data_2G19
# 
_entry.id   2G19 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2G19         
RCSB  RCSB036561   
WWPDB D_1000036561 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2G19 
_pdbx_database_status.recvd_initial_deposition_date   2006-02-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Syed, R.S.' 1 
'Li, V.'     2 
# 
_citation.id                        primary 
_citation.title                     
'Cellular oxygen sensing: Crystal structure of hypoxia-inducible factor prolyl hydroxylase (PHD2).' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            103 
_citation.page_first                9814 
_citation.page_last                 9819 
_citation.year                      2006 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16782814 
_citation.pdbx_database_id_DOI      10.1073/pnas.0601283103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'McDonough, M.A.' 1  
primary 'Li, V.'          2  
primary 'Flashman, E.'    3  
primary 'Chowdhury, R.'   4  
primary 'Mohr, C.'        5  
primary 'Lienard, B.M.'   6  
primary 'Zondlo, J.'      7  
primary 'Oldham, N.J.'    8  
primary 'Clifton, I.J.'   9  
primary 'Lewis, J.'       10 
primary 'McNeill, L.A.'   11 
primary 'Kurzeja, R.J.'   12 
primary 'Hewitson, K.S.'  13 
primary 'Yang, E.'        14 
primary 'Jordan, S.'      15 
primary 'Syed, R.S.'      16 
primary 'Schofield, C.J.' 17 
# 
_cell.entry_id           2G19 
_cell.length_a           110.851 
_cell.length_b           110.851 
_cell.length_c           40.379 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2G19 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Egl nine homolog 1'                                    27549.391 1   1.14.11.- ? 'CATALYTIC DOMAIN' ? 
2 non-polymer syn 'FE (II) ION'                                           55.845    1   ?         ? ?                  ? 
3 non-polymer syn 'N-[(4-HYDROXY-8-IODOISOQUINOLIN-3-YL)CARBONYL]GLYCINE' 372.115   1   ?         ? ?                  ? 
4 water       nat water                                                   18.015    135 ?         ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Hypoxia-inducible factor prolyl hydroxylase 2, HIF-prolyl hydroxylase 2, HIF-PH2, HPH-2, Prolyl hydroxylase domain-containing protein 2, PHD2, SM-20
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWI
EGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVS
GGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPHH
HHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWI
EGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVS
GGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPHH
HHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ASN n 
1 4   GLY n 
1 5   GLN n 
1 6   THR n 
1 7   LYS n 
1 8   PRO n 
1 9   LEU n 
1 10  PRO n 
1 11  ALA n 
1 12  LEU n 
1 13  LYS n 
1 14  LEU n 
1 15  ALA n 
1 16  LEU n 
1 17  GLU n 
1 18  TYR n 
1 19  ILE n 
1 20  VAL n 
1 21  PRO n 
1 22  CYS n 
1 23  MET n 
1 24  ASN n 
1 25  LYS n 
1 26  HIS n 
1 27  GLY n 
1 28  ILE n 
1 29  CYS n 
1 30  VAL n 
1 31  VAL n 
1 32  ASP n 
1 33  ASP n 
1 34  PHE n 
1 35  LEU n 
1 36  GLY n 
1 37  LYS n 
1 38  GLU n 
1 39  THR n 
1 40  GLY n 
1 41  GLN n 
1 42  GLN n 
1 43  ILE n 
1 44  GLY n 
1 45  ASP n 
1 46  GLU n 
1 47  VAL n 
1 48  ARG n 
1 49  ALA n 
1 50  LEU n 
1 51  HIS n 
1 52  ASP n 
1 53  THR n 
1 54  GLY n 
1 55  LYS n 
1 56  PHE n 
1 57  THR n 
1 58  ASP n 
1 59  GLY n 
1 60  GLN n 
1 61  LEU n 
1 62  VAL n 
1 63  SER n 
1 64  GLN n 
1 65  LYS n 
1 66  SER n 
1 67  ASP n 
1 68  SER n 
1 69  SER n 
1 70  LYS n 
1 71  ASP n 
1 72  ILE n 
1 73  ARG n 
1 74  GLY n 
1 75  ASP n 
1 76  LYS n 
1 77  ILE n 
1 78  THR n 
1 79  TRP n 
1 80  ILE n 
1 81  GLU n 
1 82  GLY n 
1 83  LYS n 
1 84  GLU n 
1 85  PRO n 
1 86  GLY n 
1 87  CYS n 
1 88  GLU n 
1 89  THR n 
1 90  ILE n 
1 91  GLY n 
1 92  LEU n 
1 93  LEU n 
1 94  MET n 
1 95  SER n 
1 96  SER n 
1 97  MET n 
1 98  ASP n 
1 99  ASP n 
1 100 LEU n 
1 101 ILE n 
1 102 ARG n 
1 103 HIS n 
1 104 CYS n 
1 105 ASN n 
1 106 GLY n 
1 107 LYS n 
1 108 LEU n 
1 109 GLY n 
1 110 SER n 
1 111 TYR n 
1 112 LYS n 
1 113 ILE n 
1 114 ASN n 
1 115 GLY n 
1 116 ARG n 
1 117 THR n 
1 118 LYS n 
1 119 ALA n 
1 120 MET n 
1 121 VAL n 
1 122 ALA n 
1 123 CYS n 
1 124 TYR n 
1 125 PRO n 
1 126 GLY n 
1 127 ASN n 
1 128 GLY n 
1 129 THR n 
1 130 GLY n 
1 131 TYR n 
1 132 VAL n 
1 133 ARG n 
1 134 HIS n 
1 135 VAL n 
1 136 ASP n 
1 137 ASN n 
1 138 PRO n 
1 139 ASN n 
1 140 GLY n 
1 141 ASP n 
1 142 GLY n 
1 143 ARG n 
1 144 CYS n 
1 145 VAL n 
1 146 THR n 
1 147 CYS n 
1 148 ILE n 
1 149 TYR n 
1 150 TYR n 
1 151 LEU n 
1 152 ASN n 
1 153 LYS n 
1 154 ASP n 
1 155 TRP n 
1 156 ASP n 
1 157 ALA n 
1 158 LYS n 
1 159 VAL n 
1 160 SER n 
1 161 GLY n 
1 162 GLY n 
1 163 ILE n 
1 164 LEU n 
1 165 ARG n 
1 166 ILE n 
1 167 PHE n 
1 168 PRO n 
1 169 GLU n 
1 170 GLY n 
