277  ILE A C   1 
ATOM   2128  O  O   . ILE A 1  277 ? 56.413  96.895  113.887 1.00 20.88 ? 277  ILE A O   1 
ATOM   2129  C  CB  . ILE A 1  277 ? 53.895  96.554  116.171 1.00 21.03 ? 277  ILE A CB  1 
ATOM   2130  C  CG1 . ILE A 1  277 ? 53.870  96.762  117.701 1.00 22.62 ? 277  ILE A CG1 1 
ATOM   2131  C  CG2 . ILE A 1  277 ? 54.471  95.161  115.926 1.00 19.18 ? 277  ILE A CG2 1 
ATOM   2132  C  CD1 . ILE A 1  277 ? 52.545  96.541  118.372 1.00 21.87 ? 277  ILE A CD1 1 
ATOM   2133  N  N   . GLY A 1  278 ? 54.467  97.662  113.047 1.00 20.98 ? 278  GLY A N   1 
ATOM   2134  C  CA  . GLY A 1  278 ? 54.832  97.536  111.645 1.00 20.85 ? 278  GLY A CA  1 
ATOM   2135  C  C   . GLY A 1  278 ? 54.911  96.112  111.125 1.00 20.67 ? 278  GLY A C   1 
ATOM   2136  O  O   . GLY A 1  278 ? 54.083  95.272  111.484 1.00 20.14 ? 278  GLY A O   1 
ATOM   2137  N  N   . HIS A 1  279 ? 55.612  96.029  110.002 1.00 20.96 ? 279  HIS A N   1 
ATOM   2138  C  CA  . HIS A 1  279 ? 56.053  94.806  109.347 1.00 20.80 ? 279  HIS A CA  1 
ATOM   2139  C  C   . HIS A 1  279 ? 57.582  94.774  109.205 1.00 20.95 ? 279  HIS A C   1 
ATOM   2140  O  O   . HIS A 1  279 ? 58.260  95.812  109.380 1.00 22.21 ? 279  HIS A O   1 
ATOM   2141  C  CB  . HIS A 1  279 ? 55.351  94.624  107.979 1.00 20.96 ? 279  HIS A CB  1 
ATOM   2142  C  CG  . HIS A 1  279 ? 55.087  95.906  107.235 1.00 34.65 ? 279  HIS A CG  1 
ATOM   2143  N  ND1 . HIS A 1  279 ? 55.786  96.263  106.098 1.00 38.30 ? 279  HIS A ND1 1 
ATOM   2144  C  CD2 . HIS A 1  279 ? 54.108  96.835  107.375 1.00 37.85 ? 279  HIS A CD2 1 
ATOM   2145  C  CE1 . HIS A 1  279 ? 55.323  97.412  105.639 1.00 36.98 ? 279  HIS A CE1 1 
ATOM   2146  N  NE2 . HIS A 1  279 ? 54.311  97.786  106.401 1.00 44.49 ? 279  HIS A NE2 1 
ATOM   2147  N  N   . TYR A 1  280 ? 58.124  93.567  109.037 1.00 19.98 ? 280  TYR A N   1 
ATOM   2148  C  CA  . TYR A 1  280 ? 59.528  93.339  108.687 1.00 19.86 ? 280  TYR A CA  1 
ATOM   2149  C  C   . TYR A 1  280 ? 59.705  92.154  107.741 1.00 20.82 ? 280  TYR A C   1 
ATOM   2150  O  O   . TYR A 1  280 ? 58.924  91.189  107.760 1.00 21.13 ? 280  TYR A O   1 
ATOM   2151  C  CB  . TYR A 1  280 ? 60.404  93.200  109.946 1.00 19.23 ? 280  TYR A CB  1 
ATOM   2152  C  CG  . TYR A 1  280 ? 61.876  92.897  109.716 1.00 12.31 ? 280  TYR A CG  1 
ATOM   2153  C  CD1 . TYR A 1  280 ? 62.784  93.935  109.335 1.00 12.88 ? 280  TYR A CD1 1 
ATOM   2154  C  CD2 . TYR A 1  280 ? 62.379  91.574  109.857 1.00 11.20 ? 280  TYR A CD2 1 
ATOM   2155  C  CE1 . TYR A 1  280 ? 64.166  93.653  109.079 1.00 11.14 ? 280  TYR A CE1 1 
ATOM   2156  C  CE2 . TYR A 1  280 ? 63.767  91.266  109.556 1.00 6.81  ? 280  TYR A CE2 1 
ATOM   2157  C  CZ  . TYR A 1  280 ? 64.645  92.321  109.218 1.00 18.20 ? 280  TYR A CZ  1 
ATOM   2158  O  OH  . TYR A 1  280 ? 65.959  92.037  108.934 1.00 23.90 ? 280  TYR A OH  1 
ATOM   2159  N  N   . ASP A 1  281 ? 60.809  92.211  106.998 1.00 20.73 ? 281  ASP A N   1 
ATOM   2160  C  CA  . ASP A 1  281 ? 61.276  91.170  106.116 1.00 20.81 ? 281  ASP A CA  1 
ATOM   2161  C  C   . ASP A 1  281 ? 62.789  91.315  106.076 1.00 19.55 ? 281  ASP A C   1 
ATOM   2162  O  O   . ASP A 1  281 ? 63.306  92.442  105.925 1.00 20.16 ? 281  ASP A O   1 
ATOM   2163  C  CB  . ASP A 1  281 ? 60.693  91.482  104.736 1.00 22.74 ? 281  ASP A CB  1 
ATOM   2164  C  CG  . ASP A 1  281 ? 60.902  90.430  103.767 1.00 22.65 ? 281  ASP A CG  1 
ATOM   2165  O  OD1 . ASP A 1  281 ? 59.861  89.939  103.342 1.00 34.79 ? 281  ASP A OD1 1 
ATOM   2166  O  OD2 . ASP A 1  281 ? 61.945  90.360  103.083 1.00 23.48 ? 281  ASP A OD2 1 
ATOM   2167  N  N   . CYS A 1  282 ? 63.450  90.179  105.881 1.00 18.42 ? 282  CYS A N   1 
ATOM   2168  C  CA  . CYS A 1  282 ? 64.915  90.093  105.774 1.00 17.73 ? 282  CYS A CA  1 
ATOM   2169  C  C   . CYS A 1  282 ? 65.543  90.848  104.583 1.00 16.94 ? 282  CYS A C   1 
ATOM   2170  O  O   . CYS A 1  282 ? 66.775  90.907  104.489 1.00 17.81 ? 282  CYS A O   1 
ATOM   2171  C  CB  . CYS A 1  282 ? 65.354  88.617  105.762 1.00 16.97 ? 282  CYS A CB  1 
ATOM   2172  S  SG  . CYS A 1  282 ? 64.880  87.758  104.241 1.00 25.53 ? 282  CYS A SG  1 
ATOM   2173  N  N   . THR A 1  283 ? 64.710  91.264  103.617 1.00 15.27 ? 283  THR A N   1 
ATOM   2174  C  CA  . THR A 1  283 ? 65.156  92.071  102.461 1.00 14.40 ? 283  THR A CA  1 
ATOM   2175  C  C   . THR A 1  283 ? 64.940  93.586  102.630 1.00 14.39 ? 283  THR A C   1 
ATOM   2176  O  O   . THR A 1  283 ? 65.019  94.293  101.647 1.00 14.68 ? 283  THR A O   1 
ATOM   2177  C  CB  . THR A 1  283 ? 64.509  91.603  101.099 1.00 13.46 ? 283  THR A CB  1 
ATOM   2178  O  OG1 . THR A 1  283 ? 63.096  91.886  101.122 1.00 7.70  ? 283  THR A OG1 1 
ATOM   2179  C  CG2 . THR A 1  283 ? 64.637  90.068  100.855 1.00 15.69 ? 283  THR A CG2 1 
ATOM   2180  N  N   . TYR A 1  284 ? 64.479  94.047  103.805 1.00 14.70 ? 284  TYR A N   1 
ATOM   2181  C  CA  . TYR A 1  284 ? 64.435  95.500  104.120 1.00 14.87 ? 284  TYR A CA  1 
ATOM   2182  C  C   . TYR A 1  284 ? 65.841  96.064  104.270 1.00 16.23 ? 284  TYR A C   1 
ATOM   2183  O  O   . TYR A 1  284 ? 66.726  95.374  104.801 1.00 17.29 ? 284  TYR A O   1 
ATOM   2184  C  CB  . TYR A 1  284 ? 63.632  95.776  105.392 1.00 14.22 ? 284  TYR A CB  1 
ATOM   2185  C  CG  . TYR A 1  284 ? 62.092  95.662  105.301 1.00 6.69  ? 284  TYR A CG  1 
ATOM   2186  C  CD1 . TYR A 1  284 ? 61.448  95.010  104.217 1.00 14.71 ? 284  TYR A CD1 1 
ATOM   2187  C  CD2 . TYR A 1  284 ? 61.279  96.138  106.358 1.00 6.89  ? 284  TYR A CD2 1 
ATOM   2188  C  CE1 . TYR A 1  284 ? 60.050  94.776  104.221 1.00 14.49 ? 284  TYR A CE1 1 
ATOM   2189  C  CE2 . TYR A 1  284 ? 59.852  95.946  106.336 1.00 16.11 ? 284  TYR A CE2 1 
ATOM   2190  C  CZ  . TYR A 1  284 ? 59.269  95.243  105.264 1.00 16.45 ? 284  TYR A CZ  1 
ATOM   2191  O  OH  . TYR A 1  284 ? 57.904  95.060  105.160 1.00 31.26 ? 284  TYR A OH  1 
ATOM   2192  N  N   . GLY A 1  285 ? 66.070  97.265  103.715 1.00 16.82 ? 285  GLY A N   1 
ATOM   2193  C  CA  . GLY A 1  285 ? 67.145  98.144  104.164 1.00 17.75 ? 285  GLY A CA  1 
ATOM   2194  C  C   . GLY A 1  285 ? 66.878  98.665  105.569 1.00 19.80 ? 285  GLY A C   1 
ATOM   2195  O  O   . GLY A 1  285 ? 65.727  98.904  105.938 1.00 19.74 ? 285  GLY A O   1 
ATOM   2196  N  N   . GLY A 1  286 ? 67.927  98.787  106.376 1.00 22.06 ? 286  GLY A N   1 
ATOM   2197  C  CA  . GLY A 1  286 ? 67.764  99.113  107.796 1.00 23.95 ? 286  GLY A CA  1 
ATOM   2198  C  C   . GLY A 1  286 ? 67.552  97.863  108.630 1.00 25.55 ? 286  GLY A C   1 
ATOM   2199  O  O   . GLY A 1  286 ? 66.521  97.172  108.528 1.00 26.24 ? 286  GLY A O   1 
ATOM   2200  N  N   . GLY A 1  287 ? 68.659  97.424  109.204 1.00 26.05 ? 287  GLY A N   1 
ATOM   2201  C  CA  . GLY A 1  287 ? 68.655  96.603  110.383 1.00 25.36 ? 287  GLY A CA  1 
ATOM   2202  C  C   . GLY A 1  287 ? 68.287  97.418  111.589 1.00 24.07 ? 287  GLY A C   1 
ATOM   2203  O  O   . GLY A 1  287 ? 67.094  97.731  111.797 1.00 23.73 ? 287  GLY A O   1 
ATOM   2204  N  N   . ALA A 1  288 ? 69.336  98.017  112.143 1.00 23.27 ? 288  ALA A N   1 
ATOM   2205  C  CA  . ALA A 1  288 ? 69.342  98.586  113.477 1.00 23.09 ? 288  ALA A CA  1 
ATOM   2206  C  C   . ALA A 1  288 ? 68.490  99.865  113.587 1.00 22.53 ? 288  ALA A C   1 
ATOM   2207  O  O   . ALA A 1  288 ? 67.878  100.112 114.653 1.00 22.69 ? 288  ALA A O   1 
ATOM   2208  C  CB  . ALA A 1  288 ? 70.778  98.862  113.898 1.00 23.53 ? 288  ALA A CB  1 
ATOM   2209  N  N   . HIS A 1  289 ? 68.353  100.582 112.456 1.00 20.88 ? 289  HIS A N   1 
ATOM   2210  C  CA  . HIS A 1  289 ? 67.881  101.968 112.427 1.00 19.54 ? 289  HIS A CA  1 
ATOM   2211  C  C   . HIS A 1  289 ? 66.373  102.125 112.259 1.00 19.44 ? 289  HIS A C   1 
ATOM   2212  O  O   . HIS A 1  289 ? 65.851  103.243 112.464 1.00 19.03 ? 289  HIS A O   1 
ATOM   2213  C  CB  . HIS A 1  289 ? 68.658  102.829 111.397 1.00 19.28 ? 289  HIS A CB  1 
ATOM   2214  C  CG  . HIS A 1  289 ? 70.153  102.763 111.534 1.00 18.26 ? 289  HIS A CG  1 
ATOM   2215  N  ND1 . HIS A 1  289 ? 70.994  102.720 110.443 1.00 31.10 ? 289  HIS A ND1 1 
ATOM   2216  C  CD2 . HIS A 1  289 ? 70.956  102.724 112.627 1.00 20.43 ? 289  HIS A CD2 1 
ATOM   2217  C  CE1 . HIS A 1  289 ? 72.249  102.664 110.856 1.00 27.62 ? 289  HIS A CE1 1 
ATOM   2218  N  NE2 . HIS A 1  289 ? 72.250  102.622 112.176 1.00 21.10 ? 289  HIS A NE2 1 
ATOM   2219  N  N   . LEU A 1  290 ? 65.665  101.004 112.022 1.00 19.23 ? 290  LEU A N   1 
ATOM   2220  C  CA  . LEU A 1  290 ? 64.206  101.006 111.840 1.00 20.08 ? 290  LEU A CA  1 
ATOM   2221  C  C   . LEU A 1  290 ? 63.465  101.491 113.096 1.00 21.17 ? 290  LEU A C   1 
ATOM   2222  O  O   . LEU A 1  290 ? 63.951  101.293 114.224 1.00 22.05 ? 290  LEU A O   1 
ATOM   2223  C  CB  . LEU A 1  290 ? 63.688  99.631  111.384 1.00 20.10 ? 290  LEU A CB  1 
ATOM   2224  C  CG  . LEU A 1  290 ? 63.890  99.137  109.921 1.00 23.44 ? 290  LEU A CG  1 
ATOM   2225  C  CD1 . LEU A 1  290 ? 63.491  97.664  109.831 1.00 22.06 ? 290  LEU A CD1 1 
ATOM   2226  C  CD2 . LEU A 1  290 ? 63.127  99.933  108.832 1.00 12.53 ? 290  LEU A CD2 1 
ATOM   2227  N  N   . SER A 1  291 ? 62.435  102.309 112.871 1.00 21.05 ? 291  SER A N   1 
ATOM   2228  C  CA  . SER A 1  291 ? 61.689  102.969 113.944 1.00 21.71 ? 291  SER A CA  1 
ATOM   2229  C  C   . SER A 1  291 ? 60.990  102.011 114.906 1.00 22.30 ? 291  SER A C   1 
ATOM   2230  O  O   . SER A 1  291 ? 61.061  102.212 116.125 1.00 23.05 ? 291  SER A O   1 
ATOM   2231  C  CB  . SER A 1  291 ? 60.681  103.955 113.382 1.00 21.58 ? 291  SER A CB  1 
ATOM   2232  O  OG  . SER A 1  291 ? 61.282  104.990 112.661 1.00 25.44 ? 291  SER A OG  1 
ATOM   2233  N  N   . SER A 1  292 ? 60.292  101.013 114.355 1.00 22.16 ? 292  SER A N   1 
ATOM   2234  C  CA  . SER A 1  292 ? 59.640  99.953  115.133 1.00 22.30 ? 292  SER A CA  1 
ATOM   2235  C  C   . SER A 1  292 ? 60.676  99.194  115.992 1.00 22.63 ? 292  SER A C   1 
ATOM   2236  O  O   . SER A 1  292 ? 61.651  98.682  115.422 1.00 23.01 ? 292  SER A O   1 
ATOM   2237  C  CB  . SER A 1  292 ? 58.901  98.984  114.209 1.00 21.72 ? 292  SER A CB  1 
ATOM   2238  O  OG  . SER A 1  292 ? 58.405  97.869  114.931 1.00 20.46 ? 292  SER A OG  1 
ATOM   2239  N  N   . PRO A 1  293 ? 60.506  99.178  117.338 1.00 22.64 ? 293  PRO A N   1 
ATOM   2240  C  CA  . PRO A 1  293 ? 61.386  98.376  118.221 1.00 22.14 ? 293  PRO A CA  1 
ATOM   2241  C  C   . PRO A 1  293 ? 61.348  96.868  117.962 1.00 21.48 ? 293  PRO A C   1 
ATOM   2242  O  O   . PRO A 1  293 ? 62.425  96.268  118.006 1.00 22.07 ? 293  PRO A O   1 
ATOM   2243  C  CB  . PRO A 1  293 ? 60.886  98.717  119.638 1.00 22.25 ? 293  PRO A CB  1 
ATOM   2244  C  CG  . PRO A 1  293 ? 60.182  100.041 119.480 1.00 21.47 ? 293  PRO A CG  1 
ATOM   2245  C  CD  . PRO A 1  293 ? 59.501  99.924  118.140 1.00 22.62 ? 293  PRO A CD  1 
ATOM   2246  N  N   . LEU A 1  294 ? 60.195  96.302  117.576 1.00 20.82 ? 294  LEU A N   1 
ATOM   2247  C  CA  . LEU A 1  294 ? 60.145  94.904  117.093 1.00 19.89 ? 294  LEU A CA  1 
ATOM   2248  C  C   . LEU A 1  294 ? 61.005  94.665  115.839 1.00 19.65 ? 294  LEU A C   1 
ATOM   2249  O  O   . LEU A 1  294 ? 61.957  93.910  115.929 1.00 20.16 ? 294  LEU A O   1 
ATOM   2250  C  CB  . LEU A 1  294 ? 58.705  94.343  116.955 1.00 19.18 ? 294  LEU A CB  1 
ATOM   2251  C  CG  . LEU A 1  294 ? 58.456  92.848  116.621 1.00 25.81 ? 294  LEU A CG  1 
ATOM   2252  C  CD1 . LEU A 1  294 ? 59.181  91.824  117.476 1.00 27.89 ? 294  LEU A CD1 1 
ATOM   2253  C  CD2 . LEU A 1  294 ? 56.979  92.481  116.532 1.00 18.43 ? 294  LEU A CD2 1 
ATOM   2254  N  N   . ALA A 1  295 ? 60.823  95.510  114.812 1.00 19.14 ? 295  ALA A N   1 
ATOM   2255  C  CA  . ALA A 1  295 ? 61.609  95.472  113.563 1.00 19.54 ? 295  ALA A CA  1 
ATOM   2256  C  C   . ALA A 1  295 ? 63.121  95.643  113.775 1.00 19.66 ? 295  ALA A C   1 
ATOM   2257  O  O   . ALA A 1  295 ? 63.903  94.823  113.272 1.00 19.17 ? 295  ALA A O   1 
ATOM   2258  C  CB  . ALA A 1  295 ? 61.097  96.507  112.561 1.00 19.26 ? 295  ALA A CB  1 
ATOM   2259  N  N   . SER A 1  296 ? 63.480  96.570  114.670 1.00 19.78 ? 296  SER A N   1 
ATOM   2260  C  CA  . SER A 1  296 ? 64.871  96.925  114.960 1.00 20.33 ? 296  SER A CA  1 
ATOM   2261  C  C   . SER A 1  296 ? 65.619  95.757  115.648 1.00 20.55 ? 296  SER A C   1 
ATOM   2262  O  O   . SER A 1  296 ? 66.671  95.341  115.171 1.00 19.40 ? 296  SER A O   1 
ATOM   2263  C  CB  . SER A 1  296 ? 64.922  98.202  115.809 1.00 20.16 ? 296  SER A CB  1 
ATOM   2264  O  OG  . SER A 1  296 ? 66.255  98.517  116.151 1.00 27.48 ? 296  SER A OG  1 
ATOM   2265  N  N   . ILE A 1  297 ? 64.999  95.199  116.701 1.00 21.75 ? 297  ILE A N   1 
ATOM   2266  C  CA  . ILE A 1  297 ? 65.555  94.103  117.503 1.00 22.84 ? 297  ILE A CA  1 
ATOM   2267  C  C   . ILE A 1  297 ? 65.549  92.780  116.702 1.00 22.57 ? 297  ILE A C   1 
ATOM   2268  O  O   . ILE A 1  297 ? 66.573  92.074  116.696 1.00 22.13 ? 297  ILE A O   1 
ATOM   2269  C  CB  . ILE A 1  297 ? 64.851  94.036  118.931 1.00 23.44 ? 297  ILE A CB  1 
ATOM   2270  C  CG1 . ILE A 1  297 ? 65.555  95.005  119.898 1.00 40.32 ? 297  ILE A CG1 1 
ATOM   2271  C  CG2 . ILE A 1  297 ? 64.911  92.663  119.573 1.00 26.21 ? 297  ILE A CG2 1 
ATOM   2272  C  CD1 . ILE A 1  297 ? 64.624  96.001  120.631 1.00 43.60 ? 297  ILE A CD1 1 
ATOM   2273  N  N   . ALA A 1  298 ? 64.496  92.567  115.897 1.00 23.01 ? 298  ALA A N   1 
ATOM   2274  C  CA  . ALA A 1  298 ? 64.391  91.368  115.040 1.00 24.22 ? 298  ALA A CA  1 
ATOM   2275  C  C   . ALA A 1  298 ? 65.479  91.305  113.974 1.00 24.53 ? 298  ALA A C   1 
ATOM   2276  O  O   . ALA A 1  298 ? 66.117  90.250  113.806 1.00 25.73 ? 298  ALA A O   1 
ATOM   2277  C  CB  . ALA A 1  298 ? 63.011  91.221  114.425 1.00 24.24 ? 298  ALA A CB  1 
ATOM   2278  N  N   . ALA A 1  299 ? 65.779  92.464  113.391 1.00 23.87 ? 299  ALA A N   1 
ATOM   2279  C  CA  . ALA A 1  299 ? 66.900  92.655  112.473 1.00 24.35 ? 299  ALA A CA  1 
ATOM   2280  C  C   . ALA A 1  299 ? 68.278  92.542  113.116 1.00 25.34 ? 299  ALA A C   1 
ATOM   2281  O  O   . ALA A 1  299 ? 69.155  91.912  112.531 1.00 26.43 ? 299  ALA A O   1 
ATOM   2282  C  CB  . ALA A 1  299 ? 66.760  93.970  111.728 1.00 24.15 ? 299  ALA A CB  1 
ATOM   2283  N  N   . THR A 1  300 ? 68.480  93.192  114.270 1.00 25.95 ? 300  THR A N   1 
ATOM   2284  C  CA  . THR A 1  300 ? 69.779  93.205  114.977 1.00 27.65 ? 300  THR A CA  1 
ATOM   2285  C  C   . THR A 1  300 ? 70.171  91.819  115.513 1.00 28.83 ? 300  THR A C   1 
ATOM   2286  O  O   . THR A 1  300 ? 71.262  91.325  115.202 1.00 29.52 ? 300  THR A O   1 
ATOM   2287  C  CB  . THR A 1  300 ? 69.791  94.297  116.091 1.00 28.32 ? 300  THR A CB  1 
ATOM   2288  O  OG1 . THR A 1  300 ? 69.459  95.563  115.507 1.00 32.12 ? 300  THR A OG1 1 
ATOM   2289  C  CG2 . THR A 1  300 ? 71.218  94.547  116.654 1.00 29.79 ? 300  THR A CG2 1 
ATOM   2290  N  N   . ASN A 1  301 ? 69.196  91.135  116.114 1.00 29.05 ? 301  ASN A N   1 
ATOM   2291  C  CA  . ASN A 1  301 ? 69.423  89.902  116.842 1.00 29.08 ? 301  ASN A CA  1 
ATOM   2292  C  C   . ASN A 1  301 ? 69.134  88.648  116.014 1.00 29.56 ? 301  ASN A C   1 
ATOM   2293  O  O   . ASN A 1  301 ? 69.409  87.528  116.475 1.00 29.03 ? 301  ASN A O   1 
ATOM   2294  C  CB  . ASN A 1  301 ? 68.653  89.918  118.172 1.00 28.85 ? 301  ASN A CB  1 
ATOM   2295  C  CG  . ASN A 1  301 ? 69.174  90.956  119.130 1.00 35.84 ? 301  ASN A CG  1 
ATOM   2296  O  OD1 . ASN A 1  301 ? 70.300  90.852  119.620 1.00 45.03 ? 301  ASN A OD1 1 
ATOM   2297  N  ND2 . ASN A 1  301 ? 68.420  92.035  119.292 1.00 38.94 ? 301  ASN A ND2 1 
ATOM   2298  N  N   . LYS A 1  302 ? 68.756  88.879  114.741 1.00 30.21 ? 302  LYS A N   1 
ATOM   2299  C  CA  . LYS A 1  302 ? 68.402  87.861  113.733 1.00 30.44 ? 302  LYS A CA  1 
ATOM   2300  C  C   . LYS A 1  302 ? 67.280  86.913  114.189 1.00 30.59 ? 302  LYS A C   1 
ATOM   2301  O  O   . LYS A 1  302 ? 67.387  85.679  114.092 1.00 31.27 ? 302  LYS A O   1 
ATOM   2302  C  CB  . LYS A 1  302 ? 69.655  87.163  113.152 1.00 30.55 ? 302  LYS A CB  1 
ATOM   2303  C  CG  . LYS A 1  302 ? 70.357  87.985  112.087 1.00 40.34 ? 302  LYS A CG  1 
ATOM   2304  C  CD  . LYS A 1  302 ? 71.862  87.976  112.275 1.00 46.41 ? 302  LYS A CD  1 
ATOM   2305  C  CE  . LYS A 1  302 ? 72.571  88.201  110.946 1.00 47.51 ? 302  LYS A CE  1 
ATOM   2306  N  NZ  . LYS A 1  302 ? 73.915  87.559  110.928 1.00 54.44 ? 302  LYS A NZ  1 
ATOM   2307  N  N   . LEU A 1  303 ? 66.171  87.525  114.612 1.00 30.19 ? 303  LEU A N   1 
ATOM   2308  C  CA  . LEU A 1  303 ? 65.091  86.832  115.328 1.00 29.35 ? 303  LEU A CA  1 
ATOM   2309  C  C   . LEU A 1  303 ? 64.020  86.221  114.450 1.00 28.92 ? 303  LEU A C   1 
ATOM   2310  O  O   . LEU A 1  303 ? 63.288  85.345  114.911 1.00 29.29 ? 303  LEU A O   1 
ATOM   2311  C  CB  . LEU A 1  303 ? 64.448  87.744  116.385 1.00 28.99 ? 303  LEU A CB  1 
ATOM   2312  C  CG  . LEU A 1  303 ? 65.230  88.261  117.601 1.00 25.90 ? 303  LEU A CG  1 
ATOM   2313  C  CD1 . LEU A 1  303 ? 64.289  89.058  118.522 1.00 24.55 ? 303  LEU A CD1 1 
ATOM   2314  C  CD2 . LEU A 1  303 ? 65.975  87.163  118.381 1.00 16.97 ? 303  LEU A CD2 1 
ATOM   2315  N  N   . CYS A 1  304 ? 64.177  86.415  113.147 1.00 28.10 ? 304  CYS A N   1 
ATOM   2316  C  CA  . CYS A 1  304 ? 63.075  86.694  112.220 1.00 27.85 ? 304  CYS A CA  1 
ATOM   2317  C  C   . CYS A 1  304 ? 63.587  86.459  110.811 1.00 26.21 ? 304  CYS A C   1 
ATOM   2318  O  O   . CYS A 1  304 ? 64.709  86.891  110.456 1.00 26.66 ? 304  CYS A O   1 
ATOM   2319  C  CB  . CYS A 1  304 ? 62.735  88.187  112.307 1.00 28.98 ? 304  CYS A CB  1 
ATOM   2320  S  SG  . CYS A 1  304 ? 61.020  88.572  112.276 1.00 33.45 ? 304  CYS A SG  1 
ATOM   2321  N  N   . GLN A 1  305 ? 62.718  85.908  109.981 1.00 24.44 ? 305  GLN A N   1 
ATOM   2322  C  CA  . GLN A 1  305 ? 62.788  86.108  108.530 1.00 22.91 ? 305  GLN A CA  1 
ATOM   2323  C  C   . GLN A 1  305 ? 61.777  87.160  108.066 1.00 20.60 ? 305  GLN A C   1 
ATOM   2324  O  O   . GLN A 1  305 ? 62.138  88.071  107.331 1.00 20.46 ? 305  GLN A O   1 
ATOM   2325  C  CB  . GLN A 1  305 ? 62.643  84.767  107.784 1.00 22.70 ? 305  GLN A CB  1 
ATOM   2326  C  CG  . GLN A 1  305 ? 63.591  84.609  106.558 1.00 40.51 ? 305  GLN A CG  1 
ATOM   2327  C  CD  . GLN A 1  305 ? 65.090  84.538  106.892 1.00 44.15 ? 305  GLN A CD  1 
ATOM   2328  O  OE1 . GLN A 1  305 ? 65.882  85.323  106.356 1.00 45.72 ? 305  GLN A OE1 1 
ATOM   2329  N  NE2 . GLN A 1  305 ? 65.490  83.488  107.601 1.00 49.21 ? 305  GLN A NE2 1 
ATOM   2330  N  N   . SER A 1  306 ? 60.595  87.131  108.681 1.00 18.55 ? 306  SER A N   1 
ATOM   2331  C  CA  . SER A 1  306 ? 59.541  88.126  108.504 1.00 17.60 ? 306  SER A CA  1 
ATOM   2332  C  C   . SER A 1  306 ? 58.574  88.175  109.704 1.00 17.38 ? 306  SER A C   1 
ATOM   2333  O  O   . SER A 1  306 ? 58.575  87.271  110.549 1.00 18.56 ? 306  SER A O   1 
ATOM   2334  C  CB  . SER A 1  306 ? 58.773  87.912  107.168 1.00 16.72 ? 306  SER A CB  1 
ATOM   2335  O  OG  . SER A 1  306 ? 58.000  86.727  107.190 1.00 25.46 ? 306  SER A OG  1 
ATOM   2336  N  N   . PHE A 1  307 ? 57.935  89.327  109.871 1.00 16.60 ? 307  PHE A N   1 
ATOM   2337  C  CA  . PHE A 1  307 ? 56.690  89.474  110.617 1.00 15.48 ? 307  PHE A CA  1 
ATOM   2338  C  C   . PHE A 1  307 ? 55.768  90.499  109.947 1.00 15.28 ? 307  PHE A C   1 
ATOM   2339  O  O   . PHE A 1  307 ? 56.238  91.391  109.248 1.00 14.84 ? 307  PHE A O   1 
ATOM   2340  C  CB  . PHE A 1  307 ? 56.920  89.776  112.143 1.00 14.94 ? 307  PHE A CB  1 
ATOM   2341  C  CG  . PHE A 1  307 ? 57.402  91.177  112.447 1.00 23.77 ? 307  PHE A CG  1 
ATOM   2342  C  CD1 . PHE A 1  307 ? 58.768  91.409  112.717 1.00 26.67 ? 307  PHE A CD1 1 
ATOM   2343  C  CD2 . PHE A 1  307 ? 56.471  92.257  112.622 1.00 16.30 ? 307  PHE A CD2 1 
ATOM   2344  C  CE1 . PHE A 1  307 ? 59.226  92.725  113.107 1.00 12.03 ? 307  PHE A CE1 1 
ATOM   2345  C  CE2 . PHE A 1  307 ? 56.918  93.578  112.845 1.00 17.46 ? 307  PHE A CE2 1 
ATOM   2346  C  CZ  . PHE A 1  307 ? 58.303  93.819  113.118 1.00 13.80 ? 307  PHE A CZ  1 
ATOM   2347  N  N   . GLN A 1  308 ? 54.498  90.457  110.347 1.00 15.71 ? 308  GLN A N   1 
ATOM   2348  C  CA  . GLN A 1  308 ? 53.435  91.364  109.901 1.00 16.51 ? 308  GLN A CA  1 
ATOM   2349  C  C   . GLN A 1  308 ? 52.424  91.511  111.026 1.00 16.53 ? 308  GLN A C   1 
ATOM   2350  O  O   . GLN A 1  308 ? 52.272  90.595  111.829 1.00 16.59 ? 308  GLN A O   1 
ATOM   2351  C  CB  . GLN A 1  308 ? 52.757  90.879  108.595 1.00 16.69 ? 308  GLN A CB  1 
ATOM   2352  C  CG  . GLN A 1  308 ? 52.092  89.455  108.663 1.00 36.03 ? 308  GLN A CG  1 
ATOM   2353  C  CD  . GLN A 1  308 ? 51.411  89.011  107.368 1.00 43.73 ? 308  GLN A CD  1 
ATOM   2354  O  OE1 . GLN A 1  308 ? 50.680  89.784  106.731 1.00 51.82 ? 308  GLN A OE1 1 
ATOM   2355  N  NE2 . GLN A 1  308 ? 51.539  87.732  107.059 1.00 35.79 ? 308  GLN A NE2 1 
ATOM   2356  N  N   . THR A 1  309 ? 51.969  92.739  111.235 1.00 16.65 ? 309  THR A N   1 
ATOM   2357  C  CA  . THR A 1  309 ? 50.737  93.002  111.973 1.00 16.67 ? 309  THR A CA  1 
ATOM   2358  C  C   . THR A 1  309 ? 49.552  92.867  111.048 1.00 16.36 ? 309  THR A C   1 
ATOM   2359  O  O   . THR A 1  309 ? 49.678  93.077  109.833 1.00 16.30 ? 309  THR A O   1 
ATOM   2360  C  CB  . THR A 1  309 ? 50.734  94.404  112.627 1.00 17.09 ? 309  THR A CB  1 
ATOM   2361  O  OG1 . THR A 1  309 ? 51.213  95.390  111.708 1.00 20.38 ? 309  THR A OG1 1 
ATOM   2362  C  CG2 . THR A 1  309 ? 51.683  94.463  113.770 1.00 18.16 ? 309  THR A CG2 1 
ATOM   2363  N  N   . PHE A 1  310 ? 48.414  92.481  111.624 1.00 16.70 ? 310  PHE A N   1 
ATOM   2364  C  CA  . PHE A 1  310 ? 47.136  92.394  110.915 1.00 16.80 ? 310  PHE A CA  1 
ATOM   2365  C  C   . PHE A 1  310 ? 45.978  92.813  111.793 1.00 17.93 ? 310  PHE A C   1 
ATOM   2366  O  O   . PHE A 1  310 ? 46.079  92.757  113.031 1.00 18.49 ? 310  PHE A O   1 
ATOM   2367  C  CB  . PHE A 1  310 ? 46.919  91.003  110.299 1.00 16.84 ? 310  PHE A CB  1 
ATOM   2368  C  CG  . PHE A 1  310 ? 46.923  89.855  111.303 1.00 8.34  ? 310  PHE A CG  1 
ATOM   2369  C  CD1 . PHE A 1  310 ? 45.761  89.522  112.028 1.00 8.09  ? 310  PHE A CD1 1 
ATOM   2370  C  CD2 . PHE A 1  310 ? 48.043  89.004  111.391 1.00 12.48 ? 310  PHE A CD2 1 
ATOM   2371  C  CE1 . PHE A 1  310 ? 45.742  88.417  112.939 1.00 15.65 ? 310  PHE A CE1 1 
ATOM   2372  C  CE2 . PHE A 1  310 ? 48.029  87.850  112.241 1.00 14.62 ? 310  PHE A CE2 1 
ATOM   2373  C  CZ  . PHE A 1  310 ? 46.890  87.568  113.030 1.00 12.60 ? 310  PHE A CZ  1 
ATOM   2374  N  N   . ASN A 1  311 ? 44.955  93.373  111.141 1.00 18.41 ? 311  ASN A N   1 
ATOM   2375  C  CA  . ASN A 1  311 ? 43.633  93.580  111.702 1.00 19.21 ? 311  ASN A CA  1 
ATOM   2376  C  C   . ASN A 1  311 ? 42.595  93.123  110.661 1.00 20.49 ? 311  ASN A C   1 
ATOM   2377  O  O   . ASN A 1  311 ? 42.279  93.862  109.700 1.00 21.31 ? 311  ASN A O   1 
ATOM   2378  C  CB  . ASN A 1  311 ? 43.470  95.060  112.127 1.00 19.29 ? 311  ASN A CB  1 
ATOM   2379  C  CG  . ASN A 1  311 ? 42.110  95.366  112.773 1.00 21.26 ? 311  ASN A CG  1 
ATOM   2380  O  OD1 . ASN A 1  311 ? 41.693  94.709  113.732 1.00 25.41 ? 311  ASN A OD1 1 
ATOM   2381  N  ND2 . ASN A 1  311 ? 41.526  96.484  112.378 1.00 23.94 ? 311  ASN A ND2 1 
ATOM   2382  N  N   . ILE A 1  312 ? 42.330  91.812  110.688 1.00 20.36 ? 312  ILE A N   1 
ATOM   2383  C  CA  . ILE A 1  312 ? 41.303  91.180  109.846 1.00 20.47 ? 312  ILE A CA  1 
ATOM   2384  C  C   . ILE A 1  312 ? 39.947  91.470  110.499 1.00 20.64 ? 312  ILE A C   1 
ATOM   2385  O  O   . ILE A 1  312 ? 39.786  91.257  111.714 1.00 21.28 ? 312  ILE A O   1 
ATOM   2386  C  CB  . ILE A 1  312 ? 41.562  89.614  109.665 1.00 20.63 ? 312  ILE A CB  1 
ATOM   2387  C  CG1 . ILE A 1  312 ? 42.908  89.352  108.966 1.00 14.63 ? 312  ILE A CG1 1 
ATOM   2388  C  CG2 . ILE A 1  312 ? 40.453  88.960  108.786 1.00 22.62 ? 312  ILE A CG2 1 
ATOM   2389  C  CD1 . ILE A 1  312 ? 43.632  88.084  109.431 1.00 19.27 ? 312  ILE A CD1 1 
ATOM   2390  N  N   . CYS A 1  313 ? 39.032  92.029  109.699 1.00 19.85 ? 313  CYS A N   1 
ATOM   2391  C  CA  . CYS A 1  313 ? 37.671  92.390  110.125 1.00 19.06 ? 313  CYS A CA  1 
ATOM   2392  C  C   . CYS A 1  313 ? 36.617  91.502  109.489 1.00 18.85 ? 313  CYS A C   1 
ATOM   2393  O  O   . CYS A 1  313 ? 36.666  91.226  108.281 1.00 18.91 ? 313  CYS A O   1 
ATOM   2394  C  CB  . CYS A 1  313 ? 37.360  93.852  109.825 1.00 18.56 ? 313  CYS A CB  1 
ATOM   2395  S  SG  . CYS A 1  313 ? 38.598  95.014  110.412 1.00 24.83 ? 313  CYS A SG  1 
ATOM   2396  N  N   . TYR A 1  314 ? 35.732  90.988  110.343 1.00 18.63 ? 314  TYR A N   1 
ATOM   2397  C  CA  . TYR A 1  314 ? 34.423  90.447  109.938 1.00 18.94 ? 314  TYR A CA  1 
ATOM   2398  C  C   . TYR A 1  314 ? 33.285  91.240  110.577 1.00 19.45 ? 314  TYR A C   1 
ATOM   2399  O  O   . TYR A 1  314 ? 33.558  92.259  111.178 1.00 20.22 ? 314  TYR A O   1 
ATOM   2400  C  CB  . TYR A 1  314 ? 34.367  88.956  110.271 1.00 18.65 ? 314  TYR A CB  1 
ATOM   2401  C  CG  . TYR A 1  314 ? 35.491  88.170  109.622 1.00 17.98 ? 314  TYR A CG  1 
ATOM   2402  C  CD1 . TYR A 1  314 ? 36.567  87.678  110.402 1.00 14.31 ? 314  TYR A CD1 1 
ATOM   2403  C  CD2 . TYR A 1  314 ? 35.560  88.025  108.199 1.00 13.71 ? 314  TYR A CD2 1 
ATOM   2404  C  CE1 . TYR A 1  314 ? 37.613  86.916  109.800 1.00 10.13 ? 314  TYR A CE1 1 
ATOM   2405  C  CE2 . TYR A 1  314 ? 36.638  87.328  107.585 1.00 16.18 ? 314  TYR A CE2 1 
ATOM   2406  C  CZ  . TYR A 1  314 ? 37.632  86.751  108.395 1.00 12.31 ? 314  TYR A CZ  1 
ATOM   2407  O  OH  . TYR A 1  314 ? 38.680  86.107  107.792 1.00 21.36 ? 314  TYR A OH  1 
ATOM   2408  N  N   . ALA A 1  315 ? 32.041  90.964  110.181 1.00 19.66 ? 315  ALA A N   1 
ATOM   2409  C  CA  . ALA A 1  315 ? 30.860  91.516  110.855 1.00 20.01 ? 315  ALA A CA  1 
ATOM   2410  C  C   . ALA A 1  315 ? 30.856  91.132  112.342 1.00 20.21 ? 315  ALA A C   1 
ATOM   2411  O  O   . ALA A 1  315 ? 30.964  89.924  112.687 1.00 19.57 ? 315  ALA A O   1 
ATOM   2412  C  CB  . ALA A 1  315 ? 29.558  91.068  110.159 1.00 20.08 ? 315  ALA A CB  1 
ATOM   2413  N  N   . ASP A 1  316 ? 31.101  92.176  113.159 1.00 20.20 ? 316  ASP A N   1 
ATOM   2414  C  CA  . ASP A 1  316 ? 30.939  92.180  114.634 1.00 19.85 ? 316  ASP A CA  1 
ATOM   2415  C  C   . ASP A 1  316 ? 32.034  91.449  115.427 1.00 19.07 ? 316  ASP A C   1 
ATOM   2416  O  O   . ASP A 1  316 ? 31.985  91.386  116.666 1.00 18.96 ? 316  ASP A O   1 
ATOM   2417  C  CB  . ASP A 1  316 ? 29.507  91.780  115.067 1.00 20.22 ? 316  ASP A CB  1 
ATOM   2418  C  CG  . ASP A 1  316 ? 28.504  92.870  114.795 1.00 28.71 ? 316  ASP A CG  1 
ATOM   2419  O  OD1 . ASP A 1  316 ? 27.754  92.748  113.799 1.00 32.31 ? 316  ASP A OD1 1 
ATOM   2420  O  OD2 . ASP A 1  316 ? 28.472  93.937  115.453 1.00 30.73 ? 316  ASP A OD2 1 
ATOM   2421  N  N   . THR A 1  317 ? 33.068  91.009  114.701 1.00 18.80 ? 317  THR A N   1 
ATOM   2422  C  CA  . THR A 1  317 ? 34.248  90.318  115.239 1.00 18.82 ? 317  THR A CA  1 
ATOM   2423  C  C   . THR A 1  317 ? 35.486  90.531  114.330 1.00 19.30 ? 317  THR A C   1 
ATOM   2424  O  O   . THR A 1  317 ? 35.362  91.028  113.194 1.00 19.23 ? 317  THR A O   1 
ATOM   2425  C  CB  . THR A 1  317 ? 33.926  88.799  115.538 1.00 18.51 ? 317  THR A CB  1 
ATOM   2426  O  OG1 . THR A 1  317 ? 34.965  88.221  116.325 1.00 24.90 ? 317  THR A OG1 1 
ATOM   2427  C  CG2 . THR A 1  317 ? 33.901  87.948  114.285 1.00 16.58 ? 317  THR A CG2 1 
ATOM   2428  N  N   . GLY A 1  318 ? 36.669  90.227  114.864 1.00 19.65 ? 318  GLY A N   1 
ATOM   2429  C  CA  . GLY A 1  318 ? 37.887  90.248  114.076 1.00 19.94 ? 318  GLY A CA  1 
ATOM   2430  C  C   . GLY A 1  318 ? 39.029  89.396  114.572 1.00 20.15 ? 318  GLY A C   1 
ATOM   2431  O  O   . GLY A 1  318 ? 38.919  88.760  115.620 1.00 20.43 ? 318  GLY A O   1 
ATOM   2432  N  N   . LEU A 1  319 ? 40.109  89.371  113.783 1.00 20.18 ? 319  LEU A N   1 
ATOM   2433  C  CA  . LEU A 1  319 ? 41.409  88.880  114.232 1.00 20.31 ? 319  LEU A CA  1 
ATOM   2434  C  C   . LEU A 1  319 ? 42.460  89.977  114.230 1.00 20.68 ? 319  LEU A C   1 
ATOM   2435  O  O   . LEU A 1  319 ? 42.818  90.535  113.170 1.00 21.30 ? 319  LEU A O   1 
ATOM   2436  C  CB  . LEU A 1  319 ? 41.866  87.648  113.431 1.00 19.72 ? 319  LEU A CB  1 
ATOM   2437  C  CG  . LEU A 1  319 ? 41.153  86.305  113.621 1.00 27.46 ? 319  LEU A CG  1 
ATOM   2438  C  CD1 . LEU A 1  319 ? 41.561  85.320  112.530 1.00 22.02 ? 319  LEU A CD1 1 
ATOM   2439  C  CD2 . LEU A 1  319 ? 41.375  85.701  114.996 1.00 19.16 ? 319  LEU A CD2 1 
ATOM   2440  N  N   . LEU A 1  320 ? 42.878  90.343  115.436 1.00 20.30 ? 320  LEU A N   1 
ATOM   2441  C  CA  . LEU A 1  320 ? 43.860  91.392  115.634 1.00 19.99 ? 320  LEU A CA  1 
ATOM   2442  C  C   . LEU A 1  320 ? 45.095  90.821  116.278 1.00 20.05 ? 320  LEU A C   1 
ATOM   2443  O  O   . LEU A 1  320 ? 45.054  90.399  117.435 1.00 20.36 ? 320  LEU A O   1 
ATOM   2444  C  CB  . LEU A 1  320 ? 43.265  92.560  116.442 1.00 19.69 ? 320  LEU A CB  1 
ATOM   2445  C  CG  . LEU A 1  320 ? 44.189  93.682  116.949 1.00 11.77 ? 320  LEU A CG  1 
ATOM   2446  C  CD1 . LEU A 1  320 ? 44.319  94.818  115.933 1.00 15.07 ? 320  LEU A CD1 1 
ATOM   2447  C  CD2 . LEU A 1  320 ? 43.615  94.195  118.258 1.00 12.96 ? 320  LEU A CD2 1 
ATOM   2448  N  N   . GLY A 1  321 ? 46.210  90.940  115.561 1.00 20.07 ? 321  GLY A N   1 
ATOM   2449  C  CA  . GLY A 1  321 ? 47.512  90.616  116.096 1.00 20.12 ? 321  GLY A CA  1 
ATOM   2450  C  C   . GLY A 1  321 ? 48.582  90.604  115.053 1.00 20.11 ? 321  GLY A C   1 
ATOM   2451  O  O   . GLY A 1  321 ? 48.849  91.643  114.440 1.00 21.00 ? 321  GLY A O   1 
ATOM   2452  N  N   . ALA A 1  322 ? 49.311  89.487  115.005 1.00 19.41 ? 322  ALA A N   1 
ATOM   2453  C  CA  . ALA A 1  322 ? 50.605  89.374  114.319 1.00 18.34 ? 322  ALA A CA  1 
ATOM   2454  C  C   . ALA A 1  322 ? 50.968  87.949  113.914 1.00 18.73 ? 322  ALA A C   1 
ATOM   2455  O  O   . ALA A 1  322 ? 50.380  86.982  114.429 1.00 19.56 ? 322  ALA A O   1 
ATOM   2456  C  CB  . ALA A 1  322 ? 51.738  90.018  115.139 1.00 17.41 ? 322  ALA A CB  1 
ATOM   2457  N  N   . HIS A 1  323 ? 51.637  87.874  112.760 1.00 18.26 ? 323  HIS A N   1 
ATOM   2458  C  CA  . HIS A 1  323 ? 52.174  86.635  112.175 1.00 17.02 ? 323  HIS A CA  1 
ATOM   2459  C  C   . HIS A 1  323 ? 53.672  86.831  112.020 1.00 16.27 ? 323  HIS A C   1 
ATOM   2460  O  O   . HIS A 1  323 ? 54.117  87.949  111.708 1.00 15.19 ? 323  HIS A O   1 
ATOM   2461  C  CB  . HIS A 1  323 ? 51.520  86.388  110.813 1.00 16.95 ? 323  HIS A CB  1 
ATOM   2462  C  CG  . HIS A 1  323 ? 52.261  85.429  109.931 1.00 21.71 ? 323  HIS A CG  1 
ATOM   2463  N  ND1 . HIS A 1  323 ? 52.173  84.057  110.082 1.00 16.46 ? 323  HIS A ND1 1 
ATOM   2464  C  CD2 . HIS A 1  323 ? 53.108  85.641  108.896 1.00 10.24 ? 323  HIS A CD2 1 
ATOM   2465  C  CE1 . HIS A 1  323 ? 52.950  83.474  109.188 1.00 12.77 ? 323  HIS A CE1 1 
ATOM   2466  N  NE2 . HIS A 1  323 ? 53.465  84.408  108.406 1.00 15.61 ? 323  HIS A NE2 1 
ATOM   2467  N  N   . PHE A 1  324 ? 54.435  85.758  112.260 1.00 15.57 ? 324  PHE A N   1 
ATOM   2468  C  CA  . PHE A 1  324 ? 55.886  85.750  112.030 1.00 15.38 ? 324  PHE A CA  1 
ATOM   2469  C  C   . PHE A 1  324 ? 56.446  84.394  111.586 1.00 15.59 ? 324  PHE A C   1 
ATOM   2470  O  O   . PHE A 1  324 ? 55.774  83.350  111.686 1.00 15.33 ? 324  PHE A O   1 
ATOM   2471  C  CB  . PHE A 1  324 ? 56.667  86.350  113.229 1.00 15.41 ? 324  PHE A CB  1 
ATOM   2472  C  CG  . PHE A 1  324 ? 56.532  85.579  114.506 1.00 12.87 ? 324  PHE A CG  1 
ATOM   2473  C  CD1 . PHE A 1  324 ? 57.393  84.488  114.777 1.00 9.24  ? 324  PHE A CD1 1 
ATOM   2474  C  CD2 . PHE A 1  324 ? 55.694  86.068  115.543 1.00 12.84 ? 324  PHE A CD2 1 
ATOM   2475  C  CE1 . PHE A 1  324 ? 57.228  83.694  115.964 1.00 10.92 ? 324  PHE A CE1 1 
ATOM   2476  C  CE2 . PHE A 1  324 ? 55.609  85.371  116.807 1.00 17.87 ? 324  PHE A CE2 1 
ATOM   2477  C  CZ  . PHE A 1  324 ? 56.402  84.179  117.015 1.00 13.88 ? 324  PHE A CZ  1 
ATOM   2478  N  N   . VAL A 1  325 ? 57.633  84.461  110.988 1.00 15.98 ? 325  VAL A N   1 
ATOM   2479  C  CA  . VAL A 1  325 ? 58.331  83.316  110.375 1.00 15.66 ? 325  VAL A CA  1 
ATOM   2480  C  C   . VAL A 1  325 ? 59.777  83.397  110.889 1.00 15.61 ? 325  VAL A C   1 
ATOM   2481  O  O   . VAL A 1  325 ? 60.430  84.459  110.792 1.00 14.88 ? 325  VAL A O   1 
ATOM   2482  C  CB  . VAL A 1  325 ? 58.324  83.404  108.783 1.00 15.88 ? 325  VAL A CB  1 
ATOM   2483  C  CG1 . VAL A 1  325 ? 59.002  82.195  108.137 1.00 15.04 ? 325  VAL A CG1 1 
ATOM   2484  C  CG2 . VAL A 1  325 ? 56.891  83.635  108.202 1.00 12.72 ? 325  VAL A CG2 1 
ATOM   2485  N  N   . CYS A 1  326 ? 60.233  82.309  111.500 1.00 15.94 ? 326  CYS A N   1 
ATOM   2486  C  CA  . CYS A 1  326 ? 61.545  82.263  112.141 1.00 16.65 ? 326  CYS A CA  1 
ATOM   2487  C  C   . CYS A 1  326 ? 62.068  80.837  112.301 1.00 16.92 ? 326  CYS A C   1 
ATOM   2488  O  O   . CYS A 1  326 ? 61.293  79.859  112.266 1.00 16.69 ? 326  CYS A O   1 
ATOM   2489  C  CB  . CYS A 1  326 ? 61.511  82.990  113.515 1.00 16.89 ? 326  CYS A CB  1 
ATOM   2490  S  SG  . CYS A 1  326 ? 60.596  82.137  114.829 1.00 22.66 ? 326  CYS A SG  1 
ATOM   2491  N  N   . ASP A 1  327 ? 63.400  80.760  112.429 1.00 16.79 ? 327  ASP A N   1 
ATOM   2492  C  CA  . ASP A 1  327 ? 64.166  79.644  112.965 1.00 16.82 ? 327  ASP A CA  1 
ATOM   2493  C  C   . ASP A 1  327 ? 63.578  79.065  114.272 1.00 16.96 ? 327  ASP A C   1 
ATOM   2494  O  O   . ASP A 1  327 ? 63.109  79.843  115.131 1.00 17.77 ? 327  ASP A O   1 
ATOM   2495  C  CB  . ASP A 1  327 ? 65.599  80.141  113.200 1.00 16.84 ? 327  ASP A CB  1 
ATOM   2496  C  CG  . ASP A 1  327 ? 66.566  79.021  113.508 1.00 24.31 ? 327  ASP A CG  1 
ATOM   2497  O  OD1 . ASP A 1  327 ? 66.811  78.780  114.707 1.00 30.77 ? 327  ASP A OD1 1 
ATOM   2498  O  OD2 . ASP A 1  327 ? 67.020  78.247  112.637 1.00 27.02 ? 327  ASP A OD2 1 
ATOM   2499  N  N   . HIS A 1  328 ? 63.652  77.717  114.408 1.00 15.75 ? 328  HIS A N   1 
ATOM   2500  C  CA  . HIS A 1  328 ? 63.333  76.955  115.624 1.00 15.39 ? 328  HIS A CA  1 
ATOM   2501  C  C   . HIS A 1  328 ? 63.862  77.456  116.993 1.00 15.43 ? 328  HIS A C   1 
ATOM   2502  O  O   . HIS A 1  328 ? 63.151  77.329  117.984 1.00 14.83 ? 328  HIS A O   1 
ATOM   2503  C  CB  . HIS A 1  328 ? 63.616  75.432  115.438 1.00 15.88 ? 328  HIS A CB  1 
ATOM   2504  C  CG  . HIS A 1  328 ? 65.063  75.050  115.569 1.00 8.48  ? 328  HIS A CG  1 
ATOM   2505  N  ND1 . HIS A 1  328 ? 65.529  74.239  116.580 1.00 16.20 ? 328  HIS A ND1 1 
ATOM   2506  C  CD2 . HIS A 1  328 ? 66.149  75.394  114.839 1.00 19.57 ? 328  HIS A CD2 1 
ATOM   2507  C  CE1 . HIS A 1  328 ? 66.814  73.998  116.394 1.00 13.45 ? 328  HIS A CE1 1 
ATOM   2508  N  NE2 . HIS A 1  328 ? 67.226  74.723  115.372 1.00 8.92  ? 328  HIS A NE2 1 
ATOM   2509  N  N   . MET A 1  329 ? 65.073  78.040  117.020 1.00 15.51 ? 329  MET A N   1 
ATOM   2510  C  CA  . MET A 1  329 ? 65.669  78.633  118.244 1.00 16.00 ? 329  MET A CA  1 
ATOM   2511  C  C   . MET A 1  329 ? 65.329  80.130  118.517 1.00 16.79 ? 329  MET A C   1 
ATOM   2512  O  O   . MET A 1  329 ? 65.893  80.741  119.438 1.00 17.18 ? 329  MET A O   1 
ATOM   2513  C  CB  . MET A 1  329 ? 67.206  78.412  118.255 1.00 16.13 ? 329  MET A CB  1 
ATOM   2514  C  CG  . MET A 1  329 ? 67.662  76.933  118.401 1.00 16.34 ? 329  MET A CG  1 
ATOM   2515  S  SD  . MET A 1  329 ? 66.816  75.980  119.696 1.00 26.56 ? 329  MET A SD  1 
ATOM   2516  C  CE  . MET A 1  329 ? 67.330  76.786  121.267 1.00 4.60  ? 329  MET A CE  1 
ATOM   2517  N  N   . SER A 1  330 ? 64.311  80.662  117.825 1.00 16.46 ? 330  SER A N   1 
ATOM   2518  C  CA  . SER A 1  330 ? 64.005  82.116  117.832 1.00 15.10 ? 330  SER A CA  1 
ATOM   2519  C  C   . SER A 1  330 ? 62.541  82.447  118.206 1.00 14.16 ? 330  SER A C   1 
ATOM   2520  O  O   . SER A 1  330 ? 62.185  83.612  118.345 1.00 14.70 ? 330  SER A O   1 
ATOM   2521  C  CB  . SER A 1  330 ? 64.335  82.710  116.459 1.00 14.92 ? 330  SER A CB  1 
ATOM   2522  O  OG  . SER A 1  330 ? 65.707  83.027  116.319 1.00 23.48 ? 330  SER A OG  1 
ATOM   2523  N  N   . ILE A 1  331 ? 61.716  81.420  118.384 1.00 13.52 ? 331  ILE A N   1 
ATOM   2524  C  CA  . ILE A 1  331 ? 60.259  81.579  118.603 1.00 14.16 ? 331  ILE A CA  1 
ATOM   2525  C  C   . ILE A 1  331 ? 59.976  82.266  119.930 1.00 15.64 ? 331  ILE A C   1 
ATOM   2526  O  O   . ILE A 1  331 ? 59.103  83.147  119.977 1.00 15.78 ? 331  ILE A O   1 
ATOM   2527  C  CB  . ILE A 1  331 ? 59.459  80.206  118.514 1.00 12.79 ? 331  ILE A CB  1 
ATOM   2528  C  CG1 . ILE A 1  331 ? 59.906  79.369  117.307 1.00 6.78  ? 331  ILE A CG1 1 
ATOM   2529  C  CG2 . ILE A 1  331 ? 57.892  80.467  118.503 1.00 4.56  ? 331  ILE A CG2 1 
ATOM   2530  C  CD1 . ILE A 1  331 ? 59.319  77.903  117.281 1.00 28.05 ? 331  ILE A CD1 1 
ATOM   2531  N  N   . ASP A 1  332 ? 60.626  81.767  121.004 1.00 16.53 ? 332  ASP A N   1 
ATOM   2532  C  CA  . ASP A 1  332 ? 60.507  82.328  122.355 1.00 17.30 ? 332  ASP A CA  1 
ATOM   2533  C  C   . ASP A 1  332 ? 60.882  83.818  122.441 1.00 17.40 ? 332  ASP A C   1 
ATOM   2534  O  O   . ASP A 1  332 ? 60.046  84.614  122.878 1.00 18.04 ? 332  ASP A O   1 
ATOM   2535  C  CB  . ASP A 1  332 ? 61.274  81.498  123.397 1.00 17.45 ? 332  ASP A CB  1 
ATOM   2536  C  CG  . ASP A 1  332 ? 60.817  81.795  124.816 1.00 22.99 ? 332  ASP A CG  1 
ATOM   2537  O  OD1 . ASP A 1  332 ? 61.322  82.760  125.419 1.00 24.71 ? 332  ASP A OD1 1 
ATOM   2538  O  OD2 . ASP A 1  332 ? 59.799  81.281  125.309 1.00 33.58 ? 332  ASP A OD2 1 
ATOM   2539  N  N   . ASP A 1  333 ? 62.040  84.192  121.875 1.00 16.97 ? 333  ASP A N   1 
ATOM   2540  C  CA  . ASP A 1  333 ? 62.440  85.619  121.747 1.00 17.08 ? 333  ASP A CA  1 
ATOM   2541  C  C   . ASP A 1  333 ? 61.487  86.492  120.936 1.00 17.93 ? 333  ASP A C   1 
ATOM   2542  O  O   . ASP A 1  333 ? 61.215  87.618  121.348 1.00 19.33 ? 333  ASP A O   1 
ATOM   2543  C  CB  . ASP A 1  333 ? 63.880  85.786  121.237 1.00 16.78 ? 333  ASP A CB  1 
ATOM   2544  C  CG  . ASP A 1  333 ? 64.932  85.284  122.229 1.00 15.27 ? 333  ASP A CG  1 
ATOM   2545  O  OD1 . ASP A 1  333 ? 66.000  84.835  121.763 1.00 28.65 ? 333  ASP A OD1 1 
ATOM   2546  O  OD2 . ASP A 1  333 ? 64.767  85.204  123.466 1.00 27.90 ? 333  ASP A OD2 1 
ATOM   2547  N  N   . MET A 1  334 ? 60.989  85.975  119.805 1.00 17.47 ? 334  MET A N   1 
ATOM   2548  C  CA  . MET A 1  334 ? 60.060  86.700  118.930 1.00 17.24 ? 334  MET A CA  1 
ATOM   2549  C  C   . MET A 1  334 ? 58.744  87.037  119.641 1.00 17.18 ? 334  MET A C   1 
ATOM   2550  O  O   . MET A 1  334 ? 58.354  88.223  119.681 1.00 16.07 ? 334  MET A O   1 
ATOM   2551  C  CB  . MET A 1  334 ? 59.799  85.933  117.620 1.00 17.28 ? 334  MET A CB  1 
ATOM   2552  C  CG  . MET A 1  334 ? 60.605  86.400  116.383 1.00 21.73 ? 334  MET A CG  1 
ATOM   2553  S  SD  . MET A 1  334 ? 60.756  88.219  115.996 1.00 25.72 ? 334  MET A SD  1 
ATOM   2554  C  CE  . MET A 1  334 ? 59.078  88.578  115.485 1.00 23.42 ? 334  MET A CE  1 
ATOM   2555  N  N   . MET A 1  335 ? 58.172  86.027  120.330 1.00 17.84 ? 335  MET A N   1 
ATOM   2556  C  CA  . MET A 1  335 ? 56.989  86.184  121.192 1.00 18.34 ? 335  MET A CA  1 
ATOM   2557  C  C   . MET A 1  335 ? 57.155  87.205  122.363 1.00 19.04 ? 335  MET A C   1 
ATOM   2558  O  O   . MET A 1  335 ? 56.268  88.056  122.584 1.00 19.09 ? 335  MET A O   1 
ATOM   2559  C  CB  . MET A 1  335 ? 56.508  84.835  121.701 1.00 18.38 ? 335  MET A CB  1 
ATOM   2560  C  CG  . MET A 1  335 ? 55.069  84.826  122.199 1.00 24.55 ? 335  MET A CG  1 
ATOM   2561  S  SD  . MET A 1  335 ? 53.874  84.491  120.882 1.00 36.48 ? 335  MET A SD  1 
ATOM   2562  C  CE  . MET A 1  335 ? 53.317  86.098  120.774 1.00 11.68 ? 335  MET A CE  1 
ATOM   2563  N  N   . PHE A 1  336 ? 58.273  87.098  123.095 1.00 18.70 ? 336  PHE A N   1 
ATOM   2564  C  CA  . PHE A 1  336 ? 58.630  88.020  124.154 1.00 17.85 ? 336  PHE A CA  1 
ATOM   2565  C  C   . PHE A 1  336 ? 58.657  89.482  123.647 1.00 18.04 ? 336  PHE A C   1 
ATOM   2566  O  O   . PHE A 1  336 ? 57.969  90.346  124.218 1.00 18.57 ? 336  PHE A O   1 
ATOM   2567  C  CB  . PHE A 1  336 ? 59.965  87.600  124.812 1.00 18.39 ? 336  PHE A CB  1 
ATOM   2568  C  CG  . PHE A 1  336 ? 60.483  88.590  125.864 1.00 22.10 ? 336  PHE A CG  1 
ATOM   2569  C  CD1 . PHE A 1  336 ? 59.878  88.662  127.155 1.00 18.28 ? 336  PHE A CD1 1 
ATOM   2570  C  CD2 . PHE A 1  336 ? 61.513  89.508  125.536 1.00 27.46 ? 336  PHE A CD2 1 
ATOM   2571  C  CE1 . PHE A 1  336 ? 60.271  89.666  128.105 1.00 19.29 ? 336  PHE A CE1 1 
ATOM   2572  C  CE2 . PHE A 1  336 ? 61.941  90.521  126.480 1.00 25.61 ? 336  PHE A CE2 1 
ATOM   2573  C  CZ  . PHE A 1  336 ? 61.324  90.586  127.775 1.00 20.37 ? 336  PHE A CZ  1 
ATOM   2574  N  N   . VAL A 1  337 ? 59.322  89.711  122.513 1.00 17.81 ? 337  VAL A N   1 
ATOM   2575  C  CA  . VAL A 1  337 ? 59.430  91.052  121.927 1.00 17.88 ? 337  VAL A CA  1 
ATOM   2576  C  C   . VAL A 1  337 ? 58.091  91.545  121.334 1.00 17.59 ? 337  VAL A C   1 
ATOM   2577  O  O   . VAL A 1  337 ? 57.683  92.698  121.589 1.00 18.17 ? 337  VAL A O   1 
ATOM   2578  C  CB  . VAL A 1  337 ? 60.668  91.245  120.974 1.00 18.03 ? 337  VAL A CB  1 
ATOM   2579  C  CG1 . VAL A 1  337 ? 60.858  92.737  120.626 1.00 25.45 ? 337  VAL A CG1 1 
ATOM   2580  C  CG2 . VAL A 1  337 ? 61.961  90.804  121.647 1.00 21.92 ? 337  VAL A CG2 1 
ATOM   2581  N  N   . LEU A 1  338 ? 57.362  90.648  120.670 1.00 17.04 ? 338  LEU A N   1 
ATOM   2582  C  CA  . LEU A 1  338 ? 56.023  90.960  120.170 1.00 17.10 ? 338  LEU A CA  1 
ATOM   2583  C  C   . LEU A 1  338 ? 55.048  91.419  121.272 1.00 17.30 ? 338  LEU A C   1 
ATOM   2584  O  O   . LEU A 1  338 ? 54.556  92.574  121.218 1.00 17.87 ? 338  LEU A O   1 
ATOM   2585  C  CB  . LEU A 1  338 ? 55.435  89.832  119.312 1.00 16.86 ? 338  LEU A CB  1 
ATOM   2586  C  CG  . LEU A 1  338 ? 53.983  90.052  118.868 1.00 23.06 ? 338  LEU A CG  1 
ATOM   2587  C  CD1 . LEU A 1  338 ? 53.772  91.301  117.948 1.00 6.30  ? 338  LEU A CD1 1 
ATOM   2588  C  CD2 . LEU A 1  338 ? 53.414  88.819  118.301 1.00 6.18  ? 338  LEU A CD2 1 
ATOM   2589  N  N   . GLN A 1  339 ? 55.000  90.632  122.348 1.00 16.76 ? 339  GLN A N   1 
ATOM   2590  C  CA  . GLN A 1  339 ? 54.087  90.864  123.458 1.00 16.89 ? 339  GLN A CA  1 
ATOM   2591  C  C   . GLN A 1  339 ? 54.440  92.074  124.300 1.00 16.69 ? 339  GLN A C   1 
ATOM   2592  O  O   . GLN A 1  339 ? 53.543  92.839  124.659 1.00 16.49 ? 339  GLN A O   1 
ATOM   2593  C  CB  . GLN A 1  339 ? 53.963  89.645  124.317 1.00 16.55 ? 339  GLN A CB  1 
ATOM   2594  C  CG  . GLN A 1  339 ? 53.124  88.569  123.675 1.00 19.53 ? 339  GLN A CG  1 
ATOM   2595  C  CD  . GLN A 1  339 ? 52.849  87.440  124.611 1.00 15.14 ? 339  GLN A CD  1 
ATOM   2596  O  OE1 . GLN A 1  339 ? 53.780  86.804  125.119 1.00 17.14 ? 339  GLN A OE1 1 
ATOM   2597  N  NE2 . GLN A 1  339 ? 51.582  87.118  124.779 1.00 13.20 ? 339  GLN A NE2 1 
ATOM   2598  N  N   . GLY A 1  340 ? 55.753  92.284  124.501 1.00 16.78 ? 340  GLY A N   1 
ATOM   2599  C  CA  . GLY A 1  340 ? 56.323  93.472  125.122 1.00 16.39 ? 340  GLY A CA  1 
ATOM   2600  C  C   . GLY A 1  340 ? 55.935  94.772  124.436 1.00 17.18 ? 340  GLY A C   1 
ATOM   2601  O  O   . GLY A 1  340 ? 55.640  95.747  125.126 1.00 18.45 ? 340  GLY A O   1 
ATOM   2602  N  N   . GLN A 1  341 ? 55.894  94.761  123.094 1.00 16.64 ? 341  GLN A N   1 
ATOM   2603  C  CA  . GLN A 1  341 ? 55.386  95.880  122.272 1.00 15.71 ? 341  GLN A CA  1 
ATOM   2604  C  C   . GLN A 1  341 ? 53.882  96.179  122.404 1.00 15.65 ? 341  GLN A C   1 
ATOM   2605  O  O   . GLN A 1  341 ? 53.493  97.355  122.485 1.00 14.87 ? 341  GLN A O   1 
ATOM   2606  C  CB  . GLN A 1  341 ? 55.808  95.731  120.801 1.00 15.29 ? 341  GLN A CB  1 
ATOM   2607  C  CG  . GLN A 1  341 ? 57.353  95.929  120.540 1.00 9.44  ? 341  GLN A CG  1 
ATOM   2608  C  CD  . GLN A 1  341 ? 57.919  97.241  121.125 1.00 26.93 ? 341  GLN A CD  1 
ATOM   2609  O  OE1 . GLN A 1  341 ? 58.796  97.216  121.999 1.00 24.10 ? 341  GLN A OE1 1 
ATOM   2610  N  NE2 . GLN A 1  341 ? 57.369  98.373  120.690 1.00 30.37 ? 341  GLN A NE2 1 
ATOM   2611  N  N   . TRP A 1  342 ? 53.057  95.118  122.476 1.00 16.20 ? 342  TRP A N   1 
ATOM   2612  C  CA  . TRP A 1  342 ? 51.630  95.234  122.814 1.00 16.45 ? 342  TRP A CA  1 
ATOM   2613  C  C   . TRP A 1  342 ? 51.412  95.834  124.197 1.00 16.85 ? 342  TRP A C   1 
ATOM   2614  O  O   . TRP A 1  342 ? 50.662  96.822  124.322 1.00 17.84 ? 342  TRP A O   1 
ATOM   2615  C  CB  . TRP A 1  342 ? 50.915  93.879  122.728 1.00 16.54 ? 342  TRP A CB  1 
ATOM   2616  C  CG  . TRP A 1  342 ? 50.701  93.318  121.347 1.00 22.93 ? 342  TRP A CG  1 
ATOM   2617  C  CD1 . TRP A 1  342 ? 50.644  94.004  120.154 1.00 21.84 ? 342  TRP A CD1 1 
ATOM   2618  C  CD2 . TRP A 1  342 ? 50.430  91.951  121.030 1.00 23.67 ? 342  TRP A CD2 1 
ATOM   2619  N  NE1 . TRP A 1  342 ? 50.385  93.138  119.119 1.00 20.27 ? 342  TRP A NE1 1 
ATOM   2620  C  CE2 . TRP A 1  342 ? 50.343  91.858  119.606 1.00 22.10 ? 342  TRP A CE2 1 
ATOM   2621  C  CE3 . TRP A 1  342 ? 50.326  90.761  121.800 1.00 18.16 ? 342  TRP A CE3 1 
ATOM   2622  C  CZ2 . TRP A 1  342 ? 50.025  90.639  118.935 1.00 19.66 ? 342  TRP A CZ2 1 
ATOM   2623  C  CZ3 . TRP A 1  342 ? 50.085  89.524  121.125 1.00 19.81 ? 342  TRP A CZ3 1 
ATOM   2624  C  CH2 . TRP A 1  342 ? 49.897  89.493  119.706 1.00 22.16 ? 342  TRP A CH2 1 
ATOM   2625  N  N   . MET A 1  343 ? 52.178  95.328  125.181 1.00 16.27 ? 343  MET A N   1 
ATOM   2626  C  CA  . MET A 1  343 ? 52.154  95.799  126.574 1.00 15.93 ? 343  MET A CA  1 
ATOM   2627  C  C   . MET A 1  343 ? 52.657  97.230  126.734 1.00 15.95 ? 343  MET A C   1 
ATOM   2628  O  O   . MET A 1  343 ? 51.983  98.036  127.381 1.00 15.98 ? 343  MET A O   1 
ATOM   2629  C  CB  . MET A 1  343 ? 52.899  94.843  127.513 1.00 15.47 ? 343  MET A CB  1 
ATOM   2630  C  CG  . MET A 1  343 ? 52.283  93.434  127.757 1.00 16.11 ? 343  MET A CG  1 
ATOM   2631  S  SD  . MET A 1  343 ? 50.536  93.421  128.098 1.00 21.58 ? 343  MET A SD  1 
ATOM   2632  C  CE  . MET A 1  343 ? 49.870  92.989  126.385 1.00 15.73 ? 343  MET A CE  1 
ATOM   2633  N  N   . ARG A 1  344 ? 53.734  97.566  126.010 1.00 16.34 ? 344  ARG A N   1 
ATOM   2634  C  CA  . ARG A 1  344 ? 54.278  98.935  125.937 1.00 16.73 ? 344  ARG A CA  1 
ATOM   2635  C  C   . ARG A 1  344 ? 53.275  99.949  125.393 1.00 16.99 ? 344  ARG A C   1 
ATOM   2636  O  O   . ARG A 1  344 ? 53.002  100.936 126.062 1.00 17.87 ? 344  ARG A O   1 
ATOM   2637  C  CB  . ARG A 1  344 ? 55.578  98.975  125.141 1.00 17.12 ? 344  ARG A CB  1 
ATOM   2638  C  CG  . ARG A 1  344 ? 56.545  100.088 125.566 1.00 13.61 ? 344  ARG A CG  1 
ATOM   2639  C  CD  . ARG A 1  344 ? 57.648  100.434 124.551 1.00 16.96 ? 344  ARG A CD  1 
ATOM   2640  N  NE  . ARG A 1  344 ? 57.230  100.406 123.134 1.00 23.63 ? 344  ARG A NE  1 
ATOM   2641  C  CZ  . ARG A 1  344 ? 56.598  101.385 122.466 1.00 22.09 ? 344  ARG A CZ  1 
ATOM   2642  N  NH1 . ARG A 1  344 ? 56.144  102.474 123.076 1.00 12.14 ? 344  ARG A NH1 1 
ATOM   2643  N  NH2 . ARG A 1  344 ? 56.368  101.234 121.164 1.00 16.24 ? 344  ARG A NH2 1 
ATOM   2644  N  N   . LEU A 1  345 ? 52.576  99.574  124.320 1.00 17.00 ? 345  LEU A N   1 
ATOM   2645  C  CA  . LEU A 1  345 ? 51.579  100.429 123.698 1.00 16.72 ? 345  LEU A CA  1 
ATOM   2646  C  C   . LEU A 1  345 ? 50.293  100.628 124.529 1.00 17.21 ? 345  LEU A C   1 
ATOM   2647  O  O   . LEU A 1  345 ? 49.898  101.785 124.737 1.00 17.24 ? 345  LEU A O   1 
ATOM   2648  C  CB  . LEU A 1  345 ? 51.290  100.000 122.260 1.00 16.07 ? 345  LEU A CB  1 
ATOM   2649  C  CG  . LEU A 1  345 ? 52.276  100.279 121.106 1.00 15.70 ? 345  LEU A CG  1 
ATOM   2650  C  CD1 . LEU A 1  345 ? 51.571  99.886  119.824 1.00 19.53 ? 345  LEU A CD1 1 
ATOM   2651  C  CD2 . LEU A 1  345 ? 52.817  101.768 120.976 1.00 16.44 ? 345  LEU A CD2 1 
ATOM   2652  N  N   . CYS A 1  346 ? 49.824  99.540  125.172 1.00 17.38 ? 346  CYS A N   1 
ATOM   2653  C  CA  . CYS A 1  346 ? 48.701  99.526  126.146 1.00 17.77 ? 346  CYS A CA  1 
ATOM   2654  C  C   . CYS A 1  346 ? 48.891  100.501 127.317 1.00 17.79 ? 346  CYS A C   1 
ATOM   2655  O  O   . CYS A 1  346 ? 47.988  101.297 127.609 1.00 17.20 ? 346  CYS A O   1 
ATOM   2656  C  CB  . CYS A 1  346 ? 48.488  98.110  126.716 1.00 18.08 ? 346  CYS A CB  1 
ATOM   2657  S  SG  . CYS A 1  346 ? 47.591  96.932  125.668 1.00 21.30 ? 346  CYS A SG  1 
ATOM   2658  N  N   . THR A 1  347 ? 50.117  100.530 127.859 1.00 17.95 ? 347  THR A N   1 
ATOM   2659  C  CA  . THR A 1  347 ? 50.436  101.185 129.139 1.00 18.16 ? 347  THR A CA  1 
ATOM   2660  C  C   . THR A 1  347 ? 51.083  102.569 128.953 1.00 19.13 ? 347  THR A C   1 
ATOM   2661  O  O   . THR A 1  347 ? 50.883  103.458 129.792 1.00 18.69 ? 347  THR A O   1 
ATOM   2662  C  CB  . THR A 1  347 ? 51.378  100.304 130.010 1.00 17.87 ? 347  THR A CB  1 
ATOM   2663  O  OG1 . THR A 1  347 ? 52.537  99.939  129.247 1.00 12.80 ? 347  THR A OG1 1 
ATOM   2664  C  CG2 . THR A 1  347 ? 50.721  98.949  130.410 1.00 21.87 ? 347  THR A CG2 1 
ATOM   2665  N  N   . SER A 1  348 ? 51.932  102.704 127.917 1.00 20.43 ? 348  SER A N   1 
ATOM   2666  C  CA  . SER A 1  348 ? 52.936  103.793 127.816 1.00 21.58 ? 348  SER A CA  1 
ATOM   2667  C  C   . SER A 1  348 ? 53.343  104.213 126.379 1.00 22.10 ? 348  SER A C   1 
ATOM   2668  O  O   . SER A 1  348 ? 54.518  104.605 126.128 1.00 22.43 ? 348  SER A O   1 
ATOM   2669  C  CB  . SER A 1  348 ? 54.160  103.463 128.680 1.00 21.65 ? 348  SER A CB  1 
ATOM   2670  O  OG  . SER A 1  348 ? 54.585  102.149 128.439 1.00 18.59 ? 348  SER A OG  1 
ATOM   2671  N  N   . ALA A 1  349 ? 52.353  104.211 125.471 1.00 22.18 ? 349  ALA A N   1 
ATOM   2672  C  CA  . ALA A 1  349 ? 52.450  104.857 124.144 1.00 22.37 ? 349  ALA A CA  1 
ATOM   2673  C  C   . ALA A 1  349 ? 52.675  106.339 124.293 1.00 22.88 ? 349  ALA A C   1 
ATOM   2674  O  O   . ALA A 1  349 ? 52.024  106.988 125.129 1.00 23.81 ? 349  ALA A O   1 
ATOM   2675  C  CB  . ALA A 1  349 ? 51.208  104.600 123.310 1.00 22.25 ? 349  ALA A CB  1 
ATOM   2676  N  N   . THR A 1  350 ? 53.797  106.769 123.730 1.00 22.34 ? 350  THR A N   1 
ATOM   2677  C  CA  . THR A 1  350 ? 54.153  108.182 123.605 1.00 22.28 ? 350  THR A CA  1 
ATOM   2678  C  C   . THR A 1  350 ? 53.713  108.770 122.255 1.00 21.79 ? 350  THR A C   1 
ATOM   2679  O  O   . THR A 1  350 ? 53.434  108.019 121.300 1.00 21.81 ? 350  THR A O   1 
ATOM   2680  C  CB  . THR A 1  350 ? 55.680  108.408 123.875 1.00 22.50 ? 350  THR A CB  1 
ATOM   2681  O  OG1 . THR A 1  350 ? 56.461  107.386 123.239 1.00 25.97 ? 350  THR A OG1 1 
ATOM   2682  C  CG2 . THR A 1  350 ? 56.012  108.254 125.357 1.00 28.21 ? 350  THR A CG2 1 
ATOM   2683  N  N   . GLU A 1  351 ? 53.814  110.097 122.156 1.00 20.67 ? 351  GLU A N   1 
ATOM   2684  C  CA  . GLU A 1  351 ? 53.134  110.925 121.166 1.00 20.29 ? 351  GLU A CA  1 
ATOM   2685  C  C   . GLU A 1  351 ? 53.789  110.893 119.780 1.00 20.32 ? 351  GLU A C   1 
ATOM   2686  O  O   . GLU A 1  351 ? 53.077  110.846 118.757 1.00 20.84 ? 351  GLU A O   1 
ATOM   2687  C  CB  . GLU A 1  351 ? 53.058  112.365 121.688 1.00 19.76 ? 351  GLU A CB  1 
ATOM   2688  C  CG  . GLU A 1  351 ? 51.767  113.106 121.404 1.00 26.86 ? 351  GLU A CG  1 
ATOM   2689  C  CD  . GLU A 1  351 ? 50.573  112.556 122.161 1.00 29.85 ? 351  GLU A CD  1 
ATOM   2690  O  OE1 . GLU A 1  351 ? 50.527  112.647 123.414 1.00 32.47 ? 351  GLU A OE1 1 
ATOM   2691  O  OE2 . GLU A 1  351 ? 49.714  111.964 121.491 1.00 29.62 ? 351  GLU A OE2 1 
ATOM   2692  N  N   . SER A 1  352 ? 55.123  111.031 119.762 1.00 19.68 ? 352  SER A N   1 
ATOM   2693  C  CA  . SER A 1  352 ? 55.958  110.978 118.559 1.00 19.66 ? 352  SER A CA  1 
ATOM   2694  C  C   . SER A 1  352 ? 55.723  109.717 117.688 1.00 20.43 ? 352  SER A C   1 
ATOM   2695  O  O   . SER A 1  352 ? 55.478  109.853 116.472 1.00 20.95 ? 352  SER A O   1 
ATOM   2696  C  CB  . SER A 1  352 ? 57.416  111.060 118.960 1.00 19.12 ? 352  SER A CB  1 
ATOM   2697  O  OG  . SER A 1  352 ? 58.126  111.903 118.101 1.00 28.95 ? 352  SER A OG  1 
ATOM   2698  N  N   . GLU A 1  353 ? 55.646  108.541 118.344 1.00 19.81 ? 353  GLU A N   1 
ATOM   2699  C  CA  . GLU A 1  353 ? 55.461  107.255 117.668 1.00 19.98 ? 353  GLU A CA  1 
ATOM   2700  C  C   . GLU A 1  353 ? 54.040  107.092 117.118 1.00 20.25 ? 353  GLU A C   1 
ATOM   2701  O  O   . GLU A 1  353 ? 53.858  106.479 116.058 1.00 20.47 ? 353  GLU A O   1 
ATOM   2702  C  CB  . GLU A 1  353 ? 55.909  106.057 118.552 1.00 19.88 ? 353  GLU A CB  1 
ATOM   2703  C  CG  . GLU A 1  353 ? 54.927  105.605 119.648 1.00 21.01 ? 353  GLU A CG  1 
ATOM   2704  C  CD  . GLU A 1  353 ? 55.512  104.661 120.691 1.00 29.14 ? 353  GLU A CD  1 
ATOM   2705  O  OE1 . GLU A 1  353 ? 55.031  104.702 121.851 1.00 22.90 ? 353  GLU A OE1 1 
ATOM   2706  O  OE2 . GLU A 1  353 ? 56.351  103.793 120.347 1.00 36.32 ? 353  GLU A OE2 1 
ATOM   2707  N  N   . VAL A 1  354 ? 53.078  107.749 117.784 1.00 20.42 ? 354  VAL A N   1 
ATOM   2708  C  CA  . VAL A 1  354 ? 51.660  107.745 117.398 1.00 20.47 ? 354  VAL A CA  1 
ATOM   2709  C  C   . VAL A 1  354 ? 51.458  108.538 116.106 1.00 20.53 ? 354  VAL A C   1 
ATOM   2710  O  O   . VAL A 1  354 ? 50.928  107.968 115.147 1.00 20.93 ? 354  VAL A O   1 
ATOM   2711  C  CB  . VAL A 1  354 ? 50.683  108.147 118.580 1.00 20.23 ? 354  VAL A CB  1 
ATOM   2712  C  CG1 . VAL A 1  354 ? 49.222  108.239 118.108 1.00 21.40 ? 354  VAL A CG1 1 
ATOM   2713  C  CG2 . VAL A 1  354 ? 50.733  107.098 119.673 1.00 24.77 ? 354  VAL A CG2 1 
ATOM   2714  N  N   . LEU A 1  355 ? 52.070  109.734 116.042 1.00 20.18 ? 355  LEU A N   1 
ATOM   2715  C  CA  . LEU A 1  355 ? 52.258  110.530 114.807 1.00 20.30 ? 355  LEU A CA  1 
ATOM   2716  C  C   . LEU A 1  355 ? 52.876  109.750 113.620 1.00 19.71 ? 355  LEU A C   1 
ATOM   2717  O  O   . LEU A 1  355 ? 52.275  109.737 112.531 1.00 20.47 ? 355  LEU A O   1 
ATOM   2718  C  CB  . LEU A 1  355 ? 53.039  111.835 115.105 1.00 20.76 ? 355  LEU A CB  1 
ATOM   2719  C  CG  . LEU A 1  355 ? 53.312  112.952 114.066 1.00 23.70 ? 355  LEU A CG  1 
ATOM   2720  C  CD1 . LEU A 1  355 ? 52.093  113.808 113.742 1.00 27.59 ? 355  LEU A CD1 1 
ATOM   2721  C  CD2 . LEU A 1  355 ? 54.436  113.846 114.560 1.00 26.06 ? 355  LEU A CD2 1 
ATOM   2722  N  N   . ARG A 1  356 ? 53.909  108.939 113.898 1.00 18.27 ? 356  ARG A N   1 
ATOM   2723  C  CA  . ARG A 1  356 ? 54.497  108.036 112.899 1.00 17.22 ? 356  ARG A CA  1 
ATOM   2724  C  C   . ARG A 1  356 ? 53.511  106.966 112.363 1.00 17.47 ? 356  ARG A C   1 
ATOM   2725  O  O   . ARG A 1  356 ? 53.327  106.854 111.120 1.00 17.76 ? 356  ARG A O   1 
ATOM   2726  C  CB  . ARG A 1  356 ? 55.820  107.433 113.368 1.00 16.63 ? 356  ARG A CB  1 
ATOM   2727  C  CG  . ARG A 1  356 ? 56.410  106.437 112.351 1.00 20.65 ? 356  ARG A CG  1 
ATOM   2728  C  CD  . ARG A 1  356 ? 57.635  105.785 112.762 1.00 19.54 ? 356  ARG A CD  1 
ATOM   2729  N  NE  . ARG A 1  356 ? 57.346  104.527 113.457 1.00 31.83 ? 356  ARG A NE  1 
ATOM   2730  C  CZ  . ARG A 1  356 ? 57.539  104.307 114.757 1.00 27.59 ? 356  ARG A CZ  1 
ATOM   2731  N  NH1 . ARG A 1  356 ? 57.987  105.281 115.555 1.00 18.24 ? 356  ARG A NH1 1 
ATOM   2732  N  NH2 . ARG A 1  356 ? 57.349  103.079 115.245 1.00 28.32 ? 356  ARG A NH2 1 
ATOM   2733  N  N   . GLY A 1  357 ? 52.854  106.262 113.298 1.00 16.69 ? 357  GLY A N   1 
ATOM   2734  C  CA  . GLY A 1  357 ? 51.711  105.400 113.037 1.00 16.36 ? 357  GLY A CA  1 
ATOM   2735  C  C   . GLY A 1  357 ? 50.572  106.023 112.247 1.00 17.48 ? 357  GLY A C   1 
ATOM   2736  O  O   . GLY A 1  357 ? 50.085  105.387 111.300 1.00 17.83 ? 357  GLY A O   1 
ATOM   2737  N  N   . LYS A 1  358 ? 50.224  107.287 112.572 1.00 17.91 ? 358  LYS A N   1 
ATOM   2738  C  CA  . LYS A 1  358 ? 49.193  108.070 111.857 1.00 17.83 ? 358  LYS A CA  1 
ATOM   2739  C  C   . LYS A 1  358 ? 49.600  108.325 110.381 1.00 17.71 ? 358  LYS A C   1 
ATOM   2740  O  O   . LYS A 1  358 ? 48.842  107.969 109.460 1.00 17.71 ? 358  LYS A O   1 
ATOM   2741  C  CB  . LYS A 1  358 ? 48.920  109.422 112.547 1.00 17.81 ? 358  LYS A CB  1 
ATOM   2742  C  CG  . LYS A 1  358 ? 48.290  109.386 113.954 1.00 24.30 ? 358  LYS A CG  1 
ATOM   2743  C  CD  . LYS A 1  358 ? 47.393  110.597 114.187 1.00 24.19 ? 358  LYS A CD  1 
ATOM   2744  C  CE  . LYS A 1  358 ? 48.105  111.853 114.700 1.00 24.11 ? 358  LYS A CE  1 
ATOM   2745  N  NZ  . LYS A 1  358 ? 47.094  112.922 114.929 1.00 24.03 ? 358  LYS A NZ  1 
ATOM   2746  N  N   . ASN A 1  359 ? 50.808  108.890 110.195 1.00 16.92 ? 359  ASN A N   1 
ATOM   2747  C  CA  . ASN A 1  359 ? 51.418  109.163 108.888 1.00 16.85 ? 359  ASN A CA  1 
ATOM   2748  C  C   . ASN A 1  359 ? 51.564  107.942 107.970 1.00 17.86 ? 359  ASN A C   1 
ATOM   2749  O  O   . ASN A 1  359 ? 51.193  108.005 106.799 1.00 18.24 ? 359  ASN A O   1 
ATOM   2750  C  CB  . ASN A 1  359 ? 52.788  109.858 109.081 1.00 15.98 ? 359  ASN A CB  1 
ATOM   2751  C  CG  . ASN A 1  359 ? 52.674  111.305 109.588 1.00 12.68 ? 359  ASN A CG  1 
ATOM   2752  O  OD1 . ASN A 1  359 ? 53.653  111.865 110.097 1.00 6.44  ? 359  ASN A OD1 1 
ATOM   2753  N  ND2 . ASN A 1  359 ? 51.483  111.903 109.480 1.00 6.01  ? 359  ASN A ND2 1 
ATOM   2754  N  N   . LEU A 1  360 ? 51.988  106.816 108.555 1.00 18.60 ? 360  LEU A N   1 
ATOM   2755  C  CA  . LEU A 1  360 ? 52.064  105.518 107.869 1.00 19.17 ? 360  LEU A CA  1 
ATOM   2756  C  C   . LEU A 1  360 ? 50.718  105.016 107.336 1.00 20.02 ? 360  LEU A C   1 
ATOM   2757  O  O   . LEU A 1  360 ? 50.644  104.627 106.167 1.00 21.03 ? 360  LEU A O   1 
ATOM   2758  C  CB  . LEU A 1  360 ? 52.714  104.467 108.756 1.00 18.70 ? 360  LEU A CB  1 
ATOM   2759  C  CG  . LEU A 1  360 ? 54.239  104.368 108.912 1.00 21.59 ? 360  LEU A CG  1 
ATOM   2760  C  CD1 . LEU A 1  360 ? 54.573  103.461 110.137 1.00 15.03 ? 360  LEU A CD1 1 
ATOM   2761  C  CD2 . LEU A 1  360 ? 54.924  103.804 107.663 1.00 23.57 ? 360  LEU A CD2 1 
ATOM   2762  N  N   . LEU A 1  361 ? 49.650  105.298 108.089 1.00 19.45 ? 361  LEU A N   1 
ATOM   2763  C  CA  . LEU A 1  361 ? 48.279  104.977 107.704 1.00 19.29 ? 361  LEU A CA  1 
ATOM   2764  C  C   . LEU A 1  361 ? 47.752  105.874 106.590 1.00 18.95 ? 361  LEU A C   1 
ATOM   2765  O  O   . LEU A 1  361 ? 47.224  105.361 105.593 1.00 19.84 ? 361  LEU A O   1 
ATOM   2766  C  CB  . LEU A 1  361 ? 47.351  104.979 108.940 1.00 19.56 ? 361  LEU A CB  1 
ATOM   2767  C  CG  . LEU A 1  361 ? 46.021  104.224 109.025 1.00 31.76 ? 361  LEU A CG  1 
ATOM   2768  C  CD1 . LEU A 1  361 ? 46.088  102.704 108.694 1.00 38.12 ? 361  LEU A CD1 1 
ATOM   2769  C  CD2 . LEU A 1  361 ? 45.452  104.426 110.416 1.00 30.18 ? 361  LEU A CD2 1 
ATOM   2770  N  N   . ARG A 1  362 ? 47.939  107.192 106.744 1.00 17.93 ? 362  ARG A N   1 
ATOM   2771  C  CA  . ARG A 1  362 ? 47.689  108.201 105.695 1.00 17.48 ? 362  ARG A CA  1 
ATOM   2772  C  C   . ARG A 1  362 ? 48.367  107.872 104.339 1.00 17.17 ? 362  ARG A C   1 
ATOM   2773  O  O   . ARG A 1  362 ? 47.691  107.875 103.305 1.00 17.93 ? 362  ARG A O   1 
ATOM   2774  C  CB  . ARG A 1  362 ? 48.128  109.592 106.157 1.00 17.52 ? 362  ARG A CB  1 
ATOM   2775  C  CG  . ARG A 1  362 ? 47.360  110.189 107.311 1.00 16.03 ? 362  ARG A CG  1 
ATOM   2776  C  CD  . ARG A 1  362 ? 48.010  111.459 107.818 1.00 20.88 ? 362  ARG A CD  1 
ATOM   2777  N  NE  . ARG A 1  362 ? 47.120  112.271 108.656 1.00 7.42  ? 362  ARG A NE  1 
ATOM   2778  C  CZ  . ARG A 1  362 ? 47.452  112.820 109.829 1.00 9.25  ? 362  ARG A CZ  1 
ATOM   2779  N  NH1 . ARG A 1  362 ? 48.628  112.566 110.397 1.00 2.00  ? 362  ARG A NH1 1 
ATOM   2780  N  NH2 . ARG A 1  362 ? 46.582  113.623 110.454 1.00 12.55 ? 362  ARG A NH2 1 
ATOM   2781  N  N   . ASN A 1  363 ? 49.662  107.520 104.381 1.00 16.34 ? 363  ASN A N   1 
ATOM   2782  C  CA  . ASN A 1  363 ? 50.426  107.033 103.221 1.00 16.43 ? 363  ASN A CA  1 
ATOM   2783  C  C   . ASN A 1  363 ? 49.950  105.712 102.644 1.00 17.31 ? 363  ASN A C   1 
ATOM   2784  O  O   . ASN A 1  363 ? 49.724  105.648 101.443 1.00 17.62 ? 363  ASN A O   1 
ATOM   2785  C  CB  . ASN A 1  363 ? 51.933  106.994 103.500 1.00 16.05 ? 363  ASN A CB  1 
ATOM   2786  C  CG  . ASN A 1  363 ? 52.581  108.365 103.385 1.00 24.79 ? 363  ASN A CG  1 
ATOM   2787  O  OD1 . ASN A 1  363 ? 52.972  108.788 102.298 1.00 25.95 ? 363  ASN A OD1 1 
ATOM   2788  N  ND2 . ASN A 1  363 ? 52.643  109.087 104.497 1.00 23.36 ? 363  ASN A ND2 1 
ATOM   2789  N  N   . ALA A 1  364 ? 49.662  104.729 103.519 1.00 17.50 ? 364  ALA A N   1 
ATOM   2790  C  CA  . ALA A 1  364 ? 49.089  103.424 103.139 1.00 17.68 ? 364  ALA A CA  1 
ATOM   2791  C  C   . ALA A 1  364 ? 47.764  103.518 102.422 1.00 19.34 ? 364  ALA A C   1 
ATOM   2792  O  O   . ALA A 1  364 ? 47.613  102.899 101.366 1.00 19.60 ? 364  ALA A O   1 
ATOM   2793  C  CB  . ALA A 1  364 ? 48.979  102.484 104.337 1.00 17.05 ? 364  ALA A CB  1 
ATOM   2794  N  N   . LEU A 1  365 ? 46.888  104.413 102.904 1.00 20.80 ? 365  LEU A N   1 
ATOM   2795  C  CA  . LEU A 1  365 ? 45.531  104.570 102.379 1.00 22.32 ? 365  LEU A CA  1 
ATOM   2796  C  C   . LEU A 1  365 ? 45.507  105.192 100.987 1.00 23.38 ? 365  LEU A C   1 
ATOM   2797  O  O   . LEU A 1  365 ? 44.698  104.785 100.134 1.00 24.06 ? 365  LEU A O   1 
ATOM   2798  C  CB  . LEU A 1  365 ? 44.652  105.375 103.354 1.00 22.76 ? 365  LEU A CB  1 
ATOM   2799  C  CG  . LEU A 1  365 ? 43.130  105.481 103.116 1.00 26.03 ? 365  LEU A CG  1 
ATOM   2800  C  CD1 . LEU A 1  365 ? 42.349  104.159 103.398 1.00 33.16 ? 365  LEU A CD1 1 
ATOM   2801  C  CD2 . LEU A 1  365 ? 42.609  106.590 103.957 1.00 26.83 ? 365  LEU A CD2 1 
ATOM   2802  N  N   . VAL A 1  366 ? 46.344  106.214 100.801 1.00 23.30 ? 366  VAL A N   1 
ATOM   2803  C  CA  . VAL A 1  366 ? 46.427  106.967 99.554  1.00 23.48 ? 366  VAL A CA  1 
ATOM   2804  C  C   . VAL A 1  366 ? 47.191  106.148 98.493  1.00 23.14 ? 366  VAL A C   1 
ATOM   2805  O  O   . VAL A 1  366 ? 46.779  106.125 97.326  1.00 23.46 ? 366  VAL A O   1 
ATOM   2806  C  CB  . VAL A 1  366 ? 46.996  108.435 99.792  1.00 23.60 ? 366  VAL A CB  1 
ATOM   2807  C  CG1 . VAL A 1  366 ? 47.227  109.176 98.484  1.00 28.09 ? 366  VAL A CG1 1 
ATOM   2808  C  CG2 . VAL A 1  366 ? 46.011  109.260 100.666 1.00 20.21 ? 366  VAL A CG2 1 
ATOM   2809  N  N   . SER A 1  367 ? 48.254  105.454 98.926  1.00 22.74 ? 367  SER A N   1 
ATOM   2810  C  CA  . SER A 1  367 ? 49.027  104.532 98.087  1.00 22.63 ? 367  SER A CA  1 
ATOM   2811  C  C   . SER A 1  367 ? 48.220  103.335 97.587  1.00 22.43 ? 367  SER A C   1 
ATOM   2812  O  O   . SER A 1  367 ? 48.343  102.970 96.419  1.00 22.28 ? 367  SER A O   1 
ATOM   2813  C  CB  . SER A 1  367 ? 50.306  104.071 98.786  1.00 22.81 ? 367  SER A CB  1 
ATOM   2814  O  OG  . SER A 1  367 ? 51.274  103.642 97.850  1.00 38.44 ? 367  SER A OG  1 
ATOM   2815  N  N   . HIS A 1  368 ? 47.367  102.778 98.461  1.00 22.50 ? 368  HIS A N   1 
ATOM   2816  C  CA  . HIS A 1  368 ? 46.443  101.702 98.115  1.00 22.27 ? 368  HIS A CA  1 
ATOM   2817  C  C   . HIS A 1  368 ? 45.409  102.147 97.068  1.00 22.81 ? 368  HIS A C   1 
ATOM   2818  O  O   . HIS A 1  368 ? 45.347  101.537 95.989  1.00 23.13 ? 368  HIS A O   1 
ATOM   2819  C  CB  . HIS A 1  368 ? 45.769  101.116 99.364  1.00 22.00 ? 368  HIS A CB  1 
ATOM   2820  C  CG  . HIS A 1  368 ? 44.894  99.937  99.082  1.00 18.05 ? 368  HIS A CG  1 
ATOM   2821  N  ND1 . HIS A 1  368 ? 43.522  100.037 99.016  1.00 27.03 ? 368  HIS A ND1 1 
ATOM   2822  C  CD2 . HIS A 1  368 ? 45.195  98.667  98.727  1.00 18.80 ? 368  HIS A CD2 1 
ATOM   2823  C  CE1 . HIS A 1  368 ? 43.008  98.858  98.711  1.00 19.31 ? 368  HIS A CE1 1 
ATOM   2824  N  NE2 . HIS A 1  368 ? 44.004  98.015  98.508  1.00 20.03 ? 368  HIS A NE2 1 
ATOM   2825  N  N   . LEU A 1  369 ? 44.769  103.305 97.300  1.00 22.30 ? 369  LEU A N   1 
ATOM   2826  C  CA  . LEU A 1  369 ? 43.665  103.774 96.466  1.00 22.22 ? 369  LEU A CA  1 
ATOM   2827  C  C   . LEU A 1  369 ? 44.151  104.533 95.219  1.00 22.42 ? 369  LEU A C   1 
ATOM   2828  O  O   . LEU A 1  369 ? 43.852  105.723 95.007  1.00 22.22 ? 369  LEU A O   1 
ATOM   2829  C  CB  . LEU A 1  369 ? 42.595  104.525 97.294  1.00 22.56 ? 369  LEU A CB  1 
ATOM   2830  C  CG  . LEU A 1  369 ? 41.762  103.854 98.405  1.00 26.01 ? 369  LEU A CG  1 
ATOM   2831  C  CD1 . LEU A 1  369 ? 40.654  104.791 98.838  1.00 20.45 ? 369  LEU A CD1 1 
ATOM   2832  C  CD2 . LEU A 1  369 ? 41.182  102.485 98.035  1.00 27.35 ? 369  LEU A CD2 1 
ATOM   2833  N  N   . ASP A 1  370 ? 44.834  103.775 94.359  1.00 23.08 ? 370  ASP A N   1 
ATOM   2834  C  CA  . ASP A 1  370 ? 45.650  104.291 93.269  1.00 23.59 ? 370  ASP A CA  1 
ATOM   2835  C  C   . ASP A 1  370 ? 45.619  103.301 92.106  1.00 23.10 ? 370  ASP A C   1 
ATOM   2836  O  O   . ASP A 1  370 ? 46.410  102.350 92.052  1.00 23.82 ? 370  ASP A O   1 
ATOM   2837  C  CB  . ASP A 1  370 ? 47.089  104.573 93.763  1.00 24.45 ? 370  ASP A CB  1 
ATOM   2838  C  CG  . ASP A 1  370 ? 47.949  105.320 92.736  1.00 34.57 ? 370  ASP A CG  1 
ATOM   2839  O  OD1 . ASP A 1  370 ? 49.190  105.182 92.829  1.00 39.23 ? 370  ASP A OD1 1 
ATOM   2840  O  OD2 . ASP A 1  370 ? 47.495  106.067 91.833  1.00 30.92 ? 370  ASP A OD2 1 
ATOM   2841  N  N   . GLY A 1  371 ? 44.775  103.620 91.126  1.00 22.15 ? 371  GLY A N   1 
ATOM   2842  C  CA  . GLY A 1  371 ? 44.297  102.669 90.137  1.00 21.06 ? 371  GLY A CA  1 
ATOM   2843  C  C   . GLY A 1  371 ? 42.799  102.484 90.225  1.00 20.48 ? 371  GLY A C   1 
ATOM   2844  O  O   . GLY A 1  371 ? 42.214  102.600 91.318  1.00 20.33 ? 371  GLY A O   1 
ATOM   2845  N  N   . THR A 1  372 ? 42.194  102.175 89.070  1.00 20.00 ? 372  THR A N   1 
ATOM   2846  C  CA  . THR A 1  372 ? 40.756  101.844 88.940  1.00 19.33 ? 372  THR A CA  1 
ATOM   2847  C  C   . THR A 1  372 ? 40.327  100.616 89.750  1.00 19.08 ? 372  THR A C   1 
ATOM   2848  O  O   . THR A 1  372 ? 39.283  100.647 90.385  1.00 19.18 ? 372  THR A O   1 
ATOM   2849  C  CB  . THR A 1  372 ? 40.299  101.684 87.451  1.00 19.05 ? 372  THR A CB  1 
ATOM   2850  O  OG1 . THR A 1  372 ? 40.928  100.545 86.843  1.00 11.86 ? 372  THR A OG1 1 
ATOM   2851  C  CG2 . THR A 1  372 ? 40.689  102.889 86.573  1.00 8.80  ? 372  THR A CG2 1 
ATOM   2852  N  N   . THR A 1  373 ? 41.198  99.610  89.794  1.00 18.96 ? 373  THR A N   1 
ATOM   2853  C  CA  . THR A 1  373 ? 40.968  98.334  90.474  1.00 19.08 ? 373  THR A CA  1 
ATOM   2854  C  C   . THR A 1  373 ? 40.849  98.399  92.010  1.00 19.74 ? 373  THR A C   1 
ATOM   2855  O  O   . THR A 1  373 ? 39.796  97.940  92.498  1.00 19.67 ? 373  THR A O   1 
ATOM   2856  C  CB  . THR A 1  373 ? 41.927  97.211  89.945  1.00 18.77 ? 373  THR A CB  1 
ATOM   2857  O  OG1 . THR A 1  373 ? 41.782  97.117  88.529  1.00 16.87 ? 373  THR A OG1 1 
ATOM   2858  C  CG2 . THR A 1  373 ? 41.517  95.800  90.437  1.00 10.59 ? 373  THR A CG2 1 
ATOM   2859  N  N   . PRO A 1  374 ? 41.843  98.966  92.767  1.00 20.19 ? 374  PRO A N   1 
ATOM   2860  C  CA  . PRO A 1  374 ? 41.690  99.106  94.234  1.00 19.71 ? 374  PRO A CA  1 
ATOM   2861  C  C   . PRO A 1  374 ? 40.574  100.049 94.681  1.00 19.30 ? 374  PRO A C   1 
ATOM   2862  O  O   . PRO A 1  374 ? 39.906  99.704  95.673  1.00 20.00 ? 374  PRO A O   1 
ATOM   2863  C  CB  . PRO A 1  374 ? 43.048  99.650  94.675  1.00 19.68 ? 374  PRO A CB  1 
ATOM   2864  C  CG  . PRO A 1  374 ? 43.974  99.261  93.590  1.00 22.67 ? 374  PRO A CG  1 
ATOM   2865  C  CD  . PRO A 1  374 ? 43.189  99.472  92.368  1.00 20.07 ? 374  PRO A CD  1 
ATOM   2866  N  N   . VAL A 1  375 ? 40.281  101.087 93.877  1.00 18.41 ? 375  VAL A N   1 
ATOM   2867  C  CA  . VAL A 1  375 ? 39.187  102.042 94.128  1.00 17.57 ? 375  VAL A CA  1 
ATOM   2868  C  C   . VAL A 1  375 ? 37.806  101.384 93.923  1.00 17.55 ? 375  VAL A C   1 
ATOM   2869  O  O   . VAL A 1  375 ? 36.912  101.560 94.772  1.00 17.92 ? 375  VAL A O   1 
ATOM   2870  C  CB  . VAL A 1  375 ? 39.370  103.402 93.326  1.00 17.27 ? 375  VAL A CB  1 
ATOM   2871  C  CG1 . VAL A 1  375 ? 38.123  104.314 93.426  1.00 10.05 ? 375  VAL A CG1 1 
ATOM   2872  C  CG2 . VAL A 1  375 ? 40.568  104.202 93.881  1.00 19.05 ? 375  VAL A CG2 1 
ATOM   2873  N  N   . CYS A 1  376 ? 37.660  100.634 92.819  1.00 17.26 ? 376  CYS A N   1 
ATOM   2874  C  CA  . CYS A 1  376 ? 36.484  99.792  92.536  1.00 17.48 ? 376  CYS A CA  1 
ATOM   2875  C  C   . CYS A 1  376 ? 36.170  98.767  93.627  1.00 17.81 ? 376  CYS A C   1 
ATOM   2876  O  O   . CYS A 1  376 ? 35.007  98.627  94.014  1.00 17.92 ? 376  CYS A O   1 
ATOM   2877  C  CB  . CYS A 1  376 ? 36.604  99.096  91.175  1.00 17.22 ? 376  CYS A CB  1 
ATOM   2878  S  SG  . CYS A 1  376 ? 35.075  98.366  90.571  1.00 17.02 ? 376  CYS A SG  1 
ATOM   2879  N  N   . GLU A 1  377 ? 37.218  98.085  94.113  1.00 18.47 ? 377  GLU A N   1 
ATOM   2880  C  CA  . GLU A 1  377 ? 37.156  97.123  95.222  1.00 18.87 ? 377  GLU A CA  1 
ATOM   2881  C  C   . GLU A 1  377 ? 36.687  97.797  96.506  1.00 19.58 ? 377  GLU A C   1 
ATOM   2882  O  O   . GLU A 1  377 ? 35.765  97.290  97.173  1.00 19.96 ? 377  GLU A O   1 
ATOM   2883  C  CB  . GLU A 1  377 ? 38.509  96.419  95.411  1.00 18.82 ? 377  GLU A CB  1 
ATOM   2884  C  CG  . GLU A 1  377 ? 38.593  95.462  96.604  1.00 30.88 ? 377  GLU A CG  1 
ATOM   2885  C  CD  . GLU A 1  377 ? 39.941  94.778  96.736  1.00 40.24 ? 377  GLU A CD  1 
ATOM   2886  O  OE1 . GLU A 1  377 ? 40.926  95.465  97.098  1.00 45.99 ? 377  GLU A OE1 1 
ATOM   2887  O  OE2 . GLU A 1  377 ? 39.999  93.537  96.561  1.00 42.92 ? 377  GLU A OE2 1 
ATOM   2888  N  N   . ASP A 1  378 ? 37.259  98.979  96.769  1.00 19.44 ? 378  ASP A N   1 
ATOM   2889  C  CA  . ASP A 1  378 ? 36.850  99.851  97.860  1.00 18.86 ? 378  ASP A CA  1 
ATOM   2890  C  C   . ASP A 1  378 ? 35.402  100.329 97.808  1.00 18.13 ? 378  ASP A C   1 
ATOM   2891  O  O   . ASP A 1  378 ? 34.762  100.339 98.842  1.00 18.58 ? 378  ASP A O   1 
ATOM   2892  C  CB  . ASP A 1  378 ? 37.812  101.020 98.028  1.00 18.62 ? 378  ASP A CB  1 
ATOM   2893  C  CG  . ASP A 1  378 ? 37.665  101.711 99.366  1.00 15.31 ? 378  ASP A CG  1 
ATOM   2894  O  OD1 . ASP A 1  378 ? 37.711  101.033 100.419 1.00 22.98 ? 378  ASP A OD1 1 
ATOM   2895  O  OD2 . ASP A 1  378 ? 37.455  102.932 99.461  1.00 19.61 ? 378  ASP A OD2 1 
ATOM   2896  N  N   . ILE A 1  379 ? 34.899  100.700 96.624  1.00 16.94 ? 379  ILE A N   1 
ATOM   2897  C  CA  . ILE A 1  379 ? 33.461  100.989 96.423  1.00 16.24 ? 379  ILE A CA  1 
ATOM   2898  C  C   . ILE A 1  379 ? 32.582  99.761  96.776  1.00 15.82 ? 379  ILE A C   1 
ATOM   2899  O  O   . ILE A 1  379 ? 31.759  99.846  97.698  1.00 15.64 ? 379  ILE A O   1 
ATOM   2900  C  CB  . ILE A 1  379 ? 33.151  101.553 94.979  1.00 15.97 ? 379  ILE A CB  1 
ATOM   2901  C  CG1 . ILE A 1  379 ? 33.808  102.938 94.776  1.00 12.40 ? 379  ILE A CG1 1 
ATOM   2902  C  CG2 . ILE A 1  379 ? 31.613  101.683 94.759  1.00 10.99 ? 379  ILE A CG2 1 
ATOM   2903  C  CD1 . ILE A 1  379 ? 34.151  103.277 93.302  1.00 7.85  ? 379  ILE A CD1 1 
ATOM   2904  N  N   . GLY A 1  380 ? 32.901  98.613  96.166  1.00 15.43 ? 380  GLY A N   1 
ATOM   2905  C  CA  . GLY A 1  380 ? 32.100  97.402  96.270  1.00 16.10 ? 380  GLY A CA  1 
ATOM   2906  C  C   . GLY A 1  380 ? 32.032  96.851  97.686  1.00 16.51 ? 380  GLY A C   1 
ATOM   2907  O  O   . GLY A 1  380 ? 30.922  96.714  98.224  1.00 15.79 ? 380  GLY A O   1 
ATOM   2908  N  N   . ARG A 1  381 ? 33.206  96.801  98.343  1.00 17.24 ? 381  ARG A N   1 
ATOM   2909  C  CA  . ARG A 1  381 ? 33.349  96.306  99.708  1.00 17.96 ? 381  ARG A CA  1 
ATOM   2910  C  C   . ARG A 1  381 ? 32.750  97.230  100.768 1.00 17.95 ? 381  ARG A C   1 
ATOM   2911  O  O   . ARG A 1  381 ? 32.059  96.743  101.676 1.00 17.95 ? 381  ARG A O   1 
ATOM   2912  C  CB  . ARG A 1  381 ? 34.803  95.967  100.027 1.00 18.72 ? 381  ARG A CB  1 
ATOM   2913  C  CG  . ARG A 1  381 ? 35.002  94.584  100.612 1.00 34.67 ? 381  ARG A CG  1 
ATOM   2914  C  CD  . ARG A 1  381 ? 35.913  94.561  101.827 1.00 44.62 ? 381  ARG A CD  1 
ATOM   2915  N  NE  . ARG A 1  381 ? 37.185  93.872  101.553 1.00 54.08 ? 381  ARG A NE  1 
ATOM   2916  C  CZ  . ARG A 1  381 ? 38.325  94.455  101.141 1.00 60.25 ? 381  ARG A CZ  1 
ATOM   2917  N  NH1 . ARG A 1  381 ? 38.390  95.761  100.860 1.00 58.72 ? 381  ARG A NH1 1 
ATOM   2918  N  NH2 . ARG A 1  381 ? 39.410  93.708  100.973 1.00 59.33 ? 381  ARG A NH2 1 
ATOM   2919  N  N   . SER A 1  382 ? 32.948  98.547  100.598 1.00 18.17 ? 382  SER A N   1 
ATOM   2920  C  CA  . SER A 1  382 ? 32.448  99.579  101.529 1.00 18.60 ? 382  SER A CA  1 
ATOM   2921  C  C   . SER A 1  382 ? 30.932  99.645  101.624 1.00 19.31 ? 382  SER A C   1 
ATOM   2922  O  O   . SER A 1  382 ? 30.404  99.539  102.722 1.00 19.72 ? 382  SER A O   1 
ATOM   2923  C  CB  . SER A 1  382 ? 33.024  100.961 101.230 1.00 18.31 ? 382  SER A CB  1 
ATOM   2924  O  OG  . SER A 1  382 ? 34.434  100.965 101.401 1.00 17.42 ? 382  SER A OG  1 
ATOM   2925  N  N   . LEU A 1  383 ? 30.258  99.606  100.468 1.00 19.67 ? 383  LEU A N   1 
ATOM   2926  C  CA  . LEU A 1  383 ? 28.789  99.553  100.369 1.00 20.21 ? 383  LEU A CA  1 
ATOM   2927  C  C   . LEU A 1  383 ? 28.142  98.297  100.977 1.00 20.81 ? 383  LEU A C   1 
ATOM   2928  O  O   . LEU A 1  383 ? 27.032  98.373  101.523 1.00 20.95 ? 383  LEU A O   1 
ATOM   2929  C  CB  . LEU A 1  383 ? 28.357  99.746  98.916  1.00 20.05 ? 383  LEU A CB  1 
ATOM   2930  C  CG  . LEU A 1  383 ? 27.997  101.179 98.493  1.00 20.04 ? 383  LEU A CG  1 
ATOM   2931  C  CD1 . LEU A 1  383 ? 29.223  102.064 98.193  1.00 13.70 ? 383  LEU A CD1 1 
ATOM   2932  C  CD2 . LEU A 1  383 ? 27.114  101.110 97.288  1.00 17.22 ? 383  LEU A CD2 1 
ATOM   2933  N  N   . LEU A 1  384 ? 28.873  97.177  100.926 1.00 21.26 ? 384  LEU A N   1 
ATOM   2934  C  CA  . LEU A 1  384 ? 28.523  95.945  101.629 1.00 21.64 ? 384  LEU A CA  1 
ATOM   2935  C  C   . LEU A 1  384 ? 28.658  96.058  103.153 1.00 21.96 ? 384  LEU A C   1 
ATOM   2936  O  O   . LEU A 1  384 ? 27.712  95.699  103.878 1.00 22.31 ? 384  LEU A O   1 
ATOM   2937  C  CB  . LEU A 1  384 ? 29.332  94.746  101.089 1.00 21.89 ? 384  LEU A CB  1 
ATOM   2938  C  CG  . LEU A 1  384 ? 29.086  94.179  99.674  1.00 21.26 ? 384  LEU A CG  1 
ATOM   2939  C  CD1 . LEU A 1  384 ? 30.146  93.158  99.369  1.00 26.11 ? 384  LEU A CD1 1 
ATOM   2940  C  CD2 . LEU A 1  384 ? 27.704  93.565  99.467  1.00 17.36 ? 384  LEU A CD2 1 
ATOM   2941  N  N   . THR A 1  385 ? 29.769  96.656  103.615 1.00 21.64 ? 385  THR A N   1 
ATOM   2942  C  CA  . THR A 1  385 ? 30.139  96.669  105.040 1.00 21.74 ? 385  THR A CA  1 
ATOM   2943  C  C   . THR A 1  385 ? 29.586  97.888  105.793 1.00 21.93 ? 385  THR A C   1 
ATOM   2944  O  O   . THR A 1  385 ? 28.887  97.723  106.794 1.00 22.21 ? 385  THR A O   1 
ATOM   2945  C  CB  . THR A 1  385 ? 31.679  96.530  105.261 1.00 21.55 ? 385  THR A CB  1 
ATOM   2946  O  OG1 . THR A 1  385 ? 32.377  97.435  104.401 1.00 26.28 ? 385  THR A OG1 1 
ATOM   2947  C  CG2 . THR A 1  385 ? 32.181  95.165  104.850 1.00 19.27 ? 385  THR A CG2 1 
ATOM   2948  N  N   . TYR A 1  386 ? 29.880  99.086  105.275 1.00 21.94 ? 386  TYR A N   1 
ATOM   2949  C  CA  . TYR A 1  386 ? 29.518  100.386 105.870 1.00 22.17 ? 386  TYR A CA  1 
ATOM   2950  C  C   . TYR A 1  386 ? 28.166  100.924 105.389 1.00 22.59 ? 386  TYR A C   1 
ATOM   2951  O  O   . TYR A 1  386 ? 27.560  101.758 106.077 1.00 22.99 ? 386  TYR A O   1 
ATOM   2952  C  CB  . TYR A 1  386 ? 30.628  101.444 105.610 1.00 22.07 ? 386  TYR A CB  1 
ATOM   2953  C  CG  . TYR A 1  386 ? 32.063  101.003 105.909 1.00 18.44 ? 386  TYR A CG  1 
ATOM   2954  C  CD1 . TYR A 1  386 ? 33.069  101.103 104.915 1.00 19.92 ? 386  TYR A CD1 1 
ATOM   2955  C  CD2 . TYR A 1  386 ? 32.452  100.596 107.220 1.00 24.40 ? 386  TYR A CD2 1 
ATOM   2956  C  CE1 . TYR A 1  386 ? 34.426  100.719 105.190 1.00 27.00 ? 386  TYR A CE1 1 
ATOM   2957  C  CE2 . TYR A 1  386 ? 33.794  100.187 107.506 1.00 24.86 ? 386  TYR A CE2 1 
ATOM   2958  C  CZ  . TYR A 1  386 ? 34.767  100.240 106.482 1.00 28.58 ? 386  TYR A CZ  1 
ATOM   2959  O  OH  . TYR A 1  386 ? 36.054  99.839  106.756 1.00 22.68 ? 386  TYR A OH  1 
ATOM   2960  N  N   . GLY A 1  387 ? 27.778  100.556 104.155 1.00 22.64 ? 387  GLY A N   1 
ATOM   2961  C  CA  . GLY A 1  387 ? 26.590  101.084 103.483 1.00 22.68 ? 387  GLY A CA  1 
ATOM   2962  C  C   . GLY A 1  387 ? 26.808  102.341 102.649 1.00 22.89 ? 387  GLY A C   1 
ATOM   2963  O  O   . GLY A 1  387 ? 25.958  102.656 101.800 1.00 23.30 ? 387  GLY A O   1 
ATOM   2964  N  N   . ARG A 1  388 ? 27.769  103.166 103.085 1.00 22.47 ? 388  ARG A N   1 
ATOM   2965  C  CA  . ARG A 1  388 ? 28.339  104.292 102.315 1.00 22.10 ? 388  ARG A CA  1 
ATOM   2966  C  C   . ARG A 1  388 ? 29.791  104.007 101.878 1.00 21.89 ? 388  ARG A C   1 
ATOM   2967  O  O   . ARG A 1  388 ? 30.411  103.018 102.325 1.00 21.42 ? 388  ARG A O   1 
ATOM   2968  C  CB  . ARG A 1  388 ? 28.266  105.638 103.096 1.00 22.04 ? 388  ARG A CB  1 
ATOM   2969  C  CG  . ARG A 1  388 ? 27.920  105.582 104.608 1.00 27.83 ? 388  ARG A CG  1 
ATOM   2970  C  CD  . ARG A 1  388 ? 29.115  105.670 105.545 1.00 24.94 ? 388  ARG A CD  1 
ATOM   2971  N  NE  . ARG A 1  388 ? 29.217  107.005 106.142 1.00 23.62 ? 388  ARG A NE  1 
ATOM   2972  C  CZ  . ARG A 1  388 ? 29.988  107.365 107.183 1.00 25.48 ? 388  ARG A CZ  1 
ATOM   2973  N  NH1 . ARG A 1  388 ? 30.750  106.501 107.852 1.00 18.80 ? 388  ARG A NH1 1 
ATOM   2974  N  NH2 . ARG A 1  388 ? 29.954  108.621 107.592 1.00 34.81 ? 388  ARG A NH2 1 
ATOM   2975  N  N   . ARG A 1  389 ? 30.262  104.782 100.895 1.00 21.91 ? 389  ARG A N   1 
ATOM   2976  C  CA  . ARG A 1  389 ? 31.685  105.091 100.760 1.00 21.65 ? 389  ARG A CA  1 
ATOM   2977  C  C   . ARG A 1  389 ? 32.074  106.180 101.761 1.00 21.21 ? 389  ARG A C   1 
ATOM   2978  O  O   . ARG A 1  389 ? 31.466  107.266 101.783 1.00 20.94 ? 389  ARG A O   1 
ATOM   2979  C  CB  . ARG A 1  389 ? 32.049  105.464 99.305  1.00 21.70 ? 389  ARG A CB  1 
ATOM   2980  C  CG  . ARG A 1  389 ? 33.540  105.821 99.043  1.00 24.26 ? 389  ARG A CG  1 
ATOM   2981  C  CD  . ARG A 1  389 ? 34.539  104.627 99.033  1.00 19.99 ? 389  ARG A CD  1 
ATOM   2982  N  NE  . ARG A 1  389 ? 35.094  104.447 97.716  1.00 14.89 ? 389  ARG A NE  1 
ATOM   2983  C  CZ  . ARG A 1  389 ? 36.088  105.113 97.165  1.00 15.57 ? 389  ARG A CZ  1 
ATOM   2984  N  NH1 . ARG A 1  389 ? 37.341  104.765 97.444  1.00 9.49  ? 389  ARG A NH1 1 
ATOM   2985  N  NH2 . ARG A 1  389 ? 35.840  105.668 95.996  1.00 13.47 ? 389  ARG A NH2 1 
ATOM   2986  N  N   . ILE A 1  390 ? 32.979  105.803 102.669 1.00 21.04 ? 390  ILE A N   1 
ATOM   2987  C  CA  . ILE A 1  390 ? 33.587  106.715 103.644 1.00 20.95 ? 390  ILE A CA  1 
ATOM   2988  C  C   . ILE A 1  390 ? 34.698  107.502 102.907 1.00 21.34 ? 390  ILE A C   1 
ATOM   2989  O  O   . ILE A 1  390 ? 35.719  106.894 102.544 1.00 21.20 ? 390  ILE A O   1 
ATOM   2990  C  CB  . ILE A 1  390 ? 34.107  105.943 104.951 1.00 20.74 ? 390  ILE A CB  1 
ATOM   2991  C  CG1 . ILE A 1  390 ? 32.938  105.185 105.632 1.00 18.56 ? 390  ILE A CG1 1 
ATOM   2992  C  CG2 . ILE A 1  390 ? 34.814  106.930 105.950 1.00 16.35 ? 390  ILE A CG2 1 
ATOM   2993  C  CD1 . ILE A 1  390 ? 33.297  104.270 106.846 1.00 23.80 ? 390  ILE A CD1 1 
ATOM   2994  N  N   . PRO A 1  391 ? 34.488  108.819 102.647 1.00 22.05 ? 391  PRO A N   1 
ATOM   2995  C  CA  . PRO A 1  391 ? 35.435  109.615 101.837 1.00 22.80 ? 391  PRO A CA  1 
ATOM   2996  C  C   . PRO A 1  391 ? 36.796  109.785 102.527 1.00 23.67 ? 391  PRO A C   1 
ATOM   2997  O  O   . PRO A 1  391 ? 36.868  109.661 103.770 1.00 24.61 ? 391  PRO A O   1 
ATOM   2998  C  CB  . PRO A 1  391 ? 34.735  110.976 101.708 1.00 22.79 ? 391  PRO A CB  1 
ATOM   2999  C  CG  . PRO A 1  391 ? 33.326  110.729 102.125 1.00 22.77 ? 391  PRO A CG  1 
ATOM   3000  C  CD  . PRO A 1  391 ? 33.416  109.689 103.184 1.00 21.98 ? 391  PRO A CD  1 
ATOM   3001  N  N   . LEU A 1  392 ? 37.854  109.987 101.727 1.00 23.07 ? 392  LEU A N   1 
ATOM   3002  C  CA  . LEU A 1  392 ? 39.237  110.143 102.224 1.00 22.49 ? 392  LEU A CA  1 
ATOM   3003  C  C   . LEU A 1  392 ? 39.442  111.222 103.313 1.00 21.51 ? 392  LEU A C   1 
ATOM   3004  O  O   . LEU A 1  392 ? 40.203  110.997 104.272 1.00 21.14 ? 392  LEU A O   1 
ATOM   3005  C  CB  . LEU A 1  392 ? 40.217  110.328 101.059 1.00 22.65 ? 392  LEU A CB  1 
ATOM   3006  C  CG  . LEU A 1  392 ? 40.678  109.031 100.381 1.00 31.95 ? 392  LEU A CG  1 
ATOM   3007  C  CD1 . LEU A 1  392 ? 40.594  109.133 98.878  1.00 26.09 ? 392  LEU A CD1 1 
ATOM   3008  C  CD2 . LEU A 1  392 ? 42.096  108.639 100.796 1.00 36.95 ? 392  LEU A CD2 1 
ATOM   3009  N  N   . ALA A 1  393 ? 38.659  112.307 103.224 1.00 21.25 ? 393  ALA A N   1 
ATOM   3010  C  CA  . ALA A 1  393 ? 38.631  113.386 104.224 1.00 21.28 ? 393  ALA A CA  1 
ATOM   3011  C  C   . ALA A 1  393 ? 38.104  112.941 105.602 1.00 21.37 ? 393  ALA A C   1 
ATOM   3012  O  O   . ALA A 1  393 ? 38.628  113.405 106.642 1.00 21.34 ? 393  ALA A O   1 
ATOM   3013  C  CB  . ALA A 1  393 ? 37.844  114.579 103.700 1.00 21.45 ? 393  ALA A CB  1 
ATOM   3014  N  N   . GLU A 1  394 ? 37.081  112.052 105.593 1.00 20.94 ? 394  GLU A N   1 
ATOM   3015  C  CA  . GLU A 1  394 ? 36.547  111.397 106.796 1.00 20.27 ? 394  GLU A CA  1 
ATOM   3016  C  C   . GLU A 1  394 ? 37.563  110.498 107.504 1.00 20.21 ? 394  GLU A C   1 
ATOM   3017  O  O   . GLU A 1  394 ? 37.793  110.696 108.709 1.00 20.50 ? 394  GLU A O   1 
ATOM   3018  C  CB  . GLU A 1  394 ? 35.222  110.663 106.533 1.00 20.13 ? 394  GLU A CB  1 
ATOM   3019  C  CG  . GLU A 1  394 ? 34.391  110.440 107.798 1.00 21.58 ? 394  GLU A CG  1 
ATOM   3020  C  CD  . GLU A 1  394 ? 33.003  109.879 107.534 1.00 27.64 ? 394  GLU A CD  1 
ATOM   3021  O  OE1 . GLU A 1  394 ? 32.730  108.751 108.008 1.00 24.48 ? 394  GLU A OE1 1 
ATOM   3022  O  OE2 . GLU A 1  394 ? 32.135  110.629 107.015 1.00 23.96 ? 394  GLU A OE2 1 
ATOM   3023  N  N   . TRP A 1  395 ? 38.206  109.579 106.751 1.00 19.76 ? 395  TRP A N   1 
ATOM   3024  C  CA  . TRP A 1  395 ? 39.356  108.790 107.238 1.00 19.60 ? 395  TRP A CA  1 
ATOM   3025  C  C   . TRP A 1  395 ? 40.470  109.630 107.850 1.00 19.96 ? 395  TRP A C   1 
ATOM   3026  O  O   . TRP A 1  395 ? 40.887  109.346 108.976 1.00 20.06 ? 395  TRP A O   1 
ATOM   3027  C  CB  . TRP A 1  395 ? 39.934  107.848 106.169 1.00 19.37 ? 395  TRP A CB  1 
ATOM   3028  C  CG  . TRP A 1  395 ? 39.031  106.682 105.727 1.00 11.13 ? 395  TRP A CG  1 
ATOM   3029  C  CD1 . TRP A 1  395 ? 38.754  106.327 104.439 1.00 13.91 ? 395  TRP A CD1 1 
ATOM   3030  C  CD2 . TRP A 1  395 ? 38.426  105.665 106.553 1.00 13.85 ? 395  TRP A CD2 1 
ATOM   3031  N  NE1 . TRP A 1  395 ? 37.917  105.234 104.403 1.00 13.93 ? 395  TRP A NE1 1 
ATOM   3032  C  CE2 . TRP A 1  395 ? 37.718  104.780 105.677 1.00 14.55 ? 395  TRP A CE2 1 
ATOM   3033  C  CE3 . TRP A 1  395 ? 38.372  105.420 107.952 1.00 17.37 ? 395  TRP A CE3 1 
ATOM   3034  C  CZ2 . TRP A 1  395 ? 36.910  103.703 106.149 1.00 12.32 ? 395  TRP A CZ2 1 
ATOM   3035  C  CZ3 . TRP A 1  395 ? 37.532  104.360 108.437 1.00 20.85 ? 395  TRP A CZ3 1 
ATOM   3036  C  CH2 . TRP A 1  395 ? 36.835  103.505 107.525 1.00 20.50 ? 395  TRP A CH2 1 
ATOM   3037  N  N   . GLU A 1  396 ? 40.759  110.776 107.210 1.00 20.17 ? 396  GLU A N   1 
ATOM   3038  C  CA  . GLU A 1  396 ? 41.719  111.761 107.699 1.00 20.08 ? 396  GLU A CA  1 
ATOM   3039  C  C   . GLU A 1  396 ? 41.369  112.340 109.070 1.00 20.10 ? 396  GLU A C   1 
ATOM   3040  O  O   . GLU A 1  396 ? 42.217  112.319 109.972 1.00 20.38 ? 396  GLU A O   1 
ATOM   3041  C  CB  . GLU A 1  396 ? 41.988  112.861 106.653 1.00 20.03 ? 396  GLU A CB  1 
ATOM   3042  C  CG  . GLU A 1  396 ? 42.919  114.024 107.081 1.00 20.69 ? 396  GLU A CG  1 
ATOM   3043  C  CD  . GLU A 1  396 ? 44.232  113.602 107.746 1.00 21.34 ? 396  GLU A CD  1 
ATOM   3044  O  OE1 . GLU A 1  396 ? 44.801  112.531 107.406 1.00 30.36 ? 396  GLU A OE1 1 
ATOM   3045  O  OE2 . GLU A 1  396 ? 44.699  114.350 108.616 1.00 18.60 ? 396  GLU A OE2 1 
ATOM   3046  N  N   . SER A 1  397 ? 40.140  112.856 109.190 1.00 19.64 ? 397  SER A N   1 
ATOM   3047  C  CA  . SER A 1  397 ? 39.520  113.265 110.457 1.00 19.35 ? 397  SER A CA  1 
ATOM   3048  C  C   . SER A 1  397 ? 39.552  112.180 111.561 1.00 19.09 ? 397  SER A C   1 
ATOM   3049  O  O   . SER A 1  397 ? 39.907  112.484 112.701 1.00 19.52 ? 397  SER A O   1 
ATOM   3050  C  CB  . SER A 1  397 ? 38.095  113.775 110.204 1.00 19.12 ? 397  SER A CB  1 
ATOM   3051  O  OG  . SER A 1  397 ? 37.397  113.980 111.417 1.00 26.33 ? 397  SER A OG  1 
ATOM   3052  N  N   . ARG A 1  398 ? 39.271  110.929 111.186 1.00 18.78 ? 398  ARG A N   1 
ATOM   3053  C  CA  . ARG A 1  398 ? 39.382  109.767 112.083 1.00 18.57 ? 398  ARG A CA  1 
ATOM   3054  C  C   . ARG A 1  398 ? 40.829  109.416 112.502 1.00 18.75 ? 398  ARG A C   1 
ATOM   3055  O  O   . ARG A 1  398 ? 41.058  109.006 113.646 1.00 19.08 ? 398  ARG A O   1 
ATOM   3056  C  CB  . ARG A 1  398 ? 38.695  108.559 111.474 1.00 18.38 ? 398  ARG A CB  1 
ATOM   3057  C  CG  . ARG A 1  398 ? 37.273  108.374 111.926 1.00 26.30 ? 398  ARG A CG  1 
ATOM   3058  C  CD  . ARG A 1  398 ? 36.363  107.739 110.884 1.00 27.96 ? 398  ARG A CD  1 
ATOM   3059  N  NE  . ARG A 1  398 ? 34.992  108.245 111.017 1.00 38.56 ? 398  ARG A NE  1 
ATOM   3060  C  CZ  . ARG A 1  398 ? 33.984  107.637 111.656 1.00 40.62 ? 398  ARG A CZ  1 
ATOM   3061  N  NH1 . ARG A 1  398 ? 34.056  106.356 112.028 1.00 48.40 ? 398  ARG A NH1 1 
ATOM   3062  N  NH2 . ARG A 1  398 ? 32.835  108.282 111.792 1.00 41.44 ? 398  ARG A NH2 1 
ATOM   3063  N  N   . ILE A 1  399 ? 41.787  109.603 111.590 1.00 18.63 ? 399  ILE A N   1 
ATOM   3064  C  CA  . ILE A 1  399 ? 43.212  109.365 111.876 1.00 18.95 ? 399  ILE A CA  1 
ATOM   3065  C  C   . ILE A 1  399 ? 43.770  110.484 112.776 1.00 19.66 ? 399  ILE A C   1 
ATOM   3066  O  O   . ILE A 1  399 ? 44.210  110.170 113.887 1.00 19.81 ? 399  ILE A O   1 
ATOM   3067  C  CB  . ILE A 1  399 ? 44.061  109.104 110.562 1.00 18.79 ? 399  ILE A CB  1 
ATOM   3068  C  CG1 . ILE A 1  399 ? 43.673  107.758 109.929 1.00 19.03 ? 399  ILE A CG1 1 
ATOM   3069  C  CG2 . ILE A 1  399 ? 45.590  109.082 110.854 1.00 15.61 ? 399  ILE A CG2 1 
ATOM   3070  C  CD1 . ILE A 1  399 ? 43.768  107.714 108.383 1.00 26.14 ? 399  ILE A CD1 1 
ATOM   3071  N  N   . ALA A 1  400 ? 43.492  111.752 112.399 1.00 19.58 ? 400  ALA A N   1 
ATOM   3072  C  CA  . ALA A 1  400 ? 43.909  112.973 113.128 1.00 20.11 ? 400  ALA A CA  1 
ATOM   3073  C  C   . ALA A 1  400 ? 43.527  113.009 114.613 1.00 20.55 ? 400  ALA A C   1 
ATOM   3074  O  O   . ALA A 1  400 ? 44.371  113.368 115.451 1.00 20.87 ? 400  ALA A O   1 
ATOM   3075  C  CB  . ALA A 1  400 ? 43.408  114.243 112.416 1.00 19.63 ? 400  ALA A CB  1 
ATOM   3076  N  N   . GLU A 1  401 ? 42.329  112.476 114.917 1.00 20.17 ? 401  GLU A N   1 
ATOM   3077  C  CA  . GLU A 1  401 ? 41.765  112.332 116.278 1.00 19.85 ? 401  GLU A CA  1 
ATOM   3078  C  C   . GLU A 1  401 ? 42.622  111.493 117.219 1.00 19.22 ? 401  GLU A C   1 
ATOM   3079  O  O   . GLU A 1  401 ? 42.655  111.762 118.425 1.00 19.08 ? 401  GLU A O   1 
ATOM   3080  C  CB  . GLU A 1  401 ? 40.374  111.699 116.199 1.00 20.13 ? 401  GLU A CB  1 
ATOM   3081  C  CG  . GLU A 1  401 ? 39.219  112.675 116.388 1.00 29.66 ? 401  GLU A CG  1 
ATOM   3082  C  CD  . GLU A 1  401 ? 37.960  112.282 115.613 1.00 39.30 ? 401  GLU A CD  1 
ATOM   3083  O  OE1 . GLU A 1  401 ? 37.581  111.076 115.600 1.00 32.92 ? 401  GLU A OE1 1 
ATOM   3084  O  OE2 . GLU A 1  401 ? 37.305  113.201 115.064 1.00 44.02 ? 401  GLU A OE2 1 
ATOM   3085  N  N   . VAL A 1  402 ? 43.266  110.457 116.660 1.00 18.83 ? 402  VAL A N   1 
ATOM   3086  C  CA  . VAL A 1  402 ? 44.107  109.512 117.404 1.00 18.33 ? 402  VAL A CA  1 
ATOM   3087  C  C   . VAL A 1  402 ? 45.372  110.220 117.904 1.00 17.89 ? 402  VAL A C   1 
ATOM   3088  O  O   . VAL A 1  402 ? 45.985  110.987 117.164 1.00 17.70 ? 402  VAL A O   1 
ATOM   3089  C  CB  . VAL A 1  402 ? 44.438  108.219 116.596 1.00 18.25 ? 402  VAL A CB  1 
ATOM   3090  C  CG1 . VAL A 1  402 ? 45.161  107.207 117.457 1.00 19.56 ? 402  VAL A CG1 1 
ATOM   3091  C  CG2 . VAL A 1  402 ? 43.158  107.569 116.016 1.00 17.77 ? 402  VAL A CG2 1 
ATOM   3092  N  N   . ASP A 1  403 ? 45.479  110.248 119.228 1.00 17.72 ? 403  ASP A N   1 
ATOM   3093  C  CA  . ASP A 1  403 ? 46.731  110.541 119.919 1.00 17.01 ? 403  ASP A CA  1 
ATOM   3094  C  C   . ASP A 1  403 ? 47.163  109.364 120.848 1.00 15.96 ? 403  ASP A C   1 
ATOM   3095  O  O   . ASP A 1  403 ? 46.624  108.245 120.711 1.00 15.52 ? 403  ASP A O   1 
ATOM   3096  C  CB  . ASP A 1  403 ? 46.676  111.944 120.576 1.00 16.55 ? 403  ASP A CB  1 
ATOM   3097  C  CG  . ASP A 1  403 ? 45.795  112.001 121.816 1.00 30.49 ? 403  ASP A CG  1 
ATOM   3098  O  OD1 . ASP A 1  403 ? 44.888  112.868 121.852 1.00 32.36 ? 403  ASP A OD1 1 
ATOM   3099  O  OD2 . ASP A 1  403 ? 46.111  111.453 122.896 1.00 42.14 ? 403  ASP A OD2 1 
ATOM   3100  N  N   . ALA A 1  404 ? 48.226  109.584 121.638 1.00 15.20 ? 404  ALA A N   1 
ATOM   3101  C  CA  . ALA A 1  404 ? 48.783  108.600 122.567 1.00 15.40 ? 404  ALA A CA  1 
ATOM   3102  C  C   . ALA A 1  404 ? 47.824  108.029 123.607 1.00 16.11 ? 404  ALA A C   1 
ATOM   3103  O  O   . ALA A 1  404 ? 47.852  106.814 123.841 1.00 16.46 ? 404  ALA A O   1 
ATOM   3104  C  CB  . ALA A 1  404 ? 50.036  109.113 123.210 1.00 15.52 ? 404  ALA A CB  1 
ATOM   3105  N  N   . ARG A 1  405 ? 46.919  108.878 124.122 1.00 16.52 ? 405  ARG A N   1 
ATOM   3106  C  CA  . ARG A 1  405 ? 45.849  108.487 125.055 1.00 17.66 ? 405  ARG A CA  1 
ATOM   3107  C  C   . ARG A 1  405 ? 44.842  107.533 124.408 1.00 18.26 ? 405  ARG A C   1 
ATOM   3108  O  O   . ARG A 1  405 ? 44.436  106.544 125.040 1.00 18.43 ? 405  ARG A O   1 
ATOM   3109  C  CB  . ARG A 1  405 ? 45.141  109.729 125.654 1.00 17.98 ? 405  ARG A CB  1 
ATOM   3110  C  CG  . ARG A 1  405 ? 44.327  109.467 126.930 1.00 25.33 ? 405  ARG A CG  1 
ATOM   3111  C  CD  . ARG A 1  405 ? 43.058  110.312 127.044 1.00 37.18 ? 405  ARG A CD  1 
ATOM   3112  N  NE  . ARG A 1  405 ? 42.971  111.010 128.340 1.00 45.05 ? 405  ARG A NE  1 
ATOM   3113  C  CZ  . ARG A 1  405 ? 42.374  110.544 129.453 1.00 47.35 ? 405  ARG A CZ  1 
ATOM   3114  N  NH1 . ARG A 1  405 ? 41.727  109.374 129.478 1.00 41.00 ? 405  ARG A NH1 1 
ATOM   3115  N  NH2 . ARG A 1  405 ? 42.397  111.285 130.551 1.00 47.10 ? 405  ARG A NH2 1 
ATOM   3116  N  N   . VAL A 1  406 ? 44.412  107.894 123.187 1.00 18.52 ? 406  VAL A N   1 
ATOM   3117  C  CA  . VAL A 1  406 ? 43.578  107.064 122.293 1.00 18.49 ? 406  VAL A CA  1 
ATOM   3118  C  C   . VAL A 1  406 ? 44.252  105.719 121.964 1.00 19.19 ? 406  VAL A C   1 
ATOM   3119  O  O   . VAL A 1  406 ? 43.611  104.684 122.101 1.00 18.60 ? 406  VAL A O   1 
ATOM   3120  C  CB  . VAL A 1  406 ? 43.121  107.847 120.999 1.00 18.20 ? 406  VAL A CB  1 
ATOM   3121  C  CG1 . VAL A 1  406 ? 42.183  106.997 120.108 1.00 21.96 ? 406  VAL A CG1 1 
ATOM   3122  C  CG2 . VAL A 1  406 ? 42.391  109.175 121.375 1.00 15.76 ? 406  VAL A CG2 1 
ATOM   3123  N  N   . VAL A 1  407 ? 45.565  105.730 121.665 1.00 20.25 ? 407  VAL A N   1 
ATOM   3124  C  CA  . VAL A 1  407 ? 46.307  104.467 121.419 1.00 20.66 ? 407  VAL A CA  1 
ATOM   3125  C  C   . VAL A 1  407 ? 46.339  103.557 122.664 1.00 21.37 ? 407  VAL A C   1 
ATOM   3126  O  O   . VAL A 1  407 ? 45.866  102.420 122.588 1.00 21.27 ? 407  VAL A O   1 
ATOM   3127  C  CB  . VAL A 1  407 ? 47.685  104.657 120.675 1.00 20.21 ? 407  VAL A CB  1 
ATOM   3128  C  CG1 . VAL A 1  407 ? 48.619  103.410 120.798 1.00 13.54 ? 407  VAL A CG1 1 
ATOM   3129  C  CG2 . VAL A 1  407 ? 47.438  104.903 119.220 1.00 12.49 ? 407  VAL A CG2 1 
ATOM   3130  N  N   . ARG A 1  408 ? 46.588  104.169 123.824 1.00 21.71 ? 408  ARG A N   1 
ATOM   3131  C  CA  . ARG A 1  408 ? 46.694  103.418 125.066 1.00 21.91 ? 408  ARG A CA  1 
ATOM   3132  C  C   . ARG A 1  408 ? 45.400  102.875 125.699 1.00 21.85 ? 408  ARG A C   1 
ATOM   3133  O  O   . ARG A 1  408 ? 45.374  101.697 126.077 1.00 21.87 ? 408  ARG A O   1 
ATOM   3134  C  CB  . ARG A 1  408 ? 47.762  103.964 126.021 1.00 21.98 ? 408  ARG A CB  1 
ATOM   3135  C  CG  . ARG A 1  408 ? 47.439  105.164 126.780 1.00 27.50 ? 408  ARG A CG  1 
ATOM   3136  C  CD  . ARG A 1  408 ? 48.646  105.778 127.441 1.00 23.28 ? 408  ARG A CD  1 
ATOM   3137  N  NE  . ARG A 1  408 ? 48.329  107.154 127.798 1.00 18.25 ? 408  ARG A NE  1 
ATOM   3138  C  CZ  . ARG A 1  408 ? 48.752  108.232 127.159 1.00 23.80 ? 408  ARG A CZ  1 
ATOM   3139  N  NH1 . ARG A 1  408 ? 49.886  108.202 126.466 1.00 26.40 ? 408  ARG A NH1 1 
ATOM   3140  N  NH2 . ARG A 1  408 ? 48.222  109.407 127.476 1.00 22.84 ? 408  ARG A NH2 1 
ATOM   3141  N  N   . GLU A 1  409 ? 44.294  103.605 125.481 1.00 21.48 ? 409  GLU A N   1 
ATOM   3142  C  CA  . GLU A 1  409 ? 42.927  103.162 125.827 1.00 21.31 ? 409  GLU A CA  1 
ATOM   3143  C  C   . GLU A 1  409 ? 42.423  102.058 124.904 1.00 21.12 ? 409  GLU A C   1 
ATOM   3144  O  O   . GLU A 1  409 ? 41.913  101.029 125.380 1.00 21.44 ? 409  GLU A O   1 
ATOM   3145  C  CB  . GLU A 1  409 ? 41.940  104.335 125.816 1.00 21.55 ? 409  GLU A CB  1 
ATOM   3146  C  CG  . GLU A 1  409 ? 41.653  104.925 127.184 1.00 32.17 ? 409  GLU A CG  1 
ATOM   3147  C  CD  . GLU A 1  409 ? 41.038  106.314 127.113 1.00 39.21 ? 409  GLU A CD  1 
ATOM   3148  O  OE1 . GLU A 1  409 ? 41.657  107.260 127.641 1.00 42.11 ? 409  GLU A OE1 1 
ATOM   3149  O  OE2 . GLU A 1  409 ? 39.881  106.444 126.648 1.00 41.26 ? 409  GLU A OE2 1 
ATOM   3150  N  N   . VAL A 1  410 ? 42.593  102.273 123.595 1.00 20.91 ? 410  VAL A N   1 
ATOM   3151  C  CA  . VAL A 1  410 ? 42.103  101.377 122.550 1.00 20.45 ? 410  VAL A CA  1 
ATOM   3152  C  C   . VAL A 1  410 ? 42.886  100.057 122.516 1.00 20.59 ? 410  VAL A C   1 
ATOM   3153  O  O   . VAL A 1  410 ? 42.249  98.997  122.542 1.00 20.74 ? 410  VAL A O   1 
ATOM   3154  C  CB  . VAL A 1  410 ? 41.921  102.113 121.187 1.00 20.15 ? 410  VAL A CB  1 
ATOM   3155  C  CG1 . VAL A 1  410 ? 41.716  101.179 120.028 1.00 16.84 ? 410  VAL A CG1 1 
ATOM   3156  C  CG2 . VAL A 1  410 ? 40.736  103.111 121.275 1.00 24.99 ? 410  VAL A CG2 1 
ATOM   3157  N  N   . CYS A 1  411 ? 44.210  100.130 122.727 1.00 20.33 ? 411  CYS A N   1 
ATOM   3158  C  CA  . CYS A 1  411 ? 45.047  98.930  122.875 1.00 20.94 ? 411  CYS A CA  1 
ATOM   3159  C  C   . CYS A 1  411 ? 44.730  98.097  124.115 1.00 21.31 ? 411  CYS A C   1 
ATOM   3160  O  O   . CYS A 1  411 ? 44.624  96.867  124.012 1.00 21.15 ? 411  CYS A O   1 
ATOM   3161  C  CB  . CYS A 1  411 ? 46.539  99.242  122.791 1.00 20.78 ? 411  CYS A CB  1 
ATOM   3162  S  SG  . CYS A 1  411 ? 47.085  99.546  121.102 1.00 19.41 ? 411  CYS A SG  1 
ATOM   3163  N  N   . SER A 1  412 ? 44.511  98.783  125.247 1.00 21.42 ? 412  SER A N   1 
ATOM   3164  C  CA  . SER A 1  412 ? 44.102  98.158  126.512 1.00 21.45 ? 412  SER A CA  1 
ATOM   3165  C  C   . SER A 1  412 ? 42.807  97.356  126.431 1.00 21.66 ? 412  SER A C   1 
ATOM   3166  O  O   . SER A 1  412 ? 42.856  96.158  126.694 1.00 21.80 ? 412  SER A O   1 
ATOM   3167  C  CB  . SER A 1  412 ? 44.084  99.162  127.657 1.00 21.43 ? 412  SER A CB  1 
ATOM   3168  O  OG  . SER A 1  412 ? 45.406  99.595  127.957 1.00 13.99 ? 412  SER A OG  1 
ATOM   3169  N  N   . LYS A 1  413 ? 41.788  97.941  125.769 1.00 21.74 ? 413  LYS A N   1 
ATOM   3170  C  CA  . LYS A 1  413 ? 40.482  97.297  125.458 1.00 21.79 ? 413  LYS A CA  1 
ATOM   3171  C  C   . LYS A 1  413 ? 40.579  95.916  124.761 1.00 21.62 ? 413  LYS A C   1 
ATOM   3172  O  O   . LYS A 1  413 ? 39.946  94.960  125.218 1.00 21.94 ? 413  LYS A O   1 
ATOM   3173  C  CB  . LYS A 1  413 ? 39.606  98.245  124.628 1.00 21.74 ? 413  LYS A CB  1 
ATOM   3174  C  CG  . LYS A 1  413 ? 38.119  98.121  124.884 1.00 24.94 ? 413  LYS A CG  1 
ATOM   3175  C  CD  . LYS A 1  413 ? 37.327  99.150  124.074 1.00 28.48 ? 413  LYS A CD  1 
ATOM   3176  C  CE  . LYS A 1  413 ? 36.092  98.506  123.453 1.00 32.35 ? 413  LYS A CE  1 
ATOM   3177  N  NZ  . LYS A 1  413 ? 34.960  99.455  123.241 1.00 27.56 ? 413  LYS A NZ  1 
ATOM   3178  N  N   . TYR A 1  414 ? 41.523  95.786  123.817 1.00 21.05 ? 414  TYR A N   1 
ATOM   3179  C  CA  . TYR A 1  414 ? 41.669  94.576  123.002 1.00 20.51 ? 414  TYR A CA  1 
ATOM   3180  C  C   . TYR A 1  414 ? 42.811  93.651  123.379 1.00 20.52 ? 414  TYR A C   1 
ATOM   3181  O  O   . TYR A 1  414 ? 42.641  92.437  123.310 1.00 20.85 ? 414  TYR A O   1 
ATOM   3182  C  CB  . TYR A 1  414 ? 41.650  94.881  121.497 1.00 20.28 ? 414  TYR A CB  1 
ATOM   3183  C  CG  . TYR A 1  414 ? 40.385  95.566  121.052 1.00 22.88 ? 414  TYR A CG  1 
ATOM   3184  C  CD1 . TYR A 1  414 ? 40.331  96.982  120.926 1.00 21.95 ? 414  TYR A CD1 1 
ATOM   3185  C  CD2 . TYR A 1  414 ? 39.192  94.833  120.870 1.00 14.67 ? 414  TYR A CD2 1 
ATOM   3186  C  CE1 . TYR A 1  414 ? 39.092  97.653  120.689 1.00 20.17 ? 414  TYR A CE1 1 
ATOM   3187  C  CE2 . TYR A 1  414 ? 37.940  95.494  120.667 1.00 21.99 ? 414  TYR A CE2 1 
ATOM   3188  C  CZ  . TYR A 1  414 ? 37.909  96.884  120.532 1.00 14.06 ? 414  TYR A CZ  1 
ATOM   3189  O  OH  . TYR A 1  414 ? 36.722  97.494  120.261 1.00 17.23 ? 414  TYR A OH  1 
ATOM   3190  N  N   . PHE A 1  415 ? 43.954  94.219  123.782 1.00 20.18 ? 415  PHE A N   1 
ATOM   3191  C  CA  . PHE A 1  415 ? 45.139  93.438  124.131 1.00 20.21 ? 415  PHE A CA  1 
ATOM   3192  C  C   . PHE A 1  415 ? 45.267  93.080  125.592 1.00 20.11 ? 415  PHE A C   1 
ATOM   3193  O  O   . PHE A 1  415 ? 45.547  91.910  125.898 1.00 20.11 ? 415  PHE A O   1 
ATOM   3194  C  CB  . PHE A 1  415 ? 46.431  94.076  123.616 1.00 20.54 ? 415  PHE A CB  1 
ATOM   3195  C  CG  . PHE A 1  415 ? 46.581  94.037  122.133 1.00 26.07 ? 415  PHE A CG  1 
ATOM   3196  C  CD1 . PHE A 1  415 ? 46.414  95.214  121.376 1.00 25.72 ? 415  PHE A CD1 1 
ATOM   3197  C  CD2 . PHE A 1  415 ? 46.947  92.825  121.467 1.00 25.93 ? 415  PHE A CD2 1 
ATOM   3198  C  CE1 . PHE A 1  415 ? 46.663  95.214  119.968 1.00 31.24 ? 415  PHE A CE1 1 
ATOM   3199  C  CE2 . PHE A 1  415 ? 47.097  92.785  120.057 1.00 22.58 ? 415  PHE A CE2 1 
ATOM   3200  C  CZ  . PHE A 1  415 ? 47.020  93.986  119.313 1.00 22.99 ? 415  PHE A CZ  1 
ATOM   3201  N  N   . TYR A 1  416 ? 45.044  94.065  126.484 1.00 19.80 ? 416  TYR A N   1 
ATOM   3202  C  CA  . TYR A 1  416 ? 45.399  93.943  127.903 1.00 19.69 ? 416  TYR A CA  1 
ATOM   3203  C  C   . TYR A 1  416 ? 44.577  92.920  128.685 1.00 20.71 ? 416  TYR A C   1 
ATOM   3204  O  O   . TYR A 1  416 ? 43.330  93.026  128.769 1.00 21.38 ? 416  TYR A O   1 
ATOM   3205  C  CB  . TYR A 1  416 ? 45.463  95.288  128.624 1.00 19.24 ? 416  TYR A CB  1 
ATOM   3206  C  CG  . TYR A 1  416 ? 46.399  95.268  129.809 1.00 18.82 ? 416  TYR A CG  1 
ATOM   3207  C  CD1 . TYR A 1  416 ? 47.795  95.483  129.637 1.00 16.64 ? 416  TYR A CD1 1 
ATOM   3208  C  CD2 . TYR A 1  416 ? 45.916  94.932  131.109 1.00 20.70 ? 416  TYR A CD2 1 
ATOM   3209  C  CE1 . TYR A 1  416 ? 48.701  95.334  130.739 1.00 21.60 ? 416  TYR A CE1 1 
ATOM   3210  C  CE2 . TYR A 1  416 ? 46.805  94.737  132.195 1.00 21.39 ? 416  TYR A CE2 1 
ATOM   3211  C  CZ  . TYR A 1  416 ? 48.187  94.957  132.009 1.00 21.68 ? 416  TYR A CZ  1 
ATOM   3212  O  OH  . TYR A 1  416 ? 49.036  94.818  133.074 1.00 23.46 ? 416  TYR A OH  1 
ATOM   3213  N  N   . ASP A 1  417 ? 45.299  91.875  129.132 1.00 20.60 ? 417  ASP A N   1 
ATOM   3214  C  CA  . ASP A 1  417 ? 44.807  90.773  129.971 1.00 20.96 ? 417  ASP A CA  1 
ATOM   3215  C  C   . ASP A 1  417 ? 43.698  89.976  129.265 1.00 21.48 ? 417  ASP A C   1 
ATOM   3216  O  O   . ASP A 1  417 ? 42.625  89.719  129.814 1.00 22.29 ? 417  ASP A O   1 
ATOM   3217  C  CB  . ASP A 1  417 ? 44.431  91.301  131.381 1.00 20.92 ? 417  ASP A CB  1 
ATOM   3218  C  CG  . ASP A 1  417 ? 44.232  90.210  132.393 1.00 21.09 ? 417  ASP A CG  1 
ATOM   3219  O  OD1 . ASP A 1  417 ? 45.193  89.501  132.726 1.00 29.02 ? 417  ASP A OD1 1 
ATOM   3220  O  OD2 . ASP A 1  417 ? 43.179  90.096  133.034 1.00 28.54 ? 417  ASP A OD2 1 
ATOM   3221  N  N   . GLN A 1  418 ? 43.934  89.726  127.982 1.00 21.45 ? 418  GLN A N   1 
ATOM   3222  C  CA  . GLN A 1  418 ? 42.974  89.066  127.093 1.00 20.98 ? 418  GLN A CA  1 
ATOM   3223  C  C   . GLN A 1  418 ? 43.534  87.739  126.634 1.00 20.60 ? 418  GLN A C   1 
ATOM   3224  O  O   . GLN A 1  418 ? 44.754  87.573  126.596 1.00 20.59 ? 418  GLN A O   1 
ATOM   3225  C  CB  . GLN A 1  418 ? 42.637  89.966  125.891 1.00 20.79 ? 418  GLN A CB  1 
ATOM   3226  C  CG  . GLN A 1  418 ? 41.916  91.264  126.260 1.00 25.55 ? 418  GLN A CG  1 
ATOM   3227  C  CD  . GLN A 1  418 ? 40.466  91.064  126.631 1.00 30.74 ? 418  GLN A CD  1 
ATOM   3228  O  OE1 . GLN A 1  418 ? 40.133  91.004  127.803 1.00 35.78 ? 418  GLN A OE1 1 
ATOM   3229  N  NE2 . GLN A 1  418 ? 39.597  91.033  125.637 1.00 39.24 ? 418  GLN A NE2 1 
ATOM   3230  N  N   . CYS A 1  419 ? 42.641  86.773  126.387 1.00 20.26 ? 419  CYS A N   1 
ATOM   3231  C  CA  . CYS A 1  419 ? 43.025  85.452  125.897 1.00 20.02 ? 419  CYS A CA  1 
ATOM   3232  C  C   . CYS A 1  419 ? 43.276  85.502  124.384 1.00 19.97 ? 419  CYS A C   1 
ATOM   3233  O  O   . CYS A 1  419 ? 42.330  85.768  123.631 1.00 20.60 ? 419  CYS A O   1 
ATOM   3234  C  CB  . CYS A 1  419 ? 41.996  84.384  126.281 1.00 19.82 ? 419  CYS A CB  1 
ATOM   3235  S  SG  . CYS A 1  419 ? 41.889  84.127  128.059 1.00 22.86 ? 419  CYS A SG  1 
ATOM   3236  N  N   . PRO A 1  420 ? 44.547  85.351  123.938 1.00 19.10 ? 420  PRO A N   1 
ATOM   3237  C  CA  . PRO A 1  420 ? 44.829  85.237  122.493 1.00 18.58 ? 420  PRO A CA  1 
ATOM   3238  C  C   . PRO A 1  420 ? 44.424  83.872  121.912 1.00 18.00 ? 420  PRO A C   1 
ATOM   3239  O  O   . PRO A 1  420 ? 44.179  82.928  122.674 1.00 18.44 ? 420  PRO A O   1 
ATOM   3240  C  CB  . PRO A 1  420 ? 46.341  85.430  122.412 1.00 18.72 ? 420  PRO A CB  1 
ATOM   3241  C  CG  . PRO A 1  420 ? 46.866  84.976  123.731 1.00 21.75 ? 420  PRO A CG  1 
ATOM   3242  C  CD  . PRO A 1  420 ? 45.777  85.123  124.736 1.00 18.39 ? 420  PRO A CD  1 
ATOM   3243  N  N   . ALA A 1  421 ? 44.196  83.850  120.602 1.00 16.88 ? 421  ALA A N   1 
ATOM   3244  C  CA  . ALA A 1  421 ? 44.232  82.650  119.786 1.00 16.42 ? 421  ALA A CA  1 
ATOM   3245  C  C   . ALA A 1  421 ? 45.599  82.529  119.153 1.00 17.06 ? 421  ALA A C   1 
ATOM   3246  O  O   . ALA A 1  421 ? 46.098  83.497  118.585 1.00 16.94 ? 421  ALA A O   1 
ATOM   3247  C  CB  . ALA A 1  421 ? 43.162  82.711  118.730 1.00 15.42 ? 421  ALA A CB  1 
ATOM   3248  N  N   . VAL A 1  422 ? 46.163  81.316  119.215 1.00 18.21 ? 422  VAL A N   1 
ATOM   3249  C  CA  . VAL A 1  422 ? 47.545  80.992  118.760 1.00 18.59 ? 422  VAL A CA  1 
ATOM   3250  C  C   . VAL A 1  422 ? 47.439  79.866  117.718 1.00 19.25 ? 422  VAL A C   1 
ATOM   3251  O  O   . VAL A 1  422 ? 46.694  78.889  117.927 1.00 19.52 ? 422  VAL A O   1 
ATOM   3252  C  CB  . VAL A 1  422 ? 48.481  80.541  119.980 1.00 18.52 ? 422  VAL A CB  1 
ATOM   3253  C  CG1 . VAL A 1  422 ? 49.896  80.110  119.527 1.00 17.34 ? 422  VAL A CG1 1 
ATOM   3254  C  CG2 . VAL A 1  422 ? 48.606  81.621  121.010 1.00 15.81 ? 422  VAL A CG2 1 
ATOM   3255  N  N   . ALA A 1  423 ? 48.111  80.054  116.570 1.00 19.09 ? 423  ALA A N   1 
ATOM   3256  C  CA  . ALA A 1  423 ? 48.365  78.967  115.598 1.00 18.35 ? 423  ALA A CA  1 
ATOM   3257  C  C   . ALA A 1  423 ? 49.847  78.849  115.293 1.00 18.79 ? 423  ALA A C   1 
ATOM   3258  O  O   . ALA A 1  423 ? 50.524  79.874  115.111 1.00 20.01 ? 423  ALA A O   1 
ATOM   3259  C  CB  . ALA A 1  423 ? 47.567  79.187  114.332 1.00 17.70 ? 423  ALA A CB  1 
ATOM   3260  N  N   . GLY A 1  424 ? 50.363  77.624  115.436 1.00 17.99 ? 424  GLY A N   1 
ATOM   3261  C  CA  . GLY A 1  424 ? 51.754  77.261  115.154 1.00 16.96 ? 424  GLY A CA  1 
ATOM   3262  C  C   . GLY A 1  424 ? 51.872  76.076  114.200 1.00 16.89 ? 424  GLY A C   1 
ATOM   3263  O  O   . GLY A 1  424 ? 51.036  75.170  114.233 1.00 17.13 ? 424  GLY A O   1 
ATOM   3264  N  N   . PHE A 1  425 ? 52.709  76.256  113.186 1.00 16.88 ? 425  PHE A N   1 
ATOM   3265  C  CA  . PHE A 1  425 ? 53.033  75.235  112.187 1.00 17.09 ? 425  PHE A CA  1 
ATOM   3266  C  C   . PHE A 1  425 ? 54.550  75.195  111.964 1.00 17.44 ? 425  PHE A C   1 
ATOM   3267  O  O   . PHE A 1  425 ? 55.179  76.244  111.790 1.00 18.18 ? 425  PHE A O   1 
ATOM   3268  C  CB  . PHE A 1  425 ? 52.272  75.534  110.871 1.00 16.70 ? 425  PHE A CB  1 
ATOM   3269  C  CG  . PHE A 1  425 ? 52.413  74.469  109.779 1.00 15.91 ? 425  PHE A CG  1 
ATOM   3270  C  CD1 . PHE A 1  425 ? 52.222  74.845  108.432 1.00 12.71 ? 425  PHE A CD1 1 
ATOM   3271  C  CD2 . PHE A 1  425 ? 52.574  73.084  110.079 1.00 9.88  ? 425  PHE A CD2 1 
ATOM   3272  C  CE1 . PHE A 1  425 ? 52.318  73.903  107.381 1.00 15.80 ? 425  PHE A CE1 1 
ATOM   3273  C  CE2 . PHE A 1  425 ? 52.580  72.110  109.046 1.00 17.70 ? 425  PHE A CE2 1 
ATOM   3274  C  CZ  . PHE A 1  425 ? 52.458  72.522  107.684 1.00 16.83 ? 425  PHE A CZ  1 
ATOM   3275  N  N   . GLY A 1  426 ? 55.134  74.012  112.156 1.00 17.29 ? 426  GLY A N   1 
ATOM   3276  C  CA  . GLY A 1  426 ? 56.514  73.735  111.776 1.00 17.66 ? 426  GLY A CA  1 
ATOM   3277  C  C   . GLY A 1  426 ? 57.421  73.286  112.922 1.00 18.20 ? 426  GLY A C   1 
ATOM   3278  O  O   . GLY A 1  426 ? 56.988  72.434  113.706 1.00 19.26 ? 426  GLY A O   1 
ATOM   3279  N  N   . PRO A 1  427 ? 58.711  73.687  112.928 1.00 17.64 ? 427  PRO A N   1 
ATOM   3280  C  CA  . PRO A 1  427 ? 59.636  73.278  114.012 1.00 17.25 ? 427  PRO A CA  1 
ATOM   3281  C  C   . PRO A 1  427 ? 59.411  74.077  115.317 1.00 18.36 ? 427  PRO A C   1 
ATOM   3282  O  O   . PRO A 1  427 ? 60.155  75.041  115.642 1.00 18.67 ? 427  PRO A O   1 
ATOM   3283  C  CB  . PRO A 1  427 ? 61.028  73.472  113.395 1.00 15.93 ? 427  PRO A CB  1 
ATOM   3284  C  CG  . PRO A 1  427 ? 60.824  74.516  112.337 1.00 12.44 ? 427  PRO A CG  1 
ATOM   3285  C  CD  . PRO A 1  427 ? 59.437  74.362  111.824 1.00 16.74 ? 427  PRO A CD  1 
ATOM   3286  N  N   . ILE A 1  428 ? 58.330  73.708  116.021 1.00 18.20 ? 428  ILE A N   1 
ATOM   3287  C  CA  . ILE A 1  428 ? 57.685  74.600  117.011 1.00 17.91 ? 428  ILE A CA  1 
ATOM   3288  C  C   . ILE A 1  428 ? 57.850  74.172  118.482 1.00 18.94 ? 428  ILE A C   1 
ATOM   3289  O  O   . ILE A 1  428 ? 57.155  74.694  119.354 1.00 19.93 ? 428  ILE A O   1 
ATOM   3290  C  CB  . ILE A 1  428 ? 56.191  74.994  116.613 1.00 17.94 ? 428  ILE A CB  1 
ATOM   3291  C  CG1 . ILE A 1  428 ? 55.296  73.732  116.408 1.00 9.88  ? 428  ILE A CG1 1 
ATOM   3292  C  CG2 . ILE A 1  428 ? 56.172  75.927  115.386 1.00 11.59 ? 428  ILE A CG2 1 
ATOM   3293  C  CD1 . ILE A 1  428 ? 53.837  73.953  116.647 1.00 21.41 ? 428  ILE A CD1 1 
ATOM   3294  N  N   . GLU A 1  429 ? 58.855  73.313  118.755 1.00 19.03 ? 429  GLU A N   1 
ATOM   3295  C  CA  . GLU A 1  429 ? 59.239  72.863  120.113 1.00 18.64 ? 429  GLU A CA  1 
ATOM   3296  C  C   . GLU A 1  429 ? 59.483  74.016  121.095 1.00 18.93 ? 429  GLU A C   1 
ATOM   3297  O  O   . GLU A 1  429 ? 59.029  73.951  122.217 1.00 18.77 ? 429  GLU A O   1 
ATOM   3298  C  CB  . GLU A 1  429 ? 60.455  71.908  120.067 1.00 18.41 ? 429  GLU A CB  1 
ATOM   3299  C  CG  . GLU A 1  429 ? 60.651  71.002  121.306 1.00 8.61  ? 429  GLU A CG  1 
ATOM   3300  C  CD  . GLU A 1  429 ? 61.962  70.196  121.254 1.00 20.68 ? 429  GLU A CD  1 
ATOM   3301  O  OE1 . GLU A 1  429 ? 61.945  68.994  120.889 1.00 20.63 ? 429  GLU A OE1 1 
ATOM   3302  O  OE2 . GLU A 1  429 ? 63.026  70.759  121.563 1.00 22.93 ? 429  GLU A OE2 1 
ATOM   3303  N  N   . GLN A 1  430 ? 60.090  75.102  120.611 1.00 20.09 ? 430  GLN A N   1 
ATOM   3304  C  CA  . GLN A 1  430 ? 60.428  76.282  121.423 1.00 20.78 ? 430  GLN A CA  1 
ATOM   3305  C  C   . GLN A 1  430 ? 59.282  77.325  121.492 1.00 21.45 ? 430  GLN A C   1 
ATOM   3306  O  O   . GLN A 1  430 ? 59.364  78.272  122.285 1.00 21.39 ? 430  GLN A O   1 
ATOM   3307  C  CB  . GLN A 1  430 ? 61.852  76.814  121.046 1.00 20.77 ? 430  GLN A CB  1 
ATOM   3308  C  CG  . GLN A 1  430 ? 62.167  78.362  121.075 1.00 34.49 ? 430  GLN A CG  1 
ATOM   3309  C  CD  . GLN A 1  430 ? 63.359  78.701  121.912 1.00 35.86 ? 430  GLN A CD  1 
ATOM   3310  O  OE1 . GLN A 1  430 ? 64.405  78.999  121.387 1.00 39.12 ? 430  GLN A OE1 1 
ATOM   3311  N  NE2 . GLN A 1  430 ? 63.220  78.597  123.232 1.00 57.69 ? 430  GLN A NE2 1 
ATOM   3312  N  N   . LEU A 1  431 ? 58.152  77.030  120.820 1.00 22.47 ? 431  LEU A N   1 
ATOM   3313  C  CA  . LEU A 1  431 ? 56.910  77.803  120.974 1.00 23.65 ? 431  LEU A CA  1 
ATOM   3314  C  C   . LEU A 1  431 ? 56.423  77.765  122.415 1.00 24.32 ? 431  LEU A C   1 
ATOM   3315  O  O   . LEU A 1  431 ? 56.294  76.652  122.972 1.00 24.82 ? 431  LEU A O   1 
ATOM   3316  C  CB  . LEU A 1  431 ? 55.791  77.391  119.988 1.00 23.94 ? 431  LEU A CB  1 
ATOM   3317  C  CG  . LEU A 1  431 ? 54.384  78.031  120.047 1.00 28.45 ? 431  LEU A CG  1 
ATOM   3318  C  CD1 . LEU A 1  431 ? 54.347  79.535  119.648 1.00 33.95 ? 431  LEU A CD1 1 
ATOM   3319  C  CD2 . LEU A 1  431 ? 53.472  77.265  119.184 1.00 17.39 ? 431  LEU A CD2 1 
ATOM   3320  N  N   . PRO A 1  432 ? 56.344  78.956  123.069 1.00 24.44 ? 432  PRO A N   1 
ATOM   3321  C  CA  . PRO A 1  432 ? 55.928  79.043  124.479 1.00 24.27 ? 432  PRO A CA  1 
ATOM   3322  C  C   . PRO A 1  432 ? 54.587  78.393  124.709 1.00 23.70 ? 432  PRO A C   1 
ATOM   3323  O  O   . PRO A 1  432 ? 53.728  78.414  123.807 1.00 23.67 ? 432  PRO A O   1 
ATOM   3324  C  CB  . PRO A 1  432 ? 55.816  80.555  124.723 1.00 24.19 ? 432  PRO A CB  1 
ATOM   3325  C  CG  . PRO A 1  432 ? 56.726  81.143  123.770 1.00 25.17 ? 432  PRO A CG  1 
ATOM   3326  C  CD  . PRO A 1  432 ? 56.639  80.309  122.542 1.00 23.78 ? 432  PRO A CD  1 
ATOM   3327  N  N   . ASP A 1  433 ? 54.531  77.608  125.783 1.00 23.01 ? 433  ASP A N   1 
ATOM   3328  C  CA  . ASP A 1  433 ? 53.289  77.155  126.418 1.00 22.05 ? 433  ASP A CA  1 
ATOM   3329  C  C   . ASP A 1  433 ? 52.235  78.255  126.502 1.00 21.44 ? 433  ASP A C   1 
ATOM   3330  O  O   . ASP A 1  433 ? 52.571  79.416  126.821 1.00 21.70 ? 433  ASP A O   1 
ATOM   3331  C  CB  . ASP A 1  433 ? 53.608  76.659  127.825 1.00 22.03 ? 433  ASP A CB  1 
ATOM   3332  C  CG  . ASP A 1  433 ? 52.475  75.947  128.442 1.00 23.56 ? 433  ASP A CG  1 
ATOM   3333  O  OD1 . ASP A 1  433 ? 51.731  76.609  129.194 1.00 27.86 ? 433  ASP A OD1 1 
ATOM   3334  O  OD2 . ASP A 1  433 ? 52.177  74.774  128.138 1.00 18.85 ? 433  ASP A OD2 1 
ATOM   3335  N  N   . TYR A 1  434 ? 50.970  77.868  126.293 1.00 20.90 ? 434  TYR A N   1 
ATOM   3336  C  CA  . TYR A 1  434 ? 49.853  78.811  126.229 1.00 20.92 ? 434  TYR A CA  1 
ATOM   3337  C  C   . TYR A 1  434 ? 49.697  79.668  127.480 1.00 21.41 ? 434  TYR A C   1 
ATOM   3338  O  O   . TYR A 1  434 ? 49.486  80.892  127.346 1.00 21.99 ? 434  TYR A O   1 
ATOM   3339  C  CB  . TYR A 1  434 ? 48.520  78.145  125.846 1.00 20.69 ? 434  TYR A CB  1 
ATOM   3340  C  CG  . TYR A 1  434 ? 47.384  79.142  125.640 1.00 14.49 ? 434  TYR A CG  1 
ATOM   3341  C  CD1 . TYR A 1  434 ? 47.153  79.729  124.376 1.00 6.48  ? 434  TYR A CD1 1 
ATOM   3342  C  CD2 . TYR A 1  434 ? 46.575  79.564  126.734 1.00 16.29 ? 434  TYR A CD2 1 
ATOM   3343  C  CE1 . TYR A 1  434 ? 46.130  80.729  124.198 1.00 17.94 ? 434  TYR A CE1 1 
ATOM   3344  C  CE2 . TYR A 1  434 ? 45.673  80.646  126.595 1.00 20.60 ? 434  TYR A CE2 1 
ATOM   3345  C  CZ  . TYR A 1  434 ? 45.382  81.153  125.316 1.00 19.54 ? 434  TYR A CZ  1 
ATOM   3346  O  OH  . TYR A 1  434 ? 44.378  82.093  125.179 1.00 20.39 ? 434  TYR A OH  1 
ATOM   3347  N  N   . ASN A 1  435 ? 49.800  79.038  128.669 1.00 20.70 ? 435  ASN A N   1 
ATOM   3348  C  CA  . ASN A 1  435 ? 49.849  79.750  129.970 1.00 20.24 ? 435  ASN A CA  1 
ATOM   3349  C  C   . ASN A 1  435 ? 50.892  80.873  130.025 1.00 19.49 ? 435  ASN A C   1 
ATOM   3350  O  O   . ASN A 1  435 ? 50.575  81.985  130.427 1.00 19.39 ? 435  ASN A O   1 
ATOM   3351  C  CB  . ASN A 1  435 ? 50.069  78.783  131.141 1.00 20.14 ? 435  ASN A CB  1 
ATOM   3352  C  CG  . ASN A 1  435 ? 48.815  78.020  131.522 1.00 26.32 ? 435  ASN A CG  1 
ATOM   3353  O  OD1 . ASN A 1  435 ? 47.833  78.613  131.951 1.00 21.35 ? 435  ASN A OD1 1 
ATOM   3354  N  ND2 . ASN A 1  435 ? 48.909  76.684  131.531 1.00 16.41 ? 435  ASN A ND2 1 
ATOM   3355  N  N   . ARG A 1  436 ? 52.030  80.623  129.389 1.00 19.30 ? 436  ARG A N   1 
ATOM   3356  C  CA  . ARG A 1  436 ? 53.123  81.583  129.308 1.00 20.04 ? 436  ARG A CA  1 
ATOM   3357  C  C   . ARG A 1  436 ? 52.985  82.635  128.230 1.00 20.35 ? 436  ARG A C   1 
ATOM   3358  O  O   . ARG A 1  436 ? 53.381  83.774  128.464 1.00 21.27 ? 436  ARG A O   1 
ATOM   3359  C  CB  . ARG A 1  436 ? 54.455  80.873  129.297 1.00 19.81 ? 436  ARG A CB  1 
ATOM   3360  C  CG  . ARG A 1  436 ? 54.748  80.380  130.706 1.00 29.84 ? 436  ARG A CG  1 
ATOM   3361  C  CD  . ARG A 1  436 ? 56.057  79.803  130.914 1.00 27.45 ? 436  ARG A CD  1 
ATOM   3362  N  NE  . ARG A 1  436 ? 57.096  80.820  131.013 1.00 17.67 ? 436  ARG A NE  1 
ATOM   3363  C  CZ  . ARG A 1  436 ? 58.373  80.549  131.136 1.00 24.30 ? 436  ARG A CZ  1 
ATOM   3364  N  NH1 . ARG A 1  436 ? 58.777  79.328  131.519 1.00 28.38 ? 436  ARG A NH1 1 
ATOM   3365  N  NH2 . ARG A 1  436 ? 59.255  81.527  131.014 1.00 17.04 ? 436  ARG A NH2 1 
ATOM   3366  N  N   . ILE A 1  437 ? 52.258  82.300  127.149 1.00 20.00 ? 437  ILE A N   1 
ATOM   3367  C  CA  . ILE A 1  437 ? 51.677  83.274  126.213 1.00 19.76 ? 437  ILE A CA  1 
ATOM   3368  C  C   . ILE A 1  437 ? 50.623  84.175  126.898 1.00 20.27 ? 437  ILE A C   1 
ATOM   3369  O  O   . ILE A 1  437 ? 50.769  85.412  126.854 1.00 21.06 ? 437  ILE A O   1 
ATOM   3370  C  CB  . ILE A 1  437 ? 51.159  82.589  124.889 1.00 19.83 ? 437  ILE A CB  1 
ATOM   3371  C  CG1 . ILE A 1  437 ? 52.319  82.000  124.071 1.00 18.88 ? 437  ILE A CG1 1 
ATOM   3372  C  CG2 . ILE A 1  437 ? 50.321  83.544  124.021 1.00 8.41  ? 437  ILE A CG2 1 
ATOM   3373  C  CD1 . ILE A 1  437 ? 51.897  80.980  123.018 1.00 15.31 ? 437  ILE A CD1 1 
ATOM   3374  N  N   . ARG A 1  438 ? 49.651  83.555  127.593 1.00 19.59 ? 438  ARG A N   1 
ATOM   3375  C  CA  . ARG A 1  438 ? 48.611  84.241  128.398 1.00 19.32 ? 438  ARG A CA  1 
ATOM   3376  C  C   . ARG A 1  438 ? 49.145  85.231  129.432 1.00 18.95 ? 438  ARG A C   1 
ATOM   3377  O  O   . ARG A 1  438 ? 48.535  86.281  129.669 1.00 19.03 ? 438  ARG A O   1 
ATOM   3378  C  CB  . ARG A 1  438 ? 47.711  83.218  129.128 1.00 20.25 ? 438  ARG A CB  1 
ATOM   3379  C  CG  . ARG A 1  438 ? 46.133  83.343  129.027 1.00 21.76 ? 438  ARG A CG  1 
ATOM   3380  C  CD  . ARG A 1  438 ? 45.509  84.710  128.731 1.00 14.69 ? 438  ARG A CD  1 
ATOM   3381  N  NE  . ARG A 1  438 ? 45.822  85.672  129.784 1.00 27.24 ? 438  ARG A NE  1 
ATOM   3382  C  CZ  . ARG A 1  438 ? 44.978  86.521  130.360 1.00 27.95 ? 438  ARG A CZ  1 
ATOM   3383  N  NH1 . ARG A 1  438 ? 43.655  86.474  130.159 1.00 22.30 ? 438  ARG A NH1 1 
ATOM   3384  N  NH2 . ARG A 1  438 ? 45.469  87.361  131.247 1.00 37.16 ? 438  ARG A NH2 1 
ATOM   3385  N  N   . SER A 1  439 ? 50.246  84.849  130.078 1.00 18.74 ? 439  SER A N   1 
ATOM   3386  C  CA  . SER A 1  439 ? 50.943  85.662  131.060 1.00 18.64 ? 439  SER A CA  1 
ATOM   3387  C  C   . SER A 1  439 ? 51.658  86.881  130.453 1.00 19.78 ? 439  SER A C   1 
ATOM   3388  O  O   . SER A 1  439 ? 51.878  87.884  131.154 1.00 20.22 ? 439  SER A O   1 
ATOM   3389  C  CB  . SER A 1  439 ? 51.923  84.784  131.802 1.00 18.13 ? 439  SER A CB  1 
ATOM   3390  O  OG  . SER A 1  439 ? 51.226  83.934  132.689 1.00 20.43 ? 439  SER A OG  1 
ATOM   3391  N  N   . GLY A 1  440 ? 52.073  86.755  129.182 1.00 19.66 ? 440  GLY A N   1 
ATOM   3392  C  CA  . GLY A 1  440 ? 52.511  87.868  128.354 1.00 19.57 ? 440  GLY A CA  1 
ATOM   3393  C  C   . GLY A 1  440 ? 51.446  88.896  127.982 1.00 19.77 ? 440  GLY A C   1 
ATOM   3394  O  O   . GLY A 1  440 ? 51.789  89.903  127.374 1.00 19.84 ? 440  GLY A O   1 
ATOM   3395  N  N   . MET A 1  441 ? 50.167  88.620  128.280 1.00 19.73 ? 441  MET A N   1 
ATOM   3396  C  CA  . MET A 1  441 ? 49.066  89.534  127.937 1.00 19.83 ? 441  MET A CA  1 
ATOM   3397  C  C   . MET A 1  441 ? 48.750  90.625  128.974 1.00 20.19 ? 441  MET A C   1 
ATOM   3398  O  O   . MET A 1  441 ? 47.984  91.561  128.694 1.00 20.21 ? 441  MET A O   1 
ATOM   3399  C  CB  . MET A 1  441 ? 47.826  88.763  127.486 1.00 20.17 ? 441  MET A CB  1 
ATOM   3400  C  CG  . MET A 1  441 ? 48.042  87.841  126.225 1.00 26.89 ? 441  MET A CG  1 
ATOM   3401  S  SD  . MET A 1  441 ? 48.770  88.622  124.741 1.00 23.29 ? 441  MET A SD  1 
ATOM   3402  C  CE  . MET A 1  441 ? 47.486  89.761  124.254 1.00 10.90 ? 441  MET A CE  1 
ATOM   3403  N  N   . PHE A 1  442 ? 49.465  90.572  130.100 1.00 20.35 ? 442  PHE A N   1 
ATOM   3404  C  CA  . PHE A 1  442 ? 49.461  91.595  131.148 1.00 20.27 ? 442  PHE A CA  1 
ATOM   3405  C  C   . PHE A 1  442 ? 50.901  91.810  131.647 1.00 20.27 ? 442  PHE A C   1 
ATOM   3406  O  O   . PHE A 1  442 ? 51.767  90.904  131.502 1.00 19.84 ? 442  PHE A O   1 
ATOM   3407  C  CB  . PHE A 1  442 ? 48.492  91.212  132.303 1.00 20.39 ? 442  PHE A CB  1 
ATOM   3408  C  CG  . PHE A 1  442 ? 48.903  89.980  133.073 1.00 19.51 ? 442  PHE A CG  1 
ATOM   3409  C  CD1 . PHE A 1  442 ? 48.377  88.714  132.721 1.00 24.66 ? 442  PHE A CD1 1 
ATOM   3410  C  CD2 . PHE A 1  442 ? 49.809  90.073  134.170 1.00 17.04 ? 442  PHE A CD2 1 
ATOM   3411  C  CE1 . PHE A 1  442 ? 48.756  87.537  133.432 1.00 22.11 ? 442  PHE A CE1 1 
ATOM   3412  C  CE2 . PHE A 1  442 ? 50.248  88.906  134.849 1.00 21.02 ? 442  PHE A CE2 1 
ATOM   3413  C  CZ  . PHE A 1  442 ? 49.751  87.629  134.455 1.00 26.20 ? 442  PHE A CZ  1 
ATOM   3414  N  N   . TRP A 1  443 ? 51.105  92.952  132.316 1.00 20.32 ? 443  TRP A N   1 
ATOM   3415  C  CA  . TRP A 1  443 ? 52.347  93.283  133.019 1.00 20.66 ? 443  TRP A CA  1 
ATOM   3416  C  C   . TRP A 1  443 ? 52.144  93.389  134.533 1.00 20.69 ? 443  TRP A C   1 
ATOM   3417  O  O   . TRP A 1  443 ? 51.245  94.116  135.007 1.00 21.06 ? 443  TRP A O   1 
ATOM   3418  C  CB  . TRP A 1  443 ? 52.930  94.593  132.459 1.00 21.26 ? 443  TRP A CB  1 
ATOM   3419  C  CG  . TRP A 1  443 ? 53.952  94.434  131.315 1.00 21.27 ? 443  TRP A CG  1 
ATOM   3420  C  CD1 . TRP A 1  443 ? 54.500  93.254  130.825 1.00 15.98 ? 443  TRP A CD1 1 
ATOM   3421  C  CD2 . TRP A 1  443 ? 54.566  95.489  130.573 1.00 18.80 ? 443  TRP A CD2 1 
ATOM   3422  N  NE1 . TRP A 1  443 ? 55.402  93.525  129.825 1.00 20.50 ? 443  TRP A NE1 1 
ATOM   3423  C  CE2 . TRP A 1  443 ? 55.524  94.885  129.691 1.00 23.26 ? 443  TRP A CE2 1 
ATOM   3424  C  CE3 . TRP A 1  443 ? 54.450  96.906  130.587 1.00 20.52 ? 443  TRP A CE3 1 
ATOM   3425  C  CZ2 . TRP A 1  443 ? 56.329  95.647  128.792 1.00 12.86 ? 443  TRP A CZ2 1 
ATOM   3426  C  CZ3 . TRP A 1  443 ? 55.237  97.668  129.670 1.00 22.90 ? 443  TRP A CZ3 1 
ATOM   3427  C  CH2 . TRP A 1  443 ? 56.159  97.021  128.782 1.00 20.04 ? 443  TRP A CH2 1 
ATOM   3428  N  N   . LEU A 1  444 ? 52.947  92.627  135.281 1.00 20.70 ? 444  LEU A N   1 
ATOM   3429  C  CA  . LEU A 1  444 ? 53.018  92.736  136.747 1.00 21.21 ? 444  LEU A CA  1 
ATOM   3430  C  C   . LEU A 1  444 ? 53.443  94.101  137.322 1.00 22.48 ? 444  LEU A C   1 
ATOM   3431  O  O   . LEU A 1  444 ? 53.011  94.436  138.431 1.00 23.18 ? 444  LEU A O   1 
ATOM   3432  C  CB  . LEU A 1  444 ? 53.848  91.609  137.374 1.00 20.99 ? 444  LEU A CB  1 
ATOM   3433  C  CG  . LEU A 1  444 ? 53.446  90.124  137.241 1.00 25.81 ? 444  LEU A CG  1 
ATOM   3434  C  CD1 . LEU A 1  444 ? 54.662  89.271  137.529 1.00 21.73 ? 444  LEU A CD1 1 
ATOM   3435  C  CD2 . LEU A 1  444 ? 52.314  89.746  138.163 1.00 10.26 ? 444  LEU A CD2 1 
ATOM   3436  N  N   . ARG A 1  445 ? 54.322  94.844  136.623 1.00 22.62 ? 445  ARG A N   1 
ATOM   3437  C  CA  . ARG A 1  445 ? 54.642  96.241  137.020 1.00 23.23 ? 445  ARG A CA  1 
ATOM   3438  C  C   . ARG A 1  445 ? 53.529  97.275  136.872 1.00 24.17 ? 445  ARG A C   1 
ATOM   3439  O  O   . ARG A 1  445 ? 53.622  98.353  137.471 1.00 24.14 ? 445  ARG A O   1 
ATOM   3440  C  CB  . ARG A 1  445 ? 56.010  96.810  136.542 1.00 22.67 ? 445  ARG A CB  1 
ATOM   3441  C  CG  . ARG A 1  445 ? 56.698  96.230  135.345 1.00 27.26 ? 445  ARG A CG  1 
ATOM   3442  C  CD  . ARG A 1  445 ? 56.238  96.754  133.975 1.00 27.88 ? 445  ARG A CD  1 
ATOM   3443  N  NE  . ARG A 1  445 ? 57.364  96.862  133.040 1.00 30.59 ? 445  ARG A NE  1 
ATOM   3444  C  CZ  . ARG A 1  445 ? 57.976  95.867  132.382 1.00 28.04 ? 445  ARG A CZ  1 
ATOM   3445  N  NH1 . ARG A 1  445 ? 57.473  94.642  132.311 1.00 32.81 ? 445  ARG A NH1 1 
ATOM   3446  N  NH2 . ARG A 1  445 ? 59.042  96.158  131.650 1.00 39.76 ? 445  ARG A NH2 1 
ATOM   3447  N  N   . PHE A 1  446 ? 52.497  96.947  136.081 1.00 25.09 ? 446  PHE A N   1 
ATOM   3448  C  CA  . PHE A 1  446 ? 51.350  97.832  135.839 1.00 26.29 ? 446  PHE A CA  1 
ATOM   3449  C  C   . PHE A 1  446 ? 50.103  97.355  136.595 1.00 27.37 ? 446  PHE A C   1 
ATOM   3450  O  O   . PHE A 1  446 ? 49.558  98.092  137.422 1.00 27.49 ? 446  PHE A O   1 
ATOM   3451  C  CB  . PHE A 1  446 ? 51.086  97.999  134.327 1.00 26.31 ? 446  PHE A CB  1 
ATOM   3452  C  CG  . PHE A 1  446 ? 49.982  98.996  133.991 1.00 27.40 ? 446  PHE A CG  1 
ATOM   3453  C  CD1 . PHE A 1  446 ? 50.286  100.377 133.815 1.00 21.17 ? 446  PHE A CD1 1 
ATOM   3454  C  CD2 . PHE A 1  446 ? 48.641  98.541  133.752 1.00 23.22 ? 446  PHE A CD2 1 
ATOM   3455  C  CE1 . PHE A 1  446 ? 49.262  101.318 133.453 1.00 22.41 ? 446  PHE A CE1 1 
ATOM   3456  C  CE2 . PHE A 1  446 ? 47.607  99.456  133.385 1.00 24.32 ? 446  PHE A CE2 1 
ATOM   3457  C  CZ  . PHE A 1  446 ? 47.920  100.850 133.211 1.00 25.39 ? 446  PHE A CZ  1 
ATOM   3458  O  OXT . PHE A 1  446 ? 49.520  96.316  136.276 1.00 27.82 ? 446  PHE A OXT 1 
ATOM   3459  N  N   . VAL B 2  17  ? 31.943  115.392 87.815  1.00 46.59 ? 17   VAL B N   1 
ATOM   3460  C  CA  . VAL B 2  17  ? 33.174  116.242 87.684  1.00 46.66 ? 17   VAL B CA  1 
ATOM   3461  C  C   . VAL B 2  17  ? 34.291  115.861 88.697  1.00 46.51 ? 17   VAL B C   1 
ATOM   3462  O  O   . VAL B 2  17  ? 34.025  115.824 89.909  1.00 46.65 ? 17   VAL B O   1 
ATOM   3463  C  CB  . VAL B 2  17  ? 32.875  117.806 87.683  1.00 46.85 ? 17   VAL B CB  1 
ATOM   3464  C  CG1 . VAL B 2  17  ? 32.273  118.249 86.344  1.00 49.53 ? 17   VAL B CG1 1 
ATOM   3465  C  CG2 . VAL B 2  17  ? 31.973  118.260 88.875  1.00 48.38 ? 17   VAL B CG2 1 
ATOM   3466  N  N   . PRO B 2  18  ? 35.436  115.355 88.194  1.00 46.24 ? 18   PRO B N   1 
ATOM   3467  C  CA  . PRO B 2  18  ? 36.757  115.769 88.719  1.00 45.89 ? 18   PRO B CA  1 
ATOM   3468  C  C   . PRO B 2  18  ? 37.253  117.149 88.182  1.00 45.44 ? 18   PRO B C   1 
ATOM   3469  O  O   . PRO B 2  18  ? 36.577  117.702 87.292  1.00 45.56 ? 18   PRO B O   1 
ATOM   3470  C  CB  . PRO B 2  18  ? 37.696  114.630 88.273  1.00 45.77 ? 18   PRO B CB  1 
ATOM   3471  C  CG  . PRO B 2  18  ? 37.007  113.982 87.126  1.00 44.50 ? 18   PRO B CG  1 
ATOM   3472  C  CD  . PRO B 2  18  ? 35.545  114.101 87.413  1.00 46.17 ? 18   PRO B CD  1 
ATOM   3473  N  N   . PRO B 2  19  ? 38.335  117.727 88.762  1.00 44.85 ? 19   PRO B N   1 
ATOM   3474  C  CA  . PRO B 2  19  ? 39.284  118.565 87.998  1.00 43.81 ? 19   PRO B CA  1 
ATOM   3475  C  C   . PRO B 2  19  ? 39.696  117.984 86.631  1.00 42.46 ? 19   PRO B C   1 
ATOM   3476  O  O   . PRO B 2  19  ? 40.007  116.777 86.550  1.00 42.66 ? 19   PRO B O   1 
ATOM   3477  C  CB  . PRO B 2  19  ? 40.506  118.672 88.944  1.00 43.86 ? 19   PRO B CB  1 
ATOM   3478  C  CG  . PRO B 2  19  ? 40.073  118.003 90.258  1.00 44.77 ? 19   PRO B CG  1 
ATOM   3479  C  CD  . PRO B 2  19  ? 38.564  117.898 90.215  1.00 45.03 ? 19   PRO B CD  1 
ATOM   3480  N  N   . HIS B 2  20  ? 39.476  118.779 85.569  1.00 40.77 ? 20   HIS B N   1 
ATOM   3481  C  CA  . HIS B 2  20  ? 40.155  118.625 84.264  1.00 38.94 ? 20   HIS B CA  1 
ATOM   3482  C  C   . HIS B 2  20  ? 41.699  118.482 84.448  1.00 36.41 ? 20   HIS B C   1 
ATOM   3483  O  O   . HIS B 2  20  ? 42.286  119.301 85.184  1.00 36.32 ? 20   HIS B O   1 
ATOM   3484  C  CB  . HIS B 2  20  ? 39.816  119.808 83.330  1.00 39.38 ? 20   HIS B CB  1 
ATOM   3485  C  CG  . HIS B 2  20  ? 39.926  119.489 81.865  1.00 48.06 ? 20   HIS B CG  1 
ATOM   3486  N  ND1 . HIS B 2  20  ? 38.891  119.714 80.980  1.00 49.33 ? 20   HIS B ND1 1 
ATOM   3487  C  CD2 . HIS B 2  20  ? 40.985  119.101 81.109  1.00 47.58 ? 20   HIS B CD2 1 
ATOM   3488  C  CE1 . HIS B 2  20  ? 39.286  119.409 79.756  1.00 50.69 ? 20   HIS B CE1 1 
ATOM   3489  N  NE2 . HIS B 2  20  ? 40.546  119.013 79.810  1.00 50.92 ? 20   HIS B NE2 1 
ATOM   3490  N  N   . PRO B 2  21  ? 42.304  117.367 83.961  1.00 34.07 ? 21   PRO B N   1 
ATOM   3491  C  CA  . PRO B 2  21  ? 43.742  117.103 84.182  1.00 31.83 ? 21   PRO B CA  1 
ATOM   3492  C  C   . PRO B 2  21  ? 44.679  118.162 83.581  1.00 29.58 ? 21   PRO B C   1 
ATOM   3493  O  O   . PRO B 2  21  ? 44.412  118.679 82.486  1.00 29.72 ? 21   PRO B O   1 
ATOM   3494  C  CB  . PRO B 2  21  ? 43.964  115.735 83.510  1.00 31.84 ? 21   PRO B CB  1 
ATOM   3495  C  CG  . PRO B 2  21  ? 42.851  115.603 82.533  1.00 36.73 ? 21   PRO B CG  1 
ATOM   3496  C  CD  . PRO B 2  21  ? 41.683  116.256 83.198  1.00 34.00 ? 21   PRO B CD  1 
ATOM   3497  N  N   . GLN B 2  22  ? 45.663  118.576 84.385  1.00 27.09 ? 22   GLN B N   1 
ATOM   3498  C  CA  . GLN B 2  22  ? 46.916  119.185 83.908  1.00 24.66 ? 22   GLN B CA  1 
ATOM   3499  C  C   . GLN B 2  22  ? 47.650  118.292 82.892  1.00 22.75 ? 22   GLN B C   1 
ATOM   3500  O  O   . GLN B 2  22  ? 47.489  117.054 82.902  1.00 22.55 ? 22   GLN B O   1 
ATOM   3501  C  CB  . GLN B 2  22  ? 47.857  119.491 85.085  1.00 24.39 ? 22   GLN B CB  1 
ATOM   3502  C  CG  . GLN B 2  22  ? 47.365  120.557 86.073  1.00 26.68 ? 22   GLN B CG  1 
ATOM   3503  C  CD  . GLN B 2  22  ? 47.650  121.973 85.618  1.00 24.25 ? 22   GLN B CD  1 
ATOM   3504  O  OE1 . GLN B 2  22  ? 46.753  122.659 85.138  1.00 17.81 ? 22   GLN B OE1 1 
ATOM   3505  N  NE2 . GLN B 2  22  ? 48.897  122.423 85.793  1.00 24.39 ? 22   GLN B NE2 1 
ATOM   3506  N  N   . ASP B 2  23  ? 48.340  118.945 81.948  1.00 20.65 ? 23   ASP B N   1 
ATOM   3507  C  CA  . ASP B 2  23  ? 49.362  118.310 81.101  1.00 18.18 ? 23   ASP B CA  1 
ATOM   3508  C  C   . ASP B 2  23  ? 50.681  118.121 81.834  1.00 16.42 ? 23   ASP B C   1 
ATOM   3509  O  O   . ASP B 2  23  ? 51.049  118.955 82.685  1.00 15.92 ? 23   ASP B O   1 
ATOM   3510  C  CB  . ASP B 2  23  ? 49.609  119.163 79.864  1.00 18.06 ? 23   ASP B CB  1 
ATOM   3511  C  CG  . ASP B 2  23  ? 48.435  119.181 78.895  1.00 21.24 ? 23   ASP B CG  1 
ATOM   3512  O  OD1 . ASP B 2  23  ? 48.663  119.550 77.720  1.00 19.59 ? 23   ASP B OD1 1 
ATOM   3513  O  OD2 . ASP B 2  23  ? 47.255  118.900 79.205  1.00 22.86 ? 23   ASP B OD2 1 
ATOM   3514  N  N   . LEU B 2  24  ? 51.362  117.004 81.517  1.00 15.37 ? 24   LEU B N   1 
ATOM   3515  C  CA  . LEU B 2  24  ? 52.801  116.828 81.718  1.00 14.91 ? 24   LEU B CA  1 
ATOM   3516  C  C   . LEU B 2  24  ? 53.634  117.984 81.163  1.00 14.82 ? 24   LEU B C   1 
ATOM   3517  O  O   . LEU B 2  24  ? 53.400  118.457 80.044  1.00 14.63 ? 24   LEU B O   1 
ATOM   3518  C  CB  . LEU B 2  24  ? 53.292  115.492 81.135  1.00 14.97 ? 24   LEU B CB  1 
ATOM   3519  C  CG  . LEU B 2  24  ? 54.685  114.995 81.577  1.00 16.55 ? 24   LEU B CG  1 
ATOM   3520  C  CD1 . LEU B 2  24  ? 54.672  113.550 82.018  1.00 16.41 ? 24   LEU B CD1 1 
ATOM   3521  C  CD2 . LEU B 2  24  ? 55.749  115.233 80.493  1.00 14.98 ? 24   LEU B CD2 1 
ATOM   3522  N  N   . GLU B 2  25  ? 54.591  118.412 81.989  1.00 15.04 ? 25   GLU B N   1 
ATOM   3523  C  CA  . GLU B 2  25  ? 55.607  119.423 81.656  1.00 14.92 ? 25   GLU B CA  1 
ATOM   3524  C  C   . GLU B 2  25  ? 56.956  118.739 81.554  1.00 15.12 ? 25   GLU B C   1 
ATOM   3525  O  O   . GLU B 2  25  ? 57.240  117.780 82.307  1.00 15.70 ? 25   GLU B O   1 
ATOM   3526  C  CB  . GLU B 2  25  ? 55.670  120.532 82.714  1.00 14.81 ? 25   GLU B CB  1 
ATOM   3527  C  CG  . GLU B 2  25  ? 54.325  121.110 83.173  1.00 21.48 ? 25   GLU B CG  1 
ATOM   3528  C  CD  . GLU B 2  25  ? 54.072  122.566 82.785  1.00 29.86 ? 25   GLU B CD  1 
ATOM   3529  O  OE1 . GLU B 2  25  ? 52.894  122.988 82.887  1.00 31.08 ? 25   GLU B OE1 1 
ATOM   3530  O  OE2 . GLU B 2  25  ? 55.026  123.313 82.444  1.00 40.04 ? 25   GLU B OE2 1 
ATOM   3531  N  N   . PHE B 2  26  ? 57.727  119.154 80.547  1.00 14.62 ? 26   PHE B N   1 
ATOM   3532  C  CA  . PHE B 2  26  ? 58.950  118.461 80.097  1.00 13.71 ? 26   PHE B CA  1 
ATOM   3533  C  C   . PHE B 2  26  ? 60.025  119.486 79.728  1.00 13.65 ? 26   PHE B C   1 
ATOM   3534  O  O   . PHE B 2  26  ? 59.737  120.469 79.044  1.00 13.73 ? 26   PHE B O   1 
ATOM   3535  C  CB  . PHE B 2  26  ? 58.628  117.568 78.890  1.00 13.12 ? 26   PHE B CB  1 
ATOM   3536  C  CG  . PHE B 2  26  ? 59.677  116.542 78.595  1.00 9.84  ? 26   PHE B CG  1 
ATOM   3537  C  CD1 . PHE B 2  26  ? 59.540  115.221 79.095  1.00 4.87  ? 26   PHE B CD1 1 
ATOM   3538  C  CD2 . PHE B 2  26  ? 60.772  116.849 77.728  1.00 14.21 ? 26   PHE B CD2 1 
ATOM   3539  C  CE1 . PHE B 2  26  ? 60.506  114.222 78.804  1.00 5.75  ? 26   PHE B CE1 1 
ATOM   3540  C  CE2 . PHE B 2  26  ? 61.776  115.872 77.442  1.00 17.40 ? 26   PHE B CE2 1 
ATOM   3541  C  CZ  . PHE B 2  26  ? 61.640  114.552 77.981  1.00 16.38 ? 26   PHE B CZ  1 
ATOM   3542  N  N   . THR B 2  27  ? 61.249  119.250 80.207  1.00 13.35 ? 27   THR B N   1 
ATOM   3543  C  CA  . THR B 2  27  ? 62.401  120.147 80.000  1.00 12.92 ? 27   THR B CA  1 
ATOM   3544  C  C   . THR B 2  27  ? 63.675  119.309 79.862  1.00 12.86 ? 27   THR B C   1 
ATOM   3545  O  O   . THR B 2  27  ? 63.962  118.469 80.723  1.00 12.36 ? 27   THR B O   1 
ATOM   3546  C  CB  . THR B 2  27  ? 62.509  121.151 81.189  1.00 12.82 ? 27   THR B CB  1 
ATOM   3547  O  OG1 . THR B 2  27  ? 61.360  122.012 81.184  1.00 15.68 ? 27   THR B OG1 1 
ATOM   3548  C  CG2 . THR B 2  27  ? 63.704  122.118 81.018  1.00 10.15 ? 27   THR B CG2 1 
ATOM   3549  N  N   . ARG B 2  28  ? 64.353  119.483 78.727  1.00 13.56 ? 28   ARG B N   1 
ATOM   3550  C  CA  . ARG B 2  28  ? 65.768  119.121 78.541  1.00 14.80 ? 28   ARG B CA  1 
ATOM   3551  C  C   . ARG B 2  28  ? 66.617  120.324 78.944  1.00 15.66 ? 28   ARG B C   1 
ATOM   3552  O  O   . ARG B 2  28  ? 66.364  121.455 78.497  1.00 15.86 ? 28   ARG B O   1 
ATOM   3553  C  CB  . ARG B 2  28  ? 66.067  118.792 77.065  1.00 15.09 ? 28   ARG B CB  1 
ATOM   3554  C  CG  . ARG B 2  28  ? 65.559  117.478 76.538  1.00 23.48 ? 28   ARG B CG  1 
ATOM   3555  C  CD  . ARG B 2  28  ? 66.467  116.868 75.441  1.00 20.11 ? 28   ARG B CD  1 
ATOM   3556  N  NE  . ARG B 2  28  ? 66.825  115.466 75.744  1.00 13.10 ? 28   ARG B NE  1 
ATOM   3557  C  CZ  . ARG B 2  28  ? 68.068  114.941 75.725  1.00 28.94 ? 28   ARG B CZ  1 
ATOM   3558  N  NH1 . ARG B 2  28  ? 69.133  115.685 75.408  1.00 12.10 ? 28   ARG B NH1 1 
ATOM   3559  N  NH2 . ARG B 2  28  ? 68.237  113.624 75.969  1.00 33.33 ? 28   ARG B NH2 1 
ATOM   3560  N  N   . LEU B 2  29  ? 67.629  120.077 79.772  1.00 15.98 ? 29   LEU B N   1 
ATOM   3561  C  CA  . LEU B 2  29  ? 68.661  121.086 80.065  1.00 15.76 ? 29   LEU B CA  1 
ATOM   3562  C  C   . LEU B 2  29  ? 69.843  121.007 79.070  1.00 16.53 ? 29   LEU B C   1 
ATOM   3563  O  O   . LEU B 2  29  ? 70.070  119.910 78.522  1.00 16.72 ? 29   LEU B O   1 
ATOM   3564  C  CB  . LEU B 2  29  ? 69.144  120.956 81.518  1.00 15.16 ? 29   LEU B CB  1 
ATOM   3565  C  CG  . LEU B 2  29  ? 68.200  121.235 82.692  1.00 13.24 ? 29   LEU B CG  1 
ATOM   3566  C  CD1 . LEU B 2  29  ? 68.944  120.995 84.003  1.00 11.96 ? 29   LEU B CD1 1 
ATOM   3567  C  CD2 . LEU B 2  29  ? 67.545  122.670 82.674  1.00 2.00  ? 29   LEU B CD2 1 
ATOM   3568  N  N   . PRO B 2  30  ? 70.620  122.115 78.861  1.00 17.28 ? 30   PRO B N   1 
ATOM   3569  C  CA  . PRO B 2  30  ? 71.873  122.055 78.062  1.00 18.30 ? 30   PRO B CA  1 
ATOM   3570  C  C   . PRO B 2  30  ? 72.877  120.944 78.450  1.00 19.35 ? 30   PRO B C   1 
ATOM   3571  O  O   . PRO B 2  30  ? 73.321  120.254 77.520  1.00 20.24 ? 30   PRO B O   1 
ATOM   3572  C  CB  . PRO B 2  30  ? 72.489  123.443 78.266  1.00 18.65 ? 30   PRO B CB  1 
ATOM   3573  C  CG  . PRO B 2  30  ? 71.317  124.351 78.454  1.00 17.40 ? 30   PRO B CG  1 
ATOM   3574  C  CD  . PRO B 2  30  ? 70.287  123.531 79.189  1.00 16.81 ? 30   PRO B CD  1 
ATOM   3575  N  N   . ASN B 2  31  ? 72.923  120.581 79.744  1.00 19.23 ? 31   ASN B N   1 
ATOM   3576  C  CA  . ASN B 2  31  ? 73.752  119.484 80.264  1.00 18.63 ? 31   ASN B CA  1 
ATOM   3577  C  C   . ASN B 2  31  ? 73.238  118.054 79.975  1.00 19.16 ? 31   ASN B C   1 
ATOM   3578  O  O   . ASN B 2  31  ? 73.952  117.066 80.220  1.00 19.32 ? 31   ASN B O   1 
ATOM   3579  C  CB  . ASN B 2  31  ? 74.117  119.718 81.759  1.00 18.13 ? 31   ASN B CB  1 
ATOM   3580  C  CG  . ASN B 2  31  ? 72.892  119.656 82.734  1.00 23.31 ? 31   ASN B CG  1 
ATOM   3581  O  OD1 . ASN B 2  31  ? 71.810  119.159 82.399  1.00 25.02 ? 31   ASN B OD1 1 
ATOM   3582  N  ND2 . ASN B 2  31  ? 73.138  120.038 83.999  1.00 12.36 ? 31   ASN B ND2 1 
ATOM   3583  N  N   . GLY B 2  32  ? 71.997  117.971 79.475  1.00 19.35 ? 32   GLY B N   1 
ATOM   3584  C  CA  . GLY B 2  32  ? 71.380  116.750 78.992  1.00 19.52 ? 32   GLY B CA  1 
ATOM   3585  C  C   . GLY B 2  32  ? 70.377  116.104 79.945  1.00 20.34 ? 32   GLY B C   1 
ATOM   3586  O  O   . GLY B 2  32  ? 69.733  115.121 79.566  1.00 20.58 ? 32   GLY B O   1 
ATOM   3587  N  N   . LEU B 2  33  ? 70.339  116.583 81.198  1.00 20.54 ? 33   LEU B N   1 
ATOM   3588  C  CA  . LEU B 2  33  ? 69.319  116.229 82.177  1.00 19.97 ? 33   LEU B CA  1 
ATOM   3589  C  C   . LEU B 2  33  ? 67.933  116.629 81.721  1.00 19.27 ? 33   LEU B C   1 
ATOM   3590  O  O   . LEU B 2  33  ? 67.703  117.771 81.296  1.00 19.65 ? 33   LEU B O   1 
ATOM   3591  C  CB  . LEU B 2  33  ? 69.642  116.806 83.566  1.00 20.35 ? 33   LEU B CB  1 
ATOM   3592  C  CG  . LEU B 2  33  ? 68.902  116.114 84.726  1.00 31.92 ? 33   LEU B CG  1 
ATOM   3593  C  CD1 . LEU B 2  33  ? 69.820  115.540 85.747  1.00 34.62 ? 33   LEU B CD1 1 
ATOM   3594  C  CD2 . LEU B 2  33  ? 67.944  117.054 85.358  1.00 19.48 ? 33   LEU B CD2 1 
ATOM   3595  N  N   . VAL B 2  34  ? 67.051  115.641 81.783  1.00 18.24 ? 34   VAL B N   1 
ATOM   3596  C  CA  . VAL B 2  34  ? 65.626  115.764 81.511  1.00 17.78 ? 34   VAL B CA  1 
ATOM   3597  C  C   . VAL B 2  34  ? 64.894  115.918 82.858  1.00 17.53 ? 34   VAL B C   1 
ATOM   3598  O  O   . VAL B 2  34  ? 65.247  115.265 83.835  1.00 17.41 ? 34   VAL B O   1 
ATOM   3599  C  CB  . VAL B 2  34  ? 65.123  114.515 80.689  1.00 17.93 ? 34   VAL B CB  1 
ATOM   3600  C  CG1 . VAL B 2  34  ? 63.632  114.334 80.773  1.00 16.75 ? 34   VAL B CG1 1 
ATOM   3601  C  CG2 . VAL B 2  34  ? 65.540  114.636 79.228  1.00 7.77  ? 34   VAL B CG2 1 
ATOM   3602  N  N   . ILE B 2  35  ? 63.955  116.868 82.903  1.00 17.62 ? 35   ILE B N   1 
ATOM   3603  C  CA  . ILE B 2  35  ? 63.004  117.025 84.005  1.00 17.85 ? 35   ILE B CA  1 
ATOM   3604  C  C   . ILE B 2  35  ? 61.571  116.900 83.477  1.00 18.38 ? 35   ILE B C   1 
ATOM   3605  O  O   . ILE B 2  35  ? 61.176  117.626 82.546  1.00 18.85 ? 35   ILE B O   1 
ATOM   3606  C  CB  . ILE B 2  35  ? 63.194  118.384 84.776  1.00 18.24 ? 35   ILE B CB  1 
ATOM   3607  C  CG1 . ILE B 2  35  ? 64.655  118.838 84.843  1.00 27.10 ? 35   ILE B CG1 1 
ATOM   3608  C  CG2 . ILE B 2  35  ? 62.752  118.245 86.184  1.00 16.62 ? 35   ILE B CG2 1 
ATOM   3609  C  CD1 . ILE B 2  35  ? 64.920  120.051 84.029  1.00 37.47 ? 35   ILE B CD1 1 
ATOM   3610  N  N   . ALA B 2  36  ? 60.803  115.986 84.078  1.00 18.26 ? 36   ALA B N   1 
ATOM   3611  C  CA  . ALA B 2  36  ? 59.380  115.823 83.758  1.00 18.38 ? 36   ALA B CA  1 
ATOM   3612  C  C   . ALA B 2  36  ? 58.472  115.826 84.989  1.00 19.42 ? 36   ALA B C   1 
ATOM   3613  O  O   . ALA B 2  36  ? 58.774  115.165 85.973  1.00 20.40 ? 36   ALA B O   1 
ATOM   3614  C  CB  . ALA B 2  36  ? 59.157  114.595 82.909  1.00 17.56 ? 36   ALA B CB  1 
ATOM   3615  N  N   . SER B 2  37  ? 57.426  116.656 84.964  1.00 19.32 ? 37   SER B N   1 
ATOM   3616  C  CA  . SER B 2  37  ? 56.434  116.695 86.048  1.00 19.18 ? 37   SER B CA  1 
ATOM   3617  C  C   . SER B 2  37  ? 54.969  116.733 85.629  1.00 19.10 ? 37   SER B C   1 
ATOM   3618  O  O   . SER B 2  37  ? 54.623  117.307 84.581  1.00 18.11 ? 37   SER B O   1 
ATOM   3619  C  CB  . SER B 2  37  ? 56.748  117.796 87.062  1.00 19.07 ? 37   SER B CB  1 
ATOM   3620  O  OG  . SER B 2  37  ? 56.394  119.069 86.567  1.00 16.05 ? 37   SER B OG  1 
ATOM   3621  N  N   . LEU B 2  38  ? 54.136  116.067 86.437  1.00 19.97 ? 38   LEU B N   1 
ATOM   3622  C  CA  . LEU B 2  38  ? 52.681  116.215 86.396  1.00 20.29 ? 38   LEU B CA  1 
ATOM   3623  C  C   . LEU B 2  38  ? 52.094  116.621 87.740  1.00 21.00 ? 38   LEU B C   1 
ATOM   3624  O  O   . LEU B 2  38  ? 52.284  115.915 88.741  1.00 20.95 ? 38   LEU B O   1 
ATOM   3625  C  CB  . LEU B 2  38  ? 52.007  114.931 85.863  1.00 19.91 ? 38   LEU B CB  1 
ATOM   3626  C  CG  . LEU B 2  38  ? 50.468  114.872 85.752  1.00 16.36 ? 38   LEU B CG  1 
ATOM   3627  C  CD1 . LEU B 2  38  ? 49.944  115.793 84.645  1.00 2.00  ? 38   LEU B CD1 1 
ATOM   3628  C  CD2 . LEU B 2  38  ? 49.980  113.429 85.573  1.00 18.73 ? 38   LEU B CD2 1 
ATOM   3629  N  N   . GLU B 2  39  ? 51.258  117.662 87.696  1.00 22.04 ? 39   GLU B N   1 
ATOM   3630  C  CA  . GLU B 2  39  ? 50.326  118.005 88.768  1.00 23.58 ? 39   GLU B CA  1 
ATOM   3631  C  C   . GLU B 2  39  ? 48.907  117.389 88.612  1.00 25.63 ? 39   GLU B C   1 
ATOM   3632  O  O   . GLU B 2  39  ? 47.958  118.045 88.145  1.00 26.41 ? 39   GLU B O   1 
ATOM   3633  C  CB  . GLU B 2  39  ? 50.337  119.536 89.056  1.00 23.37 ? 39   GLU B CB  1 
ATOM   3634  C  CG  . GLU B 2  39  ? 49.591  120.028 90.308  1.00 28.44 ? 39   GLU B CG  1 
ATOM   3635  C  CD  . GLU B 2  39  ? 49.997  119.325 91.606  1.00 30.64 ? 39   GLU B CD  1 
ATOM   3636  O  OE1 . GLU B 2  39  ? 50.773  119.909 92.388  1.00 32.00 ? 39   GLU B OE1 1 
ATOM   3637  O  OE2 . GLU B 2  39  ? 49.491  118.211 91.859  1.00 23.24 ? 39   GLU B OE2 1 
ATOM   3638  N  N   . ASN B 2  40  ? 48.822  116.082 88.872  1.00 27.10 ? 40   ASN B N   1 
ATOM   3639  C  CA  . ASN B 2  40  ? 47.599  115.450 89.383  1.00 28.38 ? 40   ASN B CA  1 
ATOM   3640  C  C   . ASN B 2  40  ? 47.442  115.769 90.863  1.00 28.86 ? 40   ASN B C   1 
ATOM   3641  O  O   . ASN B 2  40  ? 48.369  115.495 91.665  1.00 30.30 ? 40   ASN B O   1 
ATOM   3642  C  CB  . ASN B 2  40  ? 47.556  113.924 89.058  1.00 29.08 ? 40   ASN B CB  1 
ATOM   3643  C  CG  . ASN B 2  40  ? 48.393  113.030 90.034  1.00 37.68 ? 40   ASN B CG  1 
ATOM   3644  O  OD1 . ASN B 2  40  ? 47.926  111.968 90.445  1.00 46.42 ? 40   ASN B OD1 1 
ATOM   3645  N  ND2 . ASN B 2  40  ? 49.633  113.431 90.337  1.00 35.48 ? 40   ASN B ND2 1 
ATOM   3646  N  N   . TYR B 2  41  ? 46.370  116.499 91.185  1.00 27.44 ? 41   TYR B N   1 
ATOM   3647  C  CA  . TYR B 2  41  ? 46.190  117.148 92.496  1.00 26.29 ? 41   TYR B CA  1 
ATOM   3648  C  C   . TYR B 2  41  ? 45.910  116.128 93.642  1.00 24.93 ? 41   TYR B C   1 
ATOM   3649  O  O   . TYR B 2  41  ? 45.010  116.322 94.484  1.00 24.98 ? 41   TYR B O   1 
ATOM   3650  C  CB  . TYR B 2  41  ? 45.128  118.255 92.391  1.00 26.25 ? 41   TYR B CB  1 
ATOM   3651  C  CG  . TYR B 2  41  ? 45.554  119.452 91.562  1.00 27.79 ? 41   TYR B CG  1 
ATOM   3652  C  CD1 . TYR B 2  41  ? 46.211  120.560 92.171  1.00 32.11 ? 41   TYR B CD1 1 
ATOM   3653  C  CD2 . TYR B 2  41  ? 45.211  119.543 90.184  1.00 26.83 ? 41   TYR B CD2 1 
ATOM   3654  C  CE1 . TYR B 2  41  ? 46.548  121.741 91.413  1.00 30.85 ? 41   TYR B CE1 1 
ATOM   3655  C  CE2 . TYR B 2  41  ? 45.551  120.713 89.408  1.00 26.67 ? 41   TYR B CE2 1 
ATOM   3656  C  CZ  . TYR B 2  41  ? 46.233  121.791 90.035  1.00 29.13 ? 41   TYR B CZ  1 
ATOM   3657  O  OH  . TYR B 2  41  ? 46.587  122.905 89.305  1.00 34.74 ? 41   TYR B OH  1 
ATOM   3658  N  N   . ALA B 2  42  ? 46.875  115.220 93.792  1.00 23.27 ? 42   ALA B N   1 
ATOM   3659  C  CA  . ALA B 2  42  ? 46.770  113.961 94.519  1.00 22.15 ? 42   ALA B CA  1 
ATOM   3660  C  C   . ALA B 2  42  ? 47.338  114.167 95.952  1.00 21.40 ? 42   ALA B C   1 
ATOM   3661  O  O   . ALA B 2  42  ? 48.267  114.986 96.106  1.00 21.16 ? 42   ALA B O   1 
ATOM   3662  C  CB  . ALA B 2  42  ? 47.575  112.870 93.772  1.00 21.68 ? 42   ALA B CB  1 
ATOM   3663  N  N   . PRO B 2  43  ? 46.842  113.421 96.979  1.00 20.48 ? 43   PRO B N   1 
ATOM   3664  C  CA  . PRO B 2  43  ? 47.329  113.610 98.364  1.00 19.66 ? 43   PRO B CA  1 
ATOM   3665  C  C   . PRO B 2  43  ? 48.784  113.196 98.581  1.00 18.90 ? 43   PRO B C   1 
ATOM   3666  O  O   . PRO B 2  43  ? 49.433  113.747 99.476  1.00 18.49 ? 43   PRO B O   1 
ATOM   3667  C  CB  . PRO B 2  43  ? 46.389  112.737 99.192  1.00 19.79 ? 43   PRO B CB  1 
ATOM   3668  C  CG  . PRO B 2  43  ? 45.236  112.425 98.282  1.00 22.26 ? 43   PRO B CG  1 
ATOM   3669  C  CD  . PRO B 2  43  ? 45.797  112.367 96.936  1.00 20.11 ? 43   PRO B CD  1 
ATOM   3670  N  N   . ALA B 2  44  ? 49.253  112.224 97.801  1.00 18.99 ? 44   ALA B N   1 
ATOM   3671  C  CA  . ALA B 2  44  ? 50.639  111.774 97.823  1.00 19.48 ? 44   ALA B CA  1 
ATOM   3672  C  C   . ALA B 2  44  ? 51.390  112.247 96.599  1.00 20.02 ? 44   ALA B C   1 
ATOM   3673  O  O   . ALA B 2  44  ? 50.804  112.453 95.507  1.00 20.74 ? 44   ALA B O   1 
ATOM   3674  C  CB  . ALA B 2  44  ? 50.724  110.257 97.951  1.00 19.55 ? 44   ALA B CB  1 
ATOM   3675  N  N   . SER B 2  45  ? 52.680  112.465 96.817  1.00 19.71 ? 45   SER B N   1 
ATOM   3676  C  CA  . SER B 2  45  ? 53.627  112.765 95.770  1.00 19.86 ? 45   SER B CA  1 
ATOM   3677  C  C   . SER B 2  45  ? 54.574  111.620 95.525  1.00 19.64 ? 45   SER B C   1 
ATOM   3678  O  O   . SER B 2  45  ? 54.969  110.933 96.466  1.00 20.21 ? 45   SER B O   1 
ATOM   3679  C  CB  . SER B 2  45  ? 54.411  114.023 96.130  1.00 19.67 ? 45   SER B CB  1 
ATOM   3680  O  OG  . SER B 2  45  ? 53.536  115.097 96.355  1.00 24.85 ? 45   SER B OG  1 
ATOM   3681  N  N   . ARG B 2  46  ? 55.036  111.517 94.278  1.00 19.92 ? 46   ARG B N   1 
ATOM   3682  C  CA  . ARG B 2  46  ? 56.075  110.555 93.879  1.00 20.82 ? 46   ARG B CA  1 
ATOM   3683  C  C   . ARG B 2  46  ? 57.199  111.232 93.111  1.00 21.17 ? 46   ARG B C   1 
ATOM   3684  O  O   . ARG B 2  46  ? 56.933  112.088 92.270  1.00 22.72 ? 46   ARG B O   1 
ATOM   3685  C  CB  . ARG B 2  46  ? 55.467  109.401 93.081  1.00 20.86 ? 46   ARG B CB  1 
ATOM   3686  C  CG  . ARG B 2  46  ? 56.126  108.055 93.337  1.00 26.80 ? 46   ARG B CG  1 
ATOM   3687  C  CD  . ARG B 2  46  ? 55.473  106.888 92.584  1.00 37.23 ? 46   ARG B CD  1 
ATOM   3688  N  NE  . ARG B 2  46  ? 54.811  105.899 93.470  1.00 45.66 ? 46   ARG B NE  1 
ATOM   3689  C  CZ  . ARG B 2  46  ? 53.604  106.034 94.063  1.00 47.13 ? 46   ARG B CZ  1 
ATOM   3690  N  NH1 . ARG B 2  46  ? 52.976  107.213 94.134  1.00 53.73 ? 46   ARG B NH1 1 
ATOM   3691  N  NH2 . ARG B 2  46  ? 53.083  105.002 94.716  1.00 46.30 ? 46   ARG B NH2 1 
ATOM   3692  N  N   . ILE B 2  47  ? 58.428  111.045 93.590  1.00 20.34 ? 47   ILE B N   1 
ATOM   3693  C  CA  . ILE B 2  47  ? 59.640  111.530 92.898  1.00 20.13 ? 47   ILE B CA  1 
ATOM   3694  C  C   . ILE B 2  47  ? 60.535  110.357 92.546  1.00 19.44 ? 47   ILE B C   1 
ATOM   3695  O  O   . ILE B 2  47  ? 60.926  109.565 93.422  1.00 19.19 ? 47   ILE B O   1 
ATOM   3696  C  CB  . ILE B 2  47  ? 60.462  112.627 93.712  1.00 20.58 ? 47   ILE B CB  1 
ATOM   3697  C  CG1 . ILE B 2  47  ? 59.614  113.484 94.705  1.00 27.94 ? 47   ILE B CG1 1 
ATOM   3698  C  CG2 . ILE B 2  47  ? 61.505  113.387 92.806  1.00 34.62 ? 47   ILE B CG2 1 
ATOM   3699  C  CD1 . ILE B 2  47  ? 58.929  114.711 94.174  1.00 22.15 ? 47   ILE B CD1 1 
ATOM   3700  N  N   . GLY B 2  48  ? 60.913  110.301 91.274  1.00 19.10 ? 48   GLY B N   1 
ATOM   3701  C  CA  . GLY B 2  48  ? 61.904  109.360 90.787  1.00 18.60 ? 48   GLY B CA  1 
ATOM   3702  C  C   . GLY B 2  48  ? 63.073  110.051 90.137  1.00 18.14 ? 48   GLY B C   1 
ATOM   3703  O  O   . GLY B 2  48  ? 62.873  110.976 89.361  1.00 17.84 ? 48   GLY B O   1 
ATOM   3704  N  N   . LEU B 2  49  ? 64.285  109.645 90.528  1.00 18.13 ? 49   LEU B N   1 
ATOM   3705  C  CA  . LEU B 2  49  ? 65.494  109.862 89.738  1.00 17.28 ? 49   LEU B CA  1 
ATOM   3706  C  C   . LEU B 2  49  ? 65.936  108.607 88.993  1.00 16.67 ? 49   LEU B C   1 
ATOM   3707  O  O   . LEU B 2  49  ? 66.425  107.624 89.596  1.00 16.88 ? 49   LEU B O   1 
ATOM   3708  C  CB  . LEU B 2  49  ? 66.635  110.484 90.574  1.00 16.73 ? 49   LEU B CB  1 
ATOM   3709  C  CG  . LEU B 2  49  ? 67.877  111.021 89.835  1.00 19.40 ? 49   LEU B CG  1 
ATOM   3710  C  CD1 . LEU B 2  49  ? 67.631  112.336 89.041  1.00 25.88 ? 49   LEU B CD1 1 
ATOM   3711  C  CD2 . LEU B 2  49  ? 69.001  111.228 90.817  1.00 25.00 ? 49   LEU B CD2 1 
ATOM   3712  N  N   . PHE B 2  50  ? 65.870  108.717 87.670  1.00 16.02 ? 50   PHE B N   1 
ATOM   3713  C  CA  . PHE B 2  50  ? 66.150  107.619 86.736  1.00 15.68 ? 50   PHE B CA  1 
ATOM   3714  C  C   . PHE B 2  50  ? 67.514  107.836 86.084  1.00 15.90 ? 50   PHE B C   1 
ATOM   3715  O  O   . PHE B 2  50  ? 67.843  108.958 85.712  1.00 16.02 ? 50   PHE B O   1 
ATOM   3716  C  CB  . PHE B 2  50  ? 65.054  107.583 85.686  1.00 15.46 ? 50   PHE B CB  1 
ATOM   3717  C  CG  . PHE B 2  50  ? 63.737  107.063 86.194  1.00 17.41 ? 50   PHE B CG  1 
ATOM   3718  C  CD1 . PHE B 2  50  ? 62.819  107.927 86.862  1.00 13.49 ? 50   PHE B CD1 1 
ATOM   3719  C  CD2 . PHE B 2  50  ? 63.326  105.759 85.862  1.00 9.31  ? 50   PHE B CD2 1 
ATOM   3720  C  CE1 . PHE B 2  50  ? 61.523  107.468 87.274  1.00 15.93 ? 50   PHE B CE1 1 
ATOM   3721  C  CE2 . PHE B 2  50  ? 62.018  105.280 86.253  1.00 15.39 ? 50   PHE B CE2 1 
ATOM   3722  C  CZ  . PHE B 2  50  ? 61.141  106.124 86.997  1.00 5.82  ? 50   PHE B CZ  1 
ATOM   3723  N  N   . ILE B 2  51  ? 68.358  106.804 86.135  1.00 16.31 ? 51   ILE B N   1 
ATOM   3724  C  CA  . ILE B 2  51  ? 69.806  106.885 85.788  1.00 16.69 ? 51   ILE B CA  1 
ATOM   3725  C  C   . ILE B 2  51  ? 70.165  105.726 84.850  1.00 17.69 ? 51   ILE B C   1 
ATOM   3726  O  O   . ILE B 2  51  ? 69.783  104.565 85.120  1.00 17.90 ? 51   ILE B O   1 
ATOM   3727  C  CB  . ILE B 2  51  ? 70.752  106.838 87.068  1.00 16.02 ? 51   ILE B CB  1 
ATOM   3728  C  CG1 . ILE B 2  51  ? 70.285  107.790 88.178  1.00 21.16 ? 51   ILE B CG1 1 
ATOM   3729  C  CG2 . ILE B 2  51  ? 72.209  107.201 86.709  1.00 15.24 ? 51   ILE B CG2 1 
ATOM   3730  C  CD1 . ILE B 2  51  ? 70.372  107.192 89.549  1.00 12.39 ? 51   ILE B CD1 1 
ATOM   3731  N  N   . LYS B 2  52  ? 71.012  106.037 83.850  1.00 17.92 ? 52   LYS B N   1 
ATOM   3732  C  CA  . LYS B 2  52  ? 71.598  105.074 82.905  1.00 17.74 ? 52   LYS B CA  1 
ATOM   3733  C  C   . LYS B 2  52  ? 72.786  104.422 83.594  1.00 18.41 ? 52   LYS B C   1 
ATOM   3734  O  O   . LYS B 2  52  ? 73.961  104.861 83.433  1.00 20.33 ? 52   LYS B O   1 
ATOM   3735  C  CB  . LYS B 2  52  ? 72.040  105.781 81.620  1.00 17.34 ? 52   LYS B CB  1 
ATOM   3736  C  CG  . LYS B 2  52  ? 70.938  106.186 80.703  1.00 11.39 ? 52   LYS B CG  1 
ATOM   3737  C  CD  . LYS B 2  52  ? 71.439  106.291 79.280  1.00 14.40 ? 52   LYS B CD  1 
ATOM   3738  C  CE  . LYS B 2  52  ? 70.393  106.936 78.403  1.00 19.90 ? 52   LYS B CE  1 
ATOM   3739  N  NZ  . LYS B 2  52  ? 70.921  107.329 77.054  1.00 30.01 ? 52   LYS B NZ  1 
ATOM   3740  N  N   . ALA B 2  53  ? 72.449  103.541 84.533  1.00 16.93 ? 53   ALA B N   1 
ATOM   3741  C  CA  . ALA B 2  53  ? 73.384  102.989 85.503  1.00 16.44 ? 53   ALA B CA  1 
ATOM   3742  C  C   . ALA B 2  53  ? 73.105  101.541 85.870  1.00 16.59 ? 53   ALA B C   1 
ATOM   3743  O  O   . ALA B 2  53  ? 73.865  100.976 86.661  1.00 17.60 ? 53   ALA B O   1 
ATOM   3744  C  CB  . ALA B 2  53  ? 73.434  103.853 86.769  1.00 15.82 ? 53   ALA B CB  1 
ATOM   3745  N  N   . GLY B 2  54  ? 72.199  100.883 85.133  1.00 15.77 ? 54   GLY B N   1 
ATOM   3746  C  CA  . GLY B 2  54  ? 71.938  99.430  85.275  1.00 14.85 ? 54   GLY B CA  1 
ATOM   3747  C  C   . GLY B 2  54  ? 73.139  98.522  84.996  1.00 14.56 ? 54   GLY B C   1 
ATOM   3748  O  O   . GLY B 2  54  ? 74.227  98.991  84.660  1.00 14.41 ? 54   GLY B O   1 
ATOM   3749  N  N   . SER B 2  55  ? 72.960  97.221  85.221  1.00 14.64 ? 55   SER B N   1 
ATOM   3750  C  CA  . SER B 2  55  ? 74.076  96.242  85.213  1.00 14.21 ? 55   SER B CA  1 
ATOM   3751  C  C   . SER B 2  55  ? 74.903  96.144  83.917  1.00 14.74 ? 55   SER B C   1 
ATOM   3752  O  O   . SER B 2  55  ? 76.088  95.792  83.985  1.00 15.47 ? 55   SER B O   1 
ATOM   3753  C  CB  . SER B 2  55  ? 73.580  94.848  85.604  1.00 12.41 ? 55   SER B CB  1 
ATOM   3754  O  OG  . SER B 2  55  ? 72.449  94.552  84.821  1.00 17.48 ? 55   SER B OG  1 
ATOM   3755  N  N   . ARG B 2  56  ? 74.327  96.530  82.768  1.00 14.44 ? 56   ARG B N   1 
ATOM   3756  C  CA  . ARG B 2  56  ? 75.076  96.589  81.489  1.00 15.52 ? 56   ARG B CA  1 
ATOM   3757  C  C   . ARG B 2  56  ? 76.372  97.426  81.479  1.00 16.65 ? 56   ARG B C   1 
ATOM   3758  O  O   . ARG B 2  56  ? 77.212  97.237  80.599  1.00 16.81 ? 56   ARG B O   1 
ATOM   3759  C  CB  . ARG B 2  56  ? 74.171  96.953  80.305  1.00 16.10 ? 56   ARG B CB  1 
ATOM   3760  C  CG  . ARG B 2  56  ? 73.950  98.467  80.108  1.00 8.55  ? 56   ARG B CG  1 
ATOM   3761  C  CD  . ARG B 2  56  ? 73.251  98.852  78.850  1.00 15.35 ? 56   ARG B CD  1 
ATOM   3762  N  NE  . ARG B 2  56  ? 74.091  98.620  77.686  1.00 15.47 ? 56   ARG B NE  1 
ATOM   3763  C  CZ  . ARG B 2  56  ? 73.656  98.269  76.483  1.00 19.02 ? 56   ARG B CZ  1 
ATOM   3764  N  NH1 . ARG B 2  56  ? 72.369  98.370  76.162  1.00 19.75 ? 56   ARG B NH1 1 
ATOM   3765  N  NH2 . ARG B 2  56  ? 74.546  97.979  75.542  1.00 15.13 ? 56   ARG B NH2 1 
ATOM   3766  N  N   . TYR B 2  57  ? 76.457  98.389  82.421  1.00 17.10 ? 57   TYR B N   1 
ATOM   3767  C  CA  . TYR B 2  57  ? 77.583  99.297  82.582  1.00 17.24 ? 57   TYR B CA  1 
ATOM   3768  C  C   . TYR B 2  57  ? 78.702  98.767  83.485  1.00 18.12 ? 57   TYR B C   1 
ATOM   3769  O  O   . TYR B 2  57  ? 79.746  99.422  83.647  1.00 18.74 ? 57   TYR B O   1 
ATOM   3770  C  CB  . TYR B 2  57  ? 77.081  100.691 83.017  1.00 16.44 ? 57   TYR B CB  1 
ATOM   3771  C  CG  . TYR B 2  57  ? 76.097  101.310 82.044  1.00 5.78  ? 57   TYR B CG  1 
ATOM   3772  C  CD1 . TYR B 2  57  ? 74.736  101.383 82.381  1.00 5.50  ? 57   TYR B CD1 1 
ATOM   3773  C  CD2 . TYR B 2  57  ? 76.504  101.713 80.709  1.00 7.49  ? 57   TYR B CD2 1 
ATOM   3774  C  CE1 . TYR B 2  57  ? 73.765  101.853 81.442  1.00 6.28  ? 57   TYR B CE1 1 
ATOM   3775  C  CE2 . TYR B 2  57  ? 75.518  102.169 79.729  1.00 6.99  ? 57   TYR B CE2 1 
ATOM   3776  C  CZ  . TYR B 2  57  ? 74.170  102.300 80.154  1.00 14.72 ? 57   TYR B CZ  1 
ATOM   3777  O  OH  . TYR B 2  57  ? 73.211  102.847 79.339  1.00 20.30 ? 57   TYR B OH  1 
ATOM   3778  N  N   . GLU B 2  58  ? 78.495  97.575  84.038  1.00 18.33 ? 58   GLU B N   1 
ATOM   3779  C  CA  . GLU B 2  58  ? 79.572  96.790  84.641  1.00 18.70 ? 58   GLU B CA  1 
ATOM   3780  C  C   . GLU B 2  58  ? 80.434  96.124  83.571  1.00 19.25 ? 58   GLU B C   1 
ATOM   3781  O  O   . GLU B 2  58  ? 79.965  95.829  82.455  1.00 19.95 ? 58   GLU B O   1 
ATOM   3782  C  CB  . GLU B 2  58  ? 79.016  95.732  85.579  1.00 18.94 ? 58   GLU B CB  1 
ATOM   3783  C  CG  . GLU B 2  58  ? 78.284  96.259  86.809  1.00 15.22 ? 58   GLU B CG  1 
ATOM   3784  C  CD  . GLU B 2  58  ? 77.449  95.195  87.530  1.00 21.40 ? 58   GLU B CD  1 
ATOM   3785  O  OE1 . GLU B 2  58  ? 76.634  95.602  88.359  1.00 15.28 ? 58   GLU B OE1 1 
ATOM   3786  O  OE2 . GLU B 2  58  ? 77.721  93.974  87.425  1.00 14.90 ? 58   GLU B OE2 1 
ATOM   3787  N  N   . ASN B 2  59  ? 81.715  95.984  83.888  1.00 18.49 ? 59   ASN B N   1 
ATOM   3788  C  CA  . ASN B 2  59  ? 82.626  95.131  83.140  1.00 18.09 ? 59   ASN B CA  1 
ATOM   3789  C  C   . ASN B 2  59  ? 83.033  93.899  83.985  1.00 17.56 ? 59   ASN B C   1 
ATOM   3790  O  O   . ASN B 2  59  ? 82.681  93.822  85.166  1.00 17.16 ? 59   ASN B O   1 
ATOM   3791  C  CB  . ASN B 2  59  ? 83.865  95.943  82.651  1.00 17.36 ? 59   ASN B CB  1 
ATOM   3792  C  CG  . ASN B 2  59  ? 84.560  96.681  83.768  1.00 29.66 ? 59   ASN B CG  1 
ATOM   3793  O  OD1 . ASN B 2  59  ? 85.148  96.079  84.670  1.00 33.17 ? 59   ASN B OD1 1 
ATOM   3794  N  ND2 . ASN B 2  59  ? 84.486  98.004  83.724  1.00 47.45 ? 59   ASN B ND2 1 
ATOM   3795  N  N   . SER B 2  60  ? 83.902  93.059  83.408  1.00 17.54 ? 60   SER B N   1 
ATOM   3796  C  CA  . SER B 2  60  ? 84.574  91.906  84.057  1.00 18.15 ? 60   SER B CA  1 
ATOM   3797  C  C   . SER B 2  60  ? 85.290  92.157  85.396  1.00 18.16 ? 60   SER B C   1 
ATOM   3798  O  O   . SER B 2  60  ? 85.500  91.216  86.174  1.00 17.76 ? 60   SER B O   1 
ATOM   3799  C  CB  . SER B 2  60  ? 85.576  91.302  83.082  1.00 17.57 ? 60   SER B CB  1 
ATOM   3800  O  OG  . SER B 2  60  ? 84.889  90.687  82.032  1.00 43.21 ? 60   SER B OG  1 
ATOM   3801  N  N   . ASN B 2  61  ? 85.762  93.389  85.599  1.00 18.86 ? 61   ASN B N   1 
ATOM   3802  C  CA  . ASN B 2  61  ? 86.524  93.735  86.795  1.00 18.80 ? 61   ASN B CA  1 
ATOM   3803  C  C   . ASN B 2  61  ? 85.709  94.167  87.990  1.00 19.34 ? 61   ASN B C   1 
ATOM   3804  O  O   . ASN B 2  61  ? 86.186  94.025  89.117  1.00 21.73 ? 61   ASN B O   1 
ATOM   3805  C  CB  . ASN B 2  61  ? 87.679  94.685  86.475  1.00 19.09 ? 61   ASN B CB  1 
ATOM   3806  C  CG  . ASN B 2  61  ? 88.692  94.072  85.506  1.00 23.16 ? 61   ASN B CG  1 
ATOM   3807  O  OD1 . ASN B 2  61  ? 88.960  92.862  85.531  1.00 24.47 ? 61   ASN B OD1 1 
ATOM   3808  N  ND2 . ASN B 2  61  ? 89.282  94.912  84.672  1.00 24.99 ? 61   ASN B ND2 1 
ATOM   3809  N  N   . ASN B 2  62  ? 84.410  94.407  87.772  1.00 17.88 ? 62   ASN B N   1 
ATOM   3810  C  CA  . ASN B 2  62  ? 83.525  94.946  88.801  1.00 17.09 ? 62   ASN B CA  1 
ATOM   3811  C  C   . ASN B 2  62  ? 82.089  94.387  88.833  1.00 17.14 ? 62   ASN B C   1 
ATOM   3812  O  O   . ASN B 2  62  ? 81.154  95.075  89.281  1.00 17.73 ? 62   ASN B O   1 
ATOM   3813  C  CB  . ASN B 2  62  ? 83.580  96.523  88.830  1.00 16.01 ? 62   ASN B CB  1 
ATOM   3814  C  CG  . ASN B 2  62  ? 82.720  97.210  87.709  1.00 13.37 ? 62   ASN B CG  1 
ATOM   3815  O  OD1 . ASN B 2  62  ? 82.281  96.578  86.746  1.00 11.95 ? 62   ASN B OD1 1 
ATOM   3816  N  ND2 . ASN B 2  62  ? 82.602  98.543  87.795  1.00 15.15 ? 62   ASN B ND2 1 
ATOM   3817  N  N   . LEU B 2  63  ? 81.917  93.117  88.467  1.00 17.41 ? 63   LEU B N   1 
ATOM   3818  C  CA  . LEU B 2  63  ? 80.571  92.526  88.434  1.00 17.29 ? 63   LEU B CA  1 
ATOM   3819  C  C   . LEU B 2  63  ? 79.873  92.510  89.800  1.00 17.42 ? 63   LEU B C   1 
ATOM   3820  O  O   . LEU B 2  63  ? 80.540  92.416  90.849  1.00 17.33 ? 63   LEU B O   1 
ATOM   3821  C  CB  . LEU B 2  63  ? 80.551  91.154  87.764  1.00 17.77 ? 63   LEU B CB  1 
ATOM   3822  C  CG  . LEU B 2  63  ? 81.083  90.989  86.337  1.00 23.29 ? 63   LEU B CG  1 
ATOM   3823  C  CD1 . LEU B 2  63  ? 81.309  89.489  86.069  1.00 20.98 ? 63   LEU B CD1 1 
ATOM   3824  C  CD2 . LEU B 2  63  ? 80.174  91.621  85.276  1.00 8.90  ? 63   LEU B CD2 1 
ATOM   3825  N  N   . GLY B 2  64  ? 78.600  92.900  89.781  1.00 17.45 ? 64   GLY B N   1 
ATOM   3826  C  CA  . GLY B 2  64  ? 77.785  92.968  90.993  1.00 16.81 ? 64   GLY B CA  1 
ATOM   3827  C  C   . GLY B 2  64  ? 77.811  94.319  91.707  1.00 16.78 ? 64   GLY B C   1 
ATOM   3828  O  O   . GLY B 2  64  ? 77.056  94.502  92.661  1.00 16.48 ? 64   GLY B O   1 
ATOM   3829  N  N   . THR B 2  65  ? 78.687  95.245  91.277  1.00 17.77 ? 65   THR B N   1 
ATOM   3830  C  CA  . THR B 2  65  ? 78.768  96.611  91.856  1.00 18.99 ? 65   THR B CA  1 
ATOM   3831  C  C   . THR B 2  65  ? 77.390  97.310  91.892  1.00 21.01 ? 65   THR B C   1 
ATOM   3832  O  O   . THR B 2  65  ? 76.993  97.809  92.959  1.00 22.93 ? 65   THR B O   1 
ATOM   3833  C  CB  . THR B 2  65  ? 79.841  97.481  91.136  1.00 19.01 ? 65   THR B CB  1 
ATOM   3834  O  OG1 . THR B 2  65  ? 81.154  96.895  91.311  1.00 16.28 ? 65   THR B OG1 1 
ATOM   3835  C  CG2 . THR B 2  65  ? 79.977  98.863  91.786  1.00 12.79 ? 65   THR B CG2 1 
ATOM   3836  N  N   . SER B 2  66  ? 76.606  97.175  90.810  1.00 20.72 ? 66   SER B N   1 
ATOM   3837  C  CA  . SER B 2  66  ? 75.288  97.837  90.735  1.00 20.32 ? 66   SER B CA  1 
ATOM   3838  C  C   . SER B 2  66  ? 74.225  97.149  91.593  1.00 19.36 ? 66   SER B C   1 
ATOM   3839  O  O   . SER B 2  66  ? 73.351  97.840  92.138  1.00 19.02 ? 66   SER B O   1 
ATOM   3840  C  CB  . SER B 2  66  ? 74.821  98.085  89.287  1.00 20.27 ? 66   SER B CB  1 
ATOM   3841  O  OG  . SER B 2  66  ? 74.304  96.886  88.705  1.00 17.45 ? 66   SER B OG  1 
ATOM   3842  N  N   . HIS B 2  67  ? 74.407  95.838  91.841  1.00 19.06 ? 67   HIS B N   1 
ATOM   3843  C  CA  . HIS B 2  67  ? 73.654  95.123  92.870  1.00 18.98 ? 67   HIS B CA  1 
ATOM   3844  C  C   . HIS B 2  67  ? 73.907  95.677  94.263  1.00 18.46 ? 67   HIS B C   1 
ATOM   3845  O  O   . HIS B 2  67  ? 72.973  96.188  94.886  1.00 18.74 ? 67   HIS B O   1 
ATOM   3846  C  CB  . HIS B 2  67  ? 73.823  93.576  92.821  1.00 19.60 ? 67   HIS B CB  1 
ATOM   3847  C  CG  . HIS B 2  67  ? 72.862  92.821  93.710  1.00 12.11 ? 67   HIS B CG  1 
ATOM   3848  N  ND1 . HIS B 2  67  ? 73.017  91.476  93.994  1.00 14.53 ? 67   HIS B ND1 1 
ATOM   3849  C  CD2 . HIS B 2  67  ? 71.790  93.229  94.438  1.00 8.41  ? 67   HIS B CD2 1 
ATOM   3850  C  CE1 . HIS B 2  67  ? 71.965  91.050  94.672  1.00 9.25  ? 67   HIS B CE1 1 
ATOM   3851  N  NE2 . HIS B 2  67  ? 71.236  92.099  95.011  1.00 16.95 ? 67   HIS B NE2 1 
ATOM   3852  N  N   . LEU B 2  68  ? 75.174  95.729  94.666  1.00 18.09 ? 68   LEU B N   1 
ATOM   3853  C  CA  . LEU B 2  68  ? 75.525  96.315  95.937  1.00 17.98 ? 68   LEU B CA  1 
ATOM   3854  C  C   . LEU B 2  68  ? 75.103  97.788  96.136  1.00 18.20 ? 68   LEU B C   1 
ATOM   3855  O  O   . LEU B 2  68  ? 74.419  98.065  97.129  1.00 18.94 ? 68   LEU B O   1 
ATOM   3856  C  CB  . LEU B 2  68  ? 76.962  95.979  96.380  1.00 17.49 ? 68   LEU B CB  1 
ATOM   3857  C  CG  . LEU B 2  68  ? 77.306  96.340  97.840  1.00 14.78 ? 68   LEU B CG  1 
ATOM   3858  C  CD1 . LEU B 2  68  ? 76.406  95.701  98.884  1.00 5.41  ? 68   LEU B CD1 1 
ATOM   3859  C  CD2 . LEU B 2  68  ? 78.711  96.074  98.134  1.00 20.34 ? 68   LEU B CD2 1 
ATOM   3860  N  N   . LEU B 2  69  ? 75.199  98.579  95.055  1.00 17.55 ? 69   LEU B N   1 
ATOM   3861  C  CA  . LEU B 2  69  ? 74.626  99.934  94.973  1.00 17.38 ? 69   LEU B CA  1 
ATOM   3862  C  C   . LEU B 2  69  ? 73.104  99.978  95.197  1.00 17.92 ? 69   LEU B C   1 
ATOM   3863  O  O   . LEU B 2  69  ? 72.672  100.646 96.126  1.00 19.50 ? 69   LEU B O   1 
ATOM   3864  C  CB  . LEU B 2  69  ? 74.980  100.613 93.652  1.00 16.78 ? 69   LEU B CB  1 
ATOM   3865  C  CG  . LEU B 2  69  ? 75.587  102.017 93.554  1.00 13.89 ? 69   LEU B CG  1 
ATOM   3866  C  CD1 . LEU B 2  69  ? 75.543  102.464 92.157  1.00 10.08 ? 69   LEU B CD1 1 
ATOM   3867  C  CD2 . LEU B 2  69  ? 75.052  103.101 94.436  1.00 17.73 ? 69   LEU B CD2 1 
ATOM   3868  N  N   . ARG B 2  70  ? 72.363  99.072  94.540  1.00 16.19 ? 70   ARG B N   1 
ATOM   3869  C  CA  . ARG B 2  70  ? 70.901  98.975  94.687  1.00 15.71 ? 70   ARG B CA  1 
ATOM   3870  C  C   . ARG B 2  70  ? 70.488  98.707  96.179  1.00 16.39 ? 70   ARG B C   1 
ATOM   3871  O  O   . ARG B 2  70  ? 69.605  99.387  96.700  1.00 15.80 ? 70   ARG B O   1 
ATOM   3872  C  CB  . ARG B 2  70  ? 70.368  97.934  93.693  1.00 15.37 ? 70   ARG B CB  1 
ATOM   3873  C  CG  . ARG B 2  70  ? 68.934  97.404  93.867  1.00 22.20 ? 70   ARG B CG  1 
ATOM   3874  C  CD  . ARG B 2  70  ? 68.436  96.691  92.658  1.00 15.80 ? 70   ARG B CD  1 
ATOM   3875  N  NE  . ARG B 2  70  ? 68.726  95.267  92.698  1.00 11.20 ? 70   ARG B NE  1 
ATOM   3876  C  CZ  . ARG B 2  70  ? 69.543  94.594  91.884  1.00 12.43 ? 70   ARG B CZ  1 
ATOM   3877  N  NH1 . ARG B 2  70  ? 70.360  95.214  91.038  1.00 18.18 ? 70   ARG B NH1 1 
ATOM   3878  N  NH2 . ARG B 2  70  ? 69.592  93.270  91.982  1.00 11.56 ? 70   ARG B NH2 1 
ATOM   3879  N  N   . LEU B 2  71  ? 71.325  97.934  96.878  1.00 17.50 ? 71   LEU B N   1 
ATOM   3880  C  CA  . LEU B 2  71  ? 71.193  97.607  98.303  1.00 18.11 ? 71   LEU B CA  1 
ATOM   3881  C  C   . LEU B 2  71  ? 71.723  98.668  99.300  1.00 19.42 ? 71   LEU B C   1 
ATOM   3882  O  O   . LEU B 2  71  ? 71.392  98.576  100.501 1.00 21.11 ? 71   LEU B O   1 
ATOM   3883  C  CB  . LEU B 2  71  ? 71.815  96.207  98.600  1.00 17.40 ? 71   LEU B CB  1 
ATOM   3884  C  CG  . LEU B 2  71  ? 71.424  94.934  97.826  1.00 15.15 ? 71   LEU B CG  1 
ATOM   3885  C  CD1 . LEU B 2  71  ? 71.996  93.672  98.433  1.00 13.68 ? 71   LEU B CD1 1 
ATOM   3886  C  CD2 . LEU B 2  71  ? 69.946  94.745  97.544  1.00 16.09 ? 71   LEU B CD2 1 
ATOM   3887  N  N   . ALA B 2  72  ? 72.373  99.734  98.792  1.00 18.23 ? 72   ALA B N   1 
ATOM   3888  C  CA  . ALA B 2  72  ? 73.108  100.719 99.627  1.00 17.69 ? 72   ALA B CA  1 
ATOM   3889  C  C   . ALA B 2  72  ? 72.445  102.072 99.830  1.00 18.46 ? 72   ALA B C   1 
ATOM   3890  O  O   . ALA B 2  72  ? 73.061  102.965 100.430 1.00 17.18 ? 72   ALA B O   1 
ATOM   3891  C  CB  . ALA B 2  72  ? 74.571  100.902 99.119  1.00 16.67 ? 72   ALA B CB  1 
ATOM   3892  N  N   . SER B 2  73  ? 71.128  102.145 99.582  1.00 19.28 ? 73   SER B N   1 
ATOM   3893  C  CA  . SER B 2  73  ? 70.447  103.445 99.501  1.00 19.14 ? 73   SER B CA  1 
ATOM   3894  C  C   . SER B 2  73  ? 70.203  104.153 100.836 1.00 19.26 ? 73   SER B C   1 
ATOM   3895  O  O   . SER B 2  73  ? 69.998  105.367 100.856 1.00 19.44 ? 73   SER B O   1 
ATOM   3896  C  CB  . SER B 2  73  ? 69.173  103.368 98.671  1.00 18.95 ? 73   SER B CB  1 
ATOM   3897  O  OG  . SER B 2  73  ? 68.145  102.741 99.389  1.00 15.97 ? 73   SER B OG  1 
ATOM   3898  N  N   . SER B 2  74  ? 70.086  103.386 101.921 1.00 18.54 ? 74   SER B N   1 
ATOM   3899  C  CA  . SER B 2  74  ? 70.007  103.969 103.270 1.00 17.38 ? 74   SER B CA  1 
ATOM   3900  C  C   . SER B 2  74  ? 71.337  104.005 104.061 1.00 16.47 ? 74   SER B C   1 
ATOM   3901  O  O   . SER B 2  74  ? 71.325  104.145 105.277 1.00 16.57 ? 74   SER B O   1 
ATOM   3902  C  CB  . SER B 2  74  ? 68.863  103.326 104.060 1.00 17.34 ? 74   SER B CB  1 
ATOM   3903  O  OG  . SER B 2  74  ? 69.224  102.037 104.429 1.00 14.19 ? 74   SER B OG  1 
ATOM   3904  N  N   . LEU B 2  75  ? 72.472  103.956 103.357 1.00 15.60 ? 75   LEU B N   1 
ATOM   3905  C  CA  . LEU B 2  75  ? 73.775  104.140 103.982 1.00 15.80 ? 75   LEU B CA  1 
ATOM   3906  C  C   . LEU B 2  75  ? 74.129  105.626 104.090 1.00 16.94 ? 75   LEU B C   1 
ATOM   3907  O  O   . LEU B 2  75  ? 73.445  106.473 103.495 1.00 17.78 ? 75   LEU B O   1 
ATOM   3908  C  CB  . LEU B 2  75  ? 74.862  103.346 103.242 1.00 16.06 ? 75   LEU B CB  1 
ATOM   3909  C  CG  . LEU B 2  75  ? 74.892  101.788 103.104 1.00 17.46 ? 75   LEU B CG  1 
ATOM   3910  C  CD1 . LEU B 2  75  ? 76.290  101.286 102.926 1.00 15.21 ? 75   LEU B CD1 1 
ATOM   3911  C  CD2 . LEU B 2  75  ? 74.188  100.968 104.157 1.00 24.78 ? 75   LEU B CD2 1 
ATOM   3912  N  N   . THR B 2  76  ? 75.078  105.936 104.977 1.00 16.28 ? 76   THR B N   1 
ATOM   3913  C  CA  . THR B 2  76  ? 75.454  107.305 105.328 1.00 16.49 ? 76   THR B CA  1 
ATOM   3914  C  C   . THR B 2  76  ? 75.974  108.119 104.137 1.00 16.47 ? 76   THR B C   1 
ATOM   3915  O  O   . THR B 2  76  ? 76.663  107.574 103.255 1.00 15.97 ? 76   THR B O   1 
ATOM   3916  C  CB  . THR B 2  76  ? 76.450  107.299 106.510 1.00 16.65 ? 76   THR B CB  1 
ATOM   3917  O  OG1 . THR B 2  76  ? 75.857  106.584 107.610 1.00 13.35 ? 76   THR B OG1 1 
ATOM   3918  C  CG2 . THR B 2  76  ? 76.654  108.700 107.090 1.00 2.45  ? 76   THR B CG2 1 
ATOM   3919  N  N   . THR B 2  77  ? 75.405  109.326 104.043 1.00 16.13 ? 77   THR B N   1 
ATOM   3920  C  CA  . THR B 2  77  ? 75.684  110.357 103.042 1.00 16.95 ? 77   THR B CA  1 
ATOM   3921  C  C   . THR B 2  77  ? 76.294  111.610 103.743 1.00 17.63 ? 77   THR B C   1 
ATOM   3922  O  O   . THR B 2  77  ? 76.168  111.751 104.981 1.00 17.91 ? 77   THR B O   1 
ATOM   3923  C  CB  . THR B 2  77  ? 74.366  110.787 102.286 1.00 17.01 ? 77   THR B CB  1 
ATOM   3924  O  OG1 . THR B 2  77  ? 73.535  111.551 103.166 1.00 15.69 ? 77   THR B OG1 1 
ATOM   3925  C  CG2 . THR B 2  77  ? 73.482  109.578 101.873 1.00 20.92 ? 77   THR B CG2 1 
ATOM   3926  N  N   . LYS B 2  78  ? 76.805  112.561 102.944 1.00 17.67 ? 78   LYS B N   1 
ATOM   3927  C  CA  . LYS B 2  78  ? 77.370  113.819 103.461 1.00 17.91 ? 78   LYS B CA  1 
ATOM   3928  C  C   . LYS B 2  78  ? 76.372  114.702 104.234 1.00 17.36 ? 78   LYS B C   1 
ATOM   3929  O  O   . LYS B 2  78  ? 76.790  115.439 105.146 1.00 17.71 ? 78   LYS B O   1 
ATOM   3930  C  CB  . LYS B 2  78  ? 78.061  114.624 102.350 1.00 18.83 ? 78   LYS B CB  1 
ATOM   3931  C  CG  . LYS B 2  78  ? 79.500  114.207 102.058 1.00 30.18 ? 78   LYS B CG  1 
ATOM   3932  C  CD  . LYS B 2  78  ? 79.605  113.474 100.718 1.00 34.81 ? 78   LYS B CD  1 
ATOM   3933  C  CE  . LYS B 2  78  ? 80.908  113.786 99.986  1.00 38.10 ? 78   LYS B CE  1 
ATOM   3934  N  NZ  . LYS B 2  78  ? 80.678  114.378 98.631  1.00 36.33 ? 78   LYS B NZ  1 
ATOM   3935  N  N   . GLY B 2  79  ? 75.075  114.626 103.874 1.00 16.27 ? 79   GLY B N   1 
ATOM   3936  C  CA  . GLY B 2  79  ? 74.042  115.517 104.414 1.00 15.67 ? 79   GLY B CA  1 
ATOM   3937  C  C   . GLY B 2  79  ? 73.070  114.884 105.397 1.00 16.72 ? 79   GLY B C   1 
ATOM   3938  O  O   . GLY B 2  79  ? 72.282  115.621 106.031 1.00 16.51 ? 79   GLY B O   1 
ATOM   3939  N  N   . ALA B 2  80  ? 73.006  113.534 105.382 1.00 16.96 ? 80   ALA B N   1 
ATOM   3940  C  CA  . ALA B 2  80  ? 72.161  112.719 106.264 1.00 17.70 ? 80   ALA B CA  1 
ATOM   3941  C  C   . ALA B 2  80  ? 72.844  111.388 106.604 1.00 18.04 ? 80   ALA B C   1 
ATOM   3942  O  O   . ALA B 2  80  ? 73.302  110.673 105.707 1.00 18.45 ? 80   ALA B O   1 
ATOM   3943  C  CB  . ALA B 2  80  ? 70.809  112.453 105.599 1.00 18.11 ? 80   ALA B CB  1 
ATOM   3944  N  N   . SER B 2  81  ? 72.835  111.038 107.890 1.00 18.17 ? 81   SER B N   1 
ATOM   3945  C  CA  . SER B 2  81  ? 73.303  109.727 108.377 1.00 18.55 ? 81   SER B CA  1 
ATOM   3946  C  C   . SER B 2  81  ? 72.376  108.566 107.941 1.00 19.16 ? 81   SER B C   1 
ATOM   3947  O  O   . SER B 2  81  ? 71.180  108.783 107.631 1.00 19.18 ? 81   SER B O   1 
ATOM   3948  C  CB  . SER B 2  81  ? 73.505  109.767 109.904 1.00 18.26 ? 81   SER B CB  1 
ATOM   3949  O  OG  . SER B 2  81  ? 72.261  109.789 110.584 1.00 18.88 ? 81   SER B OG  1 
ATOM   3950  N  N   . SER B 2  82  ? 72.906  107.339 107.993 1.00 19.52 ? 82   SER B N   1 
ATOM   3951  C  CA  . SER B 2  82  ? 72.099  106.127 107.849 1.00 19.55 ? 82   SER B CA  1 
ATOM   3952  C  C   . SER B 2  82  ? 70.815  106.113 108.712 1.00 19.76 ? 82   SER B C   1 
ATOM   3953  O  O   . SER B 2  82  ? 69.685  106.094 108.155 1.00 20.15 ? 82   SER B O   1 
ATOM   3954  C  CB  . SER B 2  82  ? 72.945  104.880 108.077 1.00 20.13 ? 82   SER B CB  1 
ATOM   3955  O  OG  . SER B 2  82  ? 72.191  103.733 107.720 1.00 24.45 ? 82   SER B OG  1 
ATOM   3956  N  N   . PHE B 2  83  ? 71.011  106.394 110.006 1.00 19.26 ? 83   PHE B N   1 
ATOM   3957  C  CA  . PHE B 2  83  ? 69.961  106.580 111.006 1.00 18.73 ? 83   PHE B CA  1 
ATOM   3958  C  C   . PHE B 2  83  ? 68.934  107.653 110.634 1.00 18.97 ? 83   PHE B C   1 
ATOM   3959  O  O   . PHE B 2  83  ? 67.748  107.391 110.732 1.00 18.41 ? 83   PHE B O   1 
ATOM   3960  C  CB  . PHE B 2  83  ? 70.602  106.849 112.388 1.00 18.40 ? 83   PHE B CB  1 
ATOM   3961  C  CG  . PHE B 2  83  ? 69.620  106.954 113.517 1.00 19.31 ? 83   PHE B CG  1 
ATOM   3962  C  CD1 . PHE B 2  83  ? 69.136  105.790 114.164 1.00 18.48 ? 83   PHE B CD1 1 
ATOM   3963  C  CD2 . PHE B 2  83  ? 69.192  108.229 113.978 1.00 18.31 ? 83   PHE B CD2 1 
ATOM   3964  C  CE1 . PHE B 2  83  ? 68.161  105.885 115.211 1.00 18.96 ? 83   PHE B CE1 1 
ATOM   3965  C  CE2 . PHE B 2  83  ? 68.197  108.345 115.006 1.00 19.31 ? 83   PHE B CE2 1 
ATOM   3966  C  CZ  . PHE B 2  83  ? 67.697  107.167 115.634 1.00 16.23 ? 83   PHE B CZ  1 
ATOM   3967  N  N   . LYS B 2  84  ? 69.401  108.841 110.198 1.00 20.01 ? 84   LYS B N   1 
ATOM   3968  C  CA  . LYS B 2  84  ? 68.506  109.938 109.761 1.00 19.31 ? 84   LYS B CA  1 
ATOM   3969  C  C   . LYS B 2  84  ? 67.610  109.588 108.566 1.00 18.98 ? 84   LYS B C   1 
ATOM   3970  O  O   . LYS B 2  84  ? 66.410  109.910 108.591 1.00 19.19 ? 84   LYS B O   1 
ATOM   3971  C  CB  . LYS B 2  84  ? 69.243  111.259 109.528 1.00 18.90 ? 84   LYS B CB  1 
ATOM   3972  C  CG  . LYS B 2  84  ? 68.291  112.482 109.596 1.00 8.81  ? 84   LYS B CG  1 
ATOM   3973  C  CD  . LYS B 2  84  ? 68.993  113.801 109.343 1.00 18.65 ? 84   LYS B CD  1 
ATOM   3974  C  CE  . LYS B 2  84  ? 67.975  114.915 109.133 1.00 14.11 ? 84   LYS B CE  1 
ATOM   3975  N  NZ  . LYS B 2  84  ? 68.652  116.248 109.116 1.00 29.52 ? 84   LYS B NZ  1 
ATOM   3976  N  N   . ILE B 2  85  ? 68.202  108.973 107.537 1.00 18.70 ? 85   ILE B N   1 
ATOM   3977  C  CA  . ILE B 2  85  ? 67.470  108.511 106.339 1.00 19.53 ? 85   ILE B CA  1 
ATOM   3978  C  C   . ILE B 2  85  ? 66.283  107.593 106.697 1.00 19.79 ? 85   ILE B C   1 
ATOM   3979  O  O   . ILE B 2  85  ? 65.126  108.008 106.504 1.00 19.53 ? 85   ILE B O   1 
ATOM   3980  C  CB  . ILE B 2  85  ? 68.432  107.903 105.237 1.00 19.70 ? 85   ILE B CB  1 
ATOM   3981  C  CG1 . ILE B 2  85  ? 69.419  108.988 104.727 1.00 17.38 ? 85   ILE B CG1 1 
ATOM   3982  C  CG2 . ILE B 2  85  ? 67.631  107.354 104.022 1.00 13.35 ? 85   ILE B CG2 1 
ATOM   3983  C  CD1 . ILE B 2  85  ? 70.727  108.423 104.130 1.00 14.04 ? 85   ILE B CD1 1 
ATOM   3984  N  N   . THR B 2  86  ? 66.580  106.590 107.528 1.00 20.42 ? 86   THR B N   1 
ATOM   3985  C  CA  . THR B 2  86  ? 65.616  105.549 107.953 1.00 20.67 ? 86   THR B CA  1 
ATOM   3986  C  C   . THR B 2  86  ? 64.494  106.136 108.847 1.00 20.95 ? 86   THR B C   1 
ATOM   3987  O  O   . THR B 2  86  ? 63.325  106.035 108.481 1.00 21.33 ? 86   THR B O   1 
ATOM   3988  C  CB  . THR B 2  86  ? 66.366  104.405 108.653 1.00 20.96 ? 86   THR B CB  1 
ATOM   3989  O  OG1 . THR B 2  86  ? 67.450  103.968 107.815 1.00 25.03 ? 86   THR B OG1 1 
ATOM   3990  C  CG2 . THR B 2  86  ? 65.473  103.133 108.786 1.00 23.72 ? 86   THR B CG2 1 
ATOM   3991  N  N   . ARG B 2  87  ? 64.888  106.962 109.821 1.00 20.41 ? 87   ARG B N   1 
ATOM   3992  C  CA  . ARG B 2  87  ? 63.984  107.572 110.793 1.00 20.19 ? 87   ARG B CA  1 
ATOM   3993  C  C   . ARG B 2  87  ? 63.167  108.746 110.263 1.00 19.73 ? 87   ARG B C   1 
ATOM   3994  O  O   . ARG B 2  87  ? 61.968  108.776 110.469 1.00 20.27 ? 87   ARG B O   1 
ATOM   3995  C  CB  . ARG B 2  87  ? 64.725  107.948 112.091 1.00 20.67 ? 87   ARG B CB  1 
ATOM   3996  C  CG  . ARG B 2  87  ? 65.269  106.757 112.888 1.00 22.76 ? 87   ARG B CG  1 
ATOM   3997  C  CD  . ARG B 2  87  ? 64.199  105.847 113.490 1.00 19.66 ? 87   ARG B CD  1 
ATOM   3998  N  NE  . ARG B 2  87  ? 64.752  104.888 114.445 1.00 18.95 ? 87   ARG B NE  1 
ATOM   3999  C  CZ  . ARG B 2  87  ? 64.826  105.080 115.760 1.00 14.68 ? 87   ARG B CZ  1 
ATOM   4000  N  NH1 . ARG B 2  87  ? 64.344  106.183 116.328 1.00 7.25  ? 87   ARG B NH1 1 
ATOM   4001  N  NH2 . ARG B 2  87  ? 65.448  104.187 116.509 1.00 10.85 ? 87   ARG B NH2 1 
ATOM   4002  N  N   . GLY B 2  88  ? 63.811  109.632 109.503 1.00 19.19 ? 88   GLY B N   1 
ATOM   4003  C  CA  . GLY B 2  88  ? 63.184  110.765 108.841 1.00 18.51 ? 88   GLY B CA  1 
ATOM   4004  C  C   . GLY B 2  88  ? 62.162  110.415 107.785 1.00 18.12 ? 88   GLY B C   1 
ATOM   4005  O  O   . GLY B 2  88  ? 61.093  111.014 107.778 1.00 17.34 ? 88   GLY B O   1 
ATOM   4006  N  N   . ILE B 2  89  ? 62.477  109.424 106.937 1.00 18.81 ? 89   ILE B N   1 
ATOM   4007  C  CA  . ILE B 2  89  ? 61.510  108.826 105.982 1.00 18.87 ? 89   ILE B CA  1 
ATOM   4008  C  C   . ILE B 2  89  ? 60.331  108.137 106.685 1.00 19.10 ? 89   ILE B C   1 
ATOM   4009  O  O   . ILE B 2  89  ? 59.168  108.468 106.393 1.00 19.45 ? 89   ILE B O   1 
ATOM   4010  C  CB  . ILE B 2  89  ? 62.219  107.929 104.860 1.00 18.49 ? 89   ILE B CB  1 
ATOM   4011  C  CG1 . ILE B 2  89  ? 63.145  108.808 103.999 1.00 24.05 ? 89   ILE B CG1 1 
ATOM   4012  C  CG2 . ILE B 2  89  ? 61.198  107.310 103.915 1.00 19.81 ? 89   ILE B CG2 1 
ATOM   4013  C  CD1 . ILE B 2  89  ? 64.150  108.082 103.104 1.00 16.52 ? 89   ILE B CD1 1 
ATOM   4014  N  N   . GLU B 2  90  ? 60.639  107.307 107.689 1.00 19.36 ? 90   GLU B N   1 
ATOM   4015  C  CA  . GLU B 2  90  ? 59.612  106.564 108.455 1.00 19.26 ? 90   GLU B CA  1 
ATOM   4016  C  C   . GLU B 2  90  ? 58.698  107.439 109.307 1.00 18.86 ? 90   GLU B C   1 
ATOM   4017  O  O   . GLU B 2  90  ? 57.484  107.204 109.301 1.00 18.63 ? 90   GLU B O   1 
ATOM   4018  C  CB  . GLU B 2  90  ? 60.198  105.441 109.288 1.00 19.14 ? 90   GLU B CB  1 
ATOM   4019  C  CG  . GLU B 2  90  ? 60.571  104.210 108.494 1.00 20.43 ? 90   GLU B CG  1 
ATOM   4020  C  CD  . GLU B 2  90  ? 60.890  103.000 109.368 1.00 27.48 ? 90   GLU B CD  1 
ATOM   4021  O  OE1 . GLU B 2  90  ? 61.813  103.090 110.222 1.00 24.53 ? 90   GLU B OE1 1 
ATOM   4022  O  OE2 . GLU B 2  90  ? 60.253  101.929 109.160 1.00 21.84 ? 90   GLU B OE2 1 
ATOM   4023  N  N   . ALA B 2  91  ? 59.245  108.557 109.827 1.00 18.53 ? 91   ALA B N   1 
ATOM   4024  C  CA  . ALA B 2  91  ? 58.483  109.559 110.619 1.00 18.27 ? 91   ALA B CA  1 
ATOM   4025  C  C   . ALA B 2  91  ? 57.302  110.190 109.876 1.00 18.77 ? 91   ALA B C   1 
ATOM   4026  O  O   . ALA B 2  91  ? 56.230  110.406 110.470 1.00 18.81 ? 91   ALA B O   1 
ATOM   4027  C  CB  . ALA B 2  91  ? 59.401  110.642 111.192 1.00 17.46 ? 91   ALA B CB  1 
ATOM   4028  N  N   . VAL B 2  92  ? 57.496  110.428 108.575 1.00 19.04 ? 92   VAL B N   1 
ATOM   4029  C  CA  . VAL B 2  92  ? 56.452  110.973 107.678 1.00 18.76 ? 92   VAL B CA  1 
ATOM   4030  C  C   . VAL B 2  92  ? 55.682  109.867 106.899 1.00 18.55 ? 92   VAL B C   1 
ATOM   4031  O  O   . VAL B 2  92  ? 54.662  110.152 106.227 1.00 18.24 ? 92   VAL B O   1 
ATOM   4032  C  CB  . VAL B 2  92  ? 56.975  112.136 106.755 1.00 18.73 ? 92   VAL B CB  1 
ATOM   4033  C  CG1 . VAL B 2  92  ? 57.437  113.365 107.597 1.00 15.46 ? 92   VAL B CG1 1 
ATOM   4034  C  CG2 . VAL B 2  92  ? 58.091  111.674 105.811 1.00 8.76  ? 92   VAL B CG2 1 
ATOM   4035  N  N   . GLY B 2  93  ? 56.023  108.614 107.220 1.00 18.40 ? 93   GLY B N   1 
ATOM   4036  C  CA  . GLY B 2  93  ? 55.415  107.436 106.628 1.00 18.61 ? 93   GLY B CA  1 
ATOM   4037  C  C   . GLY B 2  93  ? 55.789  107.238 105.176 1.00 19.19 ? 93   GLY B C   1 
ATOM   4038  O  O   . GLY B 2  93  ? 55.029  106.624 104.455 1.00 19.73 ? 93   GLY B O   1 
ATOM   4039  N  N   . GLY B 2  94  ? 57.013  107.638 104.801 1.00 19.44 ? 94   GLY B N   1 
ATOM   4040  C  CA  . GLY B 2  94  ? 57.477  107.619 103.426 1.00 19.31 ? 94   GLY B CA  1 
ATOM   4041  C  C   . GLY B 2  94  ? 58.037  106.287 102.971 1.00 19.66 ? 94   GLY B C   1 
ATOM   4042  O  O   . GLY B 2  94  ? 58.082  105.313 103.754 1.00 20.03 ? 94   GLY B O   1 
ATOM   4043  N  N   . LYS B 2  95  ? 58.472  106.242 101.705 1.00 19.27 ? 95   LYS B N   1 
ATOM   4044  C  CA  . LYS B 2  95  ? 59.238  105.087 101.157 1.00 18.90 ? 95   LYS B CA  1 
ATOM   4045  C  C   . LYS B 2  95  ? 60.429  105.571 100.348 1.00 18.42 ? 95   LYS B C   1 
ATOM   4046  O  O   . LYS B 2  95  ? 60.365  106.638 99.760  1.00 18.05 ? 95   LYS B O   1 
ATOM   4047  C  CB  . LYS B 2  95  ? 58.350  104.162 100.302 1.00 18.72 ? 95   LYS B CB  1 
ATOM   4048  C  CG  . LYS B 2  95  ? 57.363  103.312 101.103 1.00 30.65 ? 95   LYS B CG  1 
ATOM   4049  C  CD  . LYS B 2  95  ? 56.184  102.851 100.256 1.00 33.22 ? 95   LYS B CD  1 
ATOM   4050  C  CE  . LYS B 2  95  ? 54.846  103.217 100.897 1.00 40.61 ? 95   LYS B CE  1 
ATOM   4051  N  NZ  . LYS B 2  95  ? 53.793  102.184 100.622 1.00 29.08 ? 95   LYS B NZ  1 
ATOM   4052  N  N   . LEU B 2  96  ? 61.534  104.828 100.420 1.00 18.93 ? 96   LEU B N   1 
ATOM   4053  C  CA  . LEU B 2  96  ? 62.648  104.953 99.487  1.00 20.09 ? 96   LEU B CA  1 
ATOM   4054  C  C   . LEU B 2  96  ? 62.926  103.607 98.829  1.00 20.15 ? 96   LEU B C   1 
ATOM   4055  O  O   . LEU B 2  96  ? 63.187  102.643 99.528  1.00 21.33 ? 96   LEU B O   1 
ATOM   4056  C  CB  . LEU B 2  96  ? 63.911  105.544 100.188 1.00 20.55 ? 96   LEU B CB  1 
ATOM   4057  C  CG  . LEU B 2  96  ? 65.301  105.545 99.512  1.00 25.89 ? 96   LEU B CG  1 
ATOM   4058  C  CD1 . LEU B 2  96  ? 65.416  106.512 98.313  1.00 25.01 ? 96   LEU B CD1 1 
ATOM   4059  C  CD2 . LEU B 2  96  ? 66.417  105.788 100.525 1.00 24.53 ? 96   LEU B CD2 1 
ATOM   4060  N  N   . SER B 2  97  ? 62.827  103.561 97.492  1.00 19.99 ? 97   SER B N   1 
ATOM   4061  C  CA  . SER B 2  97  ? 63.098  102.352 96.691  1.00 21.80 ? 97   SER B CA  1 
ATOM   4062  C  C   . SER B 2  97  ? 64.061  102.548 95.531  1.00 22.91 ? 97   SER B C   1 
ATOM   4063  O  O   . SER B 2  97  ? 64.256  103.685 95.059  1.00 24.33 ? 97   SER B O   1 
ATOM   4064  C  CB  . SER B 2  97  ? 61.812  101.624 96.212  1.00 21.90 ? 97   SER B CB  1 
ATOM   4065  O  OG  . SER B 2  97  ? 60.720  101.815 97.083  1.00 37.68 ? 97   SER B OG  1 
ATOM   4066  N  N   . VAL B 2  98  ? 64.821  101.486 95.260  1.00 22.37 ? 98   VAL B N   1 
ATOM   4067  C  CA  . VAL B 2  98  ? 65.644  101.360 94.064  1.00 22.92 ? 98   VAL B CA  1 
ATOM   4068  C  C   . VAL B 2  98  ? 65.339  100.160 93.176  1.00 23.99 ? 98   VAL B C   1 
ATOM   4069  O  O   . VAL B 2  98  ? 65.297  99.021  93.654  1.00 24.26 ? 98   VAL B O   1 
ATOM   4070  C  CB  . VAL B 2  98  ? 67.163  101.803 94.250  1.00 23.64 ? 98   VAL B CB  1 
ATOM   4071  C  CG1 . VAL B 2  98  ? 67.648  101.720 95.668  1.00 14.09 ? 98   VAL B CG1 1 
ATOM   4072  C  CG2 . VAL B 2  98  ? 68.137  101.228 93.231  1.00 22.75 ? 98   VAL B CG2 1 
ATOM   4073  N  N   . THR B 2  99  ? 64.852  100.490 91.976  1.00 24.25 ? 99   THR B N   1 
ATOM   4074  C  CA  . THR B 2  99  ? 64.458  99.542  90.931  1.00 24.32 ? 99   THR B CA  1 
ATOM   4075  C  C   . THR B 2  99  ? 65.536  99.559  89.845  1.00 24.93 ? 99   THR B C   1 
ATOM   4076  O  O   . THR B 2  99  ? 66.001  100.630 89.447  1.00 24.63 ? 99   THR B O   1 
ATOM   4077  C  CB  . THR B 2  99  ? 63.056  99.922  90.390  1.00 24.34 ? 99   THR B CB  1 
ATOM   4078  O  OG1 . THR B 2  99  ? 62.125  99.930  91.474  1.00 25.06 ? 99   THR B OG1 1 
ATOM   4079  C  CG2 . THR B 2  99  ? 62.462  98.839  89.470  1.00 20.22 ? 99   THR B CG2 1 
ATOM   4080  N  N   . SER B 2  100 ? 66.099  98.378  89.592  1.00 24.90 ? 100  SER B N   1 
ATOM   4081  C  CA  . SER B 2  100 ? 67.098  98.172  88.533  1.00 24.03 ? 100  SER B CA  1 
ATOM   4082  C  C   . SER B 2  100 ? 66.637  97.276  87.422  1.00 23.03 ? 100  SER B C   1 
ATOM   4083  O  O   . SER B 2  100 ? 65.825  96.408  87.627  1.00 23.07 ? 100  SER B O   1 
ATOM   4084  C  CB  . SER B 2  100 ? 68.422  97.674  89.085  1.00 23.58 ? 100  SER B CB  1 
ATOM   4085  O  OG  . SER B 2  100 ? 68.945  98.644  89.954  1.00 37.68 ? 100  SER B OG  1 
ATOM   4086  N  N   . THR B 2  101 ? 66.936  97.708  86.212  1.00 22.08 ? 101  THR B N   1 
ATOM   4087  C  CA  . THR B 2  101 ? 66.925  96.841  85.037  1.00 20.30 ? 101  THR B CA  1 
ATOM   4088  C  C   . THR B 2  101 ? 68.396  96.732  84.577  1.00 19.42 ? 101  THR B C   1 
ATOM   4089  O  O   . THR B 2  101 ? 69.316  97.220  85.272  1.00 18.83 ? 101  THR B O   1 
ATOM   4090  C  CB  . THR B 2  101 ? 66.001  97.461  83.938  1.00 20.05 ? 101  THR B CB  1 
ATOM   4091  O  OG1 . THR B 2  101 ? 66.508  98.746  83.557  1.00 28.23 ? 101  THR B OG1 1 
ATOM   4092  C  CG2 . THR B 2  101 ? 64.583  97.785  84.489  1.00 16.07 ? 101  THR B CG2 1 
ATOM   4093  N  N   . ARG B 2  102 ? 68.628  96.023  83.470  1.00 18.89 ? 102  ARG B N   1 
ATOM   4094  C  CA  . ARG B 2  102 ? 69.953  95.930  82.832  1.00 17.66 ? 102  ARG B CA  1 
ATOM   4095  C  C   . ARG B 2  102 ? 70.475  97.265  82.289  1.00 18.43 ? 102  ARG B C   1 
ATOM   4096  O  O   . ARG B 2  102 ? 71.678  97.416  82.109  1.00 18.22 ? 102  ARG B O   1 
ATOM   4097  C  CB  . ARG B 2  102 ? 69.941  94.872  81.736  1.00 16.64 ? 102  ARG B CB  1 
ATOM   4098  C  CG  . ARG B 2  102 ? 69.898  93.479  82.272  1.00 19.38 ? 102  ARG B CG  1 
ATOM   4099  C  CD  . ARG B 2  102 ? 69.912  92.393  81.230  1.00 13.98 ? 102  ARG B CD  1 
ATOM   4100  N  NE  . ARG B 2  102 ? 70.614  91.198  81.719  1.00 23.21 ? 102  ARG B NE  1 
ATOM   4101  C  CZ  . ARG B 2  102 ? 70.126  90.275  82.565  1.00 15.60 ? 102  ARG B CZ  1 
ATOM   4102  N  NH1 . ARG B 2  102 ? 68.896  90.350  83.075  1.00 7.56  ? 102  ARG B NH1 1 
ATOM   4103  N  NH2 . ARG B 2  102 ? 70.949  89.356  83.038  1.00 19.00 ? 102  ARG B NH2 1 
ATOM   4104  N  N   . GLU B 2  103 ? 69.581  98.254  82.147  1.00 18.86 ? 103  GLU B N   1 
ATOM   4105  C  CA  . GLU B 2  103 ? 69.899  99.564  81.575  1.00 18.26 ? 103  GLU B CA  1 
ATOM   4106  C  C   . GLU B 2  103 ? 69.838  100.649 82.615  1.00 18.66 ? 103  GLU B C   1 
ATOM   4107  O  O   . GLU B 2  103 ? 70.756  101.485 82.697  1.00 18.33 ? 103  GLU B O   1 
ATOM   4108  C  CB  . GLU B 2  103 ? 68.998  99.885  80.379  1.00 18.26 ? 103  GLU B CB  1 
ATOM   4109  C  CG  . GLU B 2  103 ? 68.993  98.781  79.322  1.00 29.53 ? 103  GLU B CG  1 
ATOM   4110  C  CD  . GLU B 2  103 ? 68.977  99.312  77.916  1.00 28.08 ? 103  GLU B CD  1 
ATOM   4111  O  OE1 . GLU B 2  103 ? 67.877  99.595  77.423  1.00 30.45 ? 103  GLU B OE1 1 
ATOM   4112  O  OE2 . GLU B 2  103 ? 70.035  99.268  77.260  1.00 27.74 ? 103  GLU B OE2 1 
ATOM   4113  N  N   . ASN B 2  104 ? 68.814  100.583 83.476  1.00 19.07 ? 104  ASN B N   1 
ATOM   4114  C  CA  . ASN B 2  104 ? 68.489  101.672 84.398  1.00 18.88 ? 104  ASN B CA  1 
ATOM   4115  C  C   . ASN B 2  104 ? 68.497  101.282 85.860  1.00 18.68 ? 104  ASN B C   1 
ATOM   4116  O  O   . ASN B 2  104 ? 68.378  100.095 86.169  1.00 19.83 ? 104  ASN B O   1 
ATOM   4117  C  CB  . ASN B 2  104 ? 67.158  102.363 84.033  1.00 18.86 ? 104  ASN B CB  1 
ATOM   4118  C  CG  . ASN B 2  104 ? 67.049  102.746 82.551  1.00 19.99 ? 104  ASN B CG  1 
ATOM   4119  O  OD1 . ASN B 2  104 ? 65.927  102.918 82.051  1.00 20.09 ? 104  ASN B OD1 1 
ATOM   4120  N  ND2 . ASN B 2  104 ? 68.177  103.124 81.930  1.00 11.41 ? 104  ASN B ND2 1 
ATOM   4121  N  N   . MET B 2  105 ? 68.984  102.211 86.680  1.00 17.68 ? 105  MET B N   1 
ATOM   4122  C  CA  . MET B 2  105 ? 68.576  102.352 88.082  1.00 17.76 ? 105  MET B CA  1 
ATOM   4123  C  C   . MET B 2  105 ? 67.563  103.497 88.230  1.00 17.83 ? 105  MET B C   1 
ATOM   4124  O  O   . MET B 2  105 ? 67.792  104.619 87.702  1.00 19.21 ? 105  MET B O   1 
ATOM   4125  C  CB  . MET B 2  105 ? 69.784  102.654 88.965  1.00 18.59 ? 105  MET B CB  1 
ATOM   4126  C  CG  . MET B 2  105 ? 70.994  101.710 88.791  1.00 8.81  ? 105  MET B CG  1 
ATOM   4127  S  SD  . MET B 2  105 ? 71.830  101.512 90.298  1.00 23.89 ? 105  MET B SD  1 
ATOM   4128  C  CE  . MET B 2  105 ? 73.178  101.514 89.727  1.00 13.52 ? 105  MET B CE  1 
ATOM   4129  N  N   . ALA B 2  106 ? 66.613  103.289 89.139  1.00 16.36 ? 106  ALA B N   1 
ATOM   4130  C  CA  . ALA B 2  106 ? 65.504  104.205 89.408  1.00 15.64 ? 106  ALA B CA  1 
ATOM   4131  C  C   . ALA B 2  106 ? 65.321  104.344 90.906  1.00 15.97 ? 106  ALA B C   1 
ATOM   4132  O  O   . ALA B 2  106 ? 64.902  103.385 91.597  1.00 15.26 ? 106  ALA B O   1 
ATOM   4133  C  CB  . ALA B 2  106 ? 64.227  103.711 88.754  1.00 14.74 ? 106  ALA B CB  1 
ATOM   4134  N  N   . TYR B 2  107 ? 65.689  105.531 91.408  1.00 16.27 ? 107  TYR B N   1 
ATOM   4135  C  CA  . TYR B 2  107 ? 65.553  105.884 92.812  1.00 16.05 ? 107  TYR B CA  1 
ATOM   4136  C  C   . TYR B 2  107 ? 64.229  106.604 93.022  1.00 16.92 ? 107  TYR B C   1 
ATOM   4137  O  O   . TYR B 2  107 ? 64.059  107.733 92.547  1.00 17.71 ? 107  TYR B O   1 
ATOM   4138  C  CB  . TYR B 2  107 ? 66.738  106.741 93.262  1.00 15.30 ? 107  TYR B CB  1 
ATOM   4139  C  CG  . TYR B 2  107 ? 68.033  105.980 93.440  1.00 15.94 ? 107  TYR B CG  1 
ATOM   4140  C  CD1 . TYR B 2  107 ? 68.799  105.564 92.309  1.00 10.80 ? 107  TYR B CD1 1 
ATOM   4141  C  CD2 . TYR B 2  107 ? 68.580  105.769 94.738  1.00 10.29 ? 107  TYR B CD2 1 
ATOM   4142  C  CE1 . TYR B 2  107 ? 70.006  104.774 92.467  1.00 15.33 ? 107  TYR B CE1 1 
ATOM   4143  C  CE2 . TYR B 2  107 ? 69.793  104.973 94.910  1.00 17.59 ? 107  TYR B CE2 1 
ATOM   4144  C  CZ  . TYR B 2  107 ? 70.481  104.500 93.768  1.00 10.38 ? 107  TYR B CZ  1 
ATOM   4145  O  OH  . TYR B 2  107 ? 71.722  103.967 93.907  1.00 17.18 ? 107  TYR B OH  1 
ATOM   4146  N  N   . THR B 2  108 ? 63.259  105.893 93.612  1.00 17.30 ? 108  THR B N   1 
ATOM   4147  C  CA  . THR B 2  108 ? 61.934  106.454 93.924  1.00 17.91 ? 108  THR B CA  1 
ATOM   4148  C  C   . THR B 2  108 ? 61.649  106.713 95.405  1.00 18.42 ? 108  THR B C   1 
ATOM   4149  O  O   . THR B 2  108 ? 61.987  105.890 96.267  1.00 18.89 ? 108  THR B O   1 
ATOM   4150  C  CB  . THR B 2  108 ? 60.750  105.719 93.228  1.00 17.83 ? 108  THR B CB  1 
ATOM   4151  O  OG1 . THR B 2  108 ? 60.702  104.356 93.662  1.00 35.54 ? 108  THR B OG1 1 
ATOM   4152  C  CG2 . THR B 2  108 ? 60.949  105.637 91.690  1.00 18.33 ? 108  THR B CG2 1 
ATOM   4153  N  N   . VAL B 2  109 ? 60.788  107.712 95.618  1.00 18.16 ? 109  VAL B N   1 
ATOM   4154  C  CA  . VAL B 2  109 ? 60.521  108.350 96.888  1.00 18.57 ? 109  VAL B CA  1 
ATOM   4155  C  C   . VAL B 2  109 ? 59.013  108.731 96.871  1.00 18.89 ? 109  VAL B C   1 
ATOM   4156  O  O   . VAL B 2  109 ? 58.507  109.214 95.841  1.00 18.25 ? 109  VAL B O   1 
ATOM   4157  C  CB  . VAL B 2  109 ? 61.558  109.537 97.089  1.00 19.89 ? 109  VAL B CB  1 
ATOM   4158  C  CG1 . VAL B 2  109 ? 60.939  110.944 97.224  1.00 17.89 ? 109  VAL B CG1 1 
ATOM   4159  C  CG2 . VAL B 2  109 ? 62.590  109.216 98.148  1.00 15.03 ? 109  VAL B CG2 1 
ATOM   4160  N  N   . GLU B 2  110 ? 58.273  108.164 97.830  1.00 19.94 ? 110  GLU B N   1 
ATOM   4161  C  CA  . GLU B 2  110 ? 56.865  108.523 98.073  1.00 19.89 ? 110  GLU B CA  1 
ATOM   4162  C  C   . GLU B 2  110 ? 56.604  109.023 99.488  1.00 19.50 ? 110  GLU B C   1 
ATOM   4163  O  O   . GLU B 2  110 ? 57.328  108.646 100.416 1.00 20.08 ? 110  GLU B O   1 
ATOM   4164  C  CB  . GLU B 2  110 ? 55.858  107.436 97.591  1.00 19.82 ? 110  GLU B CB  1 
ATOM   4165  C  CG  . GLU B 2  110 ? 55.848  106.113 98.332  1.00 35.72 ? 110  GLU B CG  1 
ATOM   4166  C  CD  . GLU B 2  110 ? 55.172  104.975 97.554  1.00 43.34 ? 110  GLU B CD  1 
ATOM   4167  O  OE1 . GLU B 2  110 ? 54.007  104.640 97.880  1.00 40.48 ? 110  GLU B OE1 1 
ATOM   4168  O  OE2 . GLU B 2  110 ? 55.886  104.251 96.813  1.00 43.68 ? 110  GLU B OE2 1 
ATOM   4169  N  N   . CYS B 2  111 ? 55.806  110.090 99.550  1.00 18.01 ? 111  CYS B N   1 
ATOM   4170  C  CA  . CYS B 2  111 ? 55.316  110.724 100.782 1.00 17.44 ? 111  CYS B CA  1 
ATOM   4171  C  C   . CYS B 2  111 ? 54.030  111.500 100.478 1.00 16.70 ? 111  CYS B C   1 
ATOM   4172  O  O   . CYS B 2  111 ? 53.690  111.725 99.310  1.00 16.51 ? 111  CYS B O   1 
ATOM   4173  C  CB  . CYS B 2  111 ? 56.367  111.681 101.376 1.00 17.87 ? 111  CYS B CB  1 
ATOM   4174  S  SG  . CYS B 2  111 ? 56.927  112.985 100.242 1.00 23.24 ? 111  CYS B SG  1 
ATOM   4175  N  N   . LEU B 2  112 ? 53.342  111.932 101.533 1.00 16.61 ? 112  LEU B N   1 
ATOM   4176  C  CA  . LEU B 2  112 ? 52.290  112.949 101.425 1.00 16.90 ? 112  LEU B CA  1 
ATOM   4177  C  C   . LEU B 2  112 ? 52.828  114.291 100.906 1.00 16.65 ? 112  LEU B C   1 
ATOM   4178  O  O   . LEU B 2  112 ? 54.040  114.574 101.024 1.00 15.93 ? 112  LEU B O   1 
ATOM   4179  C  CB  . LEU B 2  112 ? 51.519  113.120 102.755 1.00 17.02 ? 112  LEU B CB  1 
ATOM   4180  C  CG  . LEU B 2  112 ? 50.960  111.913 103.541 1.00 14.99 ? 112  LEU B CG  1 
ATOM   4181  C  CD1 . LEU B 2  112 ? 50.484  112.344 104.958 1.00 8.29  ? 112  LEU B CD1 1 
ATOM   4182  C  CD2 . LEU B 2  112 ? 49.875  111.087 102.784 1.00 16.05 ? 112  LEU B CD2 1 
ATOM   4183  N  N   . ARG B 2  113 ? 51.957  114.979 100.156 1.00 17.40 ? 113  ARG B N   1 
ATOM   4184  C  CA  . ARG B 2  113 ? 52.145  116.339 99.599  1.00 18.40 ? 113  ARG B CA  1 
ATOM   4185  C  C   . ARG B 2  113 ? 53.045  117.304 100.399 1.00 18.70 ? 113  ARG B C   1 
ATOM   4186  O  O   . ARG B 2  113 ? 54.115  117.664 99.903  1.00 19.32 ? 113  ARG B O   1 
ATOM   4187  C  CB  . ARG B 2  113 ? 50.776  116.962 99.323  1.00 18.97 ? 113  ARG B CB  1 
ATOM   4188  C  CG  . ARG B 2  113 ? 50.763  118.050 98.291  1.00 33.30 ? 113  ARG B CG  1 
ATOM   4189  C  CD  . ARG B 2  113 ? 49.408  118.247 97.654  1.00 37.03 ? 113  ARG B CD  1 
ATOM   4190  N  NE  . ARG B 2  113 ? 49.282  117.509 96.400  1.00 41.71 ? 113  ARG B NE  1 
ATOM   4191  C  CZ  . ARG B 2  113 ? 49.729  117.896 95.199  1.00 38.98 ? 113  ARG B CZ  1 
ATOM   4192  N  NH1 . ARG B 2  113 ? 50.384  119.047 95.012  1.00 37.58 ? 113  ARG B NH1 1 
ATOM   4193  N  NH2 . ARG B 2  113 ? 49.562  117.075 94.184  1.00 47.46 ? 113  ARG B NH2 1 
ATOM   4194  N  N   . ASP B 2  114 ? 52.775  117.406 101.706 1.00 18.96 ? 114  ASP B N   1 
ATOM   4195  C  CA  . ASP B 2  114 ? 53.418  118.382 102.620 1.00 19.65 ? 114  ASP B CA  1 
ATOM   4196  C  C   . ASP B 2  114 ? 54.895  118.059 102.960 1.00 19.95 ? 114  ASP B C   1 
ATOM   4197  O  O   . ASP B 2  114 ? 55.654  118.949 103.386 1.00 19.98 ? 114  ASP B O   1 
ATOM   4198  C  CB  . ASP B 2  114 ? 52.597  118.528 103.924 1.00 19.79 ? 114  ASP B CB  1 
ATOM   4199  C  CG  . ASP B 2  114 ? 51.090  118.748 103.682 1.00 25.83 ? 114  ASP B CG  1 
ATOM   4200  O  OD1 . ASP B 2  114 ? 50.315  118.445 104.616 1.00 32.19 ? 114  ASP B OD1 1 
ATOM   4201  O  OD2 . ASP B 2  114 ? 50.589  119.261 102.645 1.00 22.52 ? 114  ASP B OD2 1 
ATOM   4202  N  N   . ASP B 2  115 ? 55.324  116.861 102.573 1.00 20.45 ? 115  ASP B N   1 
ATOM   4203  C  CA  . ASP B 2  115 ? 56.587  116.261 103.017 1.00 21.15 ? 115  ASP B CA  1 
ATOM   4204  C  C   . ASP B 2  115 ? 57.635  116.083 101.926 1.00 21.73 ? 115  ASP B C   1 
ATOM   4205  O  O   . ASP B 2  115 ? 58.723  115.587 102.215 1.00 22.48 ? 115  ASP B O   1 
ATOM   4206  C  CB  . ASP B 2  115 ? 56.325  114.939 103.765 1.00 20.64 ? 115  ASP B CB  1 
ATOM   4207  C  CG  . ASP B 2  115 ? 55.533  115.134 105.053 1.00 22.96 ? 115  ASP B CG  1 