1 171 LYS n 
1 172 ALA n 
1 173 GLN n 
1 174 PHE n 
1 175 ALA n 
1 176 ASP n 
1 177 ILE n 
1 178 GLU n 
1 179 PRO n 
1 180 LYS n 
1 181 PHE n 
1 182 ASP n 
1 183 ARG n 
1 184 LEU n 
1 185 LEU n 
1 186 PHE n 
1 187 PHE n 
1 188 TRP n 
1 189 SER n 
1 190 ASP n 
1 191 ARG n 
1 192 ARG n 
1 193 ASN n 
1 194 PRO n 
1 195 HIS n 
1 196 GLU n 
1 197 VAL n 
1 198 GLN n 
1 199 PRO n 
1 200 ALA n 
1 201 TYR n 
1 202 ALA n 
1 203 THR n 
1 204 ARG n 
1 205 TYR n 
1 206 ALA n 
1 207 ILE n 
1 208 THR n 
1 209 VAL n 
1 210 TRP n 
1 211 TYR n 
1 212 PHE n 
1 213 ASP n 
1 214 ALA n 
1 215 ASP n 
1 216 GLU n 
1 217 ARG n 
1 218 ALA n 
1 219 ARG n 
1 220 ALA n 
1 221 LYS n 
1 222 VAL n 
1 223 LYS n 
1 224 TYR n 
1 225 LEU n 
1 226 THR n 
1 227 GLY n 
1 228 GLU n 
1 229 LYS n 
1 230 GLY n 
1 231 VAL n 
1 232 ARG n 
1 233 VAL n 
1 234 GLU n 
1 235 LEU n 
1 236 ASN n 
1 237 LYS n 
1 238 PRO n 
1 239 HIS n 
1 240 HIS n 
1 241 HIS n 
1 242 HIS n 
1 243 HIS n 
1 244 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EGLN1_HUMAN 
_struct_ref.pdbx_db_accession          Q9GZT9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWI
EGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVS
GGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKP
;
_struct_ref.pdbx_align_begin           181 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2G19 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 238 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9GZT9 
_struct_ref_seq.db_align_beg                  181 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  418 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       180 
_struct_ref_seq.pdbx_auth_seq_align_end       417 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2G19 HIS A 239 ? UNP Q9GZT9 ? ? 'EXPRESSION TAG' 418 1 
1 2G19 HIS A 240 ? UNP Q9GZT9 ? ? 'EXPRESSION TAG' 419 2 
1 2G19 HIS A 241 ? UNP Q9GZT9 ? ? 'EXPRESSION TAG' 420 3 
1 2G19 HIS A 242 ? UNP Q9GZT9 ? ? 'EXPRESSION TAG' 421 4 
1 2G19 HIS A 243 ? UNP Q9GZT9 ? ? 'EXPRESSION TAG' 422 5 
1 2G19 HIS A 244 ? UNP Q9GZT9 ? ? 'EXPRESSION TAG' 423 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4HG non-polymer         . 'N-[(4-HYDROXY-8-IODOISOQUINOLIN-3-YL)CARBONYL]GLYCINE' ? 'C12 H9 I N2 O4' 372.115 
ALA 'L-peptide linking' y ALANINE                                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                ? 'C3 H7 N O2 S'   121.158 
FE2 non-polymer         . 'FE (II) ION'                                           ? 'Fe 2'           55.845  
GLN 'L-peptide linking' y GLUTAMINE                                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                              ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2G19 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.60 
_exptl_crystal.density_percent_sol   52.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.40 
_exptl_crystal_grow.pdbx_details    
;28% polyethylene glycol 8000, 0.2 M ammonium sulfate, 100 mM MES buffer with 10 fold molar excess of inhibitor, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K, pH 6.40
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 120.0 ? 1 
2 ?     ? 1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-12-14 
_diffrn_detector.details                ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'DOUBLE-CRYSTAL, SI(111)' 'SINGLE WAVELENGTH' x-ray 
2 1 M ?                         ?                   x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             1.0000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2G19 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.000 
_reflns.d_resolution_high            1.700 
_reflns.number_obs                   30804 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.079 
_reflns.pdbx_netI_over_sigmaI        32.0000 
_reflns.B_iso_Wilson_estimate        21.70 
_reflns.pdbx_redundancy              10.000 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.73 
_reflns_shell.percent_possible_all   93.6 
_reflns_shell.Rmerge_I_obs           0.513 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        5.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2G19 
_refine.ls_number_reflns_obs                     30129 
_refine.ls_number_reflns_all                     30129 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               373779.01 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.00 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    95.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.253 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.000 
_refine.ls_number_reflns_R_free                  2421 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               29.20 
_refine.aniso_B[1][1]                            -1.31 
_refine.aniso_B[2][2]                            -1.31 
_refine.aniso_B[3][3]                            2.62 