ATOM   4208  O  OD1 . ASP B 2  115 ? 55.938  115.961 105.915 1.00 24.00 ? 115  ASP B OD1 1 
ATOM   4209  O  OD2 . ASP B 2  115 ? 54.490  114.489 105.295 1.00 32.04 ? 115  ASP B OD2 1 
ATOM   4210  N  N   . VAL B 2  116 ? 57.352  116.623 100.732 1.00 22.10 ? 116  VAL B N   1 
ATOM   4211  C  CA  . VAL B 2  116 ? 58.205  116.497 99.523  1.00 23.46 ? 116  VAL B CA  1 
ATOM   4212  C  C   . VAL B 2  116 ? 59.657  116.942 99.684  1.00 24.41 ? 116  VAL B C   1 
ATOM   4213  O  O   . VAL B 2  116 ? 60.543  116.276 99.173  1.00 24.69 ? 116  VAL B O   1 
ATOM   4214  C  CB  . VAL B 2  116 ? 57.602  117.188 98.236  1.00 23.93 ? 116  VAL B CB  1 
ATOM   4215  C  CG1 . VAL B 2  116 ? 56.475  116.416 97.717  1.00 29.19 ? 116  VAL B CG1 1 
ATOM   4216  C  CG2 . VAL B 2  116 ? 57.178  118.665 98.472  1.00 29.10 ? 116  VAL B CG2 1 
ATOM   4217  N  N   . ASP B 2  117 ? 59.867  118.047 100.420 1.00 25.05 ? 117  ASP B N   1 
ATOM   4218  C  CA  . ASP B 2  117 ? 61.174  118.678 100.630 1.00 25.30 ? 117  ASP B CA  1 
ATOM   4219  C  C   . ASP B 2  117 ? 62.152  117.810 101.405 1.00 25.53 ? 117  ASP B C   1 
ATOM   4220  O  O   . ASP B 2  117 ? 63.332  117.713 101.005 1.00 26.16 ? 117  ASP B O   1 
ATOM   4221  C  CB  . ASP B 2  117 ? 61.029  120.056 101.305 1.00 25.01 ? 117  ASP B CB  1 
ATOM   4222  C  CG  . ASP B 2  117 ? 60.410  121.123 100.382 1.00 26.83 ? 117  ASP B CG  1 
ATOM   4223  O  OD1 . ASP B 2  117 ? 60.637  121.117 99.143  1.00 33.01 ? 117  ASP B OD1 1 
ATOM   4224  O  OD2 . ASP B 2  117 ? 59.751  122.079 100.839 1.00 31.97 ? 117  ASP B OD2 1 
ATOM   4225  N  N   . ILE B 2  118 ? 61.678  117.194 102.503 1.00 25.17 ? 118  ILE B N   1 
ATOM   4226  C  CA  . ILE B 2  118 ? 62.510  116.253 103.273 1.00 25.17 ? 118  ILE B CA  1 
ATOM   4227  C  C   . ILE B 2  118 ? 62.895  114.996 102.498 1.00 24.92 ? 118  ILE B C   1 
ATOM   4228  O  O   . ILE B 2  118 ? 64.095  114.681 102.422 1.00 25.84 ? 118  ILE B O   1 
ATOM   4229  C  CB  . ILE B 2  118 ? 62.029  116.031 104.775 1.00 25.70 ? 118  ILE B CB  1 
ATOM   4230  C  CG1 . ILE B 2  118 ? 63.237  115.789 105.701 1.00 39.54 ? 118  ILE B CG1 1 
ATOM   4231  C  CG2 . ILE B 2  118 ? 60.963  114.928 104.929 1.00 14.64 ? 118  ILE B CG2 1 
ATOM   4232  C  CD1 . ILE B 2  118 ? 63.438  116.883 106.767 1.00 43.77 ? 118  ILE B CD1 1 
ATOM   4233  N  N   . LEU B 2  119 ? 61.940  114.514 101.686 1.00 23.43 ? 119  LEU B N   1 
ATOM   4234  C  CA  . LEU B 2  119 ? 62.137  113.359 100.825 1.00 22.59 ? 119  LEU B CA  1 
ATOM   4235  C  C   . LEU B 2  119 ? 63.010  113.622 99.611  1.00 21.90 ? 119  LEU B C   1 
ATOM   4236  O  O   . LEU B 2  119 ? 63.923  112.844 99.352  1.00 21.61 ? 119  LEU B O   1 
ATOM   4237  C  CB  . LEU B 2  119 ? 60.800  112.692 100.462 1.00 22.42 ? 119  LEU B CB  1 
ATOM   4238  C  CG  . LEU B 2  119 ? 60.192  111.557 101.319 1.00 20.09 ? 119  LEU B CG  1 
ATOM   4239  C  CD1 . LEU B 2  119 ? 60.907  110.206 101.305 1.00 17.15 ? 119  LEU B CD1 1 
ATOM   4240  C  CD2 . LEU B 2  119 ? 59.862  111.952 102.729 1.00 17.48 ? 119  LEU B CD2 1 
ATOM   4241  N  N   . MET B 2  120 ? 62.875  114.822 99.041  1.00 22.37 ? 120  MET B N   1 
ATOM   4242  C  CA  . MET B 2  120 ? 63.800  115.364 98.042  1.00 22.51 ? 120  MET B CA  1 
ATOM   4243  C  C   . MET B 2  120 ? 65.261  115.442 98.511  1.00 22.51 ? 120  MET B C   1 
ATOM   4244  O  O   . MET B 2  120 ? 66.151  114.903 97.824  1.00 22.37 ? 120  MET B O   1 
ATOM   4245  C  CB  . MET B 2  120 ? 63.320  116.719 97.520  1.00 22.51 ? 120  MET B CB  1 
ATOM   4246  C  CG  . MET B 2  120 ? 64.157  117.277 96.390  1.00 30.29 ? 120  MET B CG  1 
ATOM   4247  S  SD  . MET B 2  120 ? 63.916  116.354 94.892  1.00 45.53 ? 120  MET B SD  1 
ATOM   4248  C  CE  . MET B 2  120 ? 62.420  117.260 94.277  1.00 45.61 ? 120  MET B CE  1 
ATOM   4249  N  N   . GLU B 2  121 ? 65.476  116.108 99.655  1.00 21.94 ? 121  GLU B N   1 
ATOM   4250  C  CA  . GLU B 2  121 ? 66.778  116.209 100.319 1.00 22.31 ? 121  GLU B CA  1 
ATOM   4251  C  C   . GLU B 2  121 ? 67.445  114.851 100.567 1.00 22.49 ? 121  GLU B C   1 
ATOM   4252  O  O   . GLU B 2  121 ? 68.651  114.710 100.292 1.00 23.21 ? 121  GLU B O   1 
ATOM   4253  C  CB  . GLU B 2  121 ? 66.658  116.995 101.632 1.00 22.35 ? 121  GLU B CB  1 
ATOM   4254  C  CG  . GLU B 2  121 ? 67.986  117.477 102.215 1.00 28.25 ? 121  GLU B CG  1 
ATOM   4255  C  CD  . GLU B 2  121 ? 67.898  117.982 103.660 1.00 35.52 ? 121  GLU B CD  1 
ATOM   4256  O  OE1 . GLU B 2  121 ? 68.932  117.903 104.358 1.00 32.39 ? 121  GLU B OE1 1 
ATOM   4257  O  OE2 . GLU B 2  121 ? 66.855  118.562 104.070 1.00 31.24 ? 121  GLU B OE2 1 
ATOM   4258  N  N   . PHE B 2  122 ? 66.665  113.880 101.068 1.00 21.72 ? 122  PHE B N   1 
ATOM   4259  C  CA  . PHE B 2  122 ? 67.130  112.507 101.253 1.00 22.30 ? 122  PHE B CA  1 
ATOM   4260  C  C   . PHE B 2  122 ? 67.495  111.836 99.929  1.00 22.36 ? 122  PHE B C   1 
ATOM   4261  O  O   . PHE B 2  122 ? 68.635  111.385 99.795  1.00 23.60 ? 122  PHE B O   1 
ATOM   4262  C  CB  . PHE B 2  122 ? 66.129  111.646 102.072 1.00 22.57 ? 122  PHE B CB  1 
ATOM   4263  C  CG  . PHE B 2  122 ? 66.031  112.015 103.559 1.00 18.60 ? 122  PHE B CG  1 
ATOM   4264  C  CD1 . PHE B 2  122 ? 64.766  112.037 104.193 1.00 21.17 ? 122  PHE B CD1 1 
ATOM   4265  C  CD2 . PHE B 2  122 ? 67.193  112.206 104.361 1.00 28.75 ? 122  PHE B CD2 1 
ATOM   4266  C  CE1 . PHE B 2  122 ? 64.631  112.332 105.612 1.00 14.29 ? 122  PHE B CE1 1 
ATOM   4267  C  CE2 . PHE B 2  122 ? 67.080  112.554 105.769 1.00 25.90 ? 122  PHE B CE2 1 
ATOM   4268  C  CZ  . PHE B 2  122 ? 65.790  112.572 106.394 1.00 20.01 ? 122  PHE B CZ  1 
ATOM   4269  N  N   . LEU B 2  123 ? 66.640  112.038 98.909  1.00 20.97 ? 123  LEU B N   1 
ATOM   4270  C  CA  . LEU B 2  123 ? 66.837  111.550 97.526  1.00 20.28 ? 123  LEU B CA  1 
ATOM   4271  C  C   . LEU B 2  123 ? 68.118  112.053 96.870  1.00 19.48 ? 123  LEU B C   1 
ATOM   4272  O  O   . LEU B 2  123 ? 68.934  111.254 96.394  1.00 19.77 ? 123  LEU B O   1 
ATOM   4273  C  CB  . LEU B 2  123 ? 65.620  111.916 96.643  1.00 20.22 ? 123  LEU B CB  1 
ATOM   4274  C  CG  . LEU B 2  123 ? 65.201  111.203 95.350  1.00 25.29 ? 123  LEU B CG  1 
ATOM   4275  C  CD1 . LEU B 2  123 ? 65.561  111.978 94.170  1.00 9.30  ? 123  LEU B CD1 1 
ATOM   4276  C  CD2 . LEU B 2  123 ? 65.607  109.709 95.208  1.00 11.58 ? 123  LEU B CD2 1 
ATOM   4277  N  N   . LEU B 2  124 ? 68.364  113.353 97.042  1.00 18.77 ? 124  LEU B N   1 
ATOM   4278  C  CA  . LEU B 2  124 ? 69.566  114.020 96.573  1.00 17.87 ? 124  LEU B CA  1 
ATOM   4279  C  C   . LEU B 2  124 ? 70.831  113.581 97.264  1.00 17.68 ? 124  LEU B C   1 
ATOM   4280  O  O   . LEU B 2  124 ? 71.858  113.431 96.600  1.00 18.04 ? 124  LEU B O   1 
ATOM   4281  C  CB  . LEU B 2  124 ? 69.422  115.543 96.644  1.00 17.03 ? 124  LEU B CB  1 
ATOM   4282  C  CG  . LEU B 2  124 ? 68.451  116.185 95.649  1.00 17.41 ? 124  LEU B CG  1 
ATOM   4283  C  CD1 . LEU B 2  124 ? 68.114  117.667 96.087  1.00 21.56 ? 124  LEU B CD1 1 
ATOM   4284  C  CD2 . LEU B 2  124 ? 68.975  116.094 94.185  1.00 8.73  ? 124  LEU B CD2 1 
ATOM   4285  N  N   . ASN B 2  125 ? 70.733  113.308 98.569  1.00 17.00 ? 125  ASN B N   1 
ATOM   4286  C  CA  . ASN B 2  125 ? 71.865  112.847 99.360  1.00 16.58 ? 125  ASN B CA  1 
ATOM   4287  C  C   . ASN B 2  125 ? 72.300  111.410 99.034  1.00 16.24 ? 125  ASN B C   1 
ATOM   4288  O  O   . ASN B 2  125 ? 73.484  111.151 98.897  1.00 15.33 ? 125  ASN B O   1 
ATOM   4289  C  CB  . ASN B 2  125 ? 71.598  113.033 100.848 1.00 16.50 ? 125  ASN B CB  1 
ATOM   4290  C  CG  . ASN B 2  125 ? 71.919  114.430 101.324 1.00 25.79 ? 125  ASN B CG  1 
ATOM   4291  O  OD1 . ASN B 2  125 ? 73.082  114.854 101.337 1.00 27.10 ? 125  ASN B OD1 1 
ATOM   4292  N  ND2 . ASN B 2  125 ? 70.894  115.149 101.749 1.00 22.25 ? 125  ASN B ND2 1 
ATOM   4293  N  N   . VAL B 2  126 ? 71.320  110.540 98.787  1.00 17.41 ? 126  VAL B N   1 
ATOM   4294  C  CA  . VAL B 2  126 ? 71.533  109.124 98.411  1.00 18.26 ? 126  VAL B CA  1 
ATOM   4295  C  C   . VAL B 2  126 ? 72.283  108.999 97.073  1.00 19.74 ? 126  VAL B C   1 
ATOM   4296  O  O   . VAL B 2  126 ? 73.353  108.377 97.028  1.00 20.34 ? 126  VAL B O   1 
ATOM   4297  C  CB  . VAL B 2  126 ? 70.194  108.340 98.410  1.00 17.76 ? 126  VAL B CB  1 
ATOM   4298  C  CG1 . VAL B 2  126 ? 70.374  106.925 97.867  1.00 20.42 ? 126  VAL B CG1 1 
ATOM   4299  C  CG2 . VAL B 2  126 ? 69.599  108.291 99.839  1.00 12.69 ? 126  VAL B CG2 1 
ATOM   4300  N  N   . THR B 2  127 ? 71.848  109.803 96.096  1.00 20.69 ? 127  THR B N   1 
ATOM   4301  C  CA  . THR B 2  127 ? 72.277  109.700 94.689  1.00 20.83 ? 127  THR B CA  1 
ATOM   4302  C  C   . THR B 2  127 ? 73.490  110.565 94.341  1.00 20.77 ? 127  THR B C   1 
ATOM   4303  O  O   . THR B 2  127 ? 74.193  110.248 93.396  1.00 21.64 ? 127  THR B O   1 
ATOM   4304  C  CB  . THR B 2  127 ? 71.132  110.032 93.719  1.00 20.82 ? 127  THR B CB  1 
ATOM   4305  O  OG1 . THR B 2  127 ? 70.607  111.318 94.031  1.00 13.52 ? 127  THR B OG1 1 
ATOM   4306  C  CG2 . THR B 2  127 ? 69.934  109.102 93.885  1.00 14.90 ? 127  THR B CG2 1 
ATOM   4307  N  N   . THR B 2  128 ? 73.723  111.657 95.075  1.00 20.97 ? 128  THR B N   1 
ATOM   4308  C  CA  . THR B 2  128 ? 74.830  112.625 94.750  1.00 20.66 ? 128  THR B CA  1 
ATOM   4309  C  C   . THR B 2  128 ? 75.874  112.863 95.852  1.00 20.60 ? 128  THR B C   1 
ATOM   4310  O  O   . THR B 2  128 ? 76.920  113.503 95.599  1.00 20.33 ? 128  THR B O   1 
ATOM   4311  C  CB  . THR B 2  128 ? 74.309  114.021 94.265  1.00 20.14 ? 128  THR B CB  1 
ATOM   4312  O  OG1 . THR B 2  128 ? 73.591  114.649 95.317  1.00 22.68 ? 128  THR B OG1 1 
ATOM   4313  C  CG2 . THR B 2  128 ? 73.327  113.937 93.134  1.00 14.93 ? 128  THR B CG2 1 
ATOM   4314  N  N   . ALA B 2  129 ? 75.516  112.519 97.093  1.00 20.38 ? 129  ALA B N   1 
ATOM   4315  C  CA  . ALA B 2  129 ? 76.457  112.605 98.204  1.00 20.08 ? 129  ALA B CA  1 
ATOM   4316  C  C   . ALA B 2  129 ? 76.669  111.310 99.075  1.00 20.10 ? 129  ALA B C   1 
ATOM   4317  O  O   . ALA B 2  129 ? 76.926  111.448 100.279 1.00 20.17 ? 129  ALA B O   1 
ATOM   4318  C  CB  . ALA B 2  129 ? 76.153  113.859 99.053  1.00 19.42 ? 129  ALA B CB  1 
ATOM   4319  N  N   . PRO B 2  130 ? 76.653  110.081 98.493  1.00 19.90 ? 130  PRO B N   1 
ATOM   4320  C  CA  . PRO B 2  130 ? 76.891  108.879 99.313  1.00 19.84 ? 130  PRO B CA  1 
ATOM   4321  C  C   . PRO B 2  130 ? 78.365  108.743 99.728  1.00 19.90 ? 130  PRO B C   1 
ATOM   4322  O  O   . PRO B 2  130 ? 79.271  109.128 98.965  1.00 20.33 ? 130  PRO B O   1 
ATOM   4323  C  CB  . PRO B 2  130 ? 76.471  107.731 98.392  1.00 19.77 ? 130  PRO B CB  1 
ATOM   4324  C  CG  . PRO B 2  130 ? 76.699  108.222 97.003  1.00 18.12 ? 130  PRO B CG  1 
ATOM   4325  C  CD  . PRO B 2  130 ? 76.517  109.699 97.068  1.00 20.13 ? 130  PRO B CD  1 
ATOM   4326  N  N   . GLU B 2  131 ? 78.578  108.310 100.964 1.00 19.16 ? 131  GLU B N   1 
ATOM   4327  C  CA  . GLU B 2  131 ? 79.914  108.201 101.529 1.00 19.15 ? 131  GLU B CA  1 
ATOM   4328  C  C   . GLU B 2  131 ? 80.596  106.838 101.333 1.00 18.55 ? 131  GLU B C   1 
ATOM   4329  O  O   . GLU B 2  131 ? 81.827  106.779 101.238 1.00 18.86 ? 131  GLU B O   1 
ATOM   4330  C  CB  . GLU B 2  131 ? 79.917  108.648 102.982 1.00 19.27 ? 131  GLU B CB  1 
ATOM   4331  C  CG  . GLU B 2  131 ? 80.356  110.096 103.156 1.00 14.69 ? 131  GLU B CG  1 
ATOM   4332  C  CD  . GLU B 2  131 ? 80.317  110.580 104.605 1.00 29.08 ? 131  GLU B CD  1 
ATOM   4333  O  OE1 . GLU B 2  131 ? 80.934  109.932 105.489 1.00 32.11 ? 131  GLU B OE1 1 
ATOM   4334  O  OE2 . GLU B 2  131 ? 79.776  111.690 104.840 1.00 34.76 ? 131  GLU B OE2 1 
ATOM   4335  N  N   . PHE B 2  132 ? 79.792  105.786 101.166 1.00 17.86 ? 132  PHE B N   1 
ATOM   4336  C  CA  . PHE B 2  132 ? 80.232  104.372 101.155 1.00 18.24 ? 132  PHE B CA  1 
ATOM   4337  C  C   . PHE B 2  132 ? 81.354  104.049 102.164 1.00 18.37 ? 132  PHE B C   1 
ATOM   4338  O  O   . PHE B 2  132 ? 82.488  103.757 101.766 1.00 18.72 ? 132  PHE B O   1 
ATOM   4339  C  CB  . PHE B 2  132 ? 80.585  103.894 99.719  1.00 17.88 ? 132  PHE B CB  1 
ATOM   4340  C  CG  . PHE B 2  132 ? 79.520  104.183 98.688  1.00 20.46 ? 132  PHE B CG  1 
ATOM   4341  C  CD1 . PHE B 2  132 ? 79.815  105.045 97.600  1.00 17.31 ? 132  PHE B CD1 1 
ATOM   4342  C  CD2 . PHE B 2  132 ? 78.229  103.590 98.778  1.00 16.05 ? 132  PHE B CD2 1 
ATOM   4343  C  CE1 . PHE B 2  132 ? 78.853  105.282 96.574  1.00 12.15 ? 132  PHE B CE1 1 
ATOM   4344  C  CE2 . PHE B 2  132 ? 77.203  103.905 97.829  1.00 13.25 ? 132  PHE B CE2 1 
ATOM   4345  C  CZ  . PHE B 2  132 ? 77.532  104.765 96.715  1.00 2.08  ? 132  PHE B CZ  1 
ATOM   4346  N  N   . ARG B 2  133 ? 81.094  104.404 103.429 1.00 18.06 ? 133  ARG B N   1 
ATOM   4347  C  CA  . ARG B 2  133 ? 82.005  104.130 104.551 1.00 18.07 ? 133  ARG B CA  1 
ATOM   4348  C  C   . ARG B 2  133 ? 82.303  102.619 104.624 1.00 17.77 ? 133  ARG B C   1 
ATOM   4349  O  O   . ARG B 2  133 ? 81.406  101.811 104.424 1.00 17.04 ? 133  ARG B O   1 
ATOM   4350  C  CB  . ARG B 2  133 ? 81.374  104.600 105.865 1.00 18.56 ? 133  ARG B CB  1 
ATOM   4351  C  CG  . ARG B 2  133 ? 81.344  106.114 106.099 1.00 16.54 ? 133  ARG B CG  1 
ATOM   4352  C  CD  . ARG B 2  133 ? 80.345  106.494 107.157 1.00 19.40 ? 133  ARG B CD  1 
ATOM   4353  N  NE  . ARG B 2  133 ? 80.271  107.940 107.352 1.00 16.32 ? 133  ARG B NE  1 
ATOM   4354  C  CZ  . ARG B 2  133 ? 79.915  108.561 108.485 1.00 18.72 ? 133  ARG B CZ  1 
ATOM   4355  N  NH1 . ARG B 2  133 ? 79.317  107.908 109.474 1.00 4.55  ? 133  ARG B NH1 1 
ATOM   4356  N  NH2 . ARG B 2  133 ? 80.029  109.885 108.570 1.00 5.91  ? 133  ARG B NH2 1 
ATOM   4357  N  N   . ARG B 2  134 ? 83.600  102.306 104.628 1.00 17.88 ? 134  ARG B N   1 
ATOM   4358  C  CA  . ARG B 2  134 ? 84.186  100.961 104.593 1.00 17.60 ? 134  ARG B CA  1 
ATOM   4359  C  C   . ARG B 2  134 ? 83.473  99.918  105.500 1.00 17.46 ? 134  ARG B C   1 
ATOM   4360  O  O   . ARG B 2  134 ? 83.028  98.887  104.995 1.00 15.72 ? 134  ARG B O   1 
ATOM   4361  C  CB  . ARG B 2  134 ? 85.697  101.105 104.890 1.00 18.30 ? 134  ARG B CB  1 
ATOM   4362  C  CG  . ARG B 2  134 ? 86.550  99.862  105.054 1.00 24.86 ? 134  ARG B CG  1 
ATOM   4363  C  CD  . ARG B 2  134 ? 88.019  100.172 105.467 1.00 32.55 ? 134  ARG B CD  1 
ATOM   4364  N  NE  . ARG B 2  134 ? 88.121  100.754 106.825 1.00 36.61 ? 134  ARG B NE  1 
ATOM   4365  C  CZ  . ARG B 2  134 ? 88.427  102.028 107.108 1.00 45.41 ? 134  ARG B CZ  1 
ATOM   4366  N  NH1 . ARG B 2  134 ? 88.825  102.886 106.163 1.00 57.19 ? 134  ARG B NH1 1 
ATOM   4367  N  NH2 . ARG B 2  134 ? 88.397  102.437 108.368 1.00 46.21 ? 134  ARG B NH2 1 
ATOM   4368  N  N   . TRP B 2  135 ? 83.133  100.348 106.726 1.00 18.20 ? 135  TRP B N   1 
ATOM   4369  C  CA  . TRP B 2  135 ? 82.477  99.500  107.729 1.00 17.18 ? 135  TRP B CA  1 
ATOM   4370  C  C   . TRP B 2  135 ? 80.985  99.265  107.429 1.00 17.27 ? 135  TRP B C   1 
ATOM   4371  O  O   . TRP B 2  135 ? 80.542  98.104  107.441 1.00 17.38 ? 135  TRP B O   1 
ATOM   4372  C  CB  . TRP B 2  135 ? 82.717  100.031 109.155 1.00 16.35 ? 135  TRP B CB  1 
ATOM   4373  C  CG  . TRP B 2  135 ? 82.268  101.446 109.371 1.00 9.22  ? 135  TRP B CG  1 
ATOM   4374  C  CD1 . TRP B 2  135 ? 81.024  101.865 109.779 1.00 5.31  ? 135  TRP B CD1 1 
ATOM   4375  C  CD2 . TRP B 2  135 ? 83.084  102.634 109.308 1.00 9.35  ? 135  TRP B CD2 1 
ATOM   4376  N  NE1 . TRP B 2  135 ? 80.975  103.237 109.829 1.00 8.47  ? 135  TRP B NE1 1 
ATOM   4377  C  CE2 . TRP B 2  135 ? 82.227  103.745 109.588 1.00 4.42  ? 135  TRP B CE2 1 
ATOM   4378  C  CE3 . TRP B 2  135 ? 84.448  102.882 109.000 1.00 3.08  ? 135  TRP B CE3 1 
ATOM   4379  C  CZ2 . TRP B 2  135 ? 82.696  105.090 109.648 1.00 8.47  ? 135  TRP B CZ2 1 
ATOM   4380  C  CZ3 . TRP B 2  135 ? 84.937  104.240 109.055 1.00 12.47 ? 135  TRP B CZ3 1 
ATOM   4381  C  CH2 . TRP B 2  135 ? 84.049  105.321 109.388 1.00 9.90  ? 135  TRP B CH2 1 
ATOM   4382  N  N   . GLU B 2  136 ? 80.278  100.322 106.982 1.00 17.27 ? 136  GLU B N   1 
ATOM   4383  C  CA  . GLU B 2  136 ? 78.883  100.219 106.486 1.00 17.36 ? 136  GLU B CA  1 
ATOM   4384  C  C   . GLU B 2  136 ? 78.760  99.399  105.201 1.00 19.17 ? 136  GLU B C   1 
ATOM   4385  O  O   . GLU B 2  136 ? 77.822  98.573  105.081 1.00 19.18 ? 136  GLU B O   1 
ATOM   4386  C  CB  . GLU B 2  136 ? 78.208  101.561 106.257 1.00 16.50 ? 136  GLU B CB  1 
ATOM   4387  C  CG  . GLU B 2  136 ? 78.317  102.600 107.371 1.00 19.57 ? 136  GLU B CG  1 
ATOM   4388  C  CD  . GLU B 2  136 ? 77.361  103.766 107.174 1.00 13.63 ? 136  GLU B CD  1 
ATOM   4389  O  OE1 . GLU B 2  136 ? 77.053  104.399 108.181 1.00 21.32 ? 136  GLU B OE1 1 
ATOM   4390  O  OE2 . GLU B 2  136 ? 76.852  104.011 106.034 1.00 16.02 ? 136  GLU B OE2 1 
ATOM   4391  N  N   . VAL B 2  137 ? 79.741  99.572  104.293 1.00 19.73 ? 137  VAL B N   1 
ATOM   4392  C  CA  . VAL B 2  137 ? 79.898  98.712  103.096 1.00 20.23 ? 137  VAL B CA  1 
ATOM   4393  C  C   . VAL B 2  137 ? 80.129  97.213  103.438 1.00 20.73 ? 137  VAL B C   1 
ATOM   4394  O  O   . VAL B 2  137 ? 79.482  96.353  102.831 1.00 21.98 ? 137  VAL B O   1 
ATOM   4395  C  CB  . VAL B 2  137 ? 80.908  99.315  102.046 1.00 19.40 ? 137  VAL B CB  1 
ATOM   4396  C  CG1 . VAL B 2  137 ? 81.212  98.352  100.891 1.00 12.57 ? 137  VAL B CG1 1 
ATOM   4397  C  CG2 . VAL B 2  137 ? 80.327  100.560 101.446 1.00 12.04 ? 137  VAL B CG2 1 
ATOM   4398  N  N   . ALA B 2  138 ? 81.074  96.934  104.356 1.00 20.05 ? 138  ALA B N   1 
ATOM   4399  C  CA  . ALA B 2  138 ? 81.379  95.586  104.885 1.00 19.88 ? 138  ALA B CA  1 
ATOM   4400  C  C   . ALA B 2  138 ? 80.188  94.848  105.535 1.00 20.15 ? 138  ALA B C   1 
ATOM   4401  O  O   . ALA B 2  138 ? 79.952  93.678  105.226 1.00 21.45 ? 138  ALA B O   1 
ATOM   4402  C  CB  . ALA B 2  138 ? 82.570  95.644  105.840 1.00 19.60 ? 138  ALA B CB  1 
ATOM   4403  N  N   . ALA B 2  139 ? 79.455  95.553  106.409 1.00 20.61 ? 139  ALA B N   1 
ATOM   4404  C  CA  . ALA B 2  139 ? 78.229  95.083  107.097 1.00 20.60 ? 139  ALA B CA  1 
ATOM   4405  C  C   . ALA B 2  139 ? 77.086  94.747  106.173 1.00 22.03 ? 139  ALA B C   1 
ATOM   4406  O  O   . ALA B 2  139 ? 76.397  93.735  106.400 1.00 23.15 ? 139  ALA B O   1 
ATOM   4407  C  CB  . ALA B 2  139 ? 77.777  96.067  108.168 1.00 18.93 ? 139  ALA B CB  1 
ATOM   4408  N  N   . LEU B 2  140 ? 77.036  95.456  105.042 1.00 22.29 ? 140  LEU B N   1 
ATOM   4409  C  CA  . LEU B 2  140 ? 76.107  95.205  103.934 1.00 21.83 ? 140  LEU B CA  1 
ATOM   4410  C  C   . LEU B 2  140 ? 76.384  94.023  102.999 1.00 21.33 ? 140  LEU B C   1 
ATOM   4411  O  O   . LEU B 2  140 ? 75.429  93.488  102.446 1.00 22.24 ? 140  LEU B O   1 
ATOM   4412  C  CB  . LEU B 2  140 ? 75.864  96.494  103.128 1.00 21.80 ? 140  LEU B CB  1 
ATOM   4413  C  CG  . LEU B 2  140 ? 74.702  96.643  102.113 1.00 24.08 ? 140  LEU B CG  1 
ATOM   4414  C  CD1 . LEU B 2  140 ? 73.306  96.451  102.739 1.00 13.56 ? 140  LEU B CD1 1 
ATOM   4415  C  CD2 . LEU B 2  140 ? 74.829  98.024  101.486 1.00 14.99 ? 140  LEU B CD2 1 
ATOM   4416  N  N   . GLN B 2  141 ? 77.652  93.686  102.734 1.00 20.64 ? 141  GLN B N   1 
ATOM   4417  C  CA  . GLN B 2  141 ? 78.001  92.532  101.831 1.00 21.36 ? 141  GLN B CA  1 
ATOM   4418  C  C   . GLN B 2  141 ? 77.184  91.213  101.997 1.00 21.13 ? 141  GLN B C   1 
ATOM   4419  O  O   . GLN B 2  141 ? 76.732  90.709  100.958 1.00 21.05 ? 141  GLN B O   1 
ATOM   4420  C  CB  . GLN B 2  141 ? 79.520  92.201  101.738 1.00 21.84 ? 141  GLN B CB  1 
ATOM   4421  C  CG  . GLN B 2  141 ? 80.503  93.395  101.505 1.00 23.59 ? 141  GLN B CG  1 
ATOM   4422  C  CD  . GLN B 2  141 ? 80.863  93.695  100.016 1.00 16.34 ? 141  GLN B CD  1 
ATOM   4423  O  OE1 . GLN B 2  141 ? 80.661  92.886  99.103  1.00 30.36 ? 141  GLN B OE1 1 
ATOM   4424  N  NE2 . GLN B 2  141 ? 81.403  94.859  99.804  1.00 28.40 ? 141  GLN B NE2 1 
ATOM   4425  N  N   . PRO B 2  142 ? 76.868  90.722  103.240 1.00 21.24 ? 142  PRO B N   1 
ATOM   4426  C  CA  . PRO B 2  142 ? 75.974  89.527  103.356 1.00 20.54 ? 142  PRO B CA  1 
ATOM   4427  C  C   . PRO B 2  142 ? 74.544  89.746  102.866 1.00 19.86 ? 142  PRO B C   1 
ATOM   4428  O  O   . PRO B 2  142 ? 73.902  88.753  102.605 1.00 19.98 ? 142  PRO B O   1 
ATOM   4429  C  CB  . PRO B 2  142 ? 75.965  89.193  104.879 1.00 20.05 ? 142  PRO B CB  1 
ATOM   4430  C  CG  . PRO B 2  142 ? 77.175  89.915  105.474 1.00 24.67 ? 142  PRO B CG  1 
ATOM   4431  C  CD  . PRO B 2  142 ? 77.457  91.059  104.576 1.00 20.93 ? 142  PRO B CD  1 
ATOM   4432  N  N   . GLN B 2  143 ? 74.088  90.994  102.700 1.00 19.64 ? 143  GLN B N   1 
ATOM   4433  C  CA  . GLN B 2  143 ? 72.765  91.265  102.106 1.00 19.99 ? 143  GLN B CA  1 
ATOM   4434  C  C   . GLN B 2  143 ? 72.616  90.835  100.642 1.00 19.90 ? 143  GLN B C   1 
ATOM   4435  O  O   . GLN B 2  143 ? 71.506  90.457  100.229 1.00 20.15 ? 143  GLN B O   1 
ATOM   4436  C  CB  . GLN B 2  143 ? 72.334  92.731  102.301 1.00 20.69 ? 143  GLN B CB  1 
ATOM   4437  C  CG  . GLN B 2  143 ? 70.798  93.018  102.102 1.00 17.36 ? 143  GLN B CG  1 
ATOM   4438  C  CD  . GLN B 2  143 ? 69.900  92.278  103.081 1.00 24.78 ? 143  GLN B CD  1 
ATOM   4439  O  OE1 . GLN B 2  143 ? 68.784  91.895  102.721 1.00 24.92 ? 143  GLN B OE1 1 
ATOM   4440  N  NE2 . GLN B 2  143 ? 70.320  92.199  104.345 1.00 23.20 ? 143  GLN B NE2 1 
ATOM   4441  N  N   . LEU B 2  144 ? 73.726  90.897  99.883  1.00 19.42 ? 144  LEU B N   1 
ATOM   4442  C  CA  . LEU B 2  144 ? 73.848  90.325  98.524  1.00 19.12 ? 144  LEU B CA  1 
ATOM   4443  C  C   . LEU B 2  144 ? 73.426  88.877  98.419  1.00 19.12 ? 144  LEU B C   1 
ATOM   4444  O  O   . LEU B 2  144 ? 72.604  88.540  97.563  1.00 19.27 ? 144  LEU B O   1 
ATOM   4445  C  CB  . LEU B 2  144 ? 75.273  90.529  97.932  1.00 18.95 ? 144  LEU B CB  1 
ATOM   4446  C  CG  . LEU B 2  144 ? 75.769  91.968  97.687  1.00 24.85 ? 144  LEU B CG  1 
ATOM   4447  C  CD1 . LEU B 2  144 ? 77.290  92.048  97.626  1.00 22.92 ? 144  LEU B CD1 1 
ATOM   4448  C  CD2 . LEU B 2  144 ? 75.174  92.588  96.463  1.00 20.97 ? 144  LEU B CD2 1 
ATOM   4449  N  N   . ARG B 2  145 ? 73.847  88.080  99.406  1.00 19.30 ? 145  ARG B N   1 
ATOM   4450  C  CA  . ARG B 2  145 ? 73.568  86.635  99.470  1.00 19.23 ? 145  ARG B CA  1 
ATOM   4451  C  C   . ARG B 2  145 ? 72.071  86.350  99.749  1.00 18.26 ? 145  ARG B C   1 
ATOM   4452  O  O   . ARG B 2  145 ? 71.449  85.626  98.988  1.00 17.20 ? 145  ARG B O   1 
ATOM   4453  C  CB  . ARG B 2  145 ? 74.450  86.006  100.542 1.00 19.33 ? 145  ARG B CB  1 
ATOM   4454  C  CG  . ARG B 2  145 ? 74.578  84.472  100.441 1.00 19.02 ? 145  ARG B CG  1 
ATOM   4455  C  CD  . ARG B 2  145 ? 75.700  83.939  101.278 1.00 22.94 ? 145  ARG B CD  1 
ATOM   4456  N  NE  . ARG B 2  145 ? 76.966  84.002  100.539 1.00 29.30 ? 145  ARG B NE  1 
ATOM   4457  C  CZ  . ARG B 2  145 ? 78.003  84.792  100.828 1.00 34.45 ? 145  ARG B CZ  1 
ATOM   4458  N  NH1 . ARG B 2  145 ? 77.980  85.629  101.875 1.00 28.47 ? 145  ARG B NH1 1 
ATOM   4459  N  NH2 . ARG B 2  145 ? 79.088  84.737  100.054 1.00 35.31 ? 145  ARG B NH2 1 
ATOM   4460  N  N   . ILE B 2  146 ? 71.486  87.141  100.662 1.00 19.01 ? 146  ILE B N   1 
ATOM   4461  C  CA  . ILE B 2  146 ? 70.067  87.060  101.044 1.00 19.31 ? 146  ILE B CA  1 
ATOM   4462  C  C   . ILE B 2  146 ? 69.129  87.465  99.883  1.00 18.28 ? 146  ILE B C   1 
ATOM   4463  O  O   . ILE B 2  146 ? 68.208  86.688  99.520  1.00 17.54 ? 146  ILE B O   1 
ATOM   4464  C  CB  . ILE B 2  146 ? 69.783  87.873  102.414 1.00 19.68 ? 146  ILE B CB  1 
ATOM   4465  C  CG1 . ILE B 2  146 ? 70.591  87.342  103.648 1.00 23.52 ? 146  ILE B CG1 1 
ATOM   4466  C  CG2 . ILE B 2  146 ? 68.271  87.974  102.743 1.00 21.89 ? 146  ILE B CG2 1 
ATOM   4467  C  CD1 . ILE B 2  146 ? 70.604  85.750  103.899 1.00 38.31 ? 146  ILE B CD1 1 
ATOM   4468  N  N   . ASP B 2  147 ? 69.385  88.664  99.329  1.00 18.14 ? 147  ASP B N   1 
ATOM   4469  C  CA  . ASP B 2  147 ? 68.633  89.272  98.227  1.00 18.79 ? 147  ASP B CA  1 
ATOM   4470  C  C   . ASP B 2  147 ? 68.632  88.399  96.945  1.00 19.36 ? 147  ASP B C   1 
ATOM   4471  O  O   . ASP B 2  147 ? 67.549  88.088  96.404  1.00 19.91 ? 147  ASP B O   1 
ATOM   4472  C  CB  . ASP B 2  147 ? 69.202  90.666  97.933  1.00 19.69 ? 147  ASP B CB  1 
ATOM   4473  C  CG  . ASP B 2  147 ? 68.248  91.541  97.144  1.00 27.06 ? 147  ASP B CG  1 
ATOM   4474  O  OD1 . ASP B 2  147 ? 68.652  91.990  96.047  1.00 24.19 ? 147  ASP B OD1 1 
ATOM   4475  O  OD2 . ASP B 2  147 ? 67.185  92.005  97.633  1.00 28.30 ? 147  ASP B OD2 1 
ATOM   4476  N  N   . LYS B 2  148 ? 69.814  87.872  96.586  1.00 18.55 ? 148  LYS B N   1 
ATOM   4477  C  CA  . LYS B 2  148 ? 69.956  86.866  95.536  1.00 17.84 ? 148  LYS B CA  1 
ATOM   4478  C  C   . LYS B 2  148 ? 69.174  85.589  95.809  1.00 17.62 ? 148  LYS B C   1 
ATOM   4479  O  O   . LYS B 2  148 ? 68.508  85.081  94.887  1.00 18.56 ? 148  LYS B O   1 
ATOM   4480  C  CB  . LYS B 2  148 ? 71.434  86.558  95.264  1.00 18.05 ? 148  LYS B CB  1 
ATOM   4481  C  CG  . LYS B 2  148 ? 71.726  85.989  93.883  1.00 17.71 ? 148  LYS B CG  1 
ATOM   4482  C  CD  . LYS B 2  148 ? 73.201  85.563  93.746  1.00 17.87 ? 148  LYS B CD  1 
ATOM   4483  C  CE  . LYS B 2  148 ? 73.410  84.886  92.405  1.00 14.66 ? 148  LYS B CE  1 
ATOM   4484  N  NZ  . LYS B 2  148 ? 74.838  84.917  91.936  1.00 23.96 ? 148  LYS B NZ  1 
ATOM   4485  N  N   . ALA B 2  149 ? 69.255  85.068  97.050  1.00 16.07 ? 149  ALA B N   1 
ATOM   4486  C  CA  . ALA B 2  149 ? 68.643  83.761  97.388  1.00 14.42 ? 149  ALA B CA  1 
ATOM   4487  C  C   . ALA B 2  149 ? 67.112  83.815  97.280  1.00 13.89 ? 149  ALA B C   1 
ATOM   4488  O  O   . ALA B 2  149 ? 66.564  83.072  96.507  1.00 13.85 ? 149  ALA B O   1 
ATOM   4489  C  CB  . ALA B 2  149 ? 69.100  83.254  98.778  1.00 13.33 ? 149  ALA B CB  1 
ATOM   4490  N  N   . VAL B 2  150 ? 66.542  84.932  97.750  1.00 14.62 ? 150  VAL B N   1 
ATOM   4491  C  CA  . VAL B 2  150 ? 65.111  85.267  97.659  1.00 15.26 ? 150  VAL B CA  1 
ATOM   4492  C  C   . VAL B 2  150 ? 64.634  85.393  96.202  1.00 16.06 ? 150  VAL B C   1 
ATOM   4493  O  O   . VAL B 2  150 ? 63.749  84.647  95.799  1.00 16.16 ? 150  VAL B O   1 
ATOM   4494  C  CB  . VAL B 2  150 ? 64.754  86.528  98.550  1.00 15.07 ? 150  VAL B CB  1 
ATOM   4495  C  CG1 . VAL B 2  150 ? 63.439  87.169  98.116  1.00 10.34 ? 150  VAL B CG1 1 
ATOM   4496  C  CG2 . VAL B 2  150 ? 64.704  86.136  100.057 1.00 3.63  ? 150  VAL B CG2 1 
ATOM   4497  N  N   . ALA B 2  151 ? 65.339  86.199  95.397  1.00 16.80 ? 151  ALA B N   1 
ATOM   4498  C  CA  . ALA B 2  151 ? 65.098  86.313  93.939  1.00 16.88 ? 151  ALA B CA  1 
ATOM   4499  C  C   . ALA B 2  151 ? 65.220  85.016  93.150  1.00 17.87 ? 151  ALA B C   1 
ATOM   4500  O  O   . ALA B 2  151 ? 64.360  84.742  92.343  1.00 18.97 ? 151  ALA B O   1 
ATOM   4501  C  CB  . ALA B 2  151 ? 65.973  87.346  93.345  1.00 16.43 ? 151  ALA B CB  1 
ATOM   4502  N  N   . LEU B 2  152 ? 66.185  84.162  93.506  1.00 18.82 ? 152  LEU B N   1 
ATOM   4503  C  CA  . LEU B 2  152 ? 66.485  82.928  92.753  1.00 19.65 ? 152  LEU B CA  1 
ATOM   4504  C  C   . LEU B 2  152 ? 65.713  81.690  93.199  1.00 19.56 ? 152  LEU B C   1 
ATOM   4505  O  O   . LEU B 2  152 ? 65.908  80.602  92.660  1.00 20.26 ? 152  LEU B O   1 
ATOM   4506  C  CB  . LEU B 2  152 ? 68.010  82.679  92.659  1.00 20.81 ? 152  LEU B CB  1 
ATOM   4507  C  CG  . LEU B 2  152 ? 68.760  82.908  91.310  1.00 26.93 ? 152  LEU B CG  1 
ATOM   4508  C  CD1 . LEU B 2  152 ? 68.473  84.216  90.601  1.00 32.53 ? 152  LEU B CD1 1 
ATOM   4509  C  CD2 . LEU B 2  152 ? 70.264  82.742  91.497  1.00 28.28 ? 152  LEU B CD2 1 
ATOM   4510  N  N   . GLN B 2  153 ? 64.722  81.910  94.055  1.00 18.86 ? 153  GLN B N   1 
ATOM   4511  C  CA  . GLN B 2  153 ? 63.740  80.921  94.395  1.00 18.07 ? 153  GLN B CA  1 
ATOM   4512  C  C   . GLN B 2  153 ? 62.547  80.815  93.410  1.00 17.28 ? 153  GLN B C   1 
ATOM   4513  O  O   . GLN B 2  153 ? 61.789  79.837  93.463  1.00 16.00 ? 153  GLN B O   1 
ATOM   4514  C  CB  . GLN B 2  153 ? 63.390  81.035  95.888  1.00 18.56 ? 153  GLN B CB  1 
ATOM   4515  C  CG  . GLN B 2  153 ? 62.115  81.739  96.253  1.00 34.98 ? 153  GLN B CG  1 
ATOM   4516  C  CD  . GLN B 2  153 ? 62.218  82.499  97.555  1.00 43.77 ? 153  GLN B CD  1 
ATOM   4517  O  OE1 . GLN B 2  153 ? 62.663  81.966  98.581  1.00 23.17 ? 153  GLN B OE1 1 
ATOM   4518  N  NE2 . GLN B 2  153 ? 61.851  83.778  97.506  1.00 51.30 ? 153  GLN B NE2 1 
ATOM   4519  N  N   . ASN B 2  154 ? 62.358  81.858  92.581  1.00 17.27 ? 154  ASN B N   1 
ATOM   4520  C  CA  . ASN B 2  154 ? 61.698  81.748  91.268  1.00 17.75 ? 154  ASN B CA  1 
ATOM   4521  C  C   . ASN B 2  154 ? 62.685  81.158  90.236  1.00 17.88 ? 154  ASN B C   1 
ATOM   4522  O  O   . ASN B 2  154 ? 63.773  81.768  90.017  1.00 18.93 ? 154  ASN B O   1 
ATOM   4523  C  CB  . ASN B 2  154 ? 61.154  83.113  90.780  1.00 18.80 ? 154  ASN B CB  1 
ATOM   4524  C  CG  . ASN B 2  154 ? 60.452  83.922  91.898  1.00 28.65 ? 154  ASN B CG  1 
ATOM   4525  O  OD1 . ASN B 2  154 ? 59.268  83.725  92.172  1.00 25.92 ? 154  ASN B OD1 1 
ATOM   4526  N  ND2 . ASN B 2  154 ? 61.196  84.822  92.541  1.00 23.57 ? 154  ASN B ND2 1 
ATOM   4527  N  N   . PRO B 2  155 ? 62.395  79.954  89.682  1.00 17.75 ? 155  PRO B N   1 
ATOM   4528  C  CA  . PRO B 2  155 ? 63.199  79.396  88.566  1.00 18.78 ? 155  PRO B CA  1 
ATOM   4529  C  C   . PRO B 2  155 ? 63.343  80.320  87.350  1.00 19.45 ? 155  PRO B C   1 
ATOM   4530  O  O   . PRO B 2  155 ? 64.372  80.235  86.692  1.00 20.18 ? 155  PRO B O   1 
ATOM   4531  C  CB  . PRO B 2  155 ? 62.409  78.134  88.149  1.00 18.68 ? 155  PRO B CB  1 
ATOM   4532  C  CG  . PRO B 2  155 ? 61.645  77.748  89.359  1.00 13.85 ? 155  PRO B CG  1 
ATOM   4533  C  CD  . PRO B 2  155 ? 61.251  79.052  89.996  1.00 16.76 ? 155  PRO B CD  1 
ATOM   4534  N  N   . GLN B 2  156 ? 62.369  81.211  87.130  1.00 19.54 ? 156  GLN B N   1 
ATOM   4535  C  CA  . GLN B 2  156 ? 62.365  82.198  86.048  1.00 20.03 ? 156  GLN B CA  1 
ATOM   4536  C  C   . GLN B 2  156 ? 63.543  83.183  86.077  1.00 20.03 ? 156  GLN B C   1 
ATOM   4537  O  O   . GLN B 2  156 ? 64.128  83.461  85.021  1.00 20.31 ? 156  GLN B O   1 
ATOM   4538  C  CB  . GLN B 2  156 ? 61.041  82.964  85.993  1.00 20.35 ? 156  GLN B CB  1 
ATOM   4539  C  CG  . GLN B 2  156 ? 59.765  82.106  85.899  1.00 35.61 ? 156  GLN B CG  1 
ATOM   4540  C  CD  . GLN B 2  156 ? 59.038  81.964  87.243  1.00 45.12 ? 156  GLN B CD  1 
ATOM   4541  O  OE1 . GLN B 2  156 ? 59.615  81.491  88.229  1.00 48.10 ? 156  GLN B OE1 1 
ATOM   4542  N  NE2 . GLN B 2  156 ? 57.767  82.355  87.273  1.00 47.48 ? 156  GLN B NE2 1 
ATOM   4543  N  N   . ALA B 2  157 ? 63.936  83.609  87.284  1.00 19.60 ? 157  ALA B N   1 
ATOM   4544  C  CA  . ALA B 2  157 ? 65.078  84.503  87.488  1.00 19.41 ? 157  ALA B CA  1 
ATOM   4545  C  C   . ALA B 2  157 ? 66.417  83.915  87.063  1.00 19.26 ? 157  ALA B C   1 
ATOM   4546  O  O   . ALA B 2  157 ? 66.993  84.461  86.157  1.00 19.44 ? 157  ALA B O   1 
ATOM   4547  C  CB  . ALA B 2  157 ? 65.126  85.060  88.914  1.00 19.87 ? 157  ALA B CB  1 
ATOM   4548  N  N   . HIS B 2  158 ? 66.697  82.659  87.442  1.00 20.46 ? 158  HIS B N   1 
ATOM   4549  C  CA  . HIS B 2  158 ? 67.877  81.918  86.934  1.00 21.01 ? 158  HIS B CA  1 
ATOM   4550  C  C   . HIS B 2  158 ? 67.925  81.629  85.433  1.00 20.64 ? 158  HIS B C   1 
ATOM   4551  O  O   . HIS B 2  158 ? 68.921  81.997  84.787  1.00 21.66 ? 158  HIS B O   1 
ATOM   4552  C  CB  . HIS B 2  158 ? 68.310  80.710  87.806  1.00 21.14 ? 158  HIS B CB  1 
ATOM   4553  C  CG  . HIS B 2  158 ? 69.803  80.441  87.780  1.00 29.25 ? 158  HIS B CG  1 
ATOM   4554  N  ND1 . HIS B 2  158 ? 70.328  79.176  87.615  1.00 37.13 ? 158  HIS B ND1 1 
ATOM   4555  C  CD2 . HIS B 2  158 ? 70.873  81.281  87.816  1.00 35.55 ? 158  HIS B CD2 1 
ATOM   4556  C  CE1 . HIS B 2  158 ? 71.649  79.245  87.579  1.00 36.48 ? 158  HIS B CE1 1 
ATOM   4557  N  NE2 . HIS B 2  158 ? 72.007  80.506  87.722  1.00 20.42 ? 158  HIS B NE2 1 
ATOM   4558  N  N   . VAL B 2  159 ? 66.754  81.328  84.866  1.00 19.24 ? 159  VAL B N   1 
ATOM   4559  C  CA  . VAL B 2  159 ? 66.579  81.130  83.412  1.00 18.49 ? 159  VAL B CA  1 
ATOM   4560  C  C   . VAL B 2  159 ? 66.844  82.420  82.595  1.00 17.69 ? 159  VAL B C   1 
ATOM   4561  O  O   . VAL B 2  159 ? 67.736  82.422  81.747  1.00 17.24 ? 159  VAL B O   1 
ATOM   4562  C  CB  . VAL B 2  159 ? 65.224  80.425  83.047  1.00 18.38 ? 159  VAL B CB  1 
ATOM   4563  C  CG1 . VAL B 2  159 ? 65.023  80.326  81.517  1.00 15.22 ? 159  VAL B CG1 1 
ATOM   4564  C  CG2 . VAL B 2  159 ? 65.163  79.023  83.659  1.00 9.49  ? 159  VAL B CG2 1 
ATOM   4565  N  N   . ILE B 2  160 ? 66.172  83.518  82.957  1.00 17.20 ? 160  ILE B N   1 
ATOM   4566  C  CA  . ILE B 2  160 ? 66.326  84.807  82.258  1.00 16.14 ? 160  ILE B CA  1 
ATOM   4567  C  C   . ILE B 2  160 ? 67.741  85.382  82.430  1.00 15.77 ? 160  ILE B C   1 
ATOM   4568  O  O   . ILE B 2  160 ? 68.302  85.882  81.453  1.00 17.40 ? 160  ILE B O   1 
ATOM   4569  C  CB  . ILE B 2  160 ? 65.153  85.809  82.595  1.00 15.77 ? 160  ILE B CB  1 
ATOM   4570  C  CG1 . ILE B 2  160 ? 63.914  85.382  81.823  1.00 17.23 ? 160  ILE B CG1 1 
ATOM   4571  C  CG2 . ILE B 2  160 ? 65.471  87.295  82.151  1.00 11.03 ? 160  ILE B CG2 1 
ATOM   4572  C  CD1 . ILE B 2  160 ? 62.620  85.623  82.537  1.00 34.42 ? 160  ILE B CD1 1 
ATOM   4573  N  N   . GLU B 2  161 ? 68.356  85.152  83.602  1.00 14.16 ? 161  GLU B N   1 
ATOM   4574  C  CA  . GLU B 2  161 ? 69.777  85.484  83.837  1.00 13.10 ? 161  GLU B CA  1 
ATOM   4575  C  C   . GLU B 2  161 ? 70.736  84.645  82.980  1.00 14.60 ? 161  GLU B C   1 
ATOM   4576  O  O   . GLU B 2  161 ? 71.578  85.218  82.294  1.00 15.48 ? 161  GLU B O   1 
ATOM   4577  C  CB  . GLU B 2  161 ? 70.188  85.497  85.327  1.00 10.37 ? 161  GLU B CB  1 
ATOM   4578  C  CG  . GLU B 2  161 ? 69.403  86.462  86.230  1.00 30.05 ? 161  GLU B CG  1 
ATOM   4579  C  CD  . GLU B 2  161 ? 69.869  87.922  86.157  1.00 25.34 ? 161  GLU B CD  1 
ATOM   4580  O  OE1 . GLU B 2  161 ? 70.550  88.387  87.070  1.00 32.67 ? 161  GLU B OE1 1 
ATOM   4581  O  OE2 . GLU B 2  161 ? 69.551  88.605  85.196  1.00 28.59 ? 161  GLU B OE2 1 
ATOM   4582  N  N   . ASN B 2  162 ? 70.517  83.322  82.903  1.00 14.93 ? 162  ASN B N   1 
ATOM   4583  C  CA  . ASN B 2  162 ? 71.284  82.485  81.976  1.00 15.26 ? 162  ASN B CA  1 
ATOM   4584  C  C   . ASN B 2  162 ? 71.062  82.814  80.492  1.00 16.65 ? 162  ASN B C   1 
ATOM   4585  O  O   . ASN B 2  162 ? 72.062  82.918  79.725  1.00 16.84 ? 162  ASN B O   1 
ATOM   4586  C  CB  . ASN B 2  162 ? 71.120  80.987  82.252  1.00 14.82 ? 162  ASN B CB  1 
ATOM   4587  C  CG  . ASN B 2  162 ? 71.841  80.505  83.528  1.00 13.76 ? 162  ASN B CG  1 
ATOM   4588  O  OD1 . ASN B 2  162 ? 71.542  79.398  83.985  1.00 32.81 ? 162  ASN B OD1 1 
ATOM   4589  N  ND2 . ASN B 2  162 ? 72.955  81.150  83.901  1.00 13.50 ? 162  ASN B ND2 1 
ATOM   4590  N  N   . LEU B 2  163 ? 69.802  83.176  80.161  1.00 16.65 ? 163  LEU B N   1 
ATOM   4591  C  CA  . LEU B 2  163 ? 69.379  83.542  78.803  1.00 16.01 ? 163  LEU B CA  1 
ATOM   4592  C  C   . LEU B 2  163 ? 70.146  84.694  78.202  1.00 15.94 ? 163  LEU B C   1 
ATOM   4593  O  O   . LEU B 2  163 ? 70.576  84.600  77.049  1.00 16.23 ? 163  LEU B O   1 
ATOM   4594  C  CB  . LEU B 2  163 ? 67.852  83.738  78.672  1.00 15.40 ? 163  LEU B CB  1 
ATOM   4595  C  CG  . LEU B 2  163 ? 67.281  83.931  77.243  1.00 9.60  ? 163  LEU B CG  1 
ATOM   4596  C  CD1 . LEU B 2  163 ? 67.145  82.634  76.410  1.00 8.30  ? 163  LEU B CD1 1 
ATOM   4597  C  CD2 . LEU B 2  163 ? 66.004  84.761  77.217  1.00 16.01 ? 163  LEU B CD2 1 
ATOM   4598  N  N   . HIS B 2  164 ? 70.386  85.712  79.025  1.00 16.05 ? 164  HIS B N   1 
ATOM   4599  C  CA  . HIS B 2  164 ? 71.164  86.895  78.659  1.00 15.72 ? 164  HIS B CA  1 
ATOM   4600  C  C   . HIS B 2  164 ? 72.644  86.642  78.563  1.00 16.25 ? 164  HIS B C   1 
ATOM   4601  O  O   . HIS B 2  164 ? 73.306  87.297  77.751  1.00 17.68 ? 164  HIS B O   1 
ATOM   4602  C  CB  . HIS B 2  164 ? 70.885  88.044  79.612  1.00 14.56 ? 164  HIS B CB  1 
ATOM   4603  C  CG  . HIS B 2  164 ? 69.564  88.692  79.388  1.00 15.68 ? 164  HIS B CG  1 
ATOM   4604  N  ND1 . HIS B 2  164 ? 68.375  88.119  79.792  1.00 12.57 ? 164  HIS B ND1 1 
ATOM   4605  C  CD2 . HIS B 2  164 ? 69.237  89.859  78.781  1.00 13.81 ? 164  HIS B CD2 1 
ATOM   4606  C  CE1 . HIS B 2  164 ? 67.375  88.923  79.468  1.00 7.28  ? 164  HIS B CE1 1 
ATOM   4607  N  NE2 . HIS B 2  164 ? 67.870  89.973  78.835  1.00 9.99  ? 164  HIS B NE2 1 
ATOM   4608  N  N   . ALA B 2  165 ? 73.190  85.842  79.489  1.00 15.06 ? 165  ALA B N   1 
ATOM   4609  C  CA  . ALA B 2  165 ? 74.601  85.424  79.422  1.00 14.47 ? 165  ALA B CA  1 
ATOM   4610  C  C   . ALA B 2  165 ? 74.919  84.570  78.190  1.00 14.27 ? 165  ALA B C   1 
ATOM   4611  O  O   . ALA B 2  165 ? 75.956  84.772  77.574  1.00 14.35 ? 165  ALA B O   1 
ATOM   4612  C  CB  . ALA B 2  165 ? 75.061  84.751  80.727  1.00 13.70 ? 165  ALA B CB  1 
ATOM   4613  N  N   . ALA B 2  166 ? 73.977  83.682  77.811  1.00 14.35 ? 166  ALA B N   1 
ATOM   4614  C  CA  . ALA B 2  166 ? 73.975  82.941  76.533  1.00 13.60 ? 166  ALA B CA  1 
ATOM   4615  C  C   . ALA B 2  166 ? 73.877  83.851  75.286  1.00 12.89 ? 166  ALA B C   1 
ATOM   4616  O  O   . ALA B 2  166 ? 74.687  83.717  74.375  1.00 12.66 ? 166  ALA B O   1 
ATOM   4617  C  CB  . ALA B 2  166 ? 72.854  81.862  76.521  1.00 13.34 ? 166  ALA B CB  1 
ATOM   4618  N  N   . ALA B 2  167 ? 73.007  84.864  75.353  1.00 12.87 ? 167  ALA B N   1 
ATOM   4619  C  CA  . ALA B 2  167 ? 72.709  85.758  74.236  1.00 12.87 ? 167  ALA B CA  1 
ATOM   4620  C  C   . ALA B 2  167 ? 73.823  86.706  73.860  1.00 14.37 ? 167  ALA B C   1 
ATOM   4621  O  O   . ALA B 2  167 ? 74.113  86.846  72.654  1.00 15.58 ? 167  ALA B O   1 
ATOM   4622  C  CB  . ALA B 2  167 ? 71.408  86.490  74.442  1.00 11.61 ? 167  ALA B CB  1 
ATOM   4623  N  N   . TYR B 2  168 ? 74.526  87.238  74.871  1.00 14.58 ? 168  TYR B N   1 
ATOM   4624  C  CA  . TYR B 2  168 ? 75.397  88.409  74.705  1.00 15.86 ? 168  TYR B CA  1 
ATOM   4625  C  C   . TYR B 2  168 ? 76.814  88.136  75.095  1.00 18.72 ? 168  TYR B C   1 
ATOM   4626  O  O   . TYR B 2  168 ? 77.081  87.291  75.962  1.00 19.25 ? 168  TYR B O   1 
ATOM   4627  C  CB  . TYR B 2  168 ? 74.856  89.635  75.443  1.00 14.29 ? 168  TYR B CB  1 
ATOM   4628  C  CG  . TYR B 2  168 ? 73.557  90.154  74.888  1.00 13.48 ? 168  TYR B CG  1 
ATOM   4629  C  CD1 . TYR B 2  168 ? 72.332  89.816  75.504  1.00 14.66 ? 168  TYR B CD1 1 
ATOM   4630  C  CD2 . TYR B 2  168 ? 73.530  90.995  73.727  1.00 11.90 ? 168  TYR B CD2 1 
ATOM   4631  C  CE1 . TYR B 2  168 ? 71.079  90.296  74.980  1.00 14.55 ? 168  TYR B CE1 1 
ATOM   4632  C  CE2 . TYR B 2  168 ? 72.287  91.425  73.155  1.00 8.72  ? 168  TYR B CE2 1 
ATOM   4633  C  CZ  . TYR B 2  168 ? 71.071  91.084  73.817  1.00 4.61  ? 168  TYR B CZ  1 
ATOM   4634  O  OH  . TYR B 2  168 ? 69.867  91.442  73.265  1.00 10.41 ? 168  TYR B OH  1 
ATOM   4635  N  N   . ARG B 2  169 ? 77.718  88.699  74.295  1.00 20.76 ? 169  ARG B N   1 
ATOM   4636  C  CA  . ARG B 2  169 ? 79.178  88.622  74.510  1.00 22.68 ? 169  ARG B CA  1 
ATOM   4637  C  C   . ARG B 2  169 ? 79.633  89.396  75.746  1.00 24.02 ? 169  ARG B C   1 
ATOM   4638  O  O   . ARG B 2  169 ? 80.652  89.066  76.353  1.00 24.14 ? 169  ARG B O   1 
ATOM   4639  C  CB  . ARG B 2  169 ? 79.904  89.207  73.302  1.00 22.65 ? 169  ARG B CB  1 
ATOM   4640  C  CG  . ARG B 2  169 ? 80.108  88.264  72.199  1.00 22.66 ? 169  ARG B CG  1 
ATOM   4641  C  CD  . ARG B 2  169 ? 80.902  88.835  71.006  1.00 19.28 ? 169  ARG B CD  1 
ATOM   4642  N  NE  . ARG B 2  169 ? 80.399  88.344  69.716  1.00 21.10 ? 169  ARG B NE  1 
ATOM   4643  C  CZ  . ARG B 2  169 ? 80.589  87.111  69.212  1.00 22.89 ? 169  ARG B CZ  1 
ATOM   4644  N  NH1 . ARG B 2  169 ? 81.340  86.190  69.833  1.00 23.29 ? 169  ARG B NH1 1 
ATOM   4645  N  NH2 . ARG B 2  169 ? 80.044  86.812  68.055  1.00 18.05 ? 169  ARG B NH2 1 
ATOM   4646  N  N   . ASN B 2  170 ? 78.786  90.317  76.187  1.00 25.73 ? 170  ASN B N   1 
ATOM   4647  C  CA  . ASN B 2  170 ? 79.189  91.666  76.468  1.00 27.71 ? 170  ASN B CA  1 
ATOM   4648  C  C   . ASN B 2  170 ? 78.589  92.177  77.770  1.00 28.13 ? 170  ASN B C   1 
ATOM   4649  O  O   . ASN B 2  170 ? 79.161  91.915  78.833  1.00 30.34 ? 170  ASN B O   1 
ATOM   4650  C  CB  . ASN B 2  170 ? 78.904  92.573  75.230  1.00 28.69 ? 170  ASN B CB  1 
ATOM   4651  C  CG  . ASN B 2  170 ? 79.767  93.801  75.193  1.00 38.18 ? 170  ASN B CG  1 
ATOM   4652  O  OD1 . ASN B 2  170 ? 79.257  94.907  75.131  1.00 49.36 ? 170  ASN B OD1 1 
ATOM   4653  N  ND2 . ASN B 2  170 ? 81.085  93.614  75.111  1.00 55.26 ? 170  ASN B ND2 1 
ATOM   4654  N  N   . ALA B 2  171 ? 77.374  92.728  77.723  1.00 25.91 ? 171  ALA B N   1 
ATOM   4655  C  CA  . ALA B 2  171 ? 77.040  93.980  78.512  1.00 22.63 ? 171  ALA B CA  1 
ATOM   4656  C  C   . ALA B 2  171 ? 75.639  93.838  79.083  1.00 20.41 ? 171  ALA B C   1 
ATOM   4657  O  O   . ALA B 2  171 ? 75.521  93.628  80.277  1.00 20.64 ? 171  ALA B O   1 
ATOM   4658  C  CB  . ALA B 2  171 ? 77.145  95.233  77.643  1.00 21.52 ? 171  ALA B CB  1 
ATOM   4659  N  N   . LEU B 2  172 ? 74.679  93.542  78.182  1.00 18.25 ? 172  LEU B N   1 
ATOM   4660  C  CA  . LEU B 2  172 ? 73.407  92.904  78.506  1.00 16.23 ? 172  LEU B CA  1 
ATOM   4661  C  C   . LEU B 2  172 ? 73.501  91.445  79.004  1.00 16.17 ? 172  LEU B C   1 
ATOM   4662  O  O   . LEU B 2  172 ? 72.586  90.958  79.701  1.00 16.47 ? 172  LEU B O   1 
ATOM   4663  C  CB  . LEU B 2  172 ? 72.410  93.074  77.355  1.00 15.45 ? 172  LEU B CB  1 
ATOM   4664  C  CG  . LEU B 2  172 ? 71.879  94.463  76.946  1.00 17.29 ? 172  LEU B CG  1 
ATOM   4665  C  CD1 . LEU B 2  172 ? 71.134  94.361  75.636  1.00 4.45  ? 172  LEU B CD1 1 
ATOM   4666  C  CD2 . LEU B 2  172 ? 71.018  95.238  78.035  1.00 10.38 ? 172  LEU B CD2 1 
ATOM   4667  N  N   . ALA B 2  173 ? 74.636  90.796  78.728  1.00 15.89 ? 173  ALA B N   1 
ATOM   4668  C  CA  . ALA B 2  173 ? 75.074  89.552  79.387  1.00 15.99 ? 173  ALA B CA  1 
ATOM   4669  C  C   . ALA B 2  173 ? 75.169  89.565  80.923  1.00 17.26 ? 173  ALA B C   1 
ATOM   4670  O  O   . ALA B 2  173 ? 75.107  88.504  81.539  1.00 19.36 ? 173  ALA B O   1 
ATOM   4671  C  CB  . ALA B 2  173 ? 76.387  89.043  78.771  1.00 15.03 ? 173  ALA B CB  1 
ATOM   4672  N  N   . ASN B 2  174 ? 75.468  90.725  81.510  1.00 17.56 ? 174  ASN B N   1 
ATOM   4673  C  CA  . ASN B 2  174 ? 75.598  90.870  82.967  1.00 17.54 ? 174  ASN B CA  1 
ATOM   4674  C  C   . ASN B 2  174 ? 74.339  90.525  83.720  1.00 17.50 ? 174  ASN B C   1 
ATOM   4675  O  O   . ASN B 2  174 ? 73.222  90.835  83.277  1.00 17.27 ? 174  ASN B O   1 
ATOM   4676  C  CB  . ASN B 2  174 ? 76.084  92.269  83.382  1.00 17.33 ? 174  ASN B CB  1 
ATOM   4677  C  CG  . ASN B 2  174 ? 77.433  92.685  82.743  1.00 19.10 ? 174  ASN B CG  1 
ATOM   4678  O  OD1 . ASN B 2  174 ? 77.732  93.888  82.676  1.00 14.04 ? 174  ASN B OD1 1 
ATOM   4679  N  ND2 . ASN B 2  174 ? 78.277  91.723  82.392  1.00 8.05  ? 174  ASN B ND2 1 
ATOM   4680  N  N   . SER B 2  175 ? 74.534  89.793  84.808  1.00 17.64 ? 175  SER B N   1 
ATOM   4681  C  CA  . SER B 2  175 ? 73.499  89.569  85.804  1.00 18.72 ? 175  SER B CA  1 
ATOM   4682  C  C   . SER B 2  175 ? 73.090  90.818  86.586  1.00 19.68 ? 175  SER B C   1 
ATOM   4683  O  O   . SER B 2  175 ? 73.895  91.695  86.846  1.00 18.88 ? 175  SER B O   1 
ATOM   4684  C  CB  . SER B 2  175 ? 73.969  88.499  86.746  1.00 20.03 ? 175  SER B CB  1 
ATOM   4685  O  OG  . SER B 2  175 ? 72.875  87.893  87.389  1.00 34.95 ? 175  SER B OG  1 
ATOM   4686  N  N   . LEU B 2  176 ? 71.791  90.910  86.857  1.00 21.26 ? 176  LEU B N   1 
ATOM   4687  C  CA  . LEU B 2  176 ? 71.187  91.868  87.794  1.00 21.41 ? 176  LEU B CA  1 
ATOM   4688  C  C   . LEU B 2  176 ? 71.630  91.649  89.245  1.00 20.97 ? 176  LEU B C   1 
ATOM   4689  O  O   . LEU B 2  176 ? 71.432  92.511  90.114  1.00 20.52 ? 176  LEU B O   1 
ATOM   4690  C  CB  . LEU B 2  176 ? 69.670  91.690  87.702  1.00 21.70 ? 176  LEU B CB  1 
ATOM   4691  C  CG  . LEU B 2  176 ? 68.761  92.713  87.028  1.00 29.33 ? 176  LEU B CG  1 
ATOM   4692  C  CD1 . LEU B 2  176 ? 69.394  93.960  86.393  1.00 22.12 ? 176  LEU B CD1 1 
ATOM   4693  C  CD2 . LEU B 2  176 ? 67.763  92.052  86.112  1.00 28.93 ? 176  LEU B CD2 1 
ATOM   4694  N  N   . TYR B 2  177 ? 71.967  90.395  89.517  1.00 20.77 ? 177  TYR B N   1 
ATOM   4695  C  CA  . TYR B 2  177 ? 72.401  89.937  90.806  1.00 20.07 ? 177  TYR B CA  1 
ATOM   4696  C  C   . TYR B 2  177 ? 73.876  89.674  90.737  1.00 19.06 ? 177  TYR B C   1 
ATOM   4697  O  O   . TYR B 2  177 ? 74.408  89.303  89.683  1.00 18.96 ? 177  TYR B O   1 
ATOM   4698  C  CB  . TYR B 2  177 ? 71.582  88.693  91.212  1.00 20.01 ? 177  TYR B CB  1 
ATOM   4699  C  CG  . TYR B 2  177 ? 70.097  88.988  91.315  1.00 19.65 ? 177  TYR B CG  1 
ATOM   4700  C  CD1 . TYR B 2  177 ? 69.215  88.726  90.215  1.00 18.82 ? 177  TYR B CD1 1 
ATOM   4701  C  CD2 . TYR B 2  177 ? 69.583  89.706  92.435  1.00 24.29 ? 177  TYR B CD2 1 
ATOM   4702  C  CE1 . TYR B 2  177 ? 67.820  89.094  90.284  1.00 15.07 ? 177  TYR B CE1 1 
ATOM   4703  C  CE2 . TYR B 2  177 ? 68.210  90.085  92.510  1.00 11.96 ? 177  TYR B CE2 1 
ATOM   4704  C  CZ  . TYR B 2  177 ? 67.370  89.860  91.401  1.00 20.31 ? 177  TYR B CZ  1 
ATOM   4705  O  OH  . TYR B 2  177 ? 66.055  90.210  91.530  1.00 26.27 ? 177  TYR B OH  1 
ATOM   4706  N  N   . CYS B 2  178 ? 74.536  89.964  91.849  1.00 18.44 ? 178  CYS B N   1 
ATOM   4707  C  CA  . CYS B 2  178 ? 75.970  89.817  92.028  1.00 18.13 ? 178  CYS B CA  1 
ATOM   4708  C  C   . CYS B 2  178 ? 76.404  88.330  91.868  1.00 18.85 ? 178  CYS B C   1 
ATOM   4709  O  O   . CYS B 2  178 ? 75.760  87.460  92.468  1.00 18.20 ? 178  CYS B O   1 
ATOM   4710  C  CB  . CYS B 2  178 ? 76.340  90.368  93.412  1.00 17.80 ? 178  CYS B CB  1 
ATOM   4711  S  SG  . CYS B 2  178 ? 78.096  90.442  93.780  1.00 18.70 ? 178  CYS B SG  1 
ATOM   4712  N  N   . PRO B 2  179 ? 77.424  88.033  91.014  1.00 19.54 ? 179  PRO B N   1 
ATOM   4713  C  CA  . PRO B 2  179 ? 78.073  86.693  90.996  1.00 19.50 ? 179  PRO B CA  1 
ATOM   4714  C  C   . PRO B 2  179 ? 78.637  86.315  92.369  1.00 19.99 ? 179  PRO B C   1 
ATOM   4715  O  O   . PRO B 2  179 ? 79.129  87.225  93.077  1.00 20.08 ? 179  PRO B O   1 
ATOM   4716  C  CB  . PRO B 2  179 ? 79.229  86.879  89.997  1.00 19.51 ? 179  PRO B CB  1 
ATOM   4717  C  CG  . PRO B 2  179 ? 78.748  87.982  89.066  1.00 15.23 ? 179  PRO B CG  1 
ATOM   4718  C  CD  . PRO B 2  179 ? 78.051  88.936  90.016  1.00 19.23 ? 179  PRO B CD  1 
ATOM   4719  N  N   . ASP B 2  180 ? 78.372  85.068  92.805  1.00 19.94 ? 180  ASP B N   1 
ATOM   4720  C  CA  . ASP B 2  180 ? 78.718  84.559  94.152  1.00 19.36 ? 180  ASP B CA  1 
ATOM   4721  C  C   . ASP B 2  180 ? 80.158  84.835  94.557  1.00 18.88 ? 180  ASP B C   1 
ATOM   4722  O  O   . ASP B 2  180 ? 80.396  85.251  95.692  1.00 18.55 ? 180  ASP B O   1 
ATOM   4723  C  CB  . ASP B 2  180 ? 78.448  83.023  94.288  1.00 19.69 ? 180  ASP B CB  1 
ATOM   4724  C  CG  . ASP B 2  180 ? 76.965  82.617  94.040  1.00 28.77 ? 180  ASP B CG  1 
ATOM   4725  O  OD1 . ASP B 2  180 ? 76.043  83.472  94.031  1.00 26.81 ? 180  ASP B OD1 1 
ATOM   4726  O  OD2 . ASP B 2  180 ? 76.628  81.414  93.937  1.00 30.77 ? 180  ASP B OD2 1 
ATOM   4727  N  N   . TYR B 2  181 ? 81.103  84.629  93.616  1.00 19.23 ? 181  TYR B N   1 
ATOM   4728  C  CA  . TYR B 2  181 ? 82.547  84.850  93.842  1.00 19.36 ? 181  TYR B CA  1 
ATOM   4729  C  C   . TYR B 2  181 ? 82.875  86.284  94.236  1.00 19.58 ? 181  TYR B C   1 
ATOM   4730  O  O   . TYR B 2  181 ? 83.951  86.535  94.753  1.00 20.56 ? 181  TYR B O   1 
ATOM   4731  C  CB  . TYR B 2  181 ? 83.407  84.364  92.641  1.00 19.18 ? 181  TYR B CB  1 
ATOM   4732  C  CG  . TYR B 2  181 ? 83.606  85.378  91.522  1.00 17.97 ? 181  TYR B CG  1 
ATOM   4733  C  CD1 . TYR B 2  181 ? 84.662  86.351  91.561  1.00 14.22 ? 181  TYR B CD1 1 
ATOM   4734  C  CD2 . TYR B 2  181 ? 82.711  85.405  90.444  1.00 17.97 ? 181  TYR B CD2 1 
ATOM   4735  C  CE1 . TYR B 2  181 ? 84.834  87.288  90.487  1.00 7.94  ? 181  TYR B CE1 1 
ATOM   4736  C  CE2 . TYR B 2  181 ? 82.781  86.389  89.462  1.00 15.36 ? 181  TYR B CE2 1 
ATOM   4737  C  CZ  . TYR B 2  181 ? 83.840  87.290  89.448  1.00 15.94 ? 181  TYR B CZ  1 
ATOM   4738  O  OH  . TYR B 2  181 ? 83.853  88.155  88.400  1.00 13.50 ? 181  TYR B OH  1 
ATOM   4739  N  N   . ARG B 2  182 ? 82.017  87.217  93.797  1.00 19.37 ? 182  ARG B N   1 
ATOM   4740  C  CA  . ARG B 2  182 ? 82.116  88.644  94.094  1.00 18.53 ? 182  ARG B CA  1 
ATOM   4741  C  C   . ARG B 2  182 ? 81.524  89.092  95.433  1.00 19.06 ? 182  ARG B C   1 
ATOM   4742  O  O   . ARG B 2  182 ? 81.805  90.230  95.852  1.00 19.17 ? 182  ARG B O   1 
ATOM   4743  C  CB  . ARG B 2  182 ? 81.487  89.464  92.960  1.00 17.77 ? 182  ARG B CB  1 
ATOM   4744  C  CG  . ARG B 2  182 ? 82.264  89.479  91.662  1.00 11.45 ? 182  ARG B CG  1 
ATOM   4745  C  CD  . ARG B 2  182 ? 83.479  90.390  91.642  1.00 14.77 ? 182  ARG B CD  1 
ATOM   4746  N  NE  . ARG B 2  182 ? 83.061  91.790  91.688  1.00 11.59 ? 182  ARG B NE  1 
ATOM   4747  C  CZ  . ARG B 2  182 ? 83.801  92.802  92.118  1.00 23.49 ? 182  ARG B CZ  1 
ATOM   4748  N  NH1 . ARG B 2  182 ? 85.033  92.595  92.585  1.00 25.73 ? 182  ARG B NH1 1 
ATOM   4749  N  NH2 . ARG B 2  182 ? 83.244  94.005  92.211  1.00 4.23  ? 182  ARG B NH2 1 
ATOM   4750  N  N   . ILE B 2  183 ? 80.673  88.248  96.067  1.00 18.63 ? 183  ILE B N   1 
ATOM   4751  C  CA  . ILE B 2  183 ? 80.066  88.579  97.380  1.00 19.17 ? 183  ILE B CA  1 
ATOM   4752  C  C   . ILE B 2  183 ? 81.144  88.649  98.459  1.00 19.20 ? 183  ILE B C   1 
ATOM   4753  O  O   . ILE B 2  183 ? 81.962  87.746  98.559  1.00 19.80 ? 183  ILE B O   1 
ATOM   4754  C  CB  . ILE B 2  183 ? 78.851  87.634  97.802  1.00 19.62 ? 183  ILE B CB  1 
ATOM   4755  C  CG1 . ILE B 2  183 ? 77.691  87.726  96.785  1.00 13.25 ? 183  ILE B CG1 1 
ATOM   4756  C  CG2 . ILE B 2  183 ? 78.302  88.041  99.230  1.00 22.25 ? 183  ILE B CG2 1 
ATOM   4757  C  CD1 . ILE B 2  183 ? 76.713  86.504  96.809  1.00 22.32 ? 183  ILE B CD1 1 
ATOM   4758  N  N   . GLY B 2  184 ? 81.254  89.830  99.077  1.00 18.70 ? 184  GLY B N   1 
ATOM   4759  C  CA  . GLY B 2  184 ? 82.326  90.132  100.004 1.00 18.98 ? 184  GLY B CA  1 
ATOM   4760  C  C   . GLY B 2  184 ? 83.511  90.891  99.413  1.00 18.81 ? 184  GLY B C   1 
ATOM   4761  O  O   . GLY B 2  184 ? 84.284  91.428  100.188 1.00 19.56 ? 184  GLY B O   1 
ATOM   4762  N  N   . LYS B 2  185 ? 83.509  91.098  98.088  1.00 18.17 ? 185  LYS B N   1 
ATOM   4763  C  CA  . LYS B 2  185 ? 84.668  91.563  97.309  1.00 18.24 ? 185  LYS B CA  1 
ATOM   4764  C  C   . LYS B 2  185 ? 84.497  92.932  96.599  1.00 18.32 ? 185  LYS B C   1 
ATOM   4765  O  O   . LYS B 2  185 ? 85.504  93.557  96.212  1.00 17.52 ? 185  LYS B O   1 
ATOM   4766  C  CB  . LYS B 2  185 ? 85.180  90.483  96.346  1.00 17.81 ? 185  LYS B CB  1 
ATOM   4767  C  CG  . LYS B 2  185 ? 85.796  89.268  97.075  1.00 26.65 ? 185  LYS B CG  1 
ATOM   4768  C  CD  . LYS B 2  185 ? 87.040  88.752  96.399  1.00 38.42 ? 185  LYS B CD  1 
ATOM   4769  C  CE  . LYS B 2  185 ? 87.569  87.522  97.117  1.00 44.57 ? 185  LYS B CE  1 
ATOM   4770  N  NZ  . LYS B 2  185 ? 88.479  87.879  98.253  1.00 44.87 ? 185  LYS B NZ  1 
ATOM   4771  N  N   . VAL B 2  186 ? 83.245  93.396  96.502  1.00 18.92 ? 186  VAL B N   1 
ATOM   4772  C  CA  . VAL B 2  186 ? 82.909  94.726  95.991  1.00 20.64 ? 186  VAL B CA  1 
ATOM   4773  C  C   . VAL B 2  186 ? 83.300  95.846  96.954  1.00 21.98 ? 186  VAL B C   1 
ATOM   4774  O  O   . VAL B 2  186 ? 83.085  95.719  98.155  1.00 23.83 ? 186  VAL B O   1 
ATOM   4775  C  CB  . VAL B 2  186 ? 81.489  94.841  95.229  1.00 21.15 ? 186  VAL B CB  1 
ATOM   4776  C  CG1 . VAL B 2  186 ? 80.460  93.759  95.584  1.00 31.18 ? 186  VAL B CG1 1 
ATOM   4777  C  CG2 . VAL B 2  186 ? 80.916  96.287  95.121  1.00 11.54 ? 186  VAL B CG2 1 
ATOM   4778  N  N   . THR B 2  187 ? 84.148  96.749  96.462  1.00 20.47 ? 187  THR B N   1 
ATOM   4779  C  CA  . THR B 2  187 ? 84.890  97.690  97.320  1.00 18.72 ? 187  THR B CA  1 
ATOM   4780  C  C   . THR B 2  187 ? 84.214  99.059  97.369  1.00 18.60 ? 187  THR B C   1 
ATOM   4781  O  O   . THR B 2  187 ? 83.582  99.426  96.376  1.00 18.50 ? 187  THR B O   1 
ATOM   4782  C  CB  . THR B 2  187 ? 86.361  97.842  96.915  1.00 17.47 ? 187  THR B CB  1 
ATOM   4783  O  OG1 . THR B 2  187 ? 86.438  98.315  95.580  1.00 27.18 ? 187  THR B OG1 1 
ATOM   4784  C  CG2 . THR B 2  187 ? 87.112  96.505  96.917  1.00 8.06  ? 187  THR B CG2 1 
ATOM   4785  N  N   . PRO B 2  188 ? 84.368  99.827  98.493  1.00 18.63 ? 188  PRO B N   1 
ATOM   4786  C  CA  . PRO B 2  188 ? 84.038  101.267 98.529  1.00 18.64 ? 188  PRO B CA  1 
ATOM   4787  C  C   . PRO B 2  188 ? 84.468  102.106 97.331  1.00 17.94 ? 188  PRO B C   1 
ATOM   4788  O  O   . PRO B 2  188 ? 83.582  102.770 96.777  1.00 18.39 ? 188  PRO B O   1 
ATOM   4789  C  CB  . PRO B 2  188 ? 84.738  101.754 99.801  1.00 19.01 ? 188  PRO B CB  1 
ATOM   4790  C  CG  . PRO B 2  188 ? 84.641  100.615 100.719 1.00 18.94 ? 188  PRO B CG  1 
ATOM   4791  C  CD  . PRO B 2  188 ? 84.684  99.349  99.864  1.00 18.36 ? 188  PRO B CD  1 
ATOM   4792  N  N   . VAL B 2  189 ? 85.676  101.877 96.817  1.00 17.88 ? 189  VAL B N   1 
ATOM   4793  C  CA  . VAL B 2  189 ? 86.214  102.602 95.642  1.00 18.65 ? 189  VAL B CA  1 
ATOM   4794  C  C   . VAL B 2  189 ? 85.400  102.312 94.355  1.00 18.61 ? 189  VAL B C   1 
ATOM   4795  O  O   . VAL B 2  189 ? 84.962  103.265 93.704  1.00 19.10 ? 189  VAL B O   1 
ATOM   4796  C  CB  . VAL B 2  189 ? 87.801  102.467 95.471  1.00 18.75 ? 189  VAL B CB  1 
ATOM   4797  C  CG1 . VAL B 2  189 ? 88.284  101.034 95.679  1.00 38.91 ? 189  VAL B CG1 1 
ATOM   4798  C  CG2 . VAL B 2  189 ? 88.275  102.944 94.113  1.00 30.50 ? 189  VAL B CG2 1 
ATOM   4799  N  N   . GLU B 2  190 ? 85.005  101.042 94.174  1.00 17.44 ? 190  GLU B N   1 
ATOM   4800  C  CA  . GLU B 2  190 ? 84.172  100.594 93.044  1.00 17.08 ? 190  GLU B CA  1 
ATOM   4801  C  C   . GLU B 2  190 ? 82.778  101.208 93.027  1.00 17.11 ? 190  GLU B C   1 
ATOM   4802  O  O   . GLU B 2  190 ? 82.247  101.487 91.946  1.00 17.15 ? 190  GLU B O   1 
ATOM   4803  C  CB  . GLU B 2  190 ? 84.049  99.060  93.010  1.00 16.31 ? 190  GLU B CB  1 
ATOM   4804  C  CG  . GLU B 2  190 ? 85.278  98.334  92.458  1.00 16.02 ? 190  GLU B CG  1 
ATOM   4805  C  CD  . GLU B 2  190 ? 85.278  96.819  92.723  1.00 29.11 ? 190  GLU B CD  1 
ATOM   4806  O  OE1 . GLU B 2  190 ? 86.204  96.136  92.223  1.00 35.98 ? 190  GLU B OE1 1 
ATOM   4807  O  OE2 . GLU B 2  190 ? 84.314  96.278  93.334  1.00 20.94 ? 190  GLU B OE2 1 
ATOM   4808  N  N   . LEU B 2  191 ? 82.176  101.336 94.216  1.00 17.32 ? 191  LEU B N   1 
ATOM   4809  C  CA  . LEU B 2  191 ? 80.888  102.034 94.419  1.00 17.47 ? 191  LEU B CA  1 
ATOM   4810  C  C   . LEU B 2  191 ? 80.991  103.535 94.140  1.00 17.82 ? 191  LEU B C   1 
ATOM   4811  O  O   . LEU B 2  191 ? 80.122  104.097 93.446  1.00 18.77 ? 191  LEU B O   1 
ATOM   4812  C  CB  . LEU B 2  191 ? 80.322  101.782 95.829  1.00 16.79 ? 191  LEU B CB  1 
ATOM   4813  C  CG  . LEU B 2  191 ? 79.738  100.377 96.161  1.00 15.10 ? 191  LEU B CG  1 
ATOM   4814  C  CD1 . LEU B 2  191 ? 79.642  100.210 97.675  1.00 6.28  ? 191  LEU B CD1 1 
ATOM   4815  C  CD2 . LEU B 2  191 ? 78.339  100.172 95.580  1.00 7.32  ? 191  LEU B CD2 1 
ATOM   4816  N  N   . HIS B 2  192 ? 82.085  104.145 94.608  1.00 16.79 ? 192  HIS B N   1 
ATOM   4817  C  CA  . HIS B 2  192 ? 82.387  105.560 94.365  1.00 16.27 ? 192  HIS B CA  1 
ATOM   4818  C  C   . HIS B 2  192 ? 82.623  105.811 92.875  1.00 16.24 ? 192  HIS B C   1 
ATOM   4819  O  O   . HIS B 2  192 ? 81.881  106.593 92.282  1.00 16.14 ? 192  HIS B O   1 
ATOM   4820  C  CB  . HIS B 2  192 ? 83.598  106.012 95.197  1.00 15.95 ? 192  HIS B CB  1 
ATOM   4821  C  CG  . HIS B 2  192 ? 83.264  106.400 96.604  1.00 19.01 ? 192  HIS B CG  1 
ATOM   4822  N  ND1 . HIS B 2  192 ? 82.548  107.543 96.912  1.00 27.34 ? 192  HIS B ND1 1 
ATOM   4823  C  CD2 . HIS B 2  192 ? 83.705  105.905 97.786  1.00 18.86 ? 192  HIS B CD2 1 
ATOM   4824  C  CE1 . HIS B 2  192 ? 82.492  107.683 98.226  1.00 18.47 ? 192  HIS B CE1 1 
ATOM   4825  N  NE2 . HIS B 2  192 ? 83.233  106.735 98.776  1.00 19.86 ? 192  HIS B NE2 1 
ATOM   4826  N  N   . ASP B 2  193 ? 83.440  104.936 92.261  1.00 16.58 ? 193  ASP B N   1 
ATOM   4827  C  CA  . ASP B 2  193 ? 83.683  104.886 90.816  1.00 15.88 ? 193  ASP B CA  1 
ATOM   4828  C  C   . ASP B 2  193 ? 82.470  104.661 89.937  1.00 15.48 ? 193  ASP B C   1 
ATOM   4829  O  O   . ASP B 2  193 ? 82.324  105.382 88.952  1.00 16.05 ? 193  ASP B O   1 
ATOM   4830  C  CB  . ASP B 2  193 ? 84.809  103.926 90.457  1.00 14.94 ? 193  ASP B CB  1 
ATOM   4831  C  CG  . ASP B 2  193 ? 86.185  104.430 90.904  1.00 14.58 ? 193  ASP B CG  1 
ATOM   4832  O  OD1 . ASP B 2  193 ? 86.365  105.634 91.150  1.00 30.38 ? 193  ASP B OD1 1 
ATOM   4833  O  OD2 . ASP B 2  193 ? 87.193  103.717 90.876  1.00 30.84 ? 193  ASP B OD2 1 
ATOM   4834  N  N   . TYR B 2  194 ? 81.518  103.859 90.414  1.00 15.07 ? 194  TYR B N   1 
ATOM   4835  C  CA  . TYR B 2  194 ? 80.291  103.592 89.662  1.00 17.29 ? 194  TYR B CA  1 
ATOM   4836  C  C   . TYR B 2  194 ? 79.344  104.803 89.606  1.00 19.63 ? 194  TYR B C   1 
ATOM   4837  O  O   . TYR B 2  194 ? 78.997  105.241 88.486  1.00 19.96 ? 194  TYR B O   1 
ATOM   4838  C  CB  . TYR B 2  194 ? 79.590  102.328 90.148  1.00 16.96 ? 194  TYR B CB  1 
ATOM   4839  C  CG  . TYR B 2  194 ? 78.753  101.654 89.117  1.00 14.92 ? 194  TYR B CG  1 
ATOM   4840  C  CD1 . TYR B 2  194 ? 77.363  101.889 89.079  1.00 18.55 ? 194  TYR B CD1 1 
ATOM   4841  C  CD2 . TYR B 2  194 ? 79.292  100.625 88.279  1.00 9.43  ? 194  TYR B CD2 1 
ATOM   4842  C  CE1 . TYR B 2  194 ? 76.531  101.238 88.151  1.00 10.23 ? 194  TYR B CE1 1 
ATOM   4843  C  CE2 . TYR B 2  194 ? 78.455  99.973  87.300  1.00 16.51 ? 194  TYR B CE2 1 
ATOM   4844  C  CZ  . TYR B 2  194 ? 77.083  100.323 87.232  1.00 12.71 ? 194  TYR B CZ  1 
ATOM   4845  O  OH  . TYR B 2  194 ? 76.229  99.681  86.363  1.00 15.07 ? 194  TYR B OH  1 
ATOM   4846  N  N   . VAL B 2  195 ? 79.204  105.490 90.761  1.00 21.12 ? 195  VAL B N   1 
ATOM   4847  C  CA  . VAL B 2  195 ? 78.392  106.725 90.922  1.00 21.67 ? 195  VAL B CA  1 
ATOM   4848  C  C   . VAL B 2  195 ? 78.960  107.905 90.133  1.00 22.07 ? 195  VAL B C   1 
ATOM   4849  O  O   . VAL B 2  195 ? 78.229  108.537 89.366  1.00 22.50 ? 195  VAL B O   1 
ATOM   4850  C  CB  . VAL B 2  195 ? 78.080  107.055 92.466  1.00 22.07 ? 195  VAL B CB  1 
ATOM   4851  C  CG1 . VAL B 2  195 ? 77.507  108.530 92.701  1.00 10.87 ? 195  VAL B CG1 1 
ATOM   4852  C  CG2 . VAL B 2  195 ? 77.102  106.026 93.038  1.00 21.00 ? 195  VAL B CG2 1 
ATOM   4853  N  N   . GLN B 2  196 ? 80.275  108.111 90.229  1.00 22.76 ? 196  GLN B N   1 
ATOM   4854  C  CA  . GLN B 2  196 ? 80.989  109.169 89.476  1.00 22.29 ? 196  GLN B CA  1 
ATOM   4855  C  C   . GLN B 2  196 ? 80.916  108.973 87.948  1.00 20.75 ? 196  GLN B C   1 
ATOM   4856  O  O   . GLN B 2  196 ? 80.644  109.942 87.215  1.00 20.28 ? 196  GLN B O   1 
ATOM   4857  C  CB  . GLN B 2  196 ? 82.450  109.265 89.908  1.00 23.18 ? 196  GLN B CB  1 
ATOM   4858  C  CG  . GLN B 2  196 ? 82.693  110.019 91.210  1.00 46.32 ? 196  GLN B CG  1 
ATOM   4859  C  CD  . GLN B 2  196 ? 84.006  109.624 91.872  1.00 53.23 ? 196  GLN B CD  1 
ATOM   4860  O  OE1 . GLN B 2  196 ? 85.074  109.714 91.255  1.00 56.75 ? 196  GLN B OE1 1 
ATOM   4861  N  NE2 . GLN B 2  196 ? 83.927  109.149 93.117  1.00 54.53 ? 196  GLN B NE2 1 
ATOM   4862  N  N   . ASN B 2  197 ? 81.046  107.711 87.501  1.00 18.83 ? 197  ASN B N   1 
ATOM   4863  C  CA  . ASN B 2  197 ? 81.016  107.372 86.076  1.00 17.40 ? 197  ASN B CA  1 
ATOM   4864  C  C   . ASN B 2  197 ? 79.651  107.456 85.428  1.00 16.98 ? 197  ASN B C   1 
ATOM   4865  O  O   . ASN B 2  197 ? 79.575  107.735 84.231  1.00 17.34 ? 197  ASN B O   1 
ATOM   4866  C  CB  . ASN B 2  197 ? 81.668  105.999 85.797  1.00 17.21 ? 197  ASN B CB  1 
ATOM   4867  C  CG  . ASN B 2  197 ? 83.187  106.043 85.854  1.00 18.51 ? 197  ASN B CG  1 
ATOM   4868  O  OD1 . ASN B 2  197 ? 83.825  107.067 85.545  1.00 19.81 ? 197  ASN B OD1 1 
ATOM   4869  N  ND2 . ASN B 2  197 ? 83.776  104.948 86.280  1.00 11.93 ? 197  ASN B ND2 1 
ATOM   4870  N  N   . HIS B 2  198 ? 78.589  107.246 86.222  1.00 16.68 ? 198  HIS B N   1 
ATOM   4871  C  CA  . HIS B 2  198 ? 77.241  106.928 85.719  1.00 16.55 ? 198  HIS B CA  1 
ATOM   4872  C  C   . HIS B 2  198 ? 76.106  107.828 86.222  1.00 16.91 ? 198  HIS B C   1 
ATOM   4873  O  O   . HIS B 2  198 ? 75.192  108.120 85.464  1.00 17.04 ? 198  HIS B O   1 
ATOM   4874  C  CB  . HIS B 2  198 ? 76.890  105.440 85.919  1.00 16.92 ? 198  HIS B CB  1 
ATOM   4875  C  CG  . HIS B 2  198 ? 77.903  104.483 85.347  1.00 17.27 ? 198  HIS B CG  1 
ATOM   4876  N  ND1 . HIS B 2  198 ? 78.663  103.645 86.135  1.00 26.67 ? 198  HIS B ND1 1 
ATOM   4877  C  CD2 . HIS B 2  198 ? 78.269  104.224 84.068  1.00 24.21 ? 198  HIS B CD2 1 
ATOM   4878  C  CE1 . HIS B 2  198 ? 79.449  102.907 85.370  1.00 15.90 ? 198  HIS B CE1 1 
ATOM   4879  N  NE2 . HIS B 2  198 ? 79.220  103.227 84.110  1.00 27.49 ? 198  HIS B NE2 1 
ATOM   4880  N  N   . PHE B 2  199 ? 76.217  108.360 87.445  1.00 17.82 ? 199  PHE B N   1 
ATOM   4881  C  CA  . PHE B 2  199 ? 75.182  109.245 88.032  1.00 18.51 ? 199  PHE B CA  1 
ATOM   4882  C  C   . PHE B 2  199 ? 75.507  110.709 87.651  1.00 20.29 ? 199  PHE B C   1 
ATOM   4883  O  O   . PHE B 2  199 ? 75.976  111.505 88.498  1.00 21.20 ? 199  PHE B O   1 
ATOM   4884  C  CB  . PHE B 2  199 ? 75.090  109.055 89.570  1.00 18.41 ? 199  PHE B CB  1 
ATOM   4885  C  CG  . PHE B 2  199 ? 74.385  107.770 90.042  1.00 26.37 ? 199  PHE B CG  1 
ATOM   4886  C  CD1 . PHE B 2  199 ? 74.687  106.480 89.480  1.00 14.90 ? 199  PHE B CD1 1 
ATOM   4887  C  CD2 . PHE B 2  199 ? 73.657  107.810 91.259  1.00 24.90 ? 199  PHE B CD2 1 
ATOM   4888  C  CE1 . PHE B 2  199 ? 74.190  105.279 90.077  1.00 20.97 ? 199  PHE B CE1 1 
ATOM   4889  C  CE2 . PHE B 2  199 ? 73.179  106.593 91.884  1.00 26.13 ? 199  PHE B CE2 1 
ATOM   4890  C  CZ  . PHE B 2  199 ? 73.422  105.349 91.268  1.00 21.86 ? 199  PHE B CZ  1 
ATOM   4891  N  N   . THR B 2  200 ? 75.480  110.975 86.337  1.00 20.53 ? 200  THR B N   1 
ATOM   4892  C  CA  . THR B 2  200 ? 75.794  112.308 85.763  1.00 21.02 ? 200  THR B CA  1 
ATOM   4893  C  C   . THR B 2  200 ? 74.596  112.884 85.015  1.00 20.90 ? 200  THR B C   1 
ATOM   4894  O  O   . THR B 2  200 ? 73.760  112.116 84.532  1.00 21.51 ? 200  THR B O   1 
ATOM   4895  C  CB  . THR B 2  200 ? 77.032  112.250 84.813  1.00 21.35 ? 200  THR B CB  1 
ATOM   4896  O  OG1 . THR B 2  200 ? 76.744  111.410 83.689  1.00 31.16 ? 200  THR B OG1 1 
ATOM   4897  C  CG2 . THR B 2  200 ? 78.264  111.590 85.483  1.00 26.81 ? 200  THR B CG2 1 
ATOM   4898  N  N   . SER B 2  201 ? 74.610  114.211 84.804  1.00 20.85 ? 201  SER B N   1 
ATOM   4899  C  CA  . SER B 2  201 ? 73.517  114.977 84.166  1.00 20.46 ? 201  SER B CA  1 
ATOM   4900  C  C   . SER B 2  201 ? 73.020  114.431 82.822  1.00 19.73 ? 201  SER B C   1 
ATOM   4901  O  O   . SER B 2  201 ? 71.825  114.225 82.664  1.00 19.82 ? 201  SER B O   1 
ATOM   4902  C  CB  . SER B 2  201 ? 73.877  116.460 84.026  1.00 20.19 ? 201  SER B CB  1 
ATOM   4903  O  OG  . SER B 2  201 ? 74.227  117.008 85.273  1.00 32.20 ? 201  SER B OG  1 
ATOM   4904  N  N   . ALA B 2  202 ? 73.959  114.063 81.945  1.00 19.06 ? 202  ALA B N   1 
ATOM   4905  C  CA  . ALA B 2  202 ? 73.665  113.478 80.627  1.00 19.28 ? 202  ALA B CA  1 
ATOM   4906  C  C   . ALA B 2  202 ? 73.037  112.071 80.665  1.00 19.40 ? 202  ALA B C   1 
ATOM   4907  O  O   . ALA B 2  202 ? 72.374  111.664 79.697  1.00 20.13 ? 202  ALA B O   1 
ATOM   4908  C  CB  . ALA B 2  202 ? 74.910  113.498 79.746  1.00 19.53 ? 202  ALA B CB  1 
ATOM   4909  N  N   . ARG B 2  203 ? 73.150  111.395 81.821  1.00 18.55 ? 203  ARG B N   1 
ATOM   4910  C  CA  . ARG B 2  203 ? 72.670  110.011 82.023  1.00 17.39 ? 203  ARG B CA  1 
ATOM   4911  C  C   . ARG B 2  203 ? 71.483  109.907 82.975  1.00 16.74 ? 203  ARG B C   1 
ATOM   4912  O  O   . ARG B 2  203 ? 71.105  108.785 83.375  1.00 17.89 ? 203  ARG B O   1 
ATOM   4913  C  CB  . ARG B 2  203 ? 73.806  109.110 82.535  1.00 16.96 ? 203  ARG B CB  1 
ATOM   4914  C  CG  . ARG B 2  203 ? 75.083  109.157 81.725  1.00 16.91 ? 203  ARG B CG  1 
ATOM   4915  C  CD  . ARG B 2  203 ? 76.229  108.422 82.352  1.00 13.77 ? 203  ARG B CD  1 
ATOM   4916  N  NE  . ARG B 2  203 ? 75.998  106.985 82.365  1.00 18.11 ? 203  ARG B NE  1 
ATOM   4917  C  CZ  . ARG B 2  203 ? 76.294  106.151 81.379  1.00 21.24 ? 203  ARG B CZ  1 
ATOM   4918  N  NH1 . ARG B 2  203 ? 76.966  106.560 80.300  1.00 22.80 ? 203  ARG B NH1 1 
ATOM   4919  N  NH2 . ARG B 2  203 ? 75.938  104.881 81.491  1.00 24.67 ? 203  ARG B NH2 1 
ATOM   4920  N  N   . MET B 2  204 ? 70.757  111.013 83.140  1.00 15.07 ? 204  MET B N   1 
ATOM   4921  C  CA  . MET B 2  204 ? 69.833  111.186 84.258  1.00 14.96 ? 204  MET B CA  1 
ATOM   4922  C  C   . MET B 2  204 ? 68.535  111.911 83.869  1.00 15.26 ? 204  MET B C   1 
ATOM   4923  O  O   . MET B 2  204 ? 68.534  112.809 82.983  1.00 14.77 ? 204  MET B O   1 
ATOM   4924  C  CB  . MET B 2  204 ? 70.537  111.932 85.376  1.00 15.34 ? 204  MET B CB  1 
ATOM   4925  C  CG  . MET B 2  204 ? 70.477  111.314 86.752  1.00 30.37 ? 204  MET B CG  1 
ATOM   4926  S  SD  . MET B 2  204 ? 71.914  111.617 87.883  1.00 30.84 ? 204  MET B SD  1 
ATOM   4927  C  CE  . MET B 2  204 ? 72.118  113.318 87.829  1.00 20.53 ? 204  MET B CE  1 
ATOM   4928  N  N   . ALA B 2  205 ? 67.457  111.545 84.576  1.00 15.06 ? 205  ALA B N   1 
ATOM   4929  C  CA  . ALA B 2  205 ? 66.115  112.086 84.382  1.00 14.98 ? 205  ALA B CA  1 
ATOM   4930  C  C   . ALA B 2  205 ? 65.441  112.224 85.743  1.00 15.78 ? 205  ALA B C   1 
ATOM   4931  O  O   . ALA B 2  205 ? 65.472  111.282 86.544  1.00 16.37 ? 205  ALA B O   1 
ATOM   4932  C  CB  . ALA B 2  205 ? 65.293  111.171 83.464  1.00 14.45 ? 205  ALA B CB  1 
ATOM   4933  N  N   . LEU B 2  206 ? 64.975  113.442 86.049  1.00 15.23 ? 206  LEU B N   1 
ATOM   4934  C  CA  . LEU B 2  206 ? 64.258  113.723 87.293  1.00 14.53 ? 206  LEU B CA  1 
ATOM   4935  C  C   . LEU B 2  206 ? 62.774  113.849 87.044  1.00 14.17 ? 206  LEU B C   1 
ATOM   4936  O  O   . LEU B 2  206 ? 62.318  114.771 86.357  1.00 12.71 ? 206  LEU B O   1 
ATOM   4937  C  CB  . LEU B 2  206 ? 64.830  114.960 88.049  1.00 13.88 ? 206  LEU B CB  1 
ATOM   4938  C  CG  . LEU B 2  206 ? 64.272  115.330 89.452  1.00 17.64 ? 206  LEU B CG  1 
ATOM   4939  C  CD1 . LEU B 2  206 ? 64.521  114.289 90.577  1.00 14.59 ? 206  LEU B CD1 1 
ATOM   4940  C  CD2 . LEU B 2  206 ? 64.702  116.713 89.901  1.00 13.24 ? 206  LEU B CD2 1 
ATOM   4941  N  N   . ILE B 2  207 ? 62.031  112.895 87.612  1.00 14.56 ? 207  ILE B N   1 
ATOM   4942  C  CA  . ILE B 2  207 ? 60.589  112.766 87.368  1.00 15.11 ? 207  ILE B CA  1 
ATOM   4943  C  C   . ILE B 2  207 ? 59.822  112.963 88.652  1.00 15.86 ? 207  ILE B C   1 
ATOM   4944  O  O   . ILE B 2  207 ? 60.208  112.446 89.701  1.00 15.70 ? 207  ILE B O   1 
ATOM   4945  C  CB  . ILE B 2  207 ? 60.207  111.408 86.650  1.00 15.08 ? 207  ILE B CB  1 
ATOM   4946  C  CG1 . ILE B 2  207 ? 61.251  110.957 85.576  1.00 17.24 ? 207  ILE B CG1 1 
ATOM   4947  C  CG2 . ILE B 2  207 ? 58.757  111.439 86.116  1.00 16.23 ? 207  ILE B CG2 1 
ATOM   4948  C  CD1 . ILE B 2  207 ? 61.520  111.906 84.307  1.00 15.62 ? 207  ILE B CD1 1 
ATOM   4949  N  N   . GLY B 2  208 ? 58.796  113.803 88.570  1.00 17.09 ? 208  GLY B N   1 
ATOM   4950  C  CA  . GLY B 2  208 ? 57.979  114.170 89.713  1.00 18.46 ? 208  GLY B CA  1 
ATOM   4951  C  C   . GLY B 2  208 ? 56.501  114.090 89.441  1.00 19.46 ? 208  GLY B C   1 
ATOM   4952  O  O   . GLY B 2  208 ? 56.025  114.532 88.397  1.00 19.47 ? 208  GLY B O   1 
ATOM   4953  N  N   . LEU B 2  209 ? 55.779  113.585 90.431  1.00 20.79 ? 209  LEU B N   1 
ATOM   4954  C  CA  . LEU B 2  209 ? 54.326  113.462 90.397  1.00 22.20 ? 209  LEU B CA  1 
ATOM   4955  C  C   . LEU B 2  209 ? 53.718  114.112 91.600  1.00 23.00 ? 209  LEU B C   1 
ATOM   4956  O  O   . LEU B 2  209 ? 54.173  113.884 92.720  1.00 23.57 ? 209  LEU B O   1 
ATOM   4957  C  CB  . LEU B 2  209 ? 53.929  111.992 90.303  1.00 22.59 ? 209  LEU B CB  1 
ATOM   4958  C  CG  . LEU B 2  209 ? 53.404  111.409 88.987  1.00 28.99 ? 209  LEU B CG  1 
ATOM   4959  C  CD1 . LEU B 2  209 ? 54.249  111.764 87.733  1.00 24.36 ? 209  LEU B CD1 1 
ATOM   4960  C  CD2 . LEU B 2  209 ? 53.304  109.897 89.159  1.00 30.89 ? 209  LEU B CD2 1 
ATOM   4961  N  N   . GLY B 2  210 ? 52.840  115.078 91.328  1.00 23.37 ? 210  GLY B N   1 
ATOM   4962  C  CA  . GLY B 2  210 ? 52.285  115.980 92.328  1.00 23.53 ? 210  GLY B CA  1 
ATOM   4963  C  C   . GLY B 2  210 ? 53.280  116.924 92.973  1.00 23.85 ? 210  GLY B C   1 
ATOM   4964  O  O   . GLY B 2  210 ? 53.243  117.072 94.191  1.00 24.42 ? 210  GLY B O   1 
ATOM   4965  N  N   . VAL B 2  211 ? 54.308  117.312 92.210  1.00 23.93 ? 211  VAL B N   1 
ATOM   4966  C  CA  . VAL B 2  211 ? 55.130  118.529 92.438  1.00 24.03 ? 211  VAL B CA  1 
ATOM   4967  C  C   . VAL B 2  211 ? 55.105  119.445 91.209  1.00 23.46 ? 211  VAL B C   1 
ATOM   4968  O  O   . VAL B 2  211 ? 55.034  118.953 90.070  1.00 23.94 ? 211  VAL B O   1 
ATOM   4969  C  CB  . VAL B 2  211 ? 56.643  118.217 92.782  1.00 24.47 ? 211  VAL B CB  1 
ATOM   4970  C  CG1 . VAL B 2  211 ? 56.827  117.943 94.240  1.00 28.43 ? 211  VAL B CG1 1 
ATOM   4971  C  CG2 . VAL B 2  211 ? 57.226  117.082 91.921  1.00 29.25 ? 211  VAL B CG2 1 
ATOM   4972  N  N   . SER B 2  212 ? 55.206  120.760 91.456  1.00 22.15 ? 212  SER B N   1 
ATOM   4973  C  CA  . SER B 2  212 ? 55.381  121.784 90.410  1.00 20.70 ? 212  SER B CA  1 
ATOM   4974  C  C   . SER B 2  212 ? 56.705  121.653 89.639  1.00 19.20 ? 212  SER B C   1 
ATOM   4975  O  O   . SER B 2  212 ? 57.746  121.267 90.212  1.00 18.85 ? 212  SER B O   1 
ATOM   4976  C  CB  . SER B 2  212 ? 55.241  123.184 90.997  1.00 20.57 ? 212  SER B CB  1 
ATOM   4977  O  OG  . SER B 2  212 ? 56.392  123.526 91.749  1.00 27.33 ? 212  SER B OG  1 
ATOM   4978  N  N   . HIS B 2  213 ? 56.614  121.900 88.329  1.00 18.13 ? 213  HIS B N   1 
ATOM   4979  C  CA  . HIS B 2  213 ? 57.771  122.035 87.436  1.00 16.98 ? 213  HIS B CA  1 
ATOM   4980  C  C   . HIS B 2  213 ? 58.904  123.006 87.853  1.00 16.39 ? 213  HIS B C   1 
ATOM   4981  O  O   . HIS B 2  213 ? 60.069  122.544 87.792  1.00 16.42 ? 213  HIS B O   1 
ATOM   4982  C  CB  . HIS B 2  213 ? 57.352  122.236 85.979  1.00 16.68 ? 213  HIS B CB  1 
ATOM   4983  C  CG  . HIS B 2  213 ? 58.270  121.586 84.993  1.00 12.93 ? 213  HIS B CG  1 
ATOM   4984  N  ND1 . HIS B 2  213 ? 58.389  120.214 84.877  1.00 13.58 ? 213  HIS B ND1 1 
ATOM   4985  C  CD2 . HIS B 2  213 ? 59.041  122.116 84.012  1.00 8.90  ? 213  HIS B CD2 1 
ATOM   4986  C  CE1 . HIS B 2  213 ? 59.245  119.931 83.911  1.00 15.60 ? 213  HIS B CE1 1 
ATOM   4987  N  NE2 . HIS B 2  213 ? 59.647  121.066 83.364  1.00 21.23 ? 213  HIS B NE2 1 
ATOM   4988  N  N   . PRO B 2  214 ? 58.607  124.248 88.359  1.00 15.17 ? 214  PRO B N   1 
ATOM   4989  C  CA  . PRO B 2  214 ? 59.666  125.123 88.910  1.00 15.87 ? 214  PRO B CA  1 
ATOM   4990  C  C   . PRO B 2  214 ? 60.464  124.544 90.084  1.00 17.66 ? 214  PRO B C   1 
ATOM   4991  O  O   . PRO B 2  214 ? 61.700  124.604 89.988  1.00 18.04 ? 214  PRO B O   1 
ATOM   4992  C  CB  . PRO B 2  214 ? 58.901  126.399 89.346  1.00 15.64 ? 214  PRO B CB  1 
ATOM   4993  C  CG  . PRO B 2  214 ? 57.690  126.462 88.454  1.00 2.00  ? 214  PRO B CG  1 
ATOM   4994  C  CD  . PRO B 2  214 ? 57.316  124.993 88.322  1.00 14.93 ? 214  PRO B CD  1 
ATOM   4995  N  N   . VAL B 2  215 ? 59.801  123.800 90.991  1.00 18.64 ? 215  VAL B N   1 
ATOM   4996  C  CA  . VAL B 2  215 ? 60.438  123.160 92.162  1.00 19.42 ? 215  VAL B CA  1 
ATOM   4997  C  C   . VAL B 2  215 ? 61.412  122.028 91.735  1.00 20.53 ? 215  VAL B C   1 
ATOM   4998  O  O   . VAL B 2  215 ? 62.545  121.938 92.263  1.00 21.39 ? 215  VAL B O   1 
ATOM   4999  C  CB  . VAL B 2  215 ? 59.350  122.727 93.252  1.00 19.50 ? 215  VAL B CB  1 
ATOM   5000  C  CG1 . VAL B 2  215 ? 59.837  121.621 94.234  1.00 20.72 ? 215  VAL B CG1 1 
ATOM   5001  C  CG2 . VAL B 2  215 ? 58.885  123.940 94.054  1.00 15.09 ? 215  VAL B CG2 1 
ATOM   5002  N  N   . LEU B 2  216 ? 60.999  121.242 90.732  1.00 20.47 ? 216  LEU B N   1 
ATOM   5003  C  CA  . LEU B 2  216 ? 61.853  120.221 90.115  1.00 20.78 ? 216  LEU B CA  1 
ATOM   5004  C  C   . LEU B 2  216 ? 63.042  120.814 89.353  1.00 21.79 ? 216  LEU B C   1 
ATOM   5005  O  O   . LEU B 2  216 ? 64.191  120.463 89.660  1.00 22.20 ? 216  LEU B O   1 
ATOM   5006  C  CB  . LEU B 2  216 ? 61.039  119.256 89.239  1.00 20.27 ? 216  LEU B CB  1 
ATOM   5007  C  CG  . LEU B 2  216 ? 60.337  117.967 89.709  1.00 17.40 ? 216  LEU B CG  1 
ATOM   5008  C  CD1 . LEU B 2  216 ? 60.107  117.059 88.527  1.00 14.71 ? 216  LEU B CD1 1 
ATOM   5009  C  CD2 . LEU B 2  216 ? 61.028  117.152 90.803  1.00 18.21 ? 216  LEU B CD2 1 
ATOM   5010  N  N   . LYS B 2  217 ? 62.761  121.833 88.524  1.00 22.24 ? 217  LYS B N   1 
ATOM   5011  C  CA  . LYS B 2  217 ? 63.756  122.595 87.754  1.00 23.09 ? 217  LYS B CA  1 
ATOM   5012  C  C   . LYS B 2  217 ? 64.812  123.266 88.633  1.00 24.33 ? 217  LYS B C   1 
ATOM   5013  O  O   . LYS B 2  217 ? 66.007  123.170 88.323  1.00 25.54 ? 217  LYS B O   1 
ATOM   5014  C  CB  . LYS B 2  217 ? 63.065  123.652 86.879  1.00 23.09 ? 217  LYS B CB  1 
ATOM   5015  C  CG  . LYS B 2  217 ? 63.329  123.531 85.392  1.00 22.57 ? 217  LYS B CG  1 
ATOM   5016  C  CD  . LYS B 2  217 ? 62.820  124.765 84.641  1.00 30.15 ? 217  LYS B CD  1 
ATOM   5017  C  CE  . LYS B 2  217 ? 63.817  125.245 83.595  1.00 32.05 ? 217  LYS B CE  1 
ATOM   5018  N  NZ  . LYS B 2  217 ? 64.890  126.092 84.193  1.00 36.43 ? 217  LYS B NZ  1 
ATOM   5019  N  N   . GLN B 2  218 ? 64.366  123.848 89.761  1.00 24.14 ? 218  GLN B N   1 
ATOM   5020  C  CA  . GLN B 2  218 ? 65.228  124.404 90.815  1.00 24.26 ? 218  GLN B CA  1 
ATOM   5021  C  C   . GLN B 2  218 ? 66.120  123.338 91.481  1.00 23.63 ? 218  GLN B C   1 
ATOM   5022  O  O   . GLN B 2  218 ? 67.339  123.530 91.563  1.00 23.65 ? 218  GLN B O   1 
ATOM   5023  C  CB  . GLN B 2  218 ? 64.390  125.180 91.858  1.00 24.88 ? 218  GLN B CB  1 
ATOM   5024  C  CG  . GLN B 2  218 ? 65.180  126.104 92.791  1.00 29.27 ? 218  GLN B CG  1 
ATOM   5025  C  CD  . GLN B 2  218 ? 65.307  127.525 92.266  1.00 44.37 ? 218  GLN B CD  1 
ATOM   5026  O  OE1 . GLN B 2  218 ? 65.967  127.757 91.244  1.00 49.30 ? 218  GLN B OE1 1 
ATOM   5027  N  NE2 . GLN B 2  218 ? 64.750  128.497 93.012  1.00 36.22 ? 218  GLN B NE2 1 
ATOM   5028  N  N   . VAL B 2  219 ? 65.535  122.180 91.815  1.00 23.32 ? 219  VAL B N   1 
ATOM   5029  C  CA  . VAL B 2  219 ? 66.289  121.036 92.343  1.00 23.31 ? 219  VAL B CA  1 
ATOM   5030  C  C   . VAL B 2  219 ? 67.401  120.541 91.368  1.00 23.46 ? 219  VAL B C   1 
ATOM   5031  O  O   . VAL B 2  219 ? 68.578  120.470 91.770  1.00 23.36 ? 219  VAL B O   1 
ATOM   5032  C  CB  . VAL B 2  219 ? 65.336  119.922 92.891  1.00 23.73 ? 219  VAL B CB  1 
ATOM   5033  C  CG1 . VAL B 2  219 ? 66.036  118.549 93.000  1.00 3.99  ? 219  VAL B CG1 1 
ATOM   5034  C  CG2 . VAL B 2  219 ? 64.776  120.346 94.261  1.00 25.48 ? 219  VAL B CG2 1 
ATOM   5035  N  N   . ALA B 2  220 ? 67.056  120.518 90.075  1.00 23.92 ? 220  ALA B N   1 
ATOM   5036  C  CA  . ALA B 2  220 ? 67.890  119.961 89.000  1.00 25.00 ? 220  ALA B CA  1 
ATOM   5037  C  C   . ALA B 2  220 ? 69.107  120.839 88.688  1.00 26.40 ? 220  ALA B C   1 
ATOM   5038  O  O   . ALA B 2  220 ? 70.234  120.316 88.567  1.00 26.71 ? 220  ALA B O   1 
ATOM   5039  C  CB  . ALA B 2  220 ? 67.050  119.737 87.751  1.00 24.97 ? 220  ALA B CB  1 
ATOM   5040  N  N   . GLU B 2  221 ? 68.881  122.164 88.674  1.00 26.93 ? 221  GLU B N   1 
ATOM   5041  C  CA  . GLU B 2  221 ? 69.916  123.167 88.436  1.00 27.91 ? 221  GLU B CA  1 
ATOM   5042  C  C   . GLU B 2  221 ? 70.841  123.340 89.646  1.00 28.40 ? 221  GLU B C   1 
ATOM   5043  O  O   . GLU B 2  221 ? 72.054  123.494 89.467  1.00 28.76 ? 221  GLU B O   1 
ATOM   5044  C  CB  . GLU B 2  221 ? 69.307  124.518 87.989  1.00 28.21 ? 221  GLU B CB  1 
ATOM   5045  C  CG  . GLU B 2  221 ? 68.575  124.496 86.634  1.00 34.68 ? 221  GLU B CG  1 
ATOM   5046  C  CD  . GLU B 2  221 ? 67.945  125.842 86.251  1.00 46.43 ? 221  GLU B CD  1 
ATOM   5047  O  OE1 . GLU B 2  221 ? 67.042  126.332 86.979  1.00 46.92 ? 221  GLU B OE1 1 
ATOM   5048  O  OE2 . GLU B 2  221 ? 68.299  126.382 85.173  1.00 44.39 ? 221  GLU B OE2 1 
ATOM   5049  N  N   . GLN B 2  222 ? 70.265  123.364 90.858  1.00 28.85 ? 222  GLN B N   1 
ATOM   5050  C  CA  . GLN B 2  222 ? 71.032  123.492 92.109  1.00 29.46 ? 222  GLN B CA  1 
ATOM   5051  C  C   . GLN B 2  222 ? 71.849  122.249 92.458  1.00 29.71 ? 222  GLN B C   1 
ATOM   5052  O  O   . GLN B 2  222 ? 73.027  122.383 92.813  1.00 30.37 ? 222  GLN B O   1 
ATOM   5053  C  CB  . GLN B 2  222 ? 70.138  123.881 93.287  1.00 29.95 ? 222  GLN B CB  1 
ATOM   5054  C  CG  . GLN B 2  222 ? 69.953  125.376 93.510  1.00 44.48 ? 222  GLN B CG  1 
ATOM   5055  C  CD  . GLN B 2  222 ? 69.116  125.665 94.749  1.00 45.95 ? 222  GLN B CD  1 
ATOM   5056  O  OE1 . GLN B 2  222 ? 67.882  125.627 94.692  1.00 39.35 ? 222  GLN B OE1 1 
ATOM   5057  N  NE2 . GLN B 2  222 ? 69.782  125.822 95.890  1.00 47.48 ? 222  GLN B NE2 1 
ATOM   5058  N  N   . PHE B 2  223 ? 71.238  121.057 92.328  1.00 29.07 ? 223  PHE B N   1 
ATOM   5059  C  CA  . PHE B 2  223 ? 71.780  119.821 92.913  1.00 29.19 ? 223  PHE B CA  1 
ATOM   5060  C  C   . PHE B 2  223 ? 72.174  118.675 91.973  1.00 28.78 ? 223  PHE B C   1 
ATOM   5061  O  O   . PHE B 2  223 ? 73.062  117.900 92.325  1.00 28.64 ? 223  PHE B O   1 
ATOM   5062  C  CB  . PHE B 2  223 ? 70.930  119.320 94.091  1.00 29.50 ? 223  PHE B CB  1 
ATOM   5063  C  CG  . PHE B 2  223 ? 70.769  120.331 95.215  1.00 33.78 ? 223  PHE B CG  1 
ATOM   5064  C  CD1 . PHE B 2  223 ? 69.550  121.044 95.368  1.00 4.97  ? 223  PHE B CD1 1 
ATOM   5065  C  CD2 . PHE B 2  223 ? 71.806  120.516 96.182  1.00 36.20 ? 223  PHE B CD2 1 
ATOM   5066  C  CE1 . PHE B 2  223 ? 69.338  121.914 96.492  1.00 29.12 ? 223  PHE B CE1 1 
ATOM   5067  C  CE2 . PHE B 2  223 ? 71.637  121.406 97.284  1.00 29.51 ? 223  PHE B CE2 1 
ATOM   5068  C  CZ  . PHE B 2  223 ? 70.396  122.116 97.441  1.00 36.80 ? 223  PHE B CZ  1 
ATOM   5069  N  N   . LEU B 2  224 ? 71.698  118.722 90.723  1.00 29.04 ? 224  LEU B N   1 
ATOM   5070  C  CA  . LEU B 2  224 ? 71.974  117.680 89.715  1.00 29.58 ? 224  LEU B CA  1 
ATOM   5071  C  C   . LEU B 2  224 ? 72.812  118.113 88.484  1.00 30.17 ? 224  LEU B C   1 
ATOM   5072  O  O   . LEU B 2  224 ? 72.731  117.484 87.423  1.00 30.41 ? 224  LEU B O   1 
ATOM   5073  C  CB  . LEU B 2  224 ? 70.673  116.919 89.322  1.00 29.34 ? 224  LEU B CB  1 
ATOM   5074  C  CG  . LEU B 2  224 ? 69.852  116.220 90.416  1.00 23.93 ? 224  LEU B CG  1 
ATOM   5075  C  CD1 . LEU B 2  224 ? 68.434  116.008 89.968  1.00 18.93 ? 224  LEU B CD1 1 
ATOM   5076  C  CD2 . LEU B 2  224 ? 70.457  114.923 90.824  1.00 25.86 ? 224  LEU B CD2 1 
ATOM   5077  N  N   . ASN B 2  225 ? 73.730  119.062 88.702  1.00 30.95 ? 225  ASN B N   1 
ATOM   5078  C  CA  . ASN B 2  225 ? 74.721  119.496 87.704  1.00 31.76 ? 225  ASN B CA  1 
ATOM   5079  C  C   . ASN B 2  225 ? 76.088  118.829 87.928  1.00 32.86 ? 225  ASN B C   1 
ATOM   5080  O  O   . ASN B 2  225 ? 76.923  119.329 88.696  1.00 32.17 ? 225  ASN B O   1 
ATOM   5081  C  CB  . ASN B 2  225 ? 74.803  121.048 87.614  1.00 31.55 ? 225  ASN B CB  1 
ATOM   5082  C  CG  . ASN B 2  225 ? 75.608  121.542 86.388  1.00 36.36 ? 225  ASN B CG  1 
ATOM   5083  O  OD1 . ASN B 2  225 ? 75.493  120.999 85.271  1.00 34.68 ? 225  ASN B OD1 1 
ATOM   5084  N  ND2 . ASN B 2  225 ? 76.390  122.609 86.588  1.00 34.07 ? 225  ASN B ND2 1 
ATOM   5085  N  N   . ILE B 2  226 ? 76.161  117.572 87.465  1.00 34.73 ? 226  ILE B N   1 
ATOM   5086  C  CA  . ILE B 2  226 ? 77.343  116.695 87.568  1.00 36.66 ? 226  ILE B CA  1 
ATOM   5087  C  C   . ILE B 2  226 ? 77.723  116.336 86.133  1.00 38.65 ? 226  ILE B C   1 
ATOM   5088  O  O   . ILE B 2  226 ? 76.854  115.897 85.368  1.00 39.20 ? 226  ILE B O   1 
ATOM   5089  C  CB  . ILE B 2  226 ? 77.007  115.330 88.398  1.00 37.24 ? 226  ILE B CB  1 
ATOM   5090  C  CG1 . ILE B 2  226 ? 75.956  115.492 89.549  1.00 40.51 ? 226  ILE B CG1 1 
ATOM   5091  C  CG2 . ILE B 2  226 ? 78.295  114.501 88.750  1.00 35.38 ? 226  ILE B CG2 1 
ATOM   5092  C  CD1 . ILE B 2  226 ? 76.389  116.332 90.811  1.00 46.37 ? 226  ILE B CD1 1 
ATOM   5093  N  N   . ARG B 2  227 ? 78.984  116.580 85.749  1.00 40.58 ? 227  ARG B N   1 
ATOM   5094  C  CA  . ARG B 2  227 ? 79.685  115.737 84.749  1.00 43.19 ? 227  ARG B CA  1 
ATOM   5095  C  C   . ARG B 2  227 ? 81.198  115.638 84.871  1.00 45.05 ? 227  ARG B C   1 
ATOM   5096  O  O   . ARG B 2  227 ? 81.923  116.666 84.793  1.00 45.22 ? 227  ARG B O   1 
ATOM   5097  C  CB  . ARG B 2  227 ? 79.286  116.057 83.288  1.00 44.00 ? 227  ARG B CB  1 
ATOM   5098  C  CG  . ARG B 2  227 ? 78.537  114.902 82.573  1.00 43.73 ? 227  ARG B CG  1 
ATOM   5099  C  CD  . ARG B 2  227 ? 79.458  113.899 81.856  1.00 57.85 ? 227  ARG B CD  1 
ATOM   5100  N  NE  . ARG B 2  227 ? 78.714  112.943 81.014  1.00 69.68 ? 227  ARG B NE  1 
ATOM   5101  C  CZ  . ARG B 2  227 ? 78.786  112.849 79.670  1.00 73.05 ? 227  ARG B CZ  1 
ATOM   5102  N  NH1 . ARG B 2  227 ? 79.555  113.671 78.941  1.00 66.18 ? 227  ARG B NH1 1 
ATOM   5103  N  NH2 . ARG B 2  227 ? 78.064  111.920 79.048  1.00 72.93 ? 227  ARG B NH2 1 
ATOM   5104  N  N   . GLY B 2  228 ? 81.642  114.424 85.215  1.00 46.31 ? 228  GLY B N   1 
ATOM   5105  C  CA  . GLY B 2  228 ? 82.922  113.862 84.775  1.00 47.48 ? 228  GLY B CA  1 
ATOM   5106  C  C   . GLY B 2  228 ? 82.861  112.341 84.640  1.00 48.69 ? 228  GLY B C   1 
ATOM   5107  O  O   . GLY B 2  228 ? 83.734  111.624 85.173  1.00 48.80 ? 228  GLY B O   1 
ATOM   5108  N  N   . GLY B 2  229 ? 81.840  111.862 83.915  1.00 49.45 ? 229  GLY B N   1 
ATOM   5109  C  CA  . GLY B 2  229 ? 81.520  110.444 83.810  1.00 50.37 ? 229  GLY B CA  1 
ATOM   5110  C  C   . GLY B 2  229 ? 81.897  109.842 82.471  1.00 51.30 ? 229  GLY B C   1 
ATOM   5111  O  O   . GLY B 2  229 ? 83.030  110.041 81.985  1.00 51.17 ? 229  GLY B O   1 
ATOM   5112  N  N   . LEU B 2  230 ? 80.950  109.087 81.899  1.00 52.20 ? 230  LEU B N   1 
ATOM   5113  C  CA  . LEU B 2  230 ? 81.136  108.358 80.631  1.00 52.59 ? 230  LEU B CA  1 
ATOM   5114  C  C   . LEU B 2  230 ? 80.171  108.793 79.517  1.00 52.76 ? 230  LEU B C   1 
ATOM   5115  O  O   . LEU B 2  230 ? 79.055  109.272 79.799  1.00 52.77 ? 230  LEU B O   1 
ATOM   5116  C  CB  . LEU B 2  230 ? 81.095  106.834 80.855  1.00 52.45 ? 230  LEU B CB  1 
ATOM   5117  C  CG  . LEU B 2  230 ? 82.467  106.143 80.847  1.00 53.09 ? 230  LEU B CG  1 
ATOM   5118  C  CD1 . LEU B 2  230 ? 82.635  105.223 82.033  1.00 52.06 ? 230  LEU B CD1 1 
ATOM   5119  C  CD2 . LEU B 2  230 ? 82.730  105.393 79.532  1.00 58.39 ? 230  LEU B CD2 1 
ATOM   5120  N  N   . GLY B 2  231 ? 80.690  108.777 78.282  1.00 52.88 ? 231  GLY B N   1 
ATOM   5121  C  CA  . GLY B 2  231 ? 79.901  108.874 77.057  1.00 53.52 ? 231  GLY B CA  1 
ATOM   5122  C  C   . GLY B 2  231 ? 78.971  107.692 76.807  1.00 54.26 ? 231  GLY B C   1 
ATOM   5123  O  O   . GLY B 2  231 ? 79.403  106.525 76.929  1.00 53.91 ? 231  GLY B O   1 
ATOM   5124  N  N   . LEU B 2  232 ? 77.869  107.995 76.112  1.00 54.98 ? 232  LEU B N   1 
ATOM   5125  C  CA  . LEU B 2  232 ? 76.532  107.522 76.488  1.00 55.55 ? 232  LEU B CA  1 
ATOM   5126  C  C   . LEU B 2  232 ? 76.110  106.133 75.979  1.00 56.13 ? 232  LEU B C   1 
ATOM   5127  O  O   . LEU B 2  232 ? 76.473  105.726 74.859  1.00 56.59 ? 232  LEU B O   1 
ATOM   5128  C  CB  . LEU B 2  232 ? 75.478  108.571 76.128  1.00 55.54 ? 232  LEU B CB  1 
ATOM   5129  C  CG  . LEU B 2  232 ? 75.072  109.543 77.245  1.00 54.57 ? 232  LEU B CG  1 
ATOM   5130  C  CD1 . LEU B 2  232 ? 74.976  110.978 76.719  1.00 50.27 ? 232  LEU B CD1 1 
ATOM   5131  C  CD2 . LEU B 2  232 ? 73.751  109.103 77.893  1.00 45.38 ? 232  LEU B CD2 1 
ATOM   5132  N  N   . SER B 2  233 ? 75.449  105.378 76.876  1.00 55.80 ? 233  SER B N   1 
ATOM   5133  C  CA  . SER B 2  233 ? 74.439  104.330 76.547  1.00 55.54 ? 233  SER B CA  1 
ATOM   5134  C  C   . SER B 2  233 ? 74.919  102.907 76.099  1.00 54.65 ? 233  SER B C   1 
ATOM   5135  O  O   . SER B 2  233 ? 74.085  101.970 75.976  1.00 54.08 ? 233  SER B O   1 
ATOM   5136  C  CB  . SER B 2  233 ? 73.259  104.876 75.696  1.00 55.79 ? 233  SER B CB  1 
ATOM   5137  O  OG  . SER B 2  233 ? 72.009  104.632 76.333  1.00 60.40 ? 233  SER B OG  1 
ATOM   5138  N  N   . GLY B 2  234 ? 76.242  102.761 75.870  1.00 53.84 ? 234  GLY B N   1 
ATOM   5139  C  CA  . GLY B 2  234 ? 76.917  101.459 75.908  1.00 52.58 ? 234  GLY B CA  1 
ATOM   5140  C  C   . GLY B 2  234 ? 78.397  101.343 75.546  1.00 51.17 ? 234  GLY B C   1 
ATOM   5141  O  O   . GLY B 2  234 ? 79.018  102.279 75.025  1.00 51.32 ? 234  GLY B O   1 
ATOM   5142  N  N   . ALA B 2  235 ? 78.959  100.177 75.892  1.00 49.69 ? 235  ALA B N   1 
ATOM   5143  C  CA  . ALA B 2  235 ? 79.977  99.469  75.079  1.00 47.45 ? 235  ALA B CA  1 
ATOM   5144  C  C   . ALA B 2  235 ? 79.494  98.925  73.708  1.00 44.82 ? 235  ALA B C   1 
ATOM   5145  O  O   . ALA B 2  235 ? 80.339  98.709  72.825  1.00 45.58 ? 235  ALA B O   1 
ATOM   5146  C  CB  . ALA B 2  235 ? 80.634  98.352  75.899  1.00 47.60 ? 235  ALA B CB  1 
ATOM   5147  N  N   . LYS B 2  236 ? 78.170  99.002  73.465  1.00 41.22 ? 236  LYS B N   1 
ATOM   5148  C  CA  . LYS B 2  236 ? 77.403  98.258  72.432  1.00 38.06 ? 236  LYS B CA  1 
ATOM   5149  C  C   . LYS B 2  236 ? 77.299  96.750  72.645  1.00 34.40 ? 236  LYS B C   1 
ATOM   5150  O  O   . LYS B 2  236 ? 78.301  96.024  72.621  1.00 33.97 ? 236  LYS B O   1 
ATOM   5151  C  CB  . LYS B 2  236 ? 77.737  98.651  70.971  1.00 38.36 ? 236  LYS B CB  1 
ATOM   5152  C  CG  . LYS B 2  236 ? 76.637  98.330  69.933  1.00 45.58 ? 236  LYS B CG  1 
ATOM   5153  C  CD  . LYS B 2  236 ? 75.849  99.577  69.538  1.00 56.78 ? 236  LYS B CD  1 
ATOM   5154  C  CE  . LYS B 2  236 ? 74.677  99.235  68.614  1.00 57.90 ? 236  LYS B CE  1 
ATOM   5155  N  NZ  . LYS B 2  236 ? 73.829  100.435 68.323  1.00 56.81 ? 236  LYS B NZ  1 
ATOM   5156  N  N   . ALA B 2  237 ? 76.060  96.325  72.869  1.00 31.22 ? 237  ALA B N   1 
ATOM   5157  C  CA  . ALA B 2  237 ? 75.704  94.952  73.167  1.00 28.79 ? 237  ALA B CA  1 
ATOM   5158  C  C   . ALA B 2  237 ? 75.838  94.084  71.917  1.00 26.63 ? 237  ALA B C   1 
ATOM   5159  O  O   . ALA B 2  237 ? 75.185  94.349  70.909  1.00 25.96 ? 237  ALA B O   1 
ATOM   5160  C  CB  . ALA B 2  237 ? 74.296  94.892  73.732  1.00 28.48 ? 237  ALA B CB  1 
ATOM   5161  N  N   . LYS B 2  238 ? 76.908  93.283  71.923  1.00 25.63 ? 238  LYS B N   1 
ATOM   5162  C  CA  . LYS B 2  238 ? 77.221  92.299  70.870  1.00 24.07 ? 238  LYS B CA  1 
ATOM   5163  C  C   . LYS B 2  238 ? 76.404  91.029  71.106  1.00 21.84 ? 238  LYS B C   1 
ATOM   5164  O  O   . LYS B 2  238 ? 76.688  90.264  72.036  1.00 21.23 ? 238  LYS B O   1 
ATOM   5165  C  CB  . LYS B 2  238 ? 78.738  91.979  70.835  1.00 24.24 ? 238  LYS B CB  1 
ATOM   5166  C  CG  . LYS B 2  238 ? 79.702  93.198  70.760  1.00 32.09 ? 238  LYS B CG  1 
ATOM   5167  C  CD  . LYS B 2  238 ? 81.161  92.752  70.487  1.00 44.45 ? 238  LYS B CD  1 
ATOM   5168  C  CE  . LYS B 2  238 ? 81.974  92.504  71.782  1.00 48.39 ? 238  LYS B CE  1 
ATOM   5169  N  NZ  . LYS B 2  238 ? 83.109  93.462  71.969  1.00 48.55 ? 238  LYS B NZ  1 
ATOM   5170  N  N   . TYR B 2  239 ? 75.319  90.872  70.339  1.00 21.26 ? 239  TYR B N   1 
ATOM   5171  C  CA  . TYR B 2  239 ? 74.610  89.578  70.244  1.00 20.74 ? 239  TYR B CA  1 
ATOM   5172  C  C   . TYR B 2  239 ? 75.508  88.522  69.642  1.00 20.94 ? 239  TYR B C   1 
ATOM   5173  O  O   . TYR B 2  239 ? 76.143  88.766  68.605  1.00 21.19 ? 239  TYR B O   1 
ATOM   5174  C  CB  . TYR B 2  239 ? 73.316  89.679  69.446  1.00 20.33 ? 239  TYR B CB  1 
ATOM   5175  C  CG  . TYR B 2  239 ? 72.429  88.430  69.529  1.00 21.98 ? 239  TYR B CG  1 
ATOM   5176  C  CD1 . TYR B 2  239 ? 72.556  87.365  68.575  1.00 9.17  ? 239  TYR B CD1 1 
ATOM   5177  C  CD2 . TYR B 2  239 ? 71.505  88.277  70.578  1.00 12.78 ? 239  TYR B CD2 1 
ATOM   5178  C  CE1 . TYR B 2  239 ? 71.788  86.199  68.684  1.00 18.26 ? 239  TYR B CE1 1 
ATOM   5179  C  CE2 . TYR B 2  239 ? 70.717  87.100  70.684  1.00 20.30 ? 239  TYR B CE2 1 
ATOM   5180  C  CZ  . TYR B 2  239 ? 70.827  86.098  69.705  1.00 17.93 ? 239  TYR B CZ  1 
ATOM   5181  O  OH  . TYR B 2  239 ? 70.050  84.962  69.807  1.00 15.54 ? 239  TYR B OH  1 
ATOM   5182  N  N   . HIS B 2  240 ? 75.371  87.309  70.188  1.00 20.68 ? 240  HIS B N   1 
ATOM   5183  C  CA  . HIS B 2  240 ? 76.284  86.194  69.985  1.00 20.74 ? 240  HIS B CA  1 
ATOM   5184  C  C   . HIS B 2  240 ? 75.471  84.889  69.711  1.00 21.05 ? 240  HIS B C   1 
ATOM   5185  O  O   . HIS B 2  240 ? 75.754  84.170  68.743  1.00 21.46 ? 240  HIS B O   1 
ATOM   5186  C  CB  . HIS B 2  240 ? 77.198  86.086  71.234  1.00 20.66 ? 240  HIS B CB  1 
ATOM   5187  C  CG  . HIS B 2  240 ? 77.944  84.786  71.370  1.00 28.20 ? 240  HIS B CG  1 
ATOM   5188  N  ND1 . HIS B 2  240 ? 78.668  84.221  70.337  1.00 29.11 ? 240  HIS B ND1 1 
ATOM   5189  C  CD2 . HIS B 2  240 ? 78.212  84.037  72.467  1.00 18.68 ? 240  HIS B CD2 1 
ATOM   5190  C  CE1 . HIS B 2  240 ? 79.263  83.124  70.769  1.00 35.83 ? 240  HIS B CE1 1 
ATOM   5191  N  NE2 . HIS B 2  240 ? 78.975  82.973  72.051  1.00 39.17 ? 240  HIS B NE2 1 
ATOM   5192  N  N   . GLY B 2  241 ? 74.460  84.634  70.549  1.00 20.30 ? 241  GLY B N   1 
ATOM   5193  C  CA  . GLY B 2  241 ? 73.747  83.381  70.603  1.00 19.83 ? 241  GLY B CA  1 
ATOM   5194  C  C   . GLY B 2  241 ? 74.505  82.260  71.289  1.00 19.71 ? 241  GLY B C   1 
ATOM   5195  O  O   . GLY B 2  241 ? 75.742  82.307  71.425  1.00 19.82 ? 241  GLY B O   1 
ATOM   5196  N  N   . GLY B 2  242 ? 73.755  81.221  71.658  1.00 19.36 ? 242  GLY B N   1 
ATOM   5197  C  CA  . GLY B 2  242 ? 74.273  80.039  72.342  1.00 18.77 ? 242  GLY B CA  1 
ATOM   5198  C  C   . GLY B 2  242 ? 73.311  79.480  73.373  1.00 18.41 ? 242  GLY B C   1 
ATOM   5199  O  O   . GLY B 2  242 ? 72.159  79.883  73.422  1.00 18.26 ? 242  GLY B O   1 
ATOM   5200  N  N   . GLU B 2  243 ? 73.787  78.533  74.183  1.00 18.27 ? 243  GLU B N   1 
ATOM   5201  C  CA  . GLU B 2  243 ? 72.974  77.939  75.236  1.00 18.28 ? 243  GLU B CA  1 
ATOM   5202  C  C   . GLU B 2  243 ? 73.650  77.728  76.569  1.00 18.27 ? 243  GLU B C   1 
ATOM   5203  O  O   . GLU B 2  243 ? 74.829  77.337  76.619  1.00 17.81 ? 243  GLU B O   1 
ATOM   5204  C  CB  . GLU B 2  243 ? 72.237  76.675  74.761  1.00 18.33 ? 243  GLU B CB  1 
ATOM   5205  C  CG  . GLU B 2  243 ? 73.128  75.504  74.320  1.00 17.10 ? 243  GLU B CG  1 
ATOM   5206  C  CD  . GLU B 2  243 ? 72.541  74.687  73.182  1.00 20.33 ? 243  GLU B CD  1 
ATOM   5207  O  OE1 . GLU B 2  243 ? 73.336  74.150  72.371  1.00 25.07 ? 243  GLU B OE1 1 
ATOM   5208  O  OE2 . GLU B 2  243 ? 71.326  74.412  73.215  1.00 21.96 ? 243  GLU B OE2 1 
ATOM   5209  N  N   . ILE B 2  244 ? 72.880  77.973  77.639  1.00 18.71 ? 244  ILE B N   1 
ATOM   5210  C  CA  . ILE B 2  244 ? 73.201  77.498  78.996  1.00 19.07 ? 244  ILE B CA  1 
ATOM   5211  C  C   . ILE B 2  244 ? 72.112  76.524  79.514  1.00 19.59 ? 244  ILE B C   1 
ATOM   5212  O  O   . ILE B 2  244 ? 70.915  76.846  79.511  1.00 19.78 ? 244  ILE B O   1 
ATOM   5213  C  CB  . ILE B 2  244 ? 73.516  78.687  79.981  1.00 19.42 ? 244  ILE B CB  1 
ATOM   5214  C  CG1 . ILE B 2  244 ? 74.771  79.494  79.498  1.00 18.28 ? 244  ILE B CG1 1 
ATOM   5215  C  CG2 . ILE B 2  244 ? 73.731  78.169  81.442  1.00 12.39 ? 244  ILE B CG2 1 
ATOM   5216  C  CD1 . ILE B 2  244 ? 74.933  80.953  80.078  1.00 20.06 ? 244  ILE B CD1 1 
ATOM   5217  N  N   . ARG B 2  245 ? 72.599  75.450  80.140  1.00 19.55 ? 245  ARG B N   1 
ATOM   5218  C  CA  . ARG B 2  245 ? 71.829  74.302  80.590  1.00 19.01 ? 245  ARG B CA  1 
ATOM   5219  C  C   . ARG B 2  245 ? 72.163  74.018  82.059  1.00 18.51 ? 245  ARG B C   1 
ATOM   5220  O  O   . ARG B 2  245 ? 73.306  73.621  82.398  1.00 17.73 ? 245  ARG B O   1 
ATOM   5221  C  CB  . ARG B 2  245 ? 72.226  73.097  79.774  1.00 18.74 ? 245  ARG B CB  1 
ATOM   5222  C  CG  . ARG B 2  245 ? 71.726  73.043  78.379  1.00 11.90 ? 245  ARG B CG  1 
ATOM   5223  C  CD  . ARG B 2  245 ? 71.819  71.629  77.880  1.00 29.66 ? 245  ARG B CD  1 
ATOM   5224  N  NE  . ARG B 2  245 ? 70.816  71.418  76.870  1.00 30.37 ? 245  ARG B NE  1 
ATOM   5225  C  CZ  . ARG B 2  245 ? 69.734  70.694  76.981  1.00 26.63 ? 245  ARG B CZ  1 
ATOM   5226  N  NH1 . ARG B 2  245 ? 69.731  69.518  77.602  1.00 27.70 ? 245  ARG B NH1 1 
ATOM   5227  N  NH2 . ARG B 2  245 ? 68.780  70.964  76.139  1.00 33.74 ? 245  ARG B NH2 1 
ATOM   5228  N  N   . GLU B 2  246 ? 71.158  74.222  82.914  1.00 18.44 ? 246  GLU B N   1 
ATOM   5229  C  CA  . GLU B 2  246 ? 71.252  73.950  84.345  1.00 17.93 ? 246  GLU B CA  1 
ATOM   5230  C  C   . GLU B 2  246 ? 70.375  72.750  84.789  1.00 16.94 ? 246  GLU B C   1 
ATOM   5231  O  O   . GLU B 2  246 ? 69.147  72.887  84.950  1.00 15.54 ? 246  GLU B O   1 
ATOM   5232  C  CB  . GLU B 2  246 ? 70.930  75.225  85.133  1.00 17.74 ? 246  GLU B CB  1 
ATOM   5233  C  CG  . GLU B 2  246 ? 71.916  75.505  86.255  1.00 38.01 ? 246  GLU B CG  1 
ATOM   5234  C  CD  . GLU B 2  246 ? 71.272  75.594  87.629  1.00 45.30 ? 246  GLU B CD  1 
ATOM   5235  O  OE1 . GLU B 2  246 ? 70.290  76.364  87.812  1.00 41.64 ? 246  GLU B OE1 1 
ATOM   5236  O  OE2 . GLU B 2  246 ? 71.835  74.985  88.563  1.00 57.77 ? 246  GLU B OE2 1 
ATOM   5237  N  N   . GLN B 2  247 ? 71.010  71.570  84.895  1.00 17.68 ? 247  GLN B N   1 
ATOM   5238  C  CA  . GLN B 2  247 ? 70.459  70.399  85.610  1.00 18.18 ? 247  GLN B CA  1 
ATOM   5239  C  C   . GLN B 2  247 ? 70.137  70.732  87.083  1.00 18.85 ? 247  GLN B C   1 
ATOM   5240  O  O   . GLN B 2  247 ? 71.036  71.112  87.851  1.00 17.85 ? 247  GLN B O   1 
ATOM   5241  C  CB  . GLN B 2  247 ? 71.423  69.189  85.562  1.00 17.52 ? 247  GLN B CB  1 
ATOM   5242  C  CG  . GLN B 2  247 ? 71.106  68.081  84.616  1.00 26.11 ? 247  GLN B CG  1 
ATOM   5243  C  CD  . GLN B 2  247 ? 69.729  67.453  84.786  1.00 24.97 ? 247  GLN B CD  1 
ATOM   5244  O  OE1 . GLN B 2  247 ? 68.928  67.571  83.889  1.00 25.24 ? 247  GLN B OE1 1 
ATOM   5245  N  NE2 . GLN B 2  247 ? 69.549  66.618  85.809  1.00 20.22 ? 247  GLN B NE2 1 
ATOM   5246  N  N   . ASN B 2  248 ? 68.958  70.265  87.492  1.00 20.74 ? 248  ASN B N   1 
ATOM   5247  C  CA  . ASN B 2  248 ? 68.224  70.690  88.703  1.00 22.46 ? 248  ASN B CA  1 