_refine.aniso_B[1][2]                            -0.05 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'COMBINED MAD AND SIRAS' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2G19 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.12 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.24 
_refine_analyze.Luzzati_sigma_a_free            0.12 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1708 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             135 
_refine_hist.number_atoms_total               1863 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        48.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.9  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.87  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.81 
_refine_ls_shell.number_reflns_R_work             4164 
_refine_ls_shell.R_factor_R_work                  0.257 
_refine_ls_shell.percent_reflns_obs               87.3 
_refine_ls_shell.R_factor_R_free                  0.279 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            8.3 
_refine_ls_shell.number_reflns_R_free             379 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2G19 
_struct.title                     
'Cellular Oxygen Sensing: Crystal Structure of Hypoxia-Inducible Factor Prolyl Hydroxylase (PHD2)' 
_struct.pdbx_descriptor           'Egl nine homolog 1 (E.C.1.14.11.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2G19 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'PHD2, HIF, DSBH, OXYGENASE, TRANSCRIPTION, HYPOXIA, 2-OXOGLUTARATE, PROLYL HYDROXYLASE, HYDROXYLASE, EGLN, HPH, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 10  ? TYR A 18  ? PRO A 189 TYR A 197 1 ? 9  
HELX_P HELX_P2 2 TYR A 18  ? GLY A 27  ? TYR A 197 GLY A 206 1 ? 10 
HELX_P HELX_P3 3 GLY A 36  ? THR A 53  ? GLY A 215 THR A 232 1 ? 18 
HELX_P HELX_P4 4 ASP A 67  ? ASP A 71  ? ASP A 246 ASP A 250 5 ? 5  
HELX_P HELX_P5 5 CYS A 87  ? ASN A 105 ? CYS A 266 ASN A 284 1 ? 19 
HELX_P HELX_P6 6 ASP A 156 ? GLY A 161 ? ASP A 335 GLY A 340 1 ? 6  
HELX_P HELX_P7 7 ALA A 214 ? LYS A 221 ? ALA A 393 LYS A 400 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 134 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 313 A FE2 501 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc2 metalc ? ? A ASP 136 OD1 ? ? ? 1_555 B FE2 . FE ? ? A ASP 315 A FE2 501 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc3 metalc ? ? A HIS 195 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 374 A FE2 501 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc4 metalc ? ? B FE2 .   FE  ? ? ? 1_555 D HOH . O  ? ? A FE2 501 A HOH 601 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc5 metalc ? ? B FE2 .   FE  ? ? ? 1_555 C 4HG . O3 ? ? A FE2 501 A 4HG 801 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc6 metalc ? ? B FE2 .   FE  ? ? ? 1_555 C 4HG . N1 ? ? A FE2 501 A 4HG 801 1_555 ? ? ? ? ? ? ? 2.191 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 2 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 28  ? VAL A 31  ? ILE A 207 VAL A 210 
A 2 ARG A 183 ? TRP A 188 ? ARG A 362 TRP A 367 
A 3 ARG A 143 ? TYR A 150 ? ARG A 322 TYR A 329 
A 4 ARG A 204 ? ASP A 213 ? ARG A 383 ASP A 392 
A 5 ALA A 119 ? TYR A 124 ? ALA A 298 TYR A 303 
A 6 LYS A 76  ? ILE A 80  ? LYS A 255 ILE A 259 
B 1 ILE A 28  ? VAL A 31  ? ILE A 207 VAL A 210 
B 2 ARG A 183 ? TRP A 188 ? ARG A 362 TRP A 367 
B 3 ARG A 143 ? TYR A 150 ? ARG A 322 TYR A 329 
B 4 ARG A 204 ? ASP A 213 ? ARG A 383 ASP A 392 
B 5 ILE A 113 ? ARG A 116 ? ILE A 292 ARG A 295 
C 1 LEU A 61  ? SER A 63  ? LEU A 240 SER A 242 
C 2 ILE A 72  ? ARG A 73  ? ILE A 251 ARG A 252 
D 1 TYR A 131 ? HIS A 134 ? TYR A 310 HIS A 313 
D 2 HIS A 195 ? VAL A 197 ? HIS A 374 VAL A 376 
D 3 LEU A 164 ? ILE A 166 ? LEU A 343 ILE A 345 
D 4 ALA A 175 ? ILE A 177 ? ALA A 354 ILE A 356 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 31  ? N VAL A 210 O LEU A 184 ? O LEU A 363 
A 2 3 O PHE A 187 ? O PHE A 366 N THR A 146 ? N THR A 325 
A 3 4 N CYS A 144 ? N CYS A 323 O TYR A 211 ? O TYR A 390 
A 4 5 O THR A 208 ? O THR A 387 N MET A 120 ? N MET A 299 
A 5 6 O VAL A 121 ? O VAL A 300 N THR A 78  ? N THR A 257 
B 1 2 N VAL A 31  ? N VAL A 210 O LEU A 184 ? O LEU A 363 
B 2 3 O PHE A 187 ? O PHE A 366 N THR A 146 ? N THR A 325 
B 3 4 N CYS A 144 ? N CYS A 323 O TYR A 211 ? O TYR A 390 
B 4 5 O PHE A 212 ? O PHE A 391 N GLY A 115 ? N GLY A 294 
C 1 2 N VAL A 62  ? N VAL A 241 O ILE A 72  ? O ILE A 251 
D 1 2 N HIS A 134 ? N HIS A 313 O HIS A 195 ? O HIS A 374 
D 2 3 O GLU A 196 ? O GLU A 375 N ARG A 165 ? N ARG A 344 
D 3 4 N ILE A 166 ? N ILE A 345 O ALA A 175 ? O ALA A 354 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 A 501' 
AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE 4HG A 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  HIS A 134 ? HIS A 313 . ? 1_555 ? 
2  AC1 5  ASP A 136 ? ASP A 315 . ? 1_555 ? 
3  AC1 5  HIS A 195 ? HIS A 374 . ? 1_555 ? 
4  AC1 5  HOH D .   ? HOH A 601 . ? 1_555 ? 
5  AC1 5  4HG C .   ? 4HG A 801 . ? 1_555 ? 
6  AC2 18 ASP A 75  ? ASP A 254 . ? 1_555 ? 
7  AC2 18 ILE A 77  ? ILE A 256 . ? 1_555 ? 
8  AC2 18 MET A 120 ? MET A 299 . ? 1_555 ? 
9  AC2 18 TYR A 124 ? TYR A 303 . ? 1_555 ? 
10 AC2 18 TYR A 131 ? TYR A 310 . ? 1_555 ? 
11 AC2 18 HIS A 134 ? HIS A 313 . ? 1_555 ? 
12 AC2 18 ASP A 136 ? ASP A 315 . ? 1_555 ? 
13 AC2 18 TYR A 150 ? TYR A 329 . ? 1_555 ? 
14 AC2 18 LEU A 164 ? LEU A 343 . ? 1_555 ? 
15 AC2 18 HIS A 195 ? HIS A 374 . ? 1_555 ? 
16 AC2 18 VAL A 197 ? VAL A 376 . ? 1_555 ? 
17 AC2 18 ARG A 204 ? ARG A 383 . ? 1_555 ? 
18 AC2 18 ARG A 219 ? ARG A 398 . ? 2_665 ? 
19 AC2 18 FE2 B .   ? FE2 A 501 . ? 1_555 ? 
20 AC2 18 HOH D .   ? HOH A 601 . ? 1_555 ? 
21 AC2 18 HOH D .   ? HOH A 602 . ? 1_555 ? 
22 AC2 18 HOH D .   ? HOH A 617 . ? 1_555 ? 
23 AC2 18 HOH D .   ? HOH A 653 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2G19 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2G19 
_atom_sites.fract_transf_matrix[1][1]   0.009021 
_atom_sites.fract_transf_matrix[1][2]   0.005208 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010417 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024765 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
I  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LEU A 1 9   ? -13.938 26.868 13.396 1.00 45.27 ? 188 LEU A N   1 
ATOM   2    C  CA  . LEU A 1 9   ? -13.023 27.451 12.376 1.00 44.01 ? 188 LEU A CA  1 
ATOM   3    C  C   . LEU A 1 9   ? -13.577 28.759 11.807 1.00 42.01 ? 188 LEU A C   1 
ATOM   4    O  O   . LEU A 1 9   ? -12.854 29.747 11.710 1.00 42.51 ? 188 LEU A O   1 
ATOM   5    C  CB  . LEU A 1 9   ? -12.786 26.450 11.236 1.00 46.68 ? 188 LEU A CB  1 
ATOM   6    C  CG  . LEU A 1 9   ? -11.712 26.805 10.198 1.00 47.82 ? 188 LEU A CG  1 
ATOM   7    C  CD1 . LEU A 1 9   ? -10.329 26.644 10.821 1.00 47.86 ? 188 LEU A CD1 1 
ATOM   8    C  CD2 . LEU A 1 9   ? -11.841 25.896 8.982  1.00 48.90 ? 188 LEU A CD2 1 
ATOM   9    N  N   . PRO A 1 10  ? -14.867 28.784 11.416 1.00 39.16 ? 189 PRO A N   1 
ATOM   10   C  CA  . PRO A 1 10  ? -15.433 30.022 10.865 1.00 36.31 ? 189 PRO A CA  1 
ATOM   11   C  C   . PRO A 1 10  ? -15.302 31.166 11.855 1.00 33.16 ? 189 PRO A C   1 
ATOM   12   O  O   . PRO A 1 10  ? -15.739 31.055 12.997 1.00 30.61 ? 189 PRO A O   1 
ATOM   13   C  CB  . PRO A 1 10  ? -16.894 29.656 10.614 1.00 36.63 ? 189 PRO A CB  1 
ATOM   14   C  CG  . PRO A 1 10  ? -16.817 28.197 10.301 1.00 37.54 ? 189 PRO A CG  1 
ATOM   15   C  CD  . PRO A 1 10  ? -15.854 27.691 11.354 1.00 38.75 ? 189 PRO A CD  1 
ATOM   16   N  N   . ALA A 1 11  ? -14.698 32.258 11.402 1.00 32.54 ? 190 ALA A N   1 
ATOM   17   C  CA  . ALA A 1 11  ? -14.494 33.437 12.229 1.00 31.74 ? 190 ALA A CA  1 
ATOM   18   C  C   . ALA A 1 11  ? -15.761 33.886 12.949 1.00 31.34 ? 190 ALA A C   1 
ATOM   19   O  O   . ALA A 1 11  ? -15.723 34.256 14.118 1.00 31.06 ? 190 ALA A O   1 
ATOM   20   C  CB  . ALA A 1 11  ? -13.953 34.585 11.369 1.00 33.69 ? 190 ALA A CB  1 
ATOM   21   N  N   . LEU A 1 12  ? -16.889 33.871 12.248 1.00 29.76 ? 191 LEU A N   1 
ATOM   22   C  CA  . LEU A 1 12  ? -18.137 34.305 12.856 1.00 28.06 ? 191 LEU A CA  1 
ATOM   23   C  C   . LEU A 1 12  ? -18.571 33.385 13.988 1.00 26.51 ? 191 LEU A C   1 
ATOM   24   O  O   . LEU A 1 12  ? -19.104 33.842 14.990 1.00 25.59 ? 191 LEU A O   1 
ATOM   25   C  CB  . LEU A 1 12  ? -19.255 34.379 11.802 1.00 29.32 ? 191 LEU A CB  1 
ATOM   26   C  CG  . LEU A 1 12  ? -20.574 34.921 12.355 1.00 30.63 ? 191 LEU A CG  1 
ATOM   27   C  CD1 . LEU A 1 12  ? -20.388 36.357 12.822 1.00 30.43 ? 191 LEU A CD1 1 
ATOM   28   C  CD2 . LEU A 1 12  ? -21.654 34.859 11.283 1.00 31.87 ? 191 LEU A CD2 1 
ATOM   29   N  N   . LYS A 1 13  ? -18.340 32.086 13.824 1.00 26.46 ? 192 LYS A N   1 
ATOM   30   C  CA  . LYS A 1 13  ? -18.723 31.117 14.847 1.00 26.08 ? 192 LYS A CA  1 
ATOM   31   C  C   . LYS A 1 13  ? -17.846 31.321 16.086 1.00 26.76 ? 192 LYS A C   1 
ATOM   32   O  O   . LYS A 1 13  ? -18.329 31.309 17.214 1.00 25.73 ? 192 LYS A O   1 
ATOM   33   C  CB  . LYS A 1 13  ? -18.558 29.695 14.305 1.00 25.13 ? 192 LYS A CB  1 