ATOM   5248  C  C   . ASN B 2  248 ? 67.418  69.499  89.276  1.00 23.83 ? 248  ASN B C   1 
ATOM   5249  O  O   . ASN B 2  248 ? 67.100  69.479  90.489  1.00 24.36 ? 248  ASN B O   1 
ATOM   5250  C  CB  . ASN B 2  248 ? 67.205  71.770  88.313  1.00 22.07 ? 248  ASN B CB  1 
ATOM   5251  C  CG  . ASN B 2  248 ? 67.409  73.081  89.018  1.00 32.89 ? 248  ASN B CG  1 
ATOM   5252  O  OD1 . ASN B 2  248 ? 67.424  74.110  88.353  1.00 37.83 ? 248  ASN B OD1 1 
ATOM   5253  N  ND2 . ASN B 2  248 ? 67.202  73.089  90.334  1.00 49.28 ? 248  ASN B ND2 1 
ATOM   5254  N  N   . GLY B 2  249 ? 66.977  68.605  88.370  1.00 24.92 ? 249  GLY B N   1 
ATOM   5255  C  CA  . GLY B 2  249 ? 65.881  67.644  88.583  1.00 27.00 ? 249  GLY B CA  1 
ATOM   5256  C  C   . GLY B 2  249 ? 64.508  68.146  89.059  1.00 29.02 ? 249  GLY B C   1 
ATOM   5257  O  O   . GLY B 2  249 ? 63.694  67.310  89.463  1.00 30.20 ? 249  GLY B O   1 
ATOM   5258  N  N   . ASP B 2  250 ? 64.150  69.392  88.709  1.00 29.58 ? 250  ASP B N   1 
ATOM   5259  C  CA  . ASP B 2  250 ? 63.351  70.313  89.563  1.00 29.93 ? 250  ASP B CA  1 
ATOM   5260  C  C   . ASP B 2  250 ? 61.816  70.134  89.493  1.00 29.44 ? 250  ASP B C   1 
ATOM   5261  O  O   . ASP B 2  250 ? 61.084  71.001  89.965  1.00 29.14 ? 250  ASP B O   1 
ATOM   5262  C  CB  . ASP B 2  250 ? 63.711  71.785  89.216  1.00 30.82 ? 250  ASP B CB  1 
ATOM   5263  C  CG  . ASP B 2  250 ? 63.729  72.731  90.442  1.00 41.11 ? 250  ASP B CG  1 
ATOM   5264  O  OD1 . ASP B 2  250 ? 63.411  72.314  91.585  1.00 50.30 ? 250  ASP B OD1 1 
ATOM   5265  O  OD2 . ASP B 2  250 ? 64.061  73.940  90.336  1.00 38.43 ? 250  ASP B OD2 1 
ATOM   5266  N  N   . SER B 2  251 ? 61.365  68.929  89.092  1.00 29.96 ? 251  SER B N   1 
ATOM   5267  C  CA  . SER B 2  251 ? 59.940  68.538  88.798  1.00 29.31 ? 251  SER B CA  1 
ATOM   5268  C  C   . SER B 2  251 ? 59.376  69.133  87.509  1.00 27.04 ? 251  SER B C   1 
ATOM   5269  O  O   . SER B 2  251 ? 58.877  68.388  86.633  1.00 27.91 ? 251  SER B O   1 
ATOM   5270  C  CB  . SER B 2  251 ? 58.958  68.703  90.005  1.00 30.14 ? 251  SER B CB  1 
ATOM   5271  O  OG  . SER B 2  251 ? 58.717  70.086  90.336  1.00 30.24 ? 251  SER B OG  1 
ATOM   5272  N  N   . LEU B 2  252 ? 59.604  70.434  87.339  1.00 23.65 ? 252  LEU B N   1 
ATOM   5273  C  CA  . LEU B 2  252 ? 59.267  71.155  86.120  1.00 20.31 ? 252  LEU B CA  1 
ATOM   5274  C  C   . LEU B 2  252 ? 60.502  71.695  85.431  1.00 18.55 ? 252  LEU B C   1 
ATOM   5275  O  O   . LEU B 2  252 ? 61.427  72.228  86.102  1.00 18.64 ? 252  LEU B O   1 
ATOM   5276  C  CB  . LEU B 2  252 ? 58.213  72.252  86.404  1.00 19.15 ? 252  LEU B CB  1 
ATOM   5277  C  CG  . LEU B 2  252 ? 56.884  71.818  87.089  1.00 18.39 ? 252  LEU B CG  1 
ATOM   5278  C  CD1 . LEU B 2  252 ? 56.035  72.960  87.544  1.00 10.21 ? 252  LEU B CD1 1 
ATOM   5279  C  CD2 . LEU B 2  252 ? 56.046  70.798  86.279  1.00 10.09 ? 252  LEU B CD2 1 
ATOM   5280  N  N   . VAL B 2  253 ? 60.536  71.503  84.108  1.00 16.12 ? 253  VAL B N   1 
ATOM   5281  C  CA  . VAL B 2  253 ? 61.473  72.192  83.206  1.00 14.22 ? 253  VAL B CA  1 
ATOM   5282  C  C   . VAL B 2  253 ? 60.988  73.613  82.857  1.00 13.83 ? 253  VAL B C   1 
ATOM   5283  O  O   . VAL B 2  253 ? 59.883  73.795  82.313  1.00 13.07 ? 253  VAL B O   1 
ATOM   5284  C  CB  . VAL B 2  253 ? 61.823  71.325  81.938  1.00 13.81 ? 253  VAL B CB  1 
ATOM   5285  C  CG1 . VAL B 2  253 ? 62.642  72.113  80.873  1.00 12.51 ? 253  VAL B CG1 1 
ATOM   5286  C  CG2 . VAL B 2  253 ? 62.621  70.111  82.353  1.00 10.47 ? 253  VAL B CG2 1 
ATOM   5287  N  N   . HIS B 2  254 ? 61.855  74.594  83.133  1.00 14.06 ? 254  HIS B N   1 
ATOM   5288  C  CA  . HIS B 2  254 ? 61.694  75.952  82.634  1.00 14.62 ? 254  HIS B CA  1 
ATOM   5289  C  C   . HIS B 2  254 ? 62.662  76.161  81.474  1.00 16.45 ? 254  HIS B C   1 
ATOM   5290  O  O   . HIS B 2  254 ? 63.863  75.905  81.620  1.00 17.65 ? 254  HIS B O   1 
ATOM   5291  C  CB  . HIS B 2  254 ? 61.954  76.949  83.745  1.00 14.24 ? 254  HIS B CB  1 
ATOM   5292  C  CG  . HIS B 2  254 ? 60.837  77.076  84.728  1.00 10.91 ? 254  HIS B CG  1 
ATOM   5293  N  ND1 . HIS B 2  254 ? 60.219  78.288  84.976  1.00 17.16 ? 254  HIS B ND1 1 
ATOM   5294  C  CD2 . HIS B 2  254 ? 60.423  76.242  85.709  1.00 7.81  ? 254  HIS B CD2 1 
ATOM   5295  C  CE1 . HIS B 2  254 ? 59.365  78.145  85.972  1.00 7.88  ? 254  HIS B CE1 1 
ATOM   5296  N  NE2 . HIS B 2  254 ? 59.458  76.907  86.425  1.00 19.86 ? 254  HIS B NE2 1 
ATOM   5297  N  N   . ALA B 2  255 ? 62.123  76.502  80.300  1.00 17.09 ? 255  ALA B N   1 
ATOM   5298  C  CA  . ALA B 2  255 ? 62.940  76.791  79.113  1.00 17.94 ? 255  ALA B CA  1 
ATOM   5299  C  C   . ALA B 2  255 ? 62.595  78.109  78.414  1.00 18.18 ? 255  ALA B C   1 
ATOM   5300  O  O   . ALA B 2  255 ? 61.433  78.500  78.370  1.00 18.79 ? 255  ALA B O   1 
ATOM   5301  C  CB  . ALA B 2  255 ? 62.897  75.604  78.135  1.00 17.36 ? 255  ALA B CB  1 
ATOM   5302  N  N   . ALA B 2  256 ? 63.614  78.789  77.897  1.00 18.04 ? 256  ALA B N   1 
ATOM   5303  C  CA  . ALA B 2  256 ? 63.447  80.036  77.128  1.00 18.21 ? 256  ALA B CA  1 
ATOM   5304  C  C   . ALA B 2  256 ? 64.264  80.013  75.847  1.00 18.70 ? 256  ALA B C   1 
ATOM   5305  O  O   . ALA B 2  256 ? 65.447  79.638  75.868  1.00 19.25 ? 256  ALA B O   1 
ATOM   5306  C  CB  . ALA B 2  256 ? 63.796  81.229  77.954  1.00 18.16 ? 256  ALA B CB  1 
ATOM   5307  N  N   . LEU B 2  257 ? 63.570  80.229  74.730  1.00 18.50 ? 257  LEU B N   1 
ATOM   5308  C  CA  . LEU B 2  257 ? 64.155  80.229  73.386  1.00 18.26 ? 257  LEU B CA  1 
ATOM   5309  C  C   . LEU B 2  257 ? 63.862  81.540  72.695  1.00 18.52 ? 257  LEU B C   1 
ATOM   5310  O  O   . LEU B 2  257 ? 62.681  81.932  72.514  1.00 19.24 ? 257  LEU B O   1 
ATOM   5311  C  CB  . LEU B 2  257 ? 63.610  79.076  72.550  1.00 17.96 ? 257  LEU B CB  1 
ATOM   5312  C  CG  . LEU B 2  257 ? 64.358  78.329  71.422  1.00 21.58 ? 257  LEU B CG  1 
ATOM   5313  C  CD1 . LEU B 2  257 ? 63.500  78.169  70.169  1.00 17.43 ? 257  LEU B CD1 1 
ATOM   5314  C  CD2 . LEU B 2  257 ? 65.823  78.675  71.087  1.00 11.84 ? 257  LEU B CD2 1 
ATOM   5315  N  N   . VAL B 2  258 ? 64.935  82.131  72.181  1.00 17.71 ? 258  VAL B N   1 
ATOM   5316  C  CA  . VAL B 2  258 ? 65.002  83.547  71.848  1.00 17.22 ? 258  VAL B CA  1 
ATOM   5317  C  C   . VAL B 2  258 ? 65.850  83.764  70.581  1.00 16.14 ? 258  VAL B C   1 
ATOM   5318  O  O   . VAL B 2  258 ? 66.688  82.927  70.259  1.00 15.09 ? 258  VAL B O   1 
ATOM   5319  C  CB  . VAL B 2  258 ? 65.486  84.334  73.122  1.00 17.76 ? 258  VAL B CB  1 
ATOM   5320  C  CG1 . VAL B 2  258 ? 66.786  85.068  72.973  1.00 26.85 ? 258  VAL B CG1 1 
ATOM   5321  C  CG2 . VAL B 2  258 ? 64.358  85.134  73.758  1.00 23.76 ? 258  VAL B CG2 1 
ATOM   5322  N  N   . ALA B 2  259 ? 65.539  84.831  69.827  1.00 16.15 ? 259  ALA B N   1 
ATOM   5323  C  CA  . ALA B 2  259 ? 66.465  85.445  68.865  1.00 15.76 ? 259  ALA B CA  1 
ATOM   5324  C  C   . ALA B 2  259 ? 66.529  86.962  69.033  1.00 17.30 ? 259  ALA B C   1 
ATOM   5325  O  O   . ALA B 2  259 ? 65.668  87.551  69.724  1.00 17.54 ? 259  ALA B O   1 
ATOM   5326  C  CB  . ALA B 2  259 ? 66.075  85.035  67.391  1.00 14.74 ? 259  ALA B CB  1 
ATOM   5327  N  N   . GLU B 2  260 ? 67.604  87.575  68.500  1.00 18.30 ? 260  GLU B N   1 
ATOM   5328  C  CA  . GLU B 2  260 ? 67.721  89.029  68.352  1.00 18.78 ? 260  GLU B CA  1 
ATOM   5329  C  C   . GLU B 2  260 ? 66.603  89.642  67.552  1.00 19.91 ? 260  GLU B C   1 
ATOM   5330  O  O   . GLU B 2  260 ? 66.270  89.163  66.462  1.00 20.40 ? 260  GLU B O   1 
ATOM   5331  C  CB  . GLU B 2  260 ? 69.082  89.465  67.803  1.00 19.42 ? 260  GLU B CB  1 
ATOM   5332  C  CG  . GLU B 2  260 ? 69.452  90.910  68.214  1.00 18.42 ? 260  GLU B CG  1 
ATOM   5333  C  CD  . GLU B 2  260 ? 70.807  91.420  67.718  1.00 26.72 ? 260  GLU B CD  1 
ATOM   5334  O  OE1 . GLU B 2  260 ? 71.384  92.287  68.418  1.00 35.80 ? 260  GLU B OE1 1 
ATOM   5335  O  OE2 . GLU B 2  260 ? 71.317  90.982  66.662  1.00 20.34 ? 260  GLU B OE2 1 
ATOM   5336  N  N   . SER B 2  261 ? 65.964  90.635  68.169  1.00 20.78 ? 261  SER B N   1 
ATOM   5337  C  CA  . SER B 2  261 ? 64.757  91.250  67.656  1.00 22.10 ? 261  SER B CA  1 
ATOM   5338  C  C   . SER B 2  261 ? 65.027  92.715  67.243  1.00 23.64 ? 261  SER B C   1 
ATOM   5339  O  O   . SER B 2  261 ? 65.783  92.957  66.267  1.00 25.08 ? 261  SER B O   1 
ATOM   5340  C  CB  . SER B 2  261 ? 63.593  91.056  68.654  1.00 22.12 ? 261  SER B CB  1 
ATOM   5341  O  OG  . SER B 2  261 ? 63.833  91.678  69.896  1.00 23.13 ? 261  SER B OG  1 
ATOM   5342  N  N   . ALA B 2  262 ? 64.483  93.677  67.994  1.00 23.44 ? 262  ALA B N   1 
ATOM   5343  C  CA  . ALA B 2  262 ? 64.624  95.107  67.691  1.00 23.37 ? 262  ALA B CA  1 
ATOM   5344  C  C   . ALA B 2  262 ? 64.866  95.928  68.946  1.00 23.22 ? 262  ALA B C   1 
ATOM   5345  O  O   . ALA B 2  262 ? 64.354  95.584  70.031  1.00 22.96 ? 262  ALA B O   1 
ATOM   5346  C  CB  . ALA B 2  262 ? 63.413  95.597  66.968  1.00 23.31 ? 262  ALA B CB  1 
ATOM   5347  N  N   . ALA B 2  263 ? 65.757  96.919  68.806  1.00 23.93 ? 263  ALA B N   1 
ATOM   5348  C  CA  . ALA B 2  263 ? 65.976  97.996  69.789  1.00 24.34 ? 263  ALA B CA  1 
ATOM   5349  C  C   . ALA B 2  263 ? 64.728  98.836  70.032  1.00 26.12 ? 263  ALA B C   1 
ATOM   5350  O  O   . ALA B 2  263 ? 63.905  99.018  69.123  1.00 26.68 ? 263  ALA B O   1 
ATOM   5351  C  CB  . ALA B 2  263 ? 67.144  98.874  69.393  1.00 22.88 ? 263  ALA B CB  1 
ATOM   5352  N  N   . ILE B 2  264 ? 64.514  99.169  71.305  1.00 27.28 ? 264  ILE B N   1 
ATOM   5353  C  CA  . ILE B 2  264 ? 63.413  100.018 71.763  1.00 29.04 ? 264  ILE B CA  1 
ATOM   5354  C  C   . ILE B 2  264 ? 63.355  101.397 71.035  1.00 30.38 ? 264  ILE B C   1 
ATOM   5355  O  O   . ILE B 2  264 ? 64.411  101.974 70.636  1.00 30.36 ? 264  ILE B O   1 
ATOM   5356  C  CB  . ILE B 2  264 ? 63.440  100.114 73.346  1.00 29.63 ? 264  ILE B CB  1 
ATOM   5357  C  CG1 . ILE B 2  264 ? 62.017  100.190 73.937  1.00 40.81 ? 264  ILE B CG1 1 
ATOM   5358  C  CG2 . ILE B 2  264 ? 64.440  101.194 73.875  1.00 24.86 ? 264  ILE B CG2 1 
ATOM   5359  C  CD1 . ILE B 2  264 ? 61.852  99.568  75.354  1.00 33.37 ? 264  ILE B CD1 1 
ATOM   5360  N  N   . GLY B 2  265 ? 62.137  101.795 70.673  1.00 31.26 ? 265  GLY B N   1 
ATOM   5361  C  CA  . GLY B 2  265 ? 61.930  103.046 69.942  1.00 31.57 ? 265  GLY B CA  1 
ATOM   5362  C  C   . GLY B 2  265 ? 61.911  102.947 68.422  1.00 31.72 ? 265  GLY B C   1 
ATOM   5363  O  O   . GLY B 2  265 ? 61.346  103.835 67.782  1.00 32.43 ? 265  GLY B O   1 
ATOM   5364  N  N   . SER B 2  266 ? 62.578  101.932 67.840  1.00 30.80 ? 266  SER B N   1 
ATOM   5365  C  CA  . SER B 2  266 ? 62.352  101.538 66.430  1.00 29.46 ? 266  SER B CA  1 
ATOM   5366  C  C   . SER B 2  266 ? 60.926  101.050 66.190  1.00 28.75 ? 266  SER B C   1 
ATOM   5367  O  O   . SER B 2  266 ? 60.309  100.477 67.099  1.00 29.32 ? 266  SER B O   1 
ATOM   5368  C  CB  . SER B 2  266 ? 63.380  100.511 65.949  1.00 28.82 ? 266  SER B CB  1 
ATOM   5369  O  OG  . SER B 2  266 ? 63.103  99.232  66.459  1.00 23.17 ? 266  SER B OG  1 
ATOM   5370  N  N   . ALA B 2  267 ? 60.387  101.370 65.005  1.00 27.47 ? 267  ALA B N   1 
ATOM   5371  C  CA  . ALA B 2  267 ? 59.106  100.816 64.515  1.00 26.26 ? 267  ALA B CA  1 
ATOM   5372  C  C   . ALA B 2  267 ? 59.009  99.267  64.533  1.00 25.01 ? 267  ALA B C   1 
ATOM   5373  O  O   . ALA B 2  267 ? 57.934  98.730  64.787  1.00 25.15 ? 267  ALA B O   1 
ATOM   5374  C  CB  . ALA B 2  267 ? 58.764  101.370 63.123  1.00 25.80 ? 267  ALA B CB  1 
ATOM   5375  N  N   . GLU B 2  268 ? 60.127  98.593  64.247  1.00 24.03 ? 268  GLU B N   1 
ATOM   5376  C  CA  . GLU B 2  268 ? 60.273  97.134  64.326  1.00 23.93 ? 268  GLU B CA  1 
ATOM   5377  C  C   . GLU B 2  268 ? 59.961  96.530  65.713  1.00 24.28 ? 268  GLU B C   1 
ATOM   5378  O  O   . GLU B 2  268 ? 59.332  95.463  65.786  1.00 25.39 ? 268  GLU B O   1 
ATOM   5379  C  CB  . GLU B 2  268 ? 61.677  96.745  63.889  1.00 24.01 ? 268  GLU B CB  1 
ATOM   5380  C  CG  . GLU B 2  268 ? 61.779  95.437  63.134  1.00 22.25 ? 268  GLU B CG  1 
ATOM   5381  C  CD  . GLU B 2  268 ? 63.202  94.881  63.044  1.00 31.52 ? 268  GLU B CD  1 
ATOM   5382  O  OE1 . GLU B 2  268 ? 63.345  93.634  62.941  1.00 27.87 ? 268  GLU B OE1 1 
ATOM   5383  O  OE2 . GLU B 2  268 ? 64.182  95.668  63.016  1.00 37.96 ? 268  GLU B OE2 1 
ATOM   5384  N  N   . ALA B 2  269 ? 60.358  97.232  66.790  1.00 23.02 ? 269  ALA B N   1 
ATOM   5385  C  CA  . ALA B 2  269 ? 59.988  96.881  68.182  1.00 21.99 ? 269  ALA B CA  1 
ATOM   5386  C  C   . ALA B 2  269 ? 58.493  96.757  68.424  1.00 21.49 ? 269  ALA B C   1 
ATOM   5387  O  O   . ALA B 2  269 ? 58.061  95.867  69.175  1.00 20.69 ? 269  ALA B O   1 
ATOM   5388  C  CB  . ALA B 2  269 ? 60.618  97.848  69.196  1.00 21.16 ? 269  ALA B CB  1 
ATOM   5389  N  N   . ASN B 2  270 ? 57.728  97.691  67.836  1.00 22.02 ? 270  ASN B N   1 
ATOM   5390  C  CA  . ASN B 2  270 ? 56.259  97.645  67.813  1.00 22.15 ? 270  ASN B CA  1 
ATOM   5391  C  C   . ASN B 2  270 ? 55.682  96.411  67.117  1.00 22.21 ? 270  ASN B C   1 
ATOM   5392  O  O   . ASN B 2  270 ? 54.707  95.855  67.613  1.00 23.21 ? 270  ASN B O   1 
ATOM   5393  C  CB  . ASN B 2  270 ? 55.636  98.924  67.227  1.00 22.07 ? 270  ASN B CB  1 
ATOM   5394  C  CG  . ASN B 2  270 ? 56.086  100.209 67.935  1.00 24.43 ? 270  ASN B CG  1 
ATOM   5395  O  OD1 . ASN B 2  270 ? 56.542  101.142 67.270  1.00 32.75 ? 270  ASN B OD1 1 
ATOM   5396  N  ND2 . ASN B 2  270 ? 55.727  100.351 69.199  1.00 23.22 ? 270  ASN B ND2 1 
ATOM   5397  N  N   . ALA B 2  271 ? 56.303  95.974  66.006  1.00 21.34 ? 271  ALA B N   1 
ATOM   5398  C  CA  . ALA B 2  271 ? 55.940  94.706  65.342  1.00 21.14 ? 271  ALA B CA  1 
ATOM   5399  C  C   . ALA B 2  271 ? 56.154  93.475  66.223  1.00 21.15 ? 271  ALA B C   1 
ATOM   5400  O  O   . ALA B 2  271 ? 55.256  92.588  66.299  1.00 21.07 ? 271  ALA B O   1 
ATOM   5401  C  CB  . ALA B 2  271 ? 56.642  94.554  64.018  1.00 21.10 ? 271  ALA B CB  1 
ATOM   5402  N  N   . PHE B 2  272 ? 57.278  93.485  66.960  1.00 20.76 ? 272  PHE B N   1 
ATOM   5403  C  CA  . PHE B 2  272 ? 57.591  92.473  67.960  1.00 21.40 ? 272  PHE B CA  1 
ATOM   5404  C  C   . PHE B 2  272 ? 56.625  92.382  69.144  1.00 21.90 ? 272  PHE B C   1 
ATOM   5405  O  O   . PHE B 2  272 ? 56.187  91.279  69.501  1.00 22.22 ? 272  PHE B O   1 
ATOM   5406  C  CB  . PHE B 2  272 ? 59.060  92.552  68.397  1.00 21.11 ? 272  PHE B CB  1 
ATOM   5407  C  CG  . PHE B 2  272 ? 60.017  91.811  67.458  1.00 23.22 ? 272  PHE B CG  1 
ATOM   5408  C  CD1 . PHE B 2  272 ? 60.015  90.385  67.404  1.00 10.77 ? 272  PHE B CD1 1 
ATOM   5409  C  CD2 . PHE B 2  272 ? 60.764  92.527  66.480  1.00 13.18 ? 272  PHE B CD2 1 
ATOM   5410  C  CE1 . PHE B 2  272 ? 60.924  89.663  66.539  1.00 8.57  ? 272  PHE B CE1 1 
ATOM   5411  C  CE2 . PHE B 2  272 ? 61.659  91.843  65.585  1.00 17.66 ? 272  PHE B CE2 1 
ATOM   5412  C  CZ  . PHE B 2  272 ? 61.735  90.378  65.612  1.00 17.52 ? 272  PHE B CZ  1 
ATOM   5413  N  N   . SER B 2  273 ? 56.206  93.548  69.636  1.00 21.94 ? 273  SER B N   1 
ATOM   5414  C  CA  . SER B 2  273 ? 55.192  93.698  70.687  1.00 21.67 ? 273  SER B CA  1 
ATOM   5415  C  C   . SER B 2  273 ? 53.803  93.187  70.302  1.00 21.61 ? 273  SER B C   1 
ATOM   5416  O  O   . SER B 2  273 ? 53.105  92.622  71.147  1.00 22.25 ? 273  SER B O   1 
ATOM   5417  C  CB  . SER B 2  273 ? 55.121  95.152  71.143  1.00 21.69 ? 273  SER B CB  1 
ATOM   5418  O  OG  . SER B 2  273 ? 56.379  95.575  71.630  1.00 18.00 ? 273  SER B OG  1 
ATOM   5419  N  N   . VAL B 2  274 ? 53.411  93.398  69.040  1.00 21.32 ? 274  VAL B N   1 
ATOM   5420  C  CA  . VAL B 2  274 ? 52.144  92.869  68.479  1.00 20.72 ? 274  VAL B CA  1 
ATOM   5421  C  C   . VAL B 2  274 ? 52.223  91.345  68.287  1.00 20.91 ? 274  VAL B C   1 
ATOM   5422  O  O   . VAL B 2  274 ? 51.260  90.621  68.621  1.00 21.38 ? 274  VAL B O   1 
ATOM   5423  C  CB  . VAL B 2  274 ? 51.703  93.651  67.186  1.00 20.29 ? 274  VAL B CB  1 
ATOM   5424  C  CG1 . VAL B 2  274 ? 50.454  93.033  66.490  1.00 14.10 ? 274  VAL B CG1 1 
ATOM   5425  C  CG2 . VAL B 2  274 ? 51.386  95.081  67.529  1.00 23.53 ? 274  VAL B CG2 1 
ATOM   5426  N  N   . LEU B 2  275 ? 53.368  90.879  67.770  1.00 20.68 ? 275  LEU B N   1 
ATOM   5427  C  CA  . LEU B 2  275 ? 53.670  89.461  67.599  1.00 21.09 ? 275  LEU B CA  1 
ATOM   5428  C  C   . LEU B 2  275 ? 53.557  88.643  68.884  1.00 21.83 ? 275  LEU B C   1 
ATOM   5429  O  O   . LEU B 2  275 ? 53.041  87.499  68.863  1.00 21.87 ? 275  LEU B O   1 
ATOM   5430  C  CB  . LEU B 2  275 ? 55.049  89.250  66.929  1.00 20.89 ? 275  LEU B CB  1 
ATOM   5431  C  CG  . LEU B 2  275 ? 55.551  87.805  66.692  1.00 19.14 ? 275  LEU B CG  1 
ATOM   5432  C  CD1 . LEU B 2  275 ? 54.644  86.976  65.749  1.00 16.41 ? 275  LEU B CD1 1 
ATOM   5433  C  CD2 . LEU B 2  275 ? 56.976  87.806  66.255  1.00 11.91 ? 275  LEU B CD2 1 
ATOM   5434  N  N   . GLN B 2  276 ? 54.140  89.201  69.951  1.00 21.37 ? 276  GLN B N   1 
ATOM   5435  C  CA  . GLN B 2  276 ? 53.937  88.791  71.326  1.00 21.09 ? 276  GLN B CA  1 
ATOM   5436  C  C   . GLN B 2  276 ? 52.469  88.532  71.724  1.00 20.85 ? 276  GLN B C   1 
ATOM   5437  O  O   . GLN B 2  276 ? 52.175  87.479  72.286  1.00 21.47 ? 276  GLN B O   1 
ATOM   5438  C  CB  . GLN B 2  276 ? 54.629  89.796  72.251  1.00 21.44 ? 276  GLN B CB  1 
ATOM   5439  C  CG  . GLN B 2  276 ? 54.619  89.450  73.746  1.00 19.65 ? 276  GLN B CG  1 
ATOM   5440  C  CD  . GLN B 2  276 ? 54.941  90.624  74.645  1.00 25.82 ? 276  GLN B CD  1 
ATOM   5441  O  OE1 . GLN B 2  276 ? 55.561  90.431  75.672  1.00 38.72 ? 276  GLN B OE1 1 
ATOM   5442  N  NE2 . GLN B 2  276 ? 54.413  91.822  74.327  1.00 40.51 ? 276  GLN B NE2 1 
ATOM   5443  N  N   . HIS B 2  277 ? 51.561  89.431  71.353  1.00 20.29 ? 277  HIS B N   1 
ATOM   5444  C  CA  . HIS B 2  277 ? 50.144  89.287  71.698  1.00 20.19 ? 277  HIS B CA  1 
ATOM   5445  C  C   . HIS B 2  277 ? 49.322  88.377  70.772  1.00 21.16 ? 277  HIS B C   1 
ATOM   5446  O  O   . HIS B 2  277 ? 48.233  87.927  71.158  1.00 21.57 ? 277  HIS B O   1 
ATOM   5447  C  CB  . HIS B 2  277 ? 49.494  90.648  71.906  1.00 19.47 ? 277  HIS B CB  1 
ATOM   5448  C  CG  . HIS B 2  277 ? 49.880  91.294  73.195  1.00 17.31 ? 277  HIS B CG  1 
ATOM   5449  N  ND1 . HIS B 2  277 ? 51.065  91.979  73.353  1.00 24.93 ? 277  HIS B ND1 1 
ATOM   5450  C  CD2 . HIS B 2  277 ? 49.319  91.232  74.424  1.00 21.14 ? 277  HIS B CD2 1 
ATOM   5451  C  CE1 . HIS B 2  277 ? 51.163  92.403  74.599  1.00 18.94 ? 277  HIS B CE1 1 
ATOM   5452  N  NE2 . HIS B 2  277 ? 50.133  91.937  75.276  1.00 24.63 ? 277  HIS B NE2 1 
ATOM   5453  N  N   . VAL B 2  278 ? 49.801  88.190  69.530  1.00 21.65 ? 278  VAL B N   1 
ATOM   5454  C  CA  . VAL B 2  278 ? 49.317  87.138  68.618  1.00 21.92 ? 278  VAL B CA  1 
ATOM   5455  C  C   . VAL B 2  278 ? 49.596  85.775  69.264  1.00 22.46 ? 278  VAL B C   1 
ATOM   5456  O  O   . VAL B 2  278 ? 48.652  85.034  69.577  1.00 22.56 ? 278  VAL B O   1 
ATOM   5457  C  CB  . VAL B 2  278 ? 49.963  87.208  67.162  1.00 21.75 ? 278  VAL B CB  1 
ATOM   5458  C  CG1 . VAL B 2  278 ? 49.500  86.002  66.300  1.00 16.12 ? 278  VAL B CG1 1 
ATOM   5459  C  CG2 . VAL B 2  278 ? 49.611  88.500  66.449  1.00 19.22 ? 278  VAL B CG2 1 
ATOM   5460  N  N   . LEU B 2  279 ? 50.871  85.578  69.621  1.00 22.61 ? 279  LEU B N   1 
ATOM   5461  C  CA  . LEU B 2  279 ? 51.389  84.338  70.153  1.00 23.01 ? 279  LEU B CA  1 
ATOM   5462  C  C   . LEU B 2  279 ? 50.901  84.039  71.567  1.00 23.20 ? 279  LEU B C   1 
ATOM   5463  O  O   . LEU B 2  279 ? 50.337  82.961  71.801  1.00 23.40 ? 279  LEU B O   1 
ATOM   5464  C  CB  . LEU B 2  279 ? 52.918  84.305  70.040  1.00 23.02 ? 279  LEU B CB  1 
ATOM   5465  C  CG  . LEU B 2  279 ? 53.537  84.042  68.650  1.00 17.66 ? 279  LEU B CG  1 
ATOM   5466  C  CD1 . LEU B 2  279 ? 55.027  84.286  68.724  1.00 7.98  ? 279  LEU B CD1 1 
ATOM   5467  C  CD2 . LEU B 2  279 ? 53.268  82.597  68.136  1.00 6.23  ? 279  LEU B CD2 1 
ATOM   5468  N  N   . GLY B 2  280 ? 50.862  85.084  72.395  1.00 23.20 ? 280  GLY B N   1 
ATOM   5469  C  CA  . GLY B 2  280 ? 50.214  85.045  73.693  1.00 23.38 ? 280  GLY B CA  1 
ATOM   5470  C  C   . GLY B 2  280 ? 51.183  85.374  74.786  1.00 23.83 ? 280  GLY B C   1 
ATOM   5471  O  O   . GLY B 2  280 ? 52.248  84.760  74.887  1.00 23.34 ? 280  GLY B O   1 
ATOM   5472  N  N   . ALA B 2  281 ? 50.885  86.463  75.487  1.00 25.26 ? 281  ALA B N   1 
ATOM   5473  C  CA  . ALA B 2  281 ? 51.609  86.860  76.697  1.00 26.12 ? 281  ALA B CA  1 
ATOM   5474  C  C   . ALA B 2  281 ? 50.924  86.193  77.911  1.00 27.29 ? 281  ALA B C   1 
ATOM   5475  O  O   . ALA B 2  281 ? 50.677  84.962  77.879  1.00 28.15 ? 281  ALA B O   1 
ATOM   5476  C  CB  . ALA B 2  281 ? 51.677  88.390  76.798  1.00 25.79 ? 281  ALA B CB  1 
ATOM   5477  N  N   . GLY B 2  282 ? 50.593  86.973  78.944  1.00 27.07 ? 282  GLY B N   1 
ATOM   5478  C  CA  . GLY B 2  282 ? 49.935  86.468  80.137  1.00 26.48 ? 282  GLY B CA  1 
ATOM   5479  C  C   . GLY B 2  282 ? 48.469  86.094  79.938  1.00 26.08 ? 282  GLY B C   1 
ATOM   5480  O  O   . GLY B 2  282 ? 47.916  86.388  78.865  1.00 26.09 ? 282  GLY B O   1 
ATOM   5481  N  N   . PRO B 2  283 ? 47.822  85.507  80.971  1.00 25.81 ? 283  PRO B N   1 
ATOM   5482  C  CA  . PRO B 2  283 ? 46.373  85.235  80.922  1.00 25.37 ? 283  PRO B CA  1 
ATOM   5483  C  C   . PRO B 2  283 ? 45.505  86.466  81.177  1.00 24.67 ? 283  PRO B C   1 
ATOM   5484  O  O   . PRO B 2  283 ? 45.919  87.371  81.903  1.00 25.11 ? 283  PRO B O   1 
ATOM   5485  C  CB  . PRO B 2  283 ? 46.170  84.198  82.028  1.00 25.52 ? 283  PRO B CB  1 
ATOM   5486  C  CG  . PRO B 2  283 ? 47.271  84.446  83.009  1.00 27.17 ? 283  PRO B CG  1 
ATOM   5487  C  CD  . PRO B 2  283 ? 48.374  85.195  82.314  1.00 25.78 ? 283  PRO B CD  1 
ATOM   5488  N  N   . HIS B 2  284 ? 44.291  86.441  80.626  1.00 23.96 ? 284  HIS B N   1 
ATOM   5489  C  CA  . HIS B 2  284 ? 43.294  87.495  80.811  1.00 23.09 ? 284  HIS B CA  1 
ATOM   5490  C  C   . HIS B 2  284 ? 42.186  87.071  81.778  1.00 22.47 ? 284  HIS B C   1 
ATOM   5491  O  O   . HIS B 2  284 ? 41.588  87.922  82.433  1.00 22.67 ? 284  HIS B O   1 
ATOM   5492  C  CB  . HIS B 2  284 ? 42.709  87.919  79.459  1.00 23.06 ? 284  HIS B CB  1 
ATOM   5493  C  CG  . HIS B 2  284 ? 43.683  88.638  78.571  1.00 28.12 ? 284  HIS B CG  1 
ATOM   5494  N  ND1 . HIS B 2  284 ? 44.716  87.993  77.921  1.00 32.15 ? 284  HIS B ND1 1 
ATOM   5495  C  CD2 . HIS B 2  284 ? 43.801  89.949  78.250  1.00 18.67 ? 284  HIS B CD2 1 
ATOM   5496  C  CE1 . HIS B 2  284 ? 45.459  88.884  77.291  1.00 27.11 ? 284  HIS B CE1 1 
ATOM   5497  N  NE2 . HIS B 2  284 ? 44.911  90.074  77.454  1.00 24.98 ? 284  HIS B NE2 1 
ATOM   5498  N  N   . VAL B 2  285 ? 41.953  85.755  81.891  1.00 21.23 ? 285  VAL B N   1 
ATOM   5499  C  CA  . VAL B 2  285 ? 40.816  85.190  82.647  1.00 20.50 ? 285  VAL B CA  1 
ATOM   5500  C  C   . VAL B 2  285 ? 41.360  84.316  83.786  1.00 20.40 ? 285  VAL B C   1 
ATOM   5501  O  O   . VAL B 2  285 ? 42.321  83.555  83.573  1.00 21.16 ? 285  VAL B O   1 
ATOM   5502  C  CB  . VAL B 2  285 ? 39.806  84.398  81.708  1.00 19.98 ? 285  VAL B CB  1 
ATOM   5503  C  CG1 . VAL B 2  285 ? 38.534  83.954  82.473  1.00 10.74 ? 285  VAL B CG1 1 
ATOM   5504  C  CG2 . VAL B 2  285 ? 39.386  85.269  80.484  1.00 19.02 ? 285  VAL B CG2 1 
ATOM   5505  N  N   . LYS B 2  286 ? 40.822  84.504  85.002  1.00 19.51 ? 286  LYS B N   1 
ATOM   5506  C  CA  . LYS B 2  286 ? 41.148  83.630  86.131  1.00 19.18 ? 286  LYS B CA  1 
ATOM   5507  C  C   . LYS B 2  286 ? 40.646  82.226  85.892  1.00 19.52 ? 286  LYS B C   1 
ATOM   5508  O  O   . LYS B 2  286 ? 39.445  82.007  85.685  1.00 19.45 ? 286  LYS B O   1 
ATOM   5509  C  CB  . LYS B 2  286 ? 40.709  84.180  87.490  1.00 18.78 ? 286  LYS B CB  1 
ATOM   5510  C  CG  . LYS B 2  286 ? 41.440  83.508  88.676  1.00 2.02  ? 286  LYS B CG  1 
ATOM   5511  C  CD  . LYS B 2  286 ? 40.631  83.590  89.946  1.00 6.75  ? 286  LYS B CD  1 
ATOM   5512  C  CE  . LYS B 2  286 ? 41.541  83.663  91.157  1.00 5.90  ? 286  LYS B CE  1 
ATOM   5513  N  NZ  . LYS B 2  286 ? 40.785  83.796  92.447  1.00 2.00  ? 286  LYS B NZ  1 
ATOM   5514  N  N   . ARG B 2  287 ? 41.635  81.371  85.636  1.00 20.09 ? 287  ARG B N   1 
ATOM   5515  C  CA  . ARG B 2  287 ? 41.507  79.924  85.396  1.00 20.40 ? 287  ARG B CA  1 
ATOM   5516  C  C   . ARG B 2  287 ? 41.067  79.497  83.979  1.00 21.07 ? 287  ARG B C   1 
ATOM   5517  O  O   . ARG B 2  287 ? 40.936  78.288  83.717  1.00 21.24 ? 287  ARG B O   1 
ATOM   5518  C  CB  . ARG B 2  287 ? 40.805  79.168  86.547  1.00 20.21 ? 287  ARG B CB  1 
ATOM   5519  C  CG  . ARG B 2  287 ? 41.641  79.074  87.802  1.00 15.66 ? 287  ARG B CG  1 
ATOM   5520  C  CD  . ARG B 2  287 ? 41.023  78.234  88.876  1.00 15.55 ? 287  ARG B CD  1 
ATOM   5521  N  NE  . ARG B 2  287 ? 40.118  79.042  89.697  1.00 26.94 ? 287  ARG B NE  1 
ATOM   5522  C  CZ  . ARG B 2  287 ? 40.313  79.402  90.972  1.00 24.66 ? 287  ARG B CZ  1 
ATOM   5523  N  NH1 . ARG B 2  287 ? 41.264  78.855  91.735  1.00 23.08 ? 287  ARG B NH1 1 
ATOM   5524  N  NH2 . ARG B 2  287 ? 39.420  80.174  91.539  1.00 17.86 ? 287  ARG B NH2 1 
ATOM   5525  N  N   . GLY B 2  288 ? 41.149  80.456  83.035  1.00 21.13 ? 288  GLY B N   1 
ATOM   5526  C  CA  . GLY B 2  288 ? 40.745  80.273  81.642  1.00 21.51 ? 288  GLY B CA  1 
ATOM   5527  C  C   . GLY B 2  288 ? 41.643  79.359  80.814  1.00 22.07 ? 288  GLY B C   1 
ATOM   5528  O  O   . GLY B 2  288 ? 42.855  79.232  81.095  1.00 21.48 ? 288  GLY B O   1 
ATOM   5529  N  N   . SER B 2  289 ? 41.060  78.824  79.730  1.00 23.36 ? 289  SER B N   1 
ATOM   5530  C  CA  . SER B 2  289 ? 41.747  77.951  78.749  1.00 24.88 ? 289  SER B CA  1 
ATOM   5531  C  C   . SER B 2  289 ? 42.682  78.673  77.735  1.00 26.17 ? 289  SER B C   1 
ATOM   5532  O  O   . SER B 2  289 ? 43.456  78.007  77.028  1.00 26.39 ? 289  SER B O   1 
ATOM   5533  C  CB  . SER B 2  289 ? 40.735  77.037  78.036  1.00 24.87 ? 289  SER B CB  1 
ATOM   5534  O  OG  . SER B 2  289 ? 39.997  77.733  77.039  1.00 26.00 ? 289  SER B OG  1 
ATOM   5535  N  N   . ASN B 2  290 ? 42.737  80.011  77.830  1.00 27.29 ? 290  ASN B N   1 
ATOM   5536  C  CA  . ASN B 2  290 ? 43.527  80.910  76.950  1.00 28.62 ? 290  ASN B CA  1 
ATOM   5537  C  C   . ASN B 2  290 ? 43.260  80.684  75.439  1.00 29.23 ? 290  ASN B C   1 
ATOM   5538  O  O   . ASN B 2  290 ? 44.179  80.321  74.664  1.00 29.56 ? 290  ASN B O   1 
ATOM   5539  C  CB  . ASN B 2  290 ? 45.046  80.937  77.307  1.00 29.31 ? 290  ASN B CB  1 
ATOM   5540  C  CG  . ASN B 2  290 ? 45.321  80.648  78.773  1.00 30.82 ? 290  ASN B CG  1 
ATOM   5541  O  OD1 . ASN B 2  290 ? 45.281  81.544  79.608  1.00 35.23 ? 290  ASN B OD1 1 
ATOM   5542  N  ND2 . ASN B 2  290 ? 45.535  79.375  79.097  1.00 35.54 ? 290  ASN B ND2 1 
ATOM   5543  N  N   . ALA B 2  291 ? 41.966  80.786  75.083  1.00 28.99 ? 291  ALA B N   1 
ATOM   5544  C  CA  . ALA B 2  291 ? 41.416  80.420  73.761  1.00 28.63 ? 291  ALA B CA  1 
ATOM   5545  C  C   . ALA B 2  291 ? 42.051  81.165  72.572  1.00 28.18 ? 291  ALA B C   1 
ATOM   5546  O  O   . ALA B 2  291 ? 42.445  80.516  71.583  1.00 28.13 ? 291  ALA B O   1 
ATOM   5547  C  CB  . ALA B 2  291 ? 39.898  80.579  73.752  1.00 28.72 ? 291  ALA B CB  1 
ATOM   5548  N  N   . THR B 2  292 ? 42.337  82.463  72.779  1.00 27.20 ? 292  THR B N   1 
ATOM   5549  C  CA  . THR B 2  292 ? 42.914  83.352  71.745  1.00 26.78 ? 292  THR B CA  1 
ATOM   5550  C  C   . THR B 2  292 ? 44.461  83.420  71.796  1.00 26.09 ? 292  THR B C   1 
ATOM   5551  O  O   . THR B 2  292 ? 45.085  84.280  71.121  1.00 26.09 ? 292  THR B O   1 
ATOM   5552  C  CB  . THR B 2  292 ? 42.298  84.810  71.795  1.00 27.00 ? 292  THR B CB  1 
ATOM   5553  O  OG1 . THR B 2  292 ? 42.771  85.490  72.960  1.00 29.92 ? 292  THR B OG1 1 
ATOM   5554  C  CG2 . THR B 2  292 ? 40.758  84.816  71.940  1.00 24.05 ? 292  THR B CG2 1 
ATOM   5555  N  N   . SER B 2  293 ? 45.060  82.576  72.643  1.00 25.11 ? 293  SER B N   1 
ATOM   5556  C  CA  . SER B 2  293 ? 46.511  82.453  72.729  1.00 24.04 ? 293  SER B CA  1 
ATOM   5557  C  C   . SER B 2  293 ? 46.983  81.353  71.790  1.00 23.23 ? 293  SER B C   1 
ATOM   5558  O  O   . SER B 2  293 ? 46.737  80.158  72.029  1.00 22.76 ? 293  SER B O   1 
ATOM   5559  C  CB  . SER B 2  293 ? 46.983  82.227  74.170  1.00 23.98 ? 293  SER B CB  1 
ATOM   5560  O  OG  . SER B 2  293 ? 48.402  82.212  74.230  1.00 38.69 ? 293  SER B OG  1 
ATOM   5561  N  N   . SER B 2  294 ? 47.634  81.796  70.711  1.00 22.54 ? 294  SER B N   1 
ATOM   5562  C  CA  . SER B 2  294 ? 48.177  80.943  69.658  1.00 21.72 ? 294  SER B CA  1 
ATOM   5563  C  C   . SER B 2  294 ? 49.185  79.860  70.104  1.00 20.64 ? 294  SER B C   1 
ATOM   5564  O  O   . SER B 2  294 ? 49.028  78.688  69.715  1.00 20.60 ? 294  SER B O   1 
ATOM   5565  C  CB  . SER B 2  294 ? 48.736  81.791  68.519  1.00 21.51 ? 294  SER B CB  1 
ATOM   5566  O  OG  . SER B 2  294 ? 48.370  81.223  67.286  1.00 42.02 ? 294  SER B OG  1 
ATOM   5567  N  N   . LEU B 2  295 ? 50.158  80.236  70.953  1.00 19.75 ? 295  LEU B N   1 
ATOM   5568  C  CA  . LEU B 2  295 ? 51.157  79.284  71.494  1.00 19.21 ? 295  LEU B CA  1 
ATOM   5569  C  C   . LEU B 2  295 ? 50.545  78.240  72.405  1.00 18.70 ? 295  LEU B C   1 
ATOM   5570  O  O   . LEU B 2  295 ? 50.890  77.055  72.298  1.00 17.96 ? 295  LEU B O   1 
ATOM   5571  C  CB  . LEU B 2  295 ? 52.308  79.980  72.233  1.00 19.00 ? 295  LEU B CB  1 
ATOM   5572  C  CG  . LEU B 2  295 ? 53.361  80.770  71.479  1.00 21.38 ? 295  LEU B CG  1 
ATOM   5573  C  CD1 . LEU B 2  295 ? 54.128  81.645  72.461  1.00 21.15 ? 295  LEU B CD1 1 
ATOM   5574  C  CD2 . LEU B 2  295 ? 54.314  79.883  70.674  1.00 20.92 ? 295  LEU B CD2 1 
ATOM   5575  N  N   . TYR B 2  296 ? 49.610  78.689  73.256  1.00 19.55 ? 296  TYR B N   1 
ATOM   5576  C  CA  . TYR B 2  296 ? 48.968  77.851  74.277  1.00 20.57 ? 296  TYR B CA  1 
ATOM   5577  C  C   . TYR B 2  296 ? 48.149  76.751  73.658  1.00 20.70 ? 296  TYR B C   1 
ATOM   5578  O  O   . TYR B 2  296 ? 48.479  75.582  73.875  1.00 20.84 ? 296  TYR B O   1 
ATOM   5579  C  CB  . TYR B 2  296 ? 48.149  78.675  75.285  1.00 21.07 ? 296  TYR B CB  1 
ATOM   5580  C  CG  . TYR B 2  296 ? 48.022  78.026  76.651  1.00 25.51 ? 296  TYR B CG  1 
ATOM   5581  C  CD1 . TYR B 2  296 ? 48.818  78.475  77.735  1.00 25.27 ? 296  TYR B CD1 1 
ATOM   5582  C  CD2 . TYR B 2  296 ? 47.032  77.029  76.904  1.00 28.90 ? 296  TYR B CD2 1 
ATOM   5583  C  CE1 . TYR B 2  296 ? 48.695  77.880  79.035  1.00 25.01 ? 296  TYR B CE1 1 
ATOM   5584  C  CE2 . TYR B 2  296 ? 46.919  76.403  78.187  1.00 29.38 ? 296  TYR B CE2 1 
ATOM   5585  C  CZ  . TYR B 2  296 ? 47.737  76.854  79.245  1.00 25.38 ? 296  TYR B CZ  1 
ATOM   5586  O  OH  . TYR B 2  296 ? 47.613  76.290  80.491  1.00 27.14 ? 296  TYR B OH  1 
ATOM   5587  N  N   . GLN B 2  297 ? 47.359  77.134  72.644  1.00 21.10 ? 297  GLN B N   1 
ATOM   5588  C  CA  . GLN B 2  297 ? 46.468  76.221  71.911  1.00 20.98 ? 297  GLN B CA  1 
ATOM   5589  C  C   . GLN B 2  297 ? 47.210  75.208  71.056  1.00 20.51 ? 297  GLN B C   1 
ATOM   5590  O  O   . GLN B 2  297 ? 46.848  74.027  71.079  1.00 20.47 ? 297  GLN B O   1 
ATOM   5591  C  CB  . GLN B 2  297 ? 45.431  76.987  71.087  1.00 20.87 ? 297  GLN B CB  1 
ATOM   5592  C  CG  . GLN B 2  297 ? 44.404  77.822  71.913  1.00 26.18 ? 297  GLN B CG  1 
ATOM   5593  C  CD  . GLN B 2  297 ? 43.619  77.029  72.977  1.00 27.09 ? 297  GLN B CD  1 
ATOM   5594  O  OE1 . GLN B 2  297 ? 43.101  75.946  72.706  1.00 25.54 ? 297  GLN B OE1 1 
ATOM   5595  N  NE2 . GLN B 2  297 ? 43.513  77.598  74.176  1.00 28.86 ? 297  GLN B NE2 1 
ATOM   5596  N  N   . ALA B 2  298 ? 48.379  75.618  70.537  1.00 20.17 ? 298  ALA B N   1 
ATOM   5597  C  CA  . ALA B 2  298 ? 49.235  74.750  69.712  1.00 20.24 ? 298  ALA B CA  1 
ATOM   5598  C  C   . ALA B 2  298 ? 49.945  73.654  70.502  1.00 20.58 ? 298  ALA B C   1 
ATOM   5599  O  O   . ALA B 2  298 ? 50.016  72.500  70.036  1.00 20.50 ? 298  ALA B O   1 
ATOM   5600  C  CB  . ALA B 2  298 ? 50.208  75.550  68.929  1.00 20.07 ? 298  ALA B CB  1 
ATOM   5601  N  N   . VAL B 2  299 ? 50.433  74.021  71.695  1.00 20.90 ? 299  VAL B N   1 
ATOM   5602  C  CA  . VAL B 2  299 ? 50.987  73.088  72.685  1.00 21.58 ? 299  VAL B CA  1 
ATOM   5603  C  C   . VAL B 2  299 ? 49.888  72.163  73.259  1.00 22.81 ? 299  VAL B C   1 
ATOM   5604  O  O   . VAL B 2  299 ? 50.085  70.932  73.301  1.00 22.38 ? 299  VAL B O   1 
ATOM   5605  C  CB  . VAL B 2  299 ? 51.830  73.821  73.814  1.00 21.56 ? 299  VAL B CB  1 
ATOM   5606  C  CG1 . VAL B 2  299 ? 52.343  72.826  74.853  1.00 21.06 ? 299  VAL B CG1 1 
ATOM   5607  C  CG2 . VAL B 2  299 ? 53.055  74.597  73.200  1.00 6.25  ? 299  VAL B CG2 1 
ATOM   5608  N  N   . ALA B 2  300 ? 48.723  72.752  73.589  1.00 24.18 ? 300  ALA B N   1 
ATOM   5609  C  CA  . ALA B 2  300 ? 47.575  72.030  74.187  1.00 25.67 ? 300  ALA B CA  1 
ATOM   5610  C  C   . ALA B 2  300 ? 46.981  70.893  73.333  1.00 27.11 ? 300  ALA B C   1 
ATOM   5611  O  O   . ALA B 2  300 ? 46.373  69.962  73.887  1.00 27.59 ? 300  ALA B O   1 
ATOM   5612  C  CB  . ALA B 2  300 ? 46.482  73.014  74.619  1.00 25.57 ? 300  ALA B CB  1 
ATOM   5613  N  N   . LYS B 2  301 ? 47.111  71.027  72.000  1.00 28.19 ? 301  LYS B N   1 
ATOM   5614  C  CA  . LYS B 2  301 ? 46.699  70.039  70.994  1.00 29.33 ? 301  LYS B CA  1 
ATOM   5615  C  C   . LYS B 2  301 ? 47.338  68.649  71.189  1.00 30.37 ? 301  LYS B C   1 
ATOM   5616  O  O   . LYS B 2  301 ? 46.614  67.637  71.278  1.00 30.16 ? 301  LYS B O   1 
ATOM   5617  C  CB  . LYS B 2  301 ? 46.969  70.575  69.580  1.00 29.49 ? 301  LYS B CB  1 
ATOM   5618  C  CG  . LYS B 2  301 ? 45.956  70.139  68.535  1.00 38.17 ? 301  LYS B CG  1 
ATOM   5619  C  CD  . LYS B 2  301 ? 45.594  71.276  67.586  1.00 46.29 ? 301  LYS B CD  1 
ATOM   5620  C  CE  . LYS B 2  301 ? 44.379  70.907  66.726  1.00 57.30 ? 301  LYS B CE  1 
ATOM   5621  N  NZ  . LYS B 2  301 ? 44.722  70.768  65.277  1.00 57.61 ? 301  LYS B NZ  1 
ATOM   5622  N  N   . GLY B 2  302 ? 48.662  68.633  71.388  1.00 31.17 ? 302  GLY B N   1 
ATOM   5623  C  CA  . GLY B 2  302 ? 49.444  67.403  71.475  1.00 31.77 ? 302  GLY B CA  1 
ATOM   5624  C  C   . GLY B 2  302 ? 50.076  67.127  72.831  1.00 32.27 ? 302  GLY B C   1 
ATOM   5625  O  O   . GLY B 2  302 ? 50.869  66.178  72.948  1.00 32.57 ? 302  GLY B O   1 
ATOM   5626  N  N   . VAL B 2  303 ? 49.809  68.005  73.812  1.00 32.12 ? 303  VAL B N   1 
ATOM   5627  C  CA  . VAL B 2  303 ? 50.308  67.873  75.194  1.00 32.04 ? 303  VAL B CA  1 
ATOM   5628  C  C   . VAL B 2  303 ? 49.133  68.016  76.156  1.00 32.73 ? 303  VAL B C   1 
ATOM   5629  O  O   . VAL B 2  303 ? 48.542  69.102  76.302  1.00 32.70 ? 303  VAL B O   1 
ATOM   5630  C  CB  . VAL B 2  303 ? 51.530  68.861  75.524  1.00 31.36 ? 303  VAL B CB  1 
ATOM   5631  C  CG1 . VAL B 2  303 ? 51.917  68.854  77.026  1.00 18.81 ? 303  VAL B CG1 1 
ATOM   5632  C  CG2 . VAL B 2  303 ? 52.766  68.511  74.684  1.00 25.25 ? 303  VAL B CG2 1 
ATOM   5633  N  N   . HIS B 2  304 ? 48.966  66.962  76.945  1.00 33.57 ? 304  HIS B N   1 
ATOM   5634  C  CA  . HIS B 2  304 ? 47.753  66.699  77.729  1.00 34.40 ? 304  HIS B CA  1 
ATOM   5635  C  C   . HIS B 2  304 ? 48.021  66.858  79.239  1.00 34.61 ? 304  HIS B C   1 
ATOM   5636  O  O   . HIS B 2  304 ? 47.073  66.986  80.032  1.00 35.24 ? 304  HIS B O   1 
ATOM   5637  C  CB  . HIS B 2  304 ? 47.190  65.304  77.374  1.00 34.79 ? 304  HIS B CB  1 
ATOM   5638  C  CG  . HIS B 2  304 ? 47.070  65.058  75.891  1.00 50.58 ? 304  HIS B CG  1 
ATOM   5639  N  ND1 . HIS B 2  304 ? 46.175  65.747  75.095  1.00 54.46 ? 304  HIS B ND1 1 
ATOM   5640  C  CD2 . HIS B 2  304 ? 47.869  64.369  75.039  1.00 51.01 ? 304  HIS B CD2 1 
ATOM   5641  C  CE1 . HIS B 2  304 ? 46.360  65.408  73.831  1.00 51.07 ? 304  HIS B CE1 1 
ATOM   5642  N  NE2 . HIS B 2  304 ? 47.390  64.584  73.768  1.00 51.31 ? 304  HIS B NE2 1 
ATOM   5643  N  N   . GLN B 2  305 ? 49.308  67.041  79.572  1.00 33.80 ? 305  GLN B N   1 
ATOM   5644  C  CA  . GLN B 2  305 ? 49.828  67.244  80.934  1.00 32.99 ? 305  GLN B CA  1 
ATOM   5645  C  C   . GLN B 2  305 ? 49.738  68.755  81.331  1.00 31.51 ? 305  GLN B C   1 
ATOM   5646  O  O   . GLN B 2  305 ? 49.440  69.585  80.445  1.00 32.13 ? 305  GLN B O   1 
ATOM   5647  C  CB  . GLN B 2  305 ? 51.282  66.720  81.005  1.00 33.61 ? 305  GLN B CB  1 
ATOM   5648  C  CG  . GLN B 2  305 ? 51.400  65.167  80.998  1.00 47.74 ? 305  GLN B CG  1 
ATOM   5649  C  CD  . GLN B 2  305 ? 51.948  64.595  79.675  1.00 54.60 ? 305  GLN B CD  1 
ATOM   5650  O  OE1 . GLN B 2  305 ? 53.019  63.983  79.666  1.00 59.43 ? 305  GLN B OE1 1 
ATOM   5651  N  NE2 . GLN B 2  305 ? 51.158  64.686  78.597  1.00 50.82 ? 305  GLN B NE2 1 
ATOM   5652  N  N   . PRO B 2  306 ? 49.902  69.113  82.636  1.00 28.93 ? 306  PRO B N   1 
ATOM   5653  C  CA  . PRO B 2  306 ? 50.166  70.522  83.024  1.00 26.36 ? 306  PRO B CA  1 
ATOM   5654  C  C   . PRO B 2  306 ? 51.416  71.169  82.397  1.00 23.84 ? 306  PRO B C   1 
ATOM   5655  O  O   . PRO B 2  306 ? 52.492  70.545  82.327  1.00 22.76 ? 306  PRO B O   1 
ATOM   5656  C  CB  . PRO B 2  306 ? 50.288  70.462  84.560  1.00 26.40 ? 306  PRO B CB  1 
ATOM   5657  C  CG  . PRO B 2  306 ? 50.317  68.984  84.895  1.00 27.69 ? 306  PRO B CG  1 
ATOM   5658  C  CD  . PRO B 2  306 ? 49.535  68.315  83.827  1.00 28.33 ? 306  PRO B CD  1 
ATOM   5659  N  N   . PHE B 2  307 ? 51.200  72.367  81.837  1.00 22.06 ? 307  PHE B N   1 
ATOM   5660  C  CA  . PHE B 2  307 ? 52.242  73.191  81.219  1.00 20.54 ? 307  PHE B CA  1 
ATOM   5661  C  C   . PHE B 2  307 ? 51.906  74.684  81.280  1.00 20.22 ? 307  PHE B C   1 
ATOM   5662  O  O   . PHE B 2  307 ? 50.722  75.064  81.440  1.00 20.47 ? 307  PHE B O   1 
ATOM   5663  C  CB  . PHE B 2  307 ? 52.539  72.743  79.756  1.00 19.99 ? 307  PHE B CB  1 
ATOM   5664  C  CG  . PHE B 2  307 ? 51.431  73.047  78.781  1.00 24.53 ? 307  PHE B CG  1 
ATOM   5665  C  CD1 . PHE B 2  307 ? 51.387  74.296  78.098  1.00 21.04 ? 307  PHE B CD1 1 
ATOM   5666  C  CD2 . PHE B 2  307 ? 50.442  72.072  78.494  1.00 26.30 ? 307  PHE B CD2 1 
ATOM   5667  C  CE1 . PHE B 2  307 ? 50.289  74.635  77.266  1.00 28.49 ? 307  PHE B CE1 1 
ATOM   5668  C  CE2 . PHE B 2  307 ? 49.357  72.372  77.603  1.00 25.57 ? 307  PHE B CE2 1 
ATOM   5669  C  CZ  . PHE B 2  307 ? 49.290  73.660  76.989  1.00 24.48 ? 307  PHE B CZ  1 
ATOM   5670  N  N   . ASP B 2  308 ? 52.919  75.508  80.989  1.00 19.14 ? 308  ASP B N   1 
ATOM   5671  C  CA  . ASP B 2  308 ? 52.716  76.863  80.522  1.00 19.14 ? 308  ASP B CA  1 
ATOM   5672  C  C   . ASP B 2  308 ? 53.577  77.283  79.322  1.00 18.61 ? 308  ASP B C   1 
ATOM   5673  O  O   . ASP B 2  308 ? 54.591  76.619  79.024  1.00 18.70 ? 308  ASP B O   1 
ATOM   5674  C  CB  . ASP B 2  308 ? 52.847  77.844  81.675  1.00 18.90 ? 308  ASP B CB  1 
ATOM   5675  C  CG  . ASP B 2  308 ? 52.044  79.121  81.454  1.00 29.17 ? 308  ASP B CG  1 
ATOM   5676  O  OD1 . ASP B 2  308 ? 52.083  79.996  82.337  1.00 23.24 ? 308  ASP B OD1 1 
ATOM   5677  O  OD2 . ASP B 2  308 ? 51.336  79.342  80.444  1.00 33.93 ? 308  ASP B OD2 1 
ATOM   5678  N  N   . VAL B 2  309 ? 53.027  78.218  78.526  1.00 17.23 ? 309  VAL B N   1 
ATOM   5679  C  CA  . VAL B 2  309 ? 53.761  78.952  77.473  1.00 16.46 ? 309  VAL B CA  1 
ATOM   5680  C  C   . VAL B 2  309 ? 53.441  80.417  77.469  1.00 16.81 ? 309  VAL B C   1 
ATOM   5681  O  O   . VAL B 2  309 ? 52.265  80.798  77.559  1.00 17.30 ? 309  VAL B O   1 
ATOM   5682  C  CB  . VAL B 2  309 ? 53.502  78.478  75.988  1.00 16.37 ? 309  VAL B CB  1 
ATOM   5683  C  CG1 . VAL B 2  309 ? 54.783  78.195  75.292  1.00 8.70  ? 309  VAL B CG1 1 
ATOM   5684  C  CG2 . VAL B 2  309 ? 52.439  77.405  75.819  1.00 9.12  ? 309  VAL B CG2 1 
ATOM   5685  N  N   . SER B 2  310 ? 54.457  81.208  77.122  1.00 17.52 ? 310  SER B N   1 
ATOM   5686  C  CA  . SER B 2  310 ? 54.325  82.640  76.891  1.00 19.66 ? 310  SER B CA  1 
ATOM   5687  C  C   . SER B 2  310 ? 55.329  83.067  75.833  1.00 20.83 ? 310  SER B C   1 
ATOM   5688  O  O   . SER B 2  310 ? 56.525  82.682  75.885  1.00 22.01 ? 310  SER B O   1 
ATOM   5689  C  CB  . SER B 2  310 ? 54.588  83.418  78.195  1.00 19.83 ? 310  SER B CB  1 
ATOM   5690  O  OG  . SER B 2  310 ? 54.444  84.814  78.016  1.00 37.96 ? 310  SER B OG  1 
ATOM   5691  N  N   . ALA B 2  311 ? 54.893  84.010  75.008  1.00 20.04 ? 311  ALA B N   1 
ATOM   5692  C  CA  . ALA B 2  311 ? 55.803  84.879  74.283  1.00 19.82 ? 311  ALA B CA  1 
ATOM   5693  C  C   . ALA B 2  311 ? 56.604  85.795  75.224  1.00 19.62 ? 311  ALA B C   1 
ATOM   5694  O  O   . ALA B 2  311 ? 56.133  86.151  76.323  1.00 19.47 ? 311  ALA B O   1 
ATOM   5695  C  CB  . ALA B 2  311 ? 55.068  85.666  73.197  1.00 19.74 ? 311  ALA B CB  1 
ATOM   5696  N  N   . PHE B 2  312 ? 57.897  85.828  74.937  1.00 19.73 ? 312  PHE B N   1 
ATOM   5697  C  CA  . PHE B 2  312 ? 58.883  86.627  75.646  1.00 20.15 ? 312  PHE B CA  1 
ATOM   5698  C  C   . PHE B 2  312 ? 59.344  87.752  74.720  1.00 20.93 ? 312  PHE B C   1 
ATOM   5699  O  O   . PHE B 2  312 ? 59.724  87.510  73.564  1.00 21.19 ? 312  PHE B O   1 
ATOM   5700  C  CB  . PHE B 2  312 ? 60.056  85.734  76.072  1.00 19.80 ? 312  PHE B CB  1 
ATOM   5701  C  CG  . PHE B 2  312 ? 61.096  86.433  76.899  1.00 15.64 ? 312  PHE B CG  1 
ATOM   5702  C  CD1 . PHE B 2  312 ? 60.978  86.476  78.311  1.00 9.74  ? 312  PHE B CD1 1 
ATOM   5703  C  CD2 . PHE B 2  312 ? 62.276  86.949  76.282  1.00 12.90 ? 312  PHE B CD2 1 
ATOM   5704  C  CE1 . PHE B 2  312 ? 62.000  87.066  79.110  1.00 17.06 ? 312  PHE B CE1 1 
ATOM   5705  C  CE2 . PHE B 2  312 ? 63.287  87.554  77.051  1.00 16.03 ? 312  PHE B CE2 1 
ATOM   5706  C  CZ  . PHE B 2  312 ? 63.153  87.616  78.484  1.00 17.93 ? 312  PHE B CZ  1 
ATOM   5707  N  N   . ASN B 2  313 ? 59.350  88.966  75.270  1.00 21.48 ? 313  ASN B N   1 
ATOM   5708  C  CA  . ASN B 2  313 ? 59.716  90.180  74.563  1.00 21.50 ? 313  ASN B CA  1 
ATOM   5709  C  C   . ASN B 2  313 ? 60.468  91.128  75.490  1.00 21.88 ? 313  ASN B C   1 
ATOM   5710  O  O   . ASN B 2  313 ? 59.928  91.569  76.514  1.00 22.09 ? 313  ASN B O   1 
ATOM   5711  C  CB  . ASN B 2  313 ? 58.464  90.837  73.934  1.00 21.19 ? 313  ASN B CB  1 
ATOM   5712  C  CG  . ASN B 2  313 ? 58.798  91.992  72.967  1.00 15.76 ? 313  ASN B CG  1 
ATOM   5713  O  OD1 . ASN B 2  313 ? 58.306  93.102  73.139  1.00 26.67 ? 313  ASN B OD1 1 
ATOM   5714  N  ND2 . ASN B 2  313 ? 59.489  91.683  71.877  1.00 23.44 ? 313  ASN B ND2 1 
ATOM   5715  N  N   . ALA B 2  314 ? 61.766  91.263  75.214  1.00 22.14 ? 314  ALA B N   1 
ATOM   5716  C  CA  . ALA B 2  314 ? 62.670  92.144  75.944  1.00 22.77 ? 314  ALA B CA  1 
ATOM   5717  C  C   . ALA B 2  314 ? 63.374  93.032  74.942  1.00 23.58 ? 314  ALA B C   1 
ATOM   5718  O  O   . ALA B 2  314 ? 64.037  92.529  74.026  1.00 25.15 ? 314  ALA B O   1 
ATOM   5719  C  CB  . ALA B 2  314 ? 63.678  91.338  76.746  1.00 23.27 ? 314  ALA B CB  1 
ATOM   5720  N  N   . SER B 2  315 ? 63.066  94.326  75.021  1.00 21.91 ? 315  SER B N   1 
ATOM   5721  C  CA  . SER B 2  315 ? 63.637  95.354  74.171  1.00 20.58 ? 315  SER B CA  1 
ATOM   5722  C  C   . SER B 2  315 ? 64.529  96.301  74.965  1.00 19.77 ? 315  SER B C   1 
ATOM   5723  O  O   . SER B 2  315 ? 64.110  96.825  75.999  1.00 19.90 ? 315  SER B O   1 
ATOM   5724  C  CB  . SER B 2  315 ? 62.514  96.136  73.495  1.00 20.35 ? 315  SER B CB  1 
ATOM   5725  O  OG  . SER B 2  315 ? 62.922  96.538  72.212  1.00 32.60 ? 315  SER B OG  1 
ATOM   5726  N  N   . TYR B 2  316 ? 65.672  96.646  74.367  1.00 18.60 ? 316  TYR B N   1 
ATOM   5727  C  CA  . TYR B 2  316 ? 66.744  97.421  75.006  1.00 17.35 ? 316  TYR B CA  1 
ATOM   5728  C  C   . TYR B 2  316 ? 67.191  98.590  74.087  1.00 17.67 ? 316  TYR B C   1 
ATOM   5729  O  O   . TYR B 2  316 ? 66.674  98.741  72.971  1.00 17.84 ? 316  TYR B O   1 
ATOM   5730  C  CB  . TYR B 2  316 ? 67.941  96.488  75.345  1.00 16.27 ? 316  TYR B CB  1 
ATOM   5731  C  CG  . TYR B 2  316 ? 67.605  95.346  76.273  1.00 19.21 ? 316  TYR B CG  1 
ATOM   5732  C  CD1 . TYR B 2  316 ? 67.476  94.007  75.774  1.00 8.85  ? 316  TYR B CD1 1 
ATOM   5733  C  CD2 . TYR B 2  316 ? 67.271  95.593  77.627  1.00 17.06 ? 316  TYR B CD2 1 
ATOM   5734  C  CE1 . TYR B 2  316 ? 67.165  92.955  76.646  1.00 12.20 ? 316  TYR B CE1 1 
ATOM   5735  C  CE2 . TYR B 2  316 ? 66.901  94.545  78.488  1.00 10.65 ? 316  TYR B CE2 1 
ATOM   5736  C  CZ  . TYR B 2  316 ? 66.875  93.238  78.003  1.00 17.69 ? 316  TYR B CZ  1 
ATOM   5737  O  OH  . TYR B 2  316 ? 66.529  92.230  78.863  1.00 24.86 ? 316  TYR B OH  1 
ATOM   5738  N  N   . SER B 2  317 ? 68.187  99.364  74.536  1.00 17.28 ? 317  SER B N   1 
ATOM   5739  C  CA  . SER B 2  317 ? 68.644  100.582 73.834  1.00 17.12 ? 317  SER B CA  1 
ATOM   5740  C  C   . SER B 2  317 ? 69.241  100.301 72.444  1.00 17.62 ? 317  SER B C   1 
ATOM   5741  O  O   . SER B 2  317 ? 69.067  101.117 71.531  1.00 17.73 ? 317  SER B O   1 
ATOM   5742  C  CB  . SER B 2  317 ? 69.650  101.341 74.687  1.00 16.18 ? 317  SER B CB  1 
ATOM   5743  O  OG  . SER B 2  317 ? 70.761  100.508 74.995  1.00 21.41 ? 317  SER B OG  1 
ATOM   5744  N  N   . ASP B 2  318 ? 69.798  99.087  72.266  1.00 16.91 ? 318  ASP B N   1 
ATOM   5745  C  CA  . ASP B 2  318 ? 70.677  98.742  71.122  1.00 16.43 ? 318  ASP B CA  1 
ATOM   5746  C  C   . ASP B 2  318 ? 70.533  97.270  70.670  1.00 17.51 ? 318  ASP B C   1 
ATOM   5747  O  O   . ASP B 2  318 ? 71.327  96.769  69.843  1.00 17.85 ? 318  ASP B O   1 
ATOM   5748  C  CB  . ASP B 2  318 ? 72.146  99.100  71.444  1.00 15.83 ? 318  ASP B CB  1 
ATOM   5749  C  CG  . ASP B 2  318 ? 72.695  98.391  72.705  1.00 17.55 ? 318  ASP B CG  1 
ATOM   5750  O  OD1 . ASP B 2  318 ? 73.942  98.438  72.926  1.00 14.36 ? 318  ASP B OD1 1 
ATOM   5751  O  OD2 . ASP B 2  318 ? 71.994  97.716  73.492  1.00 21.63 ? 318  ASP B OD2 1 
ATOM   5752  N  N   . SER B 2  319 ? 69.637  96.552  71.357  1.00 17.88 ? 319  SER B N   1 
ATOM   5753  C  CA  . SER B 2  319 ? 69.295  95.170  71.053  1.00 19.03 ? 319  SER B CA  1 
ATOM   5754  C  C   . SER B 2  319 ? 67.912  94.821  71.590  1.00 19.78 ? 319  SER B C   1 
ATOM   5755  O  O   . SER B 2  319 ? 67.189  95.693  72.118  1.00 20.40 ? 319  SER B O   1 
ATOM   5756  C  CB  . SER B 2  319 ? 70.369  94.204  71.600  1.00 18.97 ? 319  SER B CB  1 
ATOM   5757  O  OG  . SER B 2  319 ? 70.198  92.928  71.042  1.00 27.59 ? 319  SER B OG  1 
ATOM   5758  N  N   . GLY B 2  320 ? 67.464  93.632  71.216  1.00 19.64 ? 320  GLY B N   1 
ATOM   5759  C  CA  . GLY B 2  320 ? 66.270  93.025  71.759  1.00 20.11 ? 320  GLY B CA  1 
ATOM   5760  C  C   . GLY B 2  320 ? 66.379  91.521  71.722  1.00 20.81 ? 320  GLY B C   1 
ATOM   5761  O  O   . GLY B 2  320 ? 67.197  90.967  70.965  1.00 21.80 ? 320  GLY B O   1 
ATOM   5762  N  N   . LEU B 2  321 ? 65.595  90.875  72.580  1.00 19.99 ? 321  LEU B N   1 
ATOM   5763  C  CA  . LEU B 2  321 ? 65.350  89.439  72.540  1.00 18.58 ? 321  LEU B CA  1 
ATOM   5764  C  C   . LEU B 2  321 ? 63.869  89.145  72.445  1.00 18.39 ? 321  LEU B C   1 
ATOM   5765  O  O   . LEU B 2  321 ? 63.077  89.718  73.199  1.00 19.41 ? 321  LEU B O   1 
ATOM   5766  C  CB  . LEU B 2  321 ? 65.940  88.741  73.772  1.00 18.13 ? 321  LEU B CB  1 
ATOM   5767  C  CG  . LEU B 2  321 ? 67.402  88.899  74.203  1.00 10.71 ? 321  LEU B CG  1 
ATOM   5768  C  CD1 . LEU B 2  321 ? 67.610  88.156  75.521  1.00 7.89  ? 321  LEU B CD1 1 
ATOM   5769  C  CD2 . LEU B 2  321 ? 68.397  88.441  73.132  1.00 12.46 ? 321  LEU B CD2 1 
ATOM   5770  N  N   . PHE B 2  322 ? 63.507  88.325  71.449  1.00 17.46 ? 322  PHE B N   1 
ATOM   5771  C  CA  . PHE B 2  322 ? 62.152  87.794  71.281  1.00 16.49 ? 322  PHE B CA  1 
ATOM   5772  C  C   . PHE B 2  322 ? 62.164  86.282  71.141  1.00 15.61 ? 322  PHE B C   1 
ATOM   5773  O  O   . PHE B 2  322 ? 62.908  85.733  70.326  1.00 15.31 ? 322  PHE B O   1 
ATOM   5774  C  CB  . PHE B 2  322 ? 61.439  88.446  70.072  1.00 15.82 ? 322  PHE B CB  1 
ATOM   5775  C  CG  . PHE B 2  322 ? 60.007  88.012  69.896  1.00 13.97 ? 322  PHE B CG  1 
ATOM   5776  C  CD1 . PHE B 2  322 ? 58.965  88.692  70.567  1.00 21.45 ? 322  PHE B CD1 1 
ATOM   5777  C  CD2 . PHE B 2  322 ? 59.679  86.890  69.072  1.00 15.12 ? 322  PHE B CD2 1 
ATOM   5778  C  CE1 . PHE B 2  322 ? 57.612  88.198  70.505  1.00 23.33 ? 322  PHE B CE1 1 
ATOM   5779  C  CE2 . PHE B 2  322 ? 58.402  86.281  69.151  1.00 15.99 ? 322  PHE B CE2 1 
ATOM   5780  C  CZ  . PHE B 2  322 ? 57.342  86.977  69.821  1.00 18.68 ? 322  PHE B CZ  1 
ATOM   5781  N  N   . GLY B 2  323 ? 61.215  85.653  71.823  1.00 15.43 ? 323  GLY B N   1 
ATOM   5782  C  CA  . GLY B 2  323 ? 60.721  84.346  71.450  1.00 15.65 ? 323  GLY B CA  1 
ATOM   5783  C  C   . GLY B 2  323 ? 59.687  83.859  72.408  1.00 16.31 ? 323  GLY B C   1 
ATOM   5784  O  O   . GLY B 2  323 ? 58.619  84.483  72.530  1.00 16.10 ? 323  GLY B O   1 
ATOM   5785  N  N   . PHE B 2  324 ? 59.986  82.717  73.051  1.00 16.47 ? 324  PHE B N   1 
ATOM   5786  C  CA  . PHE B 2  324 ? 59.050  82.070  73.969  1.00 16.61 ? 324  PHE B CA  1 
ATOM   5787  C  C   . PHE B 2  324 ? 59.662  81.383  75.196  1.00 16.31 ? 324  PHE B C   1 
ATOM   5788  O  O   . PHE B 2  324 ? 60.877  81.126  75.245  1.00 16.52 ? 324  PHE B O   1 
ATOM   5789  C  CB  . PHE B 2  324 ? 58.054  81.146  73.216  1.00 16.93 ? 324  PHE B CB  1 
ATOM   5790  C  CG  . PHE B 2  324 ? 58.697  79.990  72.530  1.00 14.60 ? 324  PHE B CG  1 
ATOM   5791  C  CD1 . PHE B 2  324 ? 58.982  78.791  73.241  1.00 12.88 ? 324  PHE B CD1 1 
ATOM   5792  C  CD2 . PHE B 2  324 ? 58.987  80.061  71.151  1.00 14.29 ? 324  PHE B CD2 1 
ATOM   5793  C  CE1 . PHE B 2  324 ? 59.625  77.690  72.599  1.00 18.53 ? 324  PHE B CE1 1 
ATOM   5794  C  CE2 . PHE B 2  324 ? 59.622  78.969  70.483  1.00 21.11 ? 324  PHE B CE2 1 
ATOM   5795  C  CZ  . PHE B 2  324 ? 59.951  77.788  71.211  1.00 20.91 ? 324  PHE B CZ  1 
ATOM   5796  N  N   . TYR B 2  325 ? 58.799  81.161  76.188  1.00 15.38 ? 325  TYR B N   1 
ATOM   5797  C  CA  . TYR B 2  325 ? 59.129  80.602  77.484  1.00 14.45 ? 325  TYR B CA  1 
ATOM   5798  C  C   . TYR B 2  325 ? 58.129  79.483  77.767  1.00 14.64 ? 325  TYR B C   1 
ATOM   5799  O  O   . TYR B 2  325 ? 56.922  79.715  77.754  1.00 14.50 ? 325  TYR B O   1 
ATOM   5800  C  CB  . TYR B 2  325 ? 59.054  81.667  78.584  1.00 13.43 ? 325  TYR B CB  1 
ATOM   5801  C  CG  . TYR B 2  325 ? 59.769  81.300  79.873  1.00 8.51  ? 325  TYR B CG  1 
ATOM   5802  C  CD1 . TYR B 2  325 ? 61.016  81.886  80.199  1.00 11.75 ? 325  TYR B CD1 1 
ATOM   5803  C  CD2 . TYR B 2  325 ? 59.171  80.439  80.830  1.00 8.30  ? 325  TYR B CD2 1 
ATOM   5804  C  CE1 . TYR B 2  325 ? 61.635  81.624  81.449  1.00 8.95  ? 325  TYR B CE1 1 
ATOM   5805  C  CE2 . TYR B 2  325 ? 59.837  80.071  81.995  1.00 12.14 ? 325  TYR B CE2 1 
ATOM   5806  C  CZ  . TYR B 2  325 ? 61.012  80.747  82.353  1.00 21.04 ? 325  TYR B CZ  1 
ATOM   5807  O  OH  . TYR B 2  325 ? 61.661  80.350  83.490  1.00 30.63 ? 325  TYR B OH  1 
ATOM   5808  N  N   . THR B 2  326 ? 58.661  78.338  78.198  1.00 14.74 ? 326  THR B N   1 
ATOM   5809  C  CA  . THR B 2  326 ? 57.876  77.111  78.461  1.00 14.61 ? 326  THR B CA  1 
ATOM   5810  C  C   . THR B 2  326 ? 58.184  76.594  79.856  1.00 14.97 ? 326  THR B C   1 
ATOM   5811  O  O   . THR B 2  326 ? 59.355  76.642  80.294  1.00 15.76 ? 326  THR B O   1 
ATOM   5812  C  CB  . THR B 2  326 ? 58.168  76.004  77.438  1.00 13.75 ? 326  THR B CB  1 
ATOM   5813  O  OG1 . THR B 2  326 ? 59.543  75.634  77.496  1.00 23.46 ? 326  THR B OG1 1 
ATOM   5814  C  CG2 . THR B 2  326 ? 57.975  76.462  75.985  1.00 14.16 ? 326  THR B CG2 1 
ATOM   5815  N  N   . ILE B 2  327 ? 57.118  76.358  80.619  1.00 14.21 ? 327  ILE B N   1 
ATOM   5816  C  CA  . ILE B 2  327 ? 57.152  75.479  81.785  1.00 14.27 ? 327  ILE B CA  1 
ATOM   5817  C  C   . ILE B 2  327 ? 56.419  74.192  81.422  1.00 14.22 ? 327  ILE B C   1 
ATOM   5818  O  O   . ILE B 2  327 ? 55.340  74.248  80.838  1.00 14.11 ? 327  ILE B O   1 
ATOM   5819  C  CB  . ILE B 2  327 ? 56.554  76.145  83.086  1.00 14.32 ? 327  ILE B CB  1 
ATOM   5820  C  CG1 . ILE B 2  327 ? 57.143  77.535  83.333  1.00 15.07 ? 327  ILE B CG1 1 
ATOM   5821  C  CG2 . ILE B 2  327 ? 56.759  75.250  84.337  1.00 6.00  ? 327  ILE B CG2 1 
ATOM   5822  C  CD1 . ILE B 2  327 ? 56.230  78.440  84.111  1.00 15.20 ? 327  ILE B CD1 1 
ATOM   5823  N  N   . SER B 2  328 ? 57.080  73.056  81.668  1.00 14.06 ? 328  SER B N   1 
ATOM   5824  C  CA  . SER B 2  328 ? 56.521  71.716  81.399  1.00 14.80 ? 328  SER B CA  1 
ATOM   5825  C  C   . SER B 2  328 ? 57.153  70.653  82.305  1.00 15.60 ? 328  SER B C   1 
ATOM   5826  O  O   . SER B 2  328 ? 58.263  70.851  82.822  1.00 16.40 ? 328  SER B O   1 
ATOM   5827  C  CB  . SER B 2  328 ? 56.703  71.338  79.925  1.00 14.20 ? 328  SER B CB  1 
ATOM   5828  O  OG  . SER B 2  328 ? 58.072  71.169  79.627  1.00 17.07 ? 328  SER B OG  1 
ATOM   5829  N  N   . GLN B 2  329 ? 56.477  69.514  82.421  1.00 15.86 ? 329  GLN B N   1 
ATOM   5830  C  CA  . GLN B 2  329 ? 57.087  68.244  82.878  1.00 17.14 ? 329  GLN B CA  1 
ATOM   5831  C  C   . GLN B 2  329 ? 58.325  67.841  82.074  1.00 17.87 ? 329  GLN B C   1 
ATOM   5832  O  O   . GLN B 2  329 ? 58.422  68.171  80.884  1.00 18.50 ? 329  GLN B O   1 
ATOM   5833  C  CB  . GLN B 2  329 ? 56.047  67.113  82.897  1.00 17.04 ? 329  GLN B CB  1 
ATOM   5834  C  CG  . GLN B 2  329 ? 55.090  67.167  84.105  1.00 23.46 ? 329  GLN B CG  1 
ATOM   5835  C  CD  . GLN B 2  329 ? 55.718  66.630  85.407  1.00 36.08 ? 329  GLN B CD  1 
ATOM   5836  O  OE1 . GLN B 2  329 ? 55.992  67.399  86.326  1.00 41.22 ? 329  GLN B OE1 1 
ATOM   5837  N  NE2 . GLN B 2  329 ? 55.880  65.309  85.503  1.00 39.06 ? 329  GLN B NE2 1 
ATOM   5838  N  N   . ALA B 2  330 ? 59.342  67.383  82.808  1.00 18.72 ? 330  ALA B N   1 
ATOM   5839  C  CA  . ALA B 2  330 ? 60.651  66.952  82.276  1.00 19.83 ? 330  ALA B CA  1 
ATOM   5840  C  C   . ALA B 2  330 ? 60.620  66.174  80.957  1.00 20.59 ? 330  ALA B C   1 
ATOM   5841  O  O   . ALA B 2  330 ? 61.143  66.686  79.943  1.00 20.58 ? 330  ALA B O   1 
ATOM   5842  C  CB  . ALA B 2  330 ? 61.471  66.206  83.350  1.00 19.70 ? 330  ALA B CB  1 
ATOM   5843  N  N   . ALA B 2  331 ? 59.765  65.137  80.925  1.00 21.21 ? 331  ALA B N   1 
ATOM   5844  C  CA  . ALA B 2  331 ? 59.541  64.278  79.745  1.00 21.96 ? 331  ALA B CA  1 
ATOM   5845  C  C   . ALA B 2  331 ? 58.833  64.974  78.563  1.00 22.64 ? 331  ALA B C   1 
ATOM   5846  O  O   . ALA B 2  331 ? 59.105  64.637  77.406  1.00 23.67 ? 331  ALA B O   1 
ATOM   5847  C  CB  . ALA B 2  331 ? 58.808  62.997  80.142  1.00 21.76 ? 331  ALA B CB  1 
ATOM   5848  N  N   . SER B 2  332 ? 58.023  65.996  78.865  1.00 22.02 ? 332  SER B N   1 
ATOM   5849  C  CA  . SER B 2  332 ? 57.250  66.756  77.878  1.00 21.88 ? 332  SER B CA  1 
ATOM   5850  C  C   . SER B 2  332 ? 57.981  68.026  77.341  1.00 21.91 ? 332  SER B C   1 
ATOM   5851  O  O   . SER B 2  332 ? 57.445  68.712  76.458  1.00 22.01 ? 332  SER B O   1 
ATOM   5852  C  CB  . SER B 2  332 ? 55.888  67.135  78.485  1.00 22.28 ? 332  SER B CB  1 
ATOM   5853  O  OG  . SER B 2  332 ? 54.998  66.027  78.555  1.00 31.56 ? 332  SER B OG  1 
ATOM   5854  N  N   . ALA B 2  333 ? 59.213  68.287  77.811  1.00 21.27 ? 333  ALA B N   1 
ATOM   5855  C  CA  . ALA B 2  333 ? 59.932  69.534  77.483  1.00 21.26 ? 333  ALA B CA  1 
ATOM   5856  C  C   . ALA B 2  333 ? 60.181  69.739  75.992  1.00 21.47 ? 333  ALA B C   1 
ATOM   5857  O  O   . ALA B 2  333 ? 59.711  70.750  75.443  1.00 22.48 ? 333  ALA B O   1 
ATOM   5858  C  CB  . ALA B 2  333 ? 61.211  69.693  78.296  1.00 20.32 ? 333  ALA B CB  1 
ATOM   5859  N  N   . GLY B 2  334 ? 60.605  68.650  75.334  1.00 19.96 ? 334  GLY B N   1 
ATOM   5860  C  CA  . GLY B 2  334 ? 60.876  68.590  73.906  1.00 19.15 ? 334  GLY B CA  1 
ATOM   5861  C  C   . GLY B 2  334 ? 59.655  68.816  73.051  1.00 18.93 ? 334  GLY B C   1 
ATOM   5862  O  O   . GLY B 2  334 ? 59.689  69.667  72.163  1.00 18.43 ? 334  GLY B O   1 
ATOM   5863  N  N   . ASP B 2  335 ? 58.579  68.080  73.361  1.00 19.33 ? 335  ASP B N   1 
ATOM   5864  C  CA  . ASP B 2  335 ? 57.254  68.230  72.726  1.00 19.45 ? 335  ASP B CA  1 
ATOM   5865  C  C   . ASP B 2  335 ? 56.680  69.633  72.788  1.00 19.68 ? 335  ASP B C   1 
ATOM   5866  O  O   . ASP B 2  335 ? 56.335  70.192  71.737  1.00 20.44 ? 335  ASP B O   1 
ATOM   5867  C  CB  . ASP B 2  335 ? 56.247  67.195  73.267  1.00 19.11 ? 335  ASP B CB  1 
ATOM   5868  C  CG  . ASP B 2  335 ? 56.668  65.754  72.984  1.00 25.11 ? 335  ASP B CG  1 
ATOM   5869  O  OD1 . ASP B 2  335 ? 56.288  64.877  73.781  1.00 28.02 ? 335  ASP B OD1 1 
ATOM   5870  O  OD2 . ASP B 2  335 ? 57.432  65.405  72.048  1.00 21.58 ? 335  ASP B OD2 1 
ATOM   5871  N  N   . VAL B 2  336 ? 56.794  70.254  73.969  1.00 19.34 ? 336  VAL B N   1 
ATOM   5872  C  CA  . VAL B 2  336 ? 56.271  71.605  74.258  1.00 18.81 ? 336  VAL B CA  1 
ATOM   5873  C  C   . VAL B 2  336 ? 57.054  72.674  73.481  1.00 19.32 ? 336  VAL B C   1 
ATOM   5874  O  O   . VAL B 2  336 ? 56.429  73.557  72.868  1.00 19.41 ? 336  VAL B O   1 
ATOM   5875  C  CB  . VAL B 2  336 ? 56.207  71.898  75.822  1.00 18.51 ? 336  VAL B CB  1 
ATOM   5876  C  CG1 . VAL B 2  336 ? 55.829  73.359  76.145  1.00 8.08  ? 336  VAL B CG1 1 
ATOM   5877  C  CG2 . VAL B 2  336 ? 55.184  71.015  76.488  1.00 6.34  ? 336  VAL B CG2 1 
ATOM   5878  N  N   . ILE B 2  337 ? 58.397  72.567  73.485  1.00 19.67 ? 337  ILE B N   1 
ATOM   5879  C  CA  . ILE B 2  337 ? 59.272  73.516  72.772  1.00 19.95 ? 337  ILE B CA  1 
ATOM   5880  C  C   . ILE B 2  337 ? 59.039  73.469  71.247  1.00 19.91 ? 337  ILE B C   1 
ATOM   5881  O  O   . ILE B 2  337 ? 58.749  74.525  70.638  1.00 20.14 ? 337  ILE B O   1 
ATOM   5882  C  CB  . ILE B 2  337 ? 60.822  73.405  73.173  1.00 20.26 ? 337  ILE B CB  1 
ATOM   5883  C  CG1 . ILE B 2  337 ? 61.039  73.660  74.682  1.00 20.65 ? 337  ILE B CG1 1 
ATOM   5884  C  CG2 . ILE B 2  337 ? 61.647  74.524  72.467  1.00 21.36 ? 337  ILE B CG2 1 
ATOM   5885  C  CD1 . ILE B 2  337 ? 62.241  72.857  75.318  1.00 15.53 ? 337  ILE B CD1 1 
ATOM   5886  N  N   . LYS B 2  338 ? 58.924  72.243  70.724  1.00 19.40 ? 338  LYS B N   1 
ATOM   5887  C  CA  . LYS B 2  338 ? 58.779  71.964  69.294  1.00 19.22 ? 338  LYS B CA  1 
ATOM   5888  C  C   . LYS B 2  338 ? 57.408  72.374  68.743  1.00 18.80 ? 338  LYS B C   1 
ATOM   5889  O  O   . LYS B 2  338 ? 57.364  73.184  67.794  1.00 19.06 ? 338  LYS B O   1 
ATOM   5890  C  CB  . LYS B 2  338 ? 59.137  70.503  68.963  1.00 19.55 ? 338  LYS B CB  1 
ATOM   5891  C  CG  . LYS B 2  338 ? 60.663  70.244  68.962  1.00 25.33 ? 338  LYS B CG  1 
ATOM   5892  C  CD  . LYS B 2  338 ? 61.011  68.759  68.990  1.00 30.88 ? 338  LYS B CD  1 
ATOM   5893  C  CE  . LYS B 2  338 ? 62.496  68.522  69.331  1.00 20.40 ? 338  LYS B CE  1 
ATOM   5894  N  NZ  . LYS B 2  338 ? 62.819  67.049  69.306  1.00 42.22 ? 338  LYS B NZ  1 
ATOM   5895  N  N   . ALA B 2  339 ? 56.332  72.009  69.473  1.00 17.39 ? 339  ALA B N   1 
ATOM   5896  C  CA  . ALA B 2  339 ? 54.977  72.557  69.253  1.00 16.17 ? 339  ALA B CA  1 
ATOM   5897  C  C   . ALA B 2  339 ? 54.917  74.099  69.222  1.00 15.99 ? 339  ALA B C   1 
ATOM   5898  O  O   . ALA B 2  339 ? 54.482  74.651  68.220  1.00 16.13 ? 339  ALA B O   1 
ATOM   5899  C  CB  . ALA B 2  339 ? 53.967  71.995  70.234  1.00 14.90 ? 339  ALA B CB  1 
ATOM   5900  N  N   . ALA B 2  340 ? 55.520  74.752  70.224  1.00 16.02 ? 340  ALA B N   1 
ATOM   5901  C  CA  . ALA B 2  340 ? 55.624  76.233  70.299  1.00 16.55 ? 340  ALA B CA  1 
ATOM   5902  C  C   . ALA B 2  340 ? 56.445  76.876  69.156  1.00 17.53 ? 340  ALA B C   1 
ATOM   5903  O  O   . ALA B 2  340 ? 56.043  77.916  68.629  1.00 17.55 ? 340  ALA B O   1 
ATOM   5904  C  CB  . ALA B 2  340 ? 56.172  76.683  71.678  1.00 15.80 ? 340  ALA B CB  1 
ATOM   5905  N  N   . TYR B 2  341 ? 57.613  76.290  68.848  1.00 18.29 ? 341  TYR B N   1 
ATOM   5906  C  CA  . TYR B 2  341 ? 58.480  76.707  67.729  1.00 18.98 ? 341  TYR B CA  1 
ATOM   5907  C  C   . TYR B 2  341 ? 57.808  76.605  66.353  1.00 20.08 ? 341  TYR B C   1 
ATOM   5908  O  O   . TYR B 2  341 ? 57.901  77.563  65.550  1.00 21.10 ? 341  TYR B O   1 
ATOM   5909  C  CB  . TYR B 2  341 ? 59.834  75.963  67.748  1.00 18.35 ? 341  TYR B CB  1 
ATOM   5910  C  CG  . TYR B 2  341 ? 60.911  76.510  66.814  1.00 20.62 ? 341  TYR B CG  1 
ATOM   5911  C  CD1 . TYR B 2  341 ? 61.048  77.911  66.569  1.00 24.71 ? 341  TYR B CD1 1 
ATOM   5912  C  CD2 . TYR B 2  341 ? 61.913  75.658  66.304  1.00 19.46 ? 341  TYR B CD2 1 
ATOM   5913  C  CE1 . TYR B 2  341 ? 62.013  78.408  65.638  1.00 14.80 ? 341  TYR B CE1 1 
ATOM   5914  C  CE2 . TYR B 2  341 ? 62.945  76.161  65.443  1.00 20.89 ? 341  TYR B CE2 1 
ATOM   5915  C  CZ  . TYR B 2  341 ? 62.997  77.551  65.153  1.00 19.31 ? 341  TYR B CZ  1 
ATOM   5916  O  OH  . TYR B 2  341 ? 63.996  78.071  64.367  1.00 19.88 ? 341  TYR B OH  1 
ATOM   5917  N  N   . ASN B 2  342 ? 57.057  75.510  66.140  1.00 19.19 ? 342  ASN B N   1 
ATOM   5918  C  CA  . ASN B 2  342 ? 56.262  75.301  64.925  1.00 18.75 ? 342  ASN B CA  1 
ATOM   5919  C  C   . ASN B 2  342 ? 55.097  76.263  64.740  1.00 18.44 ? 342  ASN B C   1 
ATOM   5920  O  O   . ASN B 2  342 ? 54.711  76.525  63.595  1.00 19.26 ? 342  ASN B O   1 
ATOM   5921  C  CB  . ASN B 2  342 ? 55.769  73.830  64.790  1.00 18.50 ? 342  ASN B CB  1 
ATOM   5922  C  CG  . ASN B 2  342 ? 56.922  72.794  64.597  1.00 23.45 ? 342  ASN B CG  1 
ATOM   5923  O  OD1 . ASN B 2  342 ? 56.699  71.608  64.793  1.00 18.28 ? 342  ASN B OD1 1 
ATOM   5924  N  ND2 . ASN B 2  342 ? 58.137  73.246  64.231  1.00 25.92 ? 342  ASN B ND2 1 
ATOM   5925  N  N   . GLN B 2  343 ? 54.477  76.692  65.846  1.00 17.59 ? 343  GLN B N   1 
ATOM   5926  C  CA  . GLN B 2  343 ? 53.386  77.674  65.815  1.00 17.94 ? 343  GLN B CA  1 
ATOM   5927  C  C   . GLN B 2  343 ? 53.869  79.075  65.379  1.00 19.21 ? 343  GLN B C   1 
ATOM   5928  O  O   . GLN B 2  343 ? 53.147  79.775  64.640  1.00 20.27 ? 343  GLN B O   1 
ATOM   5929  C  CB  . GLN B 2  343 ? 52.630  77.703  67.156  1.00 17.42 ? 343  GLN B CB  1 
ATOM   5930  C  CG  . GLN B 2  343 ? 51.460  78.739  67.310  1.00 23.89 ? 343  GLN B CG  1 
ATOM   5931  C  CD  . GLN B 2  343 ? 50.358  78.637  66.229  1.00 28.75 ? 343  GLN B CD  1 
ATOM   5932  O  OE1 . GLN B 2  343 ? 49.734  77.587  66.051  1.00 25.97 ? 343  GLN B OE1 1 
ATOM   5933  N  NE2 . GLN B 2  343 ? 50.042  79.763  65.617  1.00 25.79 ? 343  GLN B NE2 1 
ATOM   5934  N  N   . VAL B 2  344 ? 55.079  79.460  65.810  1.00 18.91 ? 344  VAL B N   1 
ATOM   5935  C  CA  . VAL B 2  344 ? 55.758  80.672  65.292  1.00 19.02 ? 344  VAL B CA  1 
ATOM   5936  C  C   . VAL B 2  344 ? 56.103  80.534  63.788  1.00 19.19 ? 344  VAL B C   1 
ATOM   5937  O  O   . VAL B 2  344 ? 55.737  81.419  63.002  1.00 19.19 ? 344  VAL B O   1 
ATOM   5938  C  CB  . VAL B 2  344 ? 57.011  81.123  66.130  1.00 18.94 ? 344  VAL B CB  1 
ATOM   5939  C  CG1 . VAL B 2  344 ? 57.405  82.578  65.776  1.00 19.53 ? 344  VAL B CG1 1 
ATOM   5940  C  CG2 . VAL B 2  344 ? 56.753  81.037  67.628  1.00 13.50 ? 344  VAL B CG2 1 
ATOM   5941  N  N   . LYS B 2  345 ? 56.641  79.360  63.402  1.00 19.45 ? 345  LYS B N   1 
ATOM   5942  C  CA  . LYS B 2  345 ? 56.898  78.974  62.001  1.00 19.85 ? 345  LYS B CA  1 
ATOM   5943  C  C   . LYS B 2  345 ? 55.687  79.109  61.069  1.00 20.15 ? 345  LYS B C   1 
ATOM   5944  O  O   . LYS B 2  345 ? 55.818  79.772  60.026  1.00 20.16 ? 345  LYS B O   1 
ATOM   5945  C  CB  . LYS B 2  345 ? 57.515  77.575  61.903  1.00 19.89 ? 345  LYS B CB  1 
ATOM   5946  C  CG  . LYS B 2  345 ? 59.037  77.573  62.081  1.00 26.22 ? 345  LYS B CG  1 
ATOM   5947  C  CD  . LYS B 2  345 ? 59.548  76.279  62.693  1.00 25.00 ? 345  LYS B CD  1 
ATOM   5948  C  CE  . LYS B 2  345 ? 60.369  75.476  61.699  1.00 31.76 ? 345  LYS B CE  1 
ATOM   5949  N  NZ  . LYS B 2  345 ? 61.446  74.679  62.369  1.00 31.32 ? 345  LYS B NZ  1 
ATOM   5950  N  N   . THR B 2  346 ? 54.496  78.718  61.576  1.00 19.83 ? 346  THR B N   1 
ATOM   5951  C  CA  . THR B 2  346 ? 53.190  78.945  60.903  1.00 20.13 ? 346  THR B CA  1 
ATOM   5952  C  C   . THR B 2  346 ? 52.861  80.423  60.633  1.00 19.90 ? 346  THR B C   1 
ATOM   5953  O  O   . THR B 2  346 ? 52.381  80.757  59.539  1.00 20.46 ? 346  THR B O   1 
ATOM   5954  C  CB  . THR B 2  346 ? 52.000  78.209  61.629  1.00 20.28 ? 346  THR B CB  1 
ATOM   5955  O  OG1 . THR B 2  346 ? 52.377  76.861  61.925  1.00 27.40 ? 346  THR B OG1 1 
ATOM   5956  C  CG2 . THR B 2  346 ? 50.814  77.974  60.674  1.00 24.05 ? 346  THR B CG2 1 
ATOM   5957  N  N   . ILE B 2  347 ? 53.220  81.291  61.576  1.00 19.91 ? 347  ILE B N   1 
ATOM   5958  C  CA  . ILE B 2  347 ? 53.054  82.756  61.439  1.00 19.90 ? 347  ILE B CA  1 
ATOM   5959  C  C   . ILE B 2  347 ? 54.101  83.397  60.492  1.00 19.90 ? 347  ILE B C   1 
ATOM   5960  O  O   . ILE B 2  347 ? 53.739  84.273  59.679  1.00 20.24 ? 347  ILE B O   1 
ATOM   5961  C  CB  . ILE B 2  347 ? 52.925  83.441  62.856  1.00 19.64 ? 347  ILE B CB  1 
ATOM   5962  C  CG1 . ILE B 2  347 ? 51.545  83.094  63.433  1.00 26.04 ? 347  ILE B CG1 1 
ATOM   5963  C  CG2 . ILE B 2  347 ? 53.009  85.003  62.782  1.00 21.21 ? 347  ILE B CG2 1 
ATOM   5964  C  CD1 . ILE B 2  347 ? 51.515  82.792  64.890  1.00 31.47 ? 347  ILE B CD1 1 
ATOM   5965  N  N   . ALA B 2  348 ? 55.360  82.927  60.581  1.00 19.25 ? 348  ALA B N   1 
ATOM   5966  C  CA  . ALA B 2  348 ? 56.453  83.274  59.642  1.00 18.67 ? 348  ALA B CA  1 
ATOM   5967  C  C   . ALA B 2  348 ? 56.179  82.899  58.165  1.00 19.25 ? 348  ALA B C   1 
ATOM   5968  O  O   . ALA B 2  348 ? 56.538  83.662  57.246  1.00 18.87 ? 348  ALA B O   1 
ATOM   5969  C  CB  . ALA B 2  348 ? 57.750  82.669  60.104  1.00 17.87 ? 348  ALA B CB  1 
ATOM   5970  N  N   . GLN B 2  349 ? 55.498  81.757  57.977  1.00 19.60 ? 349  GLN B N   1 
ATOM   5971  C  CA  . GLN B 2  349 ? 55.026  81.246  56.692  1.00 20.15 ? 349  GLN B CA  1 
ATOM   5972  C  C   . GLN B 2  349 ? 53.791  81.997  56.125  1.00 20.83 ? 349  GLN B C   1 
ATOM   5973  O  O   . GLN B 2  349 ? 53.330  81.678  55.002  1.00 21.25 ? 349  GLN B O   1 
ATOM   5974  C  CB  . GLN B 2  349 ? 54.733  79.743  56.816  1.00 20.46 ? 349  GLN B CB  1 
ATOM   5975  C  CG  . GLN B 2  349 ? 55.977  78.834  56.720  1.00 21.96 ? 349  GLN B CG  1 
ATOM   5976  C  CD  . GLN B 2  349 ? 55.819  77.471  57.422  1.00 31.99 ? 349  GLN B CD  1 
ATOM   5977  O  OE1 . GLN B 2  349 ? 54.717  76.901  57.482  1.00 34.51 ? 349  GLN B OE1 1 
ATOM   5978  N  NE2 . GLN B 2  349 ? 56.946  76.889  57.816  1.00 33.60 ? 349  GLN B NE2 1 
ATOM   5979  N  N   . GLY B 2  350 ? 53.240  82.945  56.908  1.00 20.55 ? 350  GLY B N   1 
ATOM   5980  C  CA  . GLY B 2  350 ? 52.196  83.865  56.456  1.00 20.51 ? 350  GLY B CA  1 
ATOM   5981  C  C   . GLY B 2  350 ? 50.764  83.584  56.910  1.00 21.02 ? 350  GLY B C   1 
ATOM   5982  O  O   . GLY B 2  350 ? 49.852  84.352  56.549  1.00 20.84 ? 350  GLY B O   1 
ATOM   5983  N  N   . ASN B 2  351 ? 50.573  82.525  57.710  1.00 21.63 ? 351  ASN B N   1 
ATOM   5984  C  CA  . ASN B 2  351 ? 49.246  82.097  58.186  1.00 22.27 ? 351  ASN B CA  1 
ATOM   5985  C  C   . ASN B 2  351 ? 48.853  82.896  59.431  1.00 22.86 ? 351  ASN B C   1 
ATOM   5986  O  O   . ASN B 2  351 ? 49.299  82.597  60.573  1.00 23.61 ? 351  ASN B O   1 
ATOM   5987  C  CB  . ASN B 2  351 ? 49.167  80.574  58.413  1.00 22.21 ? 351  ASN B CB  1 
ATOM   5988  C  CG  . ASN B 2  351 ? 49.598  79.773  57.192  1.00 23.71 ? 351  ASN B CG  1 
ATOM   5989  O  OD1 . ASN B 2  351 ? 50.744  79.327  57.110  1.00 27.96 ? 351  ASN B OD1 1 
ATOM   5990  N  ND2 . ASN B 2  351 ? 48.673  79.573  56.244  1.00 24.65 ? 351  ASN B ND2 1 
ATOM   5991  N  N   . LEU B 2  352 ? 48.257  84.058  59.139  1.00 22.03 ? 352  LEU B N   1 
ATOM   5992  C  CA  . LEU B 2  352 ? 47.883  85.063  60.116  1.00 21.40 ? 352  LEU B CA  1 
ATOM   5993  C  C   . LEU B 2  352 ? 46.734  85.886  59.555  1.00 21.34 ? 352  LEU B C   1 
ATOM   5994  O  O   . LEU B 2  352 ? 46.904  86.577  58.552  1.00 21.51 ? 352  LEU B O   1 
ATOM   5995  C  CB  . LEU B 2  352 ? 49.114  85.946  60.458  1.00 21.21 ? 352  LEU B CB  1 
ATOM   5996  C  CG  . LEU B 2  352 ? 49.006  87.146  61.402  1.00 16.90 ? 352  LEU B CG  1 
ATOM   5997  C  CD1 . LEU B 2  352 ? 48.954  86.716  62.848  1.00 17.11 ? 352  LEU B CD1 1 
ATOM   5998  C  CD2 . LEU B 2  352 ? 50.164  88.075  61.161  1.00 11.64 ? 352  LEU B CD2 1 
ATOM   5999  N  N   . SER B 2  353 ? 45.553  85.729  60.158  1.00 21.80 ? 353  SER B N   1 
ATOM   6000  C  CA  . SER B 2  353 ? 44.360  86.518  59.817  1.00 22.56 ? 353  SER B CA  1 
ATOM   6001  C  C   . SER B 2  353 ? 44.464  87.971  60.304  1.00 23.49 ? 353  SER B C   1 
ATOM   6002  O  O   . SER B 2  353 ? 45.215  88.262  61.258  1.00 24.19 ? 353  SER B O   1 
ATOM   6003  C  CB  . SER B 2  353 ? 43.070  85.826  60.302  1.00 22.56 ? 353  SER B CB  1 
ATOM   6004  O  OG  . SER B 2  353 ? 42.735  86.165  61.639  1.00 25.84 ? 353  SER B OG  1 
ATOM   6005  N  N   . ASN B 2  354 ? 43.796  88.880  59.589  1.00 23.66 ? 354  ASN B N   1 
ATOM   6006  C  CA  . ASN B 2  354 ? 43.596  90.255  60.073  1.00 24.20 ? 354  ASN B CA  1 
ATOM   6007  C  C   . ASN B 2  354 ? 42.860  90.430  61.442  1.00 24.25 ? 354  ASN B C   1 
ATOM   6008  O  O   . ASN B 2  354 ? 43.384  91.196  62.264  1.00 24.28 ? 354  ASN B O   1 
ATOM   6009  C  CB  . ASN B 2  354 ? 43.117  91.235  58.967  1.00 24.35 ? 354  ASN B CB  1 
ATOM   6010  C  CG  . ASN B 2  354 ? 43.047  92.698  59.453  1.00 37.32 ? 354  ASN B CG  1 
ATOM   6011  O  OD1 . ASN B 2  354 ? 41.960  93.201  59.734  1.00 38.90 ? 354  ASN B OD1 1 
ATOM   6012  N  ND2 . ASN B 2  354 ? 44.216  93.310  59.719  1.00 35.53 ? 354  ASN B ND2 1 
ATOM   6013  N  N   . PRO B 2  355 ? 41.753  89.680  61.729  1.00 24.51 ? 355  PRO B N   1 
ATOM   6014  C  CA  . PRO B 2  355 ? 41.220  89.560  63.108  1.00 24.63 ? 355  PRO B CA  1 
ATOM   6015  C  C   . PRO B 2  355 ? 42.201  89.223  64.238  1.00 24.59 ? 355  PRO B C   1 
ATOM   6016  O  O   . PRO B 2  355 ? 42.039  89.813  65.315  1.00 24.22 ? 355  PRO B O   1 
ATOM   6017  C  CB  . PRO B 2  355 ? 40.165  88.460  62.973  1.00 24.76 ? 355  PRO B CB  1 
ATOM   6018  C  CG  . PRO B 2  355 ? 39.600  88.676  61.626  1.00 24.84 ? 355  PRO B CG  1 
ATOM   6019  C  CD  . PRO B 2  355 ? 40.751  89.134  60.771  1.00 24.47 ? 355  PRO B CD  1 
ATOM   6020  N  N   . ASP B 2  356 ? 43.200  88.361  63.977  1.00 25.21 ? 356  ASP B N   1 
ATOM   6021  C  CA  . ASP B 2  356 ? 44.241  87.995  64.958  1.00 25.65 ? 356  ASP B CA  1 
ATOM   6022  C  C   . ASP B 2  356 ? 45.132  89.169  65.359  1.00 25.66 ? 356  ASP B C   1 
ATOM   6023  O  O   . ASP B 2  356 ? 45.186  89.496  66.545  1.00 26.51 ? 356  ASP B O   1 
ATOM   6024  C  CB  . ASP B 2  356 ? 45.077  86.790  64.492  1.00 26.07 ? 356  ASP B CB  1 
ATOM   6025  C  CG  . ASP B 2  356 ? 44.250  85.499  64.346  1.00 35.37 ? 356  ASP B CG  1 
ATOM   6026  O  OD1 . ASP B 2  356 ? 44.694  84.615  63.574  1.00 38.20 ? 356  ASP B OD1 1 
ATOM   6027  O  OD2 . ASP B 2  356 ? 43.130  85.303  64.887  1.00 32.64 ? 356  ASP B OD2 1 
ATOM   6028  N  N   . VAL B 2  357 ? 45.625  89.904  64.350  1.00 24.64 ? 357  VAL B N   1 
ATOM   6029  C  CA  . VAL B 2  357 ? 46.424  91.141  64.505  1.00 24.18 ? 357  VAL B CA  1 
ATOM   6030  C  C   . VAL B 2  357 ? 45.628  92.245  65.227  1.00 24.15 ? 357  VAL B C   1 
ATOM   6031  O  O   . VAL B 2  357 ? 46.143  92.836  66.180  1.00 24.34 ? 357  VAL B O   1 
ATOM   6032  C  CB  . VAL B 2  357 ? 47.003  91.664  63.129  1.00 23.77 ? 357  VAL B CB  1 
ATOM   6033  C  CG1 . VAL B 2  357 ? 47.970  92.812  63.318  1.00 24.36 ? 357  VAL B CG1 1 
ATOM   6034  C  CG2 . VAL B 2  357 ? 47.749  90.578  62.419  1.00 28.67 ? 357  VAL B CG2 1 
ATOM   6035  N  N   . GLN B 2  358 ? 44.347  92.379  64.867  1.00 23.86 ? 358  GLN B N   1 
ATOM   6036  C  CA  . GLN B 2  358 ? 43.420  93.335  65.476  1.00 23.70 ? 358  GLN B CA  1 
ATOM   6037  C  C   . GLN B 2  358 ? 43.075  93.058  66.959  1.00 23.19 ? 358  GLN B C   1 
ATOM   6038  O  O   . GLN B 2  358 ? 43.151  93.989  67.786  1.00 24.34 ? 358  GLN B O   1 
ATOM   6039  C  CB  . GLN B 2  358 ? 42.175  93.550  64.585  1.00 23.70 ? 358  GLN B CB  1 
ATOM   6040  C  CG  . GLN B 2  358 ? 41.386  94.871  64.814  1.00 35.14 ? 358  GLN B CG  1 
ATOM   6041  C  CD  . GLN B 2  358 ? 42.236  96.147  64.710  1.00 36.56 ? 358  GLN B CD  1 
ATOM   6042  O  OE1 . GLN B 2  358 ? 42.552  96.761  65.726  1.00 48.54 ? 358  GLN B OE1 1 
ATOM   6043  N  NE2 . GLN B 2  358 ? 42.555  96.563  63.491  1.00 35.32 ? 358  GLN B NE2 1 
ATOM   6044  N  N   . ALA B 2  359 ? 42.855  91.779  67.298  1.00 21.53 ? 359  ALA B N   1 
ATOM   6045  C  CA  . ALA B 2  359 ? 42.752  91.302  68.700  1.00 20.00 ? 359  ALA B CA  1 
ATOM   6046  C  C   . ALA B 2  359 ? 44.038  91.533  69.529  1.00 18.56 ? 359  ALA B C   1 
ATOM   6047  O  O   . ALA B 2  359 ? 43.964  92.020  70.661  1.00 18.37 ? 359  ALA B O   1 
ATOM   6048  C  CB  . ALA B 2  359 ? 42.330  89.820  68.750  1.00 19.22 ? 359  ALA B CB  1 
ATOM   6049  N  N   . ALA B 2  360 ? 45.181  91.183  68.934  1.00 17.65 ? 360  ALA B N   1 
ATOM   6050  C  CA  . ALA B 2  360 ? 46.513  91.364  69.506  1.00 18.26 ? 360  ALA B CA  1 
ATOM   6051  C  C   . ALA B 2  360 ? 46.895  92.849  69.713  1.00 18.31 ? 360  ALA B C   1 
ATOM   6052  O  O   . ALA B 2  360 ? 47.489  93.196  70.742  1.00 18.42 ? 360  ALA B O   1 
ATOM   6053  C  CB  . ALA B 2  360 ? 47.539  90.671  68.637  1.00 18.33 ? 360  ALA B CB  1 
ATOM   6054  N  N   . LYS B 2  361 ? 46.489  93.705  68.767  1.00 18.29 ? 361  LYS B N   1 
ATOM   6055  C  CA  . LYS B 2  361 ? 46.603  95.168  68.896  1.00 18.68 ? 361  LYS B CA  1 
ATOM   6056  C  C   . LYS B 2  361 ? 45.736  95.742  70.000  1.00 18.88 ? 361  LYS B C   1 
ATOM   6057  O  O   . LYS B 2  361 ? 46.236  96.548  70.781  1.00 18.62 ? 361  LYS B O   1 
ATOM   6058  C  CB  . LYS B 2  361 ? 46.357  95.878  67.574  1.00 18.47 ? 361  LYS B CB  1 
ATOM   6059  C  CG  . LYS B 2  361 ? 47.586  95.921  66.706  1.00 19.76 ? 361  LYS B CG  1 
ATOM   6060  C  CD  . LYS B 2  361 ? 47.234  95.933  65.245  1.00 20.91 ? 361  LYS B CD  1 
ATOM   6061  C  CE  . LYS B 2  361 ? 47.767  97.162  64.593  1.00 15.30 ? 361  LYS B CE  1 
ATOM   6062  N  NZ  . LYS B 2  361 ? 47.312  97.327  63.183  1.00 22.12 ? 361  LYS B NZ  1 
ATOM   6063  N  N   . ASN B 2  362 ? 44.515  95.188  70.158  1.00 19.03 ? 362  ASN B N   1 
ATOM   6064  C  CA  . ASN B 2  362 ? 43.628  95.499  71.290  1.00 18.96 ? 362  ASN B CA  1 
ATOM   6065  C  C   . ASN B 2  362 ? 44.158  95.107  72.661  1.00 18.74 ? 362  ASN B C   1 
ATOM   6066  O  O   . ASN B 2  362 ? 44.015  95.879  73.613  1.00 19.12 ? 362  ASN B O   1 
ATOM   6067  C  CB  . ASN B 2  362 ? 42.218  94.930  71.088  1.00 19.25 ? 362  ASN B CB  1 
ATOM   6068  C  CG  . ASN B 2  362 ? 41.418  95.653  69.998  1.00 24.66 ? 362  ASN B CG  1 
ATOM   6069  O  OD1 . ASN B 2  362 ? 40.460  95.083  69.479  1.00 18.66 ? 362  ASN B OD1 1 
ATOM   6070  N  ND2 . ASN B 2  362 ? 41.721  96.941  69.742  1.00 15.07 ? 362  ASN B ND2 1 
ATOM   6071  N  N   . LYS B 2  363 ? 44.804  93.942  72.745  1.00 18.38 ? 363  LYS B N   1 
ATOM   6072  C  CA  . LYS B 2  363 ? 45.432  93.474  73.988  1.00 18.88 ? 363  LYS B CA  1 
ATOM   6073  C  C   . LYS B 2  363 ? 46.641  94.339  74.384  1.00 19.87 ? 363  LYS B C   1 
ATOM   6074  O  O   . LYS B 2  363 ? 46.745  94.750  75.551  1.00 20.00 ? 363  LYS B O   1 
ATOM   6075  C  CB  . LYS B 2  363 ? 45.832  92.002  73.901  1.00 18.62 ? 363  LYS B CB  1 
ATOM   6076  C  CG  . LYS B 2  363 ? 44.694  91.016  73.920  1.00 20.44 ? 363  LYS B CG  1 
ATOM   6077  C  CD  . LYS B 2  363 ? 45.243  89.613  73.752  1.00 25.86 ? 363  LYS B CD  1 
ATOM   6078  C  CE  . LYS B 2  363 ? 44.384  88.760  72.843  1.00 29.22 ? 363  LYS B CE  1 
ATOM   6079  N  NZ  . LYS B 2  363 ? 44.913  87.365  72.833  1.00 25.99 ? 363  LYS B NZ  1 
ATOM   6080  N  N   . LEU B 2  364 ? 47.483  94.675  73.388  1.00 20.33 ? 364  LEU B N   1 
ATOM   6081  C  CA  . LEU B 2  364 ? 48.593  95.625  73.546  1.00 20.42 ? 364  LEU B CA  1 
ATOM   6082  C  C   . LEU B 2  364 ? 48.189  97.000  74.036  1.00 20.69 ? 364  LEU B C   1 
ATOM   6083  O  O   . LEU B 2  364 ? 48.647  97.406  75.099  1.00 21.18 ? 364  LEU B O   1 
ATOM   6084  C  CB  . LEU B 2  364 ? 49.469  95.716  72.289  1.00 19.95 ? 364  LEU B CB  1 
ATOM   6085  C  CG  . LEU B 2  364 ? 50.839  96.416  72.408  1.00 12.88 ? 364  LEU B CG  1 
ATOM   6086  C  CD1 . LEU B 2  364 ? 51.740  95.887  73.536  1.00 7.20  ? 364  LEU B CD1 1 
ATOM   6087  C  CD2 . LEU B 2  364 ? 51.547  96.342  71.081  1.00 12.45 ? 364  LEU B CD2 1 
ATOM   6088  N  N   . LYS B 2  365 ? 47.190  97.588  73.365  1.00 20.89 ? 365  LYS B N   1 
ATOM   6089  C  CA  . LYS B 2  365 ? 46.677  98.934  73.650  1.00 20.77 ? 365  LYS B CA  1 
ATOM   6090  C  C   . LYS B 2  365 ? 46.047  99.037  75.034  1.00 20.65 ? 365  LYS B C   1 
ATOM   6091  O  O   . LYS B 2  365 ? 46.399  99.941  75.782  1.00 20.87 ? 365  LYS B O   1 
ATOM   6092  C  CB  . LYS B 2  365 ? 45.680  99.382  72.573  1.00 21.04 ? 365  LYS B CB  1 
ATOM   6093  C  CG  . LYS B 2  365 ? 46.317  99.810  71.248  1.00 24.52 ? 365  LYS B CG  1 
ATOM   6094  C  CD  . LYS B 2  365 ? 45.351  100.607 70.420  1.00 27.93 ? 365  LYS B CD  1 
ATOM   6095  C  CE  . LYS B 2  365 ? 44.819  99.817  69.257  1.00 35.00 ? 365  LYS B CE  1 
ATOM   6096  N  NZ  . LYS B 2  365 ? 43.835  100.652 68.508  1.00 35.33 ? 365  LYS B NZ  1 
ATOM   6097  N  N   . ALA B 2  366 ? 45.218  98.046  75.402  1.00 20.83 ? 366  ALA B N   1 
ATOM   6098  C  CA  . ALA B 2  366 ? 44.593  97.971  76.733  1.00 21.05 ? 366  ALA B CA  1 
ATOM   6099  C  C   . ALA B 2  366 ? 45.613  97.726  77.843  1.00 21.10 ? 366  ALA B C   1 
ATOM   6100  O  O   . ALA B 2  366 ? 45.652  98.498  78.805  1.00 21.45 ? 366  ALA B O   1 
ATOM   6101  C  CB  . ALA B 2  366 ? 43.487  96.931  76.762  1.00 21.14 ? 366  ALA B CB  1 
ATOM   6102  N  N   . GLY B 2  367 ? 46.588  96.856  77.538  1.00 21.10 ? 367  GLY B N   1 
ATOM   6103  C  CA  . GLY B 2  367 ? 47.662  96.453  78.433  1.00 21.19 ? 367  GLY B CA  1 
ATOM   6104  C  C   . GLY B 2  367 ? 48.589  97.582  78.822  1.00 21.42 ? 367  GLY B C   1 
ATOM   6105  O  O   . GLY B 2  367 ? 48.837  97.772  80.013  1.00 21.28 ? 367  GLY B O   1 
ATOM   6106  N  N   . TYR B 2  368 ? 48.874  98.448  77.843  1.00 21.81 ? 368  TYR B N   1 
ATOM   6107  C  CA  . TYR B 2  368 ? 49.700  99.625  78.010  1.00 21.59 ? 368  TYR B CA  1 
ATOM   6108  C  C   . TYR B 2  368 ? 49.009  100.721 78.834  1.00 21.45 ? 368  TYR B C   1 
ATOM   6109  O  O   . TYR B 2  368 ? 49.659  101.390 79.661  1.00 21.84 ? 368  TYR B O   1 
ATOM   6110  C  CB  . TYR B 2  368 ? 50.162  100.160 76.640  1.00 21.94 ? 368  TYR B CB  1 
ATOM   6111  C  CG  . TYR B 2  368 ? 51.037  101.405 76.736  1.00 17.96 ? 368  TYR B CG  1 
ATOM   6112  C  CD1 . TYR B 2  368 ? 52.379  101.317 77.214  1.00 17.92 ? 368  TYR B CD1 1 
ATOM   6113  C  CD2 . TYR B 2  368 ? 50.471  102.695 76.551  1.00 12.17 ? 368  TYR B CD2 1 
ATOM   6114  C  CE1 . TYR B 2  368 ? 53.163  102.502 77.442  1.00 23.32 ? 368  TYR B CE1 1 
ATOM   6115  C  CE2 . TYR B 2  368 ? 51.231  103.873 76.796  1.00 19.37 ? 368  TYR B CE2 1 
ATOM   6116  C  CZ  . TYR B 2  368 ? 52.576  103.768 77.202  1.00 17.58 ? 368  TYR B CZ  1 
ATOM   6117  O  OH  . TYR B 2  368 ? 53.331  104.908 77.351  1.00 21.31 ? 368  TYR B OH  1 
ATOM   6118  N  N   . LEU B 2  369 ? 47.774  101.028 78.453  1.00 20.67 ? 369  LEU B N   1 
ATOM   6119  C  CA  . LEU B 2  369 ? 46.949  101.991 79.145  1.00 20.28 ? 369  LEU B CA  1 
ATOM   6120  C  C   . LEU B 2  369 ? 46.655  101.627 80.610  1.00 21.64 ? 369  LEU B C   1 
ATOM   6121  O  O   . LEU B 2  369 ? 46.696  102.497 81.478  1.00 22.85 ? 369  LEU B O   1 
ATOM   6122  C  CB  . LEU B 2  369 ? 45.669  102.239 78.360  1.00 19.42 ? 369  LEU B CB  1 
ATOM   6123  C  CG  . LEU B 2  369 ? 45.678  102.993 77.025  1.00 19.54 ? 369  LEU B CG  1 
ATOM   6124  C  CD1 . LEU B 2  369 ? 44.277  103.009 76.448  1.00 17.11 ? 369  LEU B CD1 1 
ATOM   6125  C  CD2 . LEU B 2  369 ? 46.180  104.416 77.161  1.00 20.72 ? 369  LEU B CD2 1 
ATOM   6126  N  N   . MET B 2  370 ? 46.518  100.332 80.880  1.00 21.74 ? 370  MET B N   1 
ATOM   6127  C  CA  . MET B 2  370 ? 46.412  99.799  82.238  1.00 22.07 ? 370  MET B CA  1 
ATOM   6128  C  C   . MET B 2  370 ? 47.723  99.863  83.015  1.00 21.96 ? 370  MET B C   1 
ATOM   6129  O  O   . MET B 2  370 ? 47.714  100.179 84.208  1.00 22.12 ? 370  MET B O   1 
ATOM   6130  C  CB  . MET B 2  370 ? 45.887  98.380  82.208  1.00 21.85 ? 370  MET B CB  1 
ATOM   6131  C  CG  . MET B 2  370 ? 44.363  98.264  82.024  1.00 23.11 ? 370  MET B CG  1 
ATOM   6132  S  SD  . MET B 2  370 ? 43.755  96.632  81.416  1.00 17.99 ? 370  MET B SD  1 
ATOM   6133  C  CE  . MET B 2  370 ? 44.810  95.451  82.333  1.00 32.15 ? 370  MET B CE  1 
ATOM   6134  N  N   . SER B 2  371 ? 48.834  99.640  82.302  1.00 21.59 ? 371  SER B N   1 
ATOM   6135  C  CA  . SER B 2  371 ? 50.204  99.756  82.811  1.00 21.39 ? 371  SER B CA  1 
ATOM   6136  C  C   . SER B 2  371 ? 50.551  101.168 83.350  1.00 21.26 ? 371  SER B C   1 
ATOM   6137  O  O   . SER B 2  371 ? 51.333  101.264 84.289  1.00 22.15 ? 371  SER B O   1 
ATOM   6138  C  CB  . SER B 2  371 ? 51.196  99.296  81.727  1.00 21.27 ? 371  SER B CB  1 
ATOM   6139  O  OG  . SER B 2  371 ? 52.504  99.812  81.899  1.00 42.94 ? 371  SER B OG  1 
ATOM   6140  N  N   . VAL B 2  372 ? 49.855  102.199 82.853  1.00 20.10 ? 372  VAL B N   1 
ATOM   6141  C  CA  . VAL B 2  372 ? 50.058  103.619 83.241  1.00 19.79 ? 372  VAL B CA  1 
ATOM   6142  C  C   . VAL B 2  372 ? 48.925  104.246 84.120  1.00 19.79 ? 372  VAL B C   1 
ATOM   6143  O  O   . VAL B 2  372 ? 48.946  105.453 84.402  1.00 19.97 ? 372  VAL B O   1 
ATOM   6144  C  CB  . VAL B 2  372 ? 50.459  104.542 81.992  1.00 19.57 ? 372  VAL B CB  1 
ATOM   6145  C  CG1 . VAL B 2  372 ? 51.748  104.054 81.354  1.00 17.50 ? 372  VAL B CG1 1 
ATOM   6146  C  CG2 . VAL B 2  372 ? 49.337  104.637 80.910  1.00 8.95  ? 372  VAL B CG2 1 
ATOM   6147  N  N   . GLU B 2  373 ? 48.048  103.382 84.647  1.00 19.74 ? 373  GLU B N   1 
ATOM   6148  C  CA  . GLU B 2  373 ? 46.918  103.732 85.524  1.00 20.24 ? 373  GLU B CA  1 
ATOM   6149  C  C   . GLU B 2  373 ? 47.323  104.307 86.889  1.00 20.56 ? 373  GLU B C   1 
ATOM   6150  O  O   . GLU B 2  373 ? 46.696  105.266 87.366  1.00 20.46 ? 373  GLU B O   1 
ATOM   6151  C  CB  . GLU B 2  373 ? 46.053  102.493 85.751  1.00 20.52 ? 373  GLU B CB  1 
ATOM   6152  C  CG  . GLU B 2  373 ? 44.610  102.635 85.364  1.00 18.07 ? 373  GLU B CG  1 
ATOM   6153  C  CD  . GLU B 2  373 ? 43.894  101.313 85.420  1.00 18.93 ? 373  GLU B CD  1 
ATOM   6154  O  OE1 . GLU B 2  373 ? 43.772  100.676 84.361  1.00 23.64 ? 373  GLU B OE1 1 
ATOM   6155  O  OE2 . GLU B 2  373 ? 43.517  100.879 86.532  1.00 22.73 ? 373  GLU B OE2 1 
ATOM   6156  N  N   . SER B 2  374 ? 48.202  103.580 87.586  1.00 21.11 ? 374  SER B N   1 
ATOM   6157  C  CA  . SER B 2  374 ? 48.778  103.990 88.871  1.00 21.88 ? 374  SER B CA  1 
ATOM   6158  C  C   . SER B 2  374 ? 49.842  105.043 88.652  1.00 23.51 ? 374  SER B C   1 
ATOM   6159  O  O   . SER B 2  374 ? 50.475  105.086 87.577  1.00 23.46 ? 374  SER B O   1 
ATOM   6160  C  CB  . SER B 2  374 ? 49.382  102.783 89.602  1.00 21.43 ? 374  SER B CB  1 
ATOM   6161  O  OG  . SER B 2  374 ? 50.422  102.188 88.840  1.00 21.12 ? 374  SER B OG  1 
ATOM   6162  N  N   . SER B 2  375 ? 50.032  105.880 89.685  1.00 25.07 ? 375  SER B N   1 
ATOM   6163  C  CA  . SER B 2  375 ? 51.229  106.708 89.885  1.00 26.08 ? 375  SER B CA  1 
ATOM   6164  C  C   . SER B 2  375 ? 52.571  105.975 89.668  1.00 26.83 ? 375  SER B C   1 
ATOM   6165  O  O   . SER B 2  375 ? 53.393  106.440 88.876  1.00 27.83 ? 375  SER B O   1 
ATOM   6166  C  CB  . SER B 2  375 ? 51.185  107.382 91.254  1.00 25.87 ? 375  SER B CB  1 
ATOM   6167  O  OG  . SER B 2  375 ? 50.166  108.350 91.295  1.00 26.48 ? 375  SER B OG  1 
ATOM   6168  N  N   . GLU B 2  376 ? 52.669  104.762 90.213  1.00 26.72 ? 376  GLU B N   1 
ATOM   6169  C  CA  . GLU B 2  376 ? 53.842  103.882 90.131  1.00 26.54 ? 376  GLU B CA  1 
ATOM   6170  C  C   . GLU B 2  376 ? 54.198  103.526 88.673  1.00 25.91 ? 376  GLU B C   1 
ATOM   6171  O  O   . GLU B 2  376 ? 55.375  103.547 88.302  1.00 26.61 ? 376  GLU B O   1 
ATOM   6172  C  CB  . GLU B 2  376 ? 53.580  102.611 90.974  1.00 26.57 ? 376  GLU B CB  1 
ATOM   6173  C  CG  . GLU B 2  376 ? 54.723  101.590 91.044  1.00 37.85 ? 376  GLU B CG  1 
ATOM   6174  C  CD  . GLU B 2  376 ? 54.592  100.624 92.215  1.00 41.76 ? 376  GLU B CD  1 
ATOM   6175  O  OE1 . GLU B 2  376 ? 54.742  101.066 93.382  1.00 43.50 ? 376  GLU B OE1 1 
ATOM   6176  O  OE2 . GLU B 2  376 ? 54.372  99.417  91.968  1.00 41.18 ? 376  GLU B OE2 1 
ATOM   6177  N  N   . GLY B 2  377 ? 53.179  103.124 87.906  1.00 24.50 ? 377  GLY B N   1 
ATOM   6178  C  CA  . GLY B 2  377 ? 53.318  102.710 86.519  1.00 22.69 ? 377  GLY B CA  1 
ATOM   6179  C  C   . GLY B 2  377 ? 53.556  103.865 85.567  1.00 21.46 ? 377  GLY B C   1 
ATOM   6180  O  O   . GLY B 2  377 ? 54.354  103.725 84.633  1.00 21.85 ? 377  GLY B O   1 
ATOM   6181  N  N   . PHE B 2  378 ? 52.869  104.992 85.812  1.00 19.56 ? 378  PHE B N   1 
ATOM   6182  C  CA  . PHE B 2  378 ? 53.054  106.240 85.071  1.00 18.29 ? 378  PHE B CA  1 
ATOM   6183  C  C   . PHE B 2  378 ? 54.471  106.826 85.223  1.00 18.37 ? 378  PHE B C   1 
ATOM   6184  O  O   . PHE B 2  378 ? 55.122  107.094 84.207  1.00 18.58 ? 378  PHE B O   1 
ATOM   6185  C  CB  . PHE B 2  378 ? 51.955  107.267 85.422  1.00 17.34 ? 378  PHE B CB  1 
ATOM   6186  C  CG  . PHE B 2  378 ? 52.042  108.564 84.638  1.00 9.85  ? 378  PHE B CG  1 
ATOM   6187  C  CD1 . PHE B 2  378 ? 51.668  108.617 83.265  1.00 5.93  ? 378  PHE B CD1 1 
ATOM   6188  C  CD2 . PHE B 2  378 ? 52.456  109.754 85.281  1.00 7.31  ? 378  PHE B CD2 1 
ATOM   6189  C  CE1 . PHE B 2  378 ? 51.758  109.831 82.513  1.00 15.59 ? 378  PHE B CE1 1 
ATOM   6190  C  CE2 . PHE B 2  378 ? 52.575  110.990 84.546  1.00 8.23  ? 378  PHE B CE2 1 
ATOM   6191  C  CZ  . PHE B 2  378 ? 52.187  111.035 83.163  1.00 12.99 ? 378  PHE B CZ  1 
ATOM   6192  N  N   . LEU B 2  379 ? 54.976  106.870 86.466  1.00 17.85 ? 379  LEU B N   1 
ATOM   6193  C  CA  . LEU B 2  379 ? 56.296  107.424 86.783  1.00 17.48 ? 379  LEU B CA  1 
ATOM   6194  C  C   . LEU B 2  379 ? 57.436  106.594 86.191  1.00 17.60 ? 379  LEU B C   1 
ATOM   6195  O  O   . LEU B 2  379 ? 58.384  107.179 85.660  1.00 16.88 ? 379  LEU B O   1 
ATOM   6196  C  CB  . LEU B 2  379 ? 56.478  107.641 88.291  1.00 16.95 ? 379  LEU B CB  1 
ATOM   6197  C  CG  . LEU B 2  379 ? 57.644  108.521 88.765  1.00 15.34 ? 379  LEU B CG  1 
ATOM   6198  C  CD1 . LEU B 2  379 ? 57.175  109.886 89.199  1.00 10.17 ? 379  LEU B CD1 1 
ATOM   6199  C  CD2 . LEU B 2  379 ? 58.385  107.857 89.892  1.00 13.00 ? 379  LEU B CD2 1 
ATOM   6200  N  N   . ASP B 2  380 ? 57.305  105.254 86.249  1.00 18.00 ? 380  ASP B N   1 
ATOM   6201  C  CA  . ASP B 2  380 ? 58.265  104.329 85.630  1.00 19.24 ? 380  ASP B CA  1 
ATOM   6202  C  C   . ASP B 2  380 ? 58.269  104.465 84.103  1.00 19.83 ? 380  ASP B C   1 
ATOM   6203  O  O   . ASP B 2  380 ? 59.346  104.499 83.500  1.00 20.57 ? 380  ASP B O   1 
ATOM   6204  C  CB  . ASP B 2  380 ? 58.048  102.853 86.074  1.00 19.74 ? 380  ASP B CB  1 
ATOM   6205  C  CG  . ASP B 2  380 ? 59.024  101.856 85.373  1.00 36.19 ? 380  ASP B CG  1 
ATOM   6206  O  OD1 . ASP B 2  380 ? 58.569  100.754 84.978  1.00 48.53 ? 380  ASP B OD1 1 
ATOM   6207  O  OD2 . ASP B 2  380 ? 60.238  102.105 85.127  1.00 39.97 ? 380  ASP B OD2 1 
ATOM   6208  N  N   . GLU B 2  381 ? 57.071  104.550 83.505  1.00 19.37 ? 381  GLU B N   1 
ATOM   6209  C  CA  . GLU B 2  381 ? 56.907  104.813 82.082  1.00 19.16 ? 381  GLU B CA  1 
ATOM   6210  C  C   . GLU B 2  381 ? 57.513  106.148 81.637  1.00 19.58 ? 381  GLU B C   1 
ATOM   6211  O  O   . GLU B 2  381 ? 58.313  106.146 80.711  1.00 21.01 ? 381  GLU B O   1 
ATOM   6212  C  CB  . GLU B 2  381 ? 55.443  104.679 81.648  1.00 18.74 ? 381  GLU B CB  1 
ATOM   6213  C  CG  . GLU B 2  381 ? 55.160  104.825 80.140  1.00 19.94 ? 381  GLU B CG  1 
ATOM   6214  C  CD  . GLU B 2  381 ? 55.964  103.884 79.247  1.00 31.03 ? 381  GLU B CD  1 
ATOM   6215  O  OE1 . GLU B 2  381 ? 56.412  104.325 78.172  1.00 35.87 ? 381  GLU B OE1 1 
ATOM   6216  O  OE2 . GLU B 2  381 ? 56.100  102.692 79.588  1.00 33.03 ? 381  GLU B OE2 1 
ATOM   6217  N  N   . VAL B 2  382 ? 57.210  107.226 82.363  1.00 18.66 ? 382  VAL B N   1 
ATOM   6218  C  CA  . VAL B 2  382 ? 57.771  108.578 82.110  1.00 18.50 ? 382  VAL B CA  1 
ATOM   6219  C  C   . VAL B 2  382 ? 59.303  108.639 82.302  1.00 19.77 ? 382  VAL B C   1 
ATOM   6220  O  O   . VAL B 2  382 ? 59.991  109.032 81.367  1.00 21.31 ? 382  VAL B O   1 
ATOM   6221  C  CB  . VAL B 2  382 ? 56.970  109.731 82.826  1.00 17.38 ? 382  VAL B CB  1 
ATOM   6222  C  CG1 . VAL B 2  382 ? 57.586  111.134 82.563  1.00 13.81 ? 382  VAL B CG1 1 
ATOM   6223  C  CG2 . VAL B 2  382 ? 55.568  109.778 82.301  1.00 2.00  ? 382  VAL B CG2 1 
ATOM   6224  N  N   . GLY B 2  383 ? 59.805  107.951 83.329  1.00 19.39 ? 383  GLY B N   1 
ATOM   6225  C  CA  . GLY B 2  383 ? 61.231  107.838 83.607  1.00 19.14 ? 383  GLY B CA  1 
ATOM   6226  C  C   . GLY B 2  383 ? 62.052  107.106 82.564  1.00 19.26 ? 383  GLY B C   1 
ATOM   6227  O  O   . GLY B 2  383 ? 63.107  107.626 82.137  1.00 19.33 ? 383  GLY B O   1 
ATOM   6228  N  N   . SER B 2  384 ? 61.587  105.903 82.195  1.00 18.69 ? 384  SER B N   1 
ATOM   6229  C  CA  . SER B 2  384 ? 62.174  105.075 81.134  1.00 19.44 ? 384  SER B CA  1 
ATOM   6230  C  C   . SER B 2  384 ? 62.189  105.738 79.761  1.00 19.76 ? 384  SER B C   1 
ATOM   6231  O  O   . SER B 2  384 ? 63.181  105.596 79.040  1.00 19.93 ? 384  SER B O   1 
ATOM   6232  C  CB  . SER B 2  384 ? 61.466  103.718 81.000  1.00 19.63 ? 384  SER B CB  1 
ATOM   6233  O  OG  . SER B 2  384 ? 61.193  103.094 82.233  1.00 23.61 ? 384  SER B OG  1 
ATOM   6234  N  N   . GLN B 2  385 ? 61.026  106.290 79.359  1.00 19.94 ? 385  GLN B N   1 
ATOM   6235  C  CA  . GLN B 2  385 ? 60.845  107.158 78.175  1.00 20.07 ? 385  GLN B CA  1 
ATOM   6236  C  C   . GLN B 2  385 ? 61.873  108.259 78.059  1.00 19.75 ? 385  GLN B C   1 
ATOM   6237  O  O   . GLN B 2  385 ? 62.628  108.255 77.091  1.00 20.62 ? 385  GLN B O   1 
ATOM   6238  C  CB  . GLN B 2  385 ? 59.463  107.783 78.169  1.00 20.13 ? 385  GLN B CB  1 
ATOM   6239  C  CG  . GLN B 2  385 ? 58.420  106.960 77.454  1.00 26.76 ? 385  GLN B CG  1 
ATOM   6240  C  CD  . GLN B 2  385 ? 57.269  107.793 76.979  1.00 27.51 ? 385  GLN B CD  1 
ATOM   6241  O  OE1 . GLN B 2  385 ? 56.111  107.474 77.243  1.00 20.15 ? 385  GLN B OE1 1 
ATOM   6242  N  NE2 . GLN B 2  385 ? 57.570  108.757 76.133  1.00 34.74 ? 385  GLN B NE2 1 
ATOM   6243  N  N   . ALA B 2  386 ? 62.087  108.962 79.177  1.00 18.49 ? 386  ALA B N   1 
ATOM   6244  C  CA  . ALA B 2  386 ? 63.011  110.093 79.286  1.00 17.73 ? 386  ALA B CA  1 
ATOM   6245  C  C   . ALA B 2  386 ? 64.477  109.675 79.073  1.00 18.20 ? 386  ALA B C   1 
ATOM   6246  O  O   . ALA B 2  386 ? 65.167  110.267 78.267  1.00 18.64 ? 386  ALA B O   1 
ATOM   6247  C  CB  . ALA B 2  386 ? 62.826  110.768 80.618  1.00 16.61 ? 386  ALA B CB  1 
ATOM   6248  N  N   . LEU B 2  387 ? 64.816  108.495 79.576  1.00 18.91 ? 387  LEU B N   1 
ATOM   6249  C  CA  . LEU B 2  387 ? 66.112  107.845 79.355  1.00 18.79 ? 387  LEU B CA  1 
ATOM   6250  C  C   . LEU B 2  387 ? 66.319  107.281 77.951  1.00 17.55 ? 387  LEU B C   1 
ATOM   6251  O  O   . LEU B 2  387 ? 67.315  107.598 77.308  1.00 17.32 ? 387  LEU B O   1 
ATOM   6252  C  CB  . LEU B 2  387 ? 66.344  106.776 80.440  1.00 19.22 ? 387  LEU B CB  1 
ATOM   6253  C  CG  . LEU B 2  387 ? 67.303  107.059 81.620  1.00 22.51 ? 387  LEU B CG  1 
ATOM   6254  C  CD1 . LEU B 2  387 ? 67.674  108.522 81.987  1.00 9.84  ? 387  LEU B CD1 1 
ATOM   6255  C  CD2 . LEU B 2  387 ? 66.932  106.270 82.832  1.00 13.16 ? 387  LEU B CD2 1 
ATOM   6256  N  N   . ALA B 2  388 ? 65.323  106.554 77.445  1.00 17.06 ? 388  ALA B N   1 
ATOM   6257  C  CA  . ALA B 2  388 ? 65.420  105.820 76.172  1.00 16.71 ? 388  ALA B CA  1 
ATOM   6258  C  C   . ALA B 2  388 ? 65.290  106.743 74.942  1.00 17.13 ? 388  ALA B C   1 
ATOM   6259  O  O   . ALA B 2  388 ? 66.170  106.722 74.069  1.00 17.80 ? 388  ALA B O   1 
ATOM   6260  C  CB  . ALA B 2  388 ? 64.393  104.694 76.126  1.00 16.00 ? 388  ALA B CB  1 
ATOM   6261  N  N   . ALA B 2  389 ? 64.304  107.661 74.992  1.00 16.47 ? 389  ALA B N   1 
ATOM   6262  C  CA  . ALA B 2  389 ? 63.856  108.494 73.853  1.00 15.01 ? 389  ALA B CA  1 
ATOM   6263  C  C   . ALA B 2  389 ? 64.182  109.996 73.978  1.00 15.17 ? 389  ALA B C   1 
ATOM   6264  O  O   . ALA B 2  389 ? 64.280  110.694 72.952  1.00 15.92 ? 389  ALA B O   1 
ATOM   6265  C  CB  . ALA B 2  389 ? 62.368  108.301 73.613  1.00 13.90 ? 389  ALA B CB  1 
ATOM   6266  N  N   . GLY B 2  390 ? 64.330  110.488 75.213  1.00 14.68 ? 390  GLY B N   1 
ATOM   6267  C  CA  . GLY B 2  390 ? 64.578  111.915 75.480  1.00 14.67 ? 390  GLY B CA  1 
ATOM   6268  C  C   . GLY B 2  390 ? 63.346  112.782 75.335  1.00 15.18 ? 390  GLY B C   1 
ATOM   6269  O  O   . GLY B 2  390 ? 63.464  114.004 75.269  1.00 15.50 ? 390  GLY B O   1 
ATOM   6270  N  N   . SER B 2  391 ? 62.165  112.146 75.414  1.00 15.69 ? 391  SER B N   1 
ATOM   6271  C  CA  . SER B 2  391 ? 60.853  112.764 75.157  1.00 15.62 ? 391  SER B CA  1 
ATOM   6272  C  C   . SER B 2  391 ? 59.784  112.087 76.005  1.00 15.42 ? 391  SER B C   1 
ATOM   6273  O  O   . SER B 2  391 ? 60.051  111.058 76.649  1.00 16.09 ? 391  SER B O   1 
ATOM   6274  C  CB  . SER B 2  391 ? 60.496  112.724 73.656  1.00 15.82 ? 391  SER B CB  1 
ATOM   6275  O  OG  . SER B 2  391 ? 60.249  111.399 73.207  1.00 29.65 ? 391  SER B OG  1 
ATOM   6276  N  N   . TYR B 2  392 ? 58.647  112.764 76.137  1.00 15.07 ? 392  TYR B N   1 
ATOM   6277  C  CA  . TYR B 2  392 ? 57.383  112.148 76.492  1.00 14.52 ? 392  TYR B CA  1 
ATOM   6278  C  C   . TYR B 2  392 ? 56.435  112.018 75.299  1.00 15.12 ? 392  TYR B C   1 
ATOM   6279  O  O   . TYR B 2  392 ? 56.070  113.016 74.648  1.00 14.79 ? 392  TYR B O   1 
ATOM   6280  C  CB  . TYR B 2  392 ? 56.722  112.876 77.684  1.00 13.95 ? 392  TYR B CB  1 
ATOM   6281  C  CG  . TYR B 2  392 ? 55.371  112.312 78.108  1.00 8.67  ? 392  TYR B CG  1 
ATOM   6282  C  CD1 . TYR B 2  392 ? 54.199  113.048 77.882  1.00 4.09  ? 392  TYR B CD1 1 
ATOM   6283  C  CD2 . TYR B 2  392 ? 55.245  110.968 78.604  1.00 13.49 ? 392  TYR B CD2 1 
ATOM   6284  C  CE1 . TYR B 2  392 ? 52.918  112.539 78.262  1.00 8.12  ? 392  TYR B CE1 1 
ATOM   6285  C  CE2 . TYR B 2  392 ? 53.966  110.402 78.866  1.00 6.23  ? 392  TYR B CE2 1 
ATOM   6286  C  CZ  . TYR B 2  392 ? 52.816  111.218 78.728  1.00 8.03  ? 392  TYR B CZ  1 
ATOM   6287  O  OH  . TYR B 2  392 ? 51.588  110.762 79.109  1.00 19.68 ? 392  TYR B OH  1 