ATOM   34   C  CG  . LYS A 1 13  ? -19.193 28.605 15.155 1.00 27.92 ? 192 LYS A CG  1 
ATOM   35   C  CD  . LYS A 1 13  ? -18.907 27.232 14.545 1.00 29.85 ? 192 LYS A CD  1 
ATOM   36   C  CE  . LYS A 1 13  ? -19.863 26.140 15.028 1.00 33.32 ? 192 LYS A CE  1 
ATOM   37   N  NZ  . LYS A 1 13  ? -19.669 25.739 16.450 1.00 33.44 ? 192 LYS A NZ  1 
ATOM   38   N  N   . LEU A 1 14  ? -16.552 31.512 15.858 1.00 27.79 ? 193 LEU A N   1 
ATOM   39   C  CA  . LEU A 1 14  ? -15.624 31.743 16.965 1.00 27.69 ? 193 LEU A CA  1 
ATOM   40   C  C   . LEU A 1 14  ? -16.048 33.009 17.707 1.00 26.17 ? 193 LEU A C   1 
ATOM   41   O  O   . LEU A 1 14  ? -16.139 33.025 18.935 1.00 26.06 ? 193 LEU A O   1 
ATOM   42   C  CB  . LEU A 1 14  ? -14.194 31.894 16.427 1.00 29.04 ? 193 LEU A CB  1 
ATOM   43   C  CG  . LEU A 1 14  ? -13.102 32.247 17.445 1.00 30.60 ? 193 LEU A CG  1 
ATOM   44   C  CD1 . LEU A 1 14  ? -13.035 31.175 18.525 1.00 31.70 ? 193 LEU A CD1 1 
ATOM   45   C  CD2 . LEU A 1 14  ? -11.754 32.402 16.722 1.00 31.67 ? 193 LEU A CD2 1 
ATOM   46   N  N   . ALA A 1 15  ? -16.332 34.064 16.949 1.00 26.46 ? 194 ALA A N   1 
ATOM   47   C  CA  . ALA A 1 15  ? -16.749 35.342 17.525 1.00 26.90 ? 194 ALA A CA  1 
ATOM   48   C  C   . ALA A 1 15  ? -18.032 35.247 18.341 1.00 26.79 ? 194 ALA A C   1 
ATOM   49   O  O   . ALA A 1 15  ? -18.065 35.598 19.516 1.00 25.74 ? 194 ALA A O   1 
ATOM   50   C  CB  . ALA A 1 15  ? -16.926 36.377 16.418 1.00 26.89 ? 194 ALA A CB  1 
ATOM   51   N  N   . LEU A 1 16  ? -19.102 34.757 17.718 1.00 27.67 ? 195 LEU A N   1 
ATOM   52   C  CA  . LEU A 1 16  ? -20.379 34.677 18.408 1.00 28.06 ? 195 LEU A CA  1 
ATOM   53   C  C   . LEU A 1 16  ? -20.486 33.643 19.515 1.00 28.84 ? 195 LEU A C   1 
ATOM   54   O  O   . LEU A 1 16  ? -21.063 33.915 20.568 1.00 29.65 ? 195 LEU A O   1 
ATOM   55   C  CB  . LEU A 1 16  ? -21.508 34.451 17.392 1.00 27.98 ? 195 LEU A CB  1 
ATOM   56   C  CG  . LEU A 1 16  ? -21.656 35.565 16.353 1.00 30.98 ? 195 LEU A CG  1 
ATOM   57   C  CD1 . LEU A 1 16  ? -22.903 35.321 15.498 1.00 30.75 ? 195 LEU A CD1 1 
ATOM   58   C  CD2 . LEU A 1 16  ? -21.757 36.901 17.066 1.00 30.09 ? 195 LEU A CD2 1 
ATOM   59   N  N   . GLU A 1 17  ? -19.936 32.455 19.293 1.00 29.26 ? 196 GLU A N   1 
ATOM   60   C  CA  . GLU A 1 17  ? -20.029 31.399 20.294 1.00 29.83 ? 196 GLU A CA  1 
ATOM   61   C  C   . GLU A 1 17  ? -18.965 31.426 21.386 1.00 29.59 ? 196 GLU A C   1 
ATOM   62   O  O   . GLU A 1 17  ? -19.126 30.764 22.417 1.00 29.22 ? 196 GLU A O   1 
ATOM   63   C  CB  . GLU A 1 17  ? -20.020 30.026 19.607 1.00 32.04 ? 196 GLU A CB  1 
ATOM   64   C  CG  . GLU A 1 17  ? -21.324 29.683 18.894 1.00 35.68 ? 196 GLU A CG  1 
ATOM   65   C  CD  . GLU A 1 17  ? -21.285 28.321 18.209 1.00 39.39 ? 196 GLU A CD  1 
ATOM   66   O  OE1 . GLU A 1 17  ? -20.481 27.460 18.627 1.00 41.19 ? 196 GLU A OE1 1 
ATOM   67   O  OE2 . GLU A 1 17  ? -22.072 28.105 17.260 1.00 39.50 ? 196 GLU A OE2 1 
ATOM   68   N  N   . TYR A 1 18  ? -17.899 32.201 21.200 1.00 28.13 ? 197 TYR A N   1 
ATOM   69   C  CA  . TYR A 1 18  ? -16.851 32.205 22.217 1.00 26.57 ? 197 TYR A CA  1 
ATOM   70   C  C   . TYR A 1 18  ? -16.267 33.556 22.615 1.00 25.30 ? 197 TYR A C   1 
ATOM   71   O  O   . TYR A 1 18  ? -16.295 33.923 23.796 1.00 24.88 ? 197 TYR A O   1 
ATOM   72   C  CB  . TYR A 1 18  ? -15.717 31.276 21.775 1.00 28.48 ? 197 TYR A CB  1 
ATOM   73   C  CG  . TYR A 1 18  ? -14.653 31.076 22.831 1.00 30.93 ? 197 TYR A CG  1 
ATOM   74   C  CD1 . TYR A 1 18  ? -14.982 30.579 24.084 1.00 32.78 ? 197 TYR A CD1 1 
ATOM   75   C  CD2 . TYR A 1 18  ? -13.326 31.393 22.581 1.00 32.35 ? 197 TYR A CD2 1 
ATOM   76   C  CE1 . TYR A 1 18  ? -14.022 30.403 25.063 1.00 34.78 ? 197 TYR A CE1 1 
ATOM   77   C  CE2 . TYR A 1 18  ? -12.354 31.220 23.557 1.00 33.64 ? 197 TYR A CE2 1 
ATOM   78   C  CZ  . TYR A 1 18  ? -12.710 30.724 24.795 1.00 35.06 ? 197 TYR A CZ  1 
ATOM   79   O  OH  . TYR A 1 18  ? -11.758 30.538 25.773 1.00 36.83 ? 197 TYR A OH  1 
ATOM   80   N  N   . ILE A 1 19  ? -15.736 34.292 21.646 1.00 24.96 ? 198 ILE A N   1 
ATOM   81   C  CA  . ILE A 1 19  ? -15.112 35.577 21.958 1.00 23.57 ? 198 ILE A CA  1 
ATOM   82   C  C   . ILE A 1 19  ? -16.069 36.545 22.630 1.00 24.41 ? 198 ILE A C   1 
ATOM   83   O  O   . ILE A 1 19  ? -15.777 37.072 23.708 1.00 22.19 ? 198 ILE A O   1 
ATOM   84   C  CB  . ILE A 1 19  ? -14.517 36.232 20.695 1.00 25.53 ? 198 ILE A CB  1 
ATOM   85   C  CG1 . ILE A 1 19  ? -13.479 35.292 20.066 1.00 27.04 ? 198 ILE A CG1 1 
ATOM   86   C  CG2 . ILE A 1 19  ? -13.872 37.568 21.056 1.00 24.61 ? 198 ILE A CG2 1 
ATOM   87   C  CD1 . ILE A 1 19  ? -13.005 35.739 18.682 1.00 30.87 ? 198 ILE A CD1 1 
ATOM   88   N  N   . VAL A 1 20  ? -17.223 36.781 22.010 1.00 22.88 ? 199 VAL A N   1 
ATOM   89   C  CA  . VAL A 1 20  ? -18.182 37.704 22.595 1.00 24.15 ? 199 VAL A CA  1 
ATOM   90   C  C   . VAL A 1 20  ? -18.608 37.315 24.009 1.00 23.87 ? 199 VAL A C   1 
ATOM   91   O  O   . VAL A 1 20  ? -18.487 38.115 24.930 1.00 23.63 ? 199 VAL A O   1 
ATOM   92   C  CB  . VAL A 1 20  ? -19.432 37.857 21.703 1.00 24.51 ? 199 VAL A CB  1 
ATOM   93   C  CG1 . VAL A 1 20  ? -20.502 38.648 22.444 1.00 25.47 ? 199 VAL A CG1 1 
ATOM   94   C  CG2 . VAL A 1 20  ? -19.057 38.558 20.404 1.00 26.27 ? 199 VAL A CG2 1 
ATOM   95   N  N   . PRO A 1 21  ? -19.124 36.087 24.209 1.00 24.83 ? 200 PRO A N   1 
ATOM   96   C  CA  . PRO A 1 21  ? -19.532 35.722 25.571 1.00 25.98 ? 200 PRO A CA  1 
ATOM   97   C  C   . PRO A 1 21  ? -18.392 35.747 26.586 1.00 26.54 ? 200 PRO A C   1 
ATOM   98   O  O   . PRO A 1 21  ? -18.577 36.167 27.732 1.00 27.15 ? 200 PRO A O   1 
ATOM   99   C  CB  . PRO A 1 21  ? -20.154 34.328 25.398 1.00 27.09 ? 200 PRO A CB  1 
ATOM   100  C  CG  . PRO A 1 21  ? -19.596 33.826 24.110 1.00 25.77 ? 200 PRO A CG  1 
ATOM   101  C  CD  . PRO A 1 21  ? -19.521 35.049 23.244 1.00 24.17 ? 200 PRO A CD  1 
ATOM   102  N  N   . CYS A 1 22  ? -17.213 35.311 26.158 1.00 27.44 ? 201 CYS A N   1 
ATOM   103  C  CA  . CYS A 1 22  ? -16.043 35.305 27.024 1.00 27.09 ? 201 CYS A CA  1 
ATOM   104  C  C   . CYS A 1 22  ? -15.626 36.727 27.418 1.00 25.89 ? 201 CYS A C   1 
ATOM   105  O  O   . CYS A 1 22  ? -15.359 37.010 28.591 1.00 25.86 ? 201 CYS A O   1 
ATOM   106  C  CB  . CYS A 1 22  ? -14.885 34.620 26.312 1.00 30.94 ? 201 CYS A CB  1 
ATOM   107  S  SG  . CYS A 1 22  ? -13.675 33.963 27.441 1.00 40.72 ? 201 CYS A SG  1 
ATOM   108  N  N   . MET A 1 23  ? -15.560 37.621 26.437 1.00 22.88 ? 202 MET A N   1 
ATOM   109  C  CA  . MET A 1 23  ? -15.172 39.005 26.724 1.00 24.14 ? 202 MET A CA  1 
ATOM   110  C  C   . MET A 1 23  ? -16.177 39.723 27.624 1.00 25.48 ? 202 MET A C   1 
ATOM   111  O  O   . MET A 1 23  ? -15.793 40.408 28.567 1.00 25.61 ? 202 MET A O   1 
ATOM   112  C  CB  . MET A 1 23  ? -15.007 39.807 25.428 1.00 24.13 ? 202 MET A CB  1 
ATOM   113  C  CG  . MET A 1 23  ? -13.750 39.467 24.645 1.00 21.95 ? 202 MET A CG  1 
ATOM   114  S  SD  . MET A 1 23  ? -12.244 39.958 25.560 1.00 22.83 ? 202 MET A SD  1 
ATOM   115  C  CE  . MET A 1 23  ? -12.292 41.772 25.411 1.00 22.63 ? 202 MET A CE  1 
ATOM   116  N  N   . ASN A 1 24  ? -17.468 39.579 27.350 1.00 26.26 ? 203 ASN A N   1 
ATOM   117  C  CA  . ASN A 1 24  ? -18.434 40.283 28.182 1.00 28.04 ? 203 ASN A CA  1 
ATOM   118  C  C   . ASN A 1 24  ? -18.471 39.733 29.596 1.00 28.08 ? 203 ASN A C   1 
ATOM   119  O  O   . ASN A 1 24  ? -18.808 40.449 30.535 1.00 29.32 ? 203 ASN A O   1 
ATOM   120  C  CB  . ASN A 1 24  ? -19.836 40.251 27.552 1.00 28.44 ? 203 ASN A CB  1 
ATOM   121  C  CG  . ASN A 1 24  ? -19.914 41.068 26.273 1.00 30.09 ? 203 ASN A CG  1 
ATOM   122  O  OD1 . ASN A 1 24  ? -19.446 42.211 26.224 1.00 30.44 ? 203 ASN A OD1 1 
ATOM   123  N  ND2 . ASN A 1 24  ? -20.514 40.494 25.233 1.00 29.76 ? 203 ASN A ND2 1 
ATOM   124  N  N   . LYS A 1 25  ? -18.083 38.473 29.759 1.00 28.24 ? 204 LYS A N   1 
ATOM   125  C  CA  . LYS A 1 25  ? -18.098 37.863 31.084 1.00 29.21 ? 204 LYS A CA  1 
ATOM   126  C  C   . LYS A 1 25  ? -16.804 37.999 31.895 1.00 28.68 ? 204 LYS A C   1 
ATOM   127  O  O   . LYS A 1 25  ? -16.852 38.277 33.099 1.00 28.66 ? 204 LYS A O   1 
ATOM   128  C  CB  . LYS A 1 25  ? -18.462 36.382 30.957 1.00 31.20 ? 204 LYS A CB  1 
ATOM   129  C  CG  . LYS A 1 25  ? -18.545 35.653 32.291 1.00 35.44 ? 204 LYS A CG  1 
ATOM   130  C  CD  . LYS A 1 25  ? -19.311 34.347 32.139 1.00 38.22 ? 204 LYS A CD  1 
ATOM   131  C  CE  . LYS A 1 25  ? -19.504 33.645 33.477 1.00 41.79 ? 204 LYS A CE  1 
ATOM   132  N  NZ  . LYS A 1 25  ? -18.223 33.148 34.054 1.00 44.11 ? 204 LYS A NZ  1 