ATOM   6288  N  N   . THR B 2  393 ? 55.949  110.790 75.123  1.00 16.00 ? 393  THR B N   1 
ATOM   6289  C  CA  . THR B 2  393 ? 54.997  110.394 74.089  1.00 16.66 ? 393  THR B CA  1 
ATOM   6290  C  C   . THR B 2  393 ? 53.669  110.126 74.838  1.00 17.03 ? 393  THR B C   1 
ATOM   6291  O  O   . THR B 2  393 ? 53.612  109.188 75.623  1.00 18.05 ? 393  THR B O   1 
ATOM   6292  C  CB  . THR B 2  393 ? 55.524  109.112 73.336  1.00 17.01 ? 393  THR B CB  1 
ATOM   6293  O  OG1 . THR B 2  393 ? 56.837  109.363 72.815  1.00 18.46 ? 393  THR B OG1 1 
ATOM   6294  C  CG2 . THR B 2  393 ? 54.691  108.790 72.084  1.00 9.12  ? 393  THR B CG2 1 
ATOM   6295  N  N   . PRO B 2  394 ? 52.627  110.955 74.625  1.00 16.95 ? 394  PRO B N   1 
ATOM   6296  C  CA  . PRO B 2  394 ? 51.290  110.696 75.215  1.00 16.51 ? 394  PRO B CA  1 
ATOM   6297  C  C   . PRO B 2  394 ? 50.641  109.334 74.813  1.00 16.67 ? 394  PRO B C   1 
ATOM   6298  O  O   . PRO B 2  394 ? 51.056  108.816 73.767  1.00 16.10 ? 394  PRO B O   1 
ATOM   6299  C  CB  . PRO B 2  394 ? 50.430  111.863 74.710  1.00 15.55 ? 394  PRO B CB  1 
ATOM   6300  C  CG  . PRO B 2  394 ? 51.307  112.757 73.955  1.00 13.95 ? 394  PRO B CG  1 
ATOM   6301  C  CD  . PRO B 2  394 ? 52.706  112.323 74.071  1.00 16.80 ? 394  PRO B CD  1 
ATOM   6302  N  N   . PRO B 2  395 ? 49.695  108.776 75.616  1.00 17.30 ? 395  PRO B N   1 
ATOM   6303  C  CA  . PRO B 2  395 ? 49.034  107.498 75.293  1.00 18.30 ? 395  PRO B CA  1 
ATOM   6304  C  C   . PRO B 2  395 ? 48.417  107.378 73.878  1.00 18.70 ? 395  PRO B C   1 
ATOM   6305  O  O   . PRO B 2  395 ? 48.759  106.398 73.206  1.00 19.43 ? 395  PRO B O   1 
ATOM   6306  C  CB  . PRO B 2  395 ? 47.942  107.408 76.362  1.00 18.53 ? 395  PRO B CB  1 
ATOM   6307  C  CG  . PRO B 2  395 ? 48.480  108.110 77.500  1.00 19.34 ? 395  PRO B CG  1 
ATOM   6308  C  CD  . PRO B 2  395 ? 49.238  109.255 76.948  1.00 16.79 ? 395  PRO B CD  1 
ATOM   6309  N  N   . SER B 2  396 ? 47.805  108.452 73.366  1.00 18.45 ? 396  SER B N   1 
ATOM   6310  C  CA  . SER B 2  396 ? 47.169  108.446 72.041  1.00 18.63 ? 396  SER B CA  1 
ATOM   6311  C  C   . SER B 2  396 ? 48.123  108.290 70.832  1.00 18.80 ? 396  SER B C   1 
ATOM   6312  O  O   . SER B 2  396 ? 47.692  107.786 69.765  1.00 18.81 ? 396  SER B O   1 
ATOM   6313  C  CB  . SER B 2  396 ? 46.215  109.632 71.865  1.00 18.75 ? 396  SER B CB  1 
ATOM   6314  O  OG  . SER B 2  396 ? 46.921  110.829 71.692  1.00 14.54 ? 396  SER B OG  1 
ATOM   6315  N  N   . THR B 2  397 ? 49.405  108.646 71.035  1.00 18.46 ? 397  THR B N   1 
ATOM   6316  C  CA  . THR B 2  397 ? 50.466  108.455 70.028  1.00 18.59 ? 397  THR B CA  1 
ATOM   6317  C  C   . THR B 2  397 ? 51.249  107.153 70.091  1.00 19.18 ? 397  THR B C   1 
ATOM   6318  O  O   . THR B 2  397 ? 51.799  106.720 69.066  1.00 18.90 ? 397  THR B O   1 
ATOM   6319  C  CB  . THR B 2  397 ? 51.370  109.745 69.747  1.00 18.42 ? 397  THR B CB  1 
ATOM   6320  O  OG1 . THR B 2  397 ? 52.697  109.380 69.339  1.00 27.61 ? 397  THR B OG1 1 
ATOM   6321  C  CG2 . THR B 2  397 ? 51.607  110.562 70.931  1.00 12.38 ? 397  THR B CG2 1 
ATOM   6322  N  N   . VAL B 2  398 ? 51.381  106.603 71.309  1.00 19.90 ? 398  VAL B N   1 
ATOM   6323  C  CA  . VAL B 2  398 ? 51.681  105.183 71.542  1.00 20.28 ? 398  VAL B CA  1 
ATOM   6324  C  C   . VAL B 2  398 ? 50.658  104.295 70.825  1.00 20.87 ? 398  VAL B C   1 
ATOM   6325  O  O   . VAL B 2  398 ? 51.059  103.473 70.007  1.00 21.20 ? 398  VAL B O   1 
ATOM   6326  C  CB  . VAL B 2  398 ? 51.844  104.829 73.080  1.00 20.47 ? 398  VAL B CB  1 
ATOM   6327  C  CG1 . VAL B 2  398 ? 52.208  103.365 73.284  1.00 8.72  ? 398  VAL B CG1 1 
ATOM   6328  C  CG2 . VAL B 2  398 ? 52.938  105.702 73.753  1.00 13.49 ? 398  VAL B CG2 1 
ATOM   6329  N  N   . LEU B 2  399 ? 49.365  104.627 70.988  1.00 21.41 ? 399  LEU B N   1 
ATOM   6330  C  CA  . LEU B 2  399 ? 48.237  103.911 70.371  1.00 21.59 ? 399  LEU B CA  1 
ATOM   6331  C  C   . LEU B 2  399 ? 48.187  104.031 68.840  1.00 21.33 ? 399  LEU B C   1 
ATOM   6332  O  O   . LEU B 2  399 ? 47.827  103.065 68.147  1.00 21.63 ? 399  LEU B O   1 
ATOM   6333  C  CB  . LEU B 2  399 ? 46.909  104.375 70.995  1.00 22.30 ? 399  LEU B CB  1 
ATOM   6334  C  CG  . LEU B 2  399 ? 46.433  104.052 72.444  1.00 33.11 ? 399  LEU B CG  1 
ATOM   6335  C  CD1 . LEU B 2  399 ? 44.924  103.838 72.495  1.00 30.49 ? 399  LEU B CD1 1 
ATOM   6336  C  CD2 . LEU B 2  399 ? 47.160  102.938 73.224  1.00 32.28 ? 399  LEU B CD2 1 
ATOM   6337  N  N   . GLN B 2  400 ? 48.570  105.211 68.337  1.00 20.72 ? 400  GLN B N   1 
ATOM   6338  C  CA  . GLN B 2  400 ? 48.779  105.496 66.908  1.00 20.03 ? 400  GLN B CA  1 
ATOM   6339  C  C   . GLN B 2  400 ? 49.945  104.680 66.316  1.00 19.61 ? 400  GLN B C   1 
ATOM   6340  O  O   . GLN B 2  400 ? 49.834  104.179 65.192  1.00 19.56 ? 400  GLN B O   1 
ATOM   6341  C  CB  . GLN B 2  400 ? 49.003  107.000 66.737  1.00 19.81 ? 400  GLN B CB  1 
ATOM   6342  C  CG  . GLN B 2  400 ? 49.347  107.505 65.357  1.00 2.84  ? 400  GLN B CG  1 
ATOM   6343  C  CD  . GLN B 2  400 ? 49.256  109.014 65.286  1.00 13.01 ? 400  GLN B CD  1 
ATOM   6344  O  OE1 . GLN B 2  400 ? 48.161  109.578 65.362  1.00 19.02 ? 400  GLN B OE1 1 
ATOM   6345  N  NE2 . GLN B 2  400 ? 50.401  109.675 65.148  1.00 8.79  ? 400  GLN B NE2 1 
ATOM   6346  N  N   . GLN B 2  401 ? 51.067  104.642 67.045  1.00 19.61 ? 401  GLN B N   1 
ATOM   6347  C  CA  . GLN B 2  401 ? 52.234  103.814 66.714  1.00 20.16 ? 401  GLN B CA  1 
ATOM   6348  C  C   . GLN B 2  401 ? 51.951  102.305 66.638  1.00 20.40 ? 401  GLN B C   1 
ATOM   6349  O  O   . GLN B 2  401 ? 52.324  101.673 65.647  1.00 19.78 ? 401  GLN B O   1 
ATOM   6350  C  CB  . GLN B 2  401 ? 53.398  104.106 67.658  1.00 20.35 ? 401  GLN B CB  1 
ATOM   6351  C  CG  . GLN B 2  401 ? 54.309  105.243 67.159  1.00 22.47 ? 401  GLN B CG  1 
ATOM   6352  C  CD  . GLN B 2  401 ? 54.890  106.119 68.275  1.00 19.40 ? 401  GLN B CD  1 
ATOM   6353  O  OE1 . GLN B 2  401 ? 55.244  105.627 69.349  1.00 17.58 ? 401  GLN B OE1 1 
ATOM   6354  N  NE2 . GLN B 2  401 ? 55.087  107.410 67.971  1.00 24.22 ? 401  GLN B NE2 1 
ATOM   6355  N  N   . ILE B 2  402 ? 51.166  101.798 67.606  1.00 21.32 ? 402  ILE B N   1 
ATOM   6356  C  CA  . ILE B 2  402 ? 50.637  100.408 67.619  1.00 22.06 ? 402  ILE B CA  1 
ATOM   6357  C  C   . ILE B 2  402 ? 49.783  100.131 66.379  1.00 22.13 ? 402  ILE B C   1 
ATOM   6358  O  O   . ILE B 2  402 ? 50.115  99.217  65.621  1.00 21.91 ? 402  ILE B O   1 
ATOM   6359  C  CB  . ILE B 2  402 ? 49.863  100.086 68.963  1.00 22.19 ? 402  ILE B CB  1 
ATOM   6360  C  CG1 . ILE B 2  402 ? 50.860  99.982  70.133  1.00 26.51 ? 402  ILE B CG1 1 
ATOM   6361  C  CG2 . ILE B 2  402 ? 49.051  98.768  68.849  1.00 21.78 ? 402  ILE B CG2 1 
ATOM   6362  C  CD1 . ILE B 2  402 ? 50.327  100.461 71.490  1.00 33.13 ? 402  ILE B CD1 1 
ATOM   6363  N  N   . ASP B 2  403 ? 48.879  101.078 66.068  1.00 22.04 ? 403  ASP B N   1 
ATOM   6364  C  CA  . ASP B 2  403 ? 47.951  100.975 64.932  1.00 21.81 ? 403  ASP B CA  1 
ATOM   6365  C  C   . ASP B 2  403 ? 48.614  100.858 63.560  1.00 21.01 ? 403  ASP B C   1 
ATOM   6366  O  O   . ASP B 2  403 ? 48.179  100.031 62.751  1.00 21.02 ? 403  ASP B O   1 
ATOM   6367  C  CB  . ASP B 2  403 ? 46.925  102.112 64.953  1.00 22.19 ? 403  ASP B CB  1 
ATOM   6368  C  CG  . ASP B 2  403 ? 45.747  101.834 65.890  1.00 33.99 ? 403  ASP B CG  1 
ATOM   6369  O  OD1 . ASP B 2  403 ? 45.179  102.817 66.420  1.00 35.79 ? 403  ASP B OD1 1 
ATOM   6370  O  OD2 . ASP B 2  403 ? 45.264  100.689 66.096  1.00 34.72 ? 403  ASP B OD2 1 
ATOM   6371  N  N   . ALA B 2  404 ? 49.777  101.515 63.420  1.00 20.50 ? 404  ALA B N   1 
ATOM   6372  C  CA  . ALA B 2  404 ? 50.568  101.585 62.178  1.00 20.51 ? 404  ALA B CA  1 
ATOM   6373  C  C   . ALA B 2  404 ? 51.294  100.273 61.799  1.00 20.55 ? 404  ALA B C   1 
ATOM   6374  O  O   . ALA B 2  404 ? 51.750  100.128 60.652  1.00 20.91 ? 404  ALA B O   1 
ATOM   6375  C  CB  . ALA B 2  404 ? 51.566  102.771 62.238  1.00 20.42 ? 404  ALA B CB  1 
ATOM   6376  N  N   . VAL B 2  405 ? 51.392  99.336  62.751  1.00 20.17 ? 405  VAL B N   1 
ATOM   6377  C  CA  . VAL B 2  405 ? 51.879  97.963  62.495  1.00 20.36 ? 405  VAL B CA  1 
ATOM   6378  C  C   . VAL B 2  405 ? 50.899  97.202  61.570  1.00 20.48 ? 405  VAL B C   1 
ATOM   6379  O  O   . VAL B 2  405 ? 49.727  97.015  61.919  1.00 20.42 ? 405  VAL B O   1 
ATOM   6380  C  CB  . VAL B 2  405 ? 52.179  97.172  63.832  1.00 20.39 ? 405  VAL B CB  1 
ATOM   6381  C  CG1 . VAL B 2  405 ? 52.720  95.773  63.551  1.00 23.95 ? 405  VAL B CG1 1 
ATOM   6382  C  CG2 . VAL B 2  405 ? 53.169  97.918  64.677  1.00 21.10 ? 405  VAL B CG2 1 
ATOM   6383  N  N   . ALA B 2  406 ? 51.344  96.987  60.326  1.00 20.66 ? 406  ALA B N   1 
ATOM   6384  C  CA  . ALA B 2  406 ? 50.669  96.103  59.356  1.00 20.54 ? 406  ALA B CA  1 
ATOM   6385  C  C   . ALA B 2  406 ? 50.895  94.616  59.697  1.00 20.69 ? 406  ALA B C   1 
ATOM   6386  O  O   . ALA B 2  406 ? 51.828  94.291  60.445  1.00 21.27 ? 406  ALA B O   1 
ATOM   6387  C  CB  . ALA B 2  406 ? 51.148  96.418  57.936  1.00 20.42 ? 406  ALA B CB  1 
ATOM   6388  N  N   . ASP B 2  407 ? 50.009  93.743  59.176  1.00 20.10 ? 407  ASP B N   1 
ATOM   6389  C  CA  . ASP B 2  407 ? 50.137  92.276  59.221  1.00 20.17 ? 407  ASP B CA  1 
ATOM   6390  C  C   . ASP B 2  407 ? 51.494  91.742  58.742  1.00 20.37 ? 407  ASP B C   1 
ATOM   6391  O  O   . ASP B 2  407 ? 52.040  90.792  59.349  1.00 20.62 ? 407  ASP B O   1 
ATOM   6392  C  CB  . ASP B 2  407 ? 49.010  91.608  58.415  1.00 20.20 ? 407  ASP B CB  1 
ATOM   6393  C  CG  . ASP B 2  407 ? 47.613  91.810  59.029  1.00 25.40 ? 407  ASP B CG  1 
ATOM   6394  O  OD1 . ASP B 2  407 ? 46.741  90.945  58.777  1.00 35.43 ? 407  ASP B OD1 1 
ATOM   6395  O  OD2 . ASP B 2  407 ? 47.258  92.811  59.692  1.00 20.18 ? 407  ASP B OD2 1 
ATOM   6396  N  N   . ALA B 2  408 ? 52.009  92.360  57.666  1.00 19.93 ? 408  ALA B N   1 
ATOM   6397  C  CA  . ALA B 2  408 ? 53.314  92.065  57.070  1.00 19.44 ? 408  ALA B CA  1 
ATOM   6398  C  C   . ALA B 2  408 ? 54.491  92.301  58.010  1.00 19.56 ? 408  ALA B C   1 
ATOM   6399  O  O   . ALA B 2  408 ? 55.454  91.523  57.978  1.00 19.62 ? 408  ALA B O   1 
ATOM   6400  C  CB  . ALA B 2  408 ? 53.499  92.833  55.747  1.00 18.74 ? 408  ALA B CB  1 
ATOM   6401  N  N   . ASP B 2  409 ? 54.405  93.360  58.840  1.00 19.85 ? 409  ASP B N   1 
ATOM   6402  C  CA  . ASP B 2  409 ? 55.412  93.674  59.873  1.00 19.98 ? 409  ASP B CA  1 
ATOM   6403  C  C   . ASP B 2  409 ? 55.503  92.555  60.935  1.00 20.38 ? 409  ASP B C   1 
ATOM   6404  O  O   . ASP B 2  409 ? 56.613  92.077  61.242  1.00 21.25 ? 409  ASP B O   1 
ATOM   6405  C  CB  . ASP B 2  409 ? 55.150  95.039  60.562  1.00 20.15 ? 409  ASP B CB  1 
ATOM   6406  C  CG  . ASP B 2  409 ? 54.982  96.225  59.576  1.00 22.51 ? 409  ASP B CG  1 
ATOM   6407  O  OD1 . ASP B 2  409 ? 55.798  96.376  58.633  1.00 16.64 ? 409  ASP B OD1 1 
ATOM   6408  O  OD2 . ASP B 2  409 ? 54.200  97.187  59.831  1.00 18.00 ? 409  ASP B OD2 1 
ATOM   6409  N  N   . VAL B 2  410 ? 54.330  92.085  61.390  1.00 19.60 ? 410  VAL B N   1 
ATOM   6410  C  CA  . VAL B 2  410 ? 54.161  90.942  62.330  1.00 18.87 ? 410  VAL B CA  1 
ATOM   6411  C  C   . VAL B 2  410 ? 54.737  89.626  61.758  1.00 18.61 ? 410  VAL B C   1 
ATOM   6412  O  O   . VAL B 2  410 ? 55.462  88.913  62.479  1.00 18.76 ? 410  VAL B O   1 
ATOM   6413  C  CB  . VAL B 2  410 ? 52.648  90.773  62.779  1.00 18.85 ? 410  VAL B CB  1 
ATOM   6414  C  CG1 . VAL B 2  410 ? 52.443  89.649  63.827  1.00 10.33 ? 410  VAL B CG1 1 
ATOM   6415  C  CG2 . VAL B 2  410 ? 52.123  92.052  63.353  1.00 12.40 ? 410  VAL B CG2 1 
ATOM   6416  N  N   . ILE B 2  411 ? 54.464  89.364  60.464  1.00 18.25 ? 411  ILE B N   1 
ATOM   6417  C  CA  . ILE B 2  411 ? 55.016  88.210  59.710  1.00 18.13 ? 411  ILE B CA  1 
ATOM   6418  C  C   . ILE B 2  411 ? 56.558  88.270  59.634  1.00 18.04 ? 411  ILE B C   1 
ATOM   6419  O  O   . ILE B 2  411 ? 57.234  87.292  60.001  1.00 17.71 ? 411  ILE B O   1 
ATOM   6420  C  CB  . ILE B 2  411 ? 54.327  88.052  58.286  1.00 18.07 ? 411  ILE B CB  1 
ATOM   6421  C  CG1 . ILE B 2  411 ? 52.868  87.581  58.447  1.00 22.15 ? 411  ILE B CG1 1 
ATOM   6422  C  CG2 . ILE B 2  411 ? 55.123  87.047  57.337  1.00 13.21 ? 411  ILE B CG2 1 
ATOM   6423  C  CD1 . ILE B 2  411 ? 51.912  87.968  57.278  1.00 14.32 ? 411  ILE B CD1 1 
ATOM   6424  N  N   . ASN B 2  412 ? 57.075  89.427  59.192  1.00 18.08 ? 412  ASN B N   1 
ATOM   6425  C  CA  . ASN B 2  412 ? 58.513  89.734  59.143  1.00 18.16 ? 412  ASN B CA  1 
ATOM   6426  C  C   . ASN B 2  412 ? 59.284  89.595  60.443  1.00 17.61 ? 412  ASN B C   1 
ATOM   6427  O  O   . ASN B 2  412 ? 60.366  88.978  60.441  1.00 18.26 ? 412  ASN B O   1 
ATOM   6428  C  CB  . ASN B 2  412 ? 58.783  91.103  58.476  1.00 17.98 ? 412  ASN B CB  1 
ATOM   6429  C  CG  . ASN B 2  412 ? 58.444  91.120  56.977  1.00 20.17 ? 412  ASN B CG  1 
ATOM   6430  O  OD1 . ASN B 2  412 ? 58.197  90.081  56.346  1.00 23.51 ? 412  ASN B OD1 1 
ATOM   6431  N  ND2 . ASN B 2  412 ? 58.377  92.319  56.417  1.00 22.29 ? 412  ASN B ND2 1 
ATOM   6432  N  N   . ALA B 2  413 ? 58.671  90.055  61.548  1.00 16.65 ? 413  ALA B N   1 
ATOM   6433  C  CA  . ALA B 2  413 ? 59.185  89.864  62.922  1.00 15.72 ? 413  ALA B CA  1 
ATOM   6434  C  C   . ALA B 2  413 ? 59.288  88.374  63.309  1.00 16.22 ? 413  ALA B C   1 
ATOM   6435  O  O   . ALA B 2  413 ? 60.370  87.921  63.734  1.00 16.52 ? 413  ALA B O   1 
ATOM   6436  C  CB  . ALA B 2  413 ? 58.350  90.645  63.939  1.00 14.88 ? 413  ALA B CB  1 
ATOM   6437  N  N   . ALA B 2  414 ? 58.229  87.612  62.998  1.00 15.89 ? 414  ALA B N   1 
ATOM   6438  C  CA  . ALA B 2  414 ? 58.218  86.138  63.120  1.00 16.08 ? 414  ALA B CA  1 
ATOM   6439  C  C   . ALA B 2  414 ? 59.238  85.411  62.238  1.00 17.26 ? 414  ALA B C   1 
ATOM   6440  O  O   . ALA B 2  414 ? 59.897  84.488  62.719  1.00 17.92 ? 414  ALA B O   1 
ATOM   6441  C  CB  . ALA B 2  414 ? 56.823  85.590  62.917  1.00 15.06 ? 414  ALA B CB  1 
ATOM   6442  N  N   . LYS B 2  415 ? 59.469  85.941  61.023  1.00 18.11 ? 415  LYS B N   1 
ATOM   6443  C  CA  . LYS B 2  415 ? 60.497  85.458  60.085  1.00 18.78 ? 415  LYS B CA  1 
ATOM   6444  C  C   . LYS B 2  415 ? 61.932  85.659  60.572  1.00 19.14 ? 415  LYS B C   1 
ATOM   6445  O  O   . LYS B 2  415 ? 62.784  84.758  60.384  1.00 19.17 ? 415  LYS B O   1 
ATOM   6446  C  CB  . LYS B 2  415 ? 60.328  86.091  58.707  1.00 18.94 ? 415  LYS B CB  1 
ATOM   6447  C  CG  . LYS B 2  415 ? 59.384  85.364  57.800  1.00 20.36 ? 415  LYS B CG  1 
ATOM   6448  C  CD  . LYS B 2  415 ? 59.856  85.429  56.345  1.00 31.19 ? 415  LYS B CD  1 
ATOM   6449  C  CE  . LYS B 2  415 ? 59.013  86.386  55.512  1.00 19.32 ? 415  LYS B CE  1 
ATOM   6450  N  NZ  . LYS B 2  415 ? 59.530  86.488  54.104  1.00 24.87 ? 415  LYS B NZ  1 
ATOM   6451  N  N   . LYS B 2  416 ? 62.159  86.780  61.268  1.00 19.78 ? 416  LYS B N   1 
ATOM   6452  C  CA  . LYS B 2  416 ? 63.468  87.126  61.858  1.00 20.30 ? 416  LYS B CA  1 
ATOM   6453  C  C   . LYS B 2  416 ? 63.831  86.214  63.016  1.00 19.89 ? 416  LYS B C   1 
ATOM   6454  O  O   . LYS B 2  416 ? 64.977  85.756  63.097  1.00 20.51 ? 416  LYS B O   1 
ATOM   6455  C  CB  . LYS B 2  416 ? 63.540  88.612  62.270  1.00 20.73 ? 416  LYS B CB  1 
ATOM   6456  C  CG  . LYS B 2  416 ? 64.954  89.194  62.209  1.00 29.25 ? 416  LYS B CG  1 
ATOM   6457  C  CD  . LYS B 2  416 ? 65.071  90.523  62.932  1.00 21.64 ? 416  LYS B CD  1 
ATOM   6458  C  CE  . LYS B 2  416 ? 65.889  91.492  62.119  1.00 32.42 ? 416  LYS B CE  1 
ATOM   6459  N  NZ  . LYS B 2  416 ? 66.191  92.730  62.894  1.00 39.87 ? 416  LYS B NZ  1 
ATOM   6460  N  N   . PHE B 2  417 ? 62.819  85.840  63.806  1.00 18.98 ? 417  PHE B N   1 
ATOM   6461  C  CA  . PHE B 2  417 ? 62.942  84.839  64.852  1.00 18.32 ? 417  PHE B CA  1 
ATOM   6462  C  C   . PHE B 2  417 ? 63.364  83.485  64.309  1.00 18.81 ? 417  PHE B C   1 
ATOM   6463  O  O   . PHE B 2  417 ? 64.408  82.967  64.722  1.00 19.15 ? 417  PHE B O   1 
ATOM   6464  C  CB  . PHE B 2  417 ? 61.661  84.754  65.711  1.00 18.69 ? 417  PHE B CB  1 
ATOM   6465  C  CG  . PHE B 2  417 ? 61.672  83.636  66.731  1.00 12.74 ? 417  PHE B CG  1 
ATOM   6466  C  CD1 . PHE B 2  417 ? 62.494  83.716  67.872  1.00 14.44 ? 417  PHE B CD1 1 
ATOM   6467  C  CD2 . PHE B 2  417 ? 60.979  82.424  66.469  1.00 15.17 ? 417  PHE B CD2 1 
ATOM   6468  C  CE1 . PHE B 2  417 ? 62.554  82.643  68.814  1.00 11.76 ? 417  PHE B CE1 1 
ATOM   6469  C  CE2 . PHE B 2  417 ? 61.032  81.347  67.382  1.00 17.93 ? 417  PHE B CE2 1 
ATOM   6470  C  CZ  . PHE B 2  417 ? 61.838  81.447  68.559  1.00 12.38 ? 417  PHE B CZ  1 
ATOM   6471  N  N   . VAL B 2  418 ? 62.634  83.002  63.294  1.00 18.72 ? 418  VAL B N   1 
ATOM   6472  C  CA  . VAL B 2  418 ? 62.803  81.655  62.725  1.00 18.18 ? 418  VAL B CA  1 
ATOM   6473  C  C   . VAL B 2  418 ? 64.205  81.500  62.091  1.00 18.00 ? 418  VAL B C   1 
ATOM   6474  O  O   . VAL B 2  418 ? 64.903  80.548  62.411  1.00 18.42 ? 418  VAL B O   1 
ATOM   6475  C  CB  . VAL B 2  418 ? 61.615  81.286  61.731  1.00 18.30 ? 418  VAL B CB  1 
ATOM   6476  C  CG1 . VAL B 2  418 ? 61.879  79.990  60.954  1.00 14.87 ? 418  VAL B CG1 1 
ATOM   6477  C  CG2 . VAL B 2  418 ? 60.282  81.175  62.491  1.00 15.32 ? 418  VAL B CG2 1 
ATOM   6478  N  N   . SER B 2  419 ? 64.641  82.508  61.326  1.00 17.58 ? 419  SER B N   1 
ATOM   6479  C  CA  . SER B 2  419 ? 65.964  82.511  60.659  1.00 17.49 ? 419  SER B CA  1 
ATOM   6480  C  C   . SER B 2  419 ? 67.169  82.959  61.531  1.00 16.97 ? 419  SER B C   1 
ATOM   6481  O  O   . SER B 2  419 ? 68.333  82.764  61.130  1.00 17.44 ? 419  SER B O   1 
ATOM   6482  C  CB  . SER B 2  419 ? 65.905  83.328  59.370  1.00 17.38 ? 419  SER B CB  1 
ATOM   6483  O  OG  . SER B 2  419 ? 65.457  84.634  59.646  1.00 20.94 ? 419  SER B OG  1 
ATOM   6484  N  N   . GLY B 2  420 ? 66.887  83.571  62.690  1.00 16.02 ? 420  GLY B N   1 
ATOM   6485  C  CA  . GLY B 2  420 ? 67.909  84.169  63.542  1.00 15.78 ? 420  GLY B CA  1 
ATOM   6486  C  C   . GLY B 2  420 ? 68.654  83.157  64.369  1.00 16.17 ? 420  GLY B C   1 
ATOM   6487  O  O   . GLY B 2  420 ? 68.059  82.159  64.814  1.00 16.28 ? 420  GLY B O   1 
ATOM   6488  N  N   . ARG B 2  421 ? 69.968  83.384  64.520  1.00 16.96 ? 421  ARG B N   1 
ATOM   6489  C  CA  . ARG B 2  421 ? 70.824  82.664  65.476  1.00 18.24 ? 421  ARG B CA  1 
ATOM   6490  C  C   . ARG B 2  421 ? 70.196  82.690  66.876  1.00 18.42 ? 421  ARG B C   1 
ATOM   6491  O  O   . ARG B 2  421 ? 69.766  83.738  67.354  1.00 19.01 ? 421  ARG B O   1 
ATOM   6492  C  CB  . ARG B 2  421 ? 72.236  83.279  65.524  1.00 19.07 ? 421  ARG B CB  1 
ATOM   6493  C  CG  . ARG B 2  421 ? 73.343  82.310  65.942  1.00 26.68 ? 421  ARG B CG  1 
ATOM   6494  C  CD  . ARG B 2  421 ? 74.486  82.229  64.920  1.00 46.50 ? 421  ARG B CD  1 
ATOM   6495  N  NE  . ARG B 2  421 ? 75.773  82.674  65.485  1.00 61.99 ? 421  ARG B NE  1 
ATOM   6496  C  CZ  . ARG B 2  421 ? 76.688  83.456  64.872  1.00 66.39 ? 421  ARG B CZ  1 
ATOM   6497  N  NH1 . ARG B 2  421 ? 76.499  83.939  63.640  1.00 70.48 ? 421  ARG B NH1 1 
ATOM   6498  N  NH2 . ARG B 2  421 ? 77.813  83.762  65.515  1.00 64.19 ? 421  ARG B NH2 1 
ATOM   6499  N  N   . LYS B 2  422 ? 70.024  81.508  67.448  1.00 17.99 ? 422  LYS B N   1 
ATOM   6500  C  CA  . LYS B 2  422 ? 69.231  81.360  68.656  1.00 17.72 ? 422  LYS B CA  1 
ATOM   6501  C  C   . LYS B 2  422 ? 70.003  81.449  69.953  1.00 16.77 ? 422  LYS B C   1 
ATOM   6502  O  O   . LYS B 2  422 ? 71.249  81.396  69.942  1.00 17.18 ? 422  LYS B O   1 
ATOM   6503  C  CB  . LYS B 2  422 ? 68.317  80.145  68.560  1.00 18.30 ? 422  LYS B CB  1 
ATOM   6504  C  CG  . LYS B 2  422 ? 66.957  80.584  68.095  1.00 21.49 ? 422  LYS B CG  1 
ATOM   6505  C  CD  . LYS B 2  422 ? 66.410  79.718  67.117  1.00 19.81 ? 422  LYS B CD  1 
ATOM   6506  C  CE  . LYS B 2  422 ? 65.446  80.491  66.317  1.00 13.08 ? 422  LYS B CE  1 
ATOM   6507  N  NZ  . LYS B 2  422 ? 65.896  80.423  64.903  1.00 13.17 ? 422  LYS B NZ  1 
ATOM   6508  N  N   . SER B 2  423 ? 69.296  81.889  70.993  1.00 14.99 ? 423  SER B N   1 
ATOM   6509  C  CA  . SER B 2  423 ? 69.748  81.742  72.380  1.00 14.16 ? 423  SER B CA  1 
ATOM   6510  C  C   . SER B 2  423 ? 68.748  80.950  73.171  1.00 13.94 ? 423  SER B C   1 
ATOM   6511  O  O   . SER B 2  423 ? 67.526  81.112  72.985  1.00 14.27 ? 423  SER B O   1 
ATOM   6512  C  CB  . SER B 2  423 ? 69.998  83.103  73.042  1.00 14.12 ? 423  SER B CB  1 
ATOM   6513  O  OG  . SER B 2  423 ? 70.842  83.912  72.244  1.00 13.67 ? 423  SER B OG  1 
ATOM   6514  N  N   . MET B 2  424 ? 69.271  80.078  74.034  1.00 13.93 ? 424  MET B N   1 
ATOM   6515  C  CA  . MET B 2  424 ? 68.465  79.186  74.880  1.00 14.10 ? 424  MET B CA  1 
ATOM   6516  C  C   . MET B 2  424 ? 69.013  79.095  76.293  1.00 13.60 ? 424  MET B C   1 
ATOM   6517  O  O   . MET B 2  424 ? 70.234  79.050  76.488  1.00 13.60 ? 424  MET B O   1 
ATOM   6518  C  CB  . MET B 2  424 ? 68.357  77.779  74.266  1.00 14.30 ? 424  MET B CB  1 
ATOM   6519  C  CG  . MET B 2  424 ? 67.160  76.944  74.763  1.00 14.02 ? 424  MET B CG  1 
ATOM   6520  S  SD  . MET B 2  424 ? 66.993  75.404  73.893  1.00 19.93 ? 424  MET B SD  1 
ATOM   6521  C  CE  . MET B 2  424 ? 65.709  74.535  75.013  1.00 4.10  ? 424  MET B CE  1 
ATOM   6522  N  N   . ALA B 2  425 ? 68.097  79.153  77.267  1.00 13.08 ? 425  ALA B N   1 
ATOM   6523  C  CA  . ALA B 2  425 ? 68.363  78.759  78.649  1.00 12.80 ? 425  ALA B CA  1 
ATOM   6524  C  C   . ALA B 2  425 ? 67.290  77.811  79.180  1.00 13.24 ? 425  ALA B C   1 
ATOM   6525  O  O   . ALA B 2  425 ? 66.090  77.995  78.905  1.00 13.22 ? 425  ALA B O   1 
ATOM   6526  C  CB  . ALA B 2  425 ? 68.500  79.947  79.530  1.00 12.07 ? 425  ALA B CB  1 
ATOM   6527  N  N   . ALA B 2  426 ? 67.750  76.779  79.898  1.00 13.39 ? 426  ALA B N   1 
ATOM   6528  C  CA  . ALA B 2  426 ? 66.884  75.748  80.477  1.00 13.45 ? 426  ALA B CA  1 
ATOM   6529  C  C   . ALA B 2  426 ? 67.355  75.310  81.842  1.00 14.02 ? 426  ALA B C   1 
ATOM   6530  O  O   . ALA B 2  426 ? 68.565  75.200  82.080  1.00 14.91 ? 426  ALA B O   1 
ATOM   6531  C  CB  . ALA B 2  426 ? 66.745  74.563  79.542  1.00 12.80 ? 426  ALA B CB  1 
ATOM   6532  N  N   . SER B 2  427 ? 66.404  75.198  82.766  1.00 13.98 ? 427  SER B N   1 
ATOM   6533  C  CA  . SER B 2  427 ? 66.623  74.536  84.042  1.00 14.95 ? 427  SER B CA  1 
ATOM   6534  C  C   . SER B 2  427 ? 65.586  73.463  84.353  1.00 15.61 ? 427  SER B C   1 
ATOM   6535  O  O   . SER B 2  427 ? 64.404  73.628  84.049  1.00 16.99 ? 427  SER B O   1 
ATOM   6536  C  CB  . SER B 2  427 ? 66.728  75.543  85.172  1.00 15.03 ? 427  SER B CB  1 
ATOM   6537  O  OG  . SER B 2  427 ? 65.483  76.146  85.408  1.00 29.37 ? 427  SER B OG  1 
ATOM   6538  N  N   . GLY B 2  428 ? 66.050  72.380  84.961  1.00 14.72 ? 428  GLY B N   1 
ATOM   6539  C  CA  . GLY B 2  428 ? 65.210  71.260  85.359  1.00 14.37 ? 428  GLY B CA  1 
ATOM   6540  C  C   . GLY B 2  428 ? 65.946  69.950  85.178  1.00 14.34 ? 428  GLY B C   1 
ATOM   6541  O  O   . GLY B 2  428 ? 67.190  69.906  85.117  1.00 14.32 ? 428  GLY B O   1 
ATOM   6542  N  N   . ASN B 2  429 ? 65.170  68.875  85.144  1.00 14.50 ? 429  ASN B N   1 
ATOM   6543  C  CA  . ASN B 2  429 ? 65.597  67.628  84.555  1.00 14.51 ? 429  ASN B CA  1 
ATOM   6544  C  C   . ASN B 2  429 ? 65.588  67.664  83.023  1.00 15.23 ? 429  ASN B C   1 
ATOM   6545  O  O   . ASN B 2  429 ? 64.532  67.548  82.383  1.00 16.71 ? 429  ASN B O   1 
ATOM   6546  C  CB  . ASN B 2  429 ? 64.793  66.462  85.119  1.00 14.40 ? 429  ASN B CB  1 
ATOM   6547  C  CG  . ASN B 2  429 ? 65.551  65.154  85.085  1.00 14.61 ? 429  ASN B CG  1 
ATOM   6548  O  OD1 . ASN B 2  429 ? 66.561  65.007  84.393  1.00 16.67 ? 429  ASN B OD1 1 
ATOM   6549  N  ND2 . ASN B 2  429 ? 65.008  64.162  85.762  1.00 19.13 ? 429  ASN B ND2 1 
ATOM   6550  N  N   . LEU B 2  430 ? 66.793  67.648  82.456  1.00 14.88 ? 430  LEU B N   1 
ATOM   6551  C  CA  . LEU B 2  430 ? 67.044  68.033  81.057  1.00 14.97 ? 430  LEU B CA  1 
ATOM   6552  C  C   . LEU B 2  430 ? 67.246  66.889  80.048  1.00 15.65 ? 430  LEU B C   1 
ATOM   6553  O  O   . LEU B 2  430 ? 67.441  67.158  78.853  1.00 16.59 ? 430  LEU B O   1 
ATOM   6554  C  CB  . LEU B 2  430 ? 68.173  69.088  80.968  1.00 14.53 ? 430  LEU B CB  1 
ATOM   6555  C  CG  . LEU B 2  430 ? 68.087  70.408  81.766  1.00 18.85 ? 430  LEU B CG  1 
ATOM   6556  C  CD1 . LEU B 2  430 ? 69.321  71.262  81.486  1.00 10.63 ? 430  LEU B CD1 1 
ATOM   6557  C  CD2 . LEU B 2  430 ? 66.802  71.218  81.518  1.00 15.42 ? 430  LEU B CD2 1 
ATOM   6558  N  N   . GLY B 2  431 ? 67.026  65.644  80.500  1.00 15.44 ? 431  GLY B N   1 
ATOM   6559  C  CA  . GLY B 2  431 ? 67.094  64.432  79.680  1.00 15.54 ? 431  GLY B CA  1 
ATOM   6560  C  C   . GLY B 2  431 ? 66.245  64.381  78.413  1.00 15.44 ? 431  GLY B C   1 
ATOM   6561  O  O   . GLY B 2  431 ? 66.554  63.602  77.505  1.00 16.35 ? 431  GLY B O   1 
ATOM   6562  N  N   . HIS B 2  432 ? 65.229  65.241  78.344  1.00 14.44 ? 432  HIS B N   1 
ATOM   6563  C  CA  . HIS B 2  432 ? 64.289  65.343  77.225  1.00 14.69 ? 432  HIS B CA  1 
ATOM   6564  C  C   . HIS B 2  432 ? 64.118  66.780  76.707  1.00 15.08 ? 432  HIS B C   1 
ATOM   6565  O  O   . HIS B 2  432 ? 63.215  67.052  75.913  1.00 15.64 ? 432  HIS B O   1 
ATOM   6566  C  CB  . HIS B 2  432 ? 62.946  64.724  77.636  1.00 14.97 ? 432  HIS B CB  1 
ATOM   6567  C  CG  . HIS B 2  432 ? 62.989  63.230  77.754  1.00 20.06 ? 432  HIS B CG  1 
ATOM   6568  N  ND1 . HIS B 2  432 ? 63.305  62.586  78.930  1.00 26.85 ? 432  HIS B ND1 1 
ATOM   6569  C  CD2 . HIS B 2  432 ? 62.907  62.264  76.811  1.00 20.13 ? 432  HIS B CD2 1 
ATOM   6570  C  CE1 . HIS B 2  432 ? 63.282  61.280  78.737  1.00 15.51 ? 432  HIS B CE1 1 
ATOM   6571  N  NE2 . HIS B 2  432 ? 63.074  61.059  77.453  1.00 22.48 ? 432  HIS B NE2 1 
ATOM   6572  N  N   . THR B 2  433 ? 65.012  67.677  77.149  1.00 15.18 ? 433  THR B N   1 
ATOM   6573  C  CA  . THR B 2  433 ? 65.111  69.069  76.680  1.00 15.02 ? 433  THR B CA  1 
ATOM   6574  C  C   . THR B 2  433 ? 66.151  69.175  75.547  1.00 15.54 ? 433  THR B C   1 
ATOM   6575  O  O   . THR B 2  433 ? 67.313  68.809  75.769  1.00 16.09 ? 433  THR B O   1 
ATOM   6576  C  CB  . THR B 2  433 ? 65.451  70.009  77.858  1.00 14.06 ? 433  THR B CB  1 
ATOM   6577  O  OG1 . THR B 2  433 ? 64.436  69.882  78.844  1.00 11.45 ? 433  THR B OG1 1 
ATOM   6578  C  CG2 . THR B 2  433 ? 65.318  71.496  77.461  1.00 8.38  ? 433  THR B CG2 1 
ATOM   6579  N  N   . PRO B 2  434 ? 65.731  69.593  74.340  1.00 15.74 ? 434  PRO B N   1 
ATOM   6580  C  CA  . PRO B 2  434 ? 66.645  69.663  73.176  1.00 17.65 ? 434  PRO B CA  1 
ATOM   6581  C  C   . PRO B 2  434 ? 67.686  70.815  73.198  1.00 20.31 ? 434  PRO B C   1 
ATOM   6582  O  O   . PRO B 2  434 ? 67.375  71.795  73.874  1.00 20.73 ? 434  PRO B O   1 
ATOM   6583  C  CB  . PRO B 2  434 ? 65.681  69.769  71.985  1.00 17.16 ? 434  PRO B CB  1 
ATOM   6584  C  CG  . PRO B 2  434 ? 64.451  70.384  72.554  1.00 16.13 ? 434  PRO B CG  1 
ATOM   6585  C  CD  . PRO B 2  434 ? 64.326  69.805  73.924  1.00 14.70 ? 434  PRO B CD  1 
ATOM   6586  N  N   . PHE B 2  435 ? 68.555  70.867  72.174  1.00 23.21 ? 435  PHE B N   1 
ATOM   6587  C  CA  . PHE B 2  435 ? 69.870  71.531  72.189  1.00 25.65 ? 435  PHE B CA  1 
ATOM   6588  C  C   . PHE B 2  435 ? 70.099  72.632  71.100  1.00 29.16 ? 435  PHE B C   1 
ATOM   6589  O  O   . PHE B 2  435 ? 71.271  72.857  70.673  1.00 32.16 ? 435  PHE B O   1 
ATOM   6590  C  CB  . PHE B 2  435 ? 70.960  70.469  71.997  1.00 24.60 ? 435  PHE B CB  1 
ATOM   6591  C  CG  . PHE B 2  435 ? 71.553  69.955  73.254  1.00 24.93 ? 435  PHE B CG  1 
ATOM   6592  C  CD1 . PHE B 2  435 ? 72.544  70.713  73.936  1.00 18.38 ? 435  PHE B CD1 1 
ATOM   6593  C  CD2 . PHE B 2  435 ? 71.401  68.573  73.578  1.00 19.32 ? 435  PHE B CD2 1 
ATOM   6594  C  CE1 . PHE B 2  435 ? 73.293  70.142  75.006  1.00 13.28 ? 435  PHE B CE1 1 
ATOM   6595  C  CE2 . PHE B 2  435 ? 72.112  67.993  74.672  1.00 21.11 ? 435  PHE B CE2 1 
ATOM   6596  C  CZ  . PHE B 2  435 ? 73.021  68.791  75.423  1.00 16.61 ? 435  PHE B CZ  1 
ATOM   6597  N  N   . ILE B 2  436 ? 69.083  73.444  70.791  1.00 28.83 ? 436  ILE B N   1 
ATOM   6598  C  CA  . ILE B 2  436 ? 69.084  74.350  69.576  1.00 27.79 ? 436  ILE B CA  1 
ATOM   6599  C  C   . ILE B 2  436 ? 69.239  73.586  68.243  1.00 27.14 ? 436  ILE B C   1 
ATOM   6600  O  O   . ILE B 2  436 ? 68.365  73.703  67.391  1.00 27.66 ? 436  ILE B O   1 
ATOM   6601  C  CB  . ILE B 2  436 ? 70.036  75.647  69.693  1.00 27.20 ? 436  ILE B CB  1 
ATOM   6602  C  CG1 . ILE B 2  436 ? 69.627  76.534  70.872  1.00 18.27 ? 436  ILE B CG1 1 
ATOM   6603  C  CG2 . ILE B 2  436 ? 70.110  76.480  68.320  1.00 12.78 ? 436  ILE B CG2 1 
ATOM   6604  C  CD1 . ILE B 2  436 ? 70.764  77.458  71.384  1.00 13.89 ? 436  ILE B CD1 1 
ATOM   6605  N  N   . ASP B 2  437 ? 70.432  73.016  68.012  1.00 26.43 ? 437  ASP B N   1 
ATOM   6606  C  CA  . ASP B 2  437 ? 70.706  71.823  67.178  1.00 26.74 ? 437  ASP B CA  1 
ATOM   6607  C  C   . ASP B 2  437 ? 69.530  70.965  66.734  1.00 27.06 ? 437  ASP B C   1 
ATOM   6608  O  O   . ASP B 2  437 ? 69.473  70.551  65.572  1.00 27.68 ? 437  ASP B O   1 
ATOM   6609  C  CB  . ASP B 2  437 ? 71.689  70.905  67.936  1.00 27.01 ? 437  ASP B CB  1 
ATOM   6610  C  CG  . ASP B 2  437 ? 73.105  71.011  67.440  1.00 33.93 ? 437  ASP B CG  1 
ATOM   6611  O  OD1 . ASP B 2  437 ? 73.491  72.057  66.856  1.00 39.94 ? 437  ASP B OD1 1 
ATOM   6612  O  OD2 . ASP B 2  437 ? 73.951  70.136  67.716  1.00 27.45 ? 437  ASP B OD2 1 
ATOM   6613  N  N   . GLU B 2  438 ? 68.650  70.659  67.694  1.00 27.02 ? 438  GLU B N   1 
ATOM   6614  C  CA  . GLU B 2  438 ? 67.710  69.539  67.654  1.00 27.79 ? 438  GLU B CA  1 
ATOM   6615  C  C   . GLU B 2  438 ? 66.285  70.049  67.448  1.00 29.11 ? 438  GLU B C   1 
ATOM   6616  O  O   . GLU B 2  438 ? 65.343  69.247  67.373  1.00 29.50 ? 438  GLU B O   1 
ATOM   6617  C  CB  . GLU B 2  438 ? 67.817  68.697  68.942  1.00 27.43 ? 438  GLU B CB  1 
ATOM   6618  C  CG  . GLU B 2  438 ? 69.211  68.135  69.222  1.00 18.76 ? 438  GLU B CG  1 
ATOM   6619  C  CD  . GLU B 2  438 ? 69.306  67.321  70.498  1.00 20.79 ? 438  GLU B CD  1 
ATOM   6620  O  OE1 . GLU B 2  438 ? 68.876  67.813  71.556  1.00 19.35 ? 438  GLU B OE1 1 
ATOM   6621  O  OE2 . GLU B 2  438 ? 70.003  66.274  70.479  1.00 28.14 ? 438  GLU B OE2 1 
ATOM   6622  N  N   . LEU B 2  439 ? 66.186  71.346  67.127  1.00 30.17 ? 439  LEU B N   1 
ATOM   6623  C  CA  . LEU B 2  439 ? 64.920  72.058  66.969  1.00 31.86 ? 439  LEU B CA  1 
ATOM   6624  C  C   . LEU B 2  439 ? 64.509  72.212  65.508  1.00 33.54 ? 439  LEU B C   1 
ATOM   6625  O  O   . LEU B 2  439 ? 63.315  72.331  65.209  1.00 34.10 ? 439  LEU B O   1 
ATOM   6626  C  CB  . LEU B 2  439 ? 64.986  73.438  67.644  1.00 31.80 ? 439  LEU B CB  1 
ATOM   6627  C  CG  . LEU B 2  439 ? 65.035  73.535  69.177  1.00 31.12 ? 439  LEU B CG  1 
ATOM   6628  C  CD1 . LEU B 2  439 ? 65.389  74.933  69.587  1.00 30.87 ? 439  LEU B CD1 1 
ATOM   6629  C  CD2 . LEU B 2  439 ? 63.720  73.130  69.824  1.00 29.79 ? 439  LEU B CD2 1 
ATOM   6630  O  OXT . LEU B 2  439 ? 65.362  72.271  64.616  1.00 34.24 ? 439  LEU B OXT 1 
ATOM   6631  N  N   . THR C 3  2   ? 66.141  90.129  123.457 1.00 64.06 ? 2    THR C N   1 
ATOM   6632  C  CA  . THR C 3  2   ? 66.511  89.250  124.614 1.00 63.99 ? 2    THR C CA  1 
ATOM   6633  C  C   . THR C 3  2   ? 65.862  89.652  125.953 1.00 62.74 ? 2    THR C C   1 
ATOM   6634  O  O   . THR C 3  2   ? 65.562  90.849  126.186 1.00 63.98 ? 2    THR C O   1 
ATOM   6635  C  CB  . THR C 3  2   ? 68.079  89.033  124.779 1.00 64.95 ? 2    THR C CB  1 
ATOM   6636  O  OG1 . THR C 3  2   ? 68.832  89.889  123.898 1.00 69.23 ? 2    THR C OG1 1 
ATOM   6637  C  CG2 . THR C 3  2   ? 68.483  87.606  124.337 1.00 71.38 ? 2    THR C CG2 1 
ATOM   6638  N  N   . ASN C 3  3   ? 65.438  88.617  126.693 1.00 59.41 ? 3    ASN C N   1 
ATOM   6639  C  CA  . ASN C 3  3   ? 65.047  88.706  128.107 1.00 56.05 ? 3    ASN C CA  1 
ATOM   6640  C  C   . ASN C 3  3   ? 66.228  88.963  129.037 1.00 52.85 ? 3    ASN C C   1 
ATOM   6641  O  O   . ASN C 3  3   ? 67.345  88.484  128.772 1.00 53.05 ? 3    ASN C O   1 
ATOM   6642  C  CB  . ASN C 3  3   ? 64.352  87.408  128.538 1.00 55.84 ? 3    ASN C CB  1 
ATOM   6643  C  CG  . ASN C 3  3   ? 63.200  87.644  129.508 1.00 56.09 ? 3    ASN C CG  1 
ATOM   6644  O  OD1 . ASN C 3  3   ? 63.360  88.268  130.566 1.00 57.04 ? 3    ASN C OD1 1 
ATOM   6645  N  ND2 . ASN C 3  3   ? 62.063  87.040  129.206 1.00 60.97 ? 3    ASN C ND2 1 
ATOM   6646  N  N   . ILE C 3  4   ? 65.959  89.690  130.132 1.00 49.50 ? 4    ILE C N   1 
ATOM   6647  C  CA  . ILE C 3  4   ? 66.843  89.771  131.326 1.00 46.55 ? 4    ILE C CA  1 
ATOM   6648  C  C   . ILE C 3  4   ? 67.047  88.374  131.976 1.00 43.60 ? 4    ILE C C   1 
ATOM   6649  O  O   . ILE C 3  4   ? 68.188  87.920  132.122 1.00 42.92 ? 4    ILE C O   1 
ATOM   6650  C  CB  . ILE C 3  4   ? 66.316  90.835  132.412 1.00 46.53 ? 4    ILE C CB  1 
ATOM   6651  C  CG1 . ILE C 3  4   ? 65.595  92.086  131.801 1.00 52.02 ? 4    ILE C CG1 1 
ATOM   6652  C  CG2 . ILE C 3  4   ? 67.395  91.144  133.494 1.00 46.39 ? 4    ILE C CG2 1 
ATOM   6653  C  CD1 . ILE C 3  4   ? 66.461  93.127  130.972 1.00 51.39 ? 4    ILE C CD1 1 
ATOM   6654  N  N   . ARG C 3  5   ? 65.930  87.650  132.136 1.00 41.45 ? 5    ARG C N   1 
ATOM   6655  C  CA  . ARG C 3  5   ? 65.831  86.309  132.751 1.00 39.51 ? 5    ARG C CA  1 
ATOM   6656  C  C   . ARG C 3  5   ? 66.756  85.234  132.147 1.00 37.95 ? 5    ARG C C   1 
ATOM   6657  O  O   . ARG C 3  5   ? 67.235  84.355  132.870 1.00 37.59 ? 5    ARG C O   1 
ATOM   6658  C  CB  . ARG C 3  5   ? 64.382  85.845  132.642 1.00 39.30 ? 5    ARG C CB  1 
ATOM   6659  C  CG  . ARG C 3  5   ? 63.879  84.926  133.726 1.00 31.11 ? 5    ARG C CG  1 
ATOM   6660  C  CD  . ARG C 3  5   ? 62.465  84.429  133.477 1.00 29.88 ? 5    ARG C CD  1 
ATOM   6661  N  NE  . ARG C 3  5   ? 62.448  83.369  132.466 1.00 32.50 ? 5    ARG C NE  1 
ATOM   6662  C  CZ  . ARG C 3  5   ? 62.083  83.485  131.185 1.00 25.65 ? 5    ARG C CZ  1 
ATOM   6663  N  NH1 . ARG C 3  5   ? 61.268  84.438  130.761 1.00 28.83 ? 5    ARG C NH1 1 
ATOM   6664  N  NH2 . ARG C 3  5   ? 62.383  82.509  130.363 1.00 19.39 ? 5    ARG C NH2 1 
ATOM   6665  N  N   . LYS C 3  6   ? 67.110  85.418  130.872 1.00 37.07 ? 6    LYS C N   1 
ATOM   6666  C  CA  . LYS C 3  6   ? 67.738  84.396  130.032 1.00 36.67 ? 6    LYS C CA  1 
ATOM   6667  C  C   . LYS C 3  6   ? 69.271  84.428  130.005 1.00 36.41 ? 6    LYS C C   1 
ATOM   6668  O  O   . LYS C 3  6   ? 69.903  83.379  129.753 1.00 36.98 ? 6    LYS C O   1 
ATOM   6669  C  CB  . LYS C 3  6   ? 67.199  84.497  128.611 1.00 36.64 ? 6    LYS C CB  1 
ATOM   6670  C  CG  . LYS C 3  6   ? 65.933  83.737  128.388 1.00 26.99 ? 6    LYS C CG  1 
ATOM   6671  C  CD  . LYS C 3  6   ? 65.774  83.463  126.925 1.00 31.45 ? 6    LYS C CD  1 
ATOM   6672  C  CE  . LYS C 3  6   ? 64.392  82.957  126.631 1.00 32.07 ? 6    LYS C CE  1 
ATOM   6673  N  NZ  . LYS C 3  6   ? 64.010  83.232  125.219 1.00 24.15 ? 6    LYS C NZ  1 
ATOM   6674  N  N   . SER C 3  7   ? 69.847  85.618  130.251 1.00 35.13 ? 7    SER C N   1 
ATOM   6675  C  CA  . SER C 3  7   ? 71.249  85.943  129.941 1.00 33.96 ? 7    SER C CA  1 
ATOM   6676  C  C   . SER C 3  7   ? 72.012  86.742  131.027 1.00 32.72 ? 7    SER C C   1 
ATOM   6677  O  O   . SER C 3  7   ? 73.232  86.917  130.910 1.00 33.04 ? 7    SER C O   1 
ATOM   6678  C  CB  . SER C 3  7   ? 71.347  86.644  128.573 1.00 34.09 ? 7    SER C CB  1 
ATOM   6679  O  OG  . SER C 3  7   ? 70.933  87.991  128.661 1.00 18.71 ? 7    SER C OG  1 
ATOM   6680  N  N   . HIS C 3  8   ? 71.280  87.315  131.999 1.00 31.20 ? 8    HIS C N   1 
ATOM   6681  C  CA  . HIS C 3  8   ? 71.845  87.745  133.290 1.00 29.73 ? 8    HIS C CA  1 
ATOM   6682  C  C   . HIS C 3  8   ? 72.497  86.536  134.009 1.00 29.37 ? 8    HIS C C   1 
ATOM   6683  O  O   . HIS C 3  8   ? 71.810  85.509  134.190 1.00 29.29 ? 8    HIS C O   1 
ATOM   6684  C  CB  . HIS C 3  8   ? 70.786  88.410  134.184 1.00 29.06 ? 8    HIS C CB  1 
ATOM   6685  C  CG  . HIS C 3  8   ? 71.327  88.931  135.485 1.00 30.09 ? 8    HIS C CG  1 
ATOM   6686  N  ND1 . HIS C 3  8   ? 71.981  90.143  135.589 1.00 33.21 ? 8    HIS C ND1 1 
ATOM   6687  C  CD2 . HIS C 3  8   ? 71.370  88.374  136.720 1.00 28.82 ? 8    HIS C CD2 1 
ATOM   6688  C  CE1 . HIS C 3  8   ? 72.367  90.326  136.840 1.00 30.86 ? 8    HIS C CE1 1 
ATOM   6689  N  NE2 . HIS C 3  8   ? 71.984  89.278  137.551 1.00 36.87 ? 8    HIS C NE2 1 
ATOM   6690  N  N   . PRO C 3  9   ? 73.797  86.644  134.384 1.00 28.70 ? 9    PRO C N   1 
ATOM   6691  C  CA  . PRO C 3  9   ? 74.615  85.478  134.791 1.00 28.22 ? 9    PRO C CA  1 
ATOM   6692  C  C   . PRO C 3  9   ? 74.093  84.727  136.010 1.00 28.24 ? 9    PRO C C   1 
ATOM   6693  O  O   . PRO C 3  9   ? 74.263  83.507  136.066 1.00 28.49 ? 9    PRO C O   1 
ATOM   6694  C  CB  . PRO C 3  9   ? 75.978  86.109  135.114 1.00 28.05 ? 9    PRO C CB  1 
ATOM   6695  C  CG  . PRO C 3  9   ? 75.989  87.342  134.340 1.00 22.54 ? 9    PRO C CG  1 
ATOM   6696  C  CD  . PRO C 3  9   ? 74.615  87.878  134.399 1.00 28.30 ? 9    PRO C CD  1 
ATOM   6697  N  N   . LEU C 3  10  ? 73.424  85.449  136.915 1.00 28.46 ? 10   LEU C N   1 
ATOM   6698  C  CA  . LEU C 3  10  ? 72.737  84.886  138.063 1.00 29.07 ? 10   LEU C CA  1 
ATOM   6699  C  C   . LEU C 3  10  ? 71.332  84.362  137.760 1.00 29.40 ? 10   LEU C C   1 
ATOM   6700  O  O   . LEU C 3  10  ? 71.030  83.223  138.100 1.00 29.10 ? 10   LEU C O   1 
ATOM   6701  C  CB  . LEU C 3  10  ? 72.734  85.873  139.253 1.00 29.29 ? 10   LEU C CB  1 
ATOM   6702  C  CG  . LEU C 3  10  ? 73.365  85.474  140.603 1.00 27.88 ? 10   LEU C CG  1 
ATOM   6703  C  CD1 . LEU C 3  10  ? 73.034  86.537  141.639 1.00 28.66 ? 10   LEU C CD1 1 
ATOM   6704  C  CD2 . LEU C 3  10  ? 72.935  84.065  141.131 1.00 21.43 ? 10   LEU C CD2 1 
ATOM   6705  N  N   . MET C 3  11  ? 70.531  85.161  137.045 1.00 30.48 ? 11   MET C N   1 
ATOM   6706  C  CA  . MET C 3  11  ? 69.151  84.814  136.682 1.00 31.86 ? 11   MET C CA  1 
ATOM   6707  C  C   . MET C 3  11  ? 69.043  83.657  135.673 1.00 32.20 ? 11   MET C C   1 
ATOM   6708  O  O   . MET C 3  11  ? 68.048  82.940  135.698 1.00 31.78 ? 11   MET C O   1 
ATOM   6709  C  CB  . MET C 3  11  ? 68.362  86.046  136.217 1.00 32.69 ? 11   MET C CB  1 
ATOM   6710  C  CG  . MET C 3  11  ? 67.474  86.683  137.309 1.00 53.72 ? 11   MET C CG  1 
ATOM   6711  S  SD  . MET C 3  11  ? 65.907  85.775  137.671 1.00 66.96 ? 11   MET C SD  1 
ATOM   6712  C  CE  . MET C 3  11  ? 64.644  87.048  137.230 1.00 66.44 ? 11   MET C CE  1 
ATOM   6713  N  N   . LYS C 3  12  ? 70.060  83.526  134.790 1.00 32.98 ? 12   LYS C N   1 
ATOM   6714  C  CA  . LYS C 3  12  ? 70.421  82.307  134.000 1.00 33.04 ? 12   LYS C CA  1 
ATOM   6715  C  C   . LYS C 3  12  ? 70.227  81.000  134.756 1.00 32.69 ? 12   LYS C C   1 
ATOM   6716  O  O   . LYS C 3  12  ? 69.425  80.169  134.321 1.00 33.27 ? 12   LYS C O   1 
ATOM   6717  C  CB  . LYS C 3  12  ? 71.894  82.380  133.527 1.00 33.32 ? 12   LYS C CB  1 
ATOM   6718  C  CG  . LYS C 3  12  ? 72.144  82.423  132.035 1.00 31.83 ? 12   LYS C CG  1 
ATOM   6719  C  CD  . LYS C 3  12  ? 73.617  82.110  131.741 1.00 31.78 ? 12   LYS C CD  1 
ATOM   6720  C  CE  . LYS C 3  12  ? 74.186  83.009  130.652 1.00 39.20 ? 12   LYS C CE  1 
ATOM   6721  N  NZ  . LYS C 3  12  ? 75.377  83.780  131.128 1.00 49.13 ? 12   LYS C NZ  1 
ATOM   6722  N  N   . ILE C 3  13  ? 70.852  80.897  135.944 1.00 32.54 ? 13   ILE C N   1 
ATOM   6723  C  CA  . ILE C 3  13  ? 70.858  79.676  136.783 1.00 32.73 ? 13   ILE C CA  1 
ATOM   6724  C  C   . ILE C 3  13  ? 69.452  79.356  137.313 1.00 33.10 ? 13   ILE C C   1 
ATOM   6725  O  O   . ILE C 3  13  ? 68.993  78.228  137.149 1.00 34.17 ? 13   ILE C O   1 
ATOM   6726  C  CB  . ILE C 3  13  ? 71.936  79.725  137.966 1.00 32.91 ? 13   ILE C CB  1 
ATOM   6727  C  CG1 . ILE C 3  13  ? 73.311  80.364  137.556 1.00 39.63 ? 13   ILE C CG1 1 
ATOM   6728  C  CG2 . ILE C 3  13  ? 72.035  78.352  138.739 1.00 29.92 ? 13   ILE C CG2 1 
ATOM   6729  C  CD1 . ILE C 3  13  ? 74.245  79.561  136.571 1.00 43.90 ? 13   ILE C CD1 1 
ATOM   6730  N  N   . VAL C 3  14  ? 68.761  80.381  137.833 1.00 32.65 ? 14   VAL C N   1 
ATOM   6731  C  CA  . VAL C 3  14  ? 67.348  80.323  138.276 1.00 31.85 ? 14   VAL C CA  1 
ATOM   6732  C  C   . VAL C 3  14  ? 66.422  79.932  137.110 1.00 31.12 ? 14   VAL C C   1 
ATOM   6733  O  O   . VAL C 3  14  ? 65.608  78.985  137.269 1.00 30.79 ? 14   VAL C O   1 
ATOM   6734  C  CB  . VAL C 3  14  ? 66.863  81.672  138.974 1.00 32.03 ? 14   VAL C CB  1 
ATOM   6735  C  CG1 . VAL C 3  14  ? 65.419  81.558  139.510 1.00 34.64 ? 14   VAL C CG1 1 
ATOM   6736  C  CG2 . VAL C 3  14  ? 67.789  82.064  140.138 1.00 39.20 ? 14   VAL C CG2 1 
ATOM   6737  N  N   . ASN C 3  15  ? 66.660  80.543  135.929 1.00 30.40 ? 15   ASN C N   1 
ATOM   6738  C  CA  . ASN C 3  15  ? 65.920  80.232  134.694 1.00 30.10 ? 15   ASN C CA  1 
ATOM   6739  C  C   . ASN C 3  15  ? 65.968  78.766  134.269 1.00 29.79 ? 15   ASN C C   1 
ATOM   6740  O  O   . ASN C 3  15  ? 64.931  78.117  134.252 1.00 29.05 ? 15   ASN C O   1 
ATOM   6741  C  CB  . ASN C 3  15  ? 66.260  81.177  133.539 1.00 29.92 ? 15   ASN C CB  1 
ATOM   6742  C  CG  . ASN C 3  15  ? 65.283  81.056  132.363 1.00 33.99 ? 15   ASN C CG  1 
ATOM   6743  O  OD1 . ASN C 3  15  ? 64.076  81.273  132.517 1.00 27.23 ? 15   ASN C OD1 1 
ATOM   6744  N  ND2 . ASN C 3  15  ? 65.809  80.697  131.185 1.00 29.86 ? 15   ASN C ND2 1 
ATOM   6745  N  N   . ASN C 3  16  ? 67.189  78.224  134.242 1.00 30.70 ? 16   ASN C N   1 
ATOM   6746  C  CA  . ASN C 3  16  ? 67.476  76.844  133.818 1.00 31.07 ? 16   ASN C CA  1 
ATOM   6747  C  C   . ASN C 3  16  ? 67.118  75.769  134.841 1.00 31.22 ? 16   ASN C C   1 
ATOM   6748  O  O   . ASN C 3  16  ? 66.992  74.583  134.470 1.00 32.07 ? 16   ASN C O   1 
ATOM   6749  C  CB  . ASN C 3  16  ? 68.942  76.694  133.338 1.00 31.08 ? 16   ASN C CB  1 
ATOM   6750  C  CG  . ASN C 3  16  ? 69.331  77.704  132.239 1.00 37.65 ? 16   ASN C CG  1 
ATOM   6751  O  OD1 . ASN C 3  16  ? 68.492  78.180  131.467 1.00 38.04 ? 16   ASN C OD1 1 
ATOM   6752  N  ND2 . ASN C 3  16  ? 70.621  78.045  132.189 1.00 46.26 ? 16   ASN C ND2 1 
ATOM   6753  N  N   . ALA C 3  17  ? 66.915  76.189  136.101 1.00 30.65 ? 17   ALA C N   1 
ATOM   6754  C  CA  . ALA C 3  17  ? 66.504  75.311  137.210 1.00 29.99 ? 17   ALA C CA  1 
ATOM   6755  C  C   . ALA C 3  17  ? 65.004  75.313  137.544 1.00 29.06 ? 17   ALA C C   1 
ATOM   6756  O  O   . ALA C 3  17  ? 64.475  74.271  137.953 1.00 29.71 ? 17   ALA C O   1 
ATOM   6757  C  CB  . ALA C 3  17  ? 67.335  75.602  138.461 1.00 30.27 ? 17   ALA C CB  1 
ATOM   6758  N  N   . PHE C 3  18  ? 64.350  76.481  137.435 1.00 27.86 ? 18   PHE C N   1 
ATOM   6759  C  CA  . PHE C 3  18  ? 63.000  76.721  138.000 1.00 27.27 ? 18   PHE C CA  1 
ATOM   6760  C  C   . PHE C 3  18  ? 61.938  77.336  137.066 1.00 25.89 ? 18   PHE C C   1 
ATOM   6761  O  O   . PHE C 3  18  ? 60.743  77.345  137.422 1.00 26.59 ? 18   PHE C O   1 
ATOM   6762  C  CB  . PHE C 3  18  ? 63.042  77.503  139.354 1.00 28.03 ? 18   PHE C CB  1 
ATOM   6763  C  CG  . PHE C 3  18  ? 64.035  76.965  140.374 1.00 40.91 ? 18   PHE C CG  1 
ATOM   6764  C  CD1 . PHE C 3  18  ? 63.867  75.668  140.960 1.00 51.58 ? 18   PHE C CD1 1 
ATOM   6765  C  CD2 . PHE C 3  18  ? 65.070  77.806  140.861 1.00 44.40 ? 18   PHE C CD2 1 
ATOM   6766  C  CE1 . PHE C 3  18  ? 64.810  75.166  141.944 1.00 53.95 ? 18   PHE C CE1 1 
ATOM   6767  C  CE2 . PHE C 3  18  ? 66.013  77.340  141.852 1.00 50.02 ? 18   PHE C CE2 1 
ATOM   6768  C  CZ  . PHE C 3  18  ? 65.886  76.011  142.387 1.00 53.21 ? 18   PHE C CZ  1 
ATOM   6769  N  N   . ILE C 3  19  ? 62.350  77.849  135.897 1.00 23.70 ? 19   ILE C N   1 
ATOM   6770  C  CA  . ILE C 3  19  ? 61.421  78.534  134.980 1.00 22.08 ? 19   ILE C CA  1 
ATOM   6771  C  C   . ILE C 3  19  ? 61.249  77.807  133.643 1.00 20.65 ? 19   ILE C C   1 
ATOM   6772  O  O   . ILE C 3  19  ? 60.112  77.551  133.221 1.00 19.95 ? 19   ILE C O   1 
ATOM   6773  C  CB  . ILE C 3  19  ? 61.724  80.095  134.771 1.00 22.04 ? 19   ILE C CB  1 
ATOM   6774  C  CG1 . ILE C 3  19  ? 62.529  80.787  135.916 1.00 34.68 ? 19   ILE C CG1 1 
ATOM   6775  C  CG2 . ILE C 3  19  ? 60.501  80.862  134.235 1.00 17.39 ? 19   ILE C CG2 1 
ATOM   6776  C  CD1 . ILE C 3  19  ? 61.872  80.987  137.264 1.00 45.88 ? 19   ILE C CD1 1 
ATOM   6777  N  N   . ASP C 3  20  ? 62.360  77.677  132.916 1.00 19.88 ? 20   ASP C N   1 
ATOM   6778  C  CA  . ASP C 3  20  ? 62.369  77.227  131.526 1.00 18.95 ? 20   ASP C CA  1 
ATOM   6779  C  C   . ASP C 3  20  ? 62.820  75.768  131.400 1.00 18.56 ? 20   ASP C C   1 
ATOM   6780  O  O   . ASP C 3  20  ? 62.753  75.190  130.297 1.00 19.58 ? 20   ASP C O   1 
ATOM   6781  C  CB  . ASP C 3  20  ? 63.236  78.155  130.678 1.00 18.90 ? 20   ASP C CB  1 
ATOM   6782  C  CG  . ASP C 3  20  ? 62.445  79.331  130.055 1.00 26.89 ? 20   ASP C CG  1 
ATOM   6783  O  OD1 . ASP C 3  20  ? 63.025  80.014  129.172 1.00 22.50 ? 20   ASP C OD1 1 
ATOM   6784  O  OD2 . ASP C 3  20  ? 61.344  79.768  130.473 1.00 10.88 ? 20   ASP C OD2 1 
ATOM   6785  N  N   . LEU C 3  21  ? 63.077  75.139  132.553 1.00 17.05 ? 21   LEU C N   1 
ATOM   6786  C  CA  . LEU C 3  21  ? 63.504  73.760  132.648 1.00 16.55 ? 21   LEU C CA  1 
ATOM   6787  C  C   . LEU C 3  21  ? 62.442  72.833  132.007 1.00 16.39 ? 21   LEU C C   1 
ATOM   6788  O  O   . LEU C 3  21  ? 61.248  72.899  132.401 1.00 15.37 ? 21   LEU C O   1 
ATOM   6789  C  CB  . LEU C 3  21  ? 63.826  73.366  134.107 1.00 16.39 ? 21   LEU C CB  1 
ATOM   6790  C  CG  . LEU C 3  21  ? 64.130  71.887  134.438 1.00 18.84 ? 21   LEU C CG  1 
ATOM   6791  C  CD1 . LEU C 3  21  ? 65.565  71.507  134.114 1.00 27.24 ? 21   LEU C CD1 1 
ATOM   6792  C  CD2 . LEU C 3  21  ? 63.816  71.591  135.883 1.00 21.72 ? 21   LEU C CD2 1 
ATOM   6793  N  N   . PRO C 3  22  ? 62.822  72.149  130.898 1.00 16.32 ? 22   PRO C N   1 
ATOM   6794  C  CA  . PRO C 3  22  ? 61.927  71.139  130.296 1.00 15.51 ? 22   PRO C CA  1 
ATOM   6795  C  C   . PRO C 3  22  ? 61.678  70.011  131.276 1.00 15.72 ? 22   PRO C C   1 
ATOM   6796  O  O   . PRO C 3  22  ? 62.648  69.600  131.921 1.00 16.62 ? 22   PRO C O   1 
ATOM   6797  C  CB  . PRO C 3  22  ? 62.690  70.656  129.061 1.00 15.18 ? 22   PRO C CB  1 
ATOM   6798  C  CG  . PRO C 3  22  ? 63.812  71.718  128.822 1.00 14.61 ? 22   PRO C CG  1 
ATOM   6799  C  CD  . PRO C 3  22  ? 64.139  72.178  130.210 1.00 15.59 ? 22   PRO C CD  1 
ATOM   6800  N  N   . ALA C 3  23  ? 60.403  69.837  131.632 1.00 14.98 ? 23   ALA C N   1 
ATOM   6801  C  CA  . ALA C 3  23  ? 59.959  68.836  132.601 1.00 16.14 ? 23   ALA C CA  1 
ATOM   6802  C  C   . ALA C 3  23  ? 58.958  67.849  131.957 1.00 15.91 ? 23   ALA C C   1 
ATOM   6803  O  O   . ALA C 3  23  ? 58.151  68.295  131.108 1.00 15.97 ? 23   ALA C O   1 
ATOM   6804  C  CB  . ALA C 3  23  ? 59.321  69.532  133.795 1.00 16.57 ? 23   ALA C CB  1 
ATOM   6805  N  N   . PRO C 3  24  ? 58.961  66.545  132.346 1.00 15.56 ? 24   PRO C N   1 
ATOM   6806  C  CA  . PRO C 3  24  ? 57.924  65.605  131.856 1.00 15.23 ? 24   PRO C CA  1 
ATOM   6807  C  C   . PRO C 3  24  ? 56.541  66.109  132.211 1.00 15.95 ? 24   PRO C C   1 
ATOM   6808  O  O   . PRO C 3  24  ? 56.389  66.708  133.284 1.00 16.60 ? 24   PRO C O   1 
ATOM   6809  C  CB  . PRO C 3  24  ? 58.225  64.310  132.617 1.00 14.49 ? 24   PRO C CB  1 
ATOM   6810  C  CG  . PRO C 3  24  ? 59.657  64.422  132.991 1.00 14.76 ? 24   PRO C CG  1 
ATOM   6811  C  CD  . PRO C 3  24  ? 59.854  65.865  133.317 1.00 15.45 ? 24   PRO C CD  1 
ATOM   6812  N  N   . SER C 3  25  ? 55.672  66.171  131.208 1.00 16.76 ? 25   SER C N   1 
ATOM   6813  C  CA  . SER C 3  25  ? 54.226  66.399  131.401 1.00 17.68 ? 25   SER C CA  1 
ATOM   6814  C  C   . SER C 3  25  ? 53.554  65.538  132.486 1.00 18.86 ? 25   SER C C   1 
ATOM   6815  O  O   . SER C 3  25  ? 52.540  65.965  133.068 1.00 19.06 ? 25   SER C O   1 
ATOM   6816  C  CB  . SER C 3  25  ? 53.496  66.207  130.086 1.00 17.83 ? 25   SER C CB  1 
ATOM   6817  O  OG  . SER C 3  25  ? 53.652  64.873  129.620 1.00 21.79 ? 25   SER C OG  1 
ATOM   6818  N  N   . ASN C 3  26  ? 54.074  64.311  132.678 1.00 19.60 ? 26   ASN C N   1 
ATOM   6819  C  CA  . ASN C 3  26  ? 53.368  63.205  133.372 1.00 20.04 ? 26   ASN C CA  1 
ATOM   6820  C  C   . ASN C 3  26  ? 53.891  62.823  134.783 1.00 20.68 ? 26   ASN C C   1 
ATOM   6821  O  O   . ASN C 3  26  ? 53.434  61.827  135.343 1.00 21.05 ? 26   ASN C O   1 
ATOM   6822  C  CB  . ASN C 3  26  ? 53.297  61.964  132.440 1.00 19.39 ? 26   ASN C CB  1 
ATOM   6823  C  CG  . ASN C 3  26  ? 54.638  61.234  132.316 1.00 23.00 ? 26   ASN C CG  1 
ATOM   6824  O  OD1 . ASN C 3  26  ? 55.678  61.856  132.096 1.00 18.90 ? 26   ASN C OD1 1 
ATOM   6825  N  ND2 . ASN C 3  26  ? 54.626  59.921  132.558 1.00 18.54 ? 26   ASN C ND2 1 
ATOM   6826  N  N   . ILE C 3  27  ? 54.903  63.547  135.301 1.00 21.44 ? 27   ILE C N   1 
ATOM   6827  C  CA  . ILE C 3  27  ? 55.412  63.317  136.682 1.00 21.46 ? 27   ILE C CA  1 
ATOM   6828  C  C   . ILE C 3  27  ? 54.379  63.557  137.773 1.00 21.70 ? 27   ILE C C   1 
ATOM   6829  O  O   . ILE C 3  27  ? 53.570  64.483  137.677 1.00 21.85 ? 27   ILE C O   1 
ATOM   6830  C  CB  . ILE C 3  27  ? 56.802  63.972  137.006 1.00 21.36 ? 27   ILE C CB  1 
ATOM   6831  C  CG1 . ILE C 3  27  ? 56.828  65.473  136.722 1.00 27.20 ? 27   ILE C CG1 1 
ATOM   6832  C  CG2 . ILE C 3  27  ? 57.920  63.213  136.297 1.00 16.84 ? 27   ILE C CG2 1 
ATOM   6833  C  CD1 . ILE C 3  27  ? 57.888  66.339  137.520 1.00 22.15 ? 27   ILE C CD1 1 
ATOM   6834  N  N   . SER C 3  28  ? 54.250  62.541  138.621 1.00 21.88 ? 28   SER C N   1 
ATOM   6835  C  CA  . SER C 3  28  ? 53.230  62.464  139.659 1.00 21.95 ? 28   SER C CA  1 
ATOM   6836  C  C   . SER C 3  28  ? 53.658  63.177  140.964 1.00 21.28 ? 28   SER C C   1 
ATOM   6837  O  O   . SER C 3  28  ? 54.778  63.685  141.069 1.00 20.45 ? 28   SER C O   1 
ATOM   6838  C  CB  . SER C 3  28  ? 52.915  60.997  139.933 1.00 22.22 ? 28   SER C CB  1 
ATOM   6839  O  OG  . SER C 3  28  ? 54.079  60.345  140.417 1.00 27.46 ? 28   SER C OG  1 
ATOM   6840  N  N   . SER C 3  29  ? 52.693  63.298  141.886 1.00 21.36 ? 29   SER C N   1 
ATOM   6841  C  CA  . SER C 3  29  ? 52.868  63.339  143.353 1.00 21.34 ? 29   SER C CA  1 
ATOM   6842  C  C   . SER C 3  29  ? 54.194  62.892  143.968 1.00 20.33 ? 29   SER C C   1 
ATOM   6843  O  O   . SER C 3  29  ? 54.726  63.589  144.835 1.00 20.59 ? 29   SER C O   1 
ATOM   6844  C  CB  . SER C 3  29  ? 51.707  62.611  144.036 1.00 21.57 ? 29   SER C CB  1 
ATOM   6845  O  OG  . SER C 3  29  ? 50.645  63.517  144.228 1.00 36.54 ? 29   SER C OG  1 
ATOM   6846  N  N   . TRP C 3  30  ? 54.720  61.759  143.492 1.00 18.99 ? 30   TRP C N   1 
ATOM   6847  C  CA  . TRP C 3  30  ? 55.968  61.178  143.983 1.00 18.42 ? 30   TRP C CA  1 
ATOM   6848  C  C   . TRP C 3  30  ? 57.236  61.974  143.657 1.00 18.87 ? 30   TRP C C   1 
ATOM   6849  O  O   . TRP C 3  30  ? 58.303  61.651  144.189 1.00 19.40 ? 30   TRP C O   1 
ATOM   6850  C  CB  . TRP C 3  30  ? 56.100  59.740  143.510 1.00 17.99 ? 30   TRP C CB  1 
ATOM   6851  C  CG  . TRP C 3  30  ? 55.070  58.815  144.088 1.00 24.26 ? 30   TRP C CG  1 
ATOM   6852  C  CD1 . TRP C 3  30  ? 54.080  58.168  143.398 1.00 23.30 ? 30   TRP C CD1 1 
ATOM   6853  C  CD2 . TRP C 3  30  ? 54.919  58.419  145.465 1.00 16.56 ? 30   TRP C CD2 1 
ATOM   6854  N  NE1 . TRP C 3  30  ? 53.251  57.506  144.268 1.00 16.70 ? 30   TRP C NE1 1 
ATOM   6855  C  CE2 . TRP C 3  30  ? 53.778  57.568  145.530 1.00 21.87 ? 30   TRP C CE2 1 
ATOM   6856  C  CE3 . TRP C 3  30  ? 55.641  58.678  146.654 1.00 15.21 ? 30   TRP C CE3 1 
ATOM   6857  C  CZ2 . TRP C 3  30  ? 53.335  56.957  146.744 1.00 27.66 ? 30   TRP C CZ2 1 
ATOM   6858  C  CZ3 . TRP C 3  30  ? 55.196  58.080  147.875 1.00 22.21 ? 30   TRP C CZ3 1 
ATOM   6859  C  CH2 . TRP C 3  30  ? 54.042  57.241  147.902 1.00 22.87 ? 30   TRP C CH2 1 
ATOM   6860  N  N   . TRP C 3  31  ? 57.133  62.850  142.646 1.00 18.34 ? 31   TRP C N   1 
ATOM   6861  C  CA  . TRP C 3  31  ? 58.159  63.792  142.260 1.00 18.59 ? 31   TRP C CA  1 
ATOM   6862  C  C   . TRP C 3  31  ? 58.131  65.098  143.082 1.00 18.79 ? 31   TRP C C   1 
ATOM   6863  O  O   . TRP C 3  31  ? 59.082  65.883  142.985 1.00 18.82 ? 31   TRP C O   1 
ATOM   6864  C  CB  . TRP C 3  31  ? 58.081  64.081  140.751 1.00 18.54 ? 31   TRP C CB  1 
ATOM   6865  C  CG  . TRP C 3  31  ? 58.877  63.118  139.911 1.00 18.74 ? 31   TRP C CG  1 
ATOM   6866  C  CD1 . TRP C 3  31  ? 60.075  63.362  139.294 1.00 22.16 ? 31   TRP C CD1 1 
ATOM   6867  C  CD2 . TRP C 3  31  ? 58.541  61.763  139.597 1.00 17.80 ? 31   TRP C CD2 1 
ATOM   6868  N  NE1 . TRP C 3  31  ? 60.575  62.204  138.742 1.00 13.83 ? 31   TRP C NE1 1 
ATOM   6869  C  CE2 . TRP C 3  31  ? 59.621  61.228  138.827 1.00 15.34 ? 31   TRP C CE2 1 
ATOM   6870  C  CE3 . TRP C 3  31  ? 57.422  60.928  139.873 1.00 18.59 ? 31   TRP C CE3 1 
ATOM   6871  C  CZ2 . TRP C 3  31  ? 59.628  59.888  138.326 1.00 11.45 ? 31   TRP C CZ2 1 
ATOM   6872  C  CZ3 . TRP C 3  31  ? 57.443  59.574  139.408 1.00 21.83 ? 31   TRP C CZ3 1 
ATOM   6873  C  CH2 . TRP C 3  31  ? 58.544  59.081  138.631 1.00 15.28 ? 31   TRP C CH2 1 
ATOM   6874  N  N   . ASN C 3  32  ? 57.072  65.312  143.897 1.00 18.25 ? 32   ASN C N   1 
ATOM   6875  C  CA  . ASN C 3  32  ? 57.006  66.458  144.843 1.00 17.53 ? 32   ASN C CA  1 
ATOM   6876  C  C   . ASN C 3  32  ? 58.039  66.470  145.975 1.00 16.84 ? 32   ASN C C   1 
ATOM   6877  O  O   . ASN C 3  32  ? 58.341  67.540  146.503 1.00 16.65 ? 32   ASN C O   1 
ATOM   6878  C  CB  . ASN C 3  32  ? 55.604  66.688  145.408 1.00 17.46 ? 32   ASN C CB  1 
ATOM   6879  C  CG  . ASN C 3  32  ? 54.715  67.451  144.462 1.00 21.90 ? 32   ASN C CG  1 
ATOM   6880  O  OD1 . ASN C 3  32  ? 54.703  68.671  144.466 1.00 35.31 ? 32   ASN C OD1 1 
ATOM   6881  N  ND2 . ASN C 3  32  ? 53.905  66.730  143.697 1.00 26.85 ? 32   ASN C ND2 1 
ATOM   6882  N  N   . PHE C 3  33  ? 58.604  65.298  146.296 1.00 16.78 ? 33   PHE C N   1 
ATOM   6883  C  CA  . PHE C 3  33  ? 59.437  65.113  147.497 1.00 16.93 ? 33   PHE C CA  1 
ATOM   6884  C  C   . PHE C 3  33  ? 60.826  65.738  147.469 1.00 17.38 ? 33   PHE C C   1 
ATOM   6885  O  O   . PHE C 3  33  ? 61.356  66.065  148.527 1.00 17.57 ? 33   PHE C O   1 
ATOM   6886  C  CB  . PHE C 3  33  ? 59.478  63.648  147.961 1.00 16.21 ? 33   PHE C CB  1 
ATOM   6887  C  CG  . PHE C 3  33  ? 58.171  63.157  148.501 1.00 19.58 ? 33   PHE C CG  1 
ATOM   6888  C  CD1 . PHE C 3  33  ? 57.773  63.470  149.844 1.00 17.87 ? 33   PHE C CD1 1 
ATOM   6889  C  CD2 . PHE C 3  33  ? 57.295  62.401  147.673 1.00 18.21 ? 33   PHE C CD2 1 
ATOM   6890  C  CE1 . PHE C 3  33  ? 56.483  63.114  150.331 1.00 15.98 ? 33   PHE C CE1 1 
ATOM   6891  C  CE2 . PHE C 3  33  ? 56.013  61.952  148.163 1.00 15.56 ? 33   PHE C CE2 1 
ATOM   6892  C  CZ  . PHE C 3  33  ? 55.590  62.334  149.487 1.00 20.63 ? 33   PHE C CZ  1 
ATOM   6893  N  N   . GLY C 3  34  ? 61.322  66.053  146.271 1.00 17.67 ? 34   GLY C N   1 
ATOM   6894  C  CA  . GLY C 3  34  ? 62.575  66.765  146.099 1.00 18.26 ? 34   GLY C CA  1 
ATOM   6895  C  C   . GLY C 3  34  ? 62.558  68.199  146.546 1.00 19.06 ? 34   GLY C C   1 
ATOM   6896  O  O   . GLY C 3  34  ? 63.477  68.611  147.267 1.00 19.57 ? 34   GLY C O   1 
ATOM   6897  N  N   . SER C 3  35  ? 61.605  68.980  146.009 1.00 19.32 ? 35   SER C N   1 
ATOM   6898  C  CA  . SER C 3  35  ? 61.284  70.338  146.508 1.00 19.50 ? 35   SER C CA  1 
ATOM   6899  C  C   . SER C 3  35  ? 60.933  70.337  148.018 1.00 19.09 ? 35   SER C C   1 
ATOM   6900  O  O   . SER C 3  35  ? 61.483  71.163  148.775 1.00 18.70 ? 35   SER C O   1 
ATOM   6901  C  CB  . SER C 3  35  ? 60.153  70.981  145.692 1.00 19.62 ? 35   SER C CB  1 
ATOM   6902  O  OG  . SER C 3  35  ? 58.935  70.239  145.825 1.00 20.62 ? 35   SER C OG  1 
ATOM   6903  N  N   . LEU C 3  36  ? 60.187  69.300  148.449 1.00 18.08 ? 36   LEU C N   1 
ATOM   6904  C  CA  . LEU C 3  36  ? 59.811  69.095  149.862 1.00 18.03 ? 36   LEU C CA  1 
ATOM   6905  C  C   . LEU C 3  36  ? 60.952  68.828  150.815 1.00 18.04 ? 36   LEU C C   1 
ATOM   6906  O  O   . LEU C 3  36  ? 60.982  69.425  151.882 1.00 18.36 ? 36   LEU C O   1 
ATOM   6907  C  CB  . LEU C 3  36  ? 58.712  68.036  150.030 1.00 17.84 ? 36   LEU C CB  1 
ATOM   6908  C  CG  . LEU C 3  36  ? 57.301  68.390  149.544 1.00 18.56 ? 36   LEU C CG  1 
ATOM   6909  C  CD1 . LEU C 3  36  ? 56.294  67.252  149.804 1.00 9.60  ? 36   LEU C CD1 1 
ATOM   6910  C  CD2 . LEU C 3  36  ? 56.798  69.736  150.084 1.00 10.31 ? 36   LEU C CD2 1 
ATOM   6911  N  N   . LEU C 3  37  ? 61.925  68.022  150.372 1.00 17.64 ? 37   LEU C N   1 
ATOM   6912  C  CA  . LEU C 3  37  ? 63.245  67.915  151.007 1.00 17.71 ? 37   LEU C CA  1 
ATOM   6913  C  C   . LEU C 3  37  ? 64.052  69.228  151.105 1.00 18.54 ? 37   LEU C C   1 
ATOM   6914  O  O   . LEU C 3  37  ? 64.619  69.518  152.178 1.00 19.16 ? 37   LEU C O   1 
ATOM   6915  C  CB  . LEU C 3  37  ? 64.078  66.796  150.372 1.00 17.29 ? 37   LEU C CB  1 
ATOM   6916  C  CG  . LEU C 3  37  ? 63.668  65.341  150.672 1.00 17.62 ? 37   LEU C CG  1 
ATOM   6917  C  CD1 . LEU C 3  37  ? 64.142  64.384  149.587 1.00 7.13  ? 37   LEU C CD1 1 
ATOM   6918  C  CD2 . LEU C 3  37  ? 64.138  64.893  152.017 1.00 15.29 ? 37   LEU C CD2 1 
ATOM   6919  N  N   . GLY C 3  38  ? 63.975  70.065  150.058 1.00 18.50 ? 38   GLY C N   1 
ATOM   6920  C  CA  . GLY C 3  38  ? 64.579  71.407  150.043 1.00 18.54 ? 38   GLY C CA  1 
ATOM   6921  C  C   . GLY C 3  38  ? 63.923  72.370  151.025 1.00 19.58 ? 38   GLY C C   1 
ATOM   6922  O  O   . GLY C 3  38  ? 64.622  72.947  151.857 1.00 19.74 ? 38   GLY C O   1 
ATOM   6923  N  N   . ILE C 3  39  ? 62.579  72.452  150.985 1.00 20.85 ? 39   ILE C N   1 
ATOM   6924  C  CA  . ILE C 3  39  ? 61.735  73.061  152.052 1.00 21.71 ? 39   ILE C CA  1 
ATOM   6925  C  C   . ILE C 3  39  ? 62.061  72.599  153.490 1.00 21.78 ? 39   ILE C C   1 
ATOM   6926  O  O   . ILE C 3  39  ? 62.384  73.454  154.332 1.00 21.94 ? 39   ILE C O   1 
ATOM   6927  C  CB  . ILE C 3  39  ? 60.163  72.998  151.729 1.00 21.97 ? 39   ILE C CB  1 
ATOM   6928  C  CG1 . ILE C 3  39  ? 59.792  73.557  150.312 1.00 23.87 ? 39   ILE C CG1 1 
ATOM   6929  C  CG2 . ILE C 3  39  ? 59.289  73.664  152.868 1.00 24.14 ? 39   ILE C CG2 1 
ATOM   6930  C  CD1 . ILE C 3  39  ? 60.246  75.001  149.933 1.00 33.27 ? 39   ILE C CD1 1 
ATOM   6931  N  N   . CYS C 3  40  ? 62.231  71.277  153.659 1.00 21.55 ? 40   CYS C N   1 
ATOM   6932  C  CA  . CYS C 3  40  ? 62.617  70.660  154.943 1.00 21.46 ? 40   CYS C CA  1 
ATOM   6933  C  C   . CYS C 3  40  ? 63.961  71.107  155.460 1.00 21.37 ? 40   CYS C C   1 
ATOM   6934  O  O   . CYS C 3  40  ? 64.052  71.490  156.616 1.00 21.58 ? 40   CYS C O   1 
ATOM   6935  C  CB  . CYS C 3  40  ? 62.571  69.134  154.885 1.00 21.43 ? 40   CYS C CB  1 
ATOM   6936  S  SG  . CYS C 3  40  ? 60.916  68.478  155.042 1.00 24.28 ? 40   CYS C SG  1 
ATOM   6937  N  N   . LEU C 3  41  ? 64.926  71.243  154.542 1.00 21.64 ? 41   LEU C N   1 
ATOM   6938  C  CA  . LEU C 3  41  ? 66.255  71.770  154.821 1.00 21.67 ? 41   LEU C CA  1 
ATOM   6939  C  C   . LEU C 3  41  ? 66.266  73.228  155.266 1.00 22.38 ? 41   LEU C C   1 
ATOM   6940  O  O   . LEU C 3  41  ? 66.923  73.543  156.266 1.00 22.25 ? 41   LEU C O   1 
ATOM   6941  C  CB  . LEU C 3  41  ? 67.215  71.526  153.642 1.00 21.23 ? 41   LEU C CB  1 
ATOM   6942  C  CG  . LEU C 3  41  ? 68.731  71.814  153.746 1.00 13.95 ? 41   LEU C CG  1 
ATOM   6943  C  CD1 . LEU C 3  41  ? 69.446  71.159  154.974 1.00 14.64 ? 41   LEU C CD1 1 
ATOM   6944  C  CD2 . LEU C 3  41  ? 69.406  71.408  152.445 1.00 14.91 ? 41   LEU C CD2 1 
ATOM   6945  N  N   . ILE C 3  42  ? 65.545  74.094  154.535 1.00 22.93 ? 42   ILE C N   1 
ATOM   6946  C  CA  . ILE C 3  42  ? 65.405  75.508  154.928 1.00 23.42 ? 42   ILE C CA  1 
ATOM   6947  C  C   . ILE C 3  42  ? 64.626  75.741  156.228 1.00 22.99 ? 42   ILE C C   1 
ATOM   6948  O  O   . ILE C 3  42  ? 65.091  76.487  157.081 1.00 23.49 ? 42   ILE C O   1 
ATOM   6949  C  CB  . ILE C 3  42  ? 65.050  76.515  153.747 1.00 24.32 ? 42   ILE C CB  1 
ATOM   6950  C  CG1 . ILE C 3  42  ? 63.551  76.590  153.436 1.00 41.80 ? 42   ILE C CG1 1 
ATOM   6951  C  CG2 . ILE C 3  42  ? 65.934  76.310  152.477 1.00 31.39 ? 42   ILE C CG2 1 
ATOM   6952  C  CD1 . ILE C 3  42  ? 62.998  78.025  153.523 1.00 44.58 ? 42   ILE C CD1 1 
ATOM   6953  N  N   . LEU C 3  43  ? 63.619  74.895  156.462 1.00 22.85 ? 43   LEU C N   1 
ATOM   6954  C  CA  . LEU C 3  43  ? 62.880  74.846  157.728 1.00 21.90 ? 43   LEU C CA  1 
ATOM   6955  C  C   . LEU C 3  43  ? 63.757  74.483  158.919 1.00 20.35 ? 43   LEU C C   1 
ATOM   6956  O  O   . LEU C 3  43  ? 63.777  75.228  159.903 1.00 19.77 ? 43   LEU C O   1 
ATOM   6957  C  CB  . LEU C 3  43  ? 61.695  73.900  157.638 1.00 22.09 ? 43   LEU C CB  1 
ATOM   6958  C  CG  . LEU C 3  43  ? 60.321  74.456  158.017 1.00 31.92 ? 43   LEU C CG  1 
ATOM   6959  C  CD1 . LEU C 3  43  ? 59.238  73.681  157.244 1.00 31.47 ? 43   LEU C CD1 1 
ATOM   6960  C  CD2 . LEU C 3  43  ? 60.076  74.365  159.523 1.00 22.13 ? 43   LEU C CD2 1 
ATOM   6961  N  N   . GLN C 3  44  ? 64.581  73.437  158.747 1.00 19.43 ? 44   GLN C N   1 
ATOM   6962  C  CA  . GLN C 3  44  ? 65.582  73.023  159.734 1.00 18.65 ? 44   GLN C CA  1 
ATOM   6963  C  C   . GLN C 3  44  ? 66.687  74.058  159.983 1.00 18.10 ? 44   GLN C C   1 
ATOM   6964  O  O   . GLN C 3  44  ? 67.093  74.263  161.142 1.00 18.19 ? 44   GLN C O   1 
ATOM   6965  C  CB  . GLN C 3  44  ? 66.182  71.657  159.389 1.00 18.65 ? 44   GLN C CB  1 
ATOM   6966  C  CG  . GLN C 3  44  ? 65.232  70.403  159.453 1.00 20.96 ? 44   GLN C CG  1 
ATOM   6967  C  CD  . GLN C 3  44  ? 64.394  70.310  160.724 1.00 18.32 ? 44   GLN C CD  1 
ATOM   6968  O  OE1 . GLN C 3  44  ? 63.286  70.853  160.784 1.00 15.18 ? 44   GLN C OE1 1 
ATOM   6969  N  NE2 . GLN C 3  44  ? 64.956  69.703  161.759 1.00 18.09 ? 44   GLN C NE2 1 
ATOM   6970  N  N   . ILE C 3  45  ? 67.089  74.759  158.917 1.00 17.86 ? 45   ILE C N   1 
ATOM   6971  C  CA  . ILE C 3  45  ? 68.013  75.896  158.994 1.00 17.75 ? 45   ILE C CA  1 
ATOM   6972  C  C   . ILE C 3  45  ? 67.498  77.092  159.820 1.00 17.68 ? 45   ILE C C   1 
ATOM   6973  O  O   . ILE C 3  45  ? 68.156  77.477  160.806 1.00 17.62 ? 45   ILE C O   1 
ATOM   6974  C  CB  . ILE C 3  45  ? 68.651  76.247  157.590 1.00 17.77 ? 45   ILE C CB  1 
ATOM   6975  C  CG1 . ILE C 3  45  ? 69.829  75.289  157.317 1.00 13.38 ? 45   ILE C CG1 1 
ATOM   6976  C  CG2 . ILE C 3  45  ? 69.190  77.698  157.534 1.00 15.26 ? 45   ILE C CG2 1 
ATOM   6977  C  CD1 . ILE C 3  45  ? 69.995  74.824  155.890 1.00 9.90  ? 45   ILE C CD1 1 
ATOM   6978  N  N   . LEU C 3  46  ? 66.268  77.534  159.522 1.00 17.62 ? 46   LEU C N   1 
ATOM   6979  C  CA  . LEU C 3  46  ? 65.694  78.761  160.101 1.00 17.52 ? 46   LEU C CA  1 
ATOM   6980  C  C   . LEU C 3  46  ? 65.344  78.599  161.583 1.00 17.25 ? 46   LEU C C   1 
ATOM   6981  O  O   . LEU C 3  46  ? 66.027  79.225  162.413 1.00 16.92 ? 46   LEU C O   1 
ATOM   6982  C  CB  . LEU C 3  46  ? 64.524  79.336  159.265 1.00 17.63 ? 46   LEU C CB  1 
ATOM   6983  C  CG  . LEU C 3  46  ? 64.824  79.841  157.828 1.00 25.13 ? 46   LEU C CG  1 
ATOM   6984  C  CD1 . LEU C 3  46  ? 63.587  79.770  156.948 1.00 27.04 ? 46   LEU C CD1 1 
ATOM   6985  C  CD2 . LEU C 3  46  ? 65.448  81.247  157.753 1.00 22.48 ? 46   LEU C CD2 1 
ATOM   6986  N  N   . THR C 3  47  ? 64.535  77.556  161.898 1.00 16.45 ? 47   THR C N   1 
ATOM   6987  C  CA  . THR C 3  47  ? 64.171  77.156  163.285 1.00 15.84 ? 47   THR C CA  1 
ATOM   6988  C  C   . THR C 3  47  ? 65.399  76.816  164.135 1.00 16.01 ? 47   THR C C   1 
ATOM   6989  O  O   . THR C 3  47  ? 65.535  77.337  165.233 1.00 16.34 ? 47   THR C O   1 
ATOM   6990  C  CB  . THR C 3  47  ? 63.161  75.947  163.344 1.00 15.61 ? 47   THR C CB  1 
ATOM   6991  O  OG1 . THR C 3  47  ? 63.719  74.804  162.688 1.00 15.18 ? 47   THR C OG1 1 
ATOM   6992  C  CG2 . THR C 3  47  ? 61.866  76.215  162.586 1.00 9.07  ? 47   THR C CG2 1 
ATOM   6993  N  N   . GLY C 3  48  ? 66.346  76.088  163.537 1.00 16.36 ? 48   GLY C N   1 
ATOM   6994  C  CA  . GLY C 3  48  ? 67.620  75.744  164.147 1.00 17.02 ? 48   GLY C CA  1 
ATOM   6995  C  C   . GLY C 3  48  ? 68.516  76.893  164.531 1.00 18.32 ? 48   GLY C C   1 
ATOM   6996  O  O   . GLY C 3  48  ? 69.154  76.813  165.585 1.00 19.11 ? 48   GLY C O   1 
ATOM   6997  N  N   . LEU C 3  49  ? 68.645  77.897  163.643 1.00 18.68 ? 49   LEU C N   1 
ATOM   6998  C  CA  . LEU C 3  49  ? 69.334  79.163  163.963 1.00 18.61 ? 49   LEU C CA  1 
ATOM   6999  C  C   . LEU C 3  49  ? 68.711  79.913  165.144 1.00 18.90 ? 49   LEU C C   1 
ATOM   7000  O  O   . LEU C 3  49  ? 69.439  80.405  166.016 1.00 18.98 ? 49   LEU C O   1 
ATOM   7001  C  CB  . LEU C 3  49  ? 69.505  80.085  162.722 1.00 18.21 ? 49   LEU C CB  1 
ATOM   7002  C  CG  . LEU C 3  49  ? 70.312  81.413  162.855 1.00 16.33 ? 49   LEU C CG  1 
ATOM   7003  C  CD1 . LEU C 3  49  ? 71.804  81.201  163.234 1.00 11.24 ? 49   LEU C CD1 1 
ATOM   7004  C  CD2 . LEU C 3  49  ? 70.157  82.366  161.635 1.00 13.76 ? 49   LEU C CD2 1 
ATOM   7005  N  N   . PHE C 3  50  ? 67.379  79.960  165.166 1.00 19.28 ? 50   PHE C N   1 
ATOM   7006  C  CA  . PHE C 3  50  ? 66.615  80.636  166.221 1.00 19.82 ? 50   PHE C CA  1 
ATOM   7007  C  C   . PHE C 3  50  ? 66.623  79.897  167.560 1.00 19.74 ? 50   PHE C C   1 
ATOM   7008  O  O   . PHE C 3  50  ? 66.594  80.540  168.609 1.00 19.63 ? 50   PHE C O   1 
ATOM   7009  C  CB  . PHE C 3  50  ? 65.200  80.951  165.744 1.00 19.82 ? 50   PHE C CB  1 
ATOM   7010  C  CG  . PHE C 3  50  ? 65.118  82.172  164.861 1.00 13.24 ? 50   PHE C CG  1 
ATOM   7011  C  CD1 . PHE C 3  50  ? 65.521  82.119  163.489 1.00 16.53 ? 50   PHE C CD1 1 
ATOM   7012  C  CD2 . PHE C 3  50  ? 64.600  83.374  165.367 1.00 4.85  ? 50   PHE C CD2 1 
ATOM   7013  C  CE1 . PHE C 3  50  ? 65.437  83.278  162.642 1.00 20.53 ? 50   PHE C CE1 1 
ATOM   7014  C  CE2 . PHE C 3  50  ? 64.469  84.528  164.521 1.00 13.65 ? 50   PHE C CE2 1 
ATOM   7015  C  CZ  . PHE C 3  50  ? 64.921  84.490  163.168 1.00 8.57  ? 50   PHE C CZ  1 
ATOM   7016  N  N   . LEU C 3  51  ? 66.781  78.569  167.502 1.00 19.79 ? 51   LEU C N   1 
ATOM   7017  C  CA  . LEU C 3  51  ? 67.171  77.737  168.659 1.00 19.70 ? 51   LEU C CA  1 
ATOM   7018  C  C   . LEU C 3  51  ? 68.605  77.928  169.139 1.00 19.20 ? 51   LEU C C   1 
ATOM   7019  O  O   . LEU C 3  51  ? 68.841  77.918  170.353 1.00 18.91 ? 51   LEU C O   1 
ATOM   7020  C  CB  . LEU C 3  51  ? 66.899  76.247  168.404 1.00 19.73 ? 51   LEU C CB  1 
ATOM   7021  C  CG  . LEU C 3  51  ? 65.466  75.733  168.225 1.00 22.88 ? 51   LEU C CG  1 
ATOM   7022  C  CD1 . LEU C 3  51  ? 65.523  74.306  167.828 1.00 19.20 ? 51   LEU C CD1 1 
ATOM   7023  C  CD2 . LEU C 3  51  ? 64.605  75.891  169.471 1.00 25.95 ? 51   LEU C CD2 1 
ATOM   7024  N  N   . ALA C 3  52  ? 69.538  78.126  168.192 1.00 18.89 ? 52   ALA C N   1 
ATOM   7025  C  CA  . ALA C 3  52  ? 70.979  78.340  168.478 1.00 18.95 ? 52   ALA C CA  1 
ATOM   7026  C  C   . ALA C 3  52  ? 71.269  79.690  169.155 1.00 19.17 ? 52   ALA C C   1 
ATOM   7027  O  O   . ALA C 3  52  ? 72.312  79.868  169.806 1.00 19.23 ? 52   ALA C O   1 
ATOM   7028  C  CB  . ALA C 3  52  ? 71.792  78.197  167.215 1.00 18.83 ? 52   ALA C CB  1 
ATOM   7029  N  N   . MET C 3  53  ? 70.329  80.620  168.974 1.00 19.49 ? 53   MET C N   1 
ATOM   7030  C  CA  . MET C 3  53  ? 70.270  81.927  169.624 1.00 19.96 ? 53   MET C CA  1 
ATOM   7031  C  C   . MET C 3  53  ? 70.030  81.892  171.152 1.00 20.89 ? 53   MET C C   1 
ATOM   7032  O  O   . MET C 3  53  ? 70.228  82.927  171.836 1.00 21.35 ? 53   MET C O   1 
ATOM   7033  C  CB  . MET C 3  53  ? 69.169  82.741  168.960 1.00 19.72 ? 53   MET C CB  1 
ATOM   7034  C  CG  . MET C 3  53  ? 69.568  83.425  167.642 1.00 17.06 ? 53   MET C CG  1 
ATOM   7035  S  SD  . MET C 3  53  ? 68.264  84.480  166.943 1.00 19.33 ? 53   MET C SD  1 
ATOM   7036  C  CE  . MET C 3  53  ? 67.821  85.516  168.339 1.00 26.87 ? 53   MET C CE  1 
ATOM   7037  N  N   . HIS C 3  54  ? 69.634  80.718  171.683 1.00 20.76 ? 54   HIS C N   1 
ATOM   7038  C  CA  . HIS C 3  54  ? 69.211  80.545  173.087 1.00 20.57 ? 54   HIS C CA  1 
ATOM   7039  C  C   . HIS C 3  54  ? 69.781  79.294  173.791 1.00 20.74 ? 54   HIS C C   1 
ATOM   7040  O  O   . HIS C 3  54  ? 69.879  79.270  175.034 1.00 21.25 ? 54   HIS C O   1 
ATOM   7041  C  CB  . HIS C 3  54  ? 67.687  80.538  173.196 1.00 20.67 ? 54   HIS C CB  1 
ATOM   7042  C  CG  . HIS C 3  54  ? 67.016  81.717  172.568 1.00 13.36 ? 54   HIS C CG  1 
ATOM   7043  N  ND1 . HIS C 3  54  ? 67.004  82.962  173.153 1.00 18.13 ? 54   HIS C ND1 1 
ATOM   7044  C  CD2 . HIS C 3  54  ? 66.195  81.802  171.498 1.00 17.89 ? 54   HIS C CD2 1 
ATOM   7045  C  CE1 . HIS C 3  54  ? 66.250  83.777  172.440 1.00 7.04  ? 54   HIS C CE1 1 
ATOM   7046  N  NE2 . HIS C 3  54  ? 65.791  83.111  171.402 1.00 13.25 ? 54   HIS C NE2 1 
ATOM   7047  N  N   . TYR C 3  55  ? 69.947  78.208  173.024 1.00 20.40 ? 55   TYR C N   1 
ATOM   7048  C  CA  . TYR C 3  55  ? 70.643  76.989  173.464 1.00 19.90 ? 55   TYR C CA  1 
ATOM   7049  C  C   . TYR C 3  55  ? 72.104  77.249  173.855 1.00 20.33 ? 55   TYR C C   1 
ATOM   7050  O  O   . TYR C 3  55  ? 72.807  77.999  173.178 1.00 21.12 ? 55   TYR C O   1 
ATOM   7051  C  CB  . TYR C 3  55  ? 70.547  75.901  172.379 1.00 19.36 ? 55   TYR C CB  1 
ATOM   7052  C  CG  . TYR C 3  55  ? 71.247  74.601  172.712 1.00 10.34 ? 55   TYR C CG  1 
ATOM   7053  C  CD1 . TYR C 3  55  ? 72.536  74.319  172.180 1.00 12.94 ? 55   TYR C CD1 1 
ATOM   7054  C  CD2 . TYR C 3  55  ? 70.624  73.627  173.539 1.00 11.59 ? 55   TYR C CD2 1 
ATOM   7055  C  CE1 . TYR C 3  55  ? 73.219  73.118  172.513 1.00 13.26 ? 55   TYR C CE1 1 
ATOM   7056  C  CE2 . TYR C 3  55  ? 71.291  72.410  173.868 1.00 12.57 ? 55   TYR C CE2 1 
ATOM   7057  C  CZ  . TYR C 3  55  ? 72.586  72.170  173.346 1.00 12.60 ? 55   TYR C CZ  1 
ATOM   7058  O  OH  . TYR C 3  55  ? 73.261  71.024  173.668 1.00 8.65  ? 55   TYR C OH  1 
ATOM   7059  N  N   . THR C 3  56  ? 72.497  76.692  175.000 1.00 20.53 ? 56   THR C N   1 
ATOM   7060  C  CA  . THR C 3  56  ? 73.902  76.542  175.415 1.00 21.33 ? 56   THR C CA  1 
ATOM   7061  C  C   . THR C 3  56  ? 74.308  75.068  175.465 1.00 22.22 ? 56   THR C C   1 
ATOM   7062  O  O   . THR C 3  56  ? 73.501  74.214  175.871 1.00 22.21 ? 56   THR C O   1 
ATOM   7063  C  CB  . THR C 3  56  ? 74.163  77.219  176.797 1.00 21.65 ? 56   THR C CB  1 
ATOM   7064  O  OG1 . THR C 3  56  ? 73.020  77.074  177.657 1.00 20.78 ? 56   THR C OG1 1 
ATOM   7065  C  CG2 . THR C 3  56  ? 74.323  78.749  176.651 1.00 33.26 ? 56   THR C CG2 1 
ATOM   7066  N  N   . SER C 3  57  ? 75.582  74.797  175.147 1.00 23.37 ? 57   SER C N   1 
ATOM   7067  C  CA  . SER C 3  57  ? 76.087  73.436  174.894 1.00 24.78 ? 57   SER C CA  1 
ATOM   7068  C  C   . SER C 3  57  ? 76.993  72.815  175.999 1.00 26.30 ? 57   SER C C   1 
ATOM   7069  O  O   . SER C 3  57  ? 77.893  71.996  175.698 1.00 26.68 ? 57   SER C O   1 
ATOM   7070  C  CB  . SER C 3  57  ? 76.731  73.366  173.506 1.00 24.85 ? 57   SER C CB  1 
ATOM   7071  O  OG  . SER C 3  57  ? 78.113  73.640  173.576 1.00 25.18 ? 57   SER C OG  1 
ATOM   7072  N  N   . ASP C 3  58  ? 76.773  73.236  177.251 1.00 27.21 ? 58   ASP C N   1 
ATOM   7073  C  CA  . ASP C 3  58  ? 77.388  72.612  178.432 1.00 28.14 ? 58   ASP C CA  1 
ATOM   7074  C  C   . ASP C 3  58  ? 76.413  71.643  179.081 1.00 28.37 ? 58   ASP C C   1 
ATOM   7075  O  O   . ASP C 3  58  ? 75.226  71.968  179.220 1.00 28.80 ? 58   ASP C O   1 
ATOM   7076  C  CB  . ASP C 3  58  ? 77.829  73.676  179.446 1.00 28.92 ? 58   ASP C CB  1 
ATOM   7077  C  CG  . ASP C 3  58  ? 78.962  73.204  180.354 1.00 39.10 ? 58   ASP C CG  1 
ATOM   7078  O  OD1 . ASP C 3  58  ? 78.728  72.294  181.195 1.00 39.88 ? 58   ASP C OD1 1 
ATOM   7079  O  OD2 . ASP C 3  58  ? 80.071  73.798  180.404 1.00 35.89 ? 58   ASP C OD2 1 
ATOM   7080  N  N   . THR C 3  59  ? 76.968  70.549  179.627 1.00 28.20 ? 59   THR C N   1 
ATOM   7081  C  CA  . THR C 3  59  ? 76.224  69.472  180.337 1.00 27.97 ? 59   THR C CA  1 
ATOM   7082  C  C   . THR C 3  59  ? 75.373  69.975  181.507 1.00 27.74 ? 59   THR C C   1 
ATOM   7083  O  O   . THR C 3  59  ? 74.219  69.558  181.646 1.00 27.54 ? 59   THR C O   1 
ATOM   7084  C  CB  . THR C 3  59  ? 77.167  68.343  180.840 1.00 27.88 ? 59   THR C CB  1 
ATOM   7085  O  OG1 . THR C 3  59  ? 78.230  68.905  181.620 1.00 38.04 ? 59   THR C OG1 1 
ATOM   7086  C  CG2 . THR C 3  59  ? 77.876  67.639  179.685 1.00 27.47 ? 59   THR C CG2 1 
ATOM   7087  N  N   . THR C 3  60  ? 75.907  70.979  182.220 1.00 27.90 ? 60   THR C N   1 
ATOM   7088  C  CA  . THR C 3  60  ? 75.253  71.662  183.355 1.00 28.32 ? 60   THR C CA  1 
ATOM   7089  C  C   . THR C 3  60  ? 74.018  72.494  182.973 1.00 28.65 ? 60   THR C C   1 
ATOM   7090  O  O   . THR C 3  60  ? 73.118  72.690  183.815 1.00 29.06 ? 60   THR C O   1 
ATOM   7091  C  CB  . THR C 3  60  ? 76.270  72.549  184.162 1.00 28.47 ? 60   THR C CB  1 
ATOM   7092  O  OG1 . THR C 3  60  ? 77.150  73.244  183.266 1.00 27.21 ? 60   THR C OG1 1 
ATOM   7093  C  CG2 . THR C 3  60  ? 77.215  71.684  185.007 1.00 32.76 ? 60   THR C CG2 1 
ATOM   7094  N  N   . THR C 3  61  ? 73.955  72.919  181.701 1.00 28.41 ? 61   THR C N   1 
ATOM   7095  C  CA  . THR C 3  61  ? 72.988  73.926  181.227 1.00 28.26 ? 61   THR C CA  1 
ATOM   7096  C  C   . THR C 3  61  ? 72.174  73.607  179.937 1.00 27.26 ? 61   THR C C   1 
ATOM   7097  O  O   . THR C 3  61  ? 71.161  74.287  179.674 1.00 27.53 ? 61   THR C O   1 
ATOM   7098  C  CB  . THR C 3  61  ? 73.592  75.390  181.289 1.00 29.31 ? 61   THR C CB  1 
ATOM   7099  O  OG1 . THR C 3  61  ? 72.588  76.356  180.945 1.00 46.11 ? 61   THR C OG1 1 
ATOM   7100  C  CG2 . THR C 3  61  ? 74.704  75.616  180.243 1.00 33.53 ? 61   THR C CG2 1 
ATOM   7101  N  N   . ALA C 3  62  ? 72.490  72.463  179.293 1.00 25.82 ? 62   ALA C N   1 
ATOM   7102  C  CA  . ALA C 3  62  ? 71.905  72.040  178.001 1.00 24.77 ? 62   ALA C CA  1 
ATOM   7103  C  C   . ALA C 3  62  ? 70.402  71.746  178.061 1.00 23.86 ? 62   ALA C C   1 
ATOM   7104  O  O   . ALA C 3  62  ? 69.636  72.304  177.260 1.00 23.64 ? 62   ALA C O   1 
ATOM   7105  C  CB  . ALA C 3  62  ? 72.665  70.848  177.411 1.00 24.68 ? 62   ALA C CB  1 
ATOM   7106  N  N   . PHE C 3  63  ? 69.999  70.940  179.059 1.00 22.97 ? 63   PHE C N   1 
ATOM   7107  C  CA  . PHE C 3  63  ? 68.597  70.661  179.392 1.00 22.00 ? 63   PHE C CA  1 
ATOM   7108  C  C   . PHE C 3  63  ? 67.812  71.909  179.799 1.00 21.29 ? 63   PHE C C   1 
ATOM   7109  O  O   . PHE C 3  63  ? 66.655  72.073  179.379 1.00 21.45 ? 63   PHE C O   1 
ATOM   7110  C  CB  . PHE C 3  63  ? 68.505  69.583  180.485 1.00 21.95 ? 63   PHE C CB  1 
ATOM   7111  C  CG  . PHE C 3  63  ? 67.180  68.873  180.529 1.00 19.86 ? 63   PHE C CG  1 
ATOM   7112  C  CD1 . PHE C 3  63  ? 67.019  67.631  179.870 1.00 9.75  ? 63   PHE C CD1 1 
ATOM   7113  C  CD2 . PHE C 3  63  ? 66.094  69.400  181.294 1.00 19.70 ? 63   PHE C CD2 1 
ATOM   7114  C  CE1 . PHE C 3  63  ? 65.763  66.955  179.891 1.00 19.92 ? 63   PHE C CE1 1 
ATOM   7115  C  CE2 . PHE C 3  63  ? 64.820  68.751  181.308 1.00 22.74 ? 63   PHE C CE2 1 
ATOM   7116  C  CZ  . PHE C 3  63  ? 64.653  67.536  180.591 1.00 20.75 ? 63   PHE C CZ  1 
ATOM   7117  N  N   . SER C 3  64  ? 68.428  72.728  180.662 1.00 20.39 ? 64   SER C N   1 
ATOM   7118  C  CA  . SER C 3  64  ? 67.857  73.965  181.185 1.00 19.86 ? 64   SER C CA  1 
ATOM   7119  C  C   . SER C 3  64  ? 67.605  75.022  180.106 1.00 19.13 ? 64   SER C C   1 
ATOM   7120  O  O   . SER C 3  64  ? 66.542  75.646  180.107 1.00 19.01 ? 64   SER C O   1 
ATOM   7121  C  CB  . SER C 3  64  ? 68.741  74.524  182.300 1.00 20.24 ? 64   SER C CB  1 
ATOM   7122  O  OG  . SER C 3  64  ? 68.030  75.447  183.105 1.00 36.47 ? 64   SER C OG  1 
ATOM   7123  N  N   . SER C 3  65  ? 68.566  75.187  179.179 1.00 18.58 ? 65   SER C N   1 
ATOM   7124  C  CA  . SER C 3  65  ? 68.433  76.106  178.039 1.00 17.99 ? 65   SER C CA  1 
ATOM   7125  C  C   . SER C 3  65  ? 67.330  75.725  177.057 1.00 17.97 ? 65   SER C C   1 
ATOM   7126  O  O   . SER C 3  65  ? 66.581  76.607  176.624 1.00 18.21 ? 65   SER C O   1 
ATOM   7127  C  CB  . SER C 3  65  ? 69.765  76.351  177.329 1.00 17.77 ? 65   SER C CB  1 
ATOM   7128  O  OG  . SER C 3  65  ? 70.298  75.180  176.736 1.00 15.51 ? 65   SER C OG  1 
ATOM   7129  N  N   . VAL C 3  66  ? 67.130  74.410  176.864 1.00 17.71 ? 66   VAL C N   1 
ATOM   7130  C  CA  . VAL C 3  66  ? 66.019  73.859  176.062 1.00 17.79 ? 66   VAL C CA  1 
ATOM   7131  C  C   . VAL C 3  66  ? 64.654  74.132  176.744 1.00 18.08 ? 66   VAL C C   1 
ATOM   7132  O  O   . VAL C 3  66  ? 63.698  74.553  176.072 1.00 18.07 ? 66   VAL C O   1 
ATOM   7133  C  CB  . VAL C 3  66  ? 66.257  72.330  175.660 1.00 17.86 ? 66   VAL C CB  1 
ATOM   7134  C  CG1 . VAL C 3  66  ? 65.026  71.688  174.976 1.00 11.75 ? 66   VAL C CG1 1 
ATOM   7135  C  CG2 . VAL C 3  66  ? 67.422  72.195  174.707 1.00 17.01 ? 66   VAL C CG2 1 
ATOM   7136  N  N   . THR C 3  67  ? 64.596  73.898  178.064 1.00 18.75 ? 67   THR C N   1 
ATOM   7137  C  CA  . THR C 3  67  ? 63.476  74.299  178.946 1.00 19.49 ? 67   THR C CA  1 
ATOM   7138  C  C   . THR C 3  67  ? 63.164  75.818  178.885 1.00 19.48 ? 67   THR C C   1 
ATOM   7139  O  O   . THR C 3  67  ? 61.998  76.198  178.700 1.00 19.08 ? 67   THR C O   1 
ATOM   7140  C  CB  . THR C 3  67  ? 63.752  73.816  180.421 1.00 20.00 ? 67   THR C CB  1 
ATOM   7141  O  OG1 . THR C 3  67  ? 63.711  72.384  180.469 1.00 24.47 ? 67   THR C OG1 1 
ATOM   7142  C  CG2 . THR C 3  67  ? 62.625  74.219  181.361 1.00 28.94 ? 67   THR C CG2 1 
ATOM   7143  N  N   . HIS C 3  68  ? 64.225  76.639  178.946 1.00 19.95 ? 68   HIS C N   1 
ATOM   7144  C  CA  . HIS C 3  68  ? 64.162  78.104  178.807 1.00 20.79 ? 68   HIS C CA  1 
ATOM   7145  C  C   . HIS C 3  68  ? 63.503  78.571  177.493 1.00 21.48 ? 68   HIS C C   1 
ATOM   7146  O  O   . HIS C 3  68  ? 62.700  79.522  177.514 1.00 21.88 ? 68   HIS C O   1 
ATOM   7147  C  CB  . HIS C 3  68  ? 65.561  78.730  179.015 1.00 20.87 ? 68   HIS C CB  1 
ATOM   7148  C  CG  . HIS C 3  68  ? 65.678  80.162  178.574 1.00 22.50 ? 68   HIS C CG  1 
ATOM   7149  N  ND1 . HIS C 3  68  ? 66.531  80.559  177.566 1.00 27.91 ? 68   HIS C ND1 1 
ATOM   7150  C  CD2 . HIS C 3  68  ? 65.047  81.285  178.993 1.00 23.67 ? 68   HIS C CD2 1 
ATOM   7151  C  CE1 . HIS C 3  68  ? 66.492  81.876  177.455 1.00 28.21 ? 68   HIS C CE1 1 
ATOM   7152  N  NE2 . HIS C 3  68  ? 65.533  82.328  178.240 1.00 27.84 ? 68   HIS C NE2 1 
ATOM   7153  N  N   . ILE C 3  69  ? 63.819  77.869  176.391 1.00 21.39 ? 69   ILE C N   1 
ATOM   7154  C  CA  . ILE C 3  69  ? 63.207  78.078  175.063 1.00 21.62 ? 69   ILE C CA  1 
ATOM   7155  C  C   . ILE C 3  69  ? 61.666  77.886  175.130 1.00 21.58 ? 69   ILE C C   1 
ATOM   7156  O  O   . ILE C 3  69  ? 60.912  78.837  174.857 1.00 21.57 ? 69   ILE C O   1 
ATOM   7157  C  CB  . ILE C 3  69  ? 63.916  77.153  173.969 1.00 21.72 ? 69   ILE C CB  1 
ATOM   7158  C  CG1 . ILE C 3  69  ? 65.328  77.673  173.627 1.00 19.28 ? 69   ILE C CG1 1 
ATOM   7159  C  CG2 . ILE C 3  69  ? 63.076  77.015  172.690 1.00 22.91 ? 69   ILE C CG2 1 
ATOM   7160  C  CD1 . ILE C 3  69  ? 66.372  76.580  173.287 1.00 14.23 ? 69   ILE C CD1 1 
ATOM   7161  N  N   . CYS C 3  70  ? 61.262  76.804  175.795 1.00 21.61 ? 70   CYS C N   1 
ATOM   7162  C  CA  . CYS C 3  70  ? 59.881  76.333  175.798 1.00 21.38 ? 70   CYS C CA  1 
ATOM   7163  C  C   . CYS C 3  70  ? 58.917  77.043  176.760 1.00 21.69 ? 70   CYS C C   1 
ATOM   7164  O  O   . CYS C 3  70  ? 57.690  77.055  176.495 1.00 22.53 ? 70   CYS C O   1 
ATOM   7165  C  CB  . CYS C 3  70  ? 59.847  74.827  175.978 1.00 21.23 ? 70   CYS C CB  1 
ATOM   7166  S  SG  . CYS C 3  70  ? 60.586  73.963  174.589 1.00 20.33 ? 70   CYS C SG  1 
ATOM   7167  N  N   . ARG C 3  71  ? 59.445  77.608  177.864 1.00 20.98 ? 71   ARG C N   1 
ATOM   7168  C  CA  . ARG C 3  71  ? 58.648  78.450  178.797 1.00 20.35 ? 71   ARG C CA  1 
ATOM   7169  C  C   . ARG C 3  71  ? 58.782  79.943  178.582 1.00 19.60 ? 71   ARG C C   1 
ATOM   7170  O  O   . ARG C 3  71  ? 57.767  80.653  178.587 1.00 19.67 ? 71   ARG C O   1 
ATOM   7171  C  CB  . ARG C 3  71  ? 58.841  78.134  180.315 1.00 20.60 ? 71   ARG C CB  1 
ATOM   7172  C  CG  . ARG C 3  71  ? 59.581  76.863  180.753 1.00 27.39 ? 71   ARG C CG  1 
ATOM   7173  C  CD  . ARG C 3  71  ? 58.747  75.607  180.694 1.00 30.58 ? 71   ARG C CD  1 
ATOM   7174  N  NE  . ARG C 3  71  ? 59.155  74.601  181.678 1.00 27.62 ? 71   ARG C NE  1 
ATOM   7175  C  CZ  . ARG C 3  71  ? 58.390  74.127  182.665 1.00 26.80 ? 71   ARG C CZ  1 
ATOM   7176  N  NH1 . ARG C 3  71  ? 57.313  74.789  183.099 1.00 23.46 ? 71   ARG C NH1 1 
ATOM   7177  N  NH2 . ARG C 3  71  ? 58.786  73.049  183.318 1.00 27.89 ? 71   ARG C NH2 1 
ATOM   7178  N  N   . ASP C 3  72  ? 60.031  80.413  178.450 1.00 18.88 ? 72   ASP C N   1 
ATOM   7179  C  CA  . ASP C 3  72  ? 60.388  81.814  178.679 1.00 18.40 ? 72   ASP C CA  1 
ATOM   7180  C  C   . ASP C 3  72  ? 60.604  82.642  177.428 1.00 17.91 ? 72   ASP C C   1 
ATOM   7181  O  O   . ASP C 3  72  ? 60.189  83.813  177.392 1.00 17.19 ? 72   ASP C O   1 
ATOM   7182  C  CB  . ASP C 3  72  ? 61.591  81.932  179.629 1.00 18.66 ? 72   ASP C CB  1 
ATOM   7183  C  CG  . ASP C 3  72  ? 61.208  81.830  181.127 1.00 22.22 ? 72   ASP C CG  1 
ATOM   7184  O  OD1 . ASP C 3  72  ? 60.000  81.763  181.502 1.00 16.59 ? 72   ASP C OD1 1 
ATOM   7185  O  OD2 . ASP C 3  72  ? 62.090  81.833  182.008 1.00 15.47 ? 72   ASP C OD2 1 
ATOM   7186  N  N   . VAL C 3  73  ? 61.315  82.054  176.446 1.00 18.33 ? 73   VAL C N   1 
ATOM   7187  C  CA  . VAL C 3  73  ? 61.537  82.641  175.099 1.00 17.99 ? 73   VAL C CA  1 
ATOM   7188  C  C   . VAL C 3  73  ? 60.185  82.710  174.370 1.00 17.86 ? 73   VAL C C   1 
ATOM   7189  O  O   . VAL C 3  73  ? 59.476  81.686  174.287 1.00 18.18 ? 73   VAL C O   1 
ATOM   7190  C  CB  . VAL C 3  73  ? 62.619  81.840  174.250 1.00 17.82 ? 73   VAL C CB  1 
ATOM   7191  C  CG1 . VAL C 3  73  ? 62.773  82.418  172.824 1.00 18.39 ? 73   VAL C CG1 1 
ATOM   7192  C  CG2 . VAL C 3  73  ? 63.983  81.855  174.921 1.00 17.83 ? 73   VAL C CG2 1 
ATOM   7193  N  N   . ASN C 3  74  ? 59.813  83.932  173.941 1.00 17.48 ? 74   ASN C N   1 
ATOM   7194  C  CA  . ASN C 3  74  ? 58.577  84.196  173.161 1.00 17.22 ? 74   ASN C CA  1 
ATOM   7195  C  C   . ASN C 3  74  ? 58.492  83.301  171.940 1.00 17.11 ? 74   ASN C C   1 
ATOM   7196  O  O   . ASN C 3  74  ? 59.486  83.171  171.217 1.00 16.91 ? 74   ASN C O   1 
ATOM   7197  C  CB  . ASN C 3  74  ? 58.440  85.666  172.719 1.00 17.10 ? 74   ASN C CB  1 
ATOM   7198  C  CG  . ASN C 3  74  ? 58.765  86.659  173.819 1.00 15.78 ? 74   ASN C CG  1 
ATOM   7199  O  OD1 . ASN C 3  74  ? 59.778  87.363  173.737 1.00 21.17 ? 74   ASN C OD1 1 
ATOM   7200  N  ND2 . ASN C 3  74  ? 57.836  86.838  174.761 1.00 5.90  ? 74   ASN C ND2 1 
ATOM   7201  N  N   . TYR C 3  75  ? 57.473  82.427  171.959 1.00 16.61 ? 75   TYR C N   1 
ATOM   7202  C  CA  . TYR C 3  75  ? 57.199  81.448  170.881 1.00 16.21 ? 75   TYR C CA  1 
ATOM   7203  C  C   . TYR C 3  75  ? 58.342  80.421  170.642 1.00 16.74 ? 75   TYR C C   1 
ATOM   7204  O  O   . TYR C 3  75  ? 58.447  79.818  169.564 1.00 17.12 ? 75   TYR C O   1 
ATOM   7205  C  CB  . TYR C 3  75  ? 56.762  82.157  169.572 1.00 15.44 ? 75   TYR C CB  1 
ATOM   7206  C  CG  . TYR C 3  75  ? 55.631  83.136  169.742 1.00 8.30  ? 75   TYR C CG  1 
ATOM   7207  C  CD1 . TYR C 3  75  ? 55.889  84.523  169.841 1.00 8.49  ? 75   TYR C CD1 1 
ATOM   7208  C  CD2 . TYR C 3  75  ? 54.277  82.692  169.764 1.00 6.33  ? 75   TYR C CD2 1 
ATOM   7209  C  CE1 . TYR C 3  75  ? 54.822  85.460  170.011 1.00 10.28 ? 75   TYR C CE1 1 
ATOM   7210  C  CE2 . TYR C 3  75  ? 53.202  83.626  169.888 1.00 7.91  ? 75   TYR C CE2 1 
ATOM   7211  C  CZ  . TYR C 3  75  ? 53.485  84.992  170.014 1.00 10.69 ? 75   TYR C CZ  1 
ATOM   7212  O  OH  . TYR C 3  75  ? 52.446  85.874  170.179 1.00 19.33 ? 75   TYR C OH  1 
ATOM   7213  N  N   . GLY C 3  76  ? 59.189  80.234  171.661 1.00 17.00 ? 76   GLY C N   1 
ATOM   7214  C  CA  . GLY C 3  76  ? 60.257  79.244  171.640 1.00 17.30 ? 76   GLY C CA  1 
ATOM   7215  C  C   . GLY C 3  76  ? 59.771  77.813  171.489 1.00 17.39 ? 76   GLY C C   1 
ATOM   7216  O  O   . GLY C 3  76  ? 60.333  77.074  170.674 1.00 18.22 ? 76   GLY C O   1 
ATOM   7217  N  N   . TRP C 3  77  ? 58.622  77.513  172.116 1.00 16.80 ? 77   TRP C N   1 
ATOM   7218  C  CA  . TRP C 3  77  ? 57.912  76.249  171.969 1.00 16.37 ? 77   TRP C CA  1 
ATOM   7219  C  C   . TRP C 3  77  ? 57.541  75.831  170.525 1.00 15.80 ? 77   TRP C C   1 
ATOM   7220  O  O   . TRP C 3  77  ? 57.998  74.755  170.106 1.00 15.16 ? 77   TRP C O   1 
ATOM   7221  C  CB  . TRP C 3  77  ? 56.734  76.155  172.937 1.00 16.30 ? 77   TRP C CB  1 
ATOM   7222  C  CG  . TRP C 3  77  ? 55.652  77.144  172.675 1.00 11.50 ? 77   TRP C CG  1 
ATOM   7223  C  CD1 . TRP C 3  77  ? 55.560  78.402  173.181 1.00 10.73 ? 77   TRP C CD1 1 
ATOM   7224  C  CD2 . TRP C 3  77  ? 54.501  76.956  171.843 1.00 8.93  ? 77   TRP C CD2 1 
ATOM   7225  N  NE1 . TRP C 3  77  ? 54.388  78.999  172.774 1.00 11.67 ? 77   TRP C NE1 1 
ATOM   7226  C  CE2 . TRP C 3  77  ? 53.733  78.156  171.917 1.00 6.92  ? 77   TRP C CE2 1 
ATOM   7227  C  CE3 . TRP C 3  77  ? 54.013  75.880  171.054 1.00 8.06  ? 77   TRP C CE3 1 
ATOM   7228  C  CZ2 . TRP C 3  77  ? 52.488  78.320  171.237 1.00 10.32 ? 77   TRP C CZ2 1 
ATOM   7229  C  CZ3 . TRP C 3  77  ? 52.794  76.062  170.321 1.00 12.06 ? 77   TRP C CZ3 1 
ATOM   7230  C  CH2 . TRP C 3  77  ? 52.082  77.305  170.388 1.00 10.41 ? 77   TRP C CH2 1 
ATOM   7231  N  N   . ILE C 3  78  ? 56.939  76.746  169.722 1.00 15.87 ? 78   ILE C N   1 
ATOM   7232  C  CA  . ILE C 3  78  ? 56.641  76.444  168.284 1.00 16.70 ? 78   ILE C CA  1 
ATOM   7233  C  C   . ILE C 3  78  ? 57.892  76.197  167.462 1.00 17.51 ? 78   ILE C C   1 
ATOM   7234  O  O   . ILE C 3  78  ? 57.999  75.116  166.908 1.00 17.71 ? 78   ILE C O   1 
ATOM   7235  C  CB  . ILE C 3  78  ? 55.687  77.431  167.504 1.00 16.84 ? 78   ILE C CB  1 
ATOM   7236  C  CG1 . ILE C 3  78  ? 55.787  78.892  167.880 1.00 15.84 ? 78   ILE C CG1 1 
ATOM   7237  C  CG2 . ILE C 3  78  ? 54.344  76.839  167.086 1.00 5.16  ? 78   ILE C CG2 1 
ATOM   7238  C  CD1 . ILE C 3  78  ? 56.517  79.667  166.786 1.00 26.42 ? 78   ILE C CD1 1 
ATOM   7239  N  N   . ILE C 3  79  ? 58.924  77.046  167.660 1.00 17.66 ? 79   ILE C N   1 
ATOM   7240  C  CA  . ILE C 3  79  ? 60.229  76.918  166.983 1.00 17.84 ? 79   ILE C CA  1 
ATOM   7241  C  C   . ILE C 3  79  ? 60.906  75.567  167.323 1.00 18.49 ? 79   ILE C C   1 
ATOM   7242  O  O   . ILE C 3  79  ? 61.237  74.804  166.400 1.00 18.95 ? 79   ILE C O   1 
ATOM   7243  C  CB  . ILE C 3  79  ? 61.161  78.183  167.254 1.00 17.75 ? 79   ILE C CB  1 
ATOM   7244  C  CG1 . ILE C 3  79  ? 60.622  79.422  166.513 1.00 9.92  ? 79   ILE C CG1 1 
ATOM   7245  C  CG2 . ILE C 3  79  ? 62.634  77.914  166.840 1.00 11.10 ? 79   ILE C CG2 1 
ATOM   7246  C  CD1 . ILE C 3  79  ? 60.812  80.739  167.223 1.00 7.40  ? 79   ILE C CD1 1 
ATOM   7247  N  N   . ARG C 3  80  ? 60.978  75.249  168.629 1.00 18.50 ? 80   ARG C N   1 
ATOM   7248  C  CA  . ARG C 3  80  ? 61.483  73.955  169.141 1.00 18.41 ? 80   ARG C CA  1 
ATOM   7249  C  C   . ARG C 3  80  ? 60.761  72.741  168.545 1.00 18.10 ? 80   ARG C C   1 
ATOM   7250  O  O   . ARG C 3  80  ? 61.422  71.803  168.082 1.00 18.01 ? 80   ARG C O   1 
ATOM   7251  C  CB  . ARG C 3  80  ? 61.447  73.926  170.686 1.00 18.51 ? 80   ARG C CB  1 
ATOM   7252  C  CG  . ARG C 3  80  ? 62.351  72.866  171.346 1.00 16.70 ? 80   ARG C CG  1 
ATOM   7253  C  CD  . ARG C 3  80  ? 61.603  71.638  171.817 1.00 19.60 ? 80   ARG C CD  1 
ATOM   7254  N  NE  . ARG C 3  80  ? 62.493  70.512  172.117 1.00 19.80 ? 80   ARG C NE  1 
ATOM   7255  C  CZ  . ARG C 3  80  ? 62.560  69.859  173.284 1.00 12.22 ? 80   ARG C CZ  1 
ATOM   7256  N  NH1 . ARG C 3  80  ? 61.881  70.267  174.364 1.00 11.29 ? 80   ARG C NH1 1 
ATOM   7257  N  NH2 . ARG C 3  80  ? 63.475  68.914  173.430 1.00 16.26 ? 80   ARG C NH2 1 
ATOM   7258  N  N   . TYR C 3  81  ? 59.423  72.791  168.542 1.00 18.10 ? 81   TYR C N   1 
ATOM   7259  C  CA  . TYR C 3  81  ? 58.581  71.688  168.061 1.00 17.99 ? 81   TYR C CA  1 
ATOM   7260  C  C   . TYR C 3  81  ? 58.508  71.576  166.544 1.00 18.31 ? 81   TYR C C   1 
ATOM   7261  O  O   . TYR C 3  81  ? 58.440  70.454  166.028 1.00 18.07 ? 81   TYR C O   1 
ATOM   7262  C  CB  . TYR C 3  81  ? 57.188  71.712  168.698 1.00 17.66 ? 81   TYR C CB  1 
ATOM   7263  C  CG  . TYR C 3  81  ? 57.172  71.603  170.223 1.00 23.28 ? 81   TYR C CG  1 
ATOM   7264  C  CD1 . TYR C 3  81  ? 58.102  70.769  170.924 1.00 29.82 ? 81   TYR C CD1 1 
ATOM   7265  C  CD2 . TYR C 3  81  ? 56.191  72.288  170.981 1.00 22.60 ? 81   TYR C CD2 1 
ATOM   7266  C  CE1 . TYR C 3  81  ? 58.148  70.750  172.346 1.00 33.12 ? 81   TYR C CE1 1 
ATOM   7267  C  CE2 . TYR C 3  81  ? 56.250  72.304  172.406 1.00 26.19 ? 81   TYR C CE2 1 
ATOM   7268  C  CZ  . TYR C 3  81  ? 57.227  71.522  173.076 1.00 32.41 ? 81   TYR C CZ  1 
ATOM   7269  O  OH  . TYR C 3  81  ? 57.266  71.465  174.455 1.00 32.91 ? 81   TYR C OH  1 
ATOM   7270  N  N   . MET C 3  82  ? 58.570  72.730  165.847 1.00 18.55 ? 82   MET C N   1 
ATOM   7271  C  CA  . MET C 3  82  ? 58.759  72.823  164.382 1.00 18.62 ? 82   MET C CA  1 
ATOM   7272  C  C   . MET C 3  82  ? 60.038  72.144  163.933 1.00 18.33 ? 82   MET C C   1 
ATOM   7273  O  O   . MET C 3  82  ? 60.021  71.403  162.956 1.00 18.65 ? 82   MET C O   1 
ATOM   7274  C  CB  . MET C 3  82  ? 58.752  74.277  163.888 1.00 18.49 ? 82   MET C CB  1 
ATOM   7275  C  CG  . MET C 3  82  ? 57.364  74.891  163.707 1.00 15.99 ? 82   MET C CG  1 
ATOM   7276  S  SD  . MET C 3  82  ? 57.436  76.556  162.955 1.00 28.72 ? 82   MET C SD  1 
ATOM   7277  C  CE  . MET C 3  82  ? 56.097  77.375  163.674 1.00 19.36 ? 82   MET C CE  1 
ATOM   7278  N  N   . HIS C 3  83  ? 61.093  72.321  164.732 1.00 17.55 ? 83   HIS C N   1 
ATOM   7279  C  CA  . HIS C 3  83  ? 62.394  71.712  164.529 1.00 16.97 ? 83   HIS C CA  1 
ATOM   7280  C  C   . HIS C 3  83  ? 62.421  70.187  164.728 1.00 17.37 ? 83   HIS C C   1 
ATOM   7281  O  O   . HIS C 3  83  ? 62.973  69.475  163.875 1.00 17.46 ? 83   HIS C O   1 
ATOM   7282  C  CB  . HIS C 3  83  ? 63.410  72.391  165.429 1.00 15.96 ? 83   HIS C CB  1 
ATOM   7283  C  CG  . HIS C 3  83  ? 64.813  72.210  164.979 1.00 18.76 ? 83   HIS C CG  1 
ATOM   7284  N  ND1 . HIS C 3  83  ? 65.350  72.912  163.922 1.00 18.30 ? 83   HIS C ND1 1 
ATOM   7285  C  CD2 . HIS C 3  83  ? 65.784  71.375  165.410 1.00 17.71 ? 83   HIS C CD2 1 
ATOM   7286  C  CE1 . HIS C 3  83  ? 66.578  72.483  163.705 1.00 19.04 ? 83   HIS C CE1 1 
ATOM   7287  N  NE2 . HIS C 3  83  ? 66.906  71.658  164.678 1.00 7.69  ? 83   HIS C NE2 1 
ATOM   7288  N  N   . ALA C 3  84  ? 61.911  69.726  165.888 1.00 17.89 ? 84   ALA C N   1 
ATOM   7289  C  CA  . ALA C 3  84  ? 61.817  68.299  166.275 1.00 18.59 ? 84   ALA C CA  1 
ATOM   7290  C  C   . ALA C 3  84  ? 60.981  67.496  165.287 1.00 19.27 ? 84   ALA C C   1 
ATOM   7291  O  O   . ALA C 3  84  ? 61.453  66.477  164.752 1.00 19.53 ? 84   ALA C O   1 
ATOM   7292  C  CB  . ALA C 3  84  ? 61.245  68.154  167.705 1.00 18.29 ? 84   ALA C CB  1 
ATOM   7293  N  N   . ASN C 3  85  ? 59.816  68.050  164.939 1.00 19.45 ? 85   ASN C N   1 
ATOM   7294  C  CA  . ASN C 3  85  ? 58.904  67.439  163.986 1.00 19.42 ? 85   ASN C CA  1 
ATOM   7295  C  C   . ASN C 3  85  ? 59.258  67.637  162.519 1.00 19.90 ? 85   ASN C C   1 
ATOM   7296  O  O   . ASN C 3  85  ? 58.960  66.761  161.696 1.00 19.83 ? 85   ASN C O   1 
ATOM   7297  C  CB  . ASN C 3  85  ? 57.464  67.807  164.299 1.00 19.38 ? 85   ASN C CB  1 
ATOM   7298  C  CG  . ASN C 3  85  ? 56.983  67.176  165.599 1.00 22.90 ? 85   ASN C CG  1 
ATOM   7299  O  OD1 . ASN C 3  85  ? 56.906  65.945  165.709 1.00 22.76 ? 85   ASN C OD1 1 
ATOM   7300  N  ND2 . ASN C 3  85  ? 56.815  68.004  166.633 1.00 18.69 ? 85   ASN C ND2 1 
ATOM   7301  N  N   . GLY C 3  86  ? 60.013  68.717  162.236 1.00 20.16 ? 86   GLY C N   1 
ATOM   7302  C  CA  . GLY C 3  86  ? 60.643  68.961  160.946 1.00 19.97 ? 86   GLY C CA  1 
ATOM   7303  C  C   . GLY C 3  86  ? 61.670  67.928  160.553 1.00 20.27 ? 86   GLY C C   1 
ATOM   7304  O  O   . GLY C 3  86  ? 61.666  67.492  159.395 1.00 21.06 ? 86   GLY C O   1 
ATOM   7305  N  N   . ALA C 3  87  ? 62.523  67.539  161.517 1.00 19.79 ? 87   ALA C N   1 
ATOM   7306  C  CA  . ALA C 3  87  ? 63.395  66.357  161.439 1.00 19.50 ? 87   ALA C CA  1 
ATOM   7307  C  C   . ALA C 3  87  ? 62.699  65.063  161.057 1.00 20.03 ? 87   ALA C C   1 
ATOM   7308  O  O   . ALA C 3  87  ? 63.213  64.318  160.216 1.00 21.05 ? 87   ALA C O   1 
ATOM   7309  C  CB  . ALA C 3  87  ? 64.176  66.179  162.712 1.00 19.35 ? 87   ALA C CB  1 
ATOM   7310  N  N   . SER C 3  88  ? 61.498  64.844  161.604 1.00 19.44 ? 88   SER C N   1 
ATOM   7311  C  CA  . SER C 3  88  ? 60.674  63.686  161.253 1.00 18.61 ? 88   SER C CA  1 
ATOM   7312  C  C   . SER C 3  88  ? 60.074  63.761  159.837 1.00 18.73 ? 88   SER C C   1 
ATOM   7313  O  O   . SER C 3  88  ? 60.220  62.799  159.059 1.00 18.58 ? 88   SER C O   1 
ATOM   7314  C  CB  . SER C 3  88  ? 59.623  63.427  162.318 1.00 18.03 ? 88   SER C CB  1 
ATOM   7315  O  OG  . SER C 3  88  ? 60.111  62.456  163.227 1.00 14.19 ? 88   SER C OG  1 
ATOM   7316  N  N   . MET C 3  89  ? 59.469  64.922  159.507 1.00 19.11 ? 89   MET C N   1 
ATOM   7317  C  CA  . MET C 3  89  ? 59.107  65.338  158.139 1.00 19.81 ? 89   MET C CA  1 
ATOM   7318  C  C   . MET C 3  89  ? 60.206  65.160  157.081 1.00 20.62 ? 89   MET C C   1 
ATOM   7319  O  O   . MET C 3  89  ? 59.933  64.577  156.020 1.00 21.35 ? 89   MET C O   1 
ATOM   7320  C  CB  . MET C 3  89  ? 58.576  66.791  158.102 1.00 19.86 ? 89   MET C CB  1 
ATOM   7321  C  CG  . MET C 3  89  ? 57.216  67.081  158.822 1.00 19.98 ? 89   MET C CG  1 
ATOM   7322  S  SD  . MET C 3  89  ? 55.979  65.754  158.903 1.00 25.72 ? 89   MET C SD  1 
ATOM   7323  C  CE  . MET C 3  89  ? 55.501  65.568  157.145 1.00 29.81 ? 89   MET C CE  1 
ATOM   7324  N  N   . PHE C 3  90  ? 61.445  65.539  157.448 1.00 20.27 ? 90   PHE C N   1 
ATOM   7325  C  CA  . PHE C 3  90  ? 62.661  65.327  156.649 1.00 20.40 ? 90   PHE C CA  1 
ATOM   7326  C  C   . PHE C 3  90  ? 62.884  63.851  156.306 1.00 20.34 ? 90   PHE C C   1 
ATOM   7327  O  O   . PHE C 3  90  ? 63.091  63.528  155.130 1.00 20.89 ? 90   PHE C O   1 