ATOM   133  N  N   . HIS A 1 26  ? -15.655 37.822 31.240 1.00 26.13 ? 205 HIS A N   1 
ATOM   134  C  CA  . HIS A 1 26  ? -14.361 37.884 31.919 1.00 25.82 ? 205 HIS A CA  1 
ATOM   135  C  C   . HIS A 1 26  ? -13.468 39.048 31.525 1.00 24.87 ? 205 HIS A C   1 
ATOM   136  O  O   . HIS A 1 26  ? -12.523 39.367 32.246 1.00 23.98 ? 205 HIS A O   1 
ATOM   137  C  CB  . HIS A 1 26  ? -13.568 36.600 31.667 1.00 26.37 ? 205 HIS A CB  1 
ATOM   138  C  CG  . HIS A 1 26  ? -14.325 35.349 31.975 1.00 30.05 ? 205 HIS A CG  1 
ATOM   139  N  ND1 . HIS A 1 26  ? -14.792 35.057 33.236 1.00 31.89 ? 205 HIS A ND1 1 
ATOM   140  C  CD2 . HIS A 1 26  ? -14.685 34.308 31.186 1.00 31.34 ? 205 HIS A CD2 1 
ATOM   141  C  CE1 . HIS A 1 26  ? -15.408 33.888 33.214 1.00 32.59 ? 205 HIS A CE1 1 
ATOM   142  N  NE2 . HIS A 1 26  ? -15.356 33.412 31.983 1.00 32.90 ? 205 HIS A NE2 1 
ATOM   143  N  N   . GLY A 1 27  ? -13.747 39.649 30.373 1.00 22.82 ? 206 GLY A N   1 
ATOM   144  C  CA  . GLY A 1 27  ? -12.945 40.767 29.895 1.00 22.97 ? 206 GLY A CA  1 
ATOM   145  C  C   . GLY A 1 27  ? -11.617 40.295 29.332 1.00 22.69 ? 206 GLY A C   1 
ATOM   146  O  O   . GLY A 1 27  ? -10.732 41.107 28.999 1.00 20.65 ? 206 GLY A O   1 
ATOM   147  N  N   . ILE A 1 28  ? -11.471 38.974 29.258 1.00 21.32 ? 207 ILE A N   1 
ATOM   148  C  CA  . ILE A 1 28  ? -10.271 38.325 28.736 1.00 23.56 ? 207 ILE A CA  1 
ATOM   149  C  C   . ILE A 1 28  ? -10.735 37.100 27.944 1.00 24.22 ? 207 ILE A C   1 
ATOM   150  O  O   . ILE A 1 28  ? -11.682 36.421 28.346 1.00 24.87 ? 207 ILE A O   1 
ATOM   151  C  CB  . ILE A 1 28  ? -9.353  37.820 29.871 1.00 24.94 ? 207 ILE A CB  1 
ATOM   152  C  CG1 . ILE A 1 28  ? -8.946  38.983 30.771 1.00 26.00 ? 207 ILE A CG1 1 
ATOM   153  C  CG2 . ILE A 1 28  ? -8.119  37.132 29.283 1.00 26.57 ? 207 ILE A CG2 1 
ATOM   154  C  CD1 . ILE A 1 28  ? -8.352  38.541 32.085 1.00 29.03 ? 207 ILE A CD1 1 
ATOM   155  N  N   . CYS A 1 29  ? -10.069 36.810 26.836 1.00 22.25 ? 208 CYS A N   1 
ATOM   156  C  CA  . CYS A 1 29  ? -10.430 35.652 26.035 1.00 23.19 ? 208 CYS A CA  1 
ATOM   157  C  C   . CYS A 1 29  ? -9.202  35.064 25.360 1.00 22.34 ? 208 CYS A C   1 
ATOM   158  O  O   . CYS A 1 29  ? -8.480  35.769 24.662 1.00 20.85 ? 208 CYS A O   1 
ATOM   159  C  CB  . CYS A 1 29  ? -11.462 36.032 24.969 1.00 23.49 ? 208 CYS A CB  1 
ATOM   160  S  SG  . CYS A 1 29  ? -11.940 34.643 23.882 1.00 25.93 ? 208 CYS A SG  1 
ATOM   161  N  N   . VAL A 1 30  ? -8.975  33.765 25.569 1.00 22.02 ? 209 VAL A N   1 
ATOM   162  C  CA  . VAL A 1 30  ? -7.839  33.086 24.949 1.00 21.37 ? 209 VAL A CA  1 
ATOM   163  C  C   . VAL A 1 30  ? -8.311  32.104 23.883 1.00 21.46 ? 209 VAL A C   1 
ATOM   164  O  O   . VAL A 1 30  ? -9.167  31.262 24.139 1.00 25.08 ? 209 VAL A O   1 
ATOM   165  C  CB  . VAL A 1 30  ? -7.004  32.314 26.001 1.00 22.60 ? 209 VAL A CB  1 
ATOM   166  C  CG1 . VAL A 1 30  ? -5.835  31.591 25.319 1.00 22.27 ? 209 VAL A CG1 1 
ATOM   167  C  CG2 . VAL A 1 30  ? -6.479  33.278 27.052 1.00 22.58 ? 209 VAL A CG2 1 
ATOM   168  N  N   . VAL A 1 31  ? -7.780  32.233 22.676 1.00 22.05 ? 210 VAL A N   1 
ATOM   169  C  CA  . VAL A 1 31  ? -8.134  31.329 21.584 1.00 24.52 ? 210 VAL A CA  1 
ATOM   170  C  C   . VAL A 1 31  ? -6.880  30.561 21.182 1.00 25.20 ? 210 VAL A C   1 
ATOM   171  O  O   . VAL A 1 31  ? -5.904  31.161 20.733 1.00 25.53 ? 210 VAL A O   1 
ATOM   172  C  CB  . VAL A 1 31  ? -8.638  32.106 20.352 1.00 25.53 ? 210 VAL A CB  1 
ATOM   173  C  CG1 . VAL A 1 31  ? -8.823  31.160 19.159 1.00 26.50 ? 210 VAL A CG1 1 
ATOM   174  C  CG2 . VAL A 1 31  ? -9.968  32.787 20.693 1.00 26.69 ? 210 VAL A CG2 1 
ATOM   175  N  N   . ASP A 1 32  ? -6.886  29.239 21.343 1.00 25.74 ? 211 ASP A N   1 
ATOM   176  C  CA  . ASP A 1 32  ? -5.716  28.477 20.944 1.00 26.96 ? 211 ASP A CA  1 
ATOM   177  C  C   . ASP A 1 32  ? -5.818  27.949 19.517 1.00 27.62 ? 211 ASP A C   1 
ATOM   178  O  O   . ASP A 1 32  ? -6.913  27.858 18.962 1.00 27.62 ? 211 ASP A O   1 
ATOM   179  C  CB  . ASP A 1 32  ? -5.458  27.350 21.945 1.00 29.05 ? 211 ASP A CB  1 
ATOM   180  C  CG  . ASP A 1 32  ? -4.692  27.838 23.163 1.00 32.09 ? 211 ASP A CG  1 
ATOM   181  O  OD1 . ASP A 1 32  ? -3.635  28.479 22.974 1.00 33.70 ? 211 ASP A OD1 1 
ATOM   182  O  OD2 . ASP A 1 32  ? -5.135  27.582 24.298 1.00 35.06 ? 211 ASP A OD2 1 