ATOM   7328  C  CB  . PHE C 3  90  ? 63.910  65.918  157.349 1.00 20.33 ? 90   PHE C CB  1 
ATOM   7329  C  CG  . PHE C 3  90  ? 64.954  66.531  156.400 1.00 26.16 ? 90   PHE C CG  1 
ATOM   7330  C  CD1 . PHE C 3  90  ? 65.480  65.799  155.284 1.00 24.16 ? 90   PHE C CD1 1 
ATOM   7331  C  CD2 . PHE C 3  90  ? 65.595  67.737  156.764 1.00 19.31 ? 90   PHE C CD2 1 
ATOM   7332  C  CE1 . PHE C 3  90  ? 66.515  66.344  154.445 1.00 14.94 ? 90   PHE C CE1 1 
ATOM   7333  C  CE2 . PHE C 3  90  ? 66.678  68.283  155.970 1.00 19.35 ? 90   PHE C CE2 1 
ATOM   7334  C  CZ  . PHE C 3  90  ? 67.137  67.581  154.808 1.00 19.72 ? 90   PHE C CZ  1 
ATOM   7335  N  N   . PHE C 3  91  ? 62.759  62.974  157.308 1.00 19.63 ? 91   PHE C N   1 
ATOM   7336  C  CA  . PHE C 3  91  ? 62.889  61.529  157.111 1.00 19.01 ? 91   PHE C CA  1 
ATOM   7337  C  C   . PHE C 3  91  ? 61.735  60.863  156.395 1.00 18.76 ? 91   PHE C C   1 
ATOM   7338  O  O   . PHE C 3  91  ? 61.978  59.923  155.624 1.00 18.32 ? 91   PHE C O   1 
ATOM   7339  C  CB  . PHE C 3  91  ? 63.248  60.809  158.401 1.00 18.73 ? 91   PHE C CB  1 
ATOM   7340  C  CG  . PHE C 3  91  ? 64.722  60.852  158.721 1.00 18.78 ? 91   PHE C CG  1 
ATOM   7341  C  CD1 . PHE C 3  91  ? 65.252  61.888  159.537 1.00 4.50  ? 91   PHE C CD1 1 
ATOM   7342  C  CD2 . PHE C 3  91  ? 65.600  59.867  158.201 1.00 19.85 ? 91   PHE C CD2 1 
ATOM   7343  C  CE1 . PHE C 3  91  ? 66.651  61.983  159.789 1.00 15.41 ? 91   PHE C CE1 1 
ATOM   7344  C  CE2 . PHE C 3  91  ? 67.008  59.934  158.452 1.00 21.09 ? 91   PHE C CE2 1 
ATOM   7345  C  CZ  . PHE C 3  91  ? 67.535  60.991  159.266 1.00 23.02 ? 91   PHE C CZ  1 
ATOM   7346  N  N   . ILE C 3  92  ? 60.515  61.412  156.567 1.00 19.44 ? 92   ILE C N   1 
ATOM   7347  C  CA  . ILE C 3  92  ? 59.301  60.957  155.836 1.00 20.53 ? 92   ILE C CA  1 
ATOM   7348  C  C   . ILE C 3  92  ? 59.455  61.233  154.329 1.00 19.29 ? 92   ILE C C   1 
ATOM   7349  O  O   . ILE C 3  92  ? 59.377  60.277  153.519 1.00 17.95 ? 92   ILE C O   1 
ATOM   7350  C  CB  . ILE C 3  92  ? 57.913  61.516  156.502 1.00 21.72 ? 92   ILE C CB  1 
ATOM   7351  C  CG1 . ILE C 3  92  ? 57.150  60.437  157.298 1.00 32.59 ? 92   ILE C CG1 1 
ATOM   7352  C  CG2 . ILE C 3  92  ? 56.985  62.371  155.532 1.00 33.38 ? 92   ILE C CG2 1 
ATOM   7353  C  CD1 . ILE C 3  92  ? 56.518  59.217  156.490 1.00 44.90 ? 92   ILE C CD1 1 
ATOM   7354  N  N   . CYS C 3  93  ? 59.973  62.442  154.032 1.00 18.64 ? 93   CYS C N   1 
ATOM   7355  C  CA  . CYS C 3  93  ? 60.236  62.902  152.670 1.00 18.07 ? 93   CYS C CA  1 
ATOM   7356  C  C   . CYS C 3  93  ? 61.413  62.205  152.035 1.00 17.92 ? 93   CYS C C   1 
ATOM   7357  O  O   . CYS C 3  93  ? 61.304  61.791  150.889 1.00 18.94 ? 93   CYS C O   1 
ATOM   7358  C  CB  . CYS C 3  93  ? 60.396  64.421  152.599 1.00 18.37 ? 93   CYS C CB  1 
ATOM   7359  S  SG  . CYS C 3  93  ? 58.857  65.289  152.918 1.00 22.83 ? 93   CYS C SG  1 
ATOM   7360  N  N   . LEU C 3  94  ? 62.459  61.941  152.824 1.00 17.53 ? 94   LEU C N   1 
ATOM   7361  C  CA  . LEU C 3  94  ? 63.624  61.146  152.401 1.00 18.22 ? 94   LEU C CA  1 
ATOM   7362  C  C   . LEU C 3  94  ? 63.257  59.748  151.923 1.00 18.91 ? 94   LEU C C   1 
ATOM   7363  O  O   . LEU C 3  94  ? 63.582  59.389  150.789 1.00 18.89 ? 94   LEU C O   1 
ATOM   7364  C  CB  . LEU C 3  94  ? 64.654  61.061  153.525 1.00 18.22 ? 94   LEU C CB  1 
ATOM   7365  C  CG  . LEU C 3  94  ? 66.150  61.372  153.472 1.00 17.02 ? 94   LEU C CG  1 
ATOM   7366  C  CD1 . LEU C 3  94  ? 66.735  62.234  152.311 1.00 7.75  ? 94   LEU C CD1 1 
ATOM   7367  C  CD2 . LEU C 3  94  ? 66.546  61.931  154.814 1.00 13.00 ? 94   LEU C CD2 1 
ATOM   7368  N  N   . TYR C 3  95  ? 62.344  59.114  152.662 1.00 20.08 ? 95   TYR C N   1 
ATOM   7369  C  CA  . TYR C 3  95  ? 61.977  57.713  152.453 1.00 20.21 ? 95   TYR C CA  1 
ATOM   7370  C  C   . TYR C 3  95  ? 61.037  57.503  151.274 1.00 20.38 ? 95   TYR C C   1 
ATOM   7371  O  O   . TYR C 3  95  ? 61.307  56.631  150.434 1.00 20.59 ? 95   TYR C O   1 
ATOM   7372  C  CB  . TYR C 3  95  ? 61.458  57.081  153.760 1.00 20.48 ? 95   TYR C CB  1 
ATOM   7373  C  CG  . TYR C 3  95  ? 62.536  56.823  154.831 1.00 26.75 ? 95   TYR C CG  1 
ATOM   7374  C  CD1 . TYR C 3  95  ? 63.940  56.860  154.512 1.00 29.97 ? 95   TYR C CD1 1 
ATOM   7375  C  CD2 . TYR C 3  95  ? 62.165  56.556  156.180 1.00 21.37 ? 95   TYR C CD2 1 
ATOM   7376  C  CE1 . TYR C 3  95  ? 64.936  56.659  155.504 1.00 29.41 ? 95   TYR C CE1 1 
ATOM   7377  C  CE2 . TYR C 3  95  ? 63.165  56.294  157.179 1.00 20.91 ? 95   TYR C CE2 1 
ATOM   7378  C  CZ  . TYR C 3  95  ? 64.543  56.352  156.819 1.00 27.38 ? 95   TYR C CZ  1 
ATOM   7379  O  OH  . TYR C 3  95  ? 65.530  56.138  157.746 1.00 33.95 ? 95   TYR C OH  1 
ATOM   7380  N  N   . MET C 3  96  ? 60.069  58.424  151.124 1.00 20.62 ? 96   MET C N   1 
ATOM   7381  C  CA  . MET C 3  96  ? 59.180  58.541  149.946 1.00 21.03 ? 96   MET C CA  1 
ATOM   7382  C  C   . MET C 3  96  ? 59.962  58.794  148.633 1.00 20.26 ? 96   MET C C   1 
ATOM   7383  O  O   . MET C 3  96  ? 59.616  58.245  147.575 1.00 19.67 ? 96   MET C O   1 
ATOM   7384  C  CB  . MET C 3  96  ? 58.126  59.668  150.156 1.00 21.96 ? 96   MET C CB  1 
ATOM   7385  C  CG  . MET C 3  96  ? 57.098  59.499  151.340 1.00 21.81 ? 96   MET C CG  1 
ATOM   7386  S  SD  . MET C 3  96  ? 56.223  57.947  151.381 1.00 35.92 ? 96   MET C SD  1 
ATOM   7387  C  CE  . MET C 3  96  ? 55.114  58.147  152.856 1.00 36.31 ? 96   MET C CE  1 
ATOM   7388  N  N   . HIS C 3  97  ? 60.979  59.661  148.738 1.00 19.97 ? 97   HIS C N   1 
ATOM   7389  C  CA  . HIS C 3  97  ? 61.872  60.058  147.655 1.00 18.98 ? 97   HIS C CA  1 
ATOM   7390  C  C   . HIS C 3  97  ? 62.780  58.922  147.183 1.00 18.62 ? 97   HIS C C   1 
ATOM   7391  O  O   . HIS C 3  97  ? 62.957  58.768  145.966 1.00 18.34 ? 97   HIS C O   1 
ATOM   7392  C  CB  . HIS C 3  97  ? 62.705  61.242  148.119 1.00 18.88 ? 97   HIS C CB  1 
ATOM   7393  C  CG  . HIS C 3  97  ? 63.421  61.967  147.026 1.00 16.33 ? 97   HIS C CG  1 
ATOM   7394  N  ND1 . HIS C 3  97  ? 62.811  62.947  146.273 1.00 22.69 ? 97   HIS C ND1 1 
ATOM   7395  C  CD2 . HIS C 3  97  ? 64.744  62.098  146.797 1.00 24.28 ? 97   HIS C CD2 1 
ATOM   7396  C  CE1 . HIS C 3  97  ? 63.726  63.615  145.595 1.00 21.06 ? 97   HIS C CE1 1 
ATOM   7397  N  NE2 . HIS C 3  97  ? 64.912  63.168  145.952 1.00 17.27 ? 97   HIS C NE2 1 
ATOM   7398  N  N   . VAL C 3  98  ? 63.426  58.218  148.138 1.00 18.78 ? 98   VAL C N   1 
ATOM   7399  C  CA  . VAL C 3  98  ? 64.239  57.009  147.868 1.00 19.53 ? 98   VAL C CA  1 
ATOM   7400  C  C   . VAL C 3  98  ? 63.364  55.904  147.224 1.00 20.60 ? 98   VAL C C   1 
ATOM   7401  O  O   . VAL C 3  98  ? 63.750  55.326  146.193 1.00 20.84 ? 98   VAL C O   1 
ATOM   7402  C  CB  . VAL C 3  98  ? 64.998  56.469  149.156 1.00 19.41 ? 98   VAL C CB  1 
ATOM   7403  C  CG1 . VAL C 3  98  ? 65.722  55.126  148.879 1.00 12.66 ? 98   VAL C CG1 1 
ATOM   7404  C  CG2 . VAL C 3  98  ? 66.018  57.472  149.661 1.00 22.50 ? 98   VAL C CG2 1 
ATOM   7405  N  N   . GLY C 3  99  ? 62.173  55.698  147.796 1.00 21.15 ? 99   GLY C N   1 
ATOM   7406  C  CA  . GLY C 3  99  ? 61.231  54.683  147.348 1.00 21.68 ? 99   GLY C CA  1 
ATOM   7407  C  C   . GLY C 3  99  ? 60.729  54.899  145.935 1.00 21.97 ? 99   GLY C C   1 
ATOM   7408  O  O   . GLY C 3  99  ? 60.614  53.918  145.166 1.00 22.23 ? 99   GLY C O   1 
ATOM   7409  N  N   . ARG C 3  100 ? 60.447  56.172  145.604 1.00 21.56 ? 100  ARG C N   1 
ATOM   7410  C  CA  . ARG C 3  100 ? 60.175  56.627  144.232 1.00 21.53 ? 100  ARG C CA  1 
ATOM   7411  C  C   . ARG C 3  100 ? 61.322  56.204  143.275 1.00 21.51 ? 100  ARG C C   1 
ATOM   7412  O  O   . ARG C 3  100 ? 61.065  55.507  142.302 1.00 21.94 ? 100  ARG C O   1 
ATOM   7413  C  CB  . ARG C 3  100 ? 59.934  58.158  144.217 1.00 21.77 ? 100  ARG C CB  1 
ATOM   7414  C  CG  . ARG C 3  100 ? 59.571  58.808  142.838 1.00 17.81 ? 100  ARG C CG  1 
ATOM   7415  C  CD  . ARG C 3  100 ? 60.732  59.054  141.867 1.00 18.01 ? 100  ARG C CD  1 
ATOM   7416  N  NE  . ARG C 3  100 ? 61.872  59.740  142.499 1.00 20.84 ? 100  ARG C NE  1 
ATOM   7417  C  CZ  . ARG C 3  100 ? 61.991  61.057  142.622 1.00 22.90 ? 100  ARG C CZ  1 
ATOM   7418  N  NH1 . ARG C 3  100 ? 61.197  61.868  141.936 1.00 24.90 ? 100  ARG C NH1 1 
ATOM   7419  N  NH2 . ARG C 3  100 ? 63.048  61.560  143.246 1.00 26.65 ? 100  ARG C NH2 1 
ATOM   7420  N  N   . GLY C 3  101 ? 62.561  56.592  143.611 1.00 21.22 ? 101  GLY C N   1 
ATOM   7421  C  CA  . GLY C 3  101 ? 63.779  56.208  142.896 1.00 21.54 ? 101  GLY C CA  1 
ATOM   7422  C  C   . GLY C 3  101 ? 63.951  54.722  142.599 1.00 21.59 ? 101  GLY C C   1 
ATOM   7423  O  O   . GLY C 3  101 ? 64.214  54.350  141.442 1.00 22.04 ? 101  GLY C O   1 
ATOM   7424  N  N   . LEU C 3  102 ? 63.618  53.902  143.600 1.00 20.85 ? 102  LEU C N   1 
ATOM   7425  C  CA  . LEU C 3  102 ? 63.698  52.441  143.559 1.00 20.72 ? 102  LEU C CA  1 
ATOM   7426  C  C   . LEU C 3  102 ? 62.694  51.837  142.572 1.00 19.57 ? 102  LEU C C   1 
ATOM   7427  O  O   . LEU C 3  102 ? 63.096  51.206  141.591 1.00 18.50 ? 102  LEU C O   1 
ATOM   7428  C  CB  . LEU C 3  102 ? 63.466  51.891  144.963 1.00 21.25 ? 102  LEU C CB  1 
ATOM   7429  C  CG  . LEU C 3  102 ? 64.485  50.926  145.533 1.00 39.18 ? 102  LEU C CG  1 
ATOM   7430  C  CD1 . LEU C 3  102 ? 65.227  51.631  146.659 1.00 39.75 ? 102  LEU C CD1 1 
ATOM   7431  C  CD2 . LEU C 3  102 ? 63.766  49.645  146.046 1.00 28.81 ? 102  LEU C CD2 1 
ATOM   7432  N  N   . TYR C 3  103 ? 61.439  52.266  142.715 1.00 19.87 ? 103  TYR C N   1 
ATOM   7433  C  CA  . TYR C 3  103 ? 60.307  51.761  141.967 1.00 20.19 ? 103  TYR C CA  1 
ATOM   7434  C  C   . TYR C 3  103 ? 60.391  52.172  140.483 1.00 21.11 ? 103  TYR C C   1 
ATOM   7435  O  O   . TYR C 3  103 ? 60.106  51.347  139.588 1.00 22.10 ? 103  TYR C O   1 
ATOM   7436  C  CB  . TYR C 3  103 ? 59.017  52.262  142.614 1.00 19.75 ? 103  TYR C CB  1 
ATOM   7437  C  CG  . TYR C 3  103 ? 57.752  51.711  142.002 1.00 21.96 ? 103  TYR C CG  1 
ATOM   7438  C  CD1 . TYR C 3  103 ? 57.129  50.543  142.527 1.00 16.01 ? 103  TYR C CD1 1 
ATOM   7439  C  CD2 . TYR C 3  103 ? 57.100  52.414  140.962 1.00 14.45 ? 103  TYR C CD2 1 
ATOM   7440  C  CE1 . TYR C 3  103 ? 55.891  50.049  141.955 1.00 15.77 ? 103  TYR C CE1 1 
ATOM   7441  C  CE2 . TYR C 3  103 ? 55.921  51.910  140.347 1.00 20.57 ? 103  TYR C CE2 1 
ATOM   7442  C  CZ  . TYR C 3  103 ? 55.330  50.738  140.839 1.00 11.17 ? 103  TYR C CZ  1 
ATOM   7443  O  OH  . TYR C 3  103 ? 54.117  50.396  140.328 1.00 19.96 ? 103  TYR C OH  1 
ATOM   7444  N  N   . TYR C 3  104 ? 60.772  53.426  140.247 1.00 20.42 ? 104  TYR C N   1 
ATOM   7445  C  CA  . TYR C 3  104 ? 60.727  54.048  138.924 1.00 20.60 ? 104  TYR C CA  1 
ATOM   7446  C  C   . TYR C 3  104 ? 62.031  53.986  138.126 1.00 21.17 ? 104  TYR C C   1 
ATOM   7447  O  O   . TYR C 3  104 ? 62.064  54.426  136.974 1.00 21.62 ? 104  TYR C O   1 
ATOM   7448  C  CB  . TYR C 3  104 ? 60.166  55.481  139.016 1.00 19.90 ? 104  TYR C CB  1 
ATOM   7449  C  CG  . TYR C 3  104 ? 58.694  55.519  139.382 1.00 23.01 ? 104  TYR C CG  1 
ATOM   7450  C  CD1 . TYR C 3  104 ? 58.277  56.009  140.643 1.00 18.20 ? 104  TYR C CD1 1 
ATOM   7451  C  CD2 . TYR C 3  104 ? 57.703  54.993  138.495 1.00 13.42 ? 104  TYR C CD2 1 
ATOM   7452  C  CE1 . TYR C 3  104 ? 56.894  56.017  141.007 1.00 20.19 ? 104  TYR C CE1 1 
ATOM   7453  C  CE2 . TYR C 3  104 ? 56.321  55.053  138.816 1.00 23.10 ? 104  TYR C CE2 1 
ATOM   7454  C  CZ  . TYR C 3  104 ? 55.930  55.545  140.083 1.00 19.15 ? 104  TYR C CZ  1 
ATOM   7455  O  OH  . TYR C 3  104 ? 54.616  55.479  140.439 1.00 21.98 ? 104  TYR C OH  1 
ATOM   7456  N  N   . GLY C 3  105 ? 63.049  53.329  138.698 1.00 21.05 ? 105  GLY C N   1 
ATOM   7457  C  CA  . GLY C 3  105 ? 64.361  53.170  138.085 1.00 21.11 ? 105  GLY C CA  1 
ATOM   7458  C  C   . GLY C 3  105 ? 65.163  54.461  137.931 1.00 21.26 ? 105  GLY C C   1 
ATOM   7459  O  O   . GLY C 3  105 ? 66.099  54.501  137.138 1.00 21.05 ? 105  GLY C O   1 
ATOM   7460  N  N   . SER C 3  106 ? 64.865  55.455  138.772 1.00 21.63 ? 106  SER C N   1 
ATOM   7461  C  CA  . SER C 3  106 ? 65.523  56.771  138.777 1.00 21.97 ? 106  SER C CA  1 
ATOM   7462  C  C   . SER C 3  106 ? 66.998  56.716  139.158 1.00 22.32 ? 106  SER C C   1 
ATOM   7463  O  O   . SER C 3  106 ? 67.777  57.571  138.725 1.00 23.18 ? 106  SER C O   1 
ATOM   7464  C  CB  . SER C 3  106 ? 64.786  57.724  139.701 1.00 22.21 ? 106  SER C CB  1 
ATOM   7465  O  OG  . SER C 3  106 ? 63.379  57.738  139.449 1.00 22.06 ? 106  SER C OG  1 
ATOM   7466  N  N   . TYR C 3  107 ? 67.385  55.615  139.809 1.00 22.03 ? 107  TYR C N   1 
ATOM   7467  C  CA  . TYR C 3  107 ? 68.771  55.243  140.117 1.00 22.06 ? 107  TYR C CA  1 
ATOM   7468  C  C   . TYR C 3  107 ? 69.715  55.009  138.924 1.00 22.26 ? 107  TYR C C   1 
ATOM   7469  O  O   . TYR C 3  107 ? 70.941  54.888  139.133 1.00 22.88 ? 107  TYR C O   1 
ATOM   7470  C  CB  . TYR C 3  107 ? 68.798  54.021  141.059 1.00 22.07 ? 107  TYR C CB  1 
ATOM   7471  C  CG  . TYR C 3  107 ? 68.121  52.791  140.537 1.00 18.05 ? 107  TYR C CG  1 
ATOM   7472  C  CD1 . TYR C 3  107 ? 66.834  52.419  141.012 1.00 23.56 ? 107  TYR C CD1 1 
ATOM   7473  C  CD2 . TYR C 3  107 ? 68.811  51.895  139.670 1.00 24.14 ? 107  TYR C CD2 1 
ATOM   7474  C  CE1 . TYR C 3  107 ? 66.204  51.203  140.558 1.00 19.12 ? 107  TYR C CE1 1 
ATOM   7475  C  CE2 . TYR C 3  107 ? 68.198  50.704  139.206 1.00 23.65 ? 107  TYR C CE2 1 
ATOM   7476  C  CZ  . TYR C 3  107 ? 66.901  50.366  139.659 1.00 21.76 ? 107  TYR C CZ  1 
ATOM   7477  O  OH  . TYR C 3  107 ? 66.344  49.183  139.246 1.00 16.91 ? 107  TYR C OH  1 
ATOM   7478  N  N   . THR C 3  108 ? 69.154  54.822  137.715 1.00 21.64 ? 108  THR C N   1 
ATOM   7479  C  CA  . THR C 3  108 ? 69.955  54.797  136.464 1.00 21.46 ? 108  THR C CA  1 
ATOM   7480  C  C   . THR C 3  108 ? 70.719  56.086  136.168 1.00 20.90 ? 108  THR C C   1 
ATOM   7481  O  O   . THR C 3  108 ? 71.649  56.056  135.356 1.00 21.64 ? 108  THR C O   1 
ATOM   7482  C  CB  . THR C 3  108 ? 69.157  54.368  135.196 1.00 21.37 ? 108  THR C CB  1 
ATOM   7483  O  OG1 . THR C 3  108 ? 68.124  55.317  134.920 1.00 22.83 ? 108  THR C OG1 1 
ATOM   7484  C  CG2 . THR C 3  108 ? 68.462  53.029  135.360 1.00 14.12 ? 108  THR C CG2 1 
ATOM   7485  N  N   . PHE C 3  109 ? 70.226  57.228  136.682 1.00 19.98 ? 109  PHE C N   1 
ATOM   7486  C  CA  . PHE C 3  109 ? 71.049  58.445  136.871 1.00 19.56 ? 109  PHE C CA  1 
ATOM   7487  C  C   . PHE C 3  109 ? 72.119  58.211  137.958 1.00 18.86 ? 109  PHE C C   1 
ATOM   7488  O  O   . PHE C 3  109 ? 71.932  58.613  139.112 1.00 18.88 ? 109  PHE C O   1 
ATOM   7489  C  CB  . PHE C 3  109 ? 70.180  59.703  137.207 1.00 19.43 ? 109  PHE C CB  1 
ATOM   7490  C  CG  . PHE C 3  109 ? 69.012  59.965  136.261 1.00 17.65 ? 109  PHE C CG  1 
ATOM   7491  C  CD1 . PHE C 3  109 ? 69.148  59.842  134.848 1.00 16.66 ? 109  PHE C CD1 1 
ATOM   7492  C  CD2 . PHE C 3  109 ? 67.848  60.582  136.773 1.00 14.43 ? 109  PHE C CD2 1 
ATOM   7493  C  CE1 . PHE C 3  109 ? 68.050  60.099  133.983 1.00 12.97 ? 109  PHE C CE1 1 
ATOM   7494  C  CE2 . PHE C 3  109 ? 66.774  60.947  135.914 1.00 14.29 ? 109  PHE C CE2 1 
ATOM   7495  C  CZ  . PHE C 3  109 ? 66.880  60.699  134.502 1.00 16.74 ? 109  PHE C CZ  1 
ATOM   7496  N  N   . LEU C 3  110 ? 73.209  57.529  137.581 1.00 19.04 ? 110  LEU C N   1 
ATOM   7497  C  CA  . LEU C 3  110 ? 74.245  57.040  138.525 1.00 20.21 ? 110  LEU C CA  1 
ATOM   7498  C  C   . LEU C 3  110 ? 74.743  58.078  139.543 1.00 19.84 ? 110  LEU C C   1 
ATOM   7499  O  O   . LEU C 3  110 ? 74.458  57.935  140.753 1.00 19.08 ? 110  LEU C O   1 
ATOM   7500  C  CB  . LEU C 3  110 ? 75.437  56.410  137.780 1.00 21.20 ? 110  LEU C CB  1 
ATOM   7501  C  CG  . LEU C 3  110 ? 75.498  54.872  137.779 1.00 34.39 ? 110  LEU C CG  1 
ATOM   7502  C  CD1 . LEU C 3  110 ? 75.889  54.374  136.397 1.00 21.98 ? 110  LEU C CD1 1 
ATOM   7503  C  CD2 . LEU C 3  110 ? 76.498  54.366  138.851 1.00 39.70 ? 110  LEU C CD2 1 
ATOM   7504  N  N   . GLU C 3  111 ? 75.172  59.229  139.010 1.00 20.14 ? 111  GLU C N   1 
ATOM   7505  C  CA  . GLU C 3  111 ? 75.817  60.295  139.790 1.00 20.85 ? 111  GLU C CA  1 
ATOM   7506  C  C   . GLU C 3  111 ? 74.811  60.993  140.702 1.00 20.87 ? 111  GLU C C   1 
ATOM   7507  O  O   . GLU C 3  111 ? 75.121  61.214  141.864 1.00 21.22 ? 111  GLU C O   1 
ATOM   7508  C  CB  . GLU C 3  111 ? 76.537  61.339  138.901 1.00 20.98 ? 111  GLU C CB  1 
ATOM   7509  C  CG  . GLU C 3  111 ? 77.462  60.783  137.822 1.00 36.69 ? 111  GLU C CG  1 
ATOM   7510  C  CD  . GLU C 3  111 ? 76.789  60.734  136.455 1.00 42.43 ? 111  GLU C CD  1 
ATOM   7511  O  OE1 . GLU C 3  111 ? 76.073  59.743  136.162 1.00 36.81 ? 111  GLU C OE1 1 
ATOM   7512  O  OE2 . GLU C 3  111 ? 76.885  61.739  135.718 1.00 50.83 ? 111  GLU C OE2 1 
ATOM   7513  N  N   . THR C 3  112 ? 73.604  61.268  140.171 1.00 20.64 ? 112  THR C N   1 
ATOM   7514  C  CA  . THR C 3  112 ? 72.474  61.869  140.897 1.00 20.96 ? 112  THR C CA  1 
ATOM   7515  C  C   . THR C 3  112 ? 72.080  60.994  142.111 1.00 21.94 ? 112  THR C C   1 
ATOM   7516  O  O   . THR C 3  112 ? 72.086  61.486  143.244 1.00 22.95 ? 112  THR C O   1 
ATOM   7517  C  CB  . THR C 3  112 ? 71.277  62.053  139.914 1.00 20.90 ? 112  THR C CB  1 
ATOM   7518  O  OG1 . THR C 3  112 ? 71.586  63.086  138.975 1.00 19.20 ? 112  THR C OG1 1 
ATOM   7519  C  CG2 . THR C 3  112 ? 69.949  62.546  140.616 1.00 10.86 ? 112  THR C CG2 1 
ATOM   7520  N  N   . TRP C 3  113 ? 71.955  59.684  141.866 1.00 21.36 ? 113  TRP C N   1 
ATOM   7521  C  CA  . TRP C 3  113 ? 71.610  58.684  142.871 1.00 20.63 ? 113  TRP C CA  1 
ATOM   7522  C  C   . TRP C 3  113 ? 72.693  58.564  143.941 1.00 20.97 ? 113  TRP C C   1 
ATOM   7523  O  O   . TRP C 3  113 ? 72.369  58.542  145.135 1.00 21.18 ? 113  TRP C O   1 
ATOM   7524  C  CB  . TRP C 3  113 ? 71.368  57.333  142.192 1.00 19.74 ? 113  TRP C CB  1 
ATOM   7525  C  CG  . TRP C 3  113 ? 71.102  56.229  143.129 1.00 15.22 ? 113  TRP C CG  1 
ATOM   7526  C  CD1 . TRP C 3  113 ? 72.001  55.296  143.590 1.00 12.53 ? 113  TRP C CD1 1 
ATOM   7527  C  CD2 . TRP C 3  113 ? 69.853  55.924  143.749 1.00 14.13 ? 113  TRP C CD2 1 
ATOM   7528  N  NE1 . TRP C 3  113 ? 71.366  54.389  144.410 1.00 14.64 ? 113  TRP C NE1 1 
ATOM   7529  C  CE2 . TRP C 3  113 ? 70.033  54.706  144.473 1.00 8.73  ? 113  TRP C CE2 1 
ATOM   7530  C  CE3 . TRP C 3  113 ? 68.548  56.487  143.672 1.00 9.15  ? 113  TRP C CE3 1 
ATOM   7531  C  CZ2 . TRP C 3  113 ? 68.982  54.073  145.167 1.00 12.99 ? 113  TRP C CZ2 1 
ATOM   7532  C  CZ3 . TRP C 3  113 ? 67.491  55.840  144.350 1.00 11.26 ? 113  TRP C CZ3 1 
ATOM   7533  C  CH2 . TRP C 3  113 ? 67.713  54.618  145.047 1.00 8.95  ? 113  TRP C CH2 1 
ATOM   7534  N  N   . ASN C 3  114 ? 73.948  58.400  143.497 1.00 21.19 ? 114  ASN C N   1 
ATOM   7535  C  CA  . ASN C 3  114 ? 75.102  58.221  144.380 1.00 21.84 ? 114  ASN C CA  1 
ATOM   7536  C  C   . ASN C 3  114 ? 75.383  59.395  145.317 1.00 21.27 ? 114  ASN C C   1 
ATOM   7537  O  O   . ASN C 3  114 ? 75.830  59.196  146.447 1.00 20.98 ? 114  ASN C O   1 
ATOM   7538  C  CB  . ASN C 3  114 ? 76.351  57.829  143.584 1.00 22.61 ? 114  ASN C CB  1 
ATOM   7539  C  CG  . ASN C 3  114 ? 77.013  56.564  144.128 1.00 49.34 ? 114  ASN C CG  1 
ATOM   7540  O  OD1 . ASN C 3  114 ? 77.957  56.649  144.942 1.00 52.69 ? 114  ASN C OD1 1 
ATOM   7541  N  ND2 . ASN C 3  114 ? 76.414  55.391  143.823 1.00 41.20 ? 114  ASN C ND2 1 
ATOM   7542  N  N   . ILE C 3  115 ? 75.008  60.592  144.869 1.00 21.24 ? 115  ILE C N   1 
ATOM   7543  C  CA  . ILE C 3  115 ? 75.030  61.808  145.673 1.00 21.02 ? 115  ILE C CA  1 
ATOM   7544  C  C   . ILE C 3  115 ? 73.857  61.829  146.668 1.00 20.51 ? 115  ILE C C   1 
ATOM   7545  O  O   . ILE C 3  115 ? 74.035  62.239  147.816 1.00 20.49 ? 115  ILE C O   1 
ATOM   7546  C  CB  . ILE C 3  115 ? 75.121  63.090  144.724 1.00 21.60 ? 115  ILE C CB  1 
ATOM   7547  C  CG1 . ILE C 3  115 ? 76.513  63.219  144.034 1.00 22.71 ? 115  ILE C CG1 1 
ATOM   7548  C  CG2 . ILE C 3  115 ? 74.669  64.386  145.398 1.00 22.26 ? 115  ILE C CG2 1 
ATOM   7549  C  CD1 . ILE C 3  115 ? 77.785  63.524  144.941 1.00 39.57 ? 115  ILE C CD1 1 
ATOM   7550  N  N   . GLY C 3  116 ? 72.710  61.274  146.258 1.00 20.00 ? 116  GLY C N   1 
ATOM   7551  C  CA  . GLY C 3  116 ? 71.544  61.131  147.119 1.00 19.22 ? 116  GLY C CA  1 
ATOM   7552  C  C   . GLY C 3  116 ? 71.785  60.234  148.332 1.00 18.61 ? 116  GLY C C   1 
ATOM   7553  O  O   . GLY C 3  116 ? 71.378  60.585  149.443 1.00 18.60 ? 116  GLY C O   1 
ATOM   7554  N  N   . VAL C 3  117 ? 72.570  59.168  148.120 1.00 17.78 ? 117  VAL C N   1 
ATOM   7555  C  CA  . VAL C 3  117 ? 73.087  58.266  149.174 1.00 17.34 ? 117  VAL C CA  1 
ATOM   7556  C  C   . VAL C 3  117 ? 73.930  59.072  150.198 1.00 18.20 ? 117  VAL C C   1 
ATOM   7557  O  O   . VAL C 3  117 ? 73.648  59.019  151.408 1.00 19.11 ? 117  VAL C O   1 
ATOM   7558  C  CB  . VAL C 3  117 ? 73.906  57.067  148.557 1.00 16.22 ? 117  VAL C CB  1 
ATOM   7559  C  CG1 . VAL C 3  117 ? 74.540  56.194  149.649 1.00 17.22 ? 117  VAL C CG1 1 
ATOM   7560  C  CG2 . VAL C 3  117 ? 73.005  56.191  147.646 1.00 18.70 ? 117  VAL C CG2 1 
ATOM   7561  N  N   . ILE C 3  118 ? 74.867  59.877  149.682 1.00 17.50 ? 118  ILE C N   1 
ATOM   7562  C  CA  . ILE C 3  118 ? 75.693  60.776  150.491 1.00 18.30 ? 118  ILE C CA  1 
ATOM   7563  C  C   . ILE C 3  118 ? 74.825  61.757  151.288 1.00 18.84 ? 118  ILE C C   1 
ATOM   7564  O  O   . ILE C 3  118 ? 74.895  61.727  152.526 1.00 19.03 ? 118  ILE C O   1 
ATOM   7565  C  CB  . ILE C 3  118 ? 76.833  61.479  149.636 1.00 18.01 ? 118  ILE C CB  1 
ATOM   7566  C  CG1 . ILE C 3  118 ? 77.854  60.448  149.054 1.00 28.39 ? 118  ILE C CG1 1 
ATOM   7567  C  CG2 . ILE C 3  118 ? 77.528  62.653  150.412 1.00 20.23 ? 118  ILE C CG2 1 
ATOM   7568  C  CD1 . ILE C 3  118 ? 78.703  59.541  150.101 1.00 32.57 ? 118  ILE C CD1 1 
ATOM   7569  N  N   . LEU C 3  119 ? 73.816  62.328  150.602 1.00 18.73 ? 119  LEU C N   1 
ATOM   7570  C  CA  . LEU C 3  119 ? 72.767  63.141  151.228 1.00 18.15 ? 119  LEU C CA  1 
ATOM   7571  C  C   . LEU C 3  119 ? 72.008  62.477  152.341 1.00 17.36 ? 119  LEU C C   1 
ATOM   7572  O  O   . LEU C 3  119 ? 72.029  63.018  153.434 1.00 17.17 ? 119  LEU C O   1 
ATOM   7573  C  CB  . LEU C 3  119 ? 71.820  63.784  150.224 1.00 18.17 ? 119  LEU C CB  1 
ATOM   7574  C  CG  . LEU C 3  119 ? 72.340  64.945  149.378 1.00 23.24 ? 119  LEU C CG  1 
ATOM   7575  C  CD1 . LEU C 3  119 ? 71.404  65.162  148.181 1.00 9.20  ? 119  LEU C CD1 1 
ATOM   7576  C  CD2 . LEU C 3  119 ? 72.570  66.259  150.179 1.00 23.32 ? 119  LEU C CD2 1 
ATOM   7577  N  N   . LEU C 3  120 ? 71.679  61.188  152.153 1.00 17.15 ? 120  LEU C N   1 
ATOM   7578  C  CA  . LEU C 3  120 ? 71.048  60.375  153.193 1.00 17.08 ? 120  LEU C CA  1 
ATOM   7579  C  C   . LEU C 3  120 ? 71.935  60.112  154.423 1.00 17.11 ? 120  LEU C C   1 
ATOM   7580  O  O   . LEU C 3  120 ? 71.499  60.375  155.542 1.00 17.12 ? 120  LEU C O   1 
ATOM   7581  C  CB  . LEU C 3  120 ? 70.426  59.059  152.633 1.00 17.09 ? 120  LEU C CB  1 
ATOM   7582  C  CG  . LEU C 3  120 ? 69.747  58.074  153.617 1.00 17.15 ? 120  LEU C CG  1 
ATOM   7583  C  CD1 . LEU C 3  120 ? 68.576  58.696  154.370 1.00 23.90 ? 120  LEU C CD1 1 
ATOM   7584  C  CD2 . LEU C 3  120 ? 69.306  56.783  152.953 1.00 14.60 ? 120  LEU C CD2 1 
ATOM   7585  N  N   . LEU C 3  121 ? 73.178  59.668  154.195 1.00 17.65 ? 121  LEU C N   1 
ATOM   7586  C  CA  . LEU C 3  121 ? 74.185  59.475  155.267 1.00 18.38 ? 121  LEU C CA  1 
ATOM   7587  C  C   . LEU C 3  121 ? 74.556  60.746  156.043 1.00 18.90 ? 121  LEU C C   1 
ATOM   7588  O  O   . LEU C 3  121 ? 74.870  60.673  157.261 1.00 19.23 ? 121  LEU C O   1 
ATOM   7589  C  CB  . LEU C 3  121 ? 75.454  58.821  154.730 1.00 18.46 ? 121  LEU C CB  1 
ATOM   7590  C  CG  . LEU C 3  121 ? 75.377  57.429  154.097 1.00 22.97 ? 121  LEU C CG  1 
ATOM   7591  C  CD1 . LEU C 3  121 ? 76.524  57.312  153.102 1.00 23.95 ? 121  LEU C CD1 1 
ATOM   7592  C  CD2 . LEU C 3  121 ? 75.428  56.304  155.156 1.00 21.26 ? 121  LEU C CD2 1 
ATOM   7593  N  N   . THR C 3  122 ? 74.454  61.893  155.354 1.00 18.63 ? 122  THR C N   1 
ATOM   7594  C  CA  . THR C 3  122 ? 74.744  63.214  155.917 1.00 18.77 ? 122  THR C CA  1 
ATOM   7595  C  C   . THR C 3  122 ? 73.592  63.751  156.772 1.00 18.90 ? 122  THR C C   1 
ATOM   7596  O  O   . THR C 3  122 ? 73.871  64.387  157.789 1.00 19.03 ? 122  THR C O   1 
ATOM   7597  C  CB  . THR C 3  122 ? 75.176  64.246  154.815 1.00 18.61 ? 122  THR C CB  1 
ATOM   7598  O  OG1 . THR C 3  122 ? 76.040  63.619  153.866 1.00 30.77 ? 122  THR C OG1 1 
ATOM   7599  C  CG2 . THR C 3  122 ? 76.124  65.258  155.378 1.00 28.46 ? 122  THR C CG2 1 
ATOM   7600  N  N   . VAL C 3  123 ? 72.329  63.582  156.334 1.00 18.81 ? 123  VAL C N   1 
ATOM   7601  C  CA  . VAL C 3  123 ? 71.174  63.922  157.205 1.00 19.16 ? 123  VAL C CA  1 
ATOM   7602  C  C   . VAL C 3  123 ? 70.966  63.030  158.431 1.00 19.63 ? 123  VAL C C   1 
ATOM   7603  O  O   . VAL C 3  123 ? 70.649  63.526  159.526 1.00 19.70 ? 123  VAL C O   1 
ATOM   7604  C  CB  . VAL C 3  123 ? 69.875  64.649  156.538 1.00 19.32 ? 123  VAL C CB  1 
ATOM   7605  C  CG1 . VAL C 3  123 ? 69.884  64.709  155.014 1.00 15.18 ? 123  VAL C CG1 1 
ATOM   7606  C  CG2 . VAL C 3  123 ? 68.538  64.129  157.046 1.00 22.23 ? 123  VAL C CG2 1 
ATOM   7607  N  N   . MET C 3  124 ? 71.304  61.749  158.260 1.00 19.96 ? 124  MET C N   1 
ATOM   7608  C  CA  . MET C 3  124 ? 71.361  60.759  159.341 1.00 19.88 ? 124  MET C CA  1 
ATOM   7609  C  C   . MET C 3  124 ? 72.346  61.136  160.455 1.00 19.70 ? 124  MET C C   1 
ATOM   7610  O  O   . MET C 3  124 ? 71.911  61.321  161.606 1.00 19.55 ? 124  MET C O   1 
ATOM   7611  C  CB  . MET C 3  124 ? 71.675  59.385  158.776 1.00 20.10 ? 124  MET C CB  1 
ATOM   7612  C  CG  . MET C 3  124 ? 70.444  58.634  158.301 1.00 12.91 ? 124  MET C CG  1 
ATOM   7613  S  SD  . MET C 3  124 ? 70.869  57.136  157.407 1.00 22.67 ? 124  MET C SD  1 
ATOM   7614  C  CE  . MET C 3  124 ? 71.252  56.003  158.758 1.00 33.30 ? 124  MET C CE  1 
ATOM   7615  N  N   . ALA C 3  125 ? 73.576  61.512  160.046 1.00 19.46 ? 125  ALA C N   1 
ATOM   7616  C  CA  . ALA C 3  125 ? 74.624  62.024  160.947 1.00 18.47 ? 125  ALA C CA  1 
ATOM   7617  C  C   . ALA C 3  125 ? 74.209  63.340  161.597 1.00 17.66 ? 125  ALA C C   1 
ATOM   7618  O  O   . ALA C 3  125 ? 74.285  63.451  162.821 1.00 16.81 ? 125  ALA C O   1 
ATOM   7619  C  CB  . ALA C 3  125 ? 75.948  62.174  160.215 1.00 18.59 ? 125  ALA C CB  1 
ATOM   7620  N  N   . THR C 3  126 ? 73.545  64.201  160.808 1.00 17.84 ? 126  THR C N   1 
ATOM   7621  C  CA  . THR C 3  126 ? 72.990  65.477  161.273 1.00 18.32 ? 126  THR C CA  1 
ATOM   7622  C  C   . THR C 3  126 ? 71.949  65.319  162.375 1.00 19.28 ? 126  THR C C   1 
ATOM   7623  O  O   . THR C 3  126 ? 72.180  65.821  163.476 1.00 20.26 ? 126  THR C O   1 
ATOM   7624  C  CB  . THR C 3  126 ? 72.492  66.342  160.086 1.00 18.03 ? 126  THR C CB  1 
ATOM   7625  O  OG1 . THR C 3  126 ? 73.612  66.664  159.268 1.00 21.90 ? 126  THR C OG1 1 
ATOM   7626  C  CG2 . THR C 3  126 ? 72.033  67.715  160.538 1.00 15.51 ? 126  THR C CG2 1 
ATOM   7627  N  N   . ALA C 3  127 ? 70.972  64.433  162.150 1.00 19.13 ? 127  ALA C N   1 
ATOM   7628  C  CA  . ALA C 3  127 ? 69.830  64.271  163.047 1.00 18.71 ? 127  ALA C CA  1 
ATOM   7629  C  C   . ALA C 3  127 ? 70.171  63.499  164.313 1.00 18.90 ? 127  ALA C C   1 
ATOM   7630  O  O   . ALA C 3  127 ? 69.546  63.730  165.351 1.00 19.16 ? 127  ALA C O   1 
ATOM   7631  C  CB  . ALA C 3  127 ? 68.673  63.646  162.326 1.00 18.30 ? 127  ALA C CB  1 
ATOM   7632  N  N   . PHE C 3  128 ? 71.109  62.545  164.202 1.00 19.35 ? 128  PHE C N   1 
ATOM   7633  C  CA  . PHE C 3  128 ? 71.747  61.895  165.357 1.00 19.86 ? 128  PHE C CA  1 
ATOM   7634  C  C   . PHE C 3  128 ? 72.381  62.910  166.332 1.00 20.42 ? 128  PHE C C   1 
ATOM   7635  O  O   . PHE C 3  128 ? 71.991  62.945  167.505 1.00 21.03 ? 128  PHE C O   1 
ATOM   7636  C  CB  . PHE C 3  128 ? 72.743  60.791  164.922 1.00 19.86 ? 128  PHE C CB  1 
ATOM   7637  C  CG  . PHE C 3  128 ? 73.766  60.404  166.000 1.00 25.11 ? 128  PHE C CG  1 
ATOM   7638  C  CD1 . PHE C 3  128 ? 75.146  60.669  165.796 1.00 17.73 ? 128  PHE C CD1 1 
ATOM   7639  C  CD2 . PHE C 3  128 ? 73.352  59.807  167.239 1.00 18.66 ? 128  PHE C CD2 1 
ATOM   7640  C  CE1 . PHE C 3  128 ? 76.121  60.350  166.806 1.00 22.16 ? 128  PHE C CE1 1 
ATOM   7641  C  CE2 . PHE C 3  128 ? 74.290  59.610  168.316 1.00 14.06 ? 128  PHE C CE2 1 
ATOM   7642  C  CZ  . PHE C 3  128 ? 75.685  59.804  168.076 1.00 19.38 ? 128  PHE C CZ  1 
ATOM   7643  N  N   . MET C 3  129 ? 73.244  63.783  165.808 1.00 20.13 ? 129  MET C N   1 
ATOM   7644  C  CA  . MET C 3  129 ? 74.013  64.743  166.618 1.00 20.24 ? 129  MET C CA  1 
ATOM   7645  C  C   . MET C 3  129 ? 73.154  65.818  167.279 1.00 20.69 ? 129  MET C C   1 
ATOM   7646  O  O   . MET C 3  129 ? 73.393  66.152  168.449 1.00 21.41 ? 129  MET C O   1 
ATOM   7647  C  CB  . MET C 3  129 ? 75.156  65.365  165.815 1.00 20.05 ? 129  MET C CB  1 
ATOM   7648  C  CG  . MET C 3  129 ? 76.410  64.516  165.820 1.00 15.32 ? 129  MET C CG  1 
ATOM   7649  S  SD  . MET C 3  129 ? 77.630  65.105  164.676 1.00 27.64 ? 129  MET C SD  1 
ATOM   7650  C  CE  . MET C 3  129 ? 78.953  63.885  164.858 1.00 12.17 ? 129  MET C CE  1 
ATOM   7651  N  N   . GLY C 3  130 ? 72.081  66.228  166.586 1.00 20.16 ? 130  GLY C N   1 
ATOM   7652  C  CA  . GLY C 3  130 ? 71.042  67.097  167.125 1.00 19.72 ? 130  GLY C CA  1 
ATOM   7653  C  C   . GLY C 3  130 ? 70.237  66.549  168.279 1.00 19.33 ? 130  GLY C C   1 
ATOM   7654  O  O   . GLY C 3  130 ? 69.970  67.285  169.230 1.00 18.56 ? 130  GLY C O   1 
ATOM   7655  N  N   . TYR C 3  131 ? 69.764  65.305  168.134 1.00 19.75 ? 131  TYR C N   1 
ATOM   7656  C  CA  . TYR C 3  131 ? 69.003  64.589  169.175 1.00 20.19 ? 131  TYR C CA  1 
ATOM   7657  C  C   . TYR C 3  131 ? 69.711  64.454  170.542 1.00 20.34 ? 131  TYR C C   1 
ATOM   7658  O  O   . TYR C 3  131 ? 69.052  64.523  171.576 1.00 20.64 ? 131  TYR C O   1 
ATOM   7659  C  CB  . TYR C 3  131 ? 68.535  63.228  168.664 1.00 20.17 ? 131  TYR C CB  1 
ATOM   7660  C  CG  . TYR C 3  131 ? 67.465  62.571  169.513 1.00 19.52 ? 131  TYR C CG  1 
ATOM   7661  C  CD1 . TYR C 3  131 ? 67.809  61.573  170.481 1.00 22.12 ? 131  TYR C CD1 1 
ATOM   7662  C  CD2 . TYR C 3  131 ? 66.089  62.918  169.350 1.00 24.75 ? 131  TYR C CD2 1 
ATOM   7663  C  CE1 . TYR C 3  131 ? 66.783  60.902  171.260 1.00 21.56 ? 131  TYR C CE1 1 
ATOM   7664  C  CE2 . TYR C 3  131 ? 65.056  62.271  170.134 1.00 20.20 ? 131  TYR C CE2 1 
ATOM   7665  C  CZ  . TYR C 3  131 ? 65.419  61.266  171.073 1.00 21.24 ? 131  TYR C CZ  1 
ATOM   7666  O  OH  . TYR C 3  131 ? 64.435  60.659  171.822 1.00 29.99 ? 131  TYR C OH  1 
ATOM   7667  N  N   . VAL C 3  132 ? 71.034  64.257  170.504 1.00 20.07 ? 132  VAL C N   1 
ATOM   7668  C  CA  . VAL C 3  132 ? 71.967  64.379  171.644 1.00 19.80 ? 132  VAL C CA  1 
ATOM   7669  C  C   . VAL C 3  132 ? 71.865  65.726  172.398 1.00 19.94 ? 132  VAL C C   1 
ATOM   7670  O  O   . VAL C 3  132 ? 71.912  65.745  173.637 1.00 20.29 ? 132  VAL C O   1 
ATOM   7671  C  CB  . VAL C 3  132 ? 73.458  64.049  171.206 1.00 19.68 ? 132  VAL C CB  1 
ATOM   7672  C  CG1 . VAL C 3  132 ? 74.445  64.057  172.396 1.00 14.89 ? 132  VAL C CG1 1 
ATOM   7673  C  CG2 . VAL C 3  132 ? 73.533  62.687  170.493 1.00 16.36 ? 132  VAL C CG2 1 
ATOM   7674  N  N   . LEU C 3  133 ? 71.697  66.820  171.648 1.00 19.75 ? 133  LEU C N   1 
ATOM   7675  C  CA  . LEU C 3  133 ? 71.822  68.202  172.175 1.00 19.17 ? 133  LEU C CA  1 
ATOM   7676  C  C   . LEU C 3  133 ? 70.991  68.628  173.419 1.00 19.08 ? 133  LEU C C   1 
ATOM   7677  O  O   . LEU C 3  133 ? 71.604  69.190  174.334 1.00 19.13 ? 133  LEU C O   1 
ATOM   7678  C  CB  . LEU C 3  133 ? 71.843  69.290  171.073 1.00 18.42 ? 133  LEU C CB  1 
ATOM   7679  C  CG  . LEU C 3  133 ? 72.784  69.178  169.856 1.00 21.09 ? 133  LEU C CG  1 
ATOM   7680  C  CD1 . LEU C 3  133 ? 72.608  70.339  168.880 1.00 20.76 ? 133  LEU C CD1 1 
ATOM   7681  C  CD2 . LEU C 3  133 ? 74.268  68.984  170.231 1.00 18.55 ? 133  LEU C CD2 1 
ATOM   7682  N  N   . PRO C 3  134 ? 69.681  68.277  173.533 1.00 18.82 ? 134  PRO C N   1 
ATOM   7683  C  CA  . PRO C 3  134 ? 68.918  68.631  174.748 1.00 19.60 ? 134  PRO C CA  1 
ATOM   7684  C  C   . PRO C 3  134 ? 69.312  67.881  176.043 1.00 20.22 ? 134  PRO C C   1 
ATOM   7685  O  O   . PRO C 3  134 ? 68.834  68.287  177.104 1.00 20.47 ? 134  PRO C O   1 
ATOM   7686  C  CB  . PRO C 3  134 ? 67.461  68.337  174.345 1.00 19.81 ? 134  PRO C CB  1 
ATOM   7687  C  CG  . PRO C 3  134 ? 67.572  67.311  173.268 1.00 22.56 ? 134  PRO C CG  1 
ATOM   7688  C  CD  . PRO C 3  134 ? 68.753  67.776  172.489 1.00 18.44 ? 134  PRO C CD  1 
ATOM   7689  N  N   . TRP C 3  135 ? 70.181  66.854  175.939 1.00 20.47 ? 135  TRP C N   1 
ATOM   7690  C  CA  . TRP C 3  135 ? 70.794  66.118  177.067 1.00 20.32 ? 135  TRP C CA  1 
ATOM   7691  C  C   . TRP C 3  135 ? 69.769  65.476  178.038 1.00 20.71 ? 135  TRP C C   1 
ATOM   7692  O  O   . TRP C 3  135 ? 69.832  65.655  179.278 1.00 20.76 ? 135  TRP C O   1 
ATOM   7693  C  CB  . TRP C 3  135 ? 71.859  66.978  177.769 1.00 19.93 ? 135  TRP C CB  1 
ATOM   7694  C  CG  . TRP C 3  135 ? 73.013  66.225  178.384 1.00 17.95 ? 135  TRP C CG  1 
ATOM   7695  C  CD1 . TRP C 3  135 ? 73.418  66.299  179.698 1.00 21.79 ? 135  TRP C CD1 1 
ATOM   7696  C  CD2 . TRP C 3  135 ? 74.044  65.497  177.694 1.00 16.77 ? 135  TRP C CD2 1 
ATOM   7697  N  NE1 . TRP C 3  135 ? 74.609  65.634  179.877 1.00 17.42 ? 135  TRP C NE1 1 
ATOM   7698  C  CE2 . TRP C 3  135 ? 75.048  65.169  178.664 1.00 19.00 ? 135  TRP C CE2 1 
ATOM   7699  C  CE3 . TRP C 3  135 ? 74.274  65.146  176.332 1.00 20.14 ? 135  TRP C CE3 1 
ATOM   7700  C  CZ2 . TRP C 3  135 ? 76.249  64.466  178.330 1.00 17.21 ? 135  TRP C CZ2 1 
ATOM   7701  C  CZ3 . TRP C 3  135 ? 75.468  64.419  175.994 1.00 13.07 ? 135  TRP C CZ3 1 
ATOM   7702  C  CH2 . TRP C 3  135 ? 76.455  64.137  176.995 1.00 15.46 ? 135  TRP C CH2 1 
ATOM   7703  N  N   . GLY C 3  136 ? 68.723  64.905  177.424 1.00 20.87 ? 136  GLY C N   1 
ATOM   7704  C  CA  . GLY C 3  136 ? 67.849  63.923  178.041 1.00 20.48 ? 136  GLY C CA  1 
ATOM   7705  C  C   . GLY C 3  136 ? 68.487  62.550  178.150 1.00 20.95 ? 136  GLY C C   1 
ATOM   7706  O  O   . GLY C 3  136 ? 69.628  62.340  177.707 1.00 20.82 ? 136  GLY C O   1 
ATOM   7707  N  N   . GLN C 3  137 ? 67.761  61.629  178.798 1.00 21.45 ? 137  GLN C N   1 
ATOM   7708  C  CA  . GLN C 3  137 ? 68.176  60.229  178.932 1.00 21.66 ? 137  GLN C CA  1 
ATOM   7709  C  C   . GLN C 3  137 ? 68.397  59.483  177.612 1.00 21.72 ? 137  GLN C C   1 
ATOM   7710  O  O   . GLN C 3  137 ? 69.436  58.826  177.445 1.00 21.90 ? 137  GLN C O   1 
ATOM   7711  C  CB  . GLN C 3  137 ? 67.251  59.447  179.871 1.00 21.71 ? 137  GLN C CB  1 
ATOM   7712  C  CG  . GLN C 3  137 ? 67.670  59.474  181.333 1.00 16.30 ? 137  GLN C CG  1 
ATOM   7713  C  CD  . GLN C 3  137 ? 68.815  58.516  181.651 1.00 23.14 ? 137  GLN C CD  1 
ATOM   7714  O  OE1 . GLN C 3  137 ? 69.965  58.750  181.249 1.00 13.45 ? 137  GLN C OE1 1 
ATOM   7715  N  NE2 . GLN C 3  137 ? 68.520  57.476  182.431 1.00 16.66 ? 137  GLN C NE2 1 
ATOM   7716  N  N   . MET C 3  138 ? 67.504  59.716  176.644 1.00 21.80 ? 138  MET C N   1 
ATOM   7717  C  CA  . MET C 3  138 ? 67.592  59.081  175.319 1.00 22.00 ? 138  MET C CA  1 
ATOM   7718  C  C   . MET C 3  138 ? 68.669  59.689  174.450 1.00 21.83 ? 138  MET C C   1 
ATOM   7719  O  O   . MET C 3  138 ? 69.386  58.956  173.775 1.00 22.08 ? 138  MET C O   1 
ATOM   7720  C  CB  . MET C 3  138 ? 66.240  59.057  174.594 1.00 21.97 ? 138  MET C CB  1 
ATOM   7721  C  CG  . MET C 3  138 ? 65.268  57.967  175.056 1.00 24.88 ? 138  MET C CG  1 
ATOM   7722  S  SD  . MET C 3  138 ? 65.954  56.312  175.478 1.00 28.68 ? 138  MET C SD  1 
ATOM   7723  C  CE  . MET C 3  138 ? 66.491  55.725  173.968 1.00 26.18 ? 138  MET C CE  1 
ATOM   7724  N  N   . SER C 3  139 ? 68.827  61.015  174.560 1.00 21.57 ? 139  SER C N   1 
ATOM   7725  C  CA  . SER C 3  139 ? 69.986  61.776  174.074 1.00 21.36 ? 139  SER C CA  1 
ATOM   7726  C  C   . SER C 3  139 ? 71.331  61.121  174.433 1.00 21.33 ? 139  SER C C   1 
ATOM   7727  O  O   . SER C 3  139 ? 71.966  60.572  173.520 1.00 21.56 ? 139  SER C O   1 
ATOM   7728  C  CB  . SER C 3  139 ? 69.914  63.223  174.553 1.00 21.43 ? 139  SER C CB  1 
ATOM   7729  O  OG  . SER C 3  139 ? 68.755  63.868  174.059 1.00 16.92 ? 139  SER C OG  1 
ATOM   7730  N  N   . PHE C 3  140 ? 71.490  60.801  175.732 1.00 20.89 ? 140  PHE C N   1 
ATOM   7731  C  CA  . PHE C 3  140 ? 72.734  60.255  176.288 1.00 20.15 ? 140  PHE C CA  1 
ATOM   7732  C  C   . PHE C 3  140 ? 73.020  58.808  175.886 1.00 19.42 ? 140  PHE C C   1 
ATOM   7733  O  O   . PHE C 3  140 ? 74.167  58.488  175.547 1.00 18.91 ? 140  PHE C O   1 
ATOM   7734  C  CB  . PHE C 3  140 ? 72.809  60.431  177.817 1.00 20.37 ? 140  PHE C CB  1 
ATOM   7735  C  CG  . PHE C 3  140 ? 74.170  60.113  178.399 1.00 25.45 ? 140  PHE C CG  1 
ATOM   7736  C  CD1 . PHE C 3  140 ? 75.224  61.061  178.303 1.00 21.08 ? 140  PHE C CD1 1 
ATOM   7737  C  CD2 . PHE C 3  140 ? 74.451  58.815  178.925 1.00 24.25 ? 140  PHE C CD2 1 
ATOM   7738  C  CE1 . PHE C 3  140 ? 76.548  60.736  178.709 1.00 21.53 ? 140  PHE C CE1 1 
ATOM   7739  C  CE2 . PHE C 3  140 ? 75.781  58.449  179.313 1.00 24.64 ? 140  PHE C CE2 1 
ATOM   7740  C  CZ  . PHE C 3  140 ? 76.834  59.429  179.230 1.00 25.16 ? 140  PHE C CZ  1 
ATOM   7741  N  N   . TRP C 3  141 ? 72.040  57.926  176.120 1.00 19.31 ? 141  TRP C N   1 
ATOM   7742  C  CA  . TRP C 3  141 ? 72.168  56.495  175.809 1.00 19.34 ? 141  TRP C CA  1 
ATOM   7743  C  C   . TRP C 3  141 ? 72.108  56.157  174.319 1.00 19.35 ? 141  TRP C C   1 
ATOM   7744  O  O   . TRP C 3  141 ? 72.799  55.226  173.866 1.00 20.12 ? 141  TRP C O   1 
ATOM   7745  C  CB  . TRP C 3  141 ? 71.228  55.634  176.673 1.00 19.15 ? 141  TRP C CB  1 
ATOM   7746  C  CG  . TRP C 3  141 ? 71.579  55.736  178.164 1.00 20.31 ? 141  TRP C CG  1 
ATOM   7747  C  CD1 . TRP C 3  141 ? 70.945  56.520  179.097 1.00 17.13 ? 141  TRP C CD1 1 
ATOM   7748  C  CD2 . TRP C 3  141 ? 72.792  55.284  178.794 1.00 19.87 ? 141  TRP C CD2 1 
ATOM   7749  N  NE1 . TRP C 3  141 ? 71.655  56.545  180.273 1.00 16.13 ? 141  TRP C NE1 1 
ATOM   7750  C  CE2 . TRP C 3  141 ? 72.812  55.829  180.114 1.00 20.66 ? 141  TRP C CE2 1 
ATOM   7751  C  CE3 . TRP C 3  141 ? 73.886  54.478  178.374 1.00 24.34 ? 141  TRP C CE3 1 
ATOM   7752  C  CZ2 . TRP C 3  141 ? 73.843  55.533  181.052 1.00 20.29 ? 141  TRP C CZ2 1 
ATOM   7753  C  CZ3 . TRP C 3  141 ? 74.946  54.221  179.296 1.00 23.45 ? 141  TRP C CZ3 1 
ATOM   7754  C  CH2 . TRP C 3  141 ? 74.916  54.770  180.611 1.00 22.01 ? 141  TRP C CH2 1 
ATOM   7755  N  N   . GLY C 3  142 ? 71.316  56.936  173.569 1.00 18.45 ? 142  GLY C N   1 
ATOM   7756  C  CA  . GLY C 3  142 ? 71.401  57.018  172.120 1.00 18.52 ? 142  GLY C CA  1 
ATOM   7757  C  C   . GLY C 3  142 ? 72.770  57.440  171.600 1.00 18.75 ? 142  GLY C C   1 
ATOM   7758  O  O   . GLY C 3  142 ? 73.339  56.714  170.764 1.00 19.26 ? 142  GLY C O   1 
ATOM   7759  N  N   . ALA C 3  143 ? 73.334  58.519  172.176 1.00 18.26 ? 143  ALA C N   1 
ATOM   7760  C  CA  . ALA C 3  143 ? 74.746  58.907  171.972 1.00 18.25 ? 143  ALA C CA  1 
ATOM   7761  C  C   . ALA C 3  143 ? 75.743  57.784  172.278 1.00 18.49 ? 143  ALA C C   1 
ATOM   7762  O  O   . ALA C 3  143 ? 76.571  57.483  171.431 1.00 18.71 ? 143  ALA C O   1 
ATOM   7763  C  CB  . ALA C 3  143 ? 75.101  60.151  172.752 1.00 18.03 ? 143  ALA C CB  1 
ATOM   7764  N  N   . THR C 3  144 ? 75.486  57.046  173.366 1.00 18.18 ? 144  THR C N   1 
ATOM   7765  C  CA  . THR C 3  144 ? 76.325  55.936  173.843 1.00 18.01 ? 144  THR C CA  1 
ATOM   7766  C  C   . THR C 3  144 ? 76.338  54.750  172.862 1.00 17.47 ? 144  THR C C   1 
ATOM   7767  O  O   . THR C 3  144 ? 77.417  54.374  172.392 1.00 16.74 ? 144  THR C O   1 
ATOM   7768  C  CB  . THR C 3  144 ? 75.895  55.524  175.293 1.00 18.04 ? 144  THR C CB  1 
ATOM   7769  O  OG1 . THR C 3  144 ? 76.068  56.653  176.165 1.00 26.68 ? 144  THR C OG1 1 
ATOM   7770  C  CG2 . THR C 3  144 ? 76.835  54.471  175.897 1.00 15.62 ? 144  THR C CG2 1 
ATOM   7771  N  N   . VAL C 3  145 ? 75.140  54.332  172.424 1.00 17.72 ? 145  VAL C N   1 
ATOM   7772  C  CA  . VAL C 3  145 ? 74.935  53.148  171.571 1.00 18.05 ? 145  VAL C CA  1 
ATOM   7773  C  C   . VAL C 3  145 ? 75.525  53.338  170.154 1.00 18.77 ? 145  VAL C C   1 
ATOM   7774  O  O   . VAL C 3  145 ? 76.340  52.500  169.713 1.00 18.27 ? 145  VAL C O   1 
ATOM   7775  C  CB  . VAL C 3  145 ? 73.429  52.675  171.589 1.00 17.74 ? 145  VAL C CB  1 
ATOM   7776  C  CG1 . VAL C 3  145 ? 73.067  51.769  170.378 1.00 15.03 ? 145  VAL C CG1 1 
ATOM   7777  C  CG2 . VAL C 3  145 ? 73.121  51.930  172.904 1.00 19.57 ? 145  VAL C CG2 1 
ATOM   7778  N  N   . ILE C 3  146 ? 75.192  54.484  169.527 1.00 19.92 ? 146  ILE C N   1 
ATOM   7779  C  CA  . ILE C 3  146 ? 75.637  54.860  168.162 1.00 20.70 ? 146  ILE C CA  1 
ATOM   7780  C  C   . ILE C 3  146 ? 77.147  55.062  168.069 1.00 21.89 ? 146  ILE C C   1 
ATOM   7781  O  O   . ILE C 3  146 ? 77.767  54.621  167.093 1.00 21.88 ? 146  ILE C O   1 
ATOM   7782  C  CB  . ILE C 3  146 ? 74.823  56.135  167.590 1.00 20.45 ? 146  ILE C CB  1 
ATOM   7783  C  CG1 . ILE C 3  146 ? 73.296  55.894  167.488 1.00 12.85 ? 146  ILE C CG1 1 
ATOM   7784  C  CG2 . ILE C 3  146 ? 75.405  56.707  166.232 1.00 19.25 ? 146  ILE C CG2 1 
ATOM   7785  C  CD1 . ILE C 3  146 ? 72.830  54.679  166.661 1.00 12.13 ? 146  ILE C CD1 1 
ATOM   7786  N  N   . THR C 3  147 ? 77.709  55.806  169.029 1.00 23.14 ? 147  THR C N   1 
ATOM   7787  C  CA  . THR C 3  147 ? 79.160  56.095  169.073 1.00 24.21 ? 147  THR C CA  1 
ATOM   7788  C  C   . THR C 3  147 ? 79.991  54.823  169.258 1.00 24.08 ? 147  THR C C   1 
ATOM   7789  O  O   . THR C 3  147 ? 80.945  54.616  168.509 1.00 24.62 ? 147  THR C O   1 
ATOM   7790  C  CB  . THR C 3  147 ? 79.504  57.137  170.154 1.00 25.19 ? 147  THR C CB  1 
ATOM   7791  O  OG1 . THR C 3  147 ? 78.552  58.207  170.105 1.00 48.28 ? 147  THR C OG1 1 
ATOM   7792  C  CG2 . THR C 3  147 ? 80.761  57.879  169.780 1.00 41.10 ? 147  THR C CG2 1 
ATOM   7793  N  N   . ASN C 3  148 ? 79.469  53.898  170.076 1.00 23.19 ? 148  ASN C N   1 
ATOM   7794  C  CA  . ASN C 3  148 ? 80.073  52.587  170.302 1.00 22.40 ? 148  ASN C CA  1 
ATOM   7795  C  C   . ASN C 3  148 ? 80.063  51.610  169.128 1.00 21.49 ? 148  ASN C C   1 
ATOM   7796  O  O   . ASN C 3  148 ? 80.833  50.642  169.143 1.00 21.37 ? 148  ASN C O   1 
ATOM   7797  C  CB  . ASN C 3  148 ? 79.521  51.932  171.574 1.00 22.25 ? 148  ASN C CB  1 
ATOM   7798  C  CG  . ASN C 3  148 ? 80.183  52.444  172.828 1.00 17.48 ? 148  ASN C CG  1 
ATOM   7799  O  OD1 . ASN C 3  148 ? 81.410  52.372  172.979 1.00 19.35 ? 148  ASN C OD1 1 
ATOM   7800  N  ND2 . ASN C 3  148 ? 79.371  52.900  173.775 1.00 15.44 ? 148  ASN C ND2 1 
ATOM   7801  N  N   . LEU C 3  149 ? 79.224  51.881  168.110 1.00 21.12 ? 149  LEU C N   1 
ATOM   7802  C  CA  . LEU C 3  149 ? 79.218  51.138  166.828 1.00 20.65 ? 149  LEU C CA  1 
ATOM   7803  C  C   . LEU C 3  149 ? 80.575  51.137  166.114 1.00 21.16 ? 149  LEU C C   1 
ATOM   7804  O  O   . LEU C 3  149 ? 80.978  50.099  165.541 1.00 21.70 ? 149  LEU C O   1 
ATOM   7805  C  CB  . LEU C 3  149 ? 78.139  51.648  165.869 1.00 19.96 ? 149  LEU C CB  1 
ATOM   7806  C  CG  . LEU C 3  149 ? 76.634  51.692  166.163 1.00 15.05 ? 149  LEU C CG  1 
ATOM   7807  C  CD1 . LEU C 3  149 ? 75.958  52.444  165.037 1.00 6.51  ? 149  LEU C CD1 1 
ATOM   7808  C  CD2 . LEU C 3  149 ? 75.958  50.322  166.385 1.00 9.00  ? 149  LEU C CD2 1 
ATOM   7809  N  N   . LEU C 3  150 ? 81.301  52.255  166.264 1.00 20.79 ? 150  LEU C N   1 
ATOM   7810  C  CA  . LEU C 3  150 ? 82.674  52.420  165.791 1.00 20.86 ? 150  LEU C CA  1 
ATOM   7811  C  C   . LEU C 3  150 ? 83.733  51.543  166.482 1.00 20.63 ? 150  LEU C C   1 
ATOM   7812  O  O   . LEU C 3  150 ? 84.702  51.153  165.829 1.00 20.87 ? 150  LEU C O   1 
ATOM   7813  C  CB  . LEU C 3  150 ? 83.099  53.917  165.756 1.00 21.21 ? 150  LEU C CB  1 
ATOM   7814  C  CG  . LEU C 3  150 ? 82.236  55.055  165.137 1.00 32.69 ? 150  LEU C CG  1 
ATOM   7815  C  CD1 . LEU C 3  150 ? 82.884  56.422  165.367 1.00 38.01 ? 150  LEU C CD1 1 
ATOM   7816  C  CD2 . LEU C 3  150 ? 81.868  54.878  163.638 1.00 37.30 ? 150  LEU C CD2 1 
ATOM   7817  N  N   . SER C 3  151 ? 83.474  51.124  167.735 1.00 20.46 ? 151  SER C N   1 
ATOM   7818  C  CA  . SER C 3  151 ? 84.407  50.278  168.536 1.00 20.14 ? 151  SER C CA  1 
ATOM   7819  C  C   . SER C 3  151 ? 84.543  48.821  168.060 1.00 19.40 ? 151  SER C C   1 
ATOM   7820  O  O   . SER C 3  151 ? 85.446  48.093  168.508 1.00 19.16 ? 151  SER C O   1 
ATOM   7821  C  CB  . SER C 3  151 ? 84.073  50.343  170.041 1.00 20.18 ? 151  SER C CB  1 
ATOM   7822  O  OG  . SER C 3  151 ? 82.891  49.631  170.335 1.00 19.99 ? 151  SER C OG  1 
ATOM   7823  N  N   . ALA C 3  152 ? 83.615  48.416  167.186 1.00 19.38 ? 152  ALA C N   1 
ATOM   7824  C  CA  . ALA C 3  152 ? 83.619  47.122  166.502 1.00 19.31 ? 152  ALA C CA  1 
ATOM   7825  C  C   . ALA C 3  152 ? 84.656  46.984  165.394 1.00 19.29 ? 152  ALA C C   1 
ATOM   7826  O  O   . ALA C 3  152 ? 85.079  45.852  165.096 1.00 19.43 ? 152  ALA C O   1 
ATOM   7827  C  CB  . ALA C 3  152 ? 82.276  46.825  165.982 1.00 19.29 ? 152  ALA C CB  1 
ATOM   7828  N  N   . ILE C 3  153 ? 85.094  48.125  164.830 1.00 19.16 ? 153  ILE C N   1 
ATOM   7829  C  CA  . ILE C 3  153 ? 86.179  48.182  163.825 1.00 19.16 ? 153  ILE C CA  1 
ATOM   7830  C  C   . ILE C 3  153 ? 87.477  47.548  164.406 1.00 19.45 ? 153  ILE C C   1 
ATOM   7831  O  O   . ILE C 3  153 ? 87.931  48.004  165.459 1.00 19.85 ? 153  ILE C O   1 
ATOM   7832  C  CB  . ILE C 3  153 ? 86.424  49.653  163.254 1.00 18.61 ? 153  ILE C CB  1 
ATOM   7833  C  CG1 . ILE C 3  153 ? 85.144  50.227  162.605 1.00 16.47 ? 153  ILE C CG1 1 
ATOM   7834  C  CG2 . ILE C 3  153 ? 87.612  49.669  162.224 1.00 17.50 ? 153  ILE C CG2 1 
ATOM   7835  C  CD1 . ILE C 3  153 ? 85.115  51.806  162.467 1.00 18.65 ? 153  ILE C CD1 1 
ATOM   7836  N  N   . PRO C 3  154 ? 87.974  46.437  163.799 1.00 19.39 ? 154  PRO C N   1 
ATOM   7837  C  CA  . PRO C 3  154 ? 89.211  45.759  164.262 1.00 19.38 ? 154  PRO C CA  1 
ATOM   7838  C  C   . PRO C 3  154 ? 90.436  46.686  164.395 1.00 19.48 ? 154  PRO C C   1 
ATOM   7839  O  O   . PRO C 3  154 ? 90.525  47.672  163.645 1.00 19.50 ? 154  PRO C O   1 
ATOM   7840  C  CB  . PRO C 3  154 ? 89.475  44.723  163.165 1.00 19.45 ? 154  PRO C CB  1 
ATOM   7841  C  CG  . PRO C 3  154 ? 88.145  44.476  162.533 1.00 25.00 ? 154  PRO C CG  1 
ATOM   7842  C  CD  . PRO C 3  154 ? 87.421  45.765  162.596 1.00 19.48 ? 154  PRO C CD  1 
ATOM   7843  N  N   . TYR C 3  155 ? 91.189  46.504  165.490 1.00 19.49 ? 155  TYR C N   1 
ATOM   7844  C  CA  . TYR C 3  155 ? 92.507  47.126  165.751 1.00 19.87 ? 155  TYR C CA  1 
ATOM   7845  C  C   . TYR C 3  155 ? 92.470  48.613  166.160 1.00 19.83 ? 155  TYR C C   1 
ATOM   7846  O  O   . TYR C 3  155 ? 92.995  48.968  167.220 1.00 20.08 ? 155  TYR C O   1 
ATOM   7847  C  CB  . TYR C 3  155 ? 93.553  46.814  164.639 1.00 20.30 ? 155  TYR C CB  1 
ATOM   7848  C  CG  . TYR C 3  155 ? 94.966  47.309  164.905 1.00 29.03 ? 155  TYR C CG  1 
ATOM   7849  C  CD1 . TYR C 3  155 ? 95.840  46.600  165.780 1.00 30.35 ? 155  TYR C CD1 1 
ATOM   7850  C  CD2 . TYR C 3  155 ? 95.462  48.467  164.244 1.00 30.25 ? 155  TYR C CD2 1 
ATOM   7851  C  CE1 . TYR C 3  155 ? 97.167  47.088  166.058 1.00 31.37 ? 155  TYR C CE1 1 
ATOM   7852  C  CE2 . TYR C 3  155 ? 96.779  48.968  164.515 1.00 30.94 ? 155  TYR C CE2 1 
ATOM   7853  C  CZ  . TYR C 3  155 ? 97.624  48.259  165.405 1.00 32.42 ? 155  TYR C CZ  1 
ATOM   7854  O  OH  . TYR C 3  155 ? 98.888  48.731  165.663 1.00 35.27 ? 155  TYR C OH  1 
ATOM   7855  N  N   . ILE C 3  156 ? 91.759  49.431  165.380 1.00 19.70 ? 156  ILE C N   1 
ATOM   7856  C  CA  . ILE C 3  156 ? 91.679  50.899  165.558 1.00 19.55 ? 156  ILE C CA  1 
ATOM   7857  C  C   . ILE C 3  156 ? 90.421  51.449  166.260 1.00 19.26 ? 156  ILE C C   1 
ATOM   7858  O  O   . ILE C 3  156 ? 90.421  52.621  166.684 1.00 19.09 ? 156  ILE C O   1 
ATOM   7859  C  CB  . ILE C 3  156 ? 91.996  51.691  164.224 1.00 19.46 ? 156  ILE C CB  1 
ATOM   7860  C  CG1 . ILE C 3  156 ? 91.052  51.305  163.066 1.00 22.62 ? 156  ILE C CG1 1 
ATOM   7861  C  CG2 . ILE C 3  156 ? 93.484  51.599  163.868 1.00 21.29 ? 156  ILE C CG2 1 
ATOM   7862  C  CD1 . ILE C 3  156 ? 90.453  52.514  162.317 1.00 23.27 ? 156  ILE C CD1 1 
ATOM   7863  N  N   . GLY C 3  157 ? 89.468  50.552  166.551 1.00 19.20 ? 157  GLY C N   1 
ATOM   7864  C  CA  . GLY C 3  157 ? 88.097  50.892  166.928 1.00 19.46 ? 157  GLY C CA  1 
ATOM   7865  C  C   . GLY C 3  157 ? 87.938  51.687  168.207 1.00 19.90 ? 157  GLY C C   1 
ATOM   7866  O  O   . GLY C 3  157 ? 87.356  52.772  168.155 1.00 19.96 ? 157  GLY C O   1 
ATOM   7867  N  N   . THR C 3  158 ? 88.595  51.222  169.286 1.00 20.17 ? 158  THR C N   1 
ATOM   7868  C  CA  . THR C 3  158 ? 88.656  51.900  170.606 1.00 20.30 ? 158  THR C CA  1 
ATOM   7869  C  C   . THR C 3  158 ? 89.266  53.311  170.542 1.00 20.01 ? 158  THR C C   1 
ATOM   7870  O  O   . THR C 3  158 ? 88.682  54.261  171.092 1.00 19.57 ? 158  THR C O   1 
ATOM   7871  C  CB  . THR C 3  158 ? 89.401  51.000  171.661 1.00 20.54 ? 158  THR C CB  1 
ATOM   7872  O  OG1 . THR C 3  158 ? 88.794  49.699  171.690 1.00 24.79 ? 158  THR C OG1 1 
ATOM   7873  C  CG2 . THR C 3  158 ? 89.196  51.515  173.113 1.00 20.82 ? 158  THR C CG2 1 
ATOM   7874  N  N   . ASN C 3  159 ? 90.398  53.429  169.826 1.00 20.30 ? 159  ASN C N   1 
ATOM   7875  C  CA  . ASN C 3  159 ? 91.094  54.701  169.579 1.00 20.58 ? 159  ASN C CA  1 
ATOM   7876  C  C   . ASN C 3  159 ? 90.250  55.741  168.832 1.00 20.65 ? 159  ASN C C   1 
ATOM   7877  O  O   . ASN C 3  159 ? 90.226  56.903  169.238 1.00 20.56 ? 159  ASN C O   1 
ATOM   7878  C  CB  . ASN C 3  159 ? 92.434  54.477  168.857 1.00 20.90 ? 159  ASN C CB  1 
ATOM   7879  C  CG  . ASN C 3  159 ? 93.401  53.588  169.648 1.00 25.50 ? 159  ASN C CG  1 
ATOM   7880  O  OD1 . ASN C 3  159 ? 93.785  52.517  169.179 1.00 30.80 ? 159  ASN C OD1 1 
ATOM   7881  N  ND2 . ASN C 3  159 ? 93.884  54.087  170.789 1.00 29.46 ? 159  ASN C ND2 1 
ATOM   7882  N  N   . LEU C 3  160 ? 89.406  55.247  167.914 1.00 21.00 ? 160  LEU C N   1 
ATOM   7883  C  CA  . LEU C 3  160 ? 88.475  56.043  167.110 1.00 21.23 ? 160  LEU C CA  1 
ATOM   7884  C  C   . LEU C 3  160 ? 87.306  56.637  167.903 1.00 21.28 ? 160  LEU C C   1 
ATOM   7885  O  O   . LEU C 3  160 ? 87.020  57.830  167.767 1.00 21.33 ? 160  LEU C O   1 
ATOM   7886  C  CB  . LEU C 3  160 ? 87.986  55.221  165.898 1.00 21.36 ? 160  LEU C CB  1 
ATOM   7887  C  CG  . LEU C 3  160 ? 88.054  55.729  164.438 1.00 26.26 ? 160  LEU C CG  1 
ATOM   7888  C  CD1 . LEU C 3  160 ? 89.470  56.159  163.925 1.00 28.80 ? 160  LEU C CD1 1 
ATOM   7889  C  CD2 . LEU C 3  160 ? 87.466  54.668  163.520 1.00 30.03 ? 160  LEU C CD2 1 
ATOM   7890  N  N   . VAL C 3  161 ? 86.715  55.833  168.792 1.00 21.45 ? 161  VAL C N   1 
ATOM   7891  C  CA  . VAL C 3  161 ? 85.558  56.233  169.630 1.00 21.67 ? 161  VAL C CA  1 
ATOM   7892  C  C   . VAL C 3  161 ? 85.958  57.217  170.748 1.00 21.52 ? 161  VAL C C   1 
ATOM   7893  O  O   . VAL C 3  161 ? 85.252  58.221  170.969 1.00 21.63 ? 161  VAL C O   1 
ATOM   7894  C  CB  . VAL C 3  161 ? 84.777  55.005  170.230 1.00 22.03 ? 161  VAL C CB  1 
ATOM   7895  C  CG1 . VAL C 3  161 ? 83.422  55.418  170.707 1.00 29.61 ? 161  VAL C CG1 1 
ATOM   7896  C  CG2 . VAL C 3  161 ? 84.549  53.981  169.207 1.00 30.88 ? 161  VAL C CG2 1 
ATOM   7897  N  N   . GLU C 3  162 ? 87.042  56.889  171.468 1.00 21.12 ? 162  GLU C N   1 
ATOM   7898  C  CA  . GLU C 3  162 ? 87.674  57.779  172.459 1.00 20.93 ? 162  GLU C CA  1 
ATOM   7899  C  C   . GLU C 3  162 ? 88.081  59.148  171.892 1.00 21.18 ? 162  GLU C C   1 
ATOM   7900  O  O   . GLU C 3  162 ? 87.804  60.172  172.527 1.00 21.31 ? 162  GLU C O   1 
ATOM   7901  C  CB  . GLU C 3  162 ? 88.860  57.090  173.122 1.00 20.77 ? 162  GLU C CB  1 
ATOM   7902  C  CG  . GLU C 3  162 ? 88.483  56.274  174.359 1.00 21.96 ? 162  GLU C CG  1 
ATOM   7903  C  CD  . GLU C 3  162 ? 89.483  55.172  174.725 1.00 20.34 ? 162  GLU C CD  1 
ATOM   7904  O  OE1 . GLU C 3  162 ? 90.717  55.368  174.575 1.00 26.63 ? 162  GLU C OE1 1 
ATOM   7905  O  OE2 . GLU C 3  162 ? 89.038  54.156  175.313 1.00 19.34 ? 162  GLU C OE2 1 
ATOM   7906  N  N   . TRP C 3  163 ? 88.568  59.148  170.635 1.00 21.40 ? 163  TRP C N   1 
ATOM   7907  C  CA  . TRP C 3  163 ? 88.818  60.357  169.822 1.00 21.06 ? 163  TRP C CA  1 
ATOM   7908  C  C   . TRP C 3  163 ? 87.571  61.198  169.545 1.00 21.34 ? 163  TRP C C   1 
ATOM   7909  O  O   . TRP C 3  163 ? 87.621  62.424  169.697 1.00 21.13 ? 163  TRP C O   1 
ATOM   7910  C  CB  . TRP C 3  163 ? 89.552  60.011  168.518 1.00 20.67 ? 163  TRP C CB  1 
ATOM   7911  C  CG  . TRP C 3  163 ? 90.016  61.213  167.705 1.00 25.59 ? 163  TRP C CG  1 
ATOM   7912  C  CD1 . TRP C 3  163 ? 90.991  62.116  168.049 1.00 23.21 ? 163  TRP C CD1 1 
ATOM   7913  C  CD2 . TRP C 3  163 ? 89.553  61.603  166.402 1.00 28.10 ? 163  TRP C CD2 1 
ATOM   7914  N  NE1 . TRP C 3  163 ? 91.136  63.063  167.062 1.00 26.43 ? 163  TRP C NE1 1 
ATOM   7915  C  CE2 . TRP C 3  163 ? 90.285  62.774  166.029 1.00 28.79 ? 163  TRP C CE2 1 
ATOM   7916  C  CE3 . TRP C 3  163 ? 88.600  61.075  165.489 1.00 26.60 ? 163  TRP C CE3 1 
ATOM   7917  C  CZ2 . TRP C 3  163 ? 90.101  63.434  164.776 1.00 28.43 ? 163  TRP C CZ2 1 
ATOM   7918  C  CZ3 . TRP C 3  163 ? 88.385  61.753  164.244 1.00 28.23 ? 163  TRP C CZ3 1 
ATOM   7919  C  CH2 . TRP C 3  163 ? 89.128  62.931  163.917 1.00 31.66 ? 163  TRP C CH2 1 
ATOM   7920  N  N   . ILE C 3  164 ? 86.468  60.548  169.150 1.00 22.24 ? 164  ILE C N   1 
ATOM   7921  C  CA  . ILE C 3  164 ? 85.197  61.260  168.968 1.00 23.14 ? 164  ILE C CA  1 
ATOM   7922  C  C   . ILE C 3  164 ? 84.415  61.647  170.233 1.00 23.39 ? 164  ILE C C   1 
ATOM   7923  O  O   . ILE C 3  164 ? 83.674  62.629  170.219 1.00 23.81 ? 164  ILE C O   1 
ATOM   7924  C  CB  . ILE C 3  164 ? 84.321  60.858  167.677 1.00 23.74 ? 164  ILE C CB  1 
ATOM   7925  C  CG1 . ILE C 3  164 ? 83.069  60.085  168.010 1.00 28.43 ? 164  ILE C CG1 1 
ATOM   7926  C  CG2 . ILE C 3  164 ? 85.121  60.268  166.503 1.00 33.72 ? 164  ILE C CG2 1 
ATOM   7927  C  CD1 . ILE C 3  164 ? 81.839  60.922  167.818 1.00 34.17 ? 164  ILE C CD1 1 
ATOM   7928  N  N   . TRP C 3  165 ? 84.635  60.904  171.324 1.00 23.45 ? 165  TRP C N   1 
ATOM   7929  C  CA  . TRP C 3  165 ? 84.235  61.313  172.679 1.00 22.98 ? 165  TRP C CA  1 
ATOM   7930  C  C   . TRP C 3  165 ? 84.982  62.550  173.201 1.00 22.49 ? 165  TRP C C   1 
ATOM   7931  O  O   . TRP C 3  165 ? 84.349  63.502  173.688 1.00 22.09 ? 165  TRP C O   1 
ATOM   7932  C  CB  . TRP C 3  165 ? 84.382  60.143  173.660 1.00 23.04 ? 165  TRP C CB  1 
ATOM   7933  C  CG  . TRP C 3  165 ? 83.392  59.014  173.495 1.00 19.98 ? 165  TRP C CG  1 
ATOM   7934  C  CD1 . TRP C 3  165 ? 82.115  59.088  172.976 1.00 26.26 ? 165  TRP C CD1 1 
ATOM   7935  C  CD2 . TRP C 3  165 ? 83.537  57.675  173.992 1.00 19.95 ? 165  TRP C CD2 1 
ATOM   7936  N  NE1 . TRP C 3  165 ? 81.478  57.875  173.096 1.00 19.84 ? 165  TRP C NE1 1 
ATOM   7937  C  CE2 . TRP C 3  165 ? 82.298  56.993  173.742 1.00 20.03 ? 165  TRP C CE2 1 
ATOM   7938  C  CE3 . TRP C 3  165 ? 84.610  56.946  174.569 1.00 14.92 ? 165  TRP C CE3 1 
ATOM   7939  C  CZ2 . TRP C 3  165 ? 82.106  55.603  174.025 1.00 15.26 ? 165  TRP C CZ2 1 
ATOM   7940  C  CZ3 . TRP C 3  165 ? 84.417  55.554  174.864 1.00 19.54 ? 165  TRP C CZ3 1 
ATOM   7941  C  CH2 . TRP C 3  165 ? 83.175  54.903  174.565 1.00 12.99 ? 165  TRP C CH2 1 
ATOM   7942  N  N   . GLY C 3  166 ? 86.302  62.565  172.993 1.00 22.73 ? 166  GLY C N   1 
ATOM   7943  C  CA  . GLY C 3  166 ? 87.227  63.445  173.704 1.00 23.48 ? 166  GLY C CA  1 
ATOM   7944  C  C   . GLY C 3  166 ? 87.421  63.099  175.169 1.00 24.04 ? 166  GLY C C   1 
ATOM   7945  O  O   . GLY C 3  166 ? 87.626  64.012  175.984 1.00 24.15 ? 166  GLY C O   1 
ATOM   7946  N  N   . GLY C 3  167 ? 87.591  61.796  175.440 1.00 24.52 ? 167  GLY C N   1 
ATOM   7947  C  CA  . GLY C 3  167 ? 87.442  61.200  176.770 1.00 25.02 ? 167  GLY C CA  1 
ATOM   7948  C  C   . GLY C 3  167 ? 87.035  59.724  176.769 1.00 25.26 ? 167  GLY C C   1 
ATOM   7949  O  O   . GLY C 3  167 ? 86.938  59.093  175.703 1.00 25.27 ? 167  GLY C O   1 
ATOM   7950  N  N   . PHE C 3  168 ? 86.785  59.193  177.972 1.00 25.35 ? 168  PHE C N   1 
ATOM   7951  C  CA  . PHE C 3  168 ? 86.549  57.752  178.200 1.00 25.40 ? 168  PHE C CA  1 
ATOM   7952  C  C   . PHE C 3  168 ? 85.066  57.327  178.082 1.00 25.32 ? 168  PHE C C   1 
ATOM   7953  O  O   . PHE C 3  168 ? 84.763  56.123  178.066 1.00 25.31 ? 168  PHE C O   1 
ATOM   7954  C  CB  . PHE C 3  168 ? 87.148  57.308  179.546 1.00 25.56 ? 168  PHE C CB  1 
ATOM   7955  C  CG  . PHE C 3  168 ? 88.624  57.643  179.721 1.00 33.95 ? 168  PHE C CG  1 
ATOM   7956  C  CD1 . PHE C 3  168 ? 89.629  56.948  178.976 1.00 39.09 ? 168  PHE C CD1 1 
ATOM   7957  C  CD2 . PHE C 3  168 ? 89.029  58.538  180.751 1.00 34.12 ? 168  PHE C CD2 1 
ATOM   7958  C  CE1 . PHE C 3  168 ? 91.036  57.190  179.216 1.00 39.80 ? 168  PHE C CE1 1 
ATOM   7959  C  CE2 . PHE C 3  168 ? 90.426  58.783  181.021 1.00 37.99 ? 168  PHE C CE2 1 
ATOM   7960  C  CZ  . PHE C 3  168 ? 91.432  58.102  180.249 1.00 39.31 ? 168  PHE C CZ  1 
ATOM   7961  N  N   . SER C 3  169 ? 84.165  58.323  178.111 1.00 25.27 ? 169  SER C N   1 
ATOM   7962  C  CA  . SER C 3  169 ? 82.758  58.211  177.687 1.00 25.28 ? 169  SER C CA  1 
ATOM   7963  C  C   . SER C 3  169 ? 82.241  59.516  177.020 1.00 25.03 ? 169  SER C C   1 
ATOM   7964  O  O   . SER C 3  169 ? 82.986  60.496  176.923 1.00 25.10 ? 169  SER C O   1 
ATOM   7965  C  CB  . SER C 3  169 ? 81.882  57.839  178.895 1.00 25.60 ? 169  SER C CB  1 
ATOM   7966  O  OG  . SER C 3  169 ? 81.912  58.864  179.877 1.00 20.93 ? 169  SER C OG  1 
ATOM   7967  N  N   . VAL C 3  170 ? 81.030  59.445  176.439 1.00 24.99 ? 170  VAL C N   1 
ATOM   7968  C  CA  . VAL C 3  170 ? 80.142  60.602  176.143 1.00 25.02 ? 170  VAL C CA  1 
ATOM   7969  C  C   . VAL C 3  170 ? 80.037  61.529  177.369 1.00 25.36 ? 170  VAL C C   1 
ATOM   7970  O  O   . VAL C 3  170 ? 79.718  61.066  178.464 1.00 26.21 ? 170  VAL C O   1 
ATOM   7971  C  CB  . VAL C 3  170 ? 78.687  60.139  175.656 1.00 24.92 ? 170  VAL C CB  1 
ATOM   7972  C  CG1 . VAL C 3  170 ? 77.813  61.320  175.260 1.00 24.61 ? 170  VAL C CG1 1 
ATOM   7973  C  CG2 . VAL C 3  170 ? 78.759  59.197  174.461 1.00 21.02 ? 170  VAL C CG2 1 
ATOM   7974  N  N   . ASP C 3  171 ? 80.512  62.766  177.196 1.00 25.16 ? 171  ASP C N   1 
ATOM   7975  C  CA  . ASP C 3  171 ? 80.770  63.723  178.295 1.00 25.19 ? 171  ASP C CA  1 
ATOM   7976  C  C   . ASP C 3  171 ? 80.673  65.203  177.832 1.00 25.03 ? 171  ASP C C   1 
ATOM   7977  O  O   . ASP C 3  171 ? 79.886  65.498  176.926 1.00 25.83 ? 171  ASP C O   1 
ATOM   7978  C  CB  . ASP C 3  171 ? 82.114  63.402  179.011 1.00 25.12 ? 171  ASP C CB  1 
ATOM   7979  C  CG  . ASP C 3  171 ? 82.000  63.441  180.536 1.00 29.43 ? 171  ASP C CG  1 
ATOM   7980  O  OD1 . ASP C 3  171 ? 81.441  64.416  181.092 1.00 29.88 ? 171  ASP C OD1 1 
ATOM   7981  O  OD2 . ASP C 3  171 ? 82.475  62.547  181.269 1.00 38.14 ? 171  ASP C OD2 1 
ATOM   7982  N  N   . LYS C 3  172 ? 81.337  66.120  178.561 1.00 24.18 ? 172  LYS C N   1 
ATOM   7983  C  CA  . LYS C 3  172 ? 81.435  67.563  178.246 1.00 23.19 ? 172  LYS C CA  1 
ATOM   7984  C  C   . LYS C 3  172 ? 81.927  67.838  176.811 1.00 21.87 ? 172  LYS C C   1 
ATOM   7985  O  O   . LYS C 3  172 ? 81.201  68.462  176.028 1.00 21.31 ? 172  LYS C O   1 
ATOM   7986  C  CB  . LYS C 3  172 ? 82.331  68.293  179.265 1.00 23.39 ? 172  LYS C CB  1 
ATOM   7987  C  CG  . LYS C 3  172 ? 81.817  68.340  180.710 1.00 35.57 ? 172  LYS C CG  1 
ATOM   7988  C  CD  . LYS C 3  172 ? 82.941  68.741  181.684 1.00 40.93 ? 172  LYS C CD  1 
ATOM   7989  C  CE  . LYS C 3  172 ? 82.706  68.171  183.087 1.00 47.79 ? 172  LYS C CE  1 
ATOM   7990  N  NZ  . LYS C 3  172 ? 83.250  69.060  184.163 1.00 45.73 ? 172  LYS C NZ  1 
ATOM   7991  N  N   . ALA C 3  173 ? 83.047  67.184  176.451 1.00 21.21 ? 173  ALA C N   1 
ATOM   7992  C  CA  . ALA C 3  173 ? 83.745  67.312  175.162 1.00 20.48 ? 173  ALA C CA  1 
ATOM   7993  C  C   . ALA C 3  173 ? 82.894  66.850  173.984 1.00 21.02 ? 173  ALA C C   1 
ATOM   7994  O  O   . ALA C 3  173 ? 82.904  67.496  172.919 1.00 21.15 ? 173  ALA C O   1 
ATOM   7995  C  CB  . ALA C 3  173 ? 85.065  66.540  175.194 1.00 19.85 ? 173  ALA C CB  1 
ATOM   7996  N  N   . THR C 3  174 ? 82.086  65.808  174.236 1.00 20.89 ? 174  THR C N   1 
ATOM   7997  C  CA  . THR C 3  174 ? 81.198  65.181  173.265 1.00 20.49 ? 174  THR C CA  1 
ATOM   7998  C  C   . THR C 3  174 ? 80.031  66.093  172.860 1.00 20.01 ? 174  THR C C   1 
ATOM   7999  O  O   . THR C 3  174 ? 79.726  66.177  171.670 1.00 20.32 ? 174  THR C O   1 
ATOM   8000  C  CB  . THR C 3  174 ? 80.689  63.795  173.806 1.00 20.92 ? 174  THR C CB  1 
ATOM   8001  O  OG1 . THR C 3  174 ? 81.797  63.048  174.332 1.00 17.44 ? 174  THR C OG1 1 
ATOM   8002  C  CG2 . THR C 3  174 ? 80.170  62.899  172.658 1.00 17.99 ? 174  THR C CG2 1 
ATOM   8003  N  N   . LEU C 3  175 ? 79.339  66.688  173.843 1.00 19.29 ? 175  LEU C N   1 
ATOM   8004  C  CA  . LEU C 3  175 ? 78.151  67.528  173.584 1.00 18.59 ? 175  LEU C CA  1 
ATOM   8005  C  C   . LEU C 3  175 ? 78.440  68.796  172.769 1.00 18.26 ? 175  LEU C C   1 
ATOM   8006  O  O   . LEU C 3  175 ? 77.694  69.116  171.830 1.00 17.99 ? 175  LEU C O   1 
ATOM   8007  C  CB  . LEU C 3  175 ? 77.402  67.853  174.885 1.00 18.30 ? 175  LEU C CB  1 
ATOM   8008  C  CG  . LEU C 3  175 ? 76.186  68.799  174.870 1.00 17.67 ? 175  LEU C CG  1 
ATOM   8009  C  CD1 . LEU C 3  175 ? 74.933  68.148  174.281 1.00 14.64 ? 175  LEU C CD1 1 
ATOM   8010  C  CD2 . LEU C 3  175 ? 75.925  69.309  176.264 1.00 23.44 ? 175  LEU C CD2 1 
ATOM   8011  N  N   . THR C 3  176 ? 79.535  69.477  173.125 1.00 18.50 ? 176  THR C N   1 
ATOM   8012  C  CA  . THR C 3  176 ? 79.949  70.748  172.526 1.00 18.72 ? 176  THR C CA  1 
ATOM   8013  C  C   . THR C 3  176 ? 80.375  70.549  171.058 1.00 18.96 ? 176  THR C C   1 
ATOM   8014  O  O   . THR C 3  176 ? 79.822  71.213  170.171 1.00 18.92 ? 176  THR C O   1 
ATOM   8015  C  CB  . THR C 3  176 ? 81.057  71.408  173.397 1.00 18.64 ? 176  THR C CB  1 
ATOM   8016  O  OG1 . THR C 3  176 ? 80.599  71.497  174.750 1.00 19.70 ? 176  THR C OG1 1 
ATOM   8017  C  CG2 . THR C 3  176 ? 81.276  72.881  173.013 1.00 20.36 ? 176  THR C CG2 1 
ATOM   8018  N  N   . ARG C 3  177 ? 81.283  69.577  170.837 1.00 19.20 ? 177  ARG C N   1 
ATOM   8019  C  CA  . ARG C 3  177 ? 81.570  68.901  169.557 1.00 19.72 ? 177  ARG C CA  1 
ATOM   8020  C  C   . ARG C 3  177 ? 80.360  68.721  168.655 1.00 19.97 ? 177  ARG C C   1 
ATOM   8021  O  O   . ARG C 3  177 ? 80.340  69.235  167.526 1.00 20.56 ? 177  ARG C O   1 
ATOM   8022  C  CB  . ARG C 3  177 ? 82.075  67.511  169.865 1.00 20.06 ? 177  ARG C CB  1 
ATOM   8023  C  CG  . ARG C 3  177 ? 83.266  67.091  169.183 1.00 21.32 ? 177  ARG C CG  1 
ATOM   8024  C  CD  . ARG C 3  177 ? 83.847  65.894  169.811 1.00 23.53 ? 177  ARG C CD  1 
ATOM   8025  N  NE  . ARG C 3  177 ? 84.761  66.292  170.877 1.00 19.07 ? 177  ARG C NE  1 
ATOM   8026  C  CZ  . ARG C 3  177 ? 86.014  65.897  170.988 1.00 15.56 ? 177  ARG C CZ  1 
ATOM   8027  N  NH1 . ARG C 3  177 ? 86.461  64.840  170.316 1.00 20.54 ? 177  ARG C NH1 1 
ATOM   8028  N  NH2 . ARG C 3  177 ? 86.775  66.442  171.914 1.00 22.14 ? 177  ARG C NH2 1 
ATOM   8029  N  N   . PHE C 3  178 ? 79.323  68.095  169.226 1.00 19.61 ? 178  PHE C N   1 
ATOM   8030  C  CA  . PHE C 3  178 ? 78.114  67.697  168.527 1.00 19.62 ? 178  PHE C CA  1 
ATOM   8031  C  C   . PHE C 3  178 ? 77.280  68.889  168.108 1.00 19.81 ? 178  PHE C C   1 
ATOM   8032  O  O   . PHE C 3  178 ? 76.884  68.929  166.965 1.00 20.58 ? 178  PHE C O   1 
ATOM   8033  C  CB  . PHE C 3  178 ? 77.293  66.686  169.361 1.00 19.27 ? 178  PHE C CB  1 
ATOM   8034  C  CG  . PHE C 3  178 ? 77.672  65.221  169.138 1.00 15.87 ? 178  PHE C CG  1 
ATOM   8035  C  CD1 . PHE C 3  178 ? 76.735  64.213  169.444 1.00 15.39 ? 178  PHE C CD1 1 
ATOM   8036  C  CD2 . PHE C 3  178 ? 78.987  64.827  168.731 1.00 9.80  ? 178  PHE C CD2 1 
ATOM   8037  C  CE1 . PHE C 3  178 ? 77.056  62.829  169.274 1.00 19.34 ? 178  PHE C CE1 1 
ATOM   8038  C  CE2 . PHE C 3  178 ? 79.336  63.460  168.582 1.00 12.82 ? 178  PHE C CE2 1 
ATOM   8039  C  CZ  . PHE C 3  178 ? 78.365  62.452  168.834 1.00 14.07 ? 178  PHE C CZ  1 
ATOM   8040  N  N   . PHE C 3  179 ? 77.276  69.944  168.934 1.00 19.64 ? 179  PHE C N   1 
ATOM   8041  C  CA  . PHE C 3  179 ? 76.684  71.251  168.590 1.00 19.53 ? 179  PHE C CA  1 
ATOM   8042  C  C   . PHE C 3  179 ? 77.332  71.934  167.388 1.00 19.62 ? 179  PHE C C   1 
ATOM   8043  O  O   . PHE C 3  179 ? 76.612  72.346  166.462 1.00 19.61 ? 179  PHE C O   1 
ATOM   8044  C  CB  . PHE C 3  179 ? 76.630  72.192  169.814 1.00 19.06 ? 179  PHE C CB  1 
ATOM   8045  C  CG  . PHE C 3  179 ? 75.904  73.497  169.564 1.00 17.60 ? 179  PHE C CG  1 
ATOM   8046  C  CD1 . PHE C 3  179 ? 76.523  74.726  169.889 1.00 23.45 ? 179  PHE C CD1 1 
ATOM   8047  C  CD2 . PHE C 3  179 ? 74.583  73.520  169.020 1.00 24.78 ? 179  PHE C CD2 1 
ATOM   8048  C  CE1 . PHE C 3  179 ? 75.829  75.974  169.685 1.00 23.90 ? 179  PHE C CE1 1 
ATOM   8049  C  CE2 . PHE C 3  179 ? 73.906  74.763  168.760 1.00 23.34 ? 179  PHE C CE2 1 
ATOM   8050  C  CZ  . PHE C 3  179 ? 74.530  75.988  169.101 1.00 24.71 ? 179  PHE C CZ  1 
ATOM   8051  N  N   . ALA C 3  180 ? 78.675  71.911  167.367 1.00 19.35 ? 180  ALA C N   1 
ATOM   8052  C  CA  . ALA C 3  180 ? 79.510  72.480  166.302 1.00 19.36 ? 180  ALA C CA  1 
ATOM   8053  C  C   . ALA C 3  180 ? 79.346  71.711  164.971 1.00 20.07 ? 180  ALA C C   1 
ATOM   8054  O  O   . ALA C 3  180 ? 78.944  72.319  163.968 1.00 19.83 ? 180  ALA C O   1 
ATOM   8055  C  CB  . ALA C 3  180 ? 80.968  72.523  166.737 1.00 18.94 ? 180  ALA C CB  1 
ATOM   8056  N  N   . PHE C 3  181 ? 79.413  70.369  165.048 1.00 20.59 ? 181  PHE C N   1 
ATOM   8057  C  CA  . PHE C 3  181 ? 79.198  69.482  163.895 1.00 20.64 ? 181  PHE C CA  1 
ATOM   8058  C  C   . PHE C 3  181 ? 77.777  69.524  163.335 1.00 20.68 ? 181  PHE C C   1 
ATOM   8059  O  O   . PHE C 3  181 ? 77.590  69.400  162.115 1.00 20.96 ? 181  PHE C O   1 
ATOM   8060  C  CB  . PHE C 3  181 ? 79.612  68.038  164.190 1.00 20.66 ? 181  PHE C CB  1 
ATOM   8061  C  CG  . PHE C 3  181 ? 81.084  67.843  164.477 1.00 24.56 ? 181  PHE C CG  1 
ATOM   8062  C  CD1 . PHE C 3  181 ? 82.089  68.396  163.628 1.00 27.28 ? 181  PHE C CD1 1 
ATOM   8063  C  CD2 . PHE C 3  181 ? 81.474  66.908  165.471 1.00 27.16 ? 181  PHE C CD2 1 
ATOM   8064  C  CE1 . PHE C 3  181 ? 83.481  68.161  163.882 1.00 31.36 ? 181  PHE C CE1 1 
ATOM   8065  C  CE2 . PHE C 3  181 ? 82.860  66.622  165.710 1.00 27.24 ? 181  PHE C CE2 1 
ATOM   8066  C  CZ  . PHE C 3  181 ? 83.865  67.288  164.946 1.00 24.88 ? 181  PHE C CZ  1 
ATOM   8067  N  N   . HIS C 3  182 ? 76.799  69.678  164.235 1.00 20.21 ? 182  HIS C N   1 
ATOM   8068  C  CA  . HIS C 3  182 ? 75.376  69.784  163.895 1.00 19.64 ? 182  HIS C CA  1 
ATOM   8069  C  C   . HIS C 3  182 ? 75.001  71.116  163.239 1.00 19.84 ? 182  HIS C C   1 
ATOM   8070  O  O   . HIS C 3  182 ? 73.976  71.188  162.540 1.00 20.29 ? 182  HIS C O   1 
ATOM   8071  C  CB  . HIS C 3  182 ? 74.541  69.559  165.145 1.00 19.08 ? 182  HIS C CB  1 
ATOM   8072  C  CG  . HIS C 3  182 ? 73.080  69.490  164.899 1.00 15.31 ? 182  HIS C CG  1 
ATOM   8073  N  ND1 . HIS C 3  182 ? 72.481  68.408  164.287 1.00 15.28 ? 182  HIS C ND1 1 
ATOM   8074  C  CD2 . HIS C 3  182 ? 72.109  70.414  165.073 1.00 6.15  ? 182  HIS C CD2 1 
ATOM   8075  C  CE1 . HIS C 3  182 ? 71.192  68.652  164.159 1.00 10.21 ? 182  HIS C CE1 1 
ATOM   8076  N  NE2 . HIS C 3  182 ? 70.931  69.812  164.731 1.00 8.49  ? 182  HIS C NE2 1 
ATOM   8077  N  N   . PHE C 3  183 ? 75.698  72.183  163.635 1.00 19.65 ? 183  PHE C N   1 
ATOM   8078  C  CA  . PHE C 3  183 ? 75.597  73.490  162.989 1.00 20.14 ? 183  PHE C CA  1 
ATOM   8079  C  C   . PHE C 3  183 ? 76.168  73.482  161.551 1.00 20.44 ? 183  PHE C C   1 
ATOM   8080  O  O   . PHE C 3  183 ? 75.466  73.878  160.643 1.00 20.35 ? 183  PHE C O   1 
ATOM   8081  C  CB  . PHE C 3  183 ? 76.242  74.596  163.858 1.00 20.06 ? 183  PHE C CB  1 
ATOM   8082  C  CG  . PHE C 3  183 ? 75.539  75.951  163.786 1.00 24.51 ? 183  PHE C CG  1 
ATOM   8083  C  CD1 . PHE C 3  183 ? 75.443  76.675  162.552 1.00 26.87 ? 183  PHE C CD1 1 
ATOM   8084  C  CD2 . PHE C 3  183 ? 75.184  76.615  164.978 1.00 25.21 ? 183  PHE C CD2 1 
ATOM   8085  C  CE1 . PHE C 3  183 ? 74.950  78.019  162.509 1.00 17.45 ? 183  PHE C CE1 1 
ATOM   8086  C  CE2 . PHE C 3  183 ? 74.657  77.954  164.953 1.00 24.57 ? 183  PHE C CE2 1 
ATOM   8087  C  CZ  . PHE C 3  183 ? 74.490  78.632  163.709 1.00 27.72 ? 183  PHE C CZ  1 
ATOM   8088  N  N   . ILE C 3  184 ? 77.401  72.982  161.367 1.00 20.71 ? 184  ILE C N   1 
ATOM   8089  C  CA  . ILE C 3  184 ? 78.098  72.976  160.071 1.00 21.32 ? 184  ILE C CA  1 
ATOM   8090  C  C   . ILE C 3  184 ? 77.461  72.065  158.978 1.00 22.66 ? 184  ILE C C   1 
ATOM   8091  O  O   . ILE C 3  184 ? 77.269  72.530  157.835 1.00 22.80 ? 184  ILE C O   1 
ATOM   8092  C  CB  . ILE C 3  184 ? 79.664  72.787  160.235 1.00 21.19 ? 184  ILE C CB  1 
ATOM   8093  C  CG1 . ILE C 3  184 ? 80.419  73.191  158.941 1.00 23.06 ? 184  ILE C CG1 1 
ATOM   8094  C  CG2 . ILE C 3  184 ? 80.052  71.360  160.770 1.00 12.60 ? 184  ILE C CG2 1 
ATOM   8095  C  CD1 . ILE C 3  184 ? 81.866  73.700  159.160 1.00 27.83 ? 184  ILE C CD1 1 
ATOM   8096  N  N   . LEU C 3  185 ? 77.033  70.848  159.371 1.00 22.75 ? 185  LEU C N   1 
ATOM   8097  C  CA  . LEU C 3  185 ? 76.640  69.792  158.421 1.00 22.99 ? 185  LEU C CA  1 
ATOM   8098  C  C   . LEU C 3  185 ? 75.445  70.103  157.477 1.00 22.91 ? 185  LEU C C   1 
ATOM   8099  O  O   . LEU C 3  185 ? 75.536  69.704  156.313 1.00 22.74 ? 185  LEU C O   1 
ATOM   8100  C  CB  . LEU C 3  185 ? 76.491  68.401  159.078 1.00 23.46 ? 185  LEU C CB  1 
ATOM   8101  C  CG  . LEU C 3  185 ? 77.688  67.447  159.277 1.00 38.51 ? 185  LEU C CG  1 
ATOM   8102  C  CD1 . LEU C 3  185 ? 77.328  66.328  160.232 1.00 39.68 ? 185  LEU C CD1 1 
ATOM   8103  C  CD2 . LEU C 3  185 ? 78.255  66.856  157.985 1.00 45.48 ? 185  LEU C CD2 1 
ATOM   8104  N  N   . PRO C 3  186 ? 74.376  70.827  157.926 1.00 22.73 ? 186  PRO C N   1 
ATOM   8105  C  CA  . PRO C 3  186 ? 73.299  71.248  157.004 1.00 22.47 ? 186  PRO C CA  1 
ATOM   8106  C  C   . PRO C 3  186 ? 73.675  72.250  155.916 1.00 21.34 ? 186  PRO C C   1 
ATOM   8107  O  O   . PRO C 3  186 ? 72.947  72.330  154.914 1.00 20.50 ? 186  PRO C O   1 
ATOM   8108  C  CB  . PRO C 3  186 ? 72.251  71.846  157.944 1.00 22.81 ? 186  PRO C CB  1 
ATOM   8109  C  CG  . PRO C 3  186 ? 72.454  71.138  159.174 1.00 18.49 ? 186  PRO C CG  1 
ATOM   8110  C  CD  . PRO C 3  186 ? 73.921  71.042  159.320 1.00 22.30 ? 186  PRO C CD  1 
ATOM   8111  N  N   . PHE C 3  187 ? 74.748  73.012  156.135 1.00 21.29 ? 187  PHE C N   1 
ATOM   8112  C  CA  . PHE C 3  187 ? 75.332  73.887  155.107 1.00 20.84 ? 187  PHE C CA  1 
ATOM   8113  C  C   . PHE C 3  187 ? 76.137  73.125  154.072 1.00 20.78 ? 187  PHE C C   1 
ATOM   8114  O  O   . PHE C 3  187 ? 76.040  73.430  152.884 1.00 19.99 ? 187  PHE C O   1 
ATOM   8115  C  CB  . PHE C 3  187 ? 76.136  75.040  155.737 1.00 20.93 ? 187  PHE C CB  1 
ATOM   8116  C  CG  . PHE C 3  187 ? 75.323  75.903  156.662 1.00 21.27 ? 187  PHE C CG  1 
ATOM   8117  C  CD1 . PHE C 3  187 ? 75.358  75.671  158.050 1.00 21.68 ? 187  PHE C CD1 1 
ATOM   8118  C  CD2 . PHE C 3  187 ? 74.395  76.858  156.148 1.00 29.08 ? 187  PHE C CD2 1 
ATOM   8119  C  CE1 . PHE C 3  187 ? 74.580  76.453  158.946 1.00 25.88 ? 187  PHE C CE1 1 
ATOM   8120  C  CE2 . PHE C 3  187 ? 73.532  77.588  157.031 1.00 31.19 ? 187  PHE C CE2 1 
ATOM   8121  C  CZ  . PHE C 3  187 ? 73.594  77.332  158.436 1.00 30.95 ? 187  PHE C CZ  1 
ATOM   8122  N  N   . ILE C 3  188 ? 76.870  72.098  154.532 1.00 21.91 ? 188  ILE C N   1 
ATOM   8123  C  CA  . ILE C 3  188 ? 77.468  71.049  153.685 1.00 22.86 ? 188  ILE C CA  1 
ATOM   8124  C  C   . ILE C 3  188 ? 76.401  70.265  152.872 1.00 23.51 ? 188  ILE C C   1 
ATOM   8125  O  O   . ILE C 3  188 ? 76.584  70.084  151.648 1.00 23.76 ? 188  ILE C O   1 
ATOM   8126  C  CB  . ILE C 3  188 ? 78.450  70.117  154.524 1.00 23.06 ? 188  ILE C CB  1 
ATOM   8127  C  CG1 . ILE C 3  188 ? 79.707  70.908  154.960 1.00 22.77 ? 188  ILE C CG1 1 
ATOM   8128  C  CG2 . ILE C 3  188 ? 78.912  68.865  153.712 1.00 30.64 ? 188  ILE C CG2 1 
ATOM   8129  C  CD1 . ILE C 3  188 ? 80.354  70.418  156.261 1.00 25.32 ? 188  ILE C CD1 1 
ATOM   8130  N  N   . ILE C 3  189 ? 75.301  69.854  153.546 1.00 23.45 ? 189  ILE C N   1 
ATOM   8131  C  CA  . ILE C 3  189 ? 74.094  69.262  152.905 1.00 23.12 ? 189  ILE C CA  1 
ATOM   8132  C  C   . ILE C 3  189 ? 73.567  70.135  151.754 1.00 22.96 ? 189  ILE C C   1 
ATOM   8133  O  O   . ILE C 3  189 ? 73.605  69.683  150.611 1.00 23.42 ? 189  ILE C O   1 
ATOM   8134  C  CB  . ILE C 3  189 ? 72.958  68.861  153.952 1.00 22.91 ? 189  ILE C CB  1 
ATOM   8135  C  CG1 . ILE C 3  189 ? 73.387  67.618  154.732 1.00 31.78 ? 189  ILE C CG1 1 
ATOM   8136  C  CG2 . ILE C 3  189 ? 71.609  68.476  153.245 1.00 16.74 ? 189  ILE C CG2 1 
ATOM   8137  C  CD1 . ILE C 3  189 ? 72.809  67.494  156.156 1.00 37.58 ? 189  ILE C CD1 1 
ATOM   8138  N  N   . MET C 3  190 ? 73.374  71.431  152.040 1.00 22.83 ? 190  MET C N   1 
ATOM   8139  C  CA  . MET C 3  190 ? 72.915  72.441  151.066 1.00 22.38 ? 190  MET C CA  1 
ATOM   8140  C  C   . MET C 3  190 ? 73.781  72.546  149.796 1.00 21.06 ? 190  MET C C   1 
ATOM   8141  O  O   . MET C 3  190 ? 73.238  72.455  148.693 1.00 20.35 ? 190  MET C O   1 
ATOM   8142  C  CB  . MET C 3  190 ? 72.709  73.801  151.732 1.00 22.92 ? 190  MET C CB  1 
ATOM   8143  C  CG  . MET C 3  190 ? 71.614  74.656  151.072 1.00 41.22 ? 190  MET C CG  1 
ATOM   8144  S  SD  . MET C 3  190 ? 71.556  76.376  151.665 1.00 48.64 ? 190  MET C SD  1 
ATOM   8145  C  CE  . MET C 3  190 ? 72.969  77.140  150.794 1.00 56.10 ? 190  MET C CE  1 
ATOM   8146  N  N   . ALA C 3  191 ? 75.106  72.452  149.985 1.00 20.82 ? 191  ALA C N   1 
ATOM   8147  C  CA  . ALA C 3  191 ? 76.088  72.397  148.896 1.00 20.86 ? 191  ALA C CA  1 
ATOM   8148  C  C   . ALA C 3  191 ? 76.044  71.089  148.083 1.00 21.36 ? 191  ALA C C   1 
ATOM   8149  O  O   . ALA C 3  191 ? 76.043  71.149  146.846 1.00 21.87 ? 191  ALA C O   1 
ATOM   8150  C  CB  . ALA C 3  191 ? 77.506  72.693  149.404 1.00 20.14 ? 191  ALA C CB  1 
ATOM   8151  N  N   . ILE C 3  192 ? 75.982  69.935  148.770 1.00 21.30 ? 192  ILE C N   1 
ATOM   8152  C  CA  . ILE C 3  192 ? 75.786  68.613  148.126 1.00 21.29 ? 192  ILE C CA  1 
ATOM   8153  C  C   . ILE C 3  192 ? 74.410  68.488  147.411 1.00 20.95 ? 192  ILE C C   1 
ATOM   8154  O  O   . ILE C 3  192 ? 74.353  67.945  146.308 1.00 20.80 ? 192  ILE C O   1 
ATOM   8155  C  CB  . ILE C 3  192 ? 76.126  67.392  149.110 1.00 21.39 ? 192  ILE C CB  1 
ATOM   8156  C  CG1 . ILE C 3  192 ? 77.589  67.468  149.616 1.00 26.29 ? 192  ILE C CG1 1 
ATOM   8157  C  CG2 . ILE C 3  192 ? 75.948  66.011  148.407 1.00 23.95 ? 192  ILE C CG2 1 
ATOM   8158  C  CD1 . ILE C 3  192 ? 77.907  66.590  150.897 1.00 28.38 ? 192  ILE C CD1 1 
ATOM   8159  N  N   . ALA C 3  193 ? 73.387  69.171  147.936 1.00 21.24 ? 193  ALA C N   1 
ATOM   8160  C  CA  . ALA C 3  193 ? 72.051  69.255  147.301 1.00 21.77 ? 193  ALA C CA  1 
ATOM   8161  C  C   . ALA C 3  193 ? 72.052  70.056  145.987 1.00 22.01 ? 193  ALA C C   1 
ATOM   8162  O  O   . ALA C 3  193 ? 71.322  69.714  145.052 1.00 22.22 ? 193  ALA C O   1 
ATOM   8163  C  CB  . ALA C 3  193 ? 71.025  69.814  148.270 1.00 21.75 ? 193  ALA C CB  1 
ATOM   8164  N  N   . MET C 3  194 ? 72.916  71.076  145.912 1.00 21.56 ? 194  MET C N   1 
ATOM   8165  C  CA  . MET C 3  194 ? 73.156  71.820  144.673 1.00 21.44 ? 194  MET C CA  1 
ATOM   8166  C  C   . MET C 3  194 ? 73.879  71.018  143.584 1.00 20.62 ? 194  MET C C   1 
ATOM   8167  O  O   . MET C 3  194 ? 73.410  70.990  142.433 1.00 20.11 ? 194  MET C O   1 
ATOM   8168  C  CB  . MET C 3  194 ? 73.823  73.165  144.953 1.00 21.91 ? 194  MET C CB  1 
ATOM   8169  C  CG  . MET C 3  194 ? 72.824  74.241  145.347 1.00 33.61 ? 194  MET C CG  1 
ATOM   8170  S  SD  . MET C 3  194 ? 73.575  75.541  146.348 1.00 50.93 ? 194  MET C SD  1 
ATOM   8171  C  CE  . MET C 3  194 ? 72.093  76.554  146.765 1.00 50.97 ? 194  MET C CE  1 
ATOM   8172  N  N   . VAL C 3  195 ? 74.878  70.229  144.014 1.00 20.48 ? 195  VAL C N   1 
ATOM   8173  C  CA  . VAL C 3  195 ? 75.616  69.244  143.184 1.00 20.23 ? 195  VAL C CA  1 
ATOM   8174  C  C   . VAL C 3  195 ? 74.701  68.114  142.667 1.00 20.99 ? 195  VAL C C   1 
ATOM   8175  O  O   . VAL C 3  195 ? 74.787  67.730  141.483 1.00 21.93 ? 195  VAL C O   1 
ATOM   8176  C  CB  . VAL C 3  195 ? 76.915  68.705  143.928 1.00 19.62 ? 195  VAL C CB  1 
ATOM   8177  C  CG1 . VAL C 3  195 ? 77.673  67.641  143.098 1.00 13.65 ? 195  VAL C CG1 1 
ATOM   8178  C  CG2 . VAL C 3  195 ? 77.894  69.885  144.225 1.00 23.19 ? 195  VAL C CG2 1 
ATOM   8179  N  N   . HIS C 3  196 ? 73.809  67.641  143.543 1.00 20.82 ? 196  HIS C N   1 
ATOM   8180  C  CA  . HIS C 3  196 ? 72.718  66.679  143.229 1.00 19.61 ? 196  HIS C CA  1 
ATOM   8181  C  C   . HIS C 3  196 ? 71.839  67.177  142.078 1.00 19.48 ? 196  HIS C C   1 
ATOM   8182  O  O   . HIS C 3  196 ? 71.736  66.488  141.070 1.00 18.67 ? 196  HIS C O   1 
ATOM   8183  C  CB  . HIS C 3  196 ? 71.881  66.461  144.499 1.00 18.68 ? 196  HIS C CB  1 
ATOM   8184  C  CG  . HIS C 3  196 ? 70.830  65.403  144.388 1.00 13.93 ? 196  HIS C CG  1 
ATOM   8185  N  ND1 . HIS C 3  196 ? 71.139  64.059  144.283 1.00 9.35  ? 196  HIS C ND1 1 
ATOM   8186  C  CD2 . HIS C 3  196 ? 69.510  65.459  144.671 1.00 9.61  ? 196  HIS C CD2 1 
ATOM   8187  C  CE1 . HIS C 3  196 ? 70.034  63.345  144.419 1.00 16.46 ? 196  HIS C CE1 1 
ATOM   8188  N  NE2 . HIS C 3  196 ? 69.036  64.167  144.666 1.00 13.32 ? 196  HIS C NE2 1 
ATOM   8189  N  N   . LEU C 3  197 ? 71.427  68.455  142.169 1.00 20.54 ? 197  LEU C N   1 
ATOM   8190  C  CA  . LEU C 3  197 ? 70.539  69.125  141.207 1.00 21.48 ? 197  LEU C CA  1 
ATOM   8191  C  C   . LEU C 3  197 ? 71.217  69.438  139.877 1.00 22.46 ? 197  LEU C C   1 
ATOM   8192  O  O   . LEU C 3  197 ? 70.552  69.462  138.836 1.00 23.69 ? 197  LEU C O   1 
ATOM   8193  C  CB  . LEU C 3  197 ? 69.955  70.404  141.823 1.00 21.40 ? 197  LEU C CB  1 
ATOM   8194  C  CG  . LEU C 3  197 ? 68.550  70.951  141.499 1.00 28.36 ? 197  LEU C CG  1 
ATOM   8195  C  CD1 . LEU C 3  197 ? 67.414  69.913  141.597 1.00 15.47 ? 197  LEU C CD1 1 
ATOM   8196  C  CD2 . LEU C 3  197 ? 68.241  72.122  142.426 1.00 25.36 ? 197  LEU C CD2 1 
ATOM   8197  N  N   . LEU C 3  198 ? 72.526  69.718  139.940 1.00 22.04 ? 198  LEU C N   1 
ATOM   8198  C  CA  . LEU C 3  198 ? 73.395  69.880  138.781 1.00 20.99 ? 198  LEU C CA  1 
ATOM   8199  C  C   . LEU C 3  198 ? 73.476  68.607  137.924 1.00 19.89 ? 198  LEU C C   1 
ATOM   8200  O  O   . LEU C 3  198 ? 73.242  68.681  136.706 1.00 19.58 ? 198  LEU C O   1 
ATOM   8201  C  CB  . LEU C 3  198 ? 74.786  70.376  139.205 1.00 20.67 ? 198  LEU C CB  1 
ATOM   8202  C  CG  . LEU C 3  198 ? 75.812  70.726  138.118 1.00 33.80 ? 198  LEU C CG  1 
ATOM   8203  C  CD1 . LEU C 3  198 ? 75.787  72.219  137.805 1.00 35.57 ? 198  LEU C CD1 1 
ATOM   8204  C  CD2 . LEU C 3  198 ? 77.213  70.298  138.549 1.00 39.26 ? 198  LEU C CD2 1 
ATOM   8205  N  N   . PHE C 3  199 ? 73.841  67.478  138.554 1.00 18.94 ? 199  PHE C N   1 
ATOM   8206  C  CA  . PHE C 3  199 ? 73.816  66.151  137.908 1.00 18.28 ? 199  PHE C CA  1 
ATOM   8207  C  C   . PHE C 3  199 ? 72.504  65.731  137.286 1.00 17.98 ? 199  PHE C C   1 
ATOM   8208  O  O   . PHE C 3  199 ? 72.507  65.301  136.103 1.00 17.09 ? 199  PHE C O   1 
ATOM   8209  C  CB  . PHE C 3  199 ? 74.393  65.054  138.790 1.00 17.75 ? 199  PHE C CB  1 
ATOM   8210  C  CG  . PHE C 3  199 ? 75.899  65.075  138.860 1.00 20.43 ? 199  PHE C CG  1 
ATOM   8211  C  CD1 . PHE C 3  199 ? 76.692  64.859  137.691 1.00 19.53 ? 199  PHE C CD1 1 
ATOM   8212  C  CD2 . PHE C 3  199 ? 76.548  65.291  140.095 1.00 14.83 ? 199  PHE C CD2 1 
ATOM   8213  C  CE1 . PHE C 3  199 ? 78.120  64.863  137.759 1.00 19.72 ? 199  PHE C CE1 1 
ATOM   8214  C  CE2 . PHE C 3  199 ? 77.972  65.309  140.182 1.00 24.08 ? 199  PHE C CE2 1 
ATOM   8215  C  CZ  . PHE C 3  199 ? 78.763  65.132  139.003 1.00 19.77 ? 199  PHE C CZ  1 
ATOM   8216  N  N   . LEU C 3  200 ? 71.398  66.089  137.966 1.00 18.38 ? 200  LEU C N   1 
ATOM   8217  C  CA  . LEU C 3  200 ? 70.028  65.854  137.469 1.00 18.75 ? 200  LEU C CA  1 
ATOM   8218  C  C   . LEU C 3  200 ? 69.672  66.623  136.187 1.00 19.28 ? 200  LEU C C   1 
ATOM   8219  O  O   . LEU C 3  200 ? 69.118  66.038  135.246 1.00 19.90 ? 200  LEU C O   1 
ATOM   8220  C  CB  . LEU C 3  200 ? 68.973  66.084  138.568 1.00 18.59 ? 200  LEU C CB  1 
ATOM   8221  C  CG  . LEU C 3  200 ? 67.505  65.751  138.191 1.00 24.78 ? 200  LEU C CG  1 
ATOM   8222  C  CD1 . LEU C 3  200 ? 67.244  64.250  138.021 1.00 9.75  ? 200  LEU C CD1 1 
ATOM   8223  C  CD2 . LEU C 3  200 ? 66.490  66.397  139.090 1.00 20.40 ? 200  LEU C CD2 1 
ATOM   8224  N  N   . HIS C 3  201 ? 70.063  67.898  136.144 1.00 19.13 ? 201  HIS C N   1 
ATOM   8225  C  CA  . HIS C 3  201 ? 69.830  68.775  134.995 1.00 19.35 ? 201  HIS C CA  1 
ATOM   8226  C  C   . HIS C 3  201 ? 70.559  68.415  133.696 1.00 18.34 ? 201  HIS C C   1 
ATOM   8227  O  O   . HIS C 3  201 ? 70.061  68.764  132.620 1.00 17.73 ? 201  HIS C O   1 
ATOM   8228  C  CB  . HIS C 3  201 ? 69.977  70.267  135.380 1.00 19.72 ? 201  HIS C CB  1 
ATOM   8229  C  CG  . HIS C 3  201 ? 68.920  70.755  136.340 1.00 31.15 ? 201  HIS C CG  1 
ATOM   8230  N  ND1 . HIS C 3  201 ? 69.068  71.911  137.077 1.00 35.54 ? 201  HIS C ND1 1 
ATOM   8231  C  CD2 . HIS C 3  201 ? 67.750  70.198  136.750 1.00 27.92 ? 201  HIS C CD2 1 
ATOM   8232  C  CE1 . HIS C 3  201 ? 68.020  72.063  137.868 1.00 32.23 ? 201  HIS C CE1 1 
ATOM   8233  N  NE2 . HIS C 3  201 ? 67.210  71.035  137.695 1.00 32.99 ? 201  HIS C NE2 1 
ATOM   8234  N  N   . GLU C 3  202 ? 71.587  67.549  133.792 1.00 18.19 ? 202  GLU C N   1 
ATOM   8235  C  CA  . GLU C 3  202 ? 72.174  66.861  132.618 1.00 19.18 ? 202  GLU C CA  1 
ATOM   8236  C  C   . GLU C 3  202 ? 71.173  66.015  131.828 1.00 20.50 ? 202  GLU C C   1 
ATOM   8237  O  O   . GLU C 3  202 ? 71.215  66.013  130.597 1.00 22.45 ? 202  GLU C O   1 
ATOM   8238  C  CB  . GLU C 3  202 ? 73.357  65.976  132.997 1.00 18.88 ? 202  GLU C CB  1 
ATOM   8239  C  CG  . GLU C 3  202 ? 74.580  66.702  133.503 1.00 22.93 ? 202  GLU C CG  1 
ATOM   8240  C  CD  . GLU C 3  202 ? 75.305  67.452  132.412 1.00 30.87 ? 202  GLU C CD  1 
ATOM   8241  O  OE1 . GLU C 3  202 ? 75.264  68.694  132.460 1.00 27.11 ? 202  GLU C OE1 1 
ATOM   8242  O  OE2 . GLU C 3  202 ? 75.876  66.798  131.503 1.00 35.75 ? 202  GLU C OE2 1 
ATOM   8243  N  N   . THR C 3  203 ? 70.228  65.394  132.532 1.00 19.24 ? 203  THR C N   1 
ATOM   8244  C  CA  . THR C 3  203 ? 69.265  64.469  131.915 1.00 19.71 ? 203  THR C CA  1 
ATOM   8245  C  C   . THR C 3  203 ? 67.819  64.959  131.951 1.00 19.54 ? 203  THR C C   1 
ATOM   8246  O  O   . THR C 3  203 ? 67.018  64.558  131.108 1.00 19.45 ? 203  THR C O   1 
ATOM   8247  C  CB  . THR C 3  203 ? 69.353  63.060  132.538 1.00 19.66 ? 203  THR C CB  1 
ATOM   8248  O  OG1 . THR C 3  203 ? 69.194  63.154  133.973 1.00 16.37 ? 203  THR C OG1 1 
ATOM   8249  C  CG2 . THR C 3  203 ? 70.782  62.420  132.307 1.00 18.74 ? 203  THR C CG2 1 
ATOM   8250  N  N   . GLY C 3  204 ? 67.510  65.816  132.936 1.00 18.93 ? 204  GLY C N   1 
ATOM   8251  C  CA  . GLY C 3  204 ? 66.162  66.051  133.420 1.00 17.86 ? 204  GLY C CA  1 
ATOM   8252  C  C   . GLY C 3  204 ? 65.595  64.851  134.146 1.00 18.21 ? 204  GLY C C   1 
ATOM   8253  O  O   . GLY C 3  204 ? 66.281  63.829  134.382 1.00 18.94 ? 204  GLY C O   1 
ATOM   8254  N  N   . SER C 3  205 ? 64.320  64.976  134.473 1.00 17.04 ? 205  SER C N   1 
ATOM   8255  C  CA  . SER C 3  205 ? 63.615  64.023  135.267 1.00 16.87 ? 205  SER C CA  1 
ATOM   8256  C  C   . SER C 3  205 ? 63.263  62.742  134.484 1.00 16.08 ? 205  SER C C   1 
ATOM   8257  O  O   . SER C 3  205 ? 62.977  62.777  133.273 1.00 15.57 ? 205  SER C O   1 
ATOM   8258  C  CB  . SER C 3  205 ? 62.360  64.661  135.843 1.00 17.39 ? 205  SER C CB  1 
ATOM   8259  O  OG  . SER C 3  205 ? 62.698  65.600  136.841 1.00 15.81 ? 205  SER C OG  1 
ATOM   8260  N  N   . ASN C 3  206 ? 63.314  61.620  135.196 1.00 15.55 ? 206  ASN C N   1 
ATOM   8261  C  CA  . ASN C 3  206 ? 62.536  60.420  134.863 1.00 16.25 ? 206  ASN C CA  1 
ATOM   8262  C  C   . ASN C 3  206 ? 61.025  60.665  135.072 1.00 17.09 ? 206  ASN C C   1 
ATOM   8263  O  O   . ASN C 3  206 ? 60.628  61.796  135.323 1.00 17.41 ? 206  ASN C O   1 
ATOM   8264  C  CB  . ASN C 3  206 ? 63.109  59.238  135.661 1.00 15.94 ? 206  ASN C CB  1 
ATOM   8265  C  CG  . ASN C 3  206 ? 62.477  57.891  135.332 1.00 20.31 ? 206  ASN C CG  1 
ATOM   8266  O  OD1 . ASN C 3  206 ? 62.343  57.074  136.227 1.00 31.65 ? 206  ASN C OD1 1 
ATOM   8267  N  ND2 . ASN C 3  206 ? 62.163  57.621  134.054 1.00 13.21 ? 206  ASN C ND2 1 
ATOM   8268  N  N   . ASN C 3  207 ? 60.199  59.733  134.619 1.00 18.30 ? 207  ASN C N   1 
ATOM   8269  C  CA  . ASN C 3  207 ? 58.743  59.823  134.753 1.00 18.46 ? 207  ASN C CA  1 
ATOM   8270  C  C   . ASN C 3  207 ? 58.132  58.472  135.168 1.00 18.72 ? 207  ASN C C   1 
ATOM   8271  O  O   . ASN C 3  207 ? 58.892  57.484  135.194 1.00 18.65 ? 207  ASN C O   1 
ATOM   8272  C  CB  . ASN C 3  207 ? 58.138  60.422  133.474 1.00 18.12 ? 207  ASN C CB  1 
ATOM   8273  C  CG  . ASN C 3  207 ? 58.199  59.494  132.316 1.00 19.51 ? 207  ASN C CG  1 
ATOM   8274  O  OD1 . ASN C 3  207 ? 57.350  58.604  132.170 1.00 14.85 ? 207  ASN C OD1 1 
ATOM   8275  N  ND2 . ASN C 3  207 ? 59.231  59.647  131.501 1.00 3.69  ? 207  ASN C ND2 1 
ATOM   8276  N  N   . PRO C 3  208 ? 56.827  58.422  135.573 1.00 19.24 ? 208  PRO C N   1 
ATOM   8277  C  CA  . PRO C 3  208 ? 56.162  57.142  135.889 1.00 19.47 ? 208  PRO C CA  1 
ATOM   8278  C  C   . PRO C 3  208 ? 56.349  55.981  134.905 1.00 20.33 ? 208  PRO C C   1 
ATOM   8279  O  O   . PRO C 3  208 ? 56.628  54.855  135.382 1.00 21.32 ? 208  PRO C O   1 
ATOM   8280  C  CB  . PRO C 3  208 ? 54.684  57.532  136.009 1.00 19.26 ? 208  PRO C CB  1 
ATOM   8281  C  CG  . PRO C 3  208 ? 54.726  58.915  136.574 1.00 21.61 ? 208  PRO C CG  1 
ATOM   8282  C  CD  . PRO C 3  208 ? 55.964  59.560  136.004 1.00 19.10 ? 208  PRO C CD  1 
ATOM   8283  N  N   . THR C 3  209 ? 56.321  56.263  133.595 1.00 19.67 ? 209  THR C N   1 
ATOM   8284  C  CA  . THR C 3  209 ? 56.402  55.217  132.549 1.00 19.20 ? 209  THR C CA  1 
ATOM   8285  C  C   . THR C 3  209 ? 57.804  54.607  132.355 1.00 18.91 ? 209  THR C C   1 
ATOM   8286  O  O   . THR C 3  209 ? 57.912  53.500  131.815 1.00 19.50 ? 209  THR C O   1 
ATOM   8287  C  CB  . THR C 3  209 ? 55.815  55.683  131.173 1.00 19.62 ? 209  THR C CB  1 
ATOM   8288  O  OG1 . THR C 3  209 ? 56.682  56.665  130.570 1.00 23.04 ? 209  THR C OG1 1 
ATOM   8289  C  CG2 . THR C 3  209 ? 54.401  56.355  131.304 1.00 13.40 ? 209  THR C CG2 1 
ATOM   8290  N  N   . GLY C 3  210 ? 58.852  55.305  132.828 1.00 18.08 ? 210  GLY C N   1 
ATOM   8291  C  CA  . GLY C 3  210 ? 60.261  54.994  132.544 1.00 17.73 ? 210  GLY C CA  1 
ATOM   8292  C  C   . GLY C 3  210 ? 60.726  55.131  131.097 1.00 17.86 ? 210  GLY C C   1 
ATOM   8293  O  O   . GLY C 3  210 ? 61.820  54.632  130.724 1.00 18.09 ? 210  GLY C O   1 
ATOM   8294  N  N   . ILE C 3  211 ? 59.859  55.717  130.264 1.00 17.75 ? 211  ILE C N   1 
ATOM   8295  C  CA  . ILE C 3  211 ? 60.126  55.950  128.837 1.00 16.90 ? 211  ILE C CA  1 
ATOM   8296  C  C   . ILE C 3  211 ? 60.519  57.418  128.731 1.00 16.72 ? 211  ILE C C   1 
ATOM   8297  O  O   . ILE C 3  211 ? 59.882  58.275  129.354 1.00 16.14 ? 211  ILE C O   1 
ATOM   8298  C  CB  . ILE C 3  211 ? 58.859  55.606  127.959 1.00 16.19 ? 211  ILE C CB  1 
ATOM   8299  C  CG1 . ILE C 3  211 ? 58.465  54.117  128.119 1.00 7.68  ? 211  ILE C CG1 1 
ATOM   8300  C  CG2 . ILE C 3  211 ? 59.122  55.871  126.442 1.00 6.12  ? 211  ILE C CG2 1 
ATOM   8301  C  CD1 . ILE C 3  211 ? 56.991  53.881  128.095 1.00 13.83 ? 211  ILE C CD1 1 
ATOM   8302  N  N   . SER C 3  212 ? 61.548  57.694  127.920 1.00 17.18 ? 212  SER C N   1 
ATOM   8303  C  CA  . SER C 3  212 ? 61.924  59.073  127.461 1.00 16.18 ? 212  SER C CA  1 
ATOM   8304  C  C   . SER C 3  212 ? 60.732  59.950  127.073 1.00 15.59 ? 212  SER C C   1 
ATOM   8305  O  O   . SER C 3  212 ? 59.708  59.435  126.556 1.00 15.55 ? 212  SER C O   1 
ATOM   8306  C  CB  . SER C 3  212 ? 62.942  59.017  126.325 1.00 15.69 ? 212  SER C CB  1 
ATOM   8307  O  OG  . SER C 3  212 ? 63.483  60.320  126.063 1.00 31.56 ? 212  SER C OG  1 
ATOM   8308  N  N   . SER C 3  213 ? 60.748  61.142  127.664 1.00 15.42 ? 213  SER C N   1 
ATOM   8309  C  CA  . SER C 3  213 ? 59.666  62.130  127.595 1.00 16.20 ? 213  SER C CA  1 
ATOM   8310  C  C   . SER C 3  213 ? 60.027  63.423  126.838 1.00 16.77 ? 213  SER C C   1 
ATOM   8311  O  O   . SER C 3  213 ? 59.208  64.357  126.805 1.00 16.70 ? 213  SER C O   1 
ATOM   8312  C  CB  . SER C 3  213 ? 59.157  62.449  129.017 1.00 16.67 ? 213  SER C CB  1 
ATOM   8313  O  OG  . SER C 3  213 ? 60.170  63.061  129.816 1.00 20.90 ? 213  SER C OG  1 
ATOM   8314  N  N   . ASP C 3  214 ? 61.142  63.387  126.080 1.00 17.68 ? 214  ASP C N   1 
ATOM   8315  C  CA  . ASP C 3  214 ? 61.593  64.466  125.143 1.00 18.58 ? 214  ASP C CA  1 
ATOM   8316  C  C   . ASP C 3  214 ? 60.545  64.957  124.139 1.00 18.98 ? 214  ASP C C   1 
ATOM   8317  O  O   . ASP C 3  214 ? 60.614  66.096  123.663 1.00 20.41 ? 214  ASP C O   1 
ATOM   8318  C  CB  . ASP C 3  214 ? 62.812  63.989  124.341 1.00 19.43 ? 214  ASP C CB  1 
ATOM   8319  C  CG  . ASP C 3  214 ? 64.120  64.007  125.135 1.00 19.37 ? 214  ASP C CG  1 
ATOM   8320  O  OD1 . ASP C 3  214 ? 65.142  63.588  124.552 1.00 28.36 ? 214  ASP C OD1 1 
ATOM   8321  O  OD2 . ASP C 3  214 ? 64.183  64.108  126.367 1.00 17.98 ? 214  ASP C OD2 1 
ATOM   8322  N  N   . VAL C 3  215 ? 59.620  64.057  123.814 1.00 17.96 ? 215  VAL C N   1 
ATOM   8323  C  CA  . VAL C 3  215 ? 58.510  64.201  122.874 1.00 17.64 ? 215  VAL C CA  1 
ATOM   8324  C  C   . VAL C 3  215 ? 57.347  65.031  123.527 1.00 16.35 ? 215  VAL C C   1 
ATOM   8325  O  O   . VAL C 3  215 ? 56.474  65.564  122.812 1.00 16.01 ? 215  VAL C O   1 
ATOM   8326  C  CB  . VAL C 3  215 ? 58.087  62.716  122.416 1.00 19.02 ? 215  VAL C CB  1 
ATOM   8327  C  CG1 . VAL C 3  215 ? 56.754  62.622  121.681 1.00 34.90 ? 215  VAL C CG1 1 
ATOM   8328  C  CG2 . VAL C 3  215 ? 59.196  62.071  121.551 1.00 28.45 ? 215  VAL C CG2 1 
ATOM   8329  N  N   . ASP C 3  216 ? 57.382  65.170  124.861 1.00 15.66 ? 216  ASP C N   1 
ATOM   8330  C  CA  . ASP C 3  216 ? 56.280  65.733  125.657 1.00 16.25 ? 216  ASP C CA  1 
ATOM   8331  C  C   . ASP C 3  216 ? 56.737  66.425  126.954 1.00 16.16 ? 216  ASP C C   1 
ATOM   8332  O  O   . ASP C 3  216 ? 56.344  66.048  128.081 1.00 15.84 ? 216  ASP C O   1 
ATOM   8333  C  CB  . ASP C 3  216 ? 55.164  64.675  125.904 1.00 17.16 ? 216  ASP C CB  1 
ATOM   8334  C  CG  . ASP C 3  216 ? 53.849  65.293  126.369 1.00 14.54 ? 216  ASP C CG  1 
ATOM   8335  O  OD1 . ASP C 3  216 ? 53.482  66.435  125.969 1.00 22.01 ? 216  ASP C OD1 1 
ATOM   8336  O  OD2 . ASP C 3  216 ? 53.088  64.674  127.100 1.00 18.61 ? 216  ASP C OD2 1 
ATOM   8337  N  N   . LYS C 3  217 ? 57.607  67.424  126.768 1.00 16.47 ? 217  LYS C N   1 
ATOM   8338  C  CA  . LYS C 3  217 ? 58.111  68.266  127.840 1.00 16.69 ? 217  LYS C CA  1 
ATOM   8339  C  C   . LYS C 3  217 ? 57.278  69.523  127.940 1.00 16.76 ? 217  LYS C C   1 
ATOM   8340  O  O   . LYS C 3  217 ? 56.752  70.038  126.934 1.00 16.98 ? 217  LYS C O   1 
ATOM   8341  C  CB  . LYS C 3  217 ? 59.615  68.614  127.669 1.00 17.28 ? 217  LYS C CB  1 
ATOM   8342  C  CG  . LYS C 3  217 ? 60.569  67.387  127.688 1.00 23.70 ? 217  LYS C CG  1 
ATOM   8343  C  CD  . LYS C 3  217 ? 60.986  66.958  129.099 1.00 13.57 ? 217  LYS C CD  1 
ATOM   8344  C  CE  . LYS C 3  217 ? 61.880  65.768  129.048 1.00 22.89 ? 217  LYS C CE  1 
ATOM   8345  N  NZ  . LYS C 3  217 ? 62.523  65.428  130.363 1.00 33.78 ? 217  LYS C NZ  1 
ATOM   8346  N  N   . ILE C 3  218 ? 57.074  69.941  129.182 1.00 16.47 ? 218  ILE C N   1 
ATOM   8347  C  CA  . ILE C 3  218 ? 56.419  71.218  129.518 1.00 16.11 ? 218  ILE C CA  1 
ATOM   8348  C  C   . ILE C 3  218 ? 57.395  72.117  130.323 1.00 15.72 ? 218  ILE C C   1 
ATOM   8349  O  O   . ILE C 3  218 ? 58.318  71.560  130.940 1.00 15.48 ? 218  ILE C O   1 
ATOM   8350  C  CB  . ILE C 3  218 ? 55.067  70.971  130.263 1.00 16.01 ? 218  ILE C CB  1 
ATOM   8351  C  CG1 . ILE C 3  218 ? 55.260  70.117  131.541 1.00 17.24 ? 218  ILE C CG1 1 
ATOM   8352  C  CG2 . ILE C 3  218 ? 53.986  70.387  129.252 1.00 12.46 ? 218  ILE C CG2 1 
ATOM   8353  C  CD1 . ILE C 3  218 ? 54.115  70.211  132.554 1.00 16.56 ? 218  ILE C CD1 1 
ATOM   8354  N  N   . PRO C 3  219 ? 57.238  73.466  130.312 1.00 15.90 ? 219  PRO C N   1 
ATOM   8355  C  CA  . PRO C 3  219 ? 58.080  74.308  131.175 1.00 16.70 ? 219  PRO C CA  1 
ATOM   8356  C  C   . PRO C 3  219 ? 57.710  74.115  132.644 1.00 17.46 ? 219  PRO C C   1 
ATOM   8357  O  O   . PRO C 3  219 ? 56.514  73.854  132.934 1.00 17.70 ? 219  PRO C O   1 
ATOM   8358  C  CB  . PRO C 3  219 ? 57.766  75.737  130.707 1.00 16.21 ? 219  PRO C CB  1 
ATOM   8359  C  CG  . PRO C 3  219 ? 56.417  75.664  130.140 1.00 17.61 ? 219  PRO C CG  1 
ATOM   8360  C  CD  . PRO C 3  219 ? 56.321  74.312  129.505 1.00 15.96 ? 219  PRO C CD  1 
ATOM   8361  N  N   . PHE C 3  220 ? 58.749  74.002  133.483 1.00 17.36 ? 220  PHE C N   1 
ATOM   8362  C  CA  . PHE C 3  220 ? 58.638  73.940  134.946 1.00 17.12 ? 220  PHE C CA  1 
ATOM   8363  C  C   . PHE C 3  220 ? 57.685  74.982  135.557 1.00 16.78 ? 220  PHE C C   1 
ATOM   8364  O  O   . PHE C 3  220 ? 56.947  74.663  136.477 1.00 16.19 ? 220  PHE C O   1 
ATOM   8365  C  CB  . PHE C 3  220 ? 60.028  74.022  135.587 1.00 17.16 ? 220  PHE C CB  1 
ATOM   8366  C  CG  . PHE C 3  220 ? 60.082  73.491  136.995 1.00 22.61 ? 220  PHE C CG  1 
ATOM   8367  C  CD1 . PHE C 3  220 ? 59.914  74.367  138.111 1.00 18.86 ? 220  PHE C CD1 1 
ATOM   8368  C  CD2 . PHE C 3  220 ? 60.321  72.111  137.233 1.00 26.32 ? 220  PHE C CD2 1 
ATOM   8369  C  CE1 . PHE C 3  220 ? 59.927  73.866  139.456 1.00 21.24 ? 220  PHE C CE1 1 
ATOM   8370  C  CE2 . PHE C 3  220 ? 60.333  71.586  138.571 1.00 21.30 ? 220  PHE C CE2 1 
ATOM   8371  C  CZ  . PHE C 3  220 ? 60.171  72.474  139.682 1.00 20.43 ? 220  PHE C CZ  1 
ATOM   8372  N  N   . HIS C 3  221 ? 57.776  76.226  135.078 1.00 17.17 ? 221  HIS C N   1 
ATOM   8373  C  CA  . HIS C 3  221 ? 56.840  77.297  135.421 1.00 17.39 ? 221  HIS C CA  1 
ATOM   8374  C  C   . HIS C 3  221 ? 55.836  77.491  134.259 1.00 17.00 ? 221  HIS C C   1 
ATOM   8375  O  O   . HIS C 3  221 ? 56.286  77.508  133.127 1.00 16.59 ? 221  HIS C O   1 
ATOM   8376  C  CB  . HIS C 3  221 ? 57.623  78.582  135.714 1.00 18.03 ? 221  HIS C CB  1 
ATOM   8377  C  CG  . HIS C 3  221 ? 56.760  79.743  136.094 1.00 20.82 ? 221  HIS C CG  1 
ATOM   8378  N  ND1 . HIS C 3  221 ? 56.142  79.833  137.324 1.00 13.27 ? 221  HIS C ND1 1 
ATOM   8379  C  CD2 . HIS C 3  221 ? 56.267  80.761  135.350 1.00 12.32 ? 221  HIS C CD2 1 
ATOM   8380  C  CE1 . HIS C 3  221 ? 55.391  80.920  137.355 1.00 10.80 ? 221  HIS C CE1 1 
ATOM   8381  N  NE2 . HIS C 3  221 ? 55.452  81.503  136.172 1.00 21.44 ? 221  HIS C NE2 1 
ATOM   8382  N  N   . PRO C 3  222 ? 54.496  77.549  134.489 1.00 17.24 ? 222  PRO C N   1 
ATOM   8383  C  CA  . PRO C 3  222 ? 53.839  77.628  135.815 1.00 17.09 ? 222  PRO C CA  1 
ATOM   8384  C  C   . PRO C 3  222 ? 53.520  76.270  136.510 1.00 17.68 ? 222  PRO C C   1 
ATOM   8385  O  O   . PRO C 3  222 ? 53.207  76.279  137.728 1.00 17.61 ? 222  PRO C O   1 
ATOM   8386  C  CB  . PRO C 3  222 ? 52.537  78.355  135.492 1.00 16.60 ? 222  PRO C CB  1 
ATOM   8387  C  CG  . PRO C 3  222 ? 52.185  77.850  134.103 1.00 17.36 ? 222  PRO C CG  1 
ATOM   8388  C  CD  . PRO C 3  222 ? 53.500  77.693  133.402 1.00 17.34 ? 222  PRO C CD  1 
ATOM   8389  N  N   . TYR C 3  223 ? 53.744  75.159  135.799 1.00 17.36 ? 223  TYR C N   1 
ATOM   8390  C  CA  . TYR C 3  223 ? 53.113  73.888  136.109 1.00 17.04 ? 223  TYR C CA  1 
ATOM   8391  C  C   . TYR C 3  223 ? 53.612  73.251  137.393 1.00 17.44 ? 223  TYR C C   1 
ATOM   8392  O  O   . TYR C 3  223 ? 52.795  72.870  138.245 1.00 17.72 ? 223  TYR C O   1 
ATOM   8393  C  CB  . TYR C 3  223 ? 53.200  72.908  134.932 1.00 16.82 ? 223  TYR C CB  1 
ATOM   8394  C  CG  . TYR C 3  223 ? 52.414  73.333  133.708 1.00 14.93 ? 223  TYR C CG  1 
ATOM   8395  C  CD1 . TYR C 3  223 ? 50.989  73.265  133.688 1.00 15.11 ? 223  TYR C CD1 1 
ATOM   8396  C  CD2 . TYR C 3  223 ? 53.090  73.787  132.538 1.00 13.26 ? 223  TYR C CD2 1 
ATOM   8397  C  CE1 . TYR C 3  223 ? 50.245  73.723  132.559 1.00 11.76 ? 223  TYR C CE1 1 
ATOM   8398  C  CE2 . TYR C 3  223 ? 52.364  74.222  131.396 1.00 5.90  ? 223  TYR C CE2 1 
ATOM   8399  C  CZ  . TYR C 3  223 ? 50.942  74.185  131.419 1.00 6.19  ? 223  TYR C CZ  1 
ATOM   8400  O  OH  . TYR C 3  223 ? 50.229  74.552  130.317 1.00 10.12 ? 223  TYR C OH  1 
ATOM   8401  N  N   . TYR C 3  224 ? 54.933  73.084  137.496 1.00 17.18 ? 224  TYR C N   1 
ATOM   8402  C  CA  . TYR C 3  224 ? 55.553  72.522  138.691 1.00 17.36 ? 224  TYR C CA  1 
ATOM   8403  C  C   . TYR C 3  224 ? 55.918  73.537  139.745 1.00 18.02 ? 224  TYR C C   1 
ATOM   8404  O  O   . TYR C 3  224 ? 56.173  73.159  140.870 1.00 18.38 ? 224  TYR C O   1 
ATOM   8405  C  CB  . TYR C 3  224 ? 56.717  71.581  138.353 1.00 17.13 ? 224  TYR C CB  1 
ATOM   8406  C  CG  . TYR C 3  224 ? 56.296  70.411  137.523 1.00 16.03 ? 224  TYR C CG  1 
ATOM   8407  C  CD1 . TYR C 3  224 ? 55.423  69.411  138.053 1.00 18.78 ? 224  TYR C CD1 1 
ATOM   8408  C  CD2 . TYR C 3  224 ? 56.576  70.391  136.143 1.00 15.33 ? 224  TYR C CD2 1 
ATOM   8409  C  CE1 . TYR C 3  224 ? 54.845  68.418  137.212 1.00 16.87 ? 224  TYR C CE1 1 
ATOM   8410  C  CE2 . TYR C 3  224 ? 56.087  69.358  135.313 1.00 12.40 ? 224  TYR C CE2 1 
ATOM   8411  C  CZ  . TYR C 3  224 ? 55.202  68.392  135.845 1.00 16.55 ? 224  TYR C CZ  1 
ATOM   8412  O  OH  . TYR C 3  224 ? 54.690  67.423  135.023 1.00 12.23 ? 224  TYR C OH  1 
ATOM   8413  N  N   . THR C 3  225 ? 55.811  74.827  139.421 1.00 18.60 ? 225  THR C N   1 
ATOM   8414  C  CA  . THR C 3  225 ? 55.848  75.868  140.449 1.00 18.57 ? 225  THR C CA  1 
ATOM   8415  C  C   . THR C 3  225 ? 54.590  75.853  141.302 1.00 18.08 ? 225  THR C C   1 
ATOM   8416  O  O   . THR C 3  225 ? 54.705  75.788  142.518 1.00 17.66 ? 225  THR C O   1 
ATOM   8417  C  CB  . THR C 3  225 ? 56.171  77.282  139.904 1.00 18.19 ? 225  THR C CB  1 
ATOM   8418  O  OG1 . THR C 3  225 ? 55.405  77.532  138.738 1.00 21.20 ? 225  THR C OG1 1 
ATOM   8419  C  CG2 . THR C 3  225 ? 57.609  77.377  139.415 1.00 18.31 ? 225  THR C CG2 1 
ATOM   8420  N  N   . ILE C 3  226 ? 53.422  75.763  140.657 1.00 18.51 ? 226  ILE C N   1 
ATOM   8421  C  CA  . ILE C 3  226 ? 52.136  75.629  141.363 1.00 19.38 ? 226  ILE C CA  1 
ATOM   8422  C  C   . ILE C 3  226 ? 51.859  74.251  141.990 1.00 19.67 ? 226  ILE C C   1 
ATOM   8423  O  O   . ILE C 3  226 ? 51.372  74.198  143.120 1.00 19.47 ? 226  ILE C O   1 
ATOM   8424  C  CB  . ILE C 3  226 ? 50.923  76.247  140.562 1.00 19.66 ? 226  ILE C CB  1 
ATOM   8425  C  CG1 . ILE C 3  226 ? 49.779  76.683  141.501 1.00 26.47 ? 226  ILE C CG1 1 
ATOM   8426  C  CG2 . ILE C 3  226 ? 50.435  75.322  139.423 1.00 15.39 ? 226  ILE C CG2 1 
ATOM   8427  C  CD1 . ILE C 3  226 ? 49.940  78.118  142.130 1.00 21.71 ? 226  ILE C CD1 1 
ATOM   8428  N  N   . LYS C 3  227 ? 52.299  73.176  141.315 1.00 20.32 ? 227  LYS C N   1 
ATOM   8429  C  CA  . LYS C 3  227 ? 52.273  71.810  141.869 1.00 21.25 ? 227  LYS C CA  1 
ATOM   8430  C  C   . LYS C 3  227 ? 53.166  71.668  143.116 1.00 21.90 ? 227  LYS C C   1 
ATOM   8431  O  O   . LYS C 3  227 ? 52.719  71.055  144.103 1.00 22.04 ? 227  LYS C O   1 
ATOM   8432  C  CB  . LYS C 3  227 ? 52.640  70.758  140.824 1.00 21.29 ? 227  LYS C CB  1 
ATOM   8433  C  CG  . LYS C 3  227 ? 52.001  69.399  141.052 1.00 29.44 ? 227  LYS C CG  1 
ATOM   8434  C  CD  . LYS C 3  227 ? 52.297  68.440  139.922 1.00 35.01 ? 227  LYS C CD  1 
ATOM   8435  C  CE  . LYS C 3  227 ? 52.611  67.024  140.445 1.00 41.29 ? 227  LYS C CE  1 
ATOM   8436  N  NZ  . LYS C 3  227 ? 54.103  66.783  140.543 1.00 33.52 ? 227  LYS C NZ  1 
ATOM   8437  N  N   . ASP C 3  228 ? 54.339  72.344  143.111 1.00 21.26 ? 228  ASP C N   1 
ATOM   8438  C  CA  . ASP C 3  228 ? 55.256  72.349  144.267 1.00 20.88 ? 228  ASP C CA  1 
ATOM   8439  C  C   . ASP C 3  228 ? 54.763  73.210  145.434 1.00 21.08 ? 228  ASP C C   1 
ATOM   8440  O  O   . ASP C 3  228 ? 55.095  72.910  146.602 1.00 21.20 ? 228  ASP C O   1 
ATOM   8441  C  CB  . ASP C 3  228 ? 56.707  72.723  143.889 1.00 20.84 ? 228  ASP C CB  1 
ATOM   8442  C  CG  . ASP C 3  228 ? 57.501  71.567  143.207 1.00 30.30 ? 228  ASP C CG  1 
ATOM   8443  O  OD1 . ASP C 3  228 ? 56.961  70.463  142.940 1.00 25.09 ? 228  ASP C OD1 1 
ATOM   8444  O  OD2 . ASP C 3  228 ? 58.679  71.738  142.795 1.00 31.53 ? 228  ASP C OD2 1 
ATOM   8445  N  N   . ILE C 3  229 ? 54.093  74.334  145.109 1.00 20.86 ? 229  ILE C N   1 
ATOM   8446  C  CA  . ILE C 3  229 ? 53.371  75.170  146.090 1.00 20.54 ? 229  ILE C CA  1 
ATOM   8447  C  C   . ILE C 3  229 ? 52.317  74.365  146.874 1.00 20.50 ? 229  ILE C C   1 
ATOM   8448  O  O   . ILE C 3  229 ? 52.377  74.335  148.107 1.00 20.75 ? 229  ILE C O   1 
ATOM   8449  C  CB  . ILE C 3  229 ? 52.804  76.503  145.446 1.00 20.25 ? 229  ILE C CB  1 
ATOM   8450  C  CG1 . ILE C 3  229 ? 53.946  77.527  145.267 1.00 18.39 ? 229  ILE C CG1 1 
ATOM   8451  C  CG2 . ILE C 3  229 ? 51.681  77.151  146.332 1.00 13.99 ? 229  ILE C CG2 1 
ATOM   8452  C  CD1 . ILE C 3  229 ? 53.752  78.517  144.108 1.00 20.41 ? 229  ILE C CD1 1 
ATOM   8453  N  N   . LEU C 3  230 ? 51.447  73.647  146.143 1.00 20.41 ? 230  LEU C N   1 
ATOM   8454  C  CA  . LEU C 3  230 ? 50.433  72.749  146.716 1.00 20.02 ? 230  LEU C CA  1 
ATOM   8455  C  C   . LEU C 3  230 ? 51.035  71.654  147.594 1.00 20.09 ? 230  LEU C C   1 
ATOM   8456  O  O   . LEU C 3  230 ? 50.580  71.462  148.712 1.00 19.80 ? 230  LEU C O   1 
ATOM   8457  C  CB  . LEU C 3  230 ? 49.513  72.158  145.622 1.00 19.82 ? 230  LEU C CB  1 
ATOM   8458  C  CG  . LEU C 3  230 ? 48.317  71.259  146.031 1.00 19.05 ? 230  LEU C CG  1 
ATOM   8459  C  CD1 . LEU C 3  230 ? 47.198  72.043  146.752 1.00 11.08 ? 230  LEU C CD1 1 
ATOM   8460  C  CD2 . LEU C 3  230 ? 47.766  70.481  144.842 1.00 16.42 ? 230  LEU C CD2 1 
ATOM   8461  N  N   . GLY C 3  231 ? 52.124  71.049  147.109 1.00 20.81 ? 231  GLY C N   1 
ATOM   8462  C  CA  . GLY C 3  231 ? 52.938  70.102  147.861 1.00 21.41 ? 231  GLY C CA  1 
ATOM   8463  C  C   . GLY C 3  231 ? 53.484  70.652  149.168 1.00 21.41 ? 231  GLY C C   1 
ATOM   8464  O  O   . GLY C 3  231 ? 53.382  69.966  150.193 1.00 21.97 ? 231  GLY C O   1 
ATOM   8465  N  N   . ALA C 3  232 ? 53.990  71.897  149.136 1.00 20.40 ? 232  ALA C N   1 
ATOM   8466  C  CA  . ALA C 3  232 ? 54.513  72.597  150.321 1.00 19.74 ? 232  ALA C CA  1 
ATOM   8467  C  C   . ALA C 3  232 ? 53.452  72.886  151.389 1.00 19.37 ? 232  ALA C C   1 
ATOM   8468  O  O   . ALA C 3  232 ? 53.693  72.628  152.566 1.00 19.67 ? 232  ALA C O   1 
ATOM   8469  C  CB  . ALA C 3  232 ? 55.279  73.868  149.928 1.00 19.66 ? 232  ALA C CB  1 
ATOM   8470  N  N   . LEU C 3  233 ? 52.254  73.277  150.947 1.00 19.12 ? 233  LEU C N   1 
ATOM   8471  C  CA  . LEU C 3  233 ? 51.108  73.526  151.821 1.00 19.62 ? 233  LEU C CA  1 
ATOM   8472  C  C   . LEU C 3  233 ? 50.542  72.240  152.478 1.00 20.42 ? 233  LEU C C   1 
ATOM   8473  O  O   . LEU C 3  233 ? 50.111  72.285  153.625 1.00 20.61 ? 233  LEU C O   1 
ATOM   8474  C  CB  . LEU C 3  233 ? 50.030  74.316  151.071 1.00 19.28 ? 233  LEU C CB  1 
ATOM   8475  C  CG  . LEU C 3  233 ? 48.816  74.938  151.783 1.00 23.36 ? 233  LEU C CG  1 
ATOM   8476  C  CD1 . LEU C 3  233 ? 49.133  76.218  152.553 1.00 18.37 ? 233  LEU C CD1 1 
ATOM   8477  C  CD2 . LEU C 3  233 ? 47.736  75.213  150.759 1.00 30.60 ? 233  LEU C CD2 1 
ATOM   8478  N  N   . LEU C 3  234 ? 50.663  71.106  151.781 1.00 20.79 ? 234  LEU C N   1 
ATOM   8479  C  CA  . LEU C 3  234 ? 50.434  69.779  152.354 1.00 21.78 ? 234  LEU C CA  1 
ATOM   8480  C  C   . LEU C 3  234 ? 51.490  69.316  153.362 1.00 22.44 ? 234  LEU C C   1 
ATOM   8481  O  O   . LEU C 3  234 ? 51.148  68.603  154.313 1.00 22.23 ? 234  LEU C O   1 
ATOM   8482  C  CB  . LEU C 3  234 ? 50.209  68.723  151.261 1.00 21.76 ? 234  LEU C CB  1 
ATOM   8483  C  CG  . LEU C 3  234 ? 48.820  68.683  150.618 1.00 18.56 ? 234  LEU C CG  1 
ATOM   8484  C  CD1 . LEU C 3  234 ? 48.937  68.341  149.173 1.00 18.77 ? 234  LEU C CD1 1 
ATOM   8485  C  CD2 . LEU C 3  234 ? 47.841  67.727  151.314 1.00 25.01 ? 234  LEU C CD2 1 
ATOM   8486  N  N   . LEU C 3  235 ? 52.762  69.662  153.111 1.00 23.36 ? 235  LEU C N   1 
ATOM   8487  C  CA  . LEU C 3  235 ? 53.842  69.539  154.106 1.00 24.24 ? 235  LEU C CA  1 
ATOM   8488  C  C   . LEU C 3  235 ? 53.625  70.399  155.357 1.00 24.77 ? 235  LEU C C   1 
ATOM   8489  O  O   . LEU C 3  235 ? 53.879  69.918  156.480 1.00 25.25 ? 235  LEU C O   1 
ATOM   8490  C  CB  . LEU C 3  235 ? 55.243  69.791  153.494 1.00 24.54 ? 235  LEU C CB  1 
ATOM   8491  C  CG  . LEU C 3  235 ? 56.500  69.524  154.364 1.00 26.67 ? 235  LEU C CG  1 
ATOM   8492  C  CD1 . LEU C 3  235 ? 56.874  68.051  154.430 1.00 28.99 ? 235  LEU C CD1 1 
ATOM   8493  C  CD2 . LEU C 3  235 ? 57.692  70.360  153.972 1.00 27.62 ? 235  LEU C CD2 1 
ATOM   8494  N  N   . ILE C 3  236 ? 53.216  71.663  155.160 1.00 24.39 ? 236  ILE C N   1 
ATOM   8495  C  CA  . ILE C 3  236 ? 52.885  72.556  156.279 1.00 24.35 ? 236  ILE C CA  1 
ATOM   8496  C  C   . ILE C 3  236 ? 51.723  72.043  157.157 1.00 23.92 ? 236  ILE C C   1 
ATOM   8497  O  O   . ILE C 3  236 ? 51.922  71.924  158.369 1.00 23.98 ? 236  ILE C O   1 
ATOM   8498  C  CB  . ILE C 3  236 ? 52.791  74.102  155.859 1.00 24.73 ? 236  ILE C CB  1 
ATOM   8499  C  CG1 . ILE C 3  236 ? 54.107  74.651  155.205 1.00 26.43 ? 236  ILE C CG1 1 
ATOM   8500  C  CG2 . ILE C 3  236 ? 52.348  75.004  157.030 1.00 23.66 ? 236  ILE C CG2 1 
ATOM   8501  C  CD1 . ILE C 3  236 ? 55.492  74.360  155.936 1.00 32.38 ? 236  ILE C CD1 1 
ATOM   8502  N  N   . LEU C 3  237 ? 50.668  71.505  156.517 1.00 23.44 ? 237  LEU C N   1 
ATOM   8503  C  CA  . LEU C 3  237 ? 49.538  70.850  157.212 1.00 23.64 ? 237  LEU C CA  1 
ATOM   8504  C  C   . LEU C 3  237 ? 49.965  69.694  158.135 1.00 23.31 ? 237  LEU C C   1 
ATOM   8505  O  O   . LEU C 3  237 ? 49.750  69.778  159.362 1.00 23.16 ? 237  LEU C O   1 
ATOM   8506  C  CB  . LEU C 3  237 ? 48.407  70.430  156.238 1.00 23.82 ? 237  LEU C CB  1 
ATOM   8507  C  CG  . LEU C 3  237 ? 47.258  69.511  156.735 1.00 27.92 ? 237  LEU C CG  1 
ATOM   8508  C  CD1 . LEU C 3  237 ? 46.221  70.218  157.618 1.00 28.80 ? 237  LEU C CD1 1 
ATOM   8509  C  CD2 . LEU C 3  237 ? 46.585  68.742  155.607 1.00 27.51 ? 237  LEU C CD2 1 
ATOM   8510  N  N   . ALA C 3  238 ? 50.749  68.772  157.562 1.00 23.09 ? 238  ALA C N   1 
ATOM   8511  C  CA  . ALA C 3  238 ? 51.287  67.592  158.255 1.00 23.26 ? 238  ALA C CA  1 
ATOM   8512  C  C   . ALA C 3  238 ? 52.276  67.921  159.391 1.00 23.18 ? 238  ALA C C   1 
ATOM   8513  O  O   . ALA C 3  238 ? 52.106  67.403  160.515 1.00 23.06 ? 238  ALA C O   1 
ATOM   8514  C  CB  . ALA C 3  238 ? 51.894  66.619  157.256 1.00 23.24 ? 238  ALA C CB  1 
ATOM   8515  N  N   . LEU C 3  239 ? 53.180  68.889  159.141 1.00 22.70 ? 239  LEU C N   1 
ATOM   8516  C  CA  . LEU C 3  239 ? 54.059  69.464  160.179 1.00 21.93 ? 239  LEU C CA  1 
ATOM   8517  C  C   . LEU C 3  239 ? 53.302  70.156  161.320 1.00 22.11 ? 239  LEU C C   1 
ATOM   8518  O  O   . LEU C 3  239 ? 53.556  69.839  162.481 1.00 22.48 ? 239  LEU C O   1 
ATOM   8519  C  CB  . LEU C 3  239 ? 55.167  70.362  159.582 1.00 21.19 ? 239  LEU C CB  1 
ATOM   8520  C  CG  . LEU C 3  239 ? 56.111  71.177  160.496 1.00 16.79 ? 239  LEU C CG  1 
ATOM   8521  C  CD1 . LEU C 3  239 ? 57.140  70.355  161.246 1.00 19.39 ? 239  LEU C CD1 1 
ATOM   8522  C  CD2 . LEU C 3  239 ? 56.775  72.346  159.783 1.00 23.92 ? 239  LEU C CD2 1 
ATOM   8523  N  N   . MET C 3  240 ? 52.345  71.033  160.977 1.00 21.96 ? 240  MET C N   1 
ATOM   8524  C  CA  . MET C 3  240 ? 51.555  71.792  161.970 1.00 21.60 ? 240  MET C CA  1 
ATOM   8525  C  C   . MET C 3  240 ? 50.594  70.967  162.805 1.00 21.84 ? 240  MET C C   1 
ATOM   8526  O  O   . MET C 3  240 ? 50.414  71.272  163.982 1.00 22.56 ? 240  MET C O   1 
ATOM   8527  C  CB  . MET C 3  240 ? 50.852  73.020  161.372 1.00 21.32 ? 240  MET C CB  1 
ATOM   8528  C  CG  . MET C 3  240 ? 51.768  74.168  160.918 1.00 22.97 ? 240  MET C CG  1 
ATOM   8529  S  SD  . MET C 3  240 ? 52.790  74.929  162.206 1.00 38.95 ? 240  MET C SD  1 
ATOM   8530  C  CE  . MET C 3  240 ? 54.269  74.195  161.851 1.00 9.12  ? 240  MET C CE  1 
ATOM   8531  N  N   . LEU C 3  241 ? 49.998  69.927  162.199 1.00 21.39 ? 241  LEU C N   1 
ATOM   8532  C  CA  . LEU C 3  241 ? 49.283  68.849  162.914 1.00 21.26 ? 241  LEU C CA  1 
ATOM   8533  C  C   . LEU C 3  241 ? 50.105  68.192  164.021 1.00 21.45 ? 241  LEU C C   1 
ATOM   8534  O  O   . LEU C 3  241 ? 49.648  68.148  165.163 1.00 21.67 ? 241  LEU C O   1 
ATOM   8535  C  CB  . LEU C 3  241 ? 48.781  67.781  161.930 1.00 20.80 ? 241  LEU C CB  1 
ATOM   8536  C  CG  . LEU C 3  241 ? 47.337  67.620  161.424 1.00 23.85 ? 241  LEU C CG  1 
ATOM   8537  C  CD1 . LEU C 3  241 ? 46.275  68.677  161.817 1.00 11.59 ? 241  LEU C CD1 1 
ATOM   8538  C  CD2 . LEU C 3  241 ? 47.324  67.326  159.922 1.00 18.17 ? 241  LEU C CD2 1 
ATOM   8539  N  N   . LEU C 3  242 ? 51.378  67.903  163.714 1.00 21.80 ? 242  LEU C N   1 
ATOM   8540  C  CA  . LEU C 3  242 ? 52.348  67.410  164.680 1.00 22.30 ? 242  LEU C CA  1 
ATOM   8541  C  C   . LEU C 3  242 ? 52.674  68.426  165.791 1.00 23.12 ? 242  LEU C C   1 
ATOM   8542  O  O   . LEU C 3  242 ? 52.309  68.166  166.932 1.00 23.15 ? 242  LEU C O   1 
ATOM   8543  C  CB  . LEU C 3  242 ? 53.601  66.827  163.988 1.00 22.08 ? 242  LEU C CB  1 
ATOM   8544  C  CG  . LEU C 3  242 ? 53.850  65.298  163.779 1.00 21.67 ? 242  LEU C CG  1 
ATOM   8545  C  CD1 . LEU C 3  242 ? 52.668  64.331  163.985 1.00 20.66 ? 242  LEU C CD1 1 
ATOM   8546  C  CD2 . LEU C 3  242 ? 54.555  64.991  162.453 1.00 13.00 ? 242  LEU C CD2 1 
ATOM   8547  N  N   . VAL C 3  243 ? 53.005  69.671  165.410 1.00 23.09 ? 243  VAL C N   1 
ATOM   8548  C  CA  . VAL C 3  243 ? 53.374  70.708  166.402 1.00 22.90 ? 243  VAL C CA  1 
ATOM   8549  C  C   . VAL C 3  243 ? 52.246  71.260  167.292 1.00 22.65 ? 243  VAL C C   1 
ATOM   8550  O  O   . VAL C 3  243 ? 52.486  71.559  168.466 1.00 22.45 ? 243  VAL C O   1 
ATOM   8551  C  CB  . VAL C 3  243 ? 54.416  71.811  165.911 1.00 22.72 ? 243  VAL C CB  1 
ATOM   8552  C  CG1 . VAL C 3  243 ? 55.357  71.280  164.853 1.00 22.36 ? 243  VAL C CG1 1 
ATOM   8553  C  CG2 . VAL C 3  243 ? 53.755  73.117  165.468 1.00 19.30 ? 243  VAL C CG2 1 
ATOM   8554  N  N   . LEU C 3  244 ? 51.048  71.402  166.717 1.00 22.60 ? 244  LEU C N   1 
ATOM   8555  C  CA  . LEU C 3  244 ? 49.922  72.070  167.391 1.00 22.83 ? 244  LEU C CA  1 
ATOM   8556  C  C   . LEU C 3  244 ? 48.867  71.140  168.010 1.00 22.89 ? 244  LEU C C   1 
ATOM   8557  O  O   . LEU C 3  244 ? 48.085  71.584  168.873 1.00 22.87 ? 244  LEU C O   1 
ATOM   8558  C  CB  . LEU C 3  244 ? 49.287  73.182  166.524 1.00 22.68 ? 244  LEU C CB  1 
ATOM   8559  C  CG  . LEU C 3  244 ? 50.140  74.294  165.873 1.00 25.06 ? 244  LEU C CG  1 
ATOM   8560  C  CD1 . LEU C 3  244 ? 49.337  74.993  164.789 1.00 25.93 ? 244  LEU C CD1 1 
ATOM   8561  C  CD2 . LEU C 3  244 ? 50.727  75.330  166.873 1.00 17.75 ? 244  LEU C CD2 1 
ATOM   8562  N  N   . PHE C 3  245 ? 48.970  69.839  167.707 1.00 23.03 ? 245  PHE C N   1 
ATOM   8563  C  CA  . PHE C 3  245 ? 48.048  68.824  168.229 1.00 23.18 ? 245  PHE C CA  1 
ATOM   8564  C  C   . PHE C 3  245 ? 48.654  67.580  168.870 1.00 23.77 ? 245  PHE C C   1 
ATOM   8565  O  O   . PHE C 3  245 ? 47.983  66.939  169.688 1.00 24.08 ? 245  PHE C O   1 
ATOM   8566  C  CB  . PHE C 3  245 ? 46.980  68.443  167.194 1.00 22.82 ? 245  PHE C CB  1 
ATOM   8567  C  CG  . PHE C 3  245 ? 46.014  69.554  166.863 1.00 14.81 ? 245  PHE C CG  1 
ATOM   8568  C  CD1 . PHE C 3  245 ? 45.151  70.105  167.861 1.00 15.68 ? 245  PHE C CD1 1 
ATOM   8569  C  CD2 . PHE C 3  245 ? 45.880  69.993  165.524 1.00 17.07 ? 245  PHE C CD2 1 
ATOM   8570  C  CE1 . PHE C 3  245 ? 44.195  71.120  167.531 1.00 15.36 ? 245  PHE C CE1 1 
ATOM   8571  C  CE2 . PHE C 3  245 ? 44.930  71.004  165.176 1.00 19.81 ? 245  PHE C CE2 1 
ATOM   8572  C  CZ  . PHE C 3  245 ? 44.051  71.528  166.179 1.00 15.80 ? 245  PHE C CZ  1 
ATOM   8573  N  N   . ALA C 3  246 ? 49.829  67.155  168.386 1.00 23.75 ? 246  ALA C N   1 
ATOM   8574  C  CA  . ALA C 3  246 ? 50.548  66.008  168.967 1.00 23.26 ? 246  ALA C CA  1 
ATOM   8575  C  C   . ALA C 3  246 ? 52.107  66.184  169.094 1.00 22.80 ? 246  ALA C C   1 
ATOM   8576  O  O   . ALA C 3  246 ? 52.860  65.427  168.454 1.00 22.57 ? 246  ALA C O   1 
ATOM   8577  C  CB  . ALA C 3  246 ? 50.137  64.684  168.235 1.00 23.30 ? 246  ALA C CB  1 
ATOM   8578  N  N   . PRO C 3  247 ? 52.590  67.207  169.854 1.00 22.95 ? 247  PRO C N   1 
ATOM   8579  C  CA  . PRO C 3  247 ? 54.026  67.566  169.857 1.00 23.87 ? 247  PRO C CA  1 
ATOM   8580  C  C   . PRO C 3  247 ? 54.973  66.519  170.457 1.00 25.24 ? 247  PRO C C   1 
ATOM   8581  O  O   . PRO C 3  247 ? 56.129  66.464  170.018 1.00 24.77 ? 247  PRO C O   1 
ATOM   8582  C  CB  . PRO C 3  247 ? 54.072  68.838  170.700 1.00 23.92 ? 247  PRO C CB  1 
ATOM   8583  C  CG  . PRO C 3  247 ? 52.661  69.219  170.927 1.00 21.94 ? 247  PRO C CG  1 
ATOM   8584  C  CD  . PRO C 3  247 ? 51.874  67.992  170.877 1.00 22.75 ? 247  PRO C CD  1 
ATOM   8585  N  N   . ASP C 3  248 ? 54.426  65.605  171.274 1.00 27.18 ? 248  ASP C N   1 
ATOM   8586  C  CA  . ASP C 3  248 ? 55.176  64.536  171.965 1.00 28.70 ? 248  ASP C CA  1 
ATOM   8587  C  C   . ASP C 3  248 ? 54.976  63.111  171.377 1.00 29.41 ? 248  ASP C C   1 
ATOM   8588  O  O   . ASP C 3  248 ? 55.538  62.127  171.918 1.00 30.26 ? 248  ASP C O   1 
ATOM   8589  C  CB  . ASP C 3  248 ? 54.864  64.543  173.484 1.00 28.86 ? 248  ASP C CB  1 
ATOM   8590  C  CG  . ASP C 3  248 ? 55.015  65.919  174.117 1.00 37.66 ? 248  ASP C CG  1 
ATOM   8591  O  OD1 . ASP C 3  248 ? 53.989  66.452  174.596 1.00 39.62 ? 248  ASP C OD1 1 
ATOM   8592  O  OD2 . ASP C 3  248 ? 56.096  66.553  174.144 1.00 39.64 ? 248  ASP C OD2 1 
ATOM   8593  N  N   . LEU C 3  249 ? 54.228  63.018  170.263 1.00 29.09 ? 249  LEU C N   1 
ATOM   8594  C  CA  . LEU C 3  249 ? 53.753  61.736  169.682 1.00 28.73 ? 249  LEU C CA  1 
ATOM   8595  C  C   . LEU C 3  249 ? 54.902  60.835  169.209 1.00 28.28 ? 249  LEU C C   1 
ATOM   8596  O  O   . LEU C 3  249 ? 54.859  59.610  169.411 1.00 28.42 ? 249  LEU C O   1 
ATOM   8597  C  CB  . LEU C 3  249 ? 52.757  61.997  168.537 1.00 28.78 ? 249  LEU C CB  1 
ATOM   8598  C  CG  . LEU C 3  249 ? 51.995  60.822  167.901 1.00 33.48 ? 249  LEU C CG  1 
ATOM   8599  C  CD1 . LEU C 3  249 ? 50.546  60.748  168.385 1.00 33.06 ? 249  LEU C CD1 1 
ATOM   8600  C  CD2 . LEU C 3  249 ? 52.073  60.914  166.388 1.00 33.27 ? 249  LEU C CD2 1 
ATOM   8601  N  N   . LEU C 3  250 ? 55.927  61.473  168.639 1.00 27.77 ? 250  LEU C N   1 
ATOM   8602  C  CA  . LEU C 3  250 ? 57.112  60.822  168.076 1.00 27.75 ? 250  LEU C CA  1 
ATOM   8603  C  C   . LEU C 3  250 ? 58.326  60.885  169.011 1.00 27.89 ? 250  LEU C C   1 
ATOM   8604  O  O   . LEU C 3  250 ? 59.278  60.105  168.838 1.00 28.74 ? 250  LEU C O   1 
ATOM   8605  C  CB  . LEU C 3  250 ? 57.443  61.397  166.673 1.00 27.70 ? 250  LEU C CB  1 
ATOM   8606  C  CG  . LEU C 3  250 ? 56.374  61.343  165.548 1.00 32.25 ? 250  LEU C CG  1 
ATOM   8607  C  CD1 . LEU C 3  250 ? 56.648  62.358  164.464 1.00 26.62 ? 250  LEU C CD1 1 
ATOM   8608  C  CD2 . LEU C 3  250 ? 56.146  59.929  164.930 1.00 33.06 ? 250  LEU C CD2 1 
ATOM   8609  N  N   . GLY C 3  251 ? 58.257  61.780  170.016 1.00 26.78 ? 251  GLY C N   1 
ATOM   8610  C  CA  . GLY C 3  251 ? 59.209  61.865  171.114 1.00 25.77 ? 251  GLY C CA  1 
ATOM   8611  C  C   . GLY C 3  251 ? 59.109  60.752  172.140 1.00 25.31 ? 251  GLY C C   1 
ATOM   8612  O  O   . GLY C 3  251 ? 58.010  60.205  172.393 1.00 25.81 ? 251  GLY C O   1 
ATOM   8613  N  N   . ASP C 3  252 ? 60.280  60.333  172.626 1.00 24.35 ? 252  ASP C N   1 
ATOM   8614  C  CA  . ASP C 3  252 ? 60.398  59.457  173.786 1.00 23.34 ? 252  ASP C CA  1 
ATOM   8615  C  C   . ASP C 3  252 ? 60.285  60.261  175.096 1.00 22.36 ? 252  ASP C C   1 
ATOM   8616  O  O   . ASP C 3  252 ? 60.960  61.315  175.216 1.00 22.89 ? 252  ASP C O   1 
ATOM   8617  C  CB  . ASP C 3  252 ? 61.686  58.630  173.743 1.00 23.54 ? 252  ASP C CB  1 
ATOM   8618  C  CG  . ASP C 3  252 ? 61.567  57.316  174.519 1.00 36.65 ? 252  ASP C CG  1 
ATOM   8619  O  OD1 . ASP C 3  252 ? 60.973  56.340  173.994 1.00 44.51 ? 252  ASP C OD1 1 
ATOM   8620  O  OD2 . ASP C 3  252 ? 61.996  57.180  175.682 1.00 36.69 ? 252  ASP C OD2 1 
ATOM   8621  N  N   . PRO C 3  253 ? 59.401  59.823  176.032 1.00 20.70 ? 253  PRO C N   1 
ATOM   8622  C  CA  . PRO C 3  253 ? 59.219  60.503  177.338 1.00 19.42 ? 253  PRO C CA  1 
ATOM   8623  C  C   . PRO C 3  253 ? 60.460  60.553  178.240 1.00 18.05 ? 253  PRO C C   1 
ATOM   8624  O  O   . PRO C 3  253 ? 60.594  61.534  178.966 1.00 16.87 ? 253  PRO C O   1 
ATOM   8625  C  CB  . PRO C 3  253 ? 58.112  59.682  178.020 1.00 19.50 ? 253  PRO C CB  1 
ATOM   8626  C  CG  . PRO C 3  253 ? 57.403  58.981  176.905 1.00 23.57 ? 253  PRO C CG  1 
ATOM   8627  C  CD  . PRO C 3  253 ? 58.467  58.673  175.906 1.00 20.55 ? 253  PRO C CD  1 
ATOM   8628  N  N   . ASP C 3  254 ? 61.368  59.574  178.111 1.00 18.06 ? 254  ASP C N   1 
ATOM   8629  C  CA  . ASP C 3  254 ? 62.659  59.540  178.821 1.00 18.48 ? 254  ASP C CA  1 
ATOM   8630  C  C   . ASP C 3  254 ? 63.611  60.705  178.514 1.00 19.30 ? 254  ASP C C   1 
ATOM   8631  O  O   . ASP C 3  254 ? 64.398  61.104  179.385 1.00 19.63 ? 254  ASP C O   1 
ATOM   8632  C  CB  . ASP C 3  254 ? 63.367  58.204  178.600 1.00 18.47 ? 254  ASP C CB  1 
ATOM   8633  C  CG  . ASP C 3  254 ? 63.177  57.245  179.757 1.00 23.98 ? 254  ASP C CG  1 
ATOM   8634  O  OD1 . ASP C 3  254 ? 62.323  56.340  179.648 1.00 21.69 ? 254  ASP C OD1 1 
ATOM   8635  O  OD2 . ASP C 3  254 ? 63.816  57.334  180.827 1.00 29.56 ? 254  ASP C OD2 1 
ATOM   8636  N  N   . ASN C 3  255 ? 63.461  61.311  177.329 1.00 19.79 ? 255  ASN C N   1 
ATOM   8637  C  CA  . ASN C 3  255 ? 64.145  62.566  176.989 1.00 20.20 ? 255  ASN C CA  1 
ATOM   8638  C  C   . ASN C 3  255 ? 63.700  63.830  177.731 1.00 20.38 ? 255  ASN C C   1 
ATOM   8639  O  O   . ASN C 3  255 ? 64.458  64.816  177.772 1.00 20.10 ? 255  ASN C O   1 
ATOM   8640  C  CB  . ASN C 3  255 ? 64.219  62.771  175.473 1.00 20.36 ? 255  ASN C CB  1 
ATOM   8641  C  CG  . ASN C 3  255 ? 65.647  62.866  174.970 1.00 30.17 ? 255  ASN C CG  1 
ATOM   8642  O  OD1 . ASN C 3  255 ? 66.541  62.184  175.473 1.00 25.94 ? 255  ASN C OD1 1 
ATOM   8643  N  ND2 . ASN C 3  255 ? 65.881  63.759  174.003 1.00 29.30 ? 255  ASN C ND2 1 
ATOM   8644  N  N   . TYR C 3  256 ? 62.514  63.764  178.365 1.00 20.81 ? 256  TYR C N   1 
ATOM   8645  C  CA  . TYR C 3  256 ? 62.048  64.744  179.375 1.00 21.04 ? 256  TYR C CA  1 
ATOM   8646  C  C   . TYR C 3  256 ? 62.637  64.599  180.798 1.00 20.94 ? 256  TYR C C   1 
ATOM   8647  O  O   . TYR C 3  256 ? 62.458  65.490  181.643 1.00 21.32 ? 256  TYR C O   1 
ATOM   8648  C  CB  . TYR C 3  256 ? 60.516  64.790  179.414 1.00 21.20 ? 256  TYR C CB  1 
ATOM   8649  C  CG  . TYR C 3  256 ? 59.901  65.628  178.324 1.00 23.86 ? 256  TYR C CG  1 
ATOM   8650  C  CD1 . TYR C 3  256 ? 59.462  65.037  177.109 1.00 20.24 ? 256  TYR C CD1 1 
ATOM   8651  C  CD2 . TYR C 3  256 ? 59.702  67.019  178.513 1.00 22.21 ? 256  TYR C CD2 1 
ATOM   8652  C  CE1 . TYR C 3  256 ? 58.818  65.823  176.096 1.00 20.15 ? 256  TYR C CE1 1 
ATOM   8653  C  CE2 . TYR C 3  256 ? 59.083  67.822  177.508 1.00 25.74 ? 256  TYR C CE2 1 
ATOM   8654  C  CZ  . TYR C 3  256 ? 58.663  67.221  176.303 1.00 24.71 ? 256  TYR C CZ  1 
ATOM   8655  O  OH  . TYR C 3  256 ? 58.090  68.008  175.335 1.00 30.28 ? 256  TYR C OH  1 
ATOM   8656  N  N   . THR C 3  257 ? 63.230  63.438  181.083 1.00 20.49 ? 257  THR C N   1 
ATOM   8657  C  CA  . THR C 3  257 ? 64.138  63.258  182.230 1.00 19.84 ? 257  THR C CA  1 
ATOM   8658  C  C   . THR C 3  257 ? 65.576  63.649  181.788 1.00 19.05 ? 257  THR C C   1 
ATOM   8659  O  O   . THR C 3  257 ? 66.040  63.124  180.759 1.00 19.00 ? 257  THR C O   1 
ATOM   8660  C  CB  . THR C 3  257 ? 64.075  61.790  182.751 1.00 19.78 ? 257  THR C CB  1 
ATOM   8661  O  OG1 . THR C 3  257 ? 62.706  61.393  182.904 1.00 26.33 ? 257  THR C OG1 1 
ATOM   8662  C  CG2 . THR C 3  257 ? 64.627  61.678  184.171 1.00 22.31 ? 257  THR C CG2 1 
ATOM   8663  N  N   . PRO C 3  258 ? 66.276  64.537  182.544 1.00 18.38 ? 258  PRO C N   1 
ATOM   8664  C  CA  . PRO C 3  258 ? 67.713  64.823  182.311 1.00 17.94 ? 258  PRO C CA  1 
ATOM   8665  C  C   . PRO C 3  258 ? 68.617  63.596  182.240 1.00 18.32 ? 258  PRO C C   1 
ATOM   8666  O  O   . PRO C 3  258 ? 68.306  62.578  182.888 1.00 18.78 ? 258  PRO C O   1 
ATOM   8667  C  CB  . PRO C 3  258 ? 68.098  65.666  183.529 1.00 17.63 ? 258  PRO C CB  1 
ATOM   8668  C  CG  . PRO C 3  258 ? 66.874  66.407  183.844 1.00 18.66 ? 258  PRO C CG  1 
ATOM   8669  C  CD  . PRO C 3  258 ? 65.737  65.442  183.589 1.00 18.25 ? 258  PRO C CD  1 
ATOM   8670  N  N   . ALA C 3  259 ? 69.614  63.654  181.346 1.00 18.40 ? 259  ALA C N   1 
ATOM   8671  C  CA  . ALA C 3  259 ? 70.670  62.629  181.198 1.00 18.90 ? 259  ALA C CA  1 
ATOM   8672  C  C   . ALA C 3  259 ? 71.268  62.150  182.523 1.00 19.44 ? 259  ALA C C   1 
ATOM   8673  O  O   . ALA C 3  259 ? 71.519  62.963  183.426 1.00 18.35 ? 259  ALA C O   1 
ATOM   8674  C  CB  . ALA C 3  259 ? 71.778  63.122  180.269 1.00 18.84 ? 259  ALA C CB  1 
ATOM   8675  N  N   . ASN C 3  260 ? 71.191  60.832  182.705 1.00 20.99 ? 260  ASN C N   1 
ATOM   8676  C  CA  . ASN C 3  260 ? 71.879  60.121  183.776 1.00 22.40 ? 260  ASN C CA  1 
ATOM   8677  C  C   . ASN C 3  260 ? 72.976  59.176  183.215 1.00 23.51 ? 260  ASN C C   1 
ATOM   8678  O  O   . ASN C 3  260 ? 72.632  58.169  182.564 1.00 23.65 ? 260  ASN C O   1 
ATOM   8679  C  CB  . ASN C 3  260 ? 70.869  59.365  184.649 1.00 22.31 ? 260  ASN C CB  1 
ATOM   8680  C  CG  . ASN C 3  260 ? 71.446  58.953  185.984 1.00 26.52 ? 260  ASN C CG  1 
ATOM   8681  O  OD1 . ASN C 3  260 ? 72.197  57.980  186.078 1.00 27.52 ? 260  ASN C OD1 1 
ATOM   8682  N  ND2 . ASN C 3  260 ? 71.051  59.656  187.037 1.00 31.29 ? 260  ASN C ND2 1 
ATOM   8683  N  N   . PRO C 3  261 ? 74.271  59.463  183.502 1.00 24.18 ? 261  PRO C N   1 
ATOM   8684  C  CA  . PRO C 3  261 ? 75.393  58.632  183.007 1.00 24.74 ? 261  PRO C CA  1 
ATOM   8685  C  C   . PRO C 3  261 ? 75.554  57.264  183.696 1.00 25.28 ? 261  PRO C C   1 
ATOM   8686  O  O   . PRO C 3  261 ? 76.284  56.411  183.152 1.00 24.90 ? 261  PRO C O   1 
ATOM   8687  C  CB  . PRO C 3  261 ? 76.623  59.507  183.280 1.00 24.98 ? 261  PRO C CB  1 
ATOM   8688  C  CG  . PRO C 3  261 ? 76.071  60.854  183.649 1.00 30.72 ? 261  PRO C CG  1 
ATOM   8689  C  CD  . PRO C 3  261 ? 74.783  60.573  184.334 1.00 24.19 ? 261  PRO C CD  1 
ATOM   8690  N  N   . LEU C 3  262 ? 74.858  57.069  184.832 1.00 26.06 ? 262  LEU C N   1 
ATOM   8691  C  CA  . LEU C 3  262 ? 74.998  55.907  185.725 1.00 26.65 ? 262  LEU C CA  1 
ATOM   8692  C  C   . LEU C 3  262 ? 73.913  54.846  185.507 1.00 27.12 ? 262  LEU C C   1 
ATOM   8693  O  O   . LEU C 3  262 ? 74.089  53.695  185.948 1.00 27.55 ? 262  LEU C O   1 
ATOM   8694  C  CB  . LEU C 3  262 ? 74.975  56.346  187.207 1.00 26.96 ? 262  LEU C CB  1 
ATOM   8695  C  CG  . LEU C 3  262 ? 75.994  57.310  187.826 1.00 32.15 ? 262  LEU C CG  1 
ATOM   8696  C  CD1 . LEU C 3  262 ? 75.321  58.093  188.952 1.00 33.30 ? 262  LEU C CD1 1 
ATOM   8697  C  CD2 . LEU C 3  262 ? 77.200  56.550  188.365 1.00 34.75 ? 262  LEU C CD2 1 
ATOM   8698  N  N   . ASN C 3  263 ? 72.742  55.282  185.002 1.00 27.12 ? 263  ASN C N   1 
ATOM   8699  C  CA  . ASN C 3  263 ? 71.566  54.417  184.770 1.00 26.97 ? 263  ASN C CA  1 
ATOM   8700  C  C   . ASN C 3  263 ? 70.911  54.578  183.387 1.00 26.82 ? 263  ASN C C   1 
ATOM   8701  O  O   . ASN C 3  263 ? 70.551  55.697  182.977 1.00 26.98 ? 263  ASN C O   1 
ATOM   8702  C  CB  . ASN C 3  263 ? 70.515  54.583  185.895 1.00 27.11 ? 263  ASN C CB  1 
ATOM   8703  C  CG  . ASN C 3  263 ? 71.044  54.177  187.296 1.00 30.56 ? 263  ASN C CG  1 
ATOM   8704  O  OD1 . ASN C 3  263 ? 70.996  54.977  188.234 1.00 30.49 ? 263  ASN C OD1 1 
ATOM   8705  N  ND2 . ASN C 3  263 ? 71.382  52.897  187.466 1.00 28.24 ? 263  ASN C ND2 1 
ATOM   8706  N  N   . THR C 3  264 ? 70.884  53.468  182.640 1.00 26.58 ? 264  THR C N   1 
ATOM   8707  C  CA  . THR C 3  264 ? 70.057  53.290  181.421 1.00 26.63 ? 264  THR C CA  1 
ATOM   8708  C  C   . THR C 3  264 ? 68.537  53.322  181.728 1.00 26.60 ? 264  THR C C   1 
ATOM   8709  O  O   . THR C 3  264 ? 68.143  52.974  182.846 1.00 27.28 ? 264  THR C O   1 
ATOM   8710  C  CB  . THR C 3  264 ? 70.391  51.950  180.713 1.00 26.92 ? 264  THR C CB  1 
ATOM   8711  O  OG1 . THR C 3  264 ? 70.342  50.868  181.657 1.00 43.44 ? 264  THR C OG1 1 
ATOM   8712  C  CG2 . THR C 3  264 ? 71.812  51.925  180.180 1.00 17.13 ? 264  THR C CG2 1 
ATOM   8713  N  N   . PRO C 3  265 ? 67.690  53.726  180.759 1.00 26.28 ? 265  PRO C N   1 
ATOM   8714  C  CA  . PRO C 3  265 ? 66.327  53.172  180.661 1.00 26.02 ? 265  PRO C CA  1 
ATOM   8715  C  C   . PRO C 3  265 ? 66.260  51.645  180.421 1.00 26.02 ? 265  PRO C C   1 
ATOM   8716  O  O   . PRO C 3  265 ? 67.168  51.141  179.739 1.00 25.41 ? 265  PRO C O   1 
ATOM   8717  C  CB  . PRO C 3  265 ? 65.721  53.948  179.504 1.00 25.72 ? 265  PRO C CB  1 
ATOM   8718  C  CG  . PRO C 3  265 ? 66.336  55.265  179.635 1.00 25.03 ? 265  PRO C CG  1 
ATOM   8719  C  CD  . PRO C 3  265 ? 67.783  54.989  179.991 1.00 26.32 ? 265  PRO C CD  1 
ATOM   8720  N  N   . PRO C 3  266 ? 65.319  50.925  181.088 1.00 26.67 ? 266  PRO C N   1 
ATOM   8721  C  CA  . PRO C 3  266 ? 65.004  49.513  180.761 1.00 26.92 ? 266  PRO C CA  1 
ATOM   8722  C  C   . PRO C 3  266 ? 64.736  49.184  179.280 1.00 27.04 ? 266  PRO C C   1 
ATOM   8723  O  O   . PRO C 3  266 ? 65.285  48.176  178.809 1.00 26.64 ? 266  PRO C O   1 
ATOM   8724  C  CB  . PRO C 3  266 ? 63.762  49.215  181.623 1.00 26.93 ? 266  PRO C CB  1 
ATOM   8725  C  CG  . PRO C 3  266 ? 63.370  50.535  182.233 1.00 27.31 ? 266  PRO C CG  1 
ATOM   8726  C  CD  . PRO C 3  266 ? 64.632  51.324  182.339 1.00 26.68 ? 266  PRO C CD  1 
ATOM   8727  N  N   . HIS C 3  267 ? 64.021  50.062  178.563 1.00 27.85 ? 267  HIS C N   1 
ATOM   8728  C  CA  . HIS C 3  267 ? 63.654  49.836  177.159 1.00 29.10 ? 267  HIS C CA  1 
ATOM   8729  C  C   . HIS C 3  267 ? 64.788  50.155  176.159 1.00 29.30 ? 267  HIS C C   1 
ATOM   8730  O  O   . HIS C 3  267 ? 65.468  49.216  175.714 1.00 30.13 ? 267  HIS C O   1 
ATOM   8731  C  CB  . HIS C 3  267 ? 62.319  50.508  176.800 1.00 29.83 ? 267  HIS C CB  1 
ATOM   8732  C  CG  . HIS C 3  267 ? 61.196  49.539  176.585 1.00 41.92 ? 267  HIS C CG  1 
ATOM   8733  N  ND1 . HIS C 3  267 ? 60.802  49.121  175.330 1.00 48.78 ? 267  HIS C ND1 1 
ATOM   8734  C  CD2 . HIS C 3  267 ? 60.377  48.911  177.465 1.00 46.48 ? 267  HIS C CD2 1 
ATOM   8735  C  CE1 . HIS C 3  267 ? 59.782  48.286  175.447 1.00 51.54 ? 267  HIS C CE1 1 
ATOM   8736  N  NE2 . HIS C 3  267 ? 59.508  48.138  176.731 1.00 48.68 ? 267  HIS C NE2 1 
ATOM   8737  N  N   . ILE C 3  268 ? 65.127  51.450  176.015 1.00 28.39 ? 268  ILE C N   1 
ATOM   8738  C  CA  . ILE C 3  268 ? 66.012  51.995  174.945 1.00 27.82 ? 268  ILE C CA  1 
ATOM   8739  C  C   . ILE C 3  268 ? 65.560  51.685  173.502 1.00 27.42 ? 268  ILE C C   1 
ATOM   8740  O  O   . ILE C 3  268 ? 65.603  50.525  173.055 1.00 27.51 ? 268  ILE C O   1 
ATOM   8741  C  CB  . ILE C 3  268 ? 67.581  51.800  175.277 1.00 27.43 ? 268  ILE C CB  1 
ATOM   8742  C  CG1 . ILE C 3  268 ? 68.091  52.999  176.065 1.00 24.83 ? 268  ILE C CG1 1 
ATOM   8743  C  CG2 . ILE C 3  268 ? 68.504  51.562  174.040 1.00 12.31 ? 268  ILE C CG2 1 
ATOM   8744  C  CD1 . ILE C 3  268 ? 68.957  52.629  177.258 1.00 37.84 ? 268  ILE C CD1 1 
ATOM   8745  N  N   . LYS C 3  269 ? 64.930  52.694  172.891 1.00 26.81 ? 269  LYS C N   1 
ATOM   8746  C  CA  . LYS C 3  269 ? 64.512  52.654  171.484 1.00 26.44 ? 269  LYS C CA  1 
ATOM   8747  C  C   . LYS C 3  269 ? 64.851  53.940  170.699 1.00 25.44 ? 269  LYS C C   1 
ATOM   8748  O  O   . LYS C 3  269 ? 64.650  55.044  171.233 1.00 25.44 ? 269  LYS C O   1 
ATOM   8749  C  CB  . LYS C 3  269 ? 63.026  52.233  171.321 1.00 27.04 ? 269  LYS C CB  1 
ATOM   8750  C  CG  . LYS C 3  269 ? 61.950  53.175  171.932 1.00 30.87 ? 269  LYS C CG  1 
ATOM   8751  C  CD  . LYS C 3  269 ? 60.961  53.649  170.865 1.00 26.73 ? 269  LYS C CD  1 
ATOM   8752  C  CE  . LYS C 3  269 ? 59.565  53.061  171.089 1.00 31.06 ? 269  LYS C CE  1 
ATOM   8753  N  NZ  . LYS C 3  269 ? 58.901  52.705  169.800 1.00 27.83 ? 269  LYS C NZ  1 
ATOM   8754  N  N   . PRO C 3  270 ? 65.331  53.807  169.440 1.00 24.60 ? 270  PRO C N   1 
ATOM   8755  C  CA  . PRO C 3  270 ? 65.383  54.950  168.501 1.00 23.08 ? 270  PRO C CA  1 
ATOM   8756  C  C   . PRO C 3  270 ? 64.039  55.643  168.219 1.00 21.20 ? 270  PRO C C   1 
ATOM   8757  O  O   . PRO C 3  270 ? 62.955  55.053  168.442 1.00 20.40 ? 270  PRO C O   1 
ATOM   8758  C  CB  . PRO C 3  270 ? 65.945  54.320  167.221 1.00 23.29 ? 270  PRO C CB  1 
ATOM   8759  C  CG  . PRO C 3  270 ? 66.817  53.244  167.718 1.00 28.38 ? 270  PRO C CG  1 
ATOM   8760  C  CD  . PRO C 3  270 ? 66.034  52.632  168.866 1.00 24.93 ? 270  PRO C CD  1 
ATOM   8761  N  N   . GLU C 3  271 ? 64.133  56.919  167.810 1.00 19.79 ? 271  GLU C N   1 
ATOM   8762  C  CA  . GLU C 3  271 ? 63.155  57.586  166.918 1.00 18.73 ? 271  GLU C CA  1 
ATOM   8763  C  C   . GLU C 3  271 ? 62.775  56.687  165.730 1.00 17.86 ? 271  GLU C C   1 
ATOM   8764  O  O   . GLU C 3  271 ? 63.655  56.012  165.168 1.00 17.30 ? 271  GLU C O   1 
ATOM   8765  C  CB  . GLU C 3  271 ? 63.732  58.917  166.376 1.00 19.01 ? 271  GLU C CB  1 
ATOM   8766  C  CG  . GLU C 3  271 ? 63.965  60.025  167.396 1.00 21.14 ? 271  GLU C CG  1 
ATOM   8767  C  CD  . GLU C 3  271 ? 62.683  60.599  167.978 1.00 28.35 ? 271  GLU C CD  1 
ATOM   8768  O  OE1 . GLU C 3  271 ? 62.415  60.353  169.175 1.00 33.79 ? 271  GLU C OE1 1 
ATOM   8769  O  OE2 . GLU C 3  271 ? 61.956  61.318  167.258 1.00 30.97 ? 271  GLU C OE2 1 
ATOM   8770  N  N   . TRP C 3  272 ? 61.513  56.803  165.284 1.00 17.99 ? 272  TRP C N   1 
ATOM   8771  C  CA  . TRP C 3  272 ? 60.856  55.865  164.341 1.00 18.82 ? 272  TRP C CA  1 
ATOM   8772  C  C   . TRP C 3  272 ? 61.655  55.513  163.064 1.00 19.53 ? 272  TRP C C   1 
ATOM   8773  O  O   . TRP C 3  272 ? 61.772  54.325  162.703 1.00 20.17 ? 272  TRP C O   1 
ATOM   8774  C  CB  . TRP C 3  272 ? 59.417  56.323  163.998 1.00 18.94 ? 272  TRP C CB  1 
ATOM   8775  C  CG  . TRP C 3  272 ? 59.365  57.590  163.181 1.00 21.91 ? 272  TRP C CG  1 
ATOM   8776  C  CD1 . TRP C 3  272 ? 59.448  58.868  163.656 1.00 24.79 ? 272  TRP C CD1 1 
ATOM   8777  C  CD2 . TRP C 3  272 ? 59.432  57.693  161.751 1.00 22.60 ? 272  TRP C CD2 1 
ATOM   8778  N  NE1 . TRP C 3  272 ? 59.547  59.764  162.618 1.00 24.71 ? 272  TRP C NE1 1 
ATOM   8779  C  CE2 . TRP C 3  272 ? 59.596  59.075  161.437 1.00 25.46 ? 272  TRP C CE2 1 
ATOM   8780  C  CE3 . TRP C 3  272 ? 59.441  56.751  160.690 1.00 19.91 ? 272  TRP C CE3 1 
ATOM   8781  C  CZ2 . TRP C 3  272 ? 59.668  59.555  160.099 1.00 22.79 ? 272  TRP C CZ2 1 
ATOM   8782  C  CZ3 . TRP C 3  272 ? 59.553  57.224  159.352 1.00 16.09 ? 272  TRP C CZ3 1 
ATOM   8783  C  CH2 . TRP C 3  272 ? 59.676  58.614  159.080 1.00 23.23 ? 272  TRP C CH2 1 
ATOM   8784  N  N   . TYR C 3  273 ? 62.349  56.528  162.528 1.00 19.03 ? 273  TYR C N   1 
ATOM   8785  C  CA  . TYR C 3  273 ? 63.070  56.461  161.256 1.00 19.06 ? 273  TYR C CA  1 
ATOM   8786  C  C   . TYR C 3  273 ? 64.391  55.679  161.310 1.00 19.27 ? 273  TYR C C   1 
ATOM   8787  O  O   . TYR C 3  273 ? 65.052  55.469  160.267 1.00 20.03 ? 273  TYR C O   1 
ATOM   8788  C  CB  . TYR C 3  273 ? 63.277  57.866  160.667 1.00 19.01 ? 273  TYR C CB  1 
ATOM   8789  C  CG  . TYR C 3  273 ? 63.952  58.872  161.590 1.00 18.03 ? 273  TYR C CG  1 
ATOM   8790  C  CD1 . TYR C 3  273 ? 63.187  59.838  162.289 1.00 13.48 ? 273  TYR C CD1 1 
ATOM   8791  C  CD2 . TYR C 3  273 ? 65.369  58.924  161.704 1.00 14.76 ? 273  TYR C CD2 1 
ATOM   8792  C  CE1 . TYR C 3  273 ? 63.814  60.792  163.146 1.00 8.50  ? 273  TYR C CE1 1 
ATOM   8793  C  CE2 . TYR C 3  273 ? 66.002  59.857  162.558 1.00 5.12  ? 273  TYR C CE2 1 
ATOM   8794  C  CZ  . TYR C 3  273 ? 65.220  60.787  163.262 1.00 7.54  ? 273  TYR C CZ  1 
ATOM   8795  O  OH  . TYR C 3  273 ? 65.841  61.697  164.061 1.00 10.90 ? 273  TYR C OH  1 
ATOM   8796  N  N   . PHE C 3  274 ? 64.788  55.281  162.516 1.00 18.30 ? 274  PHE C N   1 
ATOM   8797  C  CA  . PHE C 3  274 ? 65.977  54.468  162.697 1.00 18.15 ? 274  PHE C CA  1 
ATOM   8798  C  C   . PHE C 3  274 ? 65.719  53.017  163.136 1.00 17.80 ? 274  PHE C C   1 
ATOM   8799  O  O   . PHE C 3  274 ? 66.653  52.195  163.163 1.00 17.58 ? 274  PHE C O   1 
ATOM   8800  C  CB  . PHE C 3  274 ? 67.016  55.211  163.559 1.00 17.99 ? 274  PHE C CB  1 
ATOM   8801  C  CG  . PHE C 3  274 ? 68.405  54.651  163.460 1.00 18.91 ? 274  PHE C CG  1 
ATOM   8802  C  CD1 . PHE C 3  274 ? 69.002  54.051  164.600 1.00 18.87 ? 274  PHE C CD1 1 
ATOM   8803  C  CD2 . PHE C 3  274 ? 69.087  54.592  162.207 1.00 12.17 ? 274  PHE C CD2 1 
ATOM   8804  C  CE1 . PHE C 3  274 ? 70.267  53.387  164.504 1.00 14.19 ? 274  PHE C CE1 1 
ATOM   8805  C  CE2 . PHE C 3  274 ? 70.385  54.012  162.112 1.00 19.76 ? 274  PHE C CE2 1 
ATOM   8806  C  CZ  . PHE C 3  274 ? 70.972  53.392  163.272 1.00 16.64 ? 274  PHE C CZ  1 
ATOM   8807  N  N   . LEU C 3  275 ? 64.433  52.668  163.228 1.00 17.88 ? 275  LEU C N   1 
ATOM   8808  C  CA  . LEU C 3  275 ? 64.006  51.417  163.837 1.00 18.63 ? 275  LEU C CA  1 
ATOM   8809  C  C   . LEU C 3  275 ? 64.260  50.168  162.990 1.00 19.14 ? 275  LEU C C   1 
ATOM   8810  O  O   . LEU C 3  275 ? 64.626  49.125  163.560 1.00 20.09 ? 275  LEU C O   1 
ATOM   8811  C  CB  . LEU C 3  275 ? 62.562  51.489  164.378 1.00 18.90 ? 275  LEU C CB  1 
ATOM   8812  C  CG  . LEU C 3  275 ? 62.159  52.395  165.571 1.00 23.44 ? 275  LEU C CG  1 
ATOM   8813  C  CD1 . LEU C 3  275 ? 60.641  52.414  165.787 1.00 16.66 ? 275  LEU C CD1 1 
ATOM   8814  C  CD2 . LEU C 3  275 ? 62.844  52.036  166.885 1.00 19.88 ? 275  LEU C CD2 1 
ATOM   8815  N  N   . PHE C 3  276 ? 64.230  50.316  161.651 1.00 18.47 ? 276  PHE C N   1 
ATOM   8816  C  CA  . PHE C 3  276 ? 64.552  49.215  160.721 1.00 17.99 ? 276  PHE C CA  1 
ATOM   8817  C  C   . PHE C 3  276 ? 66.023  48.763  160.792 1.00 17.04 ? 276  PHE C C   1 
ATOM   8818  O  O   . PHE C 3  276 ? 66.314  47.534  160.813 1.00 16.46 ? 276  PHE C O   1 
ATOM   8819  C  CB  . PHE C 3  276 ? 64.082  49.500  159.270 1.00 18.14 ? 276  PHE C CB  1 
ATOM   8820  C  CG  . PHE C 3  276 ? 64.956  50.480  158.505 1.00 23.89 ? 276  PHE C CG  1 
ATOM   8821  C  CD1 . PHE C 3  276 ? 64.770  51.875  158.663 1.00 19.19 ? 276  PHE C CD1 1 
ATOM   8822  C  CD2 . PHE C 3  276 ? 66.008  50.011  157.659 1.00 21.59 ? 276  PHE C CD2 1 
ATOM   8823  C  CE1 . PHE C 3  276 ? 65.597  52.803  157.985 1.00 19.27 ? 276  PHE C CE1 1 
ATOM   8824  C  CE2 . PHE C 3  276 ? 66.883  50.926  156.996 1.00 13.17 ? 276  PHE C CE2 1 
ATOM   8825  C  CZ  . PHE C 3  276 ? 66.641  52.328  157.123 1.00 25.51 ? 276  PHE C CZ  1 
ATOM   8826  N  N   . ALA C 3  277 ? 66.915  49.763  160.888 1.00 16.00 ? 277  ALA C N   1 
ATOM   8827  C  CA  . ALA C 3  277 ? 68.360  49.570  160.928 1.00 15.66 ? 277  ALA C CA  1 
ATOM   8828  C  C   . ALA C 3  277 ? 68.779  48.993  162.276 1.00 15.73 ? 277  ALA C C   1 
ATOM   8829  O  O   . ALA C 3  277 ? 69.585  48.046  162.317 1.00 15.36 ? 277  ALA C O   1 
ATOM   8830  C  CB  . ALA C 3  277 ? 69.095  50.905  160.642 1.00 15.66 ? 277  ALA C CB  1 
ATOM   8831  N  N   . TYR C 3  278 ? 68.159  49.522  163.353 1.00 16.55 ? 278  TYR C N   1 
ATOM   8832  C  CA  . TYR C 3  278 ? 68.266  49.004  164.727 1.00 17.58 ? 278  TYR C CA  1 
ATOM   8833  C  C   . TYR C 3  278 ? 67.850  47.553  164.881 1.00 18.52 ? 278  TYR C C   1 
ATOM   8834  O  O   . TYR C 3  278 ? 68.604  46.776  165.482 1.00 19.55 ? 278  TYR C O   1 
ATOM   8835  C  CB  . TYR C 3  278 ? 67.509  49.896  165.723 1.00 17.73 ? 278  TYR C CB  1 
ATOM   8836  C  CG  . TYR C 3  278 ? 67.932  49.723  167.180 1.00 25.71 ? 278  TYR C CG  1 
ATOM   8837  C  CD1 . TYR C 3  278 ? 69.183  50.231  167.655 1.00 22.76 ? 278  TYR C CD1 1 
ATOM   8838  C  CD2 . TYR C 3  278 ? 67.042  49.137  168.123 1.00 24.03 ? 278  TYR C CD2 1 
ATOM   8839  C  CE1 . TYR C 3  278 ? 69.567  50.069  169.033 1.00 31.12 ? 278  TYR C CE1 1 
ATOM   8840  C  CE2 . TYR C 3  278 ? 67.399  49.011  169.499 1.00 20.79 ? 278  TYR C CE2 1 
ATOM   8841  C  CZ  . TYR C 3  278 ? 68.658  49.465  169.939 1.00 25.25 ? 278  TYR C CZ  1 
ATOM   8842  O  OH  . TYR C 3  278 ? 68.987  49.343  171.265 1.00 30.69 ? 278  TYR C OH  1 
ATOM   8843  N  N   . ALA C 3  279 ? 66.718  47.177  164.251 1.00 18.40 ? 279  ALA C N   1 
ATOM   8844  C  CA  . ALA C 3  279 ? 66.295  45.775  164.109 1.00 18.54 ? 279  ALA C CA  1 
ATOM   8845  C  C   . ALA C 3  279 ? 67.294  44.892  163.373 1.00 18.93 ? 279  ALA C C   1 
ATOM   8846  O  O   . ALA C 3  279 ? 67.545  43.779  163.818 1.00 18.88 ? 279  ALA C O   1 
ATOM   8847  C  CB  . ALA C 3  279 ? 64.931  45.671  163.477 1.00 18.47 ? 279  ALA C CB  1 
ATOM   8848  N  N   . ILE C 3  280 ? 67.952  45.446  162.342 1.00 19.61 ? 280  ILE C N   1 
ATOM   8849  C  CA  . ILE C 3  280 ? 68.937  44.699  161.549 1.00 20.25 ? 280  ILE C CA  1 
ATOM   8850  C  C   . ILE C 3  280 ? 70.241  44.417  162.336 1.00 21.07 ? 280  ILE C C   1 
ATOM   8851  O  O   . ILE C 3  280 ? 70.675  43.253  162.396 1.00 21.45 ? 280  ILE C O   1 
ATOM   8852  C  CB  . ILE C 3  280 ? 69.124  45.297  160.096 1.00 20.13 ? 280  ILE C CB  1 
ATOM   8853  C  CG1 . ILE C 3  280 ? 67.902  44.923  159.226 1.00 21.92 ? 280  ILE C CG1 1 
ATOM   8854  C  CG2 . ILE C 3  280 ? 70.461  44.807  159.420 1.00 18.33 ? 280  ILE C CG2 1 
ATOM   8855  C  CD1 . ILE C 3  280 ? 67.690  45.777  157.932 1.00 17.09 ? 280  ILE C CD1 1 
ATOM   8856  N  N   . LEU C 3  281 ? 70.735  45.437  163.054 1.00 21.44 ? 281  LEU C N   1 
ATOM   8857  C  CA  . LEU C 3  281 ? 71.891  45.324  163.962 1.00 21.71 ? 281  LEU C CA  1 
ATOM   8858  C  C   . LEU C 3  281 ? 71.746  44.221  165.039 1.00 21.80 ? 281  LEU C C   1 
ATOM   8859  O  O   . LEU C 3  281 ? 72.539  43.265  165.048 1.00 22.14 ? 281  LEU C O   1 
ATOM   8860  C  CB  . LEU C 3  281 ? 72.251  46.697  164.566 1.00 21.72 ? 281  LEU C CB  1 
ATOM   8861  C  CG  . LEU C 3  281 ? 73.026  46.838  165.883 1.00 22.49 ? 281  LEU C CG  1 
ATOM   8862  C  CD1 . LEU C 3  281 ? 74.495  47.018  165.621 1.00 20.47 ? 281  LEU C CD1 1 
ATOM   8863  C  CD2 . LEU C 3  281 ? 72.470  47.974  166.722 1.00 29.79 ? 281  LEU C CD2 1 
ATOM   8864  N  N   . ARG C 3  282 ? 70.650  44.267  165.803 1.00 21.55 ? 282  ARG C N   1 
ATOM   8865  C  CA  . ARG C 3  282 ? 70.459  43.336  166.922 1.00 21.97 ? 282  ARG C CA  1 
ATOM   8866  C  C   . ARG C 3  282 ? 69.938  41.919  166.557 1.00 21.60 ? 282  ARG C C   1 
ATOM   8867  O  O   . ARG C 3  282 ? 69.980  41.005  167.399 1.00 21.47 ? 282  ARG C O   1 
ATOM   8868  C  CB  . ARG C 3  282 ? 69.749  43.993  168.122 1.00 22.55 ? 282  ARG C CB  1 
ATOM   8869  C  CG  . ARG C 3  282 ? 68.310  44.393  167.896 1.00 27.86 ? 282  ARG C CG  1 
ATOM   8870  C  CD  . ARG C 3  282 ? 67.769  45.343  168.933 1.00 24.78 ? 282  ARG C CD  1 
ATOM   8871  N  NE  . ARG C 3  282 ? 66.324  45.483  168.743 1.00 28.13 ? 282  ARG C NE  1 
ATOM   8872  C  CZ  . ARG C 3  282 ? 65.448  45.984  169.614 1.00 26.20 ? 282  ARG C CZ  1 
ATOM   8873  N  NH1 . ARG C 3  282 ? 65.803  46.401  170.832 1.00 23.41 ? 282  ARG C NH1 1 
ATOM   8874  N  NH2 . ARG C 3  282 ? 64.184  46.072  169.242 1.00 30.79 ? 282  ARG C NH2 1 
ATOM   8875  N  N   . SER C 3  283 ? 69.646  41.726  165.259 1.00 21.37 ? 283  SER C N   1 
ATOM   8876  C  CA  . SER C 3  283 ? 69.409  40.416  164.629 1.00 21.43 ? 283  SER C CA  1 
ATOM   8877  C  C   . SER C 3  283 ? 70.606  39.463  164.619 1.00 21.17 ? 283  SER C C   1 
ATOM   8878  O  O   . SER C 3  283 ? 70.419  38.240  164.492 1.00 21.37 ? 283  SER C O   1 
ATOM   8879  C  CB  . SER C 3  283 ? 68.895  40.602  163.205 1.00 21.79 ? 283  SER C CB  1 
ATOM   8880  O  OG  . SER C 3  283 ? 67.623  41.216  163.216 1.00 33.86 ? 283  SER C OG  1 
ATOM   8881  N  N   . ILE C 3  284 ? 71.816  40.025  164.697 1.00 20.78 ? 284  ILE C N   1 
ATOM   8882  C  CA  . ILE C 3  284 ? 73.069  39.264  164.624 1.00 20.63 ? 284  ILE C CA  1 
ATOM   8883  C  C   . ILE C 3  284 ? 73.624  39.063  166.062 1.00 20.50 ? 284  ILE C C   1 
ATOM   8884  O  O   . ILE C 3  284 ? 73.894  40.061  166.744 1.00 20.45 ? 284  ILE C O   1 
ATOM   8885  C  CB  . ILE C 3  284 ? 74.141  39.947  163.634 1.00 20.39 ? 284  ILE C CB  1 
ATOM   8886  C  CG1 . ILE C 3  284 ? 73.524  40.493  162.305 1.00 21.49 ? 284  ILE C CG1 1 
ATOM   8887  C  CG2 . ILE C 3  284 ? 75.405  39.061  163.426 1.00 21.91 ? 284  ILE C CG2 1 
ATOM   8888  C  CD1 . ILE C 3  284 ? 72.892  39.448  161.278 1.00 22.21 ? 284  ILE C CD1 1 
ATOM   8889  N  N   . PRO C 3  285 ? 73.831  37.796  166.506 1.00 20.37 ? 285  PRO C N   1 
ATOM   8890  C  CA  . PRO C 3  285 ? 74.399  37.522  167.847 1.00 19.70 ? 285  PRO C CA  1 
ATOM   8891  C  C   . PRO C 3  285 ? 75.919  37.835  168.016 1.00 19.04 ? 285  PRO C C   1 
ATOM   8892  O  O   . PRO C 3  285 ? 76.509  37.447  169.039 1.00 19.04 ? 285  PRO C O   1 
ATOM   8893  C  CB  . PRO C 3  285 ? 74.086  36.022  168.055 1.00 19.50 ? 285  PRO C CB  1 
ATOM   8894  C  CG  . PRO C 3  285 ? 74.054  35.456  166.701 1.00 14.68 ? 285  PRO C CG  1 
ATOM   8895  C  CD  . PRO C 3  285 ? 73.445  36.526  165.836 1.00 20.39 ? 285  PRO C CD  1 
ATOM   8896  N  N   . ASN C 3  286 ? 76.472  38.640  167.105 1.00 18.59 ? 286  ASN C N   1 
ATOM   8897  C  CA  . ASN C 3  286 ? 77.877  39.067  167.097 1.00 18.31 ? 286  ASN C CA  1 
ATOM   8898  C  C   . ASN C 3  286 ? 77.985  40.598  167.041 1.00 18.15 ? 286  ASN C C   1 
ATOM   8899  O  O   . ASN C 3  286 ? 77.114  41.276  166.445 1.00 18.01 ? 286  ASN C O   1 
ATOM   8900  C  CB  . ASN C 3  286 ? 78.608  38.431  165.904 1.00 18.26 ? 286  ASN C CB  1 
ATOM   8901  C  CG  . ASN C 3  286 ? 80.114  38.413  166.080 1.00 20.77 ? 286  ASN C CG  1 
ATOM   8902  O  OD1 . ASN C 3  286 ? 80.803  39.349  165.678 1.00 25.33 ? 286  ASN C OD1 1 
ATOM   8903  N  ND2 . ASN C 3  286 ? 80.635  37.345  166.677 1.00 8.66  ? 286  ASN C ND2 1 
ATOM   8904  N  N   . LYS C 3  287 ? 79.039  41.123  167.684 1.00 17.91 ? 287  LYS C N   1 
ATOM   8905  C  CA  . LYS C 3  287 ? 79.312  42.564  167.794 1.00 17.65 ? 287  LYS C CA  1 
ATOM   8906  C  C   . LYS C 3  287 ? 79.570  43.204  166.423 1.00 17.52 ? 287  LYS C C   1 
ATOM   8907  O  O   . LYS C 3  287 ? 78.690  43.919  165.916 1.00 16.79 ? 287  LYS C O   1 
ATOM   8908  C  CB  . LYS C 3  287 ? 80.473  42.828  168.769 1.00 17.66 ? 287  LYS C CB  1 
ATOM   8909  C  CG  . LYS C 3  287 ? 80.290  44.069  169.636 1.00 20.70 ? 287  LYS C CG  1 
ATOM   8910  C  CD  . LYS C 3  287 ? 81.206  45.207  169.217 1.00 17.92 ? 287  LYS C CD  1 
ATOM   8911  C  CE  . LYS C 3  287 ? 82.337  45.439  170.216 1.00 18.30 ? 287  LYS C CE  1 
ATOM   8912  N  NZ  . LYS C 3  287 ? 82.199  46.721  170.976 1.00 12.87 ? 287  LYS C NZ  1 
ATOM   8913  N  N   . LEU C 3  288 ? 80.633  42.724  165.750 1.00 17.87 ? 288  LEU C N   1 
ATOM   8914  C  CA  . LEU C 3  288 ? 81.054  43.173  164.419 1.00 18.14 ? 288  LEU C CA  1 
ATOM   8915  C  C   . LEU C 3  288 ? 80.047  42.836  163.330 1.00 18.29 ? 288  LEU C C   1 
ATOM   8916  O  O   . LEU C 3  288 ? 79.777  43.679  162.484 1.00 18.19 ? 288  LEU C O   1 
ATOM   8917  C  CB  . LEU C 3  288 ? 82.467  42.643  164.061 1.00 18.45 ? 288  LEU C CB  1 
ATOM   8918  C  CG  . LEU C 3  288 ? 83.136  42.926  162.687 1.00 19.89 ? 288  LEU C CG  1 
ATOM   8919  C  CD1 . LEU C 3  288 ? 83.468  44.404  162.456 1.00 15.28 ? 288  LEU C CD1 1 
ATOM   8920  C  CD2 . LEU C 3  288 ? 84.375  42.050  162.476 1.00 23.10 ? 288  LEU C CD2 1 
ATOM   8921  N  N   . GLY C 3  289 ? 79.508  41.605  163.367 1.00 18.49 ? 289  GLY C N   1 
ATOM   8922  C  CA  . GLY C 3  289 ? 78.456  41.147  162.466 1.00 18.48 ? 289  GLY C CA  1 
ATOM   8923  C  C   . GLY C 3  289 ? 77.239  42.060  162.392 1.00 18.60 ? 289  GLY C C   1 
ATOM   8924  O  O   . GLY C 3  289 ? 76.832  42.431  161.286 1.00 18.94 ? 289  GLY C O   1 
ATOM   8925  N  N   . GLY C 3  290 ? 76.786  42.534  163.561 1.00 18.33 ? 290  GLY C N   1 
ATOM   8926  C  CA  . GLY C 3  290 ? 75.616  43.391  163.707 1.00 18.49 ? 290  GLY C CA  1 
ATOM   8927  C  C   . GLY C 3  290 ? 75.756  44.772  163.103 1.00 19.01 ? 290  GLY C C   1 
ATOM   8928  O  O   . GLY C 3  290 ? 74.843  45.238  162.408 1.00 19.20 ? 290  GLY C O   1 
ATOM   8929  N  N   . VAL C 3  291 ? 76.859  45.446  163.438 1.00 19.26 ? 291  VAL C N   1 
ATOM   8930  C  CA  . VAL C 3  291 ? 77.196  46.765  162.890 1.00 19.76 ? 291  VAL C CA  1 
ATOM   8931  C  C   . VAL C 3  291 ? 77.443  46.754  161.357 1.00 19.98 ? 291  VAL C C   1 
ATOM   8932  O  O   . VAL C 3  291 ? 76.981  47.675  160.646 1.00 20.29 ? 291  VAL C O   1 
ATOM   8933  C  CB  . VAL C 3  291 ? 78.320  47.494  163.727 1.00 20.04 ? 291  VAL C CB  1 
ATOM   8934  C  CG1 . VAL C 3  291 ? 79.654  46.782  163.643 1.00 23.18 ? 291  VAL C CG1 1 
ATOM   8935  C  CG2 . VAL C 3  291 ? 78.472  48.976  163.320 1.00 17.50 ? 291  VAL C CG2 1 
ATOM   8936  N  N   . LEU C 3  292 ? 78.097  45.680  160.880 1.00 19.52 ? 292  LEU C N   1 
ATOM   8937  C  CA  . LEU C 3  292 ? 78.362  45.434  159.466 1.00 19.37 ? 292  LEU C CA  1 
ATOM   8938  C  C   . LEU C 3  292 ? 77.072  45.250  158.680 1.00 19.39 ? 292  LEU C C   1 
ATOM   8939  O  O   . LEU C 3  292 ? 76.849  45.992  157.717 1.00 19.33 ? 292  LEU C O   1 
ATOM   8940  C  CB  . LEU C 3  292 ? 79.338  44.257  159.280 1.00 19.65 ? 292  LEU C CB  1 
ATOM   8941  C  CG  . LEU C 3  292 ? 80.772  44.349  158.701 1.00 26.09 ? 292  LEU C CG  1 
ATOM   8942  C  CD1 . LEU C 3  292 ? 81.614  45.586  159.063 1.00 28.67 ? 292  LEU C CD1 1 
ATOM   8943  C  CD2 . LEU C 3  292 ? 81.546  43.071  159.036 1.00 32.79 ? 292  LEU C CD2 1 
ATOM   8944  N  N   . ALA C 3  293 ? 76.146  44.463  159.253 1.00 19.62 ? 293  ALA C N   1 
ATOM   8945  C  CA  . ALA C 3  293 ? 74.741  44.371  158.813 1.00 19.96 ? 293  ALA C CA  1 
ATOM   8946  C  C   . ALA C 3  293 ? 73.962  45.707  158.793 1.00 20.60 ? 293  ALA C C   1 
ATOM   8947  O  O   . ALA C 3  293 ? 73.254  45.980  157.817 1.00 21.28 ? 293  ALA C O   1 
ATOM   8948  C  CB  . ALA C 3  293 ? 73.989  43.308  159.612 1.00 19.77 ? 293  ALA C CB  1 
ATOM   8949  N  N   . LEU C 3  294 ? 74.166  46.546  159.819 1.00 20.71 ? 294  LEU C N   1 
ATOM   8950  C  CA  . LEU C 3  294 ? 73.537  47.873  159.937 1.00 21.02 ? 294  LEU C CA  1 
ATOM   8951  C  C   . LEU C 3  294 ? 74.037  48.837  158.851 1.00 21.05 ? 294  LEU C C   1 
ATOM   8952  O  O   . LEU C 3  294 ? 73.213  49.503  158.204 1.00 21.40 ? 294  LEU C O   1 
ATOM   8953  C  CB  . LEU C 3  294 ? 73.740  48.460  161.343 1.00 21.27 ? 294  LEU C CB  1 
ATOM   8954  C  CG  . LEU C 3  294 ? 73.353  49.924  161.623 1.00 26.79 ? 294  LEU C CG  1 
ATOM   8955  C  CD1 . LEU C 3  294 ? 72.352  50.034  162.748 1.00 31.53 ? 294  LEU C CD1 1 
ATOM   8956  C  CD2 . LEU C 3  294 ? 74.581  50.721  161.925 1.00 22.06 ? 294  LEU C CD2 1 
ATOM   8957  N  N   . ALA C 3  295 ? 75.373  48.966  158.747 1.00 20.68 ? 295  ALA C N   1 
ATOM   8958  C  CA  . ALA C 3  295 ? 76.066  49.719  157.687 1.00 20.07 ? 295  ALA C CA  1 
ATOM   8959  C  C   . ALA C 3  295 ? 75.629  49.290  156.275 1.00 20.24 ? 295  ALA C C   1 
ATOM   8960  O  O   . ALA C 3  295 ? 75.052  50.124  155.551 1.00 19.73 ? 295  ALA C O   1 
ATOM   8961  C  CB  . ALA C 3  295 ? 77.586  49.616  157.851 1.00 19.76 ? 295  ALA C CB  1 
ATOM   8962  N  N   . PHE C 3  296 ? 75.598  47.958  156.053 1.00 20.55 ? 296  PHE C N   1 
ATOM   8963  C  CA  . PHE C 3  296 ? 75.203  47.361  154.773 1.00 20.98 ? 296  PHE C CA  1 
ATOM   8964  C  C   . PHE C 3  296 ? 73.724  47.546  154.421 1.00 20.85 ? 296  PHE C C   1 
ATOM   8965  O  O   . PHE C 3  296 ? 73.404  47.633  153.245 1.00 21.29 ? 296  PHE C O   1 
ATOM   8966  C  CB  . PHE C 3  296 ? 75.645  45.882  154.659 1.00 21.56 ? 296  PHE C CB  1 
ATOM   8967  C  CG  . PHE C 3  296 ? 75.659  45.329  153.229 1.00 29.39 ? 296  PHE C CG  1 
ATOM   8968  C  CD1 . PHE C 3  296 ? 74.947  44.139  152.926 1.00 32.94 ? 296  PHE C CD1 1 
ATOM   8969  C  CD2 . PHE C 3  296 ? 76.503  45.899  152.219 1.00 32.54 ? 296  PHE C CD2 1 
ATOM   8970  C  CE1 . PHE C 3  296 ? 74.983  43.558  151.599 1.00 33.30 ? 296  PHE C CE1 1 
ATOM   8971  C  CE2 . PHE C 3  296 ? 76.541  45.351  150.882 1.00 30.40 ? 296  PHE C CE2 1 
ATOM   8972  C  CZ  . PHE C 3  296 ? 75.773  44.179  150.574 1.00 33.36 ? 296  PHE C CZ  1 
ATOM   8973  N  N   . SER C 3  297 ? 72.875  47.760  155.437 1.00 20.23 ? 297  SER C N   1 
ATOM   8974  C  CA  . SER C 3  297 ? 71.434  47.998  155.250 1.00 19.57 ? 297  SER C CA  1 
ATOM   8975  C  C   . SER C 3  297 ? 71.109  49.369  154.613 1.00 19.01 ? 297  SER C C   1 
ATOM   8976  O  O   . SER C 3  297 ? 70.026  49.540  154.042 1.00 17.93 ? 297  SER C O   1 
ATOM   8977  C  CB  . SER C 3  297 ? 70.653  47.752  156.553 1.00 19.00 ? 297  SER C CB  1 
ATOM   8978  O  OG  . SER C 3  297 ? 70.354  48.953  157.254 1.00 25.78 ? 297  SER C OG  1 
ATOM   8979  N  N   . ILE C 3  298 ? 71.984  50.356  154.856 1.00 19.39 ? 298  ILE C N   1 
ATOM   8980  C  CA  . ILE C 3  298 ? 71.889  51.686  154.227 1.00 20.23 ? 298  ILE C CA  1 
ATOM   8981  C  C   . ILE C 3  298 ? 72.718  51.738  152.933 1.00 20.60 ? 298  ILE C C   1 
ATOM   8982  O  O   . ILE C 3  298 ? 72.217  52.178  151.893 1.00 21.15 ? 298  ILE C O   1 
ATOM   8983  C  CB  . ILE C 3  298 ? 72.282  52.856  155.229 1.00 20.69 ? 298  ILE C CB  1 
ATOM   8984  C  CG1 . ILE C 3  298 ? 71.667  52.683  156.655 1.00 28.53 ? 298  ILE C CG1 1 
ATOM   8985  C  CG2 . ILE C 3  298 ? 72.107  54.284  154.577 1.00 20.57 ? 298  ILE C CG2 1 
ATOM   8986  C  CD1 . ILE C 3  298 ? 70.138  52.907  156.802 1.00 29.64 ? 298  ILE C CD1 1 
ATOM   8987  N  N   . LEU C 3  299 ? 73.950  51.219  153.010 1.00 20.38 ? 299  LEU C N   1 
ATOM   8988  C  CA  . LEU C 3  299 ? 74.939  51.282  151.940 1.00 19.71 ? 299  LEU C CA  1 
ATOM   8989  C  C   . LEU C 3  299 ? 74.614  50.423  150.710 1.00 19.96 ? 299  LEU C C   1 
ATOM   8990  O  O   . LEU C 3  299 ? 75.174  50.679  149.630 1.00 20.12 ? 299  LEU C O   1 
ATOM   8991  C  CB  . LEU C 3  299 ? 76.351  50.989  152.476 1.00 19.17 ? 299  LEU C CB  1 
ATOM   8992  C  CG  . LEU C 3  299 ? 77.054  51.963  153.436 1.00 18.58 ? 299  LEU C CG  1 
ATOM   8993  C  CD1 . LEU C 3  299 ? 78.302  51.300  153.990 1.00 21.02 ? 299  LEU C CD1 1 
ATOM   8994  C  CD2 . LEU C 3  299 ? 77.418  53.336  152.800 1.00 13.44 ? 299  LEU C CD2 1 
ATOM   8995  N  N   . ILE C 3  300 ? 73.650  49.489  150.862 1.00 19.76 ? 300  ILE C N   1 
ATOM   8996  C  CA  . ILE C 3  300 ? 73.085  48.656  149.781 1.00 19.87 ? 300  ILE C CA  1 
ATOM   8997  C  C   . ILE C 3  300 ? 72.481  49.450  148.600 1.00 20.70 ? 300  ILE C C   1 
ATOM   8998  O  O   . ILE C 3  300 ? 72.544  48.986  147.448 1.00 21.08 ? 300  ILE C O   1 
ATOM   8999  C  CB  . ILE C 3  300 ? 72.061  47.580  150.358 1.00 19.78 ? 300  ILE C CB  1 
ATOM   9000  C  CG1 . ILE C 3  300 ? 71.857  46.397  149.392 1.00 20.43 ? 300  ILE C CG1 1 
ATOM   9001  C  CG2 . ILE C 3  300 ? 70.742  48.231  150.965 1.00 7.43  ? 300  ILE C CG2 1 
ATOM   9002  C  CD1 . ILE C 3  300 ? 71.484  45.083  150.062 1.00 21.50 ? 300  ILE C CD1 1 
ATOM   9003  N  N   . LEU C 3  301 ? 71.929  50.637  148.898 1.00 20.92 ? 301  LEU C N   1 
ATOM   9004  C  CA  . LEU C 3  301 ? 71.395  51.576  147.896 1.00 20.93 ? 301  LEU C CA  1 
ATOM   9005  C  C   . LEU C 3  301 ? 72.368  51.932  146.766 1.00 21.30 ? 301  LEU C C   1 
ATOM   9006  O  O   . LEU C 3  301 ? 71.962  51.927  145.607 1.00 22.25 ? 301  LEU C O   1 
ATOM   9007  C  CB  . LEU C 3  301 ? 70.858  52.846  148.560 1.00 20.52 ? 301  LEU C CB  1 
ATOM   9008  C  CG  . LEU C 3  301 ? 69.704  52.773  149.561 1.00 22.93 ? 301  LEU C CG  1 
ATOM   9009  C  CD1 . LEU C 3  301 ? 69.652  54.065  150.347 1.00 12.36 ? 301  LEU C CD1 1 
ATOM   9010  C  CD2 . LEU C 3  301 ? 68.331  52.456  148.904 1.00 23.41 ? 301  LEU C CD2 1 
ATOM   9011  N  N   . ALA C 3  302 ? 73.664  52.014  147.106 1.00 20.75 ? 302  ALA C N   1 
ATOM   9012  C  CA  . ALA C 3  302 ? 74.781  52.172  146.155 1.00 20.66 ? 302  ALA C CA  1 
ATOM   9013  C  C   . ALA C 3  302 ? 75.051  50.944  145.239 1.00 21.55 ? 302  ALA C C   1 
ATOM   9014  O  O   . ALA C 3  302 ? 75.832  51.047  144.264 1.00 21.88 ? 302  ALA C O   1 
ATOM   9015  C  CB  . ALA C 3  302 ? 76.046  52.575  146.901 1.00 19.95 ? 302  ALA C CB  1 
ATOM   9016  N  N   . LEU C 3  303 ? 74.493  49.783  145.609 1.00 21.43 ? 303  LEU C N   1 
ATOM   9017  C  CA  . LEU C 3  303 ? 74.545  48.564  144.783 1.00 21.74 ? 303  LEU C CA  1 
ATOM   9018  C  C   . LEU C 3  303 ? 73.304  48.319  143.921 1.00 21.75 ? 303  LEU C C   1 
ATOM   9019  O  O   . LEU C 3  303 ? 73.383  47.548  142.953 1.00 21.30 ? 303  LEU C O   1 
ATOM   9020  C  CB  . LEU C 3  303 ? 74.880  47.314  145.633 1.00 21.81 ? 303  LEU C CB  1 
ATOM   9021  C  CG  . LEU C 3  303 ? 76.141  47.141  146.513 1.00 27.48 ? 303  LEU C CG  1 
ATOM   9022  C  CD1 . LEU C 3  303 ? 76.358  45.647  146.816 1.00 27.34 ? 303  LEU C CD1 1 
ATOM   9023  C  CD2 . LEU C 3  303 ? 77.478  47.805  146.001 1.00 27.50 ? 303  LEU C CD2 1 
ATOM   9024  N  N   . ILE C 3  304 ? 72.180  48.969  144.273 1.00 22.34 ? 304  ILE C N   1 
ATOM   9025  C  CA  . ILE C 3  304 ? 70.914  48.875  143.512 1.00 23.18 ? 304  ILE C CA  1 
ATOM   9026  C  C   . ILE C 3  304 ? 70.994  49.125  141.958 1.00 23.63 ? 304  ILE C C   1 
ATOM   9027  O  O   . ILE C 3  304 ? 70.419  48.305  141.224 1.00 23.82 ? 304  ILE C O   1 
ATOM   9028  C  CB  . ILE C 3  304 ? 69.687  49.557  144.261 1.00 23.27 ? 304  ILE C CB  1 
ATOM   9029  C  CG1 . ILE C 3  304 ? 69.182  48.612  145.368 1.00 23.92 ? 304  ILE C CG1 1 
ATOM   9030  C  CG2 . ILE C 3  304 ? 68.489  49.930  143.260 1.00 24.65 ? 304  ILE C CG2 1 
ATOM   9031  C  CD1 . ILE C 3  304 ? 68.334  49.265  146.505 1.00 26.52 ? 304  ILE C CD1 1 
ATOM   9032  N  N   . PRO C 3  305 ? 71.766  50.149  141.472 1.00 23.59 ? 305  PRO C N   1 
ATOM   9033  C  CA  . PRO C 3  305 ? 72.152  50.236  140.044 1.00 23.44 ? 305  PRO C CA  1 
ATOM   9034  C  C   . PRO C 3  305 ? 72.743  48.984  139.376 1.00 22.89 ? 305  PRO C C   1 
ATOM   9035  O  O   . PRO C 3  305 ? 72.432  48.796  138.197 1.00 23.29 ? 305  PRO C O   1 
ATOM   9036  C  CB  . PRO C 3  305 ? 73.193  51.367  140.031 1.00 23.62 ? 305  PRO C CB  1 
ATOM   9037  C  CG  . PRO C 3  305 ? 72.775  52.281  141.132 1.00 23.42 ? 305  PRO C CG  1 
ATOM   9038  C  CD  . PRO C 3  305 ? 72.085  51.433  142.151 1.00 23.21 ? 305  PRO C CD  1 
ATOM   9039  N  N   . LEU C 3  306 ? 73.558  48.187  140.087 1.00 22.08 ? 306  LEU C N   1 
ATOM   9040  C  CA  . LEU C 3  306 ? 74.266  47.028  139.504 1.00 21.97 ? 306  LEU C CA  1 
ATOM   9041  C  C   . LEU C 3  306 ? 73.391  45.765  139.437 1.00 22.49 ? 306  LEU C C   1 
ATOM   9042  O  O   . LEU C 3  306 ? 73.677  44.823  138.658 1.00 22.71 ? 306  LEU C O   1 
ATOM   9043  C  CB  . LEU C 3  306 ? 75.585  46.741  140.249 1.00 22.20 ? 306  LEU C CB  1 
ATOM   9044  C  CG  . LEU C 3  306 ? 76.729  47.796  140.360 1.00 34.47 ? 306  LEU C CG  1 
ATOM   9045  C  CD1 . LEU C 3  306 ? 77.765  47.371  141.419 1.00 29.89 ? 306  LEU C CD1 1 
ATOM   9046  C  CD2 . LEU C 3  306 ? 77.444  48.144  139.016 1.00 29.75 ? 306  LEU C CD2 1 
ATOM   9047  N  N   . LEU C 3  307 ? 72.268  45.819  140.155 1.00 22.34 ? 307  LEU C N   1 
ATOM   9048  C  CA  . LEU C 3  307 ? 71.346  44.692  140.316 1.00 22.74 ? 307  LEU C CA  1 
ATOM   9049  C  C   . LEU C 3  307 ? 70.099  44.866  139.432 1.00 22.36 ? 307  LEU C C   1 
ATOM   9050  O  O   . LEU C 3  307 ? 69.214  43.992  139.436 1.00 21.51 ? 307  LEU C O   1 
ATOM   9051  C  CB  . LEU C 3  307 ? 70.962  44.514  141.805 1.00 22.61 ? 307  LEU C CB  1 
ATOM   9052  C  CG  . LEU C 3  307 ? 72.045  44.366  142.883 1.00 22.37 ? 307  LEU C CG  1 
ATOM   9053  C  CD1 . LEU C 3  307 ? 71.493  44.802  144.224 1.00 23.44 ? 307  LEU C CD1 1 
ATOM   9054  C  CD2 . LEU C 3  307 ? 72.627  42.943  142.966 1.00 30.98 ? 307  LEU C CD2 1 
ATOM   9055  N  N   . HIS C 3  308 ? 70.014  46.026  138.732 1.00 22.12 ? 308  HIS C N   1 
ATOM   9056  C  CA  . HIS C 3  308 ? 69.061  46.219  137.630 1.00 21.39 ? 308  HIS C CA  1 
ATOM   9057  C  C   . HIS C 3  308 ? 69.359  45.273  136.464 1.00 20.88 ? 308  HIS C C   1 
ATOM   9058  O  O   . HIS C 3  308 ? 70.431  45.311  135.855 1.00 21.14 ? 308  HIS C O   1 
ATOM   9059  C  CB  . HIS C 3  308 ? 68.961  47.678  137.169 1.00 21.13 ? 308  HIS C CB  1 
ATOM   9060  C  CG  . HIS C 3  308 ? 67.751  47.966  136.327 1.00 18.48 ? 308  HIS C CG  1 
ATOM   9061  N  ND1 . HIS C 3  308 ? 66.665  48.673  136.798 1.00 15.09 ? 308  HIS C ND1 1 
ATOM   9062  C  CD2 . HIS C 3  308 ? 67.451  47.634  135.048 1.00 16.93 ? 308  HIS C CD2 1 
ATOM   9063  C  CE1 . HIS C 3  308 ? 65.729  48.721  135.867 1.00 13.77 ? 308  HIS C CE1 1 
ATOM   9064  N  NE2 . HIS C 3  308 ? 66.202  48.146  134.776 1.00 19.88 ? 308  HIS C NE2 1 
ATOM   9065  N  N   . THR C 3  309 ? 68.303  44.589  136.057 1.00 20.17 ? 309  THR C N   1 
ATOM   9066  C  CA  . THR C 3  309 ? 68.364  43.360  135.289 1.00 19.42 ? 309  THR C CA  1 
ATOM   9067  C  C   . THR C 3  309 ? 67.273  43.394  134.170 1.00 18.76 ? 309  THR C C   1 
ATOM   9068  O  O   . THR C 3  309 ? 67.473  42.830  133.084 1.00 18.35 ? 309  THR C O   1 
ATOM   9069  C  CB  . THR C 3  309 ? 68.246  42.165  136.319 1.00 19.64 ? 309  THR C CB  1 
ATOM   9070  O  OG1 . THR C 3  309 ? 69.048  41.048  135.924 1.00 24.75 ? 309  THR C OG1 1 
ATOM   9071  C  CG2 . THR C 3  309 ? 66.879  41.646  136.437 1.00 2.00  ? 309  THR C CG2 1 
ATOM   9072  N  N   . SER C 3  310 ? 66.183  44.132  134.453 1.00 18.98 ? 310  SER C N   1 
ATOM   9073  C  CA  . SER C 3  310 ? 65.063  44.387  133.556 1.00 20.18 ? 310  SER C CA  1 
ATOM   9074  C  C   . SER C 3  310 ? 65.465  45.261  132.359 1.00 20.91 ? 310  SER C C   1 
ATOM   9075  O  O   . SER C 3  310 ? 66.156  46.281  132.516 1.00 20.56 ? 310  SER C O   1 
ATOM   9076  C  CB  . SER C 3  310 ? 63.917  45.065  134.334 1.00 20.27 ? 310  SER C CB  1 
ATOM   9077  O  OG  . SER C 3  310 ? 62.868  45.506  133.468 1.00 15.07 ? 310  SER C OG  1 
ATOM   9078  N  N   . LYS C 3  311 ? 64.864  44.936  131.213 1.00 21.22 ? 311  LYS C N   1 
ATOM   9079  C  CA  . LYS C 3  311 ? 64.929  45.747  129.992 1.00 21.22 ? 311  LYS C CA  1 
ATOM   9080  C  C   . LYS C 3  311 ? 64.021  47.010  130.004 1.00 20.96 ? 311  LYS C C   1 
ATOM   9081  O  O   . LYS C 3  311 ? 64.163  47.881  129.136 1.00 20.90 ? 311  LYS C O   1 
ATOM   9082  C  CB  . LYS C 3  311 ? 64.670  44.849  128.763 1.00 21.41 ? 311  LYS C CB  1 
ATOM   9083  C  CG  . LYS C 3  311 ? 65.935  44.112  128.266 1.00 25.25 ? 311  LYS C CG  1 
ATOM   9084  C  CD  . LYS C 3  311 ? 65.723  43.383  126.926 1.00 29.55 ? 311  LYS C CD  1 
ATOM   9085  C  CE  . LYS C 3  311 ? 66.096  44.239  125.710 1.00 21.88 ? 311  LYS C CE  1 
ATOM   9086  N  NZ  . LYS C 3  311 ? 66.015  43.506  124.394 1.00 24.68 ? 311  LYS C NZ  1 
ATOM   9087  N  N   . GLN C 3  312 ? 63.090  47.083  130.972 1.00 21.19 ? 312  GLN C N   1 
ATOM   9088  C  CA  . GLN C 3  312 ? 62.325  48.312  131.301 1.00 20.92 ? 312  GLN C CA  1 
ATOM   9089  C  C   . GLN C 3  312 ? 62.877  49.002  132.545 1.00 21.76 ? 312  GLN C C   1 
ATOM   9090  O  O   . GLN C 3  312 ? 63.179  48.330  133.548 1.00 22.74 ? 312  GLN C O   1 
ATOM   9091  C  CB  . GLN C 3  312 ? 60.838  48.012  131.507 1.00 20.06 ? 312  GLN C CB  1 
ATOM   9092  C  CG  . GLN C 3  312 ? 60.092  47.572  130.251 1.00 13.14 ? 312  GLN C CG  1 
ATOM   9093  C  CD  . GLN C 3  312 ? 59.030  46.491  130.497 1.00 16.09 ? 312  GLN C CD  1 
ATOM   9094  O  OE1 . GLN C 3  312 ? 57.948  46.570  129.933 1.00 25.81 ? 312  GLN C OE1 1 
ATOM   9095  N  NE2 . GLN C 3  312 ? 59.407  45.409  131.172 1.00 9.59  ? 312  GLN C NE2 1 
ATOM   9096  N  N   . ARG C 3  313 ? 62.932  50.344  132.490 1.00 21.32 ? 313  ARG C N   1 
ATOM   9097  C  CA  . ARG C 3  313 ? 63.419  51.202  133.574 1.00 20.79 ? 313  ARG C CA  1 
ATOM   9098  C  C   . ARG C 3  313 ? 62.539  51.136  134.837 1.00 20.30 ? 313  ARG C C   1 
ATOM   9099  O  O   . ARG C 3  313 ? 63.035  50.744  135.905 1.00 20.26 ? 313  ARG C O   1 
ATOM   9100  C  CB  . ARG C 3  313 ? 63.560  52.652  133.083 1.00 21.37 ? 313  ARG C CB  1 
ATOM   9101  C  CG  . ARG C 3  313 ? 64.476  53.526  133.934 1.00 24.72 ? 313  ARG C CG  1 
ATOM   9102  C  CD  . ARG C 3  313 ? 64.514  54.990  133.512 1.00 24.63 ? 313  ARG C CD  1 
ATOM   9103  N  NE  . ARG C 3  313 ? 65.228  55.775  134.517 1.00 25.02 ? 313  ARG C NE  1 
ATOM   9104  C  CZ  . ARG C 3  313 ? 65.662  57.035  134.387 1.00 28.20 ? 313  ARG C CZ  1 
ATOM   9105  N  NH1 . ARG C 3  313 ? 65.313  57.805  133.356 1.00 18.46 ? 313  ARG C NH1 1 
ATOM   9106  N  NH2 . ARG C 3  313 ? 66.358  57.560  135.386 1.00 18.35 ? 313  ARG C NH2 1 
ATOM   9107  N  N   . SER C 3  314 ? 61.225  51.360  134.647 1.00 19.50 ? 314  SER C N   1 
ATOM   9108  C  CA  . SER C 3  314 ? 60.246  51.593  135.709 1.00 18.37 ? 314  SER C CA  1 
ATOM   9109  C  C   . SER C 3  314 ? 59.566  50.266  136.082 1.00 18.24 ? 314  SER C C   1 
ATOM   9110  O  O   . SER C 3  314 ? 59.618  49.301  135.311 1.00 18.80 ? 314  SER C O   1 
ATOM   9111  C  CB  . SER C 3  314 ? 59.223  52.608  135.208 1.00 18.15 ? 314  SER C CB  1 
ATOM   9112  O  OG  . SER C 3  314 ? 58.134  52.759  136.088 1.00 16.15 ? 314  SER C OG  1 
ATOM   9113  N  N   . MET C 3  315 ? 58.980  50.202  137.285 1.00 17.60 ? 315  MET C N   1 
ATOM   9114  C  CA  . MET C 3  315 ? 58.135  49.046  137.678 1.00 16.41 ? 315  MET C CA  1 
ATOM   9115  C  C   . MET C 3  315 ? 56.675  49.144  137.236 1.00 16.20 ? 315  MET C C   1 
ATOM   9116  O  O   . MET C 3  315 ? 55.917  48.167  137.460 1.00 16.08 ? 315  MET C O   1 
ATOM   9117  C  CB  . MET C 3  315 ? 58.211  48.732  139.176 1.00 15.44 ? 315  MET C CB  1 
ATOM   9118  C  CG  . MET C 3  315 ? 59.480  48.092  139.609 1.00 12.82 ? 315  MET C CG  1 
ATOM   9119  S  SD  . MET C 3  315 ? 59.546  47.920  141.405 1.00 19.96 ? 315  MET C SD  1 
ATOM   9120  C  CE  . MET C 3  315 ? 61.282  47.560  141.579 1.00 19.02 ? 315  MET C CE  1 
ATOM   9121  N  N   . MET C 3  316 ? 56.307  50.240  136.531 1.00 15.69 ? 316  MET C N   1 
ATOM   9122  C  CA  . MET C 3  316 ? 54.917  50.469  136.052 1.00 16.75 ? 316  MET C CA  1 
ATOM   9123  C  C   . MET C 3  316 ? 54.320  49.313  135.212 1.00 16.91 ? 316  MET C C   1 
ATOM   9124  O  O   . MET C 3  316 ? 53.161  48.973  135.398 1.00 17.11 ? 316  MET C O   1 
ATOM   9125  C  CB  . MET C 3  316 ? 54.753  51.814  135.324 1.00 17.21 ? 316  MET C CB  1 
ATOM   9126  C  CG  . MET C 3  316 ? 53.286  52.194  134.965 1.00 19.32 ? 316  MET C CG  1 
ATOM   9127  S  SD  . MET C 3  316 ? 53.163  53.724  134.060 1.00 17.68 ? 316  MET C SD  1 
ATOM   9128  C  CE  . MET C 3  316 ? 51.356  53.824  133.803 1.00 30.98 ? 316  MET C CE  1 
ATOM   9129  N  N   . PHE C 3  317 ? 55.137  48.729  134.331 1.00 17.16 ? 317  PHE C N   1 
ATOM   9130  C  CA  . PHE C 3  317 ? 54.734  47.612  133.464 1.00 17.38 ? 317  PHE C CA  1 
ATOM   9131  C  C   . PHE C 3  317 ? 55.260  46.247  133.919 1.00 17.69 ? 317  PHE C C   1 
ATOM   9132  O  O   . PHE C 3  317 ? 55.312  45.295  133.138 1.00 17.20 ? 317  PHE C O   1 
ATOM   9133  C  CB  . PHE C 3  317 ? 55.039  47.899  131.967 1.00 17.06 ? 317  PHE C CB  1 
ATOM   9134  C  CG  . PHE C 3  317 ? 54.637  49.277  131.500 1.00 12.66 ? 317  PHE C CG  1 
ATOM   9135  C  CD1 . PHE C 3  317 ? 53.294  49.735  131.625 1.00 6.94  ? 317  PHE C CD1 1 
ATOM   9136  C  CD2 . PHE C 3  317 ? 55.616  50.147  130.968 1.00 7.31  ? 317  PHE C CD2 1 
ATOM   9137  C  CE1 . PHE C 3  317 ? 52.928  51.040  131.191 1.00 8.85  ? 317  PHE C CE1 1 
ATOM   9138  C  CE2 . PHE C 3  317 ? 55.273  51.471  130.532 1.00 14.05 ? 317  PHE C CE2 1 
ATOM   9139  C  CZ  . PHE C 3  317 ? 53.924  51.919  130.649 1.00 11.73 ? 317  PHE C CZ  1 
ATOM   9140  N  N   . ARG C 3  318 ? 55.526  46.138  135.217 1.00 18.89 ? 318  ARG C N   1 
ATOM   9141  C  CA  . ARG C 3  318 ? 56.205  44.985  135.803 1.00 19.95 ? 318  ARG C CA  1 
ATOM   9142  C  C   . ARG C 3  318 ? 55.475  44.448  137.078 1.00 20.84 ? 318  ARG C C   1 
ATOM   9143  O  O   . ARG C 3  318 ? 55.861  44.844  138.195 1.00 22.24 ? 318  ARG C O   1 
ATOM   9144  C  CB  . ARG C 3  318 ? 57.658  45.343  136.077 1.00 20.23 ? 318  ARG C CB  1 
ATOM   9145  C  CG  . ARG C 3  318 ? 58.559  45.209  134.880 1.00 28.54 ? 318  ARG C CG  1 
ATOM   9146  C  CD  . ARG C 3  318 ? 60.002  45.074  135.248 1.00 31.59 ? 318  ARG C CD  1 
ATOM   9147  N  NE  . ARG C 3  318 ? 60.604  46.369  135.492 1.00 16.60 ? 318  ARG C NE  1 
ATOM   9148  C  CZ  . ARG C 3  318 ? 61.472  46.679  136.471 1.00 24.83 ? 318  ARG C CZ  1 
ATOM   9149  N  NH1 . ARG C 3  318 ? 61.974  45.767  137.316 1.00 9.90  ? 318  ARG C NH1 1 
ATOM   9150  N  NH2 . ARG C 3  318 ? 61.973  47.906  136.483 1.00 20.61 ? 318  ARG C NH2 1 
ATOM   9151  N  N   . PRO C 3  319 ? 54.390  43.639  136.920 1.00 20.13 ? 319  PRO C N   1 
ATOM   9152  C  CA  . PRO C 3  319 ? 53.604  43.156  138.080 1.00 20.46 ? 319  PRO C CA  1 
ATOM   9153  C  C   . PRO C 3  319 ? 54.380  42.325  139.121 1.00 20.78 ? 319  PRO C C   1 
ATOM   9154  O  O   . PRO C 3  319 ? 54.180  42.615  140.303 1.00 20.60 ? 319  PRO C O   1 
ATOM   9155  C  CB  . PRO C 3  319 ? 52.475  42.309  137.438 1.00 20.85 ? 319  PRO C CB  1 
ATOM   9156  C  CG  . PRO C 3  319 ? 52.896  42.059  136.050 1.00 19.47 ? 319  PRO C CG  1 
ATOM   9157  C  CD  . PRO C 3  319 ? 53.746  43.230  135.647 1.00 19.34 ? 319  PRO C CD  1 
ATOM   9158  N  N   . LEU C 3  320 ? 55.330  41.469  138.690 1.00 21.34 ? 320  LEU C N   1 
ATOM   9159  C  CA  . LEU C 3  320 ? 56.196  40.653  139.584 1.00 21.98 ? 320  LEU C CA  1 
ATOM   9160  C  C   . LEU C 3  320 ? 57.042  41.490  140.524 1.00 22.95 ? 320  LEU C C   1 
ATOM   9161  O  O   . LEU C 3  320 ? 57.041  41.241  141.740 1.00 23.42 ? 320  LEU C O   1 
ATOM   9162  C  CB  . LEU C 3  320 ? 57.127  39.753  138.775 1.00 21.98 ? 320  LEU C CB  1 
ATOM   9163  C  CG  . LEU C 3  320 ? 56.912  38.253  138.654 1.00 30.11 ? 320  LEU C CG  1 
ATOM   9164  C  CD1 . LEU C 3  320 ? 56.061  37.936  137.421 1.00 29.13 ? 320  LEU C CD1 1 
ATOM   9165  C  CD2 . LEU C 3  320 ? 58.285  37.608  138.525 1.00 30.57 ? 320  LEU C CD2 1 
ATOM   9166  N  N   . SER C 3  321 ? 57.657  42.545  139.956 1.00 23.16 ? 321  SER C N   1 
ATOM   9167  C  CA  . SER C 3  321 ? 58.580  43.444  140.647 1.00 23.00 ? 321  SER C CA  1 
ATOM   9168  C  C   . SER C 3  321 ? 57.808  44.326  141.626 1.00 22.65 ? 321  SER C C   1 
ATOM   9169  O  O   . SER C 3  321 ? 58.261  44.517  142.750 1.00 23.01 ? 321  SER C O   1 
ATOM   9170  C  CB  . SER C 3  321 ? 59.362  44.307  139.630 1.00 23.16 ? 321  SER C CB  1 
ATOM   9171  O  OG  . SER C 3  321 ? 60.373  43.552  138.980 1.00 18.03 ? 321  SER C OG  1 
ATOM   9172  N  N   . GLN C 3  322 ? 56.627  44.800  141.188 1.00 21.91 ? 322  GLN C N   1 
ATOM   9173  C  CA  . GLN C 3  322 ? 55.630  45.493  142.005 1.00 21.37 ? 322  GLN C CA  1 
ATOM   9174  C  C   . GLN C 3  322 ? 55.269  44.736  143.296 1.00 21.84 ? 322  GLN C C   1 
ATOM   9175  O  O   . GLN C 3  322 ? 55.436  45.304  144.385 1.00 22.53 ? 322  GLN C O   1 
ATOM   9176  C  CB  . GLN C 3  322 ? 54.373  45.769  141.190 1.00 20.84 ? 322  GLN C CB  1 
ATOM   9177  C  CG  . GLN C 3  322 ? 54.410  47.020  140.357 1.00 25.15 ? 322  GLN C CG  1 
ATOM   9178  C  CD  . GLN C 3  322 ? 53.125  47.240  139.537 1.00 31.80 ? 322  GLN C CD  1 
ATOM   9179  O  OE1 . GLN C 3  322 ? 53.199  47.548  138.345 1.00 37.28 ? 322  GLN C OE1 1 
ATOM   9180  N  NE2 . GLN C 3  322 ? 51.973  47.244  140.210 1.00 24.97 ? 322  GLN C NE2 1 
ATOM   9181  N  N   . CYS C 3  323 ? 54.996  43.417  143.171 1.00 21.02 ? 323  CYS C N   1 
ATOM   9182  C  CA  . CYS C 3  323 ? 54.687  42.547  144.316 1.00 20.45 ? 323  CYS C CA  1 
ATOM   9183  C  C   . CYS C 3  323 ? 55.867  42.413  145.276 1.00 20.18 ? 323  CYS C C   1 
ATOM   9184  O  O   . CYS C 3  323 ? 55.706  42.665  146.465 1.00 20.46 ? 323  CYS C O   1 
ATOM   9185  C  CB  . CYS C 3  323 ? 54.166  41.170  143.884 1.00 19.87 ? 323  CYS C CB  1 
ATOM   9186  S  SG  . CYS C 3  323 ? 52.662  41.233  142.899 1.00 20.18 ? 323  CYS C SG  1 
ATOM   9187  N  N   . LEU C 3  324 ? 57.064  42.265  144.709 1.00 19.99 ? 324  LEU C N   1 
ATOM   9188  C  CA  . LEU C 3  324 ? 58.316  42.219  145.469 1.00 19.59 ? 324  LEU C CA  1 
ATOM   9189  C  C   . LEU C 3  324 ? 58.766  43.531  146.092 1.00 19.30 ? 324  LEU C C   1 
ATOM   9190  O  O   . LEU C 3  324 ? 59.358  43.510  147.180 1.00 19.82 ? 324  LEU C O   1 
ATOM   9191  C  CB  . LEU C 3  324 ? 59.439  41.545  144.671 1.00 19.42 ? 324  LEU C CB  1 
ATOM   9192  C  CG  . LEU C 3  324 ? 59.292  40.049  144.288 1.00 22.88 ? 324  LEU C CG  1 
ATOM   9193  C  CD1 . LEU C 3  324 ? 60.473  39.638  143.483 1.00 19.50 ? 324  LEU C CD1 1 
ATOM   9194  C  CD2 . LEU C 3  324 ? 59.120  39.080  145.473 1.00 14.20 ? 324  LEU C CD2 1 
ATOM   9195  N  N   . PHE C 3  325 ? 58.383  44.656  145.473 1.00 18.76 ? 325  PHE C N   1 
ATOM   9196  C  CA  . PHE C 3  325 ? 58.684  46.021  145.987 1.00 18.41 ? 325  PHE C CA  1 
ATOM   9197  C  C   . PHE C 3  325 ? 57.830  46.290  147.217 1.00 18.54 ? 325  PHE C C   1 
ATOM   9198  O  O   . PHE C 3  325 ? 58.339  46.792  148.216 1.00 18.21 ? 325  PHE C O   1 
ATOM   9199  C  CB  . PHE C 3  325 ? 58.459  47.106  144.910 1.00 17.06 ? 325  PHE C CB  1 
ATOM   9200  C  CG  . PHE C 3  325 ? 58.572  48.532  145.427 1.00 16.11 ? 325  PHE C CG  1 
ATOM   9201  C  CD1 . PHE C 3  325 ? 59.833  49.197  145.435 1.00 11.47 ? 325  PHE C CD1 1 
ATOM   9202  C  CD2 . PHE C 3  325 ? 57.403  49.265  145.800 1.00 12.86 ? 325  PHE C CD2 1 
ATOM   9203  C  CE1 . PHE C 3  325 ? 59.951  50.553  145.908 1.00 19.03 ? 325  PHE C CE1 1 
ATOM   9204  C  CE2 . PHE C 3  325 ? 57.493  50.606  146.296 1.00 14.52 ? 325  PHE C CE2 1 
ATOM   9205  C  CZ  . PHE C 3  325 ? 58.771  51.264  146.327 1.00 18.85 ? 325  PHE C CZ  1 
ATOM   9206  N  N   . TRP C 3  326 ? 56.518  46.057  147.076 1.00 18.97 ? 326  TRP C N   1 
ATOM   9207  C  CA  . TRP C 3  326 ? 55.569  46.171  148.174 1.00 19.25 ? 326  TRP C CA  1 
ATOM   9208  C  C   . TRP C 3  326 ? 55.839  45.220  149.336 1.00 19.00 ? 326  TRP C C   1 
ATOM   9209  O  O   . TRP C 3  326 ? 55.737  45.643  150.495 1.00 18.46 ? 326  TRP C O   1 
ATOM   9210  C  CB  . TRP C 3  326 ? 54.116  46.167  147.684 1.00 19.16 ? 326  TRP C CB  1 
ATOM   9211  C  CG  . TRP C 3  326 ? 53.785  47.395  146.843 1.00 22.08 ? 326  TRP C CG  1 
ATOM   9212  C  CD1 . TRP C 3  326 ? 53.428  47.406  145.520 1.00 25.00 ? 326  TRP C CD1 1 
ATOM   9213  C  CD2 . TRP C 3  326 ? 53.804  48.776  147.259 1.00 15.96 ? 326  TRP C CD2 1 
ATOM   9214  N  NE1 . TRP C 3  326 ? 53.284  48.697  145.069 1.00 18.40 ? 326  TRP C NE1 1 
ATOM   9215  C  CE2 . TRP C 3  326 ? 53.477  49.564  146.111 1.00 17.90 ? 326  TRP C CE2 1 
ATOM   9216  C  CE3 . TRP C 3  326 ? 54.106  49.442  148.475 1.00 21.17 ? 326  TRP C CE3 1 
ATOM   9217  C  CZ2 . TRP C 3  326 ? 53.484  50.994  146.124 1.00 19.31 ? 326  TRP C CZ2 1 
ATOM   9218  C  CZ3 . TRP C 3  326 ? 54.125  50.870  148.493 1.00 17.53 ? 326  TRP C CZ3 1 
ATOM   9219  C  CH2 . TRP C 3  326 ? 53.813  51.623  147.309 1.00 17.71 ? 326  TRP C CH2 1 
ATOM   9220  N  N   . ALA C 3  327 ? 56.402  44.044  149.007 1.00 19.63 ? 327  ALA C N   1 
ATOM   9221  C  CA  . ALA C 3  327 ? 56.983  43.094  149.977 1.00 20.39 ? 327  ALA C CA  1 
ATOM   9222  C  C   . ALA C 3  327 ? 58.189  43.632  150.736 1.00 21.43 ? 327  ALA C C   1 
ATOM   9223  O  O   . ALA C 3  327 ? 58.394  43.238  151.879 1.00 21.56 ? 327  ALA C O   1 
ATOM   9224  C  CB  . ALA C 3  327 ? 57.309  41.757  149.323 1.00 19.78 ? 327  ALA C CB  1 
ATOM   9225  N  N   . LEU C 3  328 ? 58.983  44.496  150.087 1.00 22.46 ? 328  LEU C N   1 
ATOM   9226  C  CA  . LEU C 3  328 ? 60.093  45.210  150.735 1.00 23.74 ? 328  LEU C CA  1 
ATOM   9227  C  C   . LEU C 3  328 ? 59.627  46.284  151.712 1.00 24.72 ? 328  LEU C C   1 
ATOM   9228  O  O   . LEU C 3  328 ? 60.162  46.375  152.819 1.00 25.85 ? 328  LEU C O   1 
ATOM   9229  C  CB  . LEU C 3  328 ? 61.115  45.763  149.708 1.00 23.91 ? 328  LEU C CB  1 
ATOM   9230  C  CG  . LEU C 3  328 ? 62.423  46.417  150.202 1.00 24.22 ? 328  LEU C CG  1 
ATOM   9231  C  CD1 . LEU C 3  328 ? 63.449  45.368  150.716 1.00 22.85 ? 328  LEU C CD1 1 
ATOM   9232  C  CD2 . LEU C 3  328 ? 63.037  47.312  149.128 1.00 24.34 ? 328  LEU C CD2 1 
ATOM   9233  N  N   . VAL C 3  329 ? 58.698  47.131  151.255 1.00 24.41 ? 329  VAL C N   1 
ATOM   9234  C  CA  . VAL C 3  329 ? 58.048  48.188  152.054 1.00 23.89 ? 329  VAL C CA  1 
ATOM   9235  C  C   . VAL C 3  329 ? 57.418  47.614  153.348 1.00 23.57 ? 329  VAL C C   1 
ATOM   9236  O  O   . VAL C 3  329 ? 57.742  48.092  154.446 1.00 23.43 ? 329  VAL C O   1 
ATOM   9237  C  CB  . VAL C 3  329 ? 57.010  49.018  151.182 1.00 23.82 ? 329  VAL C CB  1 
ATOM   9238  C  CG1 . VAL C 3  329 ? 56.300  50.096  152.003 1.00 21.96 ? 329  VAL C CG1 1 
ATOM   9239  C  CG2 . VAL C 3  329 ? 57.716  49.693  149.975 1.00 21.98 ? 329  VAL C CG2 1 
ATOM   9240  N  N   . ALA C 3  330 ? 56.682  46.498  153.197 1.00 22.70 ? 330  ALA C N   1 
ATOM   9241  C  CA  . ALA C 3  330 ? 56.032  45.787  154.303 1.00 22.32 ? 330  ALA C CA  1 
ATOM   9242  C  C   . ALA C 3  330 ? 57.010  45.059  155.223 1.00 22.00 ? 330  ALA C C   1 
ATOM   9243  O  O   . ALA C 3  330 ? 56.749  44.949  156.423 1.00 21.66 ? 330  ALA C O   1 
ATOM   9244  C  CB  . ALA C 3  330 ? 54.960  44.824  153.783 1.00 21.79 ? 330  ALA C CB  1 
ATOM   9245  N  N   . ASP C 3  331 ? 58.096  44.528  154.645 1.00 22.26 ? 331  ASP C N   1 
ATOM   9246  C  CA  . ASP C 3  331 ? 59.277  44.098  155.399 1.00 22.77 ? 331  ASP C CA  1 
ATOM   9247  C  C   . ASP C 3  331 ? 59.952  45.207  156.225 1.00 22.68 ? 331  ASP C C   1 
ATOM   9248  O  O   . ASP C 3  331 ? 60.353  44.966  157.368 1.00 22.99 ? 331  ASP C O   1 
ATOM   9249  C  CB  . ASP C 3  331 ? 60.307  43.433  154.490 1.00 23.07 ? 331  ASP C CB  1 
ATOM   9250  C  CG  . ASP C 3  331 ? 61.254  42.554  155.253 1.00 28.20 ? 331  ASP C CG  1 
ATOM   9251  O  OD1 . ASP C 3  331 ? 62.454  42.863  155.236 1.00 28.09 ? 331  ASP C OD1 1 
ATOM   9252  O  OD2 . ASP C 3  331 ? 60.867  41.624  156.007 1.00 30.43 ? 331  ASP C OD2 1 
ATOM   9253  N  N   . LEU C 3  332 ? 60.032  46.404  155.651 1.00 22.16 ? 332  LEU C N   1 
ATOM   9254  C  CA  . LEU C 3  332 ? 60.537  47.586  156.346 1.00 22.31 ? 332  LEU C CA  1 
ATOM   9255  C  C   . LEU C 3  332 ? 59.640  48.095  157.461 1.00 22.13 ? 332  LEU C C   1 
ATOM   9256  O  O   . LEU C 3  332 ? 60.156  48.461  158.530 1.00 22.14 ? 332  LEU C O   1 
ATOM   9257  C  CB  . LEU C 3  332 ? 60.935  48.708  155.370 1.00 22.15 ? 332  LEU C CB  1 
ATOM   9258  C  CG  . LEU C 3  332 ? 62.238  48.437  154.608 1.00 26.19 ? 332  LEU C CG  1 
ATOM   9259  C  CD1 . LEU C 3  332 ? 62.228  49.112  153.254 1.00 35.43 ? 332  LEU C CD1 1 
ATOM   9260  C  CD2 . LEU C 3  332 ? 63.432  48.871  155.406 1.00 22.57 ? 332  LEU C CD2 1 
ATOM   9261  N  N   . LEU C 3  333 ? 58.313  48.004  157.244 1.00 21.60 ? 333  LEU C N   1 
ATOM   9262  C  CA  . LEU C 3  333 ? 57.294  48.258  158.272 1.00 21.03 ? 333  LEU C CA  1 
ATOM   9263  C  C   . LEU C 3  333 ? 57.420  47.295  159.454 1.00 20.36 ? 333  LEU C C   1 
ATOM   9264  O  O   . LEU C 3  333 ? 57.484  47.748  160.602 1.00 19.79 ? 333  LEU C O   1 
ATOM   9265  C  CB  . LEU C 3  333 ? 55.878  48.198  157.677 1.00 21.44 ? 333  LEU C CB  1 
ATOM   9266  C  CG  . LEU C 3  333 ? 54.833  49.300  157.964 1.00 34.24 ? 333  LEU C CG  1 
ATOM   9267  C  CD1 . LEU C 3  333 ? 53.557  49.005  157.187 1.00 33.34 ? 333  LEU C CD1 1 
ATOM   9268  C  CD2 . LEU C 3  333 ? 54.492  49.526  159.459 1.00 30.95 ? 333  LEU C CD2 1 
ATOM   9269  N  N   . THR C 3  334 ? 57.622  46.000  159.130 1.00 20.21 ? 334  THR C N   1 
ATOM   9270  C  CA  . THR C 3  334 ? 57.897  44.909  160.087 1.00 19.45 ? 334  THR C CA  1 
ATOM   9271  C  C   . THR C 3  334 ? 59.178  45.157  160.900 1.00 18.95 ? 334  THR C C   1 
ATOM   9272  O  O   . THR C 3  334 ? 59.173  44.982  162.120 1.00 18.81 ? 334  THR C O   1 
ATOM   9273  C  CB  . THR C 3  334 ? 57.972  43.515  159.355 1.00 19.42 ? 334  THR C CB  1 
ATOM   9274  O  OG1 . THR C 3  334 ? 56.844  43.349  158.494 1.00 16.44 ? 334  THR C OG1 1 
ATOM   9275  C  CG2 . THR C 3  334 ? 57.801  42.366  160.342 1.00 11.36 ? 334  THR C CG2 1 
ATOM   9276  N  N   . LEU C 3  335 ? 60.257  45.531  160.210 1.00 18.96 ? 335  LEU C N   1 
ATOM   9277  C  CA  . LEU C 3  335 ? 61.517  45.914  160.844 1.00 19.15 ? 335  LEU C CA  1 
ATOM   9278  C  C   . LEU C 3  335 ? 61.427  47.156  161.764 1.00 19.03 ? 335  LEU C C   1 
ATOM   9279  O  O   . LEU C 3  335 ? 61.968  47.114  162.874 1.00 18.78 ? 335  LEU C O   1 
ATOM   9280  C  CB  . LEU C 3  335 ? 62.641  46.046  159.807 1.00 19.63 ? 335  LEU C CB  1 
ATOM   9281  C  CG  . LEU C 3  335 ? 63.232  44.790  159.131 1.00 23.52 ? 335  LEU C CG  1 
ATOM   9282  C  CD1 . LEU C 3  335 ? 63.917  45.210  157.818 1.00 7.74  ? 335  LEU C CD1 1 
ATOM   9283  C  CD2 . LEU C 3  335 ? 64.195  43.964  160.035 1.00 18.88 ? 335  LEU C CD2 1 
ATOM   9284  N  N   . THR C 3  336 ? 60.650  48.183  161.356 1.00 19.24 ? 336  THR C N   1 
ATOM   9285  C  CA  . THR C 3  336 ? 60.307  49.325  162.240 1.00 19.31 ? 336  THR C CA  1 
ATOM   9286  C  C   . THR C 3  336 ? 59.472  48.977  163.485 1.00 19.29 ? 336  THR C C   1 
ATOM   9287  O  O   . THR C 3  336 ? 59.769  49.466  164.585 1.00 19.03 ? 336  THR C O   1 
ATOM   9288  C  CB  . THR C 3  336 ? 59.805  50.635  161.499 1.00 19.41 ? 336  THR C CB  1 
ATOM   9289  O  OG1 . THR C 3  336 ? 59.170  50.318  160.266 1.00 28.69 ? 336  THR C OG1 1 
ATOM   9290  C  CG2 . THR C 3  336 ? 60.983  51.461  161.005 1.00 40.82 ? 336  THR C CG2 1 
ATOM   9291  N  N   . TRP C 3  337 ? 58.585  47.987  163.341 1.00 19.32 ? 337  TRP C N   1 
ATOM   9292  C  CA  . TRP C 3  337 ? 57.870  47.379  164.461 1.00 18.93 ? 337  TRP C CA  1 
ATOM   9293  C  C   . TRP C 3  337 ? 58.807  46.659  165.470 1.00 18.62 ? 337  TRP C C   1 
ATOM   9294  O  O   . TRP C 3  337 ? 58.811  47.023  166.663 1.00 18.62 ? 337  TRP C O   1 
ATOM   9295  C  CB  . TRP C 3  337 ? 56.731  46.485  163.943 1.00 19.14 ? 337  TRP C CB  1 
ATOM   9296  C  CG  . TRP C 3  337 ? 56.097  45.560  164.971 1.00 25.80 ? 337  TRP C CG  1 
ATOM   9297  C  CD1 . TRP C 3  337 ? 55.509  45.921  166.164 1.00 23.79 ? 337  TRP C CD1 1 
ATOM   9298  C  CD2 . TRP C 3  337 ? 55.895  44.150  164.839 1.00 27.34 ? 337  TRP C CD2 1 
ATOM   9299  N  NE1 . TRP C 3  337 ? 55.004  44.815  166.798 1.00 31.45 ? 337  TRP C NE1 1 
ATOM   9300  C  CE2 . TRP C 3  337 ? 55.187  43.716  166.000 1.00 27.77 ? 337  TRP C CE2 1 
ATOM   9301  C  CE3 . TRP C 3  337 ? 56.214  43.193  163.840 1.00 32.68 ? 337  TRP C CE3 1 
ATOM   9302  C  CZ2 . TRP C 3  337 ? 54.813  42.355  166.212 1.00 28.88 ? 337  TRP C CZ2 1 
ATOM   9303  C  CZ3 . TRP C 3  337 ? 55.803  41.822  164.039 1.00 26.54 ? 337  TRP C CZ3 1 
ATOM   9304  C  CH2 . TRP C 3  337 ? 55.198  41.421  165.261 1.00 28.07 ? 337  TRP C CH2 1 
ATOM   9305  N  N   . ILE C 3  338 ? 59.708  45.811  164.944 1.00 18.23 ? 338  ILE C N   1 
ATOM   9306  C  CA  . ILE C 3  338 ? 60.660  45.004  165.751 1.00 17.92 ? 338  ILE C CA  1 
ATOM   9307  C  C   . ILE C 3  338 ? 61.745  45.850  166.447 1.00 17.73 ? 338  ILE C C   1 
ATOM   9308  O  O   . ILE C 3  338 ? 62.026  45.637  167.640 1.00 17.83 ? 338  ILE C O   1 
ATOM   9309  C  CB  . ILE C 3  338 ? 61.248  43.781  164.916 1.00 17.71 ? 338  ILE C CB  1 
ATOM   9310  C  CG1 . ILE C 3  338 ? 60.135  42.773  164.507 1.00 25.92 ? 338  ILE C CG1 1 
ATOM   9311  C  CG2 . ILE C 3  338 ? 62.449  43.048  165.636 1.00 20.13 ? 338  ILE C CG2 1 
ATOM   9312  C  CD1 . ILE C 3  338 ? 59.280  42.127  165.675 1.00 25.31 ? 338  ILE C CD1 1 
ATOM   9313  N  N   . GLY C 3  339 ? 62.275  46.841  165.720 1.00 17.57 ? 339  GLY C N   1 
ATOM   9314  C  CA  . GLY C 3  339 ? 63.042  47.955  166.280 1.00 17.87 ? 339  GLY C CA  1 
ATOM   9315  C  C   . GLY C 3  339 ? 62.531  48.580  167.572 1.00 18.27 ? 339  GLY C C   1 
ATOM   9316  O  O   . GLY C 3  339 ? 63.330  48.763  168.493 1.00 18.20 ? 339  GLY C O   1 
ATOM   9317  N  N   . GLY C 3  340 ? 61.200  48.762  167.672 1.00 19.24 ? 340  GLY C N   1 
ATOM   9318  C  CA  . GLY C 3  340 ? 60.529  49.440  168.789 1.00 20.01 ? 340  GLY C CA  1 
ATOM   9319  C  C   . GLY C 3  340 ? 60.017  48.569  169.944 1.00 20.62 ? 340  GLY C C   1 
ATOM   9320  O  O   . GLY C 3  340 ? 59.246  49.059  170.802 1.00 20.26 ? 340  GLY C O   1 
ATOM   9321  N  N   . GLN C 3  341 ? 60.532  47.335  170.022 1.00 21.28 ? 341  GLN C N   1 
ATOM   9322  C  CA  . GLN C 3  341 ? 60.033  46.273  170.920 1.00 22.01 ? 341  GLN C CA  1 
ATOM   9323  C  C   . GLN C 3  341 ? 61.218  45.593  171.668 1.00 22.90 ? 341  GLN C C   1 
ATOM   9324  O  O   . GLN C 3  341 ? 62.350  45.665  171.156 1.00 22.49 ? 341  GLN C O   1 
ATOM   9325  C  CB  . GLN C 3  341 ? 59.207  45.232  170.130 1.00 21.55 ? 341  GLN C CB  1 
ATOM   9326  C  CG  . GLN C 3  341 ? 57.824  45.713  169.588 1.00 16.77 ? 341  GLN C CG  1 
ATOM   9327  C  CD  . GLN C 3  341 ? 56.824  46.153  170.662 1.00 22.58 ? 341  GLN C CD  1 
ATOM   9328  O  OE1 . GLN C 3  341 ? 56.419  47.310  170.677 1.00 25.08 ? 341  GLN C OE1 1 
ATOM   9329  N  NE2 . GLN C 3  341 ? 56.285  45.193  171.413 1.00 26.17 ? 341  GLN C NE2 1 
ATOM   9330  N  N   . PRO C 3  342 ? 60.994  44.976  172.863 1.00 23.89 ? 342  PRO C N   1 
ATOM   9331  C  CA  . PRO C 3  342 ? 62.096  44.306  173.591 1.00 24.79 ? 342  PRO C CA  1 
ATOM   9332  C  C   . PRO C 3  342 ? 62.661  43.048  172.899 1.00 25.64 ? 342  PRO C C   1 
ATOM   9333  O  O   . PRO C 3  342 ? 61.967  42.437  172.069 1.00 25.22 ? 342  PRO C O   1 
ATOM   9334  C  CB  . PRO C 3  342 ? 61.471  43.960  174.953 1.00 24.74 ? 342  PRO C CB  1 
ATOM   9335  C  CG  . PRO C 3  342 ? 60.014  43.953  174.726 1.00 19.91 ? 342  PRO C CG  1 
ATOM   9336  C  CD  . PRO C 3  342 ? 59.759  44.983  173.690 1.00 23.84 ? 342  PRO C CD  1 
ATOM   9337  N  N   . VAL C 3  343 ? 63.942  42.758  173.178 1.00 26.73 ? 343  VAL C N   1 
ATOM   9338  C  CA  . VAL C 3  343 ? 64.667  41.569  172.669 1.00 27.47 ? 343  VAL C CA  1 
ATOM   9339  C  C   . VAL C 3  343 ? 64.256  40.260  173.367 1.00 27.99 ? 343  VAL C C   1 
ATOM   9340  O  O   . VAL C 3  343 ? 65.018  39.660  174.153 1.00 28.18 ? 343  VAL C O   1 
ATOM   9341  C  CB  . VAL C 3  343 ? 66.242  41.774  172.537 1.00 27.72 ? 343  VAL C CB  1 
ATOM   9342  C  CG1 . VAL C 3  343 ? 66.579  42.632  171.317 1.00 27.30 ? 343  VAL C CG1 1 
ATOM   9343  C  CG2 . VAL C 3  343 ? 66.884  42.366  173.826 1.00 37.20 ? 343  VAL C CG2 1 
ATOM   9344  N  N   . GLU C 3  344 ? 63.051  39.805  173.008 1.00 28.27 ? 344  GLU C N   1 
ATOM   9345  C  CA  . GLU C 3  344 ? 62.343  38.684  173.652 1.00 28.38 ? 344  GLU C CA  1 
ATOM   9346  C  C   . GLU C 3  344 ? 61.550  37.858  172.605 1.00 28.31 ? 344  GLU C C   1 
ATOM   9347  O  O   . GLU C 3  344 ? 61.487  38.270  171.423 1.00 28.42 ? 344  GLU C O   1 
ATOM   9348  C  CB  . GLU C 3  344 ? 61.461  39.203  174.805 1.00 28.52 ? 344  GLU C CB  1 
ATOM   9349  C  CG  . GLU C 3  344 ? 62.173  39.186  176.155 1.00 34.47 ? 344  GLU C CG  1 
ATOM   9350  C  CD  . GLU C 3  344 ? 61.409  39.909  177.248 1.00 38.03 ? 344  GLU C CD  1 
ATOM   9351  O  OE1 . GLU C 3  344 ? 61.458  41.163  177.287 1.00 36.50 ? 344  GLU C OE1 1 
ATOM   9352  O  OE2 . GLU C 3  344 ? 60.837  39.217  178.124 1.00 40.81 ? 344  GLU C OE2 1 
ATOM   9353  N  N   . HIS C 3  345 ? 60.821  36.826  173.076 1.00 27.83 ? 345  HIS C N   1 
ATOM   9354  C  CA  . HIS C 3  345 ? 60.614  35.552  172.362 1.00 27.84 ? 345  HIS C CA  1 
ATOM   9355  C  C   . HIS C 3  345 ? 60.209  35.572  170.850 1.00 27.64 ? 345  HIS C C   1 
ATOM   9356  O  O   . HIS C 3  345 ? 61.058  35.136  170.029 1.00 28.45 ? 345  HIS C O   1 
ATOM   9357  C  CB  . HIS C 3  345 ? 59.851  34.516  173.222 1.00 28.46 ? 345  HIS C CB  1 
ATOM   9358  C  CG  . HIS C 3  345 ? 59.187  33.425  172.436 1.00 35.22 ? 345  HIS C CG  1 
ATOM   9359  N  ND1 . HIS C 3  345 ? 57.832  33.412  172.186 1.00 36.67 ? 345  HIS C ND1 1 
ATOM   9360  C  CD2 . HIS C 3  345 ? 59.698  32.341  171.804 1.00 40.71 ? 345  HIS C CD2 1 
ATOM   9361  C  CE1 . HIS C 3  345 ? 57.533  32.354  171.454 1.00 40.77 ? 345  HIS C CE1 1 
ATOM   9362  N  NE2 . HIS C 3  345 ? 58.645  31.682  171.217 1.00 43.78 ? 345  HIS C NE2 1 
ATOM   9363  N  N   . PRO C 3  346 ? 58.986  36.038  170.450 1.00 25.96 ? 346  PRO C N   1 
ATOM   9364  C  CA  . PRO C 3  346 ? 58.636  35.989  169.013 1.00 24.23 ? 346  PRO C CA  1 
ATOM   9365  C  C   . PRO C 3  346 ? 59.450  37.016  168.184 1.00 22.70 ? 346  PRO C C   1 
ATOM   9366  O  O   . PRO C 3  346 ? 60.123  36.547  167.257 1.00 22.47 ? 346  PRO C O   1 
ATOM   9367  C  CB  . PRO C 3  346 ? 57.124  36.267  168.989 1.00 23.74 ? 346  PRO C CB  1 
ATOM   9368  C  CG  . PRO C 3  346 ? 56.843  37.043  170.199 1.00 18.09 ? 346  PRO C CG  1 
ATOM   9369  C  CD  . PRO C 3  346 ? 57.940  36.777  171.214 1.00 25.67 ? 346  PRO C CD  1 
ATOM   9370  N  N   . TYR C 3  347 ? 59.768  38.140  168.827 1.00 21.41 ? 347  TYR C N   1 
ATOM   9371  C  CA  . TYR C 3  347 ? 60.363  39.305  168.200 1.00 20.40 ? 347  TYR C CA  1 
ATOM   9372  C  C   . TYR C 3  347 ? 61.786  39.085  167.680 1.00 19.62 ? 347  TYR C C   1 
ATOM   9373  O  O   . TYR C 3  347 ? 62.033  39.445  166.532 1.00 19.74 ? 347  TYR C O   1 
ATOM   9374  C  CB  . TYR C 3  347 ? 60.255  40.533  169.120 1.00 20.30 ? 347  TYR C CB  1 
ATOM   9375  C  CG  . TYR C 3  347 ? 58.835  40.925  169.587 1.00 17.22 ? 347  TYR C CG  1 
ATOM   9376  C  CD1 . TYR C 3  347 ? 57.699  40.812  168.721 1.00 18.77 ? 347  TYR C CD1 1 
ATOM   9377  C  CD2 . TYR C 3  347 ? 58.638  41.518  170.866 1.00 19.52 ? 347  TYR C CD2 1 
ATOM   9378  C  CE1 . TYR C 3  347 ? 56.393  41.231  169.144 1.00 15.36 ? 347  TYR C CE1 1 
ATOM   9379  C  CE2 . TYR C 3  347 ? 57.342  41.993  171.276 1.00 17.09 ? 347  TYR C CE2 1 
ATOM   9380  C  CZ  . TYR C 3  347 ? 56.236  41.846  170.393 1.00 14.95 ? 347  TYR C CZ  1 
ATOM   9381  O  OH  . TYR C 3  347 ? 54.995  42.306  170.740 1.00 13.93 ? 347  TYR C OH  1 
ATOM   9382  N  N   . ILE C 3  348 ? 62.585  38.259  168.398 1.00 19.18 ? 348  ILE C N   1 
ATOM   9383  C  CA  . ILE C 3  348 ? 63.969  37.863  167.994 1.00 18.73 ? 348  ILE C CA  1 
ATOM   9384  C  C   . ILE C 3  348 ? 63.991  37.104  166.655 1.00 18.72 ? 348  ILE C C   1 
ATOM   9385  O  O   . ILE C 3  348 ? 64.627  37.572  165.708 1.00 18.68 ? 348  ILE C O   1 
ATOM   9386  C  CB  . ILE C 3  348 ? 64.783  37.084  169.146 1.00 18.62 ? 348  ILE C CB  1 
ATOM   9387  C  CG1 . ILE C 3  348 ? 65.055  37.993  170.364 1.00 18.08 ? 348  ILE C CG1 1 
ATOM   9388  C  CG2 . ILE C 3  348 ? 66.157  36.505  168.603 1.00 13.09 ? 348  ILE C CG2 1 
ATOM   9389  C  CD1 . ILE C 3  348 ? 65.309  37.233  171.709 1.00 19.06 ? 348  ILE C CD1 1 
ATOM   9390  N  N   . THR C 3  349 ? 63.246  35.989  166.575 1.00 19.00 ? 349  THR C N   1 
ATOM   9391  C  CA  . THR C 3  349 ? 63.279  35.103  165.396 1.00 19.26 ? 349  THR C CA  1 
ATOM   9392  C  C   . THR C 3  349 ? 62.640  35.740  164.172 1.00 19.50 ? 349  THR C C   1 
ATOM   9393  O  O   . THR C 3  349 ? 63.202  35.642  163.066 1.00 20.28 ? 349  THR C O   1 
ATOM   9394  C  CB  . THR C 3  349 ? 62.684  33.711  165.659 1.00 19.44 ? 349  THR C CB  1 
ATOM   9395  O  OG1 . THR C 3  349 ? 61.378  33.845  166.228 1.00 31.73 ? 349  THR C OG1 1 
ATOM   9396  C  CG2 . THR C 3  349 ? 63.517  32.925  166.717 1.00 15.32 ? 349  THR C CG2 1 
ATOM   9397  N  N   . ILE C 3  350 ? 61.567  36.511  164.393 1.00 18.67 ? 350  ILE C N   1 
ATOM   9398  C  CA  . ILE C 3  350 ? 60.924  37.232  163.303 1.00 18.52 ? 350  ILE C CA  1 
ATOM   9399  C  C   . ILE C 3  350 ? 61.739  38.443  162.816 1.00 18.36 ? 350  ILE C C   1 
ATOM   9400  O  O   . ILE C 3  350 ? 61.628  38.818  161.659 1.00 18.28 ? 350  ILE C O   1 
ATOM   9401  C  CB  . ILE C 3  350 ? 59.343  37.491  163.489 1.00 18.76 ? 350  ILE C CB  1 
ATOM   9402  C  CG1 . ILE C 3  350 ? 58.996  38.885  163.975 1.00 25.25 ? 350  ILE C CG1 1 
ATOM   9403  C  CG2 . ILE C 3  350 ? 58.618  36.424  164.269 1.00 13.73 ? 350  ILE C CG2 1 
ATOM   9404  C  CD1 . ILE C 3  350 ? 58.533  39.767  162.856 1.00 5.99  ? 350  ILE C CD1 1 
ATOM   9405  N  N   . GLY C 3  351 ? 62.439  39.096  163.752 1.00 18.47 ? 351  GLY C N   1 
ATOM   9406  C  CA  . GLY C 3  351 ? 63.432  40.128  163.471 1.00 18.90 ? 351  GLY C CA  1 
ATOM   9407  C  C   . GLY C 3  351 ? 64.604  39.652  162.635 1.00 19.41 ? 351  GLY C C   1 
ATOM   9408  O  O   . GLY C 3  351 ? 65.029  40.371  161.729 1.00 19.21 ? 351  GLY C O   1 
ATOM   9409  N  N   . GLN C 3  352 ? 65.086  38.433  162.931 1.00 20.11 ? 352  GLN C N   1 
ATOM   9410  C  CA  . GLN C 3  352 ? 66.063  37.693  162.106 1.00 20.24 ? 352  GLN C CA  1 
ATOM   9411  C  C   . GLN C 3  352 ? 65.552  37.366  160.687 1.00 20.28 ? 352  GLN C C   1 
ATOM   9412  O  O   . GLN C 3  352 ? 66.283  37.577  159.704 1.00 20.36 ? 352  GLN C O   1 
ATOM   9413  C  CB  . GLN C 3  352 ? 66.543  36.417  162.824 1.00 19.80 ? 352  GLN C CB  1 
ATOM   9414  C  CG  . GLN C 3  352 ? 67.408  36.694  164.071 1.00 23.06 ? 352  GLN C CG  1 
ATOM   9415  C  CD  . GLN C 3  352 ? 67.760  35.454  164.897 1.00 24.38 ? 352  GLN C CD  1 
ATOM   9416  O  OE1 . GLN C 3  352 ? 68.924  35.271  165.240 1.00 28.38 ? 352  GLN C OE1 1 
ATOM   9417  N  NE2 . GLN C 3  352 ? 66.746  34.722  165.367 1.00 23.89 ? 352  GLN C NE2 1 
ATOM   9418  N  N   . LEU C 3  353 ? 64.295  36.906  160.599 1.00 20.03 ? 353  LEU C N   1 
ATOM   9419  C  CA  . LEU C 3  353 ? 63.649  36.522  159.331 1.00 19.73 ? 353  LEU C CA  1 
ATOM   9420  C  C   . LEU C 3  353 ? 63.367  37.721  158.411 1.00 19.62 ? 353  LEU C C   1 
ATOM   9421  O  O   . LEU C 3  353 ? 63.625  37.650  157.196 1.00 19.83 ? 353  LEU C O   1 
ATOM   9422  C  CB  . LEU C 3  353 ? 62.370  35.713  159.585 1.00 19.56 ? 353  LEU C CB  1 
ATOM   9423  C  CG  . LEU C 3  353 ? 62.453  34.236  160.029 1.00 26.67 ? 353  LEU C CG  1 
ATOM   9424  C  CD1 . LEU C 3  353 ? 61.087  33.784  160.574 1.00 28.94 ? 353  LEU C CD1 1 
ATOM   9425  C  CD2 . LEU C 3  353 ? 62.925  33.272  158.909 1.00 22.62 ? 353  LEU C CD2 1 
ATOM   9426  N  N   . ALA C 3  354 ? 62.922  38.830  159.016 1.00 18.78 ? 354  ALA C N   1 
ATOM   9427  C  CA  . ALA C 3  354 ? 62.728  40.098  158.324 1.00 18.15 ? 354  ALA C CA  1 
ATOM   9428  C  C   . ALA C 3  354 ? 64.041  40.695  157.791 1.00 18.09 ? 354  ALA C C   1 
ATOM   9429  O  O   . ALA C 3  354 ? 64.118  40.981  156.591 1.00 17.65 ? 354  ALA C O   1 
ATOM   9430  C  CB  . ALA C 3  354 ? 61.969  41.079  159.190 1.00 17.63 ? 354  ALA C CB  1 
ATOM   9431  N  N   . SER C 3  355 ? 65.110  40.551  158.590 1.00 18.50 ? 355  SER C N   1 
ATOM   9432  C  CA  . SER C 3  355 ? 66.483  40.947  158.230 1.00 18.98 ? 355  SER C CA  1 
ATOM   9433  C  C   . SER C 3  355 ? 67.074  40.162  157.067 1.00 19.45 ? 355  SER C C   1 
ATOM   9434  O  O   . SER C 3  355 ? 67.505  40.779  156.100 1.00 19.25 ? 355  SER C O   1 
ATOM   9435  C  CB  . SER C 3  355 ? 67.414  40.912  159.436 1.00 18.74 ? 355  SER C CB  1 
ATOM   9436  O  OG  . SER C 3  355 ? 66.949  41.791  160.435 1.00 16.92 ? 355  SER C OG  1 
ATOM   9437  N  N   . VAL C 3  356 ? 66.910  38.828  157.093 1.00 20.38 ? 356  VAL C N   1 
ATOM   9438  C  CA  . VAL C 3  356 ? 67.229  37.941  155.951 1.00 20.66 ? 356  VAL C CA  1 
ATOM   9439  C  C   . VAL C 3  356 ? 66.463  38.342  154.659 1.00 20.75 ? 356  VAL C C   1 
ATOM   9440  O  O   . VAL C 3  356 ? 67.125  38.712  153.667 1.00 20.57 ? 356  VAL C O   1 
ATOM   9441  C  CB  . VAL C 3  356 ? 67.146  36.414  156.325 1.00 20.82 ? 356  VAL C CB  1 
ATOM   9442  C  CG1 . VAL C 3  356 ? 67.180  35.492  155.073 1.00 23.69 ? 356  VAL C CG1 1 
ATOM   9443  C  CG2 . VAL C 3  356 ? 68.299  36.031  157.273 1.00 15.41 ? 356  VAL C CG2 1 
ATOM   9444  N  N   . LEU C 3  357 ? 65.139  38.544  154.804 1.00 20.80 ? 357  LEU C N   1 
ATOM   9445  C  CA  . LEU C 3  357 ? 64.215  38.903  153.705 1.00 21.22 ? 357  LEU C CA  1 
ATOM   9446  C  C   . LEU C 3  357 ? 64.492  40.248  153.039 1.00 21.94 ? 357  LEU C C   1 
ATOM   9447  O  O   . LEU C 3  357 ? 64.353  40.352  151.811 1.00 22.29 ? 357  LEU C O   1 
ATOM   9448  C  CB  . LEU C 3  357 ? 62.741  38.818  154.140 1.00 21.15 ? 357  LEU C CB  1 
ATOM   9449  C  CG  . LEU C 3  357 ? 61.654  38.645  153.063 1.00 22.75 ? 357  LEU C CG  1 
ATOM   9450  C  CD1 . LEU C 3  357 ? 61.301  37.176  152.867 1.00 29.82 ? 357  LEU C CD1 1 
ATOM   9451  C  CD2 . LEU C 3  357 ? 60.402  39.444  153.440 1.00 21.85 ? 357  LEU C CD2 1 
ATOM   9452  N  N   . TYR C 3  358 ? 64.869  41.255  153.850 1.00 21.80 ? 358  TYR C N   1 
ATOM   9453  C  CA  . TYR C 3  358 ? 65.359  42.558  153.381 1.00 21.58 ? 358  TYR C CA  1 
ATOM   9454  C  C   . TYR C 3  358 ? 66.492  42.380  152.361 1.00 22.15 ? 358  TYR C C   1 
ATOM   9455  O  O   . TYR C 3  358 ? 66.332  42.788  151.192 1.00 22.33 ? 358  TYR C O   1 
ATOM   9456  C  CB  . TYR C 3  358 ? 65.801  43.453  154.569 1.00 21.26 ? 358  TYR C CB  1 
ATOM   9457  C  CG  . TYR C 3  358 ? 66.371  44.830  154.171 1.00 15.39 ? 358  TYR C CG  1 
ATOM   9458  C  CD1 . TYR C 3  358 ? 65.502  45.903  153.849 1.00 10.20 ? 358  TYR C CD1 1 
ATOM   9459  C  CD2 . TYR C 3  358 ? 67.780  45.081  154.175 1.00 19.39 ? 358  TYR C CD2 1 
ATOM   9460  C  CE1 . TYR C 3  358 ? 66.005  47.180  153.506 1.00 12.70 ? 358  TYR C CE1 1 
ATOM   9461  C  CE2 . TYR C 3  358 ? 68.306  46.389  153.826 1.00 13.19 ? 358  TYR C CE2 1 
ATOM   9462  C  CZ  . TYR C 3  358 ? 67.392  47.425  153.527 1.00 13.97 ? 358  TYR C CZ  1 
ATOM   9463  O  OH  . TYR C 3  358 ? 67.824  48.667  153.119 1.00 22.13 ? 358  TYR C OH  1 
ATOM   9464  N  N   . PHE C 3  359 ? 67.528  41.621  152.763 1.00 21.95 ? 359  PHE C N   1 
ATOM   9465  C  CA  . PHE C 3  359 ? 68.697  41.357  151.923 1.00 21.80 ? 359  PHE C CA  1 
ATOM   9466  C  C   . PHE C 3  359 ? 68.410  40.352  150.818 1.00 22.31 ? 359  PHE C C   1 
ATOM   9467  O  O   . PHE C 3  359 ? 69.007  40.435  149.751 1.00 22.42 ? 359  PHE C O   1 
ATOM   9468  C  CB  . PHE C 3  359 ? 69.918  40.939  152.750 1.00 21.54 ? 359  PHE C CB  1 
ATOM   9469  C  CG  . PHE C 3  359 ? 70.426  42.016  153.684 1.00 28.77 ? 359  PHE C CG  1 
ATOM   9470  C  CD1 . PHE C 3  359 ? 71.113  43.161  153.179 1.00 23.93 ? 359  PHE C CD1 1 
ATOM   9471  C  CD2 . PHE C 3  359 ? 70.321  41.847  155.088 1.00 29.17 ? 359  PHE C CD2 1 
ATOM   9472  C  CE1 . PHE C 3  359 ? 71.538  44.208  154.053 1.00 29.49 ? 359  PHE C CE1 1 
ATOM   9473  C  CE2 . PHE C 3  359 ? 70.772  42.869  155.994 1.00 31.66 ? 359  PHE C CE2 1 
ATOM   9474  C  CZ  . PHE C 3  359 ? 71.394  44.049  155.471 1.00 32.58 ? 359  PHE C CZ  1 
ATOM   9475  N  N   . LEU C 3  360 ? 67.434  39.467  151.044 1.00 22.78 ? 360  LEU C N   1 
ATOM   9476  C  CA  . LEU C 3  360 ? 66.977  38.537  150.013 1.00 22.79 ? 360  LEU C CA  1 
ATOM   9477  C  C   . LEU C 3  360 ? 66.189  39.171  148.865 1.00 22.57 ? 360  LEU C C   1 
ATOM   9478  O  O   . LEU C 3  360 ? 66.428  38.815  147.701 1.00 22.83 ? 360  LEU C O   1 
ATOM   9479  C  CB  . LEU C 3  360 ? 66.287  37.304  150.603 1.00 22.25 ? 360  LEU C CB  1 
ATOM   9480  C  CG  . LEU C 3  360 ? 66.523  35.972  149.872 1.00 25.50 ? 360  LEU C CG  1 
ATOM   9481  C  CD1 . LEU C 3  360 ? 67.930  35.374  150.136 1.00 26.44 ? 360  LEU C CD1 1 
ATOM   9482  C  CD2 . LEU C 3  360 ? 65.407  34.950  150.239 1.00 21.15 ? 360  LEU C CD2 1 
ATOM   9483  N  N   . LEU C 3  361 ? 65.310  40.127  149.200 1.00 22.01 ? 361  LEU C N   1 
ATOM   9484  C  CA  . LEU C 3  361 ? 64.507  40.880  148.231 1.00 22.42 ? 361  LEU C CA  1 
ATOM   9485  C  C   . LEU C 3  361 ? 65.387  41.699  147.267 1.00 22.87 ? 361  LEU C C   1 
ATOM   9486  O  O   . LEU C 3  361 ? 65.305  41.498  146.042 1.00 22.72 ? 361  LEU C O   1 
ATOM   9487  C  CB  . LEU C 3  361 ? 63.488  41.793  148.947 1.00 22.50 ? 361  LEU C CB  1 
ATOM   9488  C  CG  . LEU C 3  361 ? 61.950  41.645  149.038 1.00 25.73 ? 361  LEU C CG  1 
ATOM   9489  C  CD1 . LEU C 3  361 ? 61.277  40.515  148.268 1.00 28.42 ? 361  LEU C CD1 1 
ATOM   9490  C  CD2 . LEU C 3  361 ? 61.474  41.664  150.489 1.00 18.50 ? 361  LEU C CD2 1 
ATOM   9491  N  N   . ILE C 3  362 ? 66.365  42.420  147.841 1.00 22.81 ? 362  ILE C N   1 
ATOM   9492  C  CA  . ILE C 3  362 ? 67.211  43.353  147.112 1.00 23.04 ? 362  ILE C CA  1 
ATOM   9493  C  C   . ILE C 3  362 ? 68.289  42.582  146.317 1.00 24.24 ? 362  ILE C C   1 
ATOM   9494  O  O   . ILE C 3  362 ? 68.441  42.820  145.117 1.00 25.14 ? 362  ILE C O   1 
ATOM   9495  C  CB  . ILE C 3  362 ? 67.834  44.477  148.062 1.00 22.67 ? 362  ILE C CB  1 
ATOM   9496  C  CG1 . ILE C 3  362 ? 66.742  45.355  148.711 1.00 17.03 ? 362  ILE C CG1 1 
ATOM   9497  C  CG2 . ILE C 3  362 ? 68.822  45.373  147.275 1.00 7.01  ? 362  ILE C CG2 1 
ATOM   9498  C  CD1 . ILE C 3  362 ? 67.144  46.006  150.076 1.00 15.04 ? 362  ILE C CD1 1 
ATOM   9499  N  N   . LEU C 3  363 ? 69.092  41.766  147.010 1.00 24.47 ? 363  LEU C N   1 
ATOM   9500  C  CA  . LEU C 3  363 ? 70.259  41.106  146.409 1.00 24.40 ? 363  LEU C CA  1 
ATOM   9501  C  C   . LEU C 3  363 ? 69.952  39.948  145.451 1.00 24.52 ? 363  LEU C C   1 
ATOM   9502  O  O   . LEU C 3  363 ? 70.776  39.654  144.568 1.00 24.72 ? 363  LEU C O   1 
ATOM   9503  C  CB  . LEU C 3  363 ? 71.276  40.698  147.483 1.00 24.31 ? 363  LEU C CB  1 
ATOM   9504  C  CG  . LEU C 3  363 ? 72.740  41.165  147.449 1.00 29.46 ? 363  LEU C CG  1 
ATOM   9505  C  CD1 . LEU C 3  363 ? 72.921  42.704  147.439 1.00 10.62 ? 363  LEU C CD1 1 
ATOM   9506  C  CD2 . LEU C 3  363 ? 73.494  40.537  148.628 1.00 27.38 ? 363  LEU C CD2 1 
ATOM   9507  N  N   . VAL C 3  364 ? 68.774  39.314  145.614 1.00 24.30 ? 364  VAL C N   1 
ATOM   9508  C  CA  . VAL C 3  364 ? 68.434  38.028  144.952 1.00 24.08 ? 364  VAL C CA  1 
ATOM   9509  C  C   . VAL C 3  364 ? 67.090  38.088  144.214 1.00 24.82 ? 364  VAL C C   1 
ATOM   9510  O  O   . VAL C 3  364 ? 67.050  37.803  143.020 1.00 25.38 ? 364  VAL C O   1 
ATOM   9511  C  CB  . VAL C 3  364 ? 68.517  36.744  145.913 1.00 23.49 ? 364  VAL C CB  1 
ATOM   9512  C  CG1 . VAL C 3  364 ? 68.305  35.412  145.118 1.00 12.49 ? 364  VAL C CG1 1 
ATOM   9513  C  CG2 . VAL C 3  364 ? 69.857  36.660  146.652 1.00 19.35 ? 364  VAL C CG2 1 
ATOM   9514  N  N   . LEU C 3  365 ? 66.019  38.480  144.922 1.00 24.74 ? 365  LEU C N   1 
ATOM   9515  C  CA  . LEU C 3  365 ? 64.633  38.228  144.508 1.00 24.48 ? 365  LEU C CA  1 
ATOM   9516  C  C   . LEU C 3  365 ? 64.115  39.199  143.436 1.00 24.92 ? 365  LEU C C   1 
ATOM   9517  O  O   . LEU C 3  365 ? 63.627  38.754  142.393 1.00 25.37 ? 365  LEU C O   1 
ATOM   9518  C  CB  . LEU C 3  365 ? 63.700  38.140  145.737 1.00 24.50 ? 365  LEU C CB  1 
ATOM   9519  C  CG  . LEU C 3  365 ? 63.028  36.819  146.237 1.00 31.69 ? 365  LEU C CG  1 
ATOM   9520  C  CD1 . LEU C 3  365 ? 63.845  35.488  146.155 1.00 24.06 ? 365  LEU C CD1 1 
ATOM   9521  C  CD2 . LEU C 3  365 ? 62.410  36.972  147.636 1.00 20.38 ? 365  LEU C CD2 1 
ATOM   9522  N  N   . MET C 3  366 ? 64.322  40.503  143.651 1.00 25.22 ? 366  MET C N   1 
ATOM   9523  C  CA  . MET C 3  366 ? 64.033  41.566  142.658 1.00 24.58 ? 366  MET C CA  1 
ATOM   9524  C  C   . MET C 3  366 ? 64.840  41.482  141.321 1.00 23.65 ? 366  MET C C   1 
ATOM   9525  O  O   . MET C 3  366 ? 64.185  41.480  140.261 1.00 23.68 ? 366  MET C O   1 
ATOM   9526  C  CB  . MET C 3  366 ? 64.037  42.977  143.278 1.00 24.47 ? 366  MET C CB  1 
ATOM   9527  C  CG  . MET C 3  366 ? 62.956  43.219  144.332 1.00 34.72 ? 366  MET C CG  1 
ATOM   9528  S  SD  . MET C 3  366 ? 63.375  44.543  145.516 1.00 36.62 ? 366  MET C SD  1 
ATOM   9529  C  CE  . MET C 3  366 ? 62.369  45.887  144.827 1.00 30.78 ? 366  MET C CE  1 
ATOM   9530  N  N   . PRO C 3  367 ? 66.182  41.245  141.348 1.00 22.95 ? 367  PRO C N   1 
ATOM   9531  C  CA  . PRO C 3  367 ? 66.924  40.852  140.126 1.00 22.49 ? 367  PRO C CA  1 
ATOM   9532  C  C   . PRO C 3  367 ? 66.580  39.501  139.456 1.00 22.27 ? 367  PRO C C   1 
ATOM   9533  O  O   . PRO C 3  367 ? 67.024  39.274  138.327 1.00 22.76 ? 367  PRO C O   1 
ATOM   9534  C  CB  . PRO C 3  367 ? 68.395  40.876  140.576 1.00 22.69 ? 367  PRO C CB  1 
ATOM   9535  C  CG  . PRO C 3  367 ? 68.349  40.804  142.039 1.00 25.33 ? 367  PRO C CG  1 
ATOM   9536  C  CD  . PRO C 3  367 ? 67.148  41.576  142.421 1.00 23.09 ? 367  PRO C CD  1 
ATOM   9537  N  N   . THR C 3  368 ? 65.946  38.580  140.174 1.00 21.31 ? 368  THR C N   1 
ATOM   9538  C  CA  . THR C 3  368 ? 65.399  37.374  139.551 1.00 20.93 ? 368  THR C CA  1 
ATOM   9539  C  C   . THR C 3  368 ? 64.052  37.649  138.861 1.00 20.63 ? 368  THR C C   1 
ATOM   9540  O  O   . THR C 3  368 ? 63.843  37.157  137.746 1.00 20.97 ? 368  THR C O   1 
ATOM   9541  C  CB  . THR C 3  368 ? 65.358  36.195  140.564 1.00 21.13 ? 368  THR C CB  1 
ATOM   9542  O  OG1 . THR C 3  368 ? 66.687  35.993  141.064 1.00 19.92 ? 368  THR C OG1 1 
ATOM   9543  C  CG2 . THR C 3  368 ? 65.027  34.823  139.877 1.00 15.88 ? 368  THR C CG2 1 
ATOM   9544  N  N   . ALA C 3  369 ? 63.214  38.504  139.480 1.00 19.82 ? 369  ALA C N   1 
ATOM   9545  C  CA  . ALA C 3  369 ? 61.912  38.942  138.930 1.00 18.92 ? 369  ALA C CA  1 
ATOM   9546  C  C   . ALA C 3  369 ? 62.042  39.694  137.598 1.00 18.13 ? 369  ALA C C   1 
ATOM   9547  O  O   . ALA C 3  369 ? 61.403  39.309  136.625 1.00 17.74 ? 369  ALA C O   1 
ATOM   9548  C  CB  . ALA C 3  369 ? 61.150  39.779  139.934 1.00 18.46 ? 369  ALA C CB  1 
ATOM   9549  N  N   . GLY C 3  370 ? 63.018  40.607  137.526 1.00 18.13 ? 370  GLY C N   1 
ATOM   9550  C  CA  . GLY C 3  370 ? 63.350  41.349  136.304 1.00 18.00 ? 370  GLY C CA  1 
ATOM   9551  C  C   . GLY C 3  370 ? 63.761  40.479  135.118 1.00 17.59 ? 370  GLY C C   1 
ATOM   9552  O  O   . GLY C 3  370 ? 63.203  40.665  134.033 1.00 17.18 ? 370  GLY C O   1 
ATOM   9553  N  N   . THR C 3  371 ? 64.484  39.381  135.418 1.00 17.85 ? 371  THR C N   1 
ATOM   9554  C  CA  . THR C 3  371 ? 64.970  38.394  134.436 1.00 17.76 ? 371  THR C CA  1 
ATOM   9555  C  C   . THR C 3  371 ? 63.839  37.520  133.928 1.00 18.42 ? 371  THR C C   1 
ATOM   9556  O  O   . THR C 3  371 ? 63.745  37.296  132.710 1.00 18.76 ? 371  THR C O   1 
ATOM   9557  C  CB  . THR C 3  371 ? 66.150  37.555  135.021 1.00 17.82 ? 371  THR C CB  1 
ATOM   9558  O  OG1 . THR C 3  371 ? 67.208  38.442  135.423 1.00 23.26 ? 371  THR C OG1 1 
ATOM   9559  C  CG2 . THR C 3  371 ? 66.840  36.694  133.946 1.00 10.12 ? 371  THR C CG2 1 
ATOM   9560  N  N   . ILE C 3  372 ? 62.992  37.041  134.856 1.00 18.96 ? 372  ILE C N   1 
ATOM   9561  C  CA  . ILE C 3  372 ? 61.770  36.277  134.541 1.00 18.80 ? 372  ILE C CA  1 
ATOM   9562  C  C   . ILE C 3  372 ? 60.805  37.103  133.666 1.00 18.44 ? 372  ILE C C   1 
ATOM   9563  O  O   . ILE C 3  372 ? 60.420  36.644  132.595 1.00 18.56 ? 372  ILE C O   1 
ATOM   9564  C  CB  . ILE C 3  372 ? 61.078  35.669  135.850 1.00 19.19 ? 372  ILE C CB  1 
ATOM   9565  C  CG1 . ILE C 3  372 ? 61.981  34.573  136.479 1.00 24.89 ? 372  ILE C CG1 1 
ATOM   9566  C  CG2 . ILE C 3  372 ? 59.641  35.032  135.504 1.00 12.10 ? 372  ILE C CG2 1 
ATOM   9567  C  CD1 . ILE C 3  372 ? 61.598  34.092  137.929 1.00 21.98 ? 372  ILE C CD1 1 
ATOM   9568  N  N   . GLU C 3  373 ? 60.582  38.360  134.060 1.00 18.45 ? 373  GLU C N   1 
ATOM   9569  C  CA  . GLU C 3  373 ? 59.769  39.336  133.309 1.00 18.30 ? 373  GLU C CA  1 
ATOM   9570  C  C   . GLU C 3  373 ? 60.258  39.631  131.885 1.00 18.05 ? 373  GLU C C   1 
ATOM   9571  O  O   . GLU C 3  373 ? 59.424  39.719  130.956 1.00 18.41 ? 373  GLU C O   1 
ATOM   9572  C  CB  . GLU C 3  373 ? 59.610  40.632  134.086 1.00 17.88 ? 373  GLU C CB  1 
ATOM   9573  C  CG  . GLU C 3  373 ? 58.798  40.505  135.375 1.00 27.96 ? 373  GLU C CG  1 
ATOM   9574  C  CD  . GLU C 3  373 ? 58.905  41.726  136.282 1.00 32.55 ? 373  GLU C CD  1 
ATOM   9575  O  OE1 . GLU C 3  373 ? 57.845  42.180  136.745 1.00 34.90 ? 373  GLU C OE1 1 
ATOM   9576  O  OE2 . GLU C 3  373 ? 60.035  42.165  136.619 1.00 30.62 ? 373  GLU C OE2 1 
ATOM   9577  N  N   . ASN C 3  374 ? 61.593  39.661  131.710 1.00 17.32 ? 374  ASN C N   1 
ATOM   9578  C  CA  . ASN C 3  374 ? 62.257  39.743  130.386 1.00 16.22 ? 374  ASN C CA  1 
ATOM   9579  C  C   . ASN C 3  374 ? 61.958  38.523  129.514 1.00 16.01 ? 374  ASN C C   1 
ATOM   9580  O  O   . ASN C 3  374 ? 61.493  38.684  128.367 1.00 15.87 ? 374  ASN C O   1 
ATOM   9581  C  CB  . ASN C 3  374 ? 63.784  39.938  130.521 1.00 15.46 ? 374  ASN C CB  1 
ATOM   9582  C  CG  . ASN C 3  374 ? 64.182  41.311  131.093 1.00 10.94 ? 374  ASN C CG  1 
ATOM   9583  O  OD1 . ASN C 3  374 ? 63.375  42.239  131.194 1.00 11.33 ? 374  ASN C OD1 1 
ATOM   9584  N  ND2 . ASN C 3  374 ? 65.439  41.422  131.497 1.00 11.25 ? 374  ASN C ND2 1 
ATOM   9585  N  N   . LYS C 3  375 ? 62.116  37.328  130.116 1.00 15.50 ? 375  LYS C N   1 
ATOM   9586  C  CA  . LYS C 3  375 ? 61.903  36.025  129.471 1.00 15.20 ? 375  LYS C CA  1 
ATOM   9587  C  C   . LYS C 3  375 ? 60.446  35.880  129.047 1.00 15.56 ? 375  LYS C C   1 
ATOM   9588  O  O   . LYS C 3  375 ? 60.191  35.628  127.870 1.00 15.32 ? 375  LYS C O   1 
ATOM   9589  C  CB  . LYS C 3  375 ? 62.307  34.881  130.411 1.00 15.54 ? 375  LYS C CB  1 
ATOM   9590  C  CG  . LYS C 3  375 ? 63.333  33.912  129.836 1.00 32.70 ? 375  LYS C CG  1 
ATOM   9591  C  CD  . LYS C 3  375 ? 64.691  34.037  130.546 1.00 35.34 ? 375  LYS C CD  1 
ATOM   9592  C  CE  . LYS C 3  375 ? 65.729  34.757  129.672 1.00 36.69 ? 375  LYS C CE  1 
ATOM   9593  N  NZ  . LYS C 3  375 ? 67.034  34.967  130.374 1.00 30.65 ? 375  LYS C NZ  1 
ATOM   9594  N  N   . LEU C 3  376 ? 59.541  36.347  129.924 1.00 16.55 ? 376  LEU C N   1 
ATOM   9595  C  CA  . LEU C 3  376 ? 58.087  36.379  129.699 1.00 17.01 ? 376  LEU C CA  1 
ATOM   9596  C  C   . LEU C 3  376 ? 57.637  37.249  128.531 1.00 17.56 ? 376  LEU C C   1 
ATOM   9597  O  O   . LEU C 3  376 ? 56.839  36.787  127.701 1.00 17.59 ? 376  LEU C O   1 
ATOM   9598  C  CB  . LEU C 3  376 ? 57.329  36.744  130.994 1.00 16.96 ? 376  LEU C CB  1 
ATOM   9599  C  CG  . LEU C 3  376 ? 57.132  35.632  132.058 1.00 13.49 ? 376  LEU C CG  1 
ATOM   9600  C  CD1 . LEU C 3  376 ? 56.646  36.207  133.373 1.00 11.47 ? 376  LEU C CD1 1 
ATOM   9601  C  CD2 . LEU C 3  376 ? 56.166  34.547  131.605 1.00 10.67 ? 376  LEU C CD2 1 
ATOM   9602  N  N   . LEU C 3  377 ? 58.293  38.410  128.375 1.00 18.20 ? 377  LEU C N   1 
ATOM   9603  C  CA  . LEU C 3  377 ? 58.111  39.292  127.211 1.00 18.85 ? 377  LEU C CA  1 
ATOM   9604  C  C   . LEU C 3  377 ? 58.927  38.969  125.937 1.00 19.66 ? 377  LEU C C   1 
ATOM   9605  O  O   . LEU C 3  377 ? 58.754  39.659  124.931 1.00 19.77 ? 377  LEU C O   1 
ATOM   9606  C  CB  . LEU C 3  377 ? 58.265  40.763  127.612 1.00 18.89 ? 377  LEU C CB  1 
ATOM   9607  C  CG  . LEU C 3  377 ? 57.171  41.510  128.379 1.00 14.93 ? 377  LEU C CG  1 
ATOM   9608  C  CD1 . LEU C 3  377 ? 57.686  42.881  128.700 1.00 16.95 ? 377  LEU C CD1 1 
ATOM   9609  C  CD2 . LEU C 3  377 ? 55.804  41.610  127.665 1.00 16.76 ? 377  LEU C CD2 1 
ATOM   9610  N  N   . LYS C 3  378 ? 59.577  37.785  125.923 1.00 20.63 ? 378  LYS C N   1 
ATOM   9611  C  CA  . LYS C 3  378 ? 60.488  37.293  124.848 1.00 21.92 ? 378  LYS C CA  1 
ATOM   9612  C  C   . LYS C 3  378 ? 61.681  38.256  124.515 1.00 23.52 ? 378  LYS C C   1 
ATOM   9613  O  O   . LYS C 3  378 ? 62.214  38.242  123.383 1.00 23.12 ? 378  LYS C O   1 
ATOM   9614  C  CB  . LYS C 3  378 ? 59.710  36.855  123.581 1.00 21.89 ? 378  LYS C CB  1 
ATOM   9615  C  CG  . LYS C 3  378 ? 58.788  35.645  123.747 1.00 32.55 ? 378  LYS C CG  1 
ATOM   9616  C  CD  . LYS C 3  378 ? 57.985  35.372  122.475 1.00 34.18 ? 378  LYS C CD  1 
ATOM   9617  C  CE  . LYS C 3  378 ? 56.562  35.927  122.571 1.00 41.43 ? 378  LYS C CE  1 
ATOM   9618  N  NZ  . LYS C 3  378 ? 55.598  35.110  121.774 1.00 40.10 ? 378  LYS C NZ  1 
ATOM   9619  N  N   . TRP C 3  379 ? 62.248  38.835  125.585 1.00 25.08 ? 379  TRP C N   1 
ATOM   9620  C  CA  . TRP C 3  379 ? 63.246  39.914  125.527 1.00 27.02 ? 379  TRP C CA  1 
ATOM   9621  C  C   . TRP C 3  379 ? 64.593  39.458  126.094 1.00 28.62 ? 379  TRP C C   1 
ATOM   9622  O  O   . TRP C 3  379 ? 64.667  38.666  127.040 1.00 28.92 ? 379  TRP C O   1 
ATOM   9623  C  CB  . TRP C 3  379 ? 62.754  41.116  126.354 1.00 27.14 ? 379  TRP C CB  1 
ATOM   9624  C  CG  . TRP C 3  379 ? 62.405  42.344  125.594 1.00 20.58 ? 379  TRP C CG  1 
ATOM   9625  C  CD1 . TRP C 3  379 ? 62.790  42.674  124.312 1.00 35.44 ? 379  TRP C CD1 1 
ATOM   9626  C  CD2 . TRP C 3  379 ? 61.672  43.472  126.085 1.00 25.76 ? 379  TRP C CD2 1 
ATOM   9627  N  NE1 . TRP C 3  379 ? 62.448  43.976  124.024 1.00 36.16 ? 379  TRP C NE1 1 
ATOM   9628  C  CE2 . TRP C 3  379 ? 61.750  44.497  125.079 1.00 30.37 ? 379  TRP C CE2 1 
ATOM   9629  C  CE3 . TRP C 3  379 ? 61.052  43.782  127.316 1.00 28.64 ? 379  TRP C CE3 1 
ATOM   9630  C  CZ2 . TRP C 3  379 ? 61.110  45.760  125.213 1.00 24.74 ? 379  TRP C CZ2 1 
ATOM   9631  C  CZ3 . TRP C 3  379 ? 60.462  45.090  127.480 1.00 28.11 ? 379  TRP C CZ3 1 
ATOM   9632  C  CH2 . TRP C 3  379 ? 60.513  46.051  126.432 1.00 25.96 ? 379  TRP C CH2 1 
ATOM   9633  O  OXT . TRP C 3  379 ? 65.648  40.027  125.787 1.00 29.54 ? 379  TRP C OXT 1 
ATOM   9634  N  N   . SER D 4  1   ? 57.877  42.060  190.367 1.00 37.08 ? 1    SER D N   1 
ATOM   9635  C  CA  . SER D 4  1   ? 58.702  42.413  189.169 1.00 37.28 ? 1    SER D CA  1 
ATOM   9636  C  C   . SER D 4  1   ? 58.197  41.751  187.860 1.00 37.22 ? 1    SER D C   1 
ATOM   9637  O  O   . SER D 4  1   ? 57.223  40.968  187.892 1.00 37.25 ? 1    SER D O   1 
ATOM   9638  C  CB  . SER D 4  1   ? 60.183  42.092  189.434 1.00 37.40 ? 1    SER D CB  1 
ATOM   9639  O  OG  . SER D 4  1   ? 61.019  42.769  188.507 1.00 38.34 ? 1    SER D OG  1 
ATOM   9640  N  N   . ASP D 4  2   ? 58.796  42.165  186.722 1.00 36.96 ? 2    ASP D N   1 
ATOM   9641  C  CA  . ASP D 4  2   ? 58.540  41.655  185.342 1.00 36.58 ? 2    ASP D CA  1 
ATOM   9642  C  C   . ASP D 4  2   ? 57.182  42.043  184.724 1.00 35.73 ? 2    ASP D C   1 
ATOM   9643  O  O   . ASP D 4  2   ? 57.150  42.721  183.682 1.00 35.69 ? 2    ASP D O   1 
ATOM   9644  C  CB  . ASP D 4  2   ? 58.863  40.145  185.167 1.00 36.84 ? 2    ASP D CB  1 
ATOM   9645  C  CG  . ASP D 4  2   ? 60.220  39.903  184.519 1.00 43.30 ? 2    ASP D CG  1 
ATOM   9646  O  OD1 . ASP D 4  2   ? 61.230  39.833  185.254 1.00 45.50 ? 2    ASP D OD1 1 
ATOM   9647  O  OD2 . ASP D 4  2   ? 60.366  39.717  183.291 1.00 44.59 ? 2    ASP D OD2 1 
ATOM   9648  N  N   . LEU D 4  3   ? 56.085  41.603  185.364 1.00 34.82 ? 3    LEU D N   1 
ATOM   9649  C  CA  . LEU D 4  3   ? 54.706  41.916  184.947 1.00 33.78 ? 3    LEU D CA  1 
ATOM   9650  C  C   . LEU D 4  3   ? 54.330  43.386  185.174 1.00 32.88 ? 3    LEU D C   1 
ATOM   9651  O  O   . LEU D 4  3   ? 54.855  44.039  186.092 1.00 32.76 ? 3    LEU D O   1 
ATOM   9652  C  CB  . LEU D 4  3   ? 53.701  40.986  185.638 1.00 33.68 ? 3    LEU D CB  1 
ATOM   9653  C  CG  . LEU D 4  3   ? 53.528  39.575  185.061 1.00 34.21 ? 3    LEU D CG  1 
ATOM   9654  C  CD1 . LEU D 4  3   ? 53.392  38.553  186.190 1.00 30.82 ? 3    LEU D CD1 1 
ATOM   9655  C  CD2 . LEU D 4  3   ? 52.331  39.488  184.096 1.00 33.33 ? 3    LEU D CD2 1 
ATOM   9656  N  N   . GLU D 4  4   ? 53.467  43.898  184.290 1.00 32.15 ? 4    GLU D N   1 
ATOM   9657  C  CA  . GLU D 4  4   ? 53.028  45.303  184.280 1.00 31.52 ? 4    GLU D CA  1 
ATOM   9658  C  C   . GLU D 4  4   ? 51.510  45.440  184.066 1.00 30.45 ? 4    GLU D C   1 
ATOM   9659  O  O   . GLU D 4  4   ? 50.866  44.525  183.516 1.00 30.28 ? 4    GLU D O   1 
ATOM   9660  C  CB  . GLU D 4  4   ? 53.798  46.098  183.210 1.00 31.87 ? 4    GLU D CB  1 
ATOM   9661  C  CG  . GLU D 4  4   ? 55.187  46.571  183.646 1.00 41.12 ? 4    GLU D CG  1 
ATOM   9662  C  CD  . GLU D 4  4   ? 55.268  48.077  183.889 1.00 44.94 ? 4    GLU D CD  1 
ATOM   9663  O  OE1 . GLU D 4  4   ? 54.758  48.546  184.934 1.00 45.44 ? 4    GLU D OE1 1 
ATOM   9664  O  OE2 . GLU D 4  4   ? 55.918  48.782  183.079 1.00 42.77 ? 4    GLU D OE2 1 
ATOM   9665  N  N   . LEU D 4  5   ? 50.939  46.498  184.661 1.00 29.49 ? 5    LEU D N   1 
ATOM   9666  C  CA  . LEU D 4  5   ? 49.612  47.021  184.303 1.00 28.62 ? 5    LEU D CA  1 
ATOM   9667  C  C   . LEU D 4  5   ? 49.692  48.487  183.869 1.00 28.12 ? 5    LEU D C   1 
ATOM   9668  O  O   . LEU D 4  5   ? 50.273  49.323  184.582 1.00 28.11 ? 5    LEU D O   1 
ATOM   9669  C  CB  . LEU D 4  5   ? 48.592  46.792  185.448 1.00 28.39 ? 5    LEU D CB  1 
ATOM   9670  C  CG  . LEU D 4  5   ? 47.482  47.790  185.844 1.00 24.68 ? 5    LEU D CG  1 
ATOM   9671  C  CD1 . LEU D 4  5   ? 46.177  47.559  185.075 1.00 21.92 ? 5    LEU D CD1 1 
ATOM   9672  C  CD2 . LEU D 4  5   ? 47.262  47.806  187.346 1.00 22.57 ? 5    LEU D CD2 1 
ATOM   9673  N  N   . HIS D 4  6   ? 48.928  48.793  182.813 1.00 27.72 ? 6    HIS D N   1 
ATOM   9674  C  CA  . HIS D 4  6   ? 48.968  50.068  182.082 1.00 27.22 ? 6    HIS D CA  1 
ATOM   9675  C  C   . HIS D 4  6   ? 47.706  50.926  182.383 1.00 26.60 ? 6    HIS D C   1 
ATOM   9676  O  O   . HIS D 4  6   ? 46.612  50.355  182.477 1.00 26.62 ? 6    HIS D O   1 
ATOM   9677  C  CB  . HIS D 4  6   ? 49.117  49.816  180.562 1.00 27.35 ? 6    HIS D CB  1 
ATOM   9678  C  CG  . HIS D 4  6   ? 50.408  49.147  180.178 1.00 28.37 ? 6    HIS D CG  1 
ATOM   9679  N  ND1 . HIS D 4  6   ? 50.460  47.863  179.673 1.00 28.93 ? 6    HIS D ND1 1 
ATOM   9680  C  CD2 . HIS D 4  6   ? 51.692  49.578  180.239 1.00 25.27 ? 6    HIS D CD2 1 
ATOM   9681  C  CE1 . HIS D 4  6   ? 51.721  47.525  179.465 1.00 28.90 ? 6    HIS D CE1 1 
ATOM   9682  N  NE2 . HIS D 4  6   ? 52.488  48.545  179.806 1.00 22.61 ? 6    HIS D NE2 1 
ATOM   9683  N  N   . PRO D 4  7   ? 47.856  52.265  182.552 1.00 26.28 ? 7    PRO D N   1 
ATOM   9684  C  CA  . PRO D 4  7   ? 46.762  53.138  183.040 1.00 25.75 ? 7    PRO D CA  1 
ATOM   9685  C  C   . PRO D 4  7   ? 45.500  53.221  182.133 1.00 25.09 ? 7    PRO D C   1 
ATOM   9686  O  O   . PRO D 4  7   ? 45.673  52.996  180.921 1.00 25.02 ? 7    PRO D O   1 
ATOM   9687  C  CB  . PRO D 4  7   ? 47.431  54.509  183.119 1.00 25.73 ? 7    PRO D CB  1 
ATOM   9688  C  CG  . PRO D 4  7   ? 48.863  54.201  183.202 1.00 25.22 ? 7    PRO D CG  1 
ATOM   9689  C  CD  . PRO D 4  7   ? 49.074  53.073  182.303 1.00 26.11 ? 7    PRO D CD  1 
ATOM   9690  N  N   . PRO D 4  8   ? 44.285  53.445  182.696 1.00 24.38 ? 8    PRO D N   1 
ATOM   9691  C  CA  . PRO D 4  8   ? 43.089  53.717  181.873 1.00 23.65 ? 8    PRO D CA  1 
ATOM   9692  C  C   . PRO D 4  8   ? 43.003  55.178  181.406 1.00 22.72 ? 8    PRO D C   1 
ATOM   9693  O  O   . PRO D 4  8   ? 43.789  56.016  181.889 1.00 22.61 ? 8    PRO D O   1 
ATOM   9694  C  CB  . PRO D 4  8   ? 41.925  53.359  182.814 1.00 23.92 ? 8    PRO D CB  1 
ATOM   9695  C  CG  . PRO D 4  8   ? 42.445  53.588  184.190 1.00 28.52 ? 8    PRO D CG  1 
ATOM   9696  C  CD  . PRO D 4  8   ? 43.946  53.476  184.140 1.00 24.40 ? 8    PRO D CD  1 
ATOM   9697  N  N   . SER D 4  9   ? 42.059  55.468  180.500 1.00 22.04 ? 9    SER D N   1 
ATOM   9698  C  CA  . SER D 4  9   ? 41.873  56.815  179.944 1.00 21.58 ? 9    SER D CA  1 
ATOM   9699  C  C   . SER D 4  9   ? 40.771  57.618  180.642 1.00 21.13 ? 9    SER D C   1 
ATOM   9700  O  O   . SER D 4  9   ? 39.573  57.356  180.460 1.00 20.97 ? 9    SER D O   1 
ATOM   9701  C  CB  . SER D 4  9   ? 41.705  56.776  178.419 1.00 21.51 ? 9    SER D CB  1 
ATOM   9702  O  OG  . SER D 4  9   ? 42.970  56.812  177.786 1.00 14.48 ? 9    SER D OG  1 
ATOM   9703  N  N   . TYR D 4  10  ? 41.211  58.511  181.533 1.00 20.96 ? 10   TYR D N   1 
ATOM   9704  C  CA  . TYR D 4  10  ? 40.330  59.447  182.248 1.00 20.66 ? 10   TYR D CA  1 
ATOM   9705  C  C   . TYR D 4  10  ? 39.942  60.652  181.340 1.00 19.90 ? 10   TYR D C   1 
ATOM   9706  O  O   . TYR D 4  10  ? 40.769  61.043  180.511 1.00 19.94 ? 10   TYR D O   1 
ATOM   9707  C  CB  . TYR D 4  10  ? 40.961  59.888  183.586 1.00 20.69 ? 10   TYR D CB  1 
ATOM   9708  C  CG  . TYR D 4  10  ? 41.139  58.747  184.597 1.00 21.83 ? 10   TYR D CG  1 
ATOM   9709  C  CD1 . TYR D 4  10  ? 40.090  58.392  185.494 1.00 23.19 ? 10   TYR D CD1 1 
ATOM   9710  C  CD2 . TYR D 4  10  ? 42.366  58.029  184.680 1.00 24.25 ? 10   TYR D CD2 1 
ATOM   9711  C  CE1 . TYR D 4  10  ? 40.242  57.301  186.435 1.00 24.23 ? 10   TYR D CE1 1 
ATOM   9712  C  CE2 . TYR D 4  10  ? 42.545  56.956  185.635 1.00 23.19 ? 10   TYR D CE2 1 
ATOM   9713  C  CZ  . TYR D 4  10  ? 41.473  56.598  186.494 1.00 24.79 ? 10   TYR D CZ  1 
ATOM   9714  O  OH  . TYR D 4  10  ? 41.617  55.538  187.369 1.00 17.09 ? 10   TYR D OH  1 
ATOM   9715  N  N   . PRO D 4  11  ? 38.664  61.115  181.367 1.00 19.13 ? 11   PRO D N   1 
ATOM   9716  C  CA  . PRO D 4  11  ? 38.213  62.189  180.468 1.00 18.32 ? 11   PRO D CA  1 
ATOM   9717  C  C   . PRO D 4  11  ? 38.372  63.591  181.096 1.00 18.00 ? 11   PRO D C   1 
ATOM   9718  O  O   . PRO D 4  11  ? 37.395  64.226  181.548 1.00 18.11 ? 11   PRO D O   1 
ATOM   9719  C  CB  . PRO D 4  11  ? 36.747  61.813  180.183 1.00 18.21 ? 11   PRO D CB  1 
ATOM   9720  C  CG  . PRO D 4  11  ? 36.318  60.966  181.374 1.00 19.65 ? 11   PRO D CG  1 
ATOM   9721  C  CD  . PRO D 4  11  ? 37.539  60.669  182.221 1.00 19.01 ? 11   PRO D CD  1 
ATOM   9722  N  N   . TRP D 4  12  ? 39.643  63.988  181.232 1.00 17.78 ? 12   TRP D N   1 
ATOM   9723  C  CA  . TRP D 4  12  ? 40.077  65.380  181.516 1.00 17.67 ? 12   TRP D CA  1 
ATOM   9724  C  C   . TRP D 4  12  ? 39.357  66.403  180.641 1.00 17.68 ? 12   TRP D C   1 
ATOM   9725  O  O   . TRP D 4  12  ? 39.159  66.168  179.435 1.00 17.51 ? 12   TRP D O   1 
ATOM   9726  C  CB  . TRP D 4  12  ? 41.602  65.549  181.338 1.00 17.11 ? 12   TRP D CB  1 
ATOM   9727  C  CG  . TRP D 4  12  ? 42.432  64.375  181.812 1.00 15.96 ? 12   TRP D CG  1 
ATOM   9728  C  CD1 . TRP D 4  12  ? 42.829  63.303  181.062 1.00 17.24 ? 12   TRP D CD1 1 
ATOM   9729  C  CD2 . TRP D 4  12  ? 42.867  64.100  183.156 1.00 16.19 ? 12   TRP D CD2 1 
ATOM   9730  N  NE1 . TRP D 4  12  ? 43.386  62.331  181.861 1.00 13.91 ? 12   TRP D NE1 1 
ATOM   9731  C  CE2 . TRP D 4  12  ? 43.508  62.817  183.134 1.00 6.81  ? 12   TRP D CE2 1 
ATOM   9732  C  CE3 . TRP D 4  12  ? 42.811  64.814  184.383 1.00 10.83 ? 12   TRP D CE3 1 
ATOM   9733  C  CZ2 . TRP D 4  12  ? 44.111  62.236  184.279 1.00 3.62  ? 12   TRP D CZ2 1 
ATOM   9734  C  CZ3 . TRP D 4  12  ? 43.393  64.219  185.548 1.00 12.25 ? 12   TRP D CZ3 1 
ATOM   9735  C  CH2 . TRP D 4  12  ? 44.055  62.949  185.471 1.00 8.15  ? 12   TRP D CH2 1 
ATOM   9736  N  N   . SER D 4  13  ? 38.985  67.530  181.263 1.00 17.87 ? 13   SER D N   1 
ATOM   9737  C  CA  . SER D 4  13  ? 38.492  68.744  180.576 1.00 18.18 ? 13   SER D CA  1 
ATOM   9738  C  C   . SER D 4  13  ? 39.416  69.324  179.453 1.00 18.48 ? 13   SER D C   1 
ATOM   9739  O  O   . SER D 4  13  ? 38.965  70.150  178.643 1.00 18.07 ? 13   SER D O   1 
ATOM   9740  C  CB  . SER D 4  13  ? 38.146  69.820  181.607 1.00 17.87 ? 13   SER D CB  1 
ATOM   9741  O  OG  . SER D 4  13  ? 37.068  70.611  181.153 1.00 21.78 ? 13   SER D OG  1 
ATOM   9742  N  N   . HIS D 4  14  ? 40.632  68.761  179.350 1.00 19.13 ? 14   HIS D N   1 
ATOM   9743  C  CA  . HIS D 4  14  ? 41.703  69.182  178.443 1.00 20.03 ? 14   HIS D CA  1 
ATOM   9744  C  C   . HIS D 4  14  ? 42.233  68.090  177.449 1.00 21.03 ? 14   HIS D C   1 
ATOM   9745  O  O   . HIS D 4  14  ? 43.167  68.363  176.664 1.00 21.29 ? 14   HIS D O   1 
ATOM   9746  C  CB  . HIS D 4  14  ? 42.839  69.836  179.248 1.00 19.75 ? 14   HIS D CB  1 
ATOM   9747  C  CG  . HIS D 4  14  ? 43.551  68.902  180.177 1.00 18.24 ? 14   HIS D CG  1 
ATOM   9748  N  ND1 . HIS D 4  14  ? 43.258  68.826  181.523 1.00 19.33 ? 14   HIS D ND1 1 
ATOM   9749  C  CD2 . HIS D 4  14  ? 44.623  68.098  179.979 1.00 16.00 ? 14   HIS D CD2 1 
ATOM   9750  C  CE1 . HIS D 4  14  ? 44.111  68.006  182.111 1.00 18.49 ? 14   HIS D CE1 1 
ATOM   9751  N  NE2 . HIS D 4  14  ? 44.944  67.544  181.194 1.00 15.96 ? 14   HIS D NE2 1 
ATOM   9752  N  N   . ARG D 4  15  ? 41.507  66.961  177.366 1.00 21.83 ? 15   ARG D N   1 
ATOM   9753  C  CA  . ARG D 4  15  ? 41.872  65.789  176.543 1.00 22.41 ? 15   ARG D CA  1 
ATOM   9754  C  C   . ARG D 4  15  ? 41.717  66.034  175.029 1.00 22.82 ? 15   ARG D C   1 
ATOM   9755  O  O   . ARG D 4  15  ? 42.736  66.036  174.313 1.00 23.28 ? 15   ARG D O   1 
ATOM   9756  C  CB  . ARG D 4  15  ? 41.114  64.531  176.996 1.00 22.39 ? 15   ARG D CB  1 
ATOM   9757  C  CG  . ARG D 4  15  ? 41.823  63.196  176.684 1.00 26.65 ? 15   ARG D CG  1 
ATOM   9758  C  CD  . ARG D 4  15  ? 41.131  61.937  177.245 1.00 30.72 ? 15   ARG D CD  1 
ATOM   9759  N  NE  . ARG D 4  15  ? 39.785  61.707  176.677 1.00 37.08 ? 15   ARG D NE  1 
ATOM   9760  C  CZ  . ARG D 4  15  ? 38.897  60.768  177.075 1.00 41.33 ? 15   ARG D CZ  1 
ATOM   9761  N  NH1 . ARG D 4  15  ? 39.192  59.862  178.017 1.00 40.20 ? 15   ARG D NH1 1 
ATOM   9762  N  NH2 . ARG D 4  15  ? 37.708  60.712  176.483 1.00 38.77 ? 15   ARG D NH2 1 
ATOM   9763  N  N   . GLY D 4  16  ? 40.502  66.435  174.609 1.00 22.57 ? 16   GLY D N   1 
ATOM   9764  C  CA  . GLY D 4  16  ? 40.129  66.625  173.201 1.00 22.37 ? 16   GLY D CA  1 
ATOM   9765  C  C   . GLY D 4  16  ? 40.884  67.731  172.475 1.00 22.24 ? 16   GLY D C   1 
ATOM   9766  O  O   . GLY D 4  16  ? 41.463  68.617  173.130 1.00 22.43 ? 16   GLY D O   1 
ATOM   9767  N  N   . LEU D 4  17  ? 40.885  67.672  171.134 1.00 21.83 ? 17   LEU D N   1 
ATOM   9768  C  CA  . LEU D 4  17  ? 41.861  68.400  170.286 1.00 21.31 ? 17   LEU D CA  1 
ATOM   9769  C  C   . LEU D 4  17  ? 41.876  69.928  170.430 1.00 20.38 ? 17   LEU D C   1 
ATOM   9770  O  O   . LEU D 4  17  ? 42.956  70.521  170.494 1.00 20.30 ? 17   LEU D O   1 
ATOM   9771  C  CB  . LEU D 4  17  ? 41.758  67.997  168.804 1.00 21.62 ? 17   LEU D CB  1 
ATOM   9772  C  CG  . LEU D 4  17  ? 42.391  66.706  168.236 1.00 30.02 ? 17   LEU D CG  1 
ATOM   9773  C  CD1 . LEU D 4  17  ? 42.147  66.663  166.734 1.00 29.00 ? 17   LEU D CD1 1 
ATOM   9774  C  CD2 . LEU D 4  17  ? 43.904  66.485  168.539 1.00 32.00 ? 17   LEU D CD2 1 
ATOM   9775  N  N   . LEU D 4  18  ? 40.694  70.507  170.671 1.00 19.68 ? 18   LEU D N   1 
ATOM   9776  C  CA  . LEU D 4  18  ? 40.524  71.946  170.936 1.00 19.11 ? 18   LEU D CA  1 
ATOM   9777  C  C   . LEU D 4  18  ? 40.234  72.340  172.414 1.00 18.99 ? 18   LEU D C   1 
ATOM   9778  O  O   . LEU D 4  18  ? 39.996  73.528  172.711 1.00 18.93 ? 18   LEU D O   1 
ATOM   9779  C  CB  . LEU D 4  18  ? 39.501  72.563  169.953 1.00 18.97 ? 18   LEU D CB  1 
ATOM   9780  C  CG  . LEU D 4  18  ? 39.605  72.357  168.423 1.00 22.06 ? 18   LEU D CG  1 
ATOM   9781  C  CD1 . LEU D 4  18  ? 38.389  72.945  167.723 1.00 22.54 ? 18   LEU D CD1 1 
ATOM   9782  C  CD2 . LEU D 4  18  ? 40.912  72.904  167.796 1.00 25.49 ? 18   LEU D CD2 1 
ATOM   9783  N  N   . SER D 4  19  ? 40.463  71.395  173.339 1.00 18.86 ? 19   SER D N   1 
ATOM   9784  C  CA  . SER D 4  19  ? 40.039  71.529  174.746 1.00 18.72 ? 19   SER D CA  1 
ATOM   9785  C  C   . SER D 4  19  ? 41.164  72.047  175.638 1.00 18.70 ? 19   SER D C   1 
ATOM   9786  O  O   . SER D 4  19  ? 42.189  71.371  175.839 1.00 18.62 ? 19   SER D O   1 
ATOM   9787  C  CB  . SER D 4  19  ? 39.424  70.230  175.301 1.00 18.60 ? 19   SER D CB  1 
ATOM   9788  O  OG  . SER D 4  19  ? 38.529  69.626  174.384 1.00 14.37 ? 19   SER D OG  1 
ATOM   9789  N  N   . SER D 4  20  ? 40.998  73.302  176.069 1.00 18.71 ? 20   SER D N   1 
ATOM   9790  C  CA  . SER D 4  20  ? 41.836  73.942  177.087 1.00 18.70 ? 20   SER D CA  1 
ATOM   9791  C  C   . SER D 4  20  ? 41.774  73.249  178.447 1.00 19.08 ? 20   SER D C   1 
ATOM   9792  O  O   . SER D 4  20  ? 40.794  72.553  178.769 1.00 19.53 ? 20   SER D O   1 
ATOM   9793  C  CB  . SER D 4  20  ? 41.492  75.437  177.211 1.00 18.60 ? 20   SER D CB  1 
ATOM   9794  O  OG  . SER D 4  20  ? 40.475  75.682  178.171 1.00 15.94 ? 20   SER D OG  1 
ATOM   9795  N  N   . LEU D 4  21  ? 42.831  73.468  179.230 1.00 19.17 ? 21   LEU D N   1 
ATOM   9796  C  CA  . LEU D 4  21  ? 42.841  73.290  180.685 1.00 19.10 ? 21   LEU D CA  1 
ATOM   9797  C  C   . LEU D 4  21  ? 41.770  74.096  181.433 1.00 19.31 ? 21   LEU D C   1 
ATOM   9798  O  O   . LEU D 4  21  ? 41.375  75.190  180.990 1.00 19.05 ? 21   LEU D O   1 
ATOM   9799  C  CB  . LEU D 4  21  ? 44.231  73.607  181.241 1.00 18.88 ? 21   LEU D CB  1 
ATOM   9800  C  CG  . LEU D 4  21  ? 45.416  72.702  180.876 1.00 14.39 ? 21   LEU D CG  1 
ATOM   9801  C  CD1 . LEU D 4  21  ? 46.686  73.541  180.712 1.00 10.18 ? 21   LEU D CD1 1 
ATOM   9802  C  CD2 . LEU D 4  21  ? 45.617  71.589  181.902 1.00 9.42  ? 21   LEU D CD2 1 
ATOM   9803  N  N   . ASP D 4  22  ? 41.182  73.446  182.443 1.00 20.02 ? 22   ASP D N   1 
ATOM   9804  C  CA  . ASP D 4  22  ? 40.433  74.115  183.517 1.00 20.62 ? 22   ASP D CA  1 
ATOM   9805  C  C   . ASP D 4  22  ? 41.413  74.808  184.470 1.00 20.61 ? 22   ASP D C   1 
ATOM   9806  O  O   . ASP D 4  22  ? 42.224  74.144  185.143 1.00 20.77 ? 22   ASP D O   1 
ATOM   9807  C  CB  . ASP D 4  22  ? 39.521  73.117  184.274 1.00 20.86 ? 22   ASP D CB  1 
ATOM   9808  C  CG  . ASP D 4  22  ? 38.365  73.803  185.014 1.00 25.65 ? 22   ASP D CG  1 
ATOM   9809  O  OD1 . ASP D 4  22  ? 38.618  74.682  185.873 1.00 26.46 ? 22   ASP D OD1 1 
ATOM   9810  O  OD2 . ASP D 4  22  ? 37.171  73.448  184.878 1.00 28.35 ? 22   ASP D OD2 1 
ATOM   9811  N  N   . HIS D 4  23  ? 41.388  76.143  184.426 1.00 20.34 ? 23   HIS D N   1 
ATOM   9812  C  CA  . HIS D 4  23  ? 42.282  76.998  185.209 1.00 20.21 ? 23   HIS D CA  1 
ATOM   9813  C  C   . HIS D 4  23  ? 41.899  77.156  186.691 1.00 19.95 ? 23   HIS D C   1 
ATOM   9814  O  O   . HIS D 4  23  ? 42.785  77.402  187.529 1.00 19.66 ? 23   HIS D O   1 
ATOM   9815  C  CB  . HIS D 4  23  ? 42.467  78.349  184.530 1.00 20.19 ? 23   HIS D CB  1 
ATOM   9816  C  CG  . HIS D 4  23  ? 43.306  78.292  183.291 1.00 27.64 ? 23   HIS D CG  1 
ATOM   9817  N  ND1 . HIS D 4  23  ? 44.608  78.740  183.256 1.00 29.41 ? 23   HIS D ND1 1 
ATOM   9818  C  CD2 . HIS D 4  23  ? 43.029  77.848  182.041 1.00 28.77 ? 23   HIS D CD2 1 
ATOM   9819  C  CE1 . HIS D 4  23  ? 45.105  78.550  182.047 1.00 29.43 ? 23   HIS D CE1 1 
ATOM   9820  N  NE2 . HIS D 4  23  ? 44.169  78.000  181.294 1.00 27.05 ? 23   HIS D NE2 1 
ATOM   9821  N  N   . THR D 4  24  ? 40.594  77.027  187.000 1.00 19.95 ? 24   THR D N   1 
ATOM   9822  C  CA  . THR D 4  24  ? 40.094  76.819  188.387 1.00 19.76 ? 24   THR D CA  1 
ATOM   9823  C  C   . THR D 4  24  ? 40.655  75.531  189.009 1.00 19.57 ? 24   THR D C   1 
ATOM   9824  O  O   . THR D 4  24  ? 41.127  75.556  190.145 1.00 19.61 ? 24   THR D O   1 
ATOM   9825  C  CB  . THR D 4  24  ? 38.522  76.856  188.482 1.00 19.77 ? 24   THR D CB  1 
ATOM   9826  O  OG1 . THR D 4  24  ? 37.979  77.763  187.511 1.00 25.03 ? 24   THR D OG1 1 
ATOM   9827  C  CG2 . THR D 4  24  ? 38.068  77.468  189.812 1.00 20.34 ? 24   THR D CG2 1 
ATOM   9828  N  N   . SER D 4  25  ? 40.703  74.462  188.207 1.00 19.72 ? 25   SER D N   1 
ATOM   9829  C  CA  . SER D 4  25  ? 41.381  73.205  188.548 1.00 19.94 ? 25   SER D CA  1 
ATOM   9830  C  C   . SER D 4  25  ? 42.927  73.260  188.550 1.00 20.00 ? 25   SER D C   1 
ATOM   9831  O  O   . SER D 4  25  ? 43.566  72.423  189.207 1.00 19.85 ? 25   SER D O   1 
ATOM   9832  C  CB  . SER D 4  25  ? 40.865  72.063  187.668 1.00 20.00 ? 25   SER D CB  1 
ATOM   9833  O  OG  . SER D 4  25  ? 41.319  70.807  188.141 1.00 23.95 ? 25   SER D OG  1 
ATOM   9834  N  N   . ILE D 4  26  ? 43.517  74.204  187.796 1.00 20.33 ? 26   ILE D N   1 
ATOM   9835  C  CA  . ILE D 4  26  ? 44.949  74.571  187.957 1.00 20.67 ? 26   ILE D CA  1 
ATOM   9836  C  C   . ILE D 4  26  ? 45.206  75.220  189.332 1.00 20.69 ? 26   ILE D C   1 
ATOM   9837  O  O   . ILE D 4  26  ? 46.140  74.796  190.034 1.00 20.82 ? 26   ILE D O   1 
ATOM   9838  C  CB  . ILE D 4  26  ? 45.531  75.437  186.734 1.00 20.79 ? 26   ILE D CB  1 
ATOM   9839  C  CG1 . ILE D 4  26  ? 45.550  74.612  185.435 1.00 21.93 ? 26   ILE D CG1 1 
ATOM   9840  C  CG2 . ILE D 4  26  ? 47.011  75.938  187.013 1.00 21.01 ? 26   ILE D CG2 1 
ATOM   9841  C  CD1 . ILE D 4  26  ? 45.593  75.454  184.126 1.00 22.73 ? 26   ILE D CD1 1 
ATOM   9842  N  N   . ARG D 4  27  ? 44.331  76.176  189.713 1.00 20.63 ? 27   ARG D N   1 
ATOM   9843  C  CA  . ARG D 4  27  ? 44.401  76.951  190.980 1.00 20.44 ? 27   ARG D CA  1 
ATOM   9844  C  C   . ARG D 4  27  ? 44.438  76.068  192.226 1.00 20.20 ? 27   ARG D C   1 
ATOM   9845  O  O   . ARG D 4  27  ? 45.392  76.168  193.011 1.00 20.34 ? 27   ARG D O   1 
ATOM   9846  C  CB  . ARG D 4  27  ? 43.264  77.997  191.069 1.00 20.47 ? 27   ARG D CB  1 
ATOM   9847  C  CG  . ARG D 4  27  ? 43.463  79.119  192.119 1.00 18.19 ? 27   ARG D CG  1 
ATOM   9848  C  CD  . ARG D 4  27  ? 42.230  79.996  192.339 1.00 14.85 ? 27   ARG D CD  1 
ATOM   9849  N  NE  . ARG D 4  27  ? 42.410  80.952  193.447 1.00 10.83 ? 27   ARG D NE  1 
ATOM   9850  C  CZ  . ARG D 4  27  ? 42.849  82.222  193.339 1.00 12.22 ? 27   ARG D CZ  1 
ATOM   9851  N  NH1 . ARG D 4  27  ? 43.201  82.758  192.168 1.00 7.71  ? 27   ARG D NH1 1 
ATOM   9852  N  NH2 . ARG D 4  27  ? 42.942  82.969  194.430 1.00 9.83  ? 27   ARG D NH2 1 
ATOM   9853  N  N   . ARG D 4  28  ? 43.519  75.090  192.267 1.00 19.95 ? 28   ARG D N   1 
ATOM   9854  C  CA  . ARG D 4  28  ? 43.395  74.091  193.349 1.00 19.72 ? 28   ARG D CA  1 
ATOM   9855  C  C   . ARG D 4  28  ? 44.613  73.162  193.419 1.00 20.00 ? 28   ARG D C   1 
ATOM   9856  O  O   . ARG D 4  28  ? 45.057  72.812  194.517 1.00 19.72 ? 28   ARG D O   1 
ATOM   9857  C  CB  . ARG D 4  28  ? 42.137  73.238  193.165 1.00 19.42 ? 28   ARG D CB  1 
ATOM   9858  C  CG  . ARG D 4  28  ? 40.803  73.928  193.369 1.00 14.98 ? 28   ARG D CG  1 
ATOM   9859  C  CD  . ARG D 4  28  ? 39.631  72.994  193.124 1.00 15.76 ? 28   ARG D CD  1 
ATOM   9860  N  NE  . ARG D 4  28  ? 38.418  73.697  192.699 1.00 16.57 ? 28   ARG D NE  1 
ATOM   9861  C  CZ  . ARG D 4  28  ? 37.739  73.467  191.568 1.00 16.99 ? 28   ARG D CZ  1 
ATOM   9862  N  NH1 . ARG D 4  28  ? 38.163  72.582  190.663 1.00 18.14 ? 28   ARG D NH1 1 
ATOM   9863  N  NH2 . ARG D 4  28  ? 36.640  74.165  191.321 1.00 19.27 ? 28   ARG D NH2 1 
ATOM   9864  N  N   . GLY D 4  29  ? 45.185  72.855  192.246 1.00 20.49 ? 29   GLY D N   1 
ATOM   9865  C  CA  . GLY D 4  29  ? 46.273  71.905  192.095 1.00 21.02 ? 29   GLY D CA  1 
ATOM   9866  C  C   . GLY D 4  29  ? 47.646  72.419  192.494 1.00 21.77 ? 29   GLY D C   1 
ATOM   9867  O  O   . GLY D 4  29  ? 48.500  71.598  192.880 1.00 22.02 ? 29   GLY D O   1 
ATOM   9868  N  N   . PHE D 4  30  ? 47.909  73.719  192.242 1.00 22.09 ? 30   PHE D N   1 
ATOM   9869  C  CA  . PHE D 4  30  ? 49.015  74.475  192.883 1.00 22.57 ? 30   PHE D CA  1 
ATOM   9870  C  C   . PHE D 4  30  ? 49.010  74.338  194.410 1.00 22.85 ? 30   PHE D C   1 
ATOM   9871  O  O   . PHE D 4  30  ? 50.086  74.220  195.025 1.00 23.30 ? 30   PHE D O   1 
ATOM   9872  C  CB  . PHE D 4  30  ? 49.013  75.980  192.482 1.00 22.67 ? 30   PHE D CB  1 
ATOM   9873  C  CG  . PHE D 4  30  ? 50.001  76.841  193.282 1.00 23.65 ? 30   PHE D CG  1 
ATOM   9874  C  CD1 . PHE D 4  30  ? 51.410  76.704  193.084 1.00 22.64 ? 30   PHE D CD1 1 
ATOM   9875  C  CD2 . PHE D 4  30  ? 49.537  77.646  194.364 1.00 15.85 ? 30   PHE D CD2 1 
ATOM   9876  C  CE1 . PHE D 4  30  ? 52.345  77.368  193.949 1.00 19.23 ? 30   PHE D CE1 1 
ATOM   9877  C  CE2 . PHE D 4  30  ? 50.450  78.331  195.221 1.00 10.35 ? 30   PHE D CE2 1 
ATOM   9878  C  CZ  . PHE D 4  30  ? 51.861  78.195  195.010 1.00 15.17 ? 30   PHE D CZ  1 
ATOM   9879  N  N   . GLN D 4  31  ? 47.827  74.564  195.003 1.00 22.47 ? 31   GLN D N   1 
ATOM   9880  C  CA  . GLN D 4  31  ? 47.599  74.438  196.442 1.00 21.86 ? 31   GLN D CA  1 
ATOM   9881  C  C   . GLN D 4  31  ? 47.963  73.044  196.972 1.00 21.15 ? 31   GLN D C   1 
ATOM   9882  O  O   . GLN D 4  31  ? 48.718  72.969  197.939 1.00 21.17 ? 31   GLN D O   1 
ATOM   9883  C  CB  . GLN D 4  31  ? 46.174  74.849  196.818 1.00 21.95 ? 31   GLN D CB  1 
ATOM   9884  C  CG  . GLN D 4  31  ? 45.929  76.364  196.912 1.00 27.25 ? 31   GLN D CG  1 
ATOM   9885  C  CD  . GLN D 4  31  ? 44.514  76.780  196.470 1.00 31.71 ? 31   GLN D CD  1 
ATOM   9886  O  OE1 . GLN D 4  31  ? 43.510  76.313  197.022 1.00 30.22 ? 31   GLN D OE1 1 
ATOM   9887  N  NE2 . GLN D 4  31  ? 44.445  77.720  195.534 1.00 35.96 ? 31   GLN D NE2 1 
ATOM   9888  N  N   . VAL D 4  32  ? 47.633  71.991  196.191 1.00 20.37 ? 32   VAL D N   1 
ATOM   9889  C  CA  . VAL D 4  32  ? 48.110  70.594  196.416 1.00 19.68 ? 32   VAL D CA  1 
ATOM   9890  C  C   . VAL D 4  32  ? 49.641  70.487  196.342 1.00 19.61 ? 32   VAL D C   1 
ATOM   9891  O  O   . VAL D 4  32  ? 50.241  69.805  197.187 1.00 19.43 ? 32   VAL D O   1 
ATOM   9892  C  CB  . VAL D 4  32  ? 47.464  69.492  195.452 1.00 19.38 ? 32   VAL D CB  1 
ATOM   9893  C  CG1 . VAL D 4  32  ? 47.671  68.065  196.007 1.00 12.31 ? 32   VAL D CG1 1 
ATOM   9894  C  CG2 . VAL D 4  32  ? 45.985  69.714  195.194 1.00 17.11 ? 32   VAL D CG2 1 
ATOM   9895  N  N   . TYR D 4  33  ? 50.253  71.175  195.358 1.00 19.82 ? 33   TYR D N   1 
ATOM   9896  C  CA  . TYR D 4  33  ? 51.718  71.258  195.249 1.00 19.89 ? 33   TYR D CA  1 
ATOM   9897  C  C   . TYR D 4  33  ? 52.399  71.896  196.459 1.00 20.19 ? 33   TYR D C   1 
ATOM   9898  O  O   . TYR D 4  33  ? 53.233  71.235  197.105 1.00 20.16 ? 33   TYR D O   1 
ATOM   9899  C  CB  . TYR D 4  33  ? 52.239  71.805  193.884 1.00 19.83 ? 33   TYR D CB  1 
ATOM   9900  C  CG  . TYR D 4  33  ? 53.766  71.843  193.811 1.00 13.10 ? 33   TYR D CG  1 
ATOM   9901  C  CD1 . TYR D 4  33  ? 54.524  70.627  193.845 1.00 11.68 ? 33   TYR D CD1 1 
ATOM   9902  C  CD2 . TYR D 4  33  ? 54.459  73.068  194.012 1.00 4.60  ? 33   TYR D CD2 1 
ATOM   9903  C  CE1 . TYR D 4  33  ? 55.940  70.640  194.065 1.00 12.04 ? 33   TYR D CE1 1 
ATOM   9904  C  CE2 . TYR D 4  33  ? 55.870  73.088  194.251 1.00 10.26 ? 33   TYR D CE2 1 
ATOM   9905  C  CZ  . TYR D 4  33  ? 56.595  71.872  194.251 1.00 9.21  ? 33   TYR D CZ  1 
ATOM   9906  O  OH  . TYR D 4  33  ? 57.955  71.894  194.438 1.00 19.27 ? 33   TYR D OH  1 
ATOM   9907  N  N   . LYS D 4  34  ? 51.928  73.101  196.821 1.00 20.64 ? 34   LYS D N   1 
ATOM   9908  C  CA  . LYS D 4  34  ? 52.391  73.862  197.992 1.00 21.28 ? 34   LYS D CA  1 
ATOM   9909  C  C   . LYS D 4  34  ? 52.216  73.135  199.337 1.00 21.56 ? 34   LYS D C   1 
ATOM   9910  O  O   . LYS D 4  34  ? 53.191  73.030  200.099 1.00 21.85 ? 34   LYS D O   1 
ATOM   9911  C  CB  . LYS D 4  34  ? 51.746  75.255  198.034 1.00 21.43 ? 34   LYS D CB  1 
ATOM   9912  C  CG  . LYS D 4  34  ? 52.633  76.327  198.653 1.00 22.17 ? 34   LYS D CG  1 
ATOM   9913  C  CD  . LYS D 4  34  ? 51.827  77.323  199.452 1.00 20.80 ? 34   LYS D CD  1 
ATOM   9914  C  CE  . LYS D 4  34  ? 52.675  78.532  199.786 1.00 27.32 ? 34   LYS D CE  1 
ATOM   9915  N  NZ  . LYS D 4  34  ? 52.587  78.899  201.226 1.00 26.53 ? 34   LYS D NZ  1 
ATOM   9916  N  N   . GLN D 4  35  ? 51.025  72.547  199.556 1.00 21.70 ? 35   GLN D N   1 
ATOM   9917  C  CA  . GLN D 4  35  ? 50.641  71.912  200.840 1.00 21.75 ? 35   GLN D CA  1 
ATOM   9918  C  C   . GLN D 4  35  ? 51.317  70.564  201.071 1.00 21.89 ? 35   GLN D C   1 
ATOM   9919  O  O   . GLN D 4  35  ? 52.000  70.392  202.089 1.00 21.75 ? 35   GLN D O   1 
ATOM   9920  C  CB  . GLN D 4  35  ? 49.116  71.786  200.974 1.00 21.65 ? 35   GLN D CB  1 
ATOM   9921  C  CG  . GLN D 4  35  ? 48.491  72.710  202.014 1.00 30.42 ? 35   GLN D CG  1 
ATOM   9922  C  CD  . GLN D 4  35  ? 48.237  74.111  201.483 1.00 33.19 ? 35   GLN D CD  1 
ATOM   9923  O  OE1 . GLN D 4  35  ? 47.186  74.381  200.898 1.00 33.54 ? 35   GLN D OE1 1 
ATOM   9924  N  NE2 . GLN D 4  35  ? 49.200  75.002  201.684 1.00 34.18 ? 35   GLN D NE2 1 
ATOM   9925  N  N   . VAL D 4  36  ? 51.315  69.725  200.028 1.00 22.32 ? 36   VAL D N   1 
ATOM   9926  C  CA  . VAL D 4  36  ? 51.584  68.281  200.142 1.00 22.77 ? 36   VAL D CA  1 
ATOM   9927  C  C   . VAL D 4  36  ? 52.952  67.893  199.523 1.00 23.15 ? 36   VAL D C   1 
ATOM   9928  O  O   . VAL D 4  36  ? 53.801  67.319  200.221 1.00 23.16 ? 36   VAL D O   1 
ATOM   9929  C  CB  . VAL D 4  36  ? 50.393  67.381  199.587 1.00 22.73 ? 36   VAL D CB  1 
ATOM   9930  C  CG1 . VAL D 4  36  ? 50.622  65.902  199.907 1.00 22.06 ? 36   VAL D CG1 1 
ATOM   9931  C  CG2 . VAL D 4  36  ? 49.022  67.821  200.151 1.00 21.69 ? 36   VAL D CG2 1 
ATOM   9932  N  N   . CYS D 4  37  ? 53.162  68.250  198.247 1.00 23.51 ? 37   CYS D N   1 
ATOM   9933  C  CA  . CYS D 4  37  ? 54.271  67.709  197.438 1.00 24.05 ? 37   CYS D CA  1 
ATOM   9934  C  C   . CYS D 4  37  ? 55.616  68.401  197.643 1.00 24.07 ? 37   CYS D C   1 
ATOM   9935  O  O   . CYS D 4  37  ? 56.645  67.712  197.702 1.00 24.22 ? 37   CYS D O   1 
ATOM   9936  C  CB  . CYS D 4  37  ? 53.935  67.619  195.942 1.00 24.58 ? 37   CYS D CB  1 
ATOM   9937  S  SG  . CYS D 4  37  ? 52.192  67.756  195.476 1.00 35.90 ? 37   CYS D SG  1 
ATOM   9938  N  N   . SER D 4  38  ? 55.585  69.734  197.834 1.00 23.92 ? 38   SER D N   1 
ATOM   9939  C  CA  . SER D 4  38  ? 56.785  70.608  197.892 1.00 23.79 ? 38   SER D CA  1 
ATOM   9940  C  C   . SER D 4  38  ? 57.781  70.342  199.040 1.00 23.94 ? 38   SER D C   1 
ATOM   9941  O  O   . SER D 4  38  ? 58.955  70.753  198.950 1.00 23.89 ? 38   SER D O   1 
ATOM   9942  C  CB  . SER D 4  38  ? 56.390  72.092  197.857 1.00 23.70 ? 38   SER D CB  1 
ATOM   9943  O  OG  . SER D 4  38  ? 55.518  72.424  198.920 1.00 21.83 ? 38   SER D OG  1 
ATOM   9944  N  N   . SER D 4  39  ? 57.297  69.690  200.112 1.00 24.20 ? 39   SER D N   1 
ATOM   9945  C  CA  . SER D 4  39  ? 58.133  69.157  201.210 1.00 24.30 ? 39   SER D CA  1 
ATOM   9946  C  C   . SER D 4  39  ? 59.106  68.027  200.805 1.00 24.04 ? 39   SER D C   1 
ATOM   9947  O  O   . SER D 4  39  ? 60.135  67.826  201.476 1.00 24.21 ? 39   SER D O   1 
ATOM   9948  C  CB  . SER D 4  39  ? 57.270  68.737  202.411 1.00 24.55 ? 39   SER D CB  1 
ATOM   9949  O  OG  . SER D 4  39  ? 56.404  67.670  202.070 1.00 27.66 ? 39   SER D OG  1 
ATOM   9950  N  N   . CYS D 4  40  ? 58.772  67.304  199.726 1.00 23.66 ? 40   CYS D N   1 
ATOM   9951  C  CA  . CYS D 4  40  ? 59.604  66.224  199.174 1.00 23.39 ? 40   CYS D CA  1 
ATOM   9952  C  C   . CYS D 4  40  ? 60.038  66.413  197.717 1.00 22.82 ? 40   CYS D C   1 
ATOM   9953  O  O   . CYS D 4  40  ? 61.131  65.959  197.338 1.00 22.76 ? 40   CYS D O   1 
ATOM   9954  C  CB  . CYS D 4  40  ? 58.935  64.859  199.373 1.00 23.75 ? 40   CYS D CB  1 
ATOM   9955  S  SG  . CYS D 4  40  ? 59.636  63.885  200.737 1.00 27.68 ? 40   CYS D SG  1 
ATOM   9956  N  N   . HIS D 4  41  ? 59.214  67.122  196.931 1.00 22.39 ? 41   HIS D N   1 
ATOM   9957  C  CA  . HIS D 4  41  ? 59.433  67.308  195.482 1.00 22.10 ? 41   HIS D CA  1 
ATOM   9958  C  C   . HIS D 4  41  ? 59.918  68.690  195.093 1.00 21.48 ? 41   HIS D C   1 
ATOM   9959  O  O   . HIS D 4  41  ? 59.267  69.703  195.409 1.00 21.27 ? 41   HIS D O   1 
ATOM   9960  C  CB  . HIS D 4  41  ? 58.180  66.951  194.681 1.00 22.14 ? 41   HIS D CB  1 
ATOM   9961  C  CG  . HIS D 4  41  ? 57.936  65.484  194.581 1.00 25.99 ? 41   HIS D CG  1 
ATOM   9962  N  ND1 . HIS D 4  41  ? 58.775  64.634  193.892 1.00 28.95 ? 41   HIS D ND1 1 
ATOM   9963  C  CD2 . HIS D 4  41  ? 57.001  64.701  195.161 1.00 23.96 ? 41   HIS D CD2 1 
ATOM   9964  C  CE1 . HIS D 4  41  ? 58.318  63.401  193.988 1.00 23.33 ? 41   HIS D CE1 1 
ATOM   9965  N  NE2 . HIS D 4  41  ? 57.273  63.412  194.791 1.00 19.50 ? 41   HIS D NE2 1 
ATOM   9966  N  N   . SER D 4  42  ? 61.052  68.712  194.384 1.00 21.22 ? 42   SER D N   1 
ATOM   9967  C  CA  . SER D 4  42  ? 61.485  69.881  193.603 1.00 21.04 ? 42   SER D CA  1 
ATOM   9968  C  C   . SER D 4  42  ? 60.578  70.161  192.391 1.00 21.05 ? 42   SER D C   1 
ATOM   9969  O  O   . SER D 4  42  ? 59.912  69.240  191.869 1.00 21.13 ? 42   SER D O   1 
ATOM   9970  C  CB  . SER D 4  42  ? 62.963  69.767  193.201 1.00 20.96 ? 42   SER D CB  1 
ATOM   9971  O  OG  . SER D 4  42  ? 63.220  68.599  192.434 1.00 10.01 ? 42   SER D OG  1 
ATOM   9972  N  N   . MET D 4  43  ? 60.375  71.456  192.129 1.00 20.89 ? 43   MET D N   1 
ATOM   9973  C  CA  . MET D 4  43  ? 59.811  71.945  190.865 1.00 20.54 ? 43   MET D CA  1 
ATOM   9974  C  C   . MET D 4  43  ? 60.642  73.118  190.303 1.00 20.30 ? 43   MET D C   1 
ATOM   9975  O  O   . MET D 4  43  ? 60.147  74.257  190.151 1.00 20.16 ? 43   MET D O   1 
ATOM   9976  C  CB  . MET D 4  43  ? 58.309  72.256  191.012 1.00 20.60 ? 43   MET D CB  1 
ATOM   9977  C  CG  . MET D 4  43  ? 57.522  72.060  189.729 1.00 24.37 ? 43   MET D CG  1 
ATOM   9978  S  SD  . MET D 4  43  ? 55.768  71.797  189.973 1.00 34.26 ? 43   MET D SD  1 
ATOM   9979  C  CE  . MET D 4  43  ? 55.223  73.343  189.666 1.00 15.49 ? 43   MET D CE  1 
ATOM   9980  N  N   . ASP D 4  44  ? 61.837  72.748  189.820 1.00 20.21 ? 44   ASP D N   1 
ATOM   9981  C  CA  . ASP D 4  44  ? 62.948  73.664  189.495 1.00 20.10 ? 44   ASP D CA  1 
ATOM   9982  C  C   . ASP D 4  44  ? 62.713  74.657  188.333 1.00 19.56 ? 44   ASP D C   1 
ATOM   9983  O  O   . ASP D 4  44  ? 63.450  75.653  188.214 1.00 19.58 ? 44   ASP D O   1 
ATOM   9984  C  CB  . ASP D 4  44  ? 64.244  72.865  189.243 1.00 20.47 ? 44   ASP D CB  1 
ATOM   9985  C  CG  . ASP D 4  44  ? 64.835  72.243  190.519 1.00 25.68 ? 44   ASP D CG  1 
ATOM   9986  O  OD1 . ASP D 4  44  ? 65.582  71.253  190.376 1.00 29.46 ? 44   ASP D OD1 1 
ATOM   9987  O  OD2 . ASP D 4  44  ? 64.666  72.677  191.684 1.00 28.82 ? 44   ASP D OD2 1 
ATOM   9988  N  N   . TYR D 4  45  ? 61.688  74.391  187.511 1.00 19.16 ? 45   TYR D N   1 
ATOM   9989  C  CA  . TYR D 4  45  ? 61.416  75.146  186.273 1.00 18.91 ? 45   TYR D CA  1 
ATOM   9990  C  C   . TYR D 4  45  ? 60.091  75.950  186.244 1.00 18.81 ? 45   TYR D C   1 
ATOM   9991  O  O   . TYR D 4  45  ? 59.731  76.523  185.199 1.00 18.89 ? 45   TYR D O   1 
ATOM   9992  C  CB  . TYR D 4  45  ? 61.598  74.255  185.017 1.00 18.73 ? 45   TYR D CB  1 
ATOM   9993  C  CG  . TYR D 4  45  ? 62.982  73.620  184.841 1.00 13.68 ? 45   TYR D CG  1 
ATOM   9994  C  CD1 . TYR D 4  45  ? 63.118  72.210  184.809 1.00 21.37 ? 45   TYR D CD1 1 
ATOM   9995  C  CD2 . TYR D 4  45  ? 64.146  74.416  184.614 1.00 15.44 ? 45   TYR D CD2 1 
ATOM   9996  C  CE1 . TYR D 4  45  ? 64.401  71.584  184.617 1.00 18.45 ? 45   TYR D CE1 1 
ATOM   9997  C  CE2 . TYR D 4  45  ? 65.444  73.802  184.423 1.00 19.92 ? 45   TYR D CE2 1 
ATOM   9998  C  CZ  . TYR D 4  45  ? 65.544  72.381  184.430 1.00 19.85 ? 45   TYR D CZ  1 
ATOM   9999  O  OH  . TYR D 4  45  ? 66.766  71.763  184.273 1.00 25.33 ? 45   TYR D OH  1 
ATOM   10000 N  N   . VAL D 4  46  ? 59.411  76.031  187.399 1.00 18.84 ? 46   VAL D N   1 
ATOM   10001 C  CA  . VAL D 4  46  ? 58.289  76.976  187.622 1.00 18.90 ? 46   VAL D CA  1 
ATOM   10002 C  C   . VAL D 4  46  ? 58.624  78.008  188.722 1.00 19.17 ? 46   VAL D C   1 
ATOM   10003 O  O   . VAL D 4  46  ? 59.205  77.663  189.767 1.00 19.14 ? 46   VAL D O   1 
ATOM   10004 C  CB  . VAL D 4  46  ? 56.876  76.260  187.848 1.00 18.54 ? 46   VAL D CB  1 
ATOM   10005 C  CG1 . VAL D 4  46  ? 55.721  77.281  187.925 1.00 11.37 ? 46   VAL D CG1 1 
ATOM   10006 C  CG2 . VAL D 4  46  ? 56.554  75.272  186.709 1.00 15.96 ? 46   VAL D CG2 1 
ATOM   10007 N  N   . ALA D 4  47  ? 58.484  79.276  188.327 1.00 19.35 ? 47   ALA D N   1 
ATOM   10008 C  CA  . ALA D 4  47  ? 58.585  80.462  189.189 1.00 19.11 ? 47   ALA D CA  1 
ATOM   10009 C  C   . ALA D 4  47  ? 57.193  81.085  189.432 1.00 18.77 ? 47   ALA D C   1 
ATOM   10010 O  O   . ALA D 4  47  ? 56.214  80.724  188.750 1.00 18.39 ? 47   ALA D O   1 
ATOM   10011 C  CB  . ALA D 4  47  ? 59.543  81.488  188.538 1.00 19.20 ? 47   ALA D CB  1 
ATOM   10012 N  N   . TYR D 4  48  ? 57.132  82.022  190.393 1.00 18.90 ? 48   TYR D N   1 
ATOM   10013 C  CA  . TYR D 4  48  ? 55.883  82.671  190.845 1.00 18.77 ? 48   TYR D CA  1 
ATOM   10014 C  C   . TYR D 4  48  ? 55.215  83.586  189.808 1.00 18.25 ? 48   TYR D C   1 
ATOM   10015 O  O   . TYR D 4  48  ? 53.980  83.666  189.763 1.00 18.14 ? 48   TYR D O   1 
ATOM   10016 C  CB  . TYR D 4  48  ? 56.079  83.390  192.198 1.00 18.93 ? 48   TYR D CB  1 
ATOM   10017 C  CG  . TYR D 4  48  ? 56.427  82.454  193.349 1.00 19.81 ? 48   TYR D CG  1 
ATOM   10018 C  CD1 . TYR D 4  48  ? 57.782  82.201  193.691 1.00 20.87 ? 48   TYR D CD1 1 
ATOM   10019 C  CD2 . TYR D 4  48  ? 55.407  81.819  194.114 1.00 21.52 ? 48   TYR D CD2 1 
ATOM   10020 C  CE1 . TYR D 4  48  ? 58.132  81.294  194.746 1.00 21.60 ? 48   TYR D CE1 1 
ATOM   10021 C  CE2 . TYR D 4  48  ? 55.740  80.904  195.184 1.00 20.74 ? 48   TYR D CE2 1 
ATOM   10022 C  CZ  . TYR D 4  48  ? 57.108  80.665  195.491 1.00 19.40 ? 48   TYR D CZ  1 
ATOM   10023 O  OH  . TYR D 4  48  ? 57.457  79.773  196.482 1.00 16.81 ? 48   TYR D OH  1 
ATOM   10024 N  N   . ARG D 4  49  ? 56.032  84.202  188.944 1.00 18.06 ? 49   ARG D N   1 
ATOM   10025 C  CA  . ARG D 4  49  ? 55.567  84.934  187.743 1.00 17.84 ? 49   ARG D CA  1 
ATOM   10026 C  C   . ARG D 4  49  ? 54.793  84.107  186.692 1.00 17.80 ? 49   ARG D C   1 
ATOM   10027 O  O   . ARG D 4  49  ? 53.928  84.658  185.996 1.00 17.58 ? 49   ARG D O   1 
ATOM   10028 C  CB  . ARG D 4  49  ? 56.685  85.782  187.097 1.00 17.60 ? 49   ARG D CB  1 
ATOM   10029 C  CG  . ARG D 4  49  ? 57.919  85.014  186.642 1.00 10.08 ? 49   ARG D CG  1 
ATOM   10030 C  CD  . ARG D 4  49  ? 58.542  85.498  185.318 1.00 20.59 ? 49   ARG D CD  1 
ATOM   10031 N  NE  . ARG D 4  49  ? 59.335  84.452  184.621 1.00 14.41 ? 49   ARG D NE  1 
ATOM   10032 C  CZ  . ARG D 4  49  ? 60.515  83.927  185.045 1.00 15.20 ? 49   ARG D CZ  1 
ATOM   10033 N  NH1 . ARG D 4  49  ? 61.091  84.286  186.219 1.00 3.82  ? 49   ARG D NH1 1 
ATOM   10034 N  NH2 . ARG D 4  49  ? 61.066  82.954  184.335 1.00 4.45  ? 49   ARG D NH2 1 
ATOM   10035 N  N   . HIS D 4  50  ? 55.097  82.803  186.598 1.00 18.15 ? 50   HIS D N   1 
ATOM   10036 C  CA  . HIS D 4  50  ? 54.378  81.864  185.704 1.00 18.37 ? 50   HIS D CA  1 
ATOM   10037 C  C   . HIS D 4  50  ? 52.910  81.652  186.061 1.00 19.02 ? 50   HIS D C   1 
ATOM   10038 O  O   . HIS D 4  50  ? 52.094  81.435  185.165 1.00 19.54 ? 50   HIS D O   1 
ATOM   10039 C  CB  . HIS D 4  50  ? 55.094  80.509  185.577 1.00 17.97 ? 50   HIS D CB  1 
ATOM   10040 C  CG  . HIS D 4  50  ? 56.472  80.591  184.994 1.00 16.45 ? 50   HIS D CG  1 
ATOM   10041 N  ND1 . HIS D 4  50  ? 57.520  79.839  185.476 1.00 18.04 ? 50   HIS D ND1 1 
ATOM   10042 C  CD2 . HIS D 4  50  ? 56.955  81.262  183.919 1.00 15.27 ? 50   HIS D CD2 1 
ATOM   10043 C  CE1 . HIS D 4  50  ? 58.607  80.096  184.770 1.00 17.14 ? 50   HIS D CE1 1 
ATOM   10044 N  NE2 . HIS D 4  50  ? 58.291  80.954  183.816 1.00 15.78 ? 50   HIS D NE2 1 
ATOM   10045 N  N   . LEU D 4  51  ? 52.583  81.755  187.357 1.00 19.31 ? 51   LEU D N   1 
ATOM   10046 C  CA  . LEU D 4  51  ? 51.201  81.639  187.854 1.00 19.47 ? 51   LEU D CA  1 
ATOM   10047 C  C   . LEU D 4  51  ? 50.267  82.811  187.488 1.00 19.79 ? 51   LEU D C   1 
ATOM   10048 O  O   . LEU D 4  51  ? 49.062  82.582  187.307 1.00 19.83 ? 51   LEU D O   1 
ATOM   10049 C  CB  . LEU D 4  51  ? 51.157  81.333  189.363 1.00 19.24 ? 51   LEU D CB  1 
ATOM   10050 C  CG  . LEU D 4  51  ? 51.993  80.195  189.991 1.00 19.80 ? 51   LEU D CG  1 
ATOM   10051 C  CD1 . LEU D 4  51  ? 52.181  80.445  191.484 1.00 16.38 ? 51   LEU D CD1 1 
ATOM   10052 C  CD2 . LEU D 4  51  ? 51.417  78.790  189.744 1.00 18.72 ? 51   LEU D CD2 1 
ATOM   10053 N  N   . VAL D 4  52  ? 50.864  83.982  187.197 1.00 20.07 ? 52   VAL D N   1 
ATOM   10054 C  CA  . VAL D 4  52  ? 50.182  85.303  187.047 1.00 20.65 ? 52   VAL D CA  1 
ATOM   10055 C  C   . VAL D 4  52  ? 49.170  85.331  185.867 1.00 21.41 ? 52   VAL D C   1 
ATOM   10056 O  O   . VAL D 4  52  ? 48.053  85.866  186.005 1.00 21.89 ? 52   VAL D O   1 
ATOM   10057 C  CB  . VAL D 4  52  ? 51.241  86.516  186.951 1.00 20.33 ? 52   VAL D CB  1 
ATOM   10058 C  CG1 . VAL D 4  52  ? 50.574  87.895  186.722 1.00 12.41 ? 52   VAL D CG1 1 
ATOM   10059 C  CG2 . VAL D 4  52  ? 52.131  86.585  188.201 1.00 15.47 ? 52   VAL D CG2 1 
ATOM   10060 N  N   . GLY D 4  53  ? 49.565  84.743  184.738 1.00 21.64 ? 53   GLY D N   1 
ATOM   10061 C  CA  . GLY D 4  53  ? 48.681  84.538  183.590 1.00 22.46 ? 53   GLY D CA  1 
ATOM   10062 C  C   . GLY D 4  53  ? 47.465  83.652  183.858 1.00 22.64 ? 53   GLY D C   1 
ATOM   10063 O  O   . GLY D 4  53  ? 46.343  84.046  183.521 1.00 22.87 ? 53   GLY D O   1 
ATOM   10064 N  N   . VAL D 4  54  ? 47.656  82.683  184.753 1.00 22.40 ? 54   VAL D N   1 
ATOM   10065 C  CA  . VAL D 4  54  ? 47.141  81.324  184.584 1.00 22.38 ? 54   VAL D CA  1 
ATOM   10066 C  C   . VAL D 4  54  ? 46.020  81.040  185.599 1.00 22.21 ? 54   VAL D C   1 
ATOM   10067 O  O   . VAL D 4  54  ? 44.882  80.750  185.197 1.00 22.38 ? 54   VAL D O   1 
ATOM   10068 C  CB  . VAL D 4  54  ? 48.324  80.249  184.616 1.00 22.47 ? 54   VAL D CB  1 
ATOM   10069 C  CG1 . VAL D 4  54  ? 47.811  78.799  184.534 1.00 24.17 ? 54   VAL D CG1 1 
ATOM   10070 C  CG2 . VAL D 4  54  ? 49.314  80.501  183.483 1.00 22.56 ? 54   VAL D CG2 1 
ATOM   10071 N  N   . CYS D 4  55  ? 46.325  81.254  186.884 1.00 21.91 ? 55   CYS D N   1 
ATOM   10072 C  CA  . CYS D 4  55  ? 45.505  80.785  188.016 1.00 21.60 ? 55   CYS D CA  1 
ATOM   10073 C  C   . CYS D 4  55  ? 45.364  81.788  189.170 1.00 21.57 ? 55   CYS D C   1 
ATOM   10074 O  O   . CYS D 4  55  ? 44.396  81.706  189.935 1.00 21.89 ? 55   CYS D O   1 
ATOM   10075 C  CB  . CYS D 4  55  ? 45.972  79.404  188.518 1.00 21.29 ? 55   CYS D CB  1 
ATOM   10076 S  SG  . CYS D 4  55  ? 47.755  79.203  188.784 1.00 17.31 ? 55   CYS D SG  1 
ATOM   10077 N  N   . TYR D 4  56  ? 46.276  82.769  189.221 1.00 21.36 ? 56   TYR D N   1 
ATOM   10078 C  CA  . TYR D 4  56  ? 46.262  83.879  190.189 1.00 21.10 ? 56   TYR D CA  1 
ATOM   10079 C  C   . TYR D 4  56  ? 46.276  85.270  189.515 1.00 21.02 ? 56   TYR D C   1 
ATOM   10080 O  O   . TYR D 4  56  ? 46.283  85.351  188.276 1.00 21.14 ? 56   TYR D O   1 
ATOM   10081 C  CB  . TYR D 4  56  ? 47.420  83.707  191.192 1.00 21.02 ? 56   TYR D CB  1 
ATOM   10082 C  CG  . TYR D 4  56  ? 47.245  82.514  192.124 1.00 16.24 ? 56   TYR D CG  1 
ATOM   10083 C  CD1 . TYR D 4  56  ? 46.422  82.608  193.290 1.00 19.67 ? 56   TYR D CD1 1 
ATOM   10084 C  CD2 . TYR D 4  56  ? 47.853  81.266  191.825 1.00 10.29 ? 56   TYR D CD2 1 
ATOM   10085 C  CE1 . TYR D 4  56  ? 46.212  81.473  194.148 1.00 16.39 ? 56   TYR D CE1 1 
ATOM   10086 C  CE2 . TYR D 4  56  ? 47.635  80.119  192.654 1.00 11.10 ? 56   TYR D CE2 1 
ATOM   10087 C  CZ  . TYR D 4  56  ? 46.828  80.244  193.823 1.00 14.03 ? 56   TYR D CZ  1 
ATOM   10088 O  OH  . TYR D 4  56  ? 46.648  79.172  194.657 1.00 11.23 ? 56   TYR D OH  1 
ATOM   10089 N  N   . THR D 4  57  ? 46.015  86.320  190.312 1.00 20.81 ? 57   THR D N   1 
ATOM   10090 C  CA  . THR D 4  57  ? 46.437  87.707  189.996 1.00 20.57 ? 57   THR D CA  1 
ATOM   10091 C  C   . THR D 4  57  ? 47.909  87.977  190.361 1.00 20.56 ? 57   THR D C   1 
ATOM   10092 O  O   . THR D 4  57  ? 48.541  87.175  191.084 1.00 20.23 ? 57   THR D O   1 
ATOM   10093 C  CB  . THR D 4  57  ? 45.497  88.797  190.646 1.00 20.55 ? 57   THR D CB  1 
ATOM   10094 O  OG1 . THR D 4  57  ? 45.283  88.515  192.035 1.00 25.63 ? 57   THR D OG1 1 
ATOM   10095 C  CG2 . THR D 4  57  ? 44.094  88.788  190.034 1.00 16.54 ? 57   THR D CG2 1 
ATOM   10096 N  N   . GLU D 4  58  ? 48.464  89.028  189.726 1.00 20.85 ? 58   GLU D N   1 
ATOM   10097 C  CA  . GLU D 4  58  ? 49.757  89.661  190.062 1.00 21.01 ? 58   GLU D CA  1 
ATOM   10098 C  C   . GLU D 4  58  ? 49.985  89.932  191.570 1.00 20.76 ? 58   GLU D C   1 
ATOM   10099 O  O   . GLU D 4  58  ? 51.042  89.565  192.107 1.00 20.81 ? 58   GLU D O   1 
ATOM   10100 C  CB  . GLU D 4  58  ? 49.939  90.946  189.231 1.00 21.30 ? 58   GLU D CB  1 
ATOM   10101 C  CG  . GLU D 4  58  ? 51.384  91.345  188.941 1.00 26.45 ? 58   GLU D CG  1 
ATOM   10102 C  CD  . GLU D 4  58  ? 51.480  92.679  188.213 1.00 29.99 ? 58   GLU D CD  1 
ATOM   10103 O  OE1 . GLU D 4  58  ? 51.349  92.689  186.966 1.00 31.19 ? 58   GLU D OE1 1 
ATOM   10104 O  OE2 . GLU D 4  58  ? 51.622  93.726  188.890 1.00 27.13 ? 58   GLU D OE2 1 
ATOM   10105 N  N   . ASP D 4  59  ? 48.970  90.499  192.238 1.00 20.53 ? 59   ASP D N   1 
ATOM   10106 C  CA  . ASP D 4  59  ? 48.972  90.717  193.697 1.00 20.41 ? 59   ASP D CA  1 
ATOM   10107 C  C   . ASP D 4  59  ? 48.962  89.429  194.537 1.00 20.26 ? 59   ASP D C   1 
ATOM   10108 O  O   . ASP D 4  59  ? 49.739  89.321  195.501 1.00 20.13 ? 59   ASP D O   1 
ATOM   10109 C  CB  . ASP D 4  59  ? 47.842  91.670  194.123 1.00 20.32 ? 59   ASP D CB  1 
ATOM   10110 C  CG  . ASP D 4  59  ? 48.053  93.109  193.623 1.00 22.16 ? 59   ASP D CG  1 
ATOM   10111 O  OD1 . ASP D 4  59  ? 49.101  93.728  193.935 1.00 22.41 ? 59   ASP D OD1 1 
ATOM   10112 O  OD2 . ASP D 4  59  ? 47.170  93.739  193.006 1.00 22.46 ? 59   ASP D OD2 1 
ATOM   10113 N  N   . GLU D 4  60  ? 48.144  88.450  194.108 1.00 20.27 ? 60   GLU D N   1 
ATOM   10114 C  CA  . GLU D 4  60  ? 48.015  87.107  194.724 1.00 20.26 ? 60   GLU D CA  1 
ATOM   10115 C  C   . GLU D 4  60  ? 49.329  86.317  194.729 1.00 20.37 ? 60   GLU D C   1 
ATOM   10116 O  O   . GLU D 4  60  ? 49.741  85.815  195.779 1.00 20.33 ? 60   GLU D O   1 
ATOM   10117 C  CB  . GLU D 4  60  ? 46.948  86.293  193.989 1.00 20.31 ? 60   GLU D CB  1 
ATOM   10118 C  CG  . GLU D 4  60  ? 45.706  85.944  194.792 1.00 22.70 ? 60   GLU D CG  1 
ATOM   10119 C  CD  . GLU D 4  60  ? 44.436  85.910  193.943 1.00 25.34 ? 60   GLU D CD  1 
ATOM   10120 O  OE1 . GLU D 4  60  ? 43.423  86.497  194.388 1.00 26.67 ? 60   GLU D OE1 1 
ATOM   10121 O  OE2 . GLU D 4  60  ? 44.418  85.244  192.868 1.00 19.94 ? 60   GLU D OE2 1 
ATOM   10122 N  N   . ALA D 4  61  ? 50.012  86.310  193.573 1.00 20.58 ? 61   ALA D N   1 
ATOM   10123 C  CA  . ALA D 4  61  ? 51.242  85.545  193.343 1.00 20.57 ? 61   ALA D CA  1 
ATOM   10124 C  C   . ALA D 4  61  ? 52.461  86.147  194.046 1.00 20.41 ? 61   ALA D C   1 
ATOM   10125 O  O   . ALA D 4  61  ? 53.344  85.397  194.485 1.00 20.58 ? 61   ALA D O   1 
ATOM   10126 C  CB  . ALA D 4  61  ? 51.496  85.384  191.844 1.00 20.85 ? 61   ALA D CB  1 
ATOM   10127 N  N   . LYS D 4  62  ? 52.528  87.491  194.084 1.00 20.27 ? 62   LYS D N   1 
ATOM   10128 C  CA  . LYS D 4  62  ? 53.431  88.256  194.967 1.00 20.55 ? 62   LYS D CA  1 
ATOM   10129 C  C   . LYS D 4  62  ? 53.305  87.883  196.455 1.00 20.64 ? 62   LYS D C   1 
ATOM   10130 O  O   . LYS D 4  62  ? 54.320  87.574  197.095 1.00 20.68 ? 62   LYS D O   1 
ATOM   10131 C  CB  . LYS D 4  62  ? 53.248  89.769  194.768 1.00 20.75 ? 62   LYS D CB  1 
ATOM   10132 C  CG  . LYS D 4  62  ? 54.525  90.509  194.378 1.00 24.56 ? 62   LYS D CG  1 
ATOM   10133 C  CD  . LYS D 4  62  ? 54.900  91.560  195.403 1.00 28.56 ? 62   LYS D CD  1 
ATOM   10134 C  CE  . LYS D 4  62  ? 54.877  92.954  194.799 1.00 31.05 ? 62   LYS D CE  1 
ATOM   10135 N  NZ  . LYS D 4  62  ? 53.532  93.585  194.929 1.00 28.88 ? 62   LYS D NZ  1 
ATOM   10136 N  N   . ALA D 4  63  ? 52.055  87.776  196.936 1.00 20.80 ? 63   ALA D N   1 
ATOM   10137 C  CA  . ALA D 4  63  ? 51.729  87.336  198.308 1.00 20.88 ? 63   ALA D CA  1 
ATOM   10138 C  C   . ALA D 4  63  ? 52.068  85.865  198.613 1.00 21.02 ? 63   ALA D C   1 
ATOM   10139 O  O   . ALA D 4  63  ? 52.436  85.547  199.751 1.00 21.34 ? 63   ALA D O   1 
ATOM   10140 C  CB  . ALA D 4  63  ? 50.271  87.642  198.646 1.00 20.77 ? 63   ALA D CB  1 
ATOM   10141 N  N   . LEU D 4  64  ? 51.947  84.992  197.602 1.00 20.86 ? 64   LEU D N   1 
ATOM   10142 C  CA  . LEU D 4  64  ? 52.313  83.562  197.709 1.00 20.77 ? 64   LEU D CA  1 
ATOM   10143 C  C   . LEU D 4  64  ? 53.825  83.306  197.760 1.00 20.68 ? 64   LEU D C   1 
ATOM   10144 O  O   . LEU D 4  64  ? 54.269  82.353  198.422 1.00 20.46 ? 64   LEU D O   1 
ATOM   10145 C  CB  . LEU D 4  64  ? 51.669  82.731  196.594 1.00 20.73 ? 64   LEU D CB  1 
ATOM   10146 C  CG  . LEU D 4  64  ? 50.148  82.539  196.566 1.00 21.63 ? 64   LEU D CG  1 
ATOM   10147 C  CD1 . LEU D 4  64  ? 49.694  82.443  195.116 1.00 24.23 ? 64   LEU D CD1 1 
ATOM   10148 C  CD2 . LEU D 4  64  ? 49.696  81.311  197.357 1.00 21.12 ? 64   LEU D CD2 1 
ATOM   10149 N  N   . ALA D 4  65  ? 54.573  84.065  196.941 1.00 20.78 ? 65   ALA D N   1 
ATOM   10150 C  CA  . ALA D 4  65  ? 56.042  84.186  197.014 1.00 20.85 ? 65   ALA D CA  1 
ATOM   10151 C  C   . ALA D 4  65  ? 56.553  84.768  198.337 1.00 21.10 ? 65   ALA D C   1 
ATOM   10152 O  O   . ALA D 4  65  ? 57.647  84.399  198.797 1.00 21.10 ? 65   ALA D O   1 
ATOM   10153 C  CB  . ALA D 4  65  ? 56.558  85.007  195.848 1.00 20.70 ? 65   ALA D CB  1 
ATOM   10154 N  N   . GLU D 4  66  ? 55.789  85.721  198.888 1.00 21.45 ? 66   GLU D N   1 
ATOM   10155 C  CA  . GLU D 4  66  ? 56.036  86.335  200.198 1.00 21.98 ? 66   GLU D CA  1 
ATOM   10156 C  C   . GLU D 4  66  ? 55.997  85.375  201.414 1.00 22.08 ? 66   GLU D C   1 
ATOM   10157 O  O   . GLU D 4  66  ? 56.654  85.650  202.433 1.00 21.99 ? 66   GLU D O   1 
ATOM   10158 C  CB  . GLU D 4  66  ? 55.112  87.541  200.406 1.00 22.34 ? 66   GLU D CB  1 
ATOM   10159 C  CG  . GLU D 4  66  ? 55.814  88.895  200.309 1.00 26.78 ? 66   GLU D CG  1 
ATOM   10160 C  CD  . GLU D 4  66  ? 55.214  89.827  199.261 1.00 24.66 ? 66   GLU D CD  1 
ATOM   10161 O  OE1 . GLU D 4  66  ? 54.045  90.253  199.413 1.00 25.44 ? 66   GLU D OE1 1 
ATOM   10162 O  OE2 . GLU D 4  66  ? 55.965  90.247  198.358 1.00 27.19 ? 66   GLU D OE2 1 
ATOM   10163 N  N   . GLU D 4  67  ? 55.240  84.270  201.280 1.00 22.14 ? 67   GLU D N   1 
ATOM   10164 C  CA  . GLU D 4  67  ? 55.149  83.162  202.258 1.00 22.16 ? 67   GLU D CA  1 
ATOM   10165 C  C   . GLU D 4  67  ? 56.471  82.426  202.577 1.00 22.40 ? 67   GLU D C   1 
ATOM   10166 O  O   . GLU D 4  67  ? 56.624  81.898  203.686 1.00 22.42 ? 67   GLU D O   1 
ATOM   10167 C  CB  . GLU D 4  67  ? 54.081  82.149  201.817 1.00 22.14 ? 67   GLU D CB  1 
ATOM   10168 C  CG  . GLU D 4  67  ? 52.735  82.303  202.508 1.00 22.96 ? 67   GLU D CG  1 
ATOM   10169 C  CD  . GLU D 4  67  ? 51.564  82.331  201.537 1.00 24.63 ? 67   GLU D CD  1 
ATOM   10170 O  OE1 . GLU D 4  67  ? 51.022  83.425  201.293 1.00 26.93 ? 67   GLU D OE1 1 
ATOM   10171 O  OE2 . GLU D 4  67  ? 51.115  81.251  201.097 1.00 24.63 ? 67   GLU D OE2 1 
ATOM   10172 N  N   . VAL D 4  68  ? 57.393  82.375  201.604 1.00 22.72 ? 68   VAL D N   1 
ATOM   10173 C  CA  . VAL D 4  68  ? 58.681  81.634  201.717 1.00 23.23 ? 68   VAL D CA  1 
ATOM   10174 C  C   . VAL D 4  68  ? 59.897  82.594  201.809 1.00 23.44 ? 68   VAL D C   1 
ATOM   10175 O  O   . VAL D 4  68  ? 59.791  83.766  201.419 1.00 23.31 ? 68   VAL D O   1 
ATOM   10176 C  CB  . VAL D 4  68  ? 58.900  80.554  200.556 1.00 23.49 ? 68   VAL D CB  1 
ATOM   10177 C  CG1 . VAL D 4  68  ? 59.643  79.316  201.090 1.00 29.14 ? 68   VAL D CG1 1 
ATOM   10178 C  CG2 . VAL D 4  68  ? 57.579  80.101  199.893 1.00 29.73 ? 68   VAL D CG2 1 
ATOM   10179 N  N   . GLU D 4  69  ? 60.971  82.134  202.472 1.00 23.84 ? 69   GLU D N   1 
ATOM   10180 C  CA  . GLU D 4  69  ? 62.303  82.777  202.448 1.00 24.28 ? 69   GLU D CA  1 
ATOM   10181 C  C   . GLU D 4  69  ? 63.271  82.082  201.482 1.00 24.42 ? 69   GLU D C   1 
ATOM   10182 O  O   . GLU D 4  69  ? 63.341  80.840  201.453 1.00 24.34 ? 69   GLU D O   1 
ATOM   10183 C  CB  . GLU D 4  69  ? 62.907  82.837  203.857 1.00 24.55 ? 69   GLU D CB  1 
ATOM   10184 C  CG  . GLU D 4  69  ? 62.531  84.081  204.650 1.00 32.27 ? 69   GLU D CG  1 
ATOM   10185 C  CD  . GLU D 4  69  ? 61.426  83.819  205.657 1.00 36.52 ? 69   GLU D CD  1 
ATOM   10186 O  OE1 . GLU D 4  69  ? 60.237  83.970  205.293 1.00 37.83 ? 69   GLU D OE1 1 
ATOM   10187 O  OE2 . GLU D 4  69  ? 61.743  83.452  206.811 1.00 36.57 ? 69   GLU D OE2 1 
ATOM   10188 N  N   . VAL D 4  70  ? 64.112  82.886  200.819 1.00 24.70 ? 70   VAL D N   1 
ATOM   10189 C  CA  . VAL D 4  70  ? 64.763  82.495  199.554 1.00 25.06 ? 70   VAL D CA  1 
ATOM   10190 C  C   . VAL D 4  70  ? 66.273  82.168  199.671 1.00 25.46 ? 70   VAL D C   1 
ATOM   10191 O  O   . VAL D 4  70  ? 66.654  81.014  199.418 1.00 25.56 ? 70   VAL D O   1 
ATOM   10192 C  CB  . VAL D 4  70  ? 64.354  83.451  198.341 1.00 25.08 ? 70   VAL D CB  1 
ATOM   10193 C  CG1 . VAL D 4  70  ? 65.336  83.379  197.142 1.00 22.21 ? 70   VAL D CG1 1 
ATOM   10194 C  CG2 . VAL D 4  70  ? 62.928  83.123  197.854 1.00 19.41 ? 70   VAL D CG2 1 
ATOM   10195 N  N   . GLN D 4  71  ? 67.033  83.091  200.290 1.00 25.61 ? 71   GLN D N   1 
ATOM   10196 C  CA  . GLN D 4  71  ? 68.470  83.400  199.999 1.00 26.18 ? 71   GLN D CA  1 
ATOM   10197 C  C   . GLN D 4  71  ? 68.788  84.226  198.736 1.00 26.89 ? 71   GLN D C   1 
ATOM   10198 O  O   . GLN D 4  71  ? 68.678  83.728  197.603 1.00 26.88 ? 71   GLN D O   1 
ATOM   10199 C  CB  . GLN D 4  71  ? 69.456  82.212  200.206 1.00 26.14 ? 71   GLN D CB  1 
ATOM   10200 C  CG  . GLN D 4  71  ? 70.931  82.622  200.503 1.00 24.44 ? 71   GLN D CG  1 
ATOM   10201 C  CD  . GLN D 4  71  ? 71.906  81.443  200.503 1.00 24.33 ? 71   GLN D CD  1 
ATOM   10202 O  OE1 . GLN D 4  71  ? 72.095  80.783  199.480 1.00 26.55 ? 71   GLN D OE1 1 
ATOM   10203 N  NE2 . GLN D 4  71  ? 72.576  81.228  201.631 1.00 21.74 ? 71   GLN D NE2 1 
ATOM   10204 N  N   . ASP D 4  72  ? 69.226  85.471  198.974 1.00 27.68 ? 72   ASP D N   1 
ATOM   10205 C  CA  . ASP D 4  72  ? 69.811  86.357  197.954 1.00 28.58 ? 72   ASP D CA  1 
ATOM   10206 C  C   . ASP D 4  72  ? 71.333  86.508  198.089 1.00 29.31 ? 72   ASP D C   1 
ATOM   10207 O  O   . ASP D 4  72  ? 71.882  86.466  199.204 1.00 29.01 ? 72   ASP D O   1 
ATOM   10208 C  CB  . ASP D 4  72  ? 69.138  87.737  197.976 1.00 28.72 ? 72   ASP D CB  1 
ATOM   10209 C  CG  . ASP D 4  72  ? 69.193  88.442  196.620 1.00 32.77 ? 72   ASP D CG  1 
ATOM   10210 O  OD1 . ASP D 4  72  ? 68.129  88.648  196.007 1.00 32.57 ? 72   ASP D OD1 1 
ATOM   10211 O  OD2 . ASP D 4  72  ? 70.252  88.858  196.100 1.00 37.70 ? 72   ASP D OD2 1 
ATOM   10212 N  N   . GLY D 4  73  ? 71.995  86.650  196.930 1.00 30.24 ? 73   GLY D N   1 
ATOM   10213 C  CA  . GLY D 4  73  ? 73.426  86.935  196.823 1.00 30.73 ? 73   GLY D CA  1 
ATOM   10214 C  C   . GLY D 4  73  ? 73.848  88.294  197.387 1.00 31.09 ? 73   GLY D C   1 
ATOM   10215 O  O   . GLY D 4  73  ? 73.042  89.239  197.338 1.00 31.30 ? 73   GLY D O   1 
ATOM   10216 N  N   . PRO D 4  74  ? 75.149  88.452  197.709 1.00 31.14 ? 74   PRO D N   1 
ATOM   10217 C  CA  . PRO D 4  74  ? 75.579  89.206  198.903 1.00 30.85 ? 74   PRO D CA  1 
ATOM   10218 C  C   . PRO D 4  74  ? 75.478  90.741  198.798 1.00 30.80 ? 74   PRO D C   1 
ATOM   10219 O  O   . PRO D 4  74  ? 75.275  91.268  197.689 1.00 30.76 ? 74   PRO D O   1 
ATOM   10220 C  CB  . PRO D 4  74  ? 77.050  88.789  199.067 1.00 30.72 ? 74   PRO D CB  1 
ATOM   10221 C  CG  . PRO D 4  74  ? 77.393  87.967  197.854 1.00 31.41 ? 74   PRO D CG  1 
ATOM   10222 C  CD  . PRO D 4  74  ? 76.307  88.143  196.842 1.00 31.23 ? 74   PRO D CD  1 
ATOM   10223 N  N   . ASN D 4  75  ? 75.398  91.398  199.965 1.00 30.74 ? 75   ASN D N   1 
ATOM   10224 C  CA  . ASN D 4  75  ? 75.828  92.798  200.146 1.00 30.73 ? 75   ASN D CA  1 
ATOM   10225 C  C   . ASN D 4  75  ? 77.347  92.922  200.506 1.00 30.83 ? 75   ASN D C   1 
ATOM   10226 O  O   . ASN D 4  75  ? 78.080  91.917  200.426 1.00 30.91 ? 75   ASN D O   1 
ATOM   10227 C  CB  . ASN D 4  75  ? 74.901  93.516  201.160 1.00 30.66 ? 75   ASN D CB  1 
ATOM   10228 C  CG  . ASN D 4  75  ? 74.598  94.970  200.769 1.00 27.07 ? 75   ASN D CG  1 
ATOM   10229 O  OD1 . ASN D 4  75  ? 75.494  95.820  200.728 1.00 23.05 ? 75   ASN D OD1 1 
ATOM   10230 N  ND2 . ASN D 4  75  ? 73.318  95.274  200.586 1.00 26.16 ? 75   ASN D ND2 1 
ATOM   10231 N  N   . GLU D 4  76  ? 77.776  94.124  200.946 1.00 30.73 ? 76   GLU D N   1 
ATOM   10232 C  CA  . GLU D 4  76  ? 79.186  94.577  200.997 1.00 30.73 ? 76   GLU D CA  1 
ATOM   10233 C  C   . GLU D 4  76  ? 80.167  93.731  201.844 1.00 30.64 ? 76   GLU D C   1 
ATOM   10234 O  O   . GLU D 4  76  ? 81.377  93.722  201.556 1.00 30.71 ? 76   GLU D O   1 
ATOM   10235 C  CB  . GLU D 4  76  ? 79.260  96.063  201.409 1.00 30.75 ? 76   GLU D CB  1 
ATOM   10236 C  CG  . GLU D 4  76  ? 80.413  96.851  200.786 1.00 29.48 ? 76   GLU D CG  1 
ATOM   10237 C  CD  . GLU D 4  76  ? 79.978  98.185  200.208 1.00 29.00 ? 76   GLU D CD  1 
ATOM   10238 O  OE1 . GLU D 4  76  ? 80.162  99.219  200.882 1.00 27.29 ? 76   GLU D OE1 1 
ATOM   10239 O  OE2 . GLU D 4  76  ? 79.492  98.205  199.059 1.00 31.64 ? 76   GLU D OE2 1 
ATOM   10240 N  N   . ASP D 4  77  ? 79.646  93.051  202.877 1.00 30.45 ? 77   ASP D N   1 
ATOM   10241 C  CA  . ASP D 4  77  ? 80.434  92.135  203.728 1.00 30.29 ? 77   ASP D CA  1 
ATOM   10242 C  C   . ASP D 4  77  ? 80.819  90.809  203.054 1.00 30.07 ? 77   ASP D C   1 
ATOM   10243 O  O   . ASP D 4  77  ? 81.866  90.230  203.388 1.00 30.06 ? 77   ASP D O   1 
ATOM   10244 C  CB  . ASP D 4  77  ? 79.743  91.881  205.073 1.00 30.37 ? 77   ASP D CB  1 
ATOM   10245 C  CG  . ASP D 4  77  ? 79.680  93.123  205.942 1.00 31.89 ? 77   ASP D CG  1 
ATOM   10246 O  OD1 . ASP D 4  77  ? 78.598  93.743  206.002 1.00 31.92 ? 77   ASP D OD1 1 
ATOM   10247 O  OD2 . ASP D 4  77  ? 80.659  93.560  206.593 1.00 32.54 ? 77   ASP D OD2 1 
ATOM   10248 N  N   . GLY D 4  78  ? 79.967  90.337  202.131 1.00 29.87 ? 78   GLY D N   1 
ATOM   10249 C  CA  . GLY D 4  78  ? 80.179  89.104  201.377 1.00 29.59 ? 78   GLY D CA  1 
ATOM   10250 C  C   . GLY D 4  78  ? 79.652  87.907  202.134 1.00 29.37 ? 78   GLY D C   1 
ATOM   10251 O  O   . GLY D 4  78  ? 80.421  86.993  202.453 1.00 29.23 ? 78   GLY D O   1 
ATOM   10252 N  N   . GLU D 4  79  ? 78.328  87.778  202.119 1.00 29.43 ? 79   GLU D N   1 
ATOM   10253 C  CA  . GLU D 4  79  ? 77.548  87.426  203.313 1.00 29.62 ? 79   GLU D CA  1 
ATOM   10254 C  C   . GLU D 4  79  ? 76.551  86.270  203.126 1.00 29.55 ? 79   GLU D C   1 
ATOM   10255 O  O   . GLU D 4  79  ? 76.655  85.253  203.831 1.00 29.58 ? 79   GLU D O   1 
ATOM   10256 C  CB  . GLU D 4  79  ? 76.880  88.679  203.951 1.00 29.75 ? 79   GLU D CB  1 
ATOM   10257 C  CG  . GLU D 4  79  ? 76.081  89.586  202.999 1.00 29.04 ? 79   GLU D CG  1 
ATOM   10258 C  CD  . GLU D 4  79  ? 75.827  90.971  203.562 1.00 25.95 ? 79   GLU D CD  1 
ATOM   10259 O  OE1 . GLU D 4  79  ? 76.748  91.814  203.514 1.00 23.35 ? 79   GLU D OE1 1 
ATOM   10260 O  OE2 . GLU D 4  79  ? 74.665  91.259  203.919 1.00 25.25 ? 79   GLU D OE2 1 
ATOM   10261 N  N   . MET D 4  80  ? 75.763  86.347  202.043 1.00 29.49 ? 80   MET D N   1 
ATOM   10262 C  CA  . MET D 4  80  ? 74.469  85.653  201.873 1.00 29.60 ? 80   MET D CA  1 
ATOM   10263 C  C   . MET D 4  80  ? 73.449  85.800  203.016 1.00 29.35 ? 80   MET D C   1 
ATOM   10264 O  O   . MET D 4  80  ? 73.653  85.282  204.127 1.00 29.34 ? 80   MET D O   1 
ATOM   10265 C  CB  . MET D 4  80  ? 74.647  84.194  201.407 1.00 29.85 ? 80   MET D CB  1 
ATOM   10266 C  CG  . MET D 4  80  ? 74.467  83.986  199.897 1.00 37.74 ? 80   MET D CG  1 
ATOM   10267 S  SD  . MET D 4  80  ? 75.759  84.727  198.851 1.00 43.86 ? 80   MET D SD  1 
ATOM   10268 C  CE  . MET D 4  80  ? 77.106  83.500  198.998 1.00 44.89 ? 80   MET D CE  1 
ATOM   10269 N  N   . PHE D 4  81  ? 72.439  86.638  202.752 1.00 29.03 ? 81   PHE D N   1 
ATOM   10270 C  CA  . PHE D 4  81  ? 71.276  86.879  203.632 1.00 28.69 ? 81   PHE D CA  1 
ATOM   10271 C  C   . PHE D 4  81  ? 70.009  86.156  203.126 1.00 28.44 ? 81   PHE D C   1 
ATOM   10272 O  O   . PHE D 4  81  ? 69.944  85.768  201.948 1.00 28.39 ? 81   PHE D O   1 
ATOM   10273 C  CB  . PHE D 4  81  ? 71.027  88.399  203.808 1.00 28.62 ? 81   PHE D CB  1 
ATOM   10274 C  CG  . PHE D 4  81  ? 70.737  89.142  202.513 1.00 31.30 ? 81   PHE D CG  1 
ATOM   10275 C  CD1 . PHE D 4  81  ? 69.394  89.360  202.091 1.00 31.31 ? 81   PHE D CD1 1 
ATOM   10276 C  CD2 . PHE D 4  81  ? 71.795  89.744  201.773 1.00 31.59 ? 81   PHE D CD2 1 
ATOM   10277 C  CE1 . PHE D 4  81  ? 69.103  90.080  200.878 1.00 31.81 ? 81   PHE D CE1 1 
ATOM   10278 C  CE2 . PHE D 4  81  ? 71.532  90.479  200.563 1.00 30.70 ? 81   PHE D CE2 1 
ATOM   10279 C  CZ  . PHE D 4  81  ? 70.177  90.650  200.118 1.00 33.42 ? 81   PHE D CZ  1 
ATOM   10280 N  N   . MET D 4  82  ? 69.011  86.014  204.012 1.00 28.13 ? 82   MET D N   1 
ATOM   10281 C  CA  . MET D 4  82  ? 67.661  85.533  203.653 1.00 27.79 ? 82   MET D CA  1 
ATOM   10282 C  C   . MET D 4  82  ? 66.684  86.684  203.373 1.00 27.68 ? 82   MET D C   1 
ATOM   10283 O  O   . MET D 4  82  ? 66.730  87.728  204.040 1.00 27.50 ? 82   MET D O   1 
ATOM   10284 C  CB  . MET D 4  82  ? 67.101  84.573  204.718 1.00 27.70 ? 82   MET D CB  1 
ATOM   10285 C  CG  . MET D 4  82  ? 67.862  83.244  204.870 1.00 26.29 ? 82   MET D CG  1 
ATOM   10286 S  SD  . MET D 4  82  ? 67.602  82.072  203.518 1.00 24.19 ? 82   MET D SD  1 
ATOM   10287 C  CE  . MET D 4  82  ? 68.867  80.849  203.898 1.00 26.70 ? 82   MET D CE  1 
ATOM   10288 N  N   . ARG D 4  83  ? 65.724  86.413  202.484 1.00 27.93 ? 83   ARG D N   1 
ATOM   10289 C  CA  . ARG D 4  83  ? 64.955  87.433  201.753 1.00 28.23 ? 83   ARG D CA  1 
ATOM   10290 C  C   . ARG D 4  83  ? 63.439  87.071  201.775 1.00 28.14 ? 83   ARG D C   1 
ATOM   10291 O  O   . ARG D 4  83  ? 63.111  85.902  201.514 1.00 28.16 ? 83   ARG D O   1 
ATOM   10292 C  CB  . ARG D 4  83  ? 65.496  87.559  200.304 1.00 28.53 ? 83   ARG D CB  1 
ATOM   10293 C  CG  . ARG D 4  83  ? 64.814  88.634  199.397 1.00 32.06 ? 83   ARG D CG  1 
ATOM   10294 C  CD  . ARG D 4  83  ? 65.543  88.966  198.095 1.00 31.01 ? 83   ARG D CD  1 
ATOM   10295 N  NE  . ARG D 4  83  ? 65.739  87.789  197.227 1.00 37.29 ? 83   ARG D NE  1 
ATOM   10296 C  CZ  . ARG D 4  83  ? 65.093  87.527  196.078 1.00 37.09 ? 83   ARG D CZ  1 
ATOM   10297 N  NH1 . ARG D 4  83  ? 64.218  88.380  195.543 1.00 38.33 ? 83   ARG D NH1 1 
ATOM   10298 N  NH2 . ARG D 4  83  ? 65.392  86.423  195.416 1.00 37.94 ? 83   ARG D NH2 1 
ATOM   10299 N  N   . PRO D 4  84  ? 62.539  88.065  202.011 1.00 28.16 ? 84   PRO D N   1 
ATOM   10300 C  CA  . PRO D 4  84  ? 61.074  87.836  202.047 1.00 28.25 ? 84   PRO D CA  1 
ATOM   10301 C  C   . PRO D 4  84  ? 60.387  87.178  200.834 1.00 28.65 ? 84   PRO D C   1 
ATOM   10302 O  O   . PRO D 4  84  ? 59.273  86.679  201.042 1.00 29.25 ? 84   PRO D O   1 
ATOM   10303 C  CB  . PRO D 4  84  ? 60.495  89.242  202.289 1.00 28.22 ? 84   PRO D CB  1 
ATOM   10304 C  CG  . PRO D 4  84  ? 61.627  90.183  202.073 1.00 29.66 ? 84   PRO D CG  1 
ATOM   10305 C  CD  . PRO D 4  84  ? 62.845  89.437  202.484 1.00 28.26 ? 84   PRO D CD  1 
ATOM   10306 N  N   . GLY D 4  85  ? 60.998  87.201  199.635 1.00 28.23 ? 85   GLY D N   1 
ATOM   10307 C  CA  . GLY D 4  85  ? 60.529  86.442  198.470 1.00 27.76 ? 85   GLY D CA  1 
ATOM   10308 C  C   . GLY D 4  85  ? 59.671  87.270  197.522 1.00 27.42 ? 85   GLY D C   1 
ATOM   10309 O  O   . GLY D 4  85  ? 58.739  87.953  197.984 1.00 27.34 ? 85   GLY D O   1 
ATOM   10310 N  N   . LYS D 4  86  ? 59.884  87.081  196.205 1.00 26.93 ? 86   LYS D N   1 
ATOM   10311 C  CA  . LYS D 4  86  ? 59.580  88.105  195.176 1.00 26.48 ? 86   LYS D CA  1 
ATOM   10312 C  C   . LYS D 4  86  ? 58.519  87.726  194.096 1.00 26.00 ? 86   LYS D C   1 
ATOM   10313 O  O   . LYS D 4  86  ? 57.325  87.921  194.351 1.00 26.60 ? 86   LYS D O   1 
ATOM   10314 C  CB  . LYS D 4  86  ? 60.864  88.736  194.603 1.00 26.38 ? 86   LYS D CB  1 
ATOM   10315 C  CG  . LYS D 4  86  ? 61.200  90.087  195.206 1.00 34.23 ? 86   LYS D CG  1 
ATOM   10316 C  CD  . LYS D 4  86  ? 61.625  91.098  194.143 1.00 35.42 ? 86   LYS D CD  1 
ATOM   10317 C  CE  . LYS D 4  86  ? 61.108  92.500  194.475 1.00 39.07 ? 86   LYS D CE  1 
ATOM   10318 N  NZ  . LYS D 4  86  ? 61.966  93.223  195.468 1.00 36.10 ? 86   LYS D NZ  1 
ATOM   10319 N  N   . LEU D 4  87  ? 58.974  87.392  192.871 1.00 24.63 ? 87   LEU D N   1 
ATOM   10320 C  CA  . LEU D 4  87  ? 58.190  86.795  191.753 1.00 23.36 ? 87   LEU D CA  1 
ATOM   10321 C  C   . LEU D 4  87  ? 59.133  86.098  190.743 1.00 22.39 ? 87   LEU D C   1 
ATOM   10322 O  O   . LEU D 4  87  ? 58.727  85.139  190.066 1.00 21.94 ? 87   LEU D O   1 
ATOM   10323 C  CB  . LEU D 4  87  ? 57.347  87.853  190.993 1.00 22.95 ? 87   LEU D CB  1 
ATOM   10324 C  CG  . LEU D 4  87  ? 55.884  88.174  191.367 1.00 16.21 ? 87   LEU D CG  1 
ATOM   10325 C  CD1 . LEU D 4  87  ? 55.462  89.527  190.787 1.00 16.97 ? 87   LEU D CD1 1 
ATOM   10326 C  CD2 . LEU D 4  87  ? 54.871  87.082  190.985 1.00 11.39 ? 87   LEU D CD2 1 
ATOM   10327 N  N   . SER D 4  88  ? 60.332  86.681  190.580 1.00 21.94 ? 88   SER D N   1 
ATOM   10328 C  CA  . SER D 4  88  ? 61.475  86.130  189.822 1.00 21.68 ? 88   SER D CA  1 
ATOM   10329 C  C   . SER D 4  88  ? 62.076  84.813  190.359 1.00 21.74 ? 88   SER D C   1 
ATOM   10330 O  O   . SER D 4  88  ? 62.828  84.139  189.636 1.00 21.47 ? 88   SER D O   1 
ATOM   10331 C  CB  . SER D 4  88  ? 62.579  87.197  189.707 1.00 21.63 ? 88   SER D CB  1 
ATOM   10332 O  OG  . SER D 4  88  ? 63.084  87.564  190.988 1.00 13.24 ? 88   SER D OG  1 
ATOM   10333 N  N   . ASP D 4  89  ? 61.850  84.534  191.651 1.00 22.26 ? 89   ASP D N   1 
ATOM   10334 C  CA  . ASP D 4  89  ? 62.391  83.343  192.334 1.00 22.74 ? 89   ASP D CA  1 
ATOM   10335 C  C   . ASP D 4  89  ? 61.626  82.073  191.971 1.00 22.84 ? 89   ASP D C   1 
ATOM   10336 O  O   . ASP D 4  89  ? 60.403  82.111  191.750 1.00 22.95 ? 89   ASP D O   1 
ATOM   10337 C  CB  . ASP D 4  89  ? 62.499  83.513  193.874 1.00 23.11 ? 89   ASP D CB  1 
ATOM   10338 C  CG  . ASP D 4  89  ? 61.759  84.745  194.407 1.00 31.06 ? 89   ASP D CG  1 
ATOM   10339 O  OD1 . ASP D 4  89  ? 62.437  85.691  194.862 1.00 33.00 ? 89   ASP D OD1 1 
ATOM   10340 O  OD2 . ASP D 4  89  ? 60.511  84.853  194.396 1.00 33.87 ? 89   ASP D OD2 1 
ATOM   10341 N  N   . TYR D 4  90  ? 62.380  80.980  191.817 1.00 22.68 ? 90   TYR D N   1 
ATOM   10342 C  CA  . TYR D 4  90  ? 61.838  79.643  191.534 1.00 22.51 ? 90   TYR D CA  1 
ATOM   10343 C  C   . TYR D 4  90  ? 61.368  78.882  192.791 1.00 22.40 ? 90   TYR D C   1 
ATOM   10344 O  O   . TYR D 4  90  ? 61.860  79.135  193.906 1.00 22.10 ? 90   TYR D O   1 
ATOM   10345 C  CB  . TYR D 4  90  ? 62.846  78.824  190.711 1.00 22.52 ? 90   TYR D CB  1 
ATOM   10346 C  CG  . TYR D 4  90  ? 62.903  79.229  189.250 1.00 24.52 ? 90   TYR D CG  1 
ATOM   10347 C  CD1 . TYR D 4  90  ? 63.801  80.241  188.805 1.00 23.14 ? 90   TYR D CD1 1 
ATOM   10348 C  CD2 . TYR D 4  90  ? 62.047  78.614  188.294 1.00 24.55 ? 90   TYR D CD2 1 
ATOM   10349 C  CE1 . TYR D 4  90  ? 63.823  80.656  187.427 1.00 21.92 ? 90   TYR D CE1 1 
ATOM   10350 C  CE2 . TYR D 4  90  ? 62.074  79.000  186.917 1.00 20.55 ? 90   TYR D CE2 1 
ATOM   10351 C  CZ  . TYR D 4  90  ? 62.948  80.027  186.500 1.00 18.95 ? 90   TYR D CZ  1 
ATOM   10352 O  OH  . TYR D 4  90  ? 62.929  80.428  185.183 1.00 13.05 ? 90   TYR D OH  1 
ATOM   10353 N  N   . PHE D 4  91  ? 60.422  77.954  192.574 1.00 22.51 ? 91   PHE D N   1 
ATOM   10354 C  CA  . PHE D 4  91  ? 59.757  77.135  193.614 1.00 22.54 ? 91   PHE D CA  1 
ATOM   10355 C  C   . PHE D 4  91  ? 60.789  76.314  194.439 1.00 23.24 ? 91   PHE D C   1 
ATOM   10356 O  O   . PHE D 4  91  ? 61.717  75.715  193.853 1.00 23.36 ? 91   PHE D O   1 
ATOM   10357 C  CB  . PHE D 4  91  ? 58.721  76.183  192.961 1.00 22.03 ? 91   PHE D CB  1 
ATOM   10358 C  CG  . PHE D 4  91  ? 57.403  76.847  192.499 1.00 10.52 ? 91   PHE D CG  1 
ATOM   10359 C  CD1 . PHE D 4  91  ? 56.380  76.021  191.964 1.00 12.14 ? 91   PHE D CD1 1 
ATOM   10360 C  CD2 . PHE D 4  91  ? 57.179  78.263  192.541 1.00 10.82 ? 91   PHE D CD2 1 
ATOM   10361 C  CE1 . PHE D 4  91  ? 55.134  76.575  191.497 1.00 10.05 ? 91   PHE D CE1 1 
ATOM   10362 C  CE2 . PHE D 4  91  ? 55.942  78.841  192.072 1.00 10.07 ? 91   PHE D CE2 1 
ATOM   10363 C  CZ  . PHE D 4  91  ? 54.928  77.989  191.527 1.00 9.38  ? 91   PHE D CZ  1 
ATOM   10364 N  N   . PRO D 4  92  ? 60.624  76.281  195.778 1.00 23.65 ? 92   PRO D N   1 
ATOM   10365 C  CA  . PRO D 4  92  ? 61.690  76.698  196.696 1.00 23.83 ? 92   PRO D CA  1 
ATOM   10366 C  C   . PRO D 4  92  ? 62.862  75.714  196.918 1.00 24.12 ? 92   PRO D C   1 
ATOM   10367 O  O   . PRO D 4  92  ? 63.912  76.240  197.334 1.00 24.39 ? 92   PRO D O   1 
ATOM   10368 C  CB  . PRO D 4  92  ? 60.931  76.954  198.002 1.00 23.90 ? 92   PRO D CB  1 
ATOM   10369 C  CG  . PRO D 4  92  ? 59.480  76.619  197.688 1.00 25.19 ? 92   PRO D CG  1 
ATOM   10370 C  CD  . PRO D 4  92  ? 59.514  75.669  196.535 1.00 23.65 ? 92   PRO D CD  1 
ATOM   10371 N  N   . LYS D 4  93  ? 62.789  74.485  196.362 1.00 24.03 ? 93   LYS D N   1 
ATOM   10372 C  CA  . LYS D 4  93  ? 63.663  73.314  196.683 1.00 24.41 ? 93   LYS D CA  1 
ATOM   10373 C  C   . LYS D 4  93  ? 63.508  72.773  198.132 1.00 24.97 ? 93   LYS D C   1 
ATOM   10374 O  O   . LYS D 4  93  ? 63.765  73.526  199.094 1.00 24.98 ? 93   LYS D O   1 
ATOM   10375 C  CB  . LYS D 4  93  ? 65.159  73.520  196.317 1.00 24.48 ? 93   LYS D CB  1 
ATOM   10376 C  CG  . LYS D 4  93  ? 65.569  73.057  194.926 1.00 26.45 ? 93   LYS D CG  1 
ATOM   10377 C  CD  . LYS D 4  93  ? 66.657  73.960  194.338 1.00 23.80 ? 93   LYS D CD  1 
ATOM   10378 C  CE  . LYS D 4  93  ? 67.958  73.193  194.084 1.00 18.91 ? 93   LYS D CE  1 
ATOM   10379 N  NZ  . LYS D 4  93  ? 68.302  73.125  192.626 1.00 6.65  ? 93   LYS D NZ  1 
ATOM   10380 N  N   . PRO D 4  94  ? 63.032  71.514  198.292 1.00 25.35 ? 94   PRO D N   1 
ATOM   10381 C  CA  . PRO D 4  94  ? 63.108  70.817  199.595 1.00 25.74 ? 94   PRO D CA  1 
ATOM   10382 C  C   . PRO D 4  94  ? 64.519  70.392  200.031 1.00 25.99 ? 94   PRO D C   1 
ATOM   10383 O  O   . PRO D 4  94  ? 64.725  70.286  201.246 1.00 25.99 ? 94   PRO D O   1 
ATOM   10384 C  CB  . PRO D 4  94  ? 62.207  69.594  199.399 1.00 25.86 ? 94   PRO D CB  1 
ATOM   10385 C  CG  . PRO D 4  94  ? 62.169  69.383  197.911 1.00 28.36 ? 94   PRO D CG  1 
ATOM   10386 C  CD  . PRO D 4  94  ? 62.204  70.745  197.328 1.00 25.16 ? 94   PRO D CD  1 
ATOM   10387 N  N   . TYR D 4  95  ? 65.422  70.107  199.076 1.00 26.31 ? 95   TYR D N   1 
ATOM   10388 C  CA  . TYR D 4  95  ? 66.776  69.575  199.359 1.00 26.76 ? 95   TYR D CA  1 
ATOM   10389 C  C   . TYR D 4  95  ? 67.920  70.305  198.606 1.00 27.53 ? 95   TYR D C   1 
ATOM   10390 O  O   . TYR D 4  95  ? 67.743  70.637  197.420 1.00 27.54 ? 95   TYR D O   1 
ATOM   10391 C  CB  . TYR D 4  95  ? 66.864  68.058  199.102 1.00 26.51 ? 95   TYR D CB  1 
ATOM   10392 C  CG  . TYR D 4  95  ? 65.758  67.227  199.727 1.00 21.71 ? 95   TYR D CG  1 
ATOM   10393 C  CD1 . TYR D 4  95  ? 64.648  66.812  198.949 1.00 15.60 ? 95   TYR D CD1 1 
ATOM   10394 C  CD2 . TYR D 4  95  ? 65.782  66.890  201.115 1.00 20.65 ? 95   TYR D CD2 1 
ATOM   10395 C  CE1 . TYR D 4  95  ? 63.586  66.055  199.523 1.00 20.06 ? 95   TYR D CE1 1 
ATOM   10396 C  CE2 . TYR D 4  95  ? 64.703  66.164  201.716 1.00 17.22 ? 95   TYR D CE2 1 
ATOM   10397 C  CZ  . TYR D 4  95  ? 63.621  65.736  200.902 1.00 20.24 ? 95   TYR D CZ  1 
ATOM   10398 O  OH  . TYR D 4  95  ? 62.592  64.997  201.438 1.00 15.44 ? 95   TYR D OH  1 
ATOM   10399 N  N   . PRO D 4  96  ? 69.081  70.527  199.274 1.00 28.17 ? 96   PRO D N   1 
ATOM   10400 C  CA  . PRO D 4  96  ? 70.294  71.041  198.598 1.00 28.69 ? 96   PRO D CA  1 
ATOM   10401 C  C   . PRO D 4  96  ? 70.963  70.093  197.576 1.00 29.15 ? 96   PRO D C   1 
ATOM   10402 O  O   . PRO D 4  96  ? 71.687  70.605  196.708 1.00 29.22 ? 96   PRO D O   1 
ATOM   10403 C  CB  . PRO D 4  96  ? 71.246  71.336  199.764 1.00 28.73 ? 96   PRO D CB  1 
ATOM   10404 C  CG  . PRO D 4  96  ? 70.764  70.483  200.870 1.00 28.31 ? 96   PRO D CG  1 
ATOM   10405 C  CD  . PRO D 4  96  ? 69.283  70.491  200.742 1.00 28.13 ? 96   PRO D CD  1 
ATOM   10406 N  N   . ASN D 4  97  ? 70.886  68.775  197.814 1.00 29.46 ? 97   ASN D N   1 
ATOM   10407 C  CA  . ASN D 4  97  ? 71.433  67.727  196.916 1.00 29.44 ? 97   ASN D CA  1 
ATOM   10408 C  C   . ASN D 4  97  ? 70.354  66.684  196.497 1.00 29.23 ? 97   ASN D C   1 
ATOM   10409 O  O   . ASN D 4  97  ? 69.259  66.683  197.083 1.00 29.47 ? 97   ASN D O   1 
ATOM   10410 C  CB  . ASN D 4  97  ? 72.657  67.009  197.551 1.00 29.55 ? 97   ASN D CB  1 
ATOM   10411 C  CG  . ASN D 4  97  ? 73.648  67.971  198.220 1.00 32.84 ? 97   ASN D CG  1 
ATOM   10412 O  OD1 . ASN D 4  97  ? 73.782  67.972  199.440 1.00 30.24 ? 97   ASN D OD1 1 
ATOM   10413 N  ND2 . ASN D 4  97  ? 74.391  68.734  197.415 1.00 36.42 ? 97   ASN D ND2 1 
ATOM   10414 N  N   . PRO D 4  98  ? 70.616  65.868  195.448 1.00 28.73 ? 98   PRO D N   1 
ATOM   10415 C  CA  . PRO D 4  98  ? 69.987  64.533  195.334 1.00 28.18 ? 98   PRO D CA  1 
ATOM   10416 C  C   . PRO D 4  98  ? 70.250  63.548  196.496 1.00 27.30 ? 98   PRO D C   1 
ATOM   10417 O  O   . PRO D 4  98  ? 69.378  62.709  196.766 1.00 27.32 ? 98   PRO D O   1 
ATOM   10418 C  CB  . PRO D 4  98  ? 70.543  63.982  194.004 1.00 28.31 ? 98   PRO D CB  1 
ATOM   10419 C  CG  . PRO D 4  98  ? 71.544  64.990  193.528 1.00 28.15 ? 98   PRO D CG  1 
ATOM   10420 C  CD  . PRO D 4  98  ? 71.169  66.290  194.143 1.00 28.76 ? 98   PRO D CD  1 
ATOM   10421 N  N   . GLU D 4  99  ? 71.452  63.587  197.080 1.00 26.38 ? 99   GLU D N   1 
ATOM   10422 C  CA  . GLU D 4  99  ? 71.841  62.687  198.186 1.00 25.70 ? 99   GLU D CA  1 
ATOM   10423 C  C   . GLU D 4  99  ? 71.069  62.946  199.497 1.00 25.13 ? 99   GLU D C   1 
ATOM   10424 O  O   . GLU D 4  99  ? 70.648  61.986  200.170 1.00 24.86 ? 99   GLU D O   1 
ATOM   10425 C  CB  . GLU D 4  99  ? 73.374  62.609  198.427 1.00 25.60 ? 99   GLU D CB  1 
ATOM   10426 C  CG  . GLU D 4  99  ? 74.280  63.546  197.628 1.00 24.33 ? 99   GLU D CG  1 
ATOM   10427 C  CD  . GLU D 4  99  ? 74.607  63.021  196.242 1.00 22.62 ? 99   GLU D CD  1 
ATOM   10428 O  OE1 . GLU D 4  99  ? 75.696  62.443  196.056 1.00 21.90 ? 99   GLU D OE1 1 
ATOM   10429 O  OE2 . GLU D 4  99  ? 73.789  63.222  195.326 1.00 23.12 ? 99   GLU D OE2 1 
ATOM   10430 N  N   . ALA D 4  100 ? 70.854  64.238  199.804 1.00 24.65 ? 100  ALA D N   1 
ATOM   10431 C  CA  . ALA D 4  100 ? 69.939  64.713  200.864 1.00 24.07 ? 100  ALA D CA  1 
ATOM   10432 C  C   . ALA D 4  100 ? 68.463  64.299  200.694 1.00 23.56 ? 100  ALA D C   1 
ATOM   10433 O  O   . ALA D 4  100 ? 67.763  64.097  201.698 1.00 23.66 ? 100  ALA D O   1 
ATOM   10434 C  CB  . ALA D 4  100 ? 70.057  66.224  201.037 1.00 23.99 ? 100  ALA D CB  1 
ATOM   10435 N  N   . ALA D 4  101 ? 67.990  64.256  199.439 1.00 22.98 ? 101  ALA D N   1 
ATOM   10436 C  CA  . ALA D 4  101 ? 66.697  63.640  199.070 1.00 22.52 ? 101  ALA D CA  1 
ATOM   10437 C  C   . ALA D 4  101 ? 66.606  62.139  199.388 1.00 21.87 ? 101  ALA D C   1 
ATOM   10438 O  O   . ALA D 4  101 ? 65.555  61.667  199.844 1.00 21.53 ? 101  ALA D O   1 
ATOM   10439 C  CB  . ALA D 4  101 ? 66.371  63.899  197.594 1.00 22.52 ? 101  ALA D CB  1 
ATOM   10440 N  N   . ARG D 4  102 ? 67.695  61.413  199.094 1.00 21.75 ? 102  ARG D N   1 
ATOM   10441 C  CA  . ARG D 4  102 ? 67.831  59.967  199.341 1.00 21.58 ? 102  ARG D CA  1 
ATOM   10442 C  C   . ARG D 4  102 ? 67.937  59.635  200.839 1.00 21.44 ? 102  ARG D C   1 
ATOM   10443 O  O   . ARG D 4  102 ? 67.316  58.666  201.302 1.00 21.67 ? 102  ARG D O   1 
ATOM   10444 C  CB  . ARG D 4  102 ? 69.027  59.385  198.559 1.00 21.65 ? 102  ARG D CB  1 
ATOM   10445 C  CG  . ARG D 4  102 ? 68.806  59.250  197.036 1.00 20.51 ? 102  ARG D CG  1 
ATOM   10446 C  CD  . ARG D 4  102 ? 69.830  58.367  196.314 1.00 19.93 ? 102  ARG D CD  1 
ATOM   10447 N  NE  . ARG D 4  102 ? 69.598  58.320  194.859 1.00 23.13 ? 102  ARG D NE  1