ATOM   183  N  N   . ASP A 1 33  ? -4.668  27.648 18.917 1.00 28.92 ? 212 ASP A N   1 
ATOM   184  C  CA  . ASP A 1 33  ? -4.597  27.141 17.548 1.00 31.75 ? 212 ASP A CA  1 
ATOM   185  C  C   . ASP A 1 33  ? -5.419  28.011 16.595 1.00 32.35 ? 212 ASP A C   1 
ATOM   186  O  O   . ASP A 1 33  ? -6.252  27.513 15.836 1.00 32.14 ? 212 ASP A O   1 
ATOM   187  C  CB  . ASP A 1 33  ? -5.102  25.694 17.517 1.00 34.11 ? 212 ASP A CB  1 
ATOM   188  C  CG  . ASP A 1 33  ? -4.459  24.838 18.595 1.00 37.39 ? 212 ASP A CG  1 
ATOM   189  O  OD1 . ASP A 1 33  ? -5.183  24.345 19.484 1.00 40.29 ? 212 ASP A OD1 1 
ATOM   190  O  OD2 . ASP A 1 33  ? -3.222  24.672 18.563 1.00 39.04 ? 212 ASP A OD2 1 
ATOM   191  N  N   . PHE A 1 34  ? -5.162  29.316 16.625 1.00 30.33 ? 213 PHE A N   1 
ATOM   192  C  CA  . PHE A 1 34  ? -5.894  30.271 15.801 1.00 29.30 ? 213 PHE A CA  1 
ATOM   193  C  C   . PHE A 1 34  ? -5.747  30.134 14.287 1.00 29.91 ? 213 PHE A C   1 
ATOM   194  O  O   . PHE A 1 34  ? -6.748  30.043 13.579 1.00 31.11 ? 213 PHE A O   1 
ATOM   195  C  CB  . PHE A 1 34  ? -5.520  31.701 16.233 1.00 27.92 ? 213 PHE A CB  1 
ATOM   196  C  CG  . PHE A 1 34  ? -6.239  32.783 15.474 1.00 27.17 ? 213 PHE A CG  1 
ATOM   197  C  CD1 . PHE A 1 34  ? -7.605  32.707 15.239 1.00 27.88 ? 213 PHE A CD1 1 
ATOM   198  C  CD2 . PHE A 1 34  ? -5.551  33.878 15.003 1.00 26.97 ? 213 PHE A CD2 1 
ATOM   199  C  CE1 . PHE A 1 34  ? -8.258  33.707 14.546 1.00 25.98 ? 213 PHE A CE1 1 
ATOM   200  C  CE2 . PHE A 1 34  ? -6.198  34.882 14.312 1.00 27.94 ? 213 PHE A CE2 1 
ATOM   201  C  CZ  . PHE A 1 34  ? -7.556  34.793 14.081 1.00 27.77 ? 213 PHE A CZ  1 
ATOM   202  N  N   . LEU A 1 35  ? -4.518  30.115 13.785 1.00 28.46 ? 214 LEU A N   1 
ATOM   203  C  CA  . LEU A 1 35  ? -4.301  30.034 12.345 1.00 30.23 ? 214 LEU A CA  1 
ATOM   204  C  C   . LEU A 1 35  ? -3.793  28.682 11.853 1.00 30.61 ? 214 LEU A C   1 
ATOM   205  O  O   . LEU A 1 35  ? -3.778  28.425 10.652 1.00 31.03 ? 214 LEU A O   1 
ATOM   206  C  CB  . LEU A 1 35  ? -3.329  31.132 11.905 1.00 29.92 ? 214 LEU A CB  1 
ATOM   207  C  CG  . LEU A 1 35  ? -3.728  32.575 12.246 1.00 30.26 ? 214 LEU A CG  1 
ATOM   208  C  CD1 . LEU A 1 35  ? -2.615  33.528 11.830 1.00 31.70 ? 214 LEU A CD1 1 
ATOM   209  C  CD2 . LEU A 1 35  ? -5.027  32.934 11.535 1.00 33.00 ? 214 LEU A CD2 1 
ATOM   210  N  N   . GLY A 1 36  ? -3.377  27.825 12.775 1.00 30.54 ? 215 GLY A N   1 
ATOM   211  C  CA  . GLY A 1 36  ? -2.868  26.524 12.382 1.00 32.80 ? 215 GLY A CA  1 
ATOM   212  C  C   . GLY A 1 36  ? -1.354  26.520 12.343 1.00 33.76 ? 215 GLY A C   1 
ATOM   213  O  O   . GLY A 1 36  ? -0.725  27.574 12.258 1.00 33.01 ? 215 GLY A O   1 
ATOM   214  N  N   . LYS A 1 37  ? -0.764  25.331 12.381 1.00 35.04 ? 216 LYS A N   1 
ATOM   215  C  CA  . LYS A 1 37  ? 0.689   25.206 12.380 1.00 36.69 ? 216 LYS A CA  1 
ATOM   216  C  C   . LYS A 1 37  ? 1.402   25.834 11.190 1.00 36.82 ? 216 LYS A C   1 
ATOM   217  O  O   . LYS A 1 37  ? 2.383   26.556 11.362 1.00 34.73 ? 216 LYS A O   1 
ATOM   218  C  CB  . LYS A 1 37  ? 1.084   23.733 12.490 1.00 39.50 ? 216 LYS A CB  1 
ATOM   219  C  CG  . LYS A 1 37  ? 0.585   23.066 13.761 1.00 42.77 ? 216 LYS A CG  1 
ATOM   220  C  CD  . LYS A 1 37  ? 0.900   23.907 14.993 1.00 43.75 ? 216 LYS A CD  1 
ATOM   221  C  CE  . LYS A 1 37  ? 0.318   23.288 16.254 1.00 44.44 ? 216 LYS A CE  1 
ATOM   222  N  NZ  . LYS A 1 37  ? 0.456   24.180 17.434 1.00 45.70 ? 216 LYS A NZ  1 
ATOM   223  N  N   . GLU A 1 38  ? 0.916   25.563 9.984  1.00 36.80 ? 217 GLU A N   1 
ATOM   224  C  CA  . GLU A 1 38  ? 1.545   26.099 8.784  1.00 37.29 ? 217 GLU A CA  1 
ATOM   225  C  C   . GLU A 1 38  ? 1.659   27.613 8.747  1.00 35.16 ? 217 GLU A C   1 
ATOM   226  O  O   . GLU A 1 38  ? 2.742   28.157 8.540  1.00 33.16 ? 217 GLU A O   1 
ATOM   227  C  CB  . GLU A 1 38  ? 0.798   25.628 7.535  1.00 40.87 ? 217 GLU A CB  1 
ATOM   228  C  CG  . GLU A 1 38  ? 1.350   24.343 6.974  1.00 45.32 ? 217 GLU A CG  1 
ATOM   229  C  CD  . GLU A 1 38  ? 2.828   24.462 6.645  1.00 47.45 ? 217 GLU A CD  1 
ATOM   230  O  OE1 . GLU A 1 38  ? 3.176   25.212 5.705  1.00 50.18 ? 217 GLU A OE1 1 
ATOM   231  O  OE2 . GLU A 1 38  ? 3.643   23.814 7.335  1.00 48.59 ? 217 GLU A OE2 1 
ATOM   232  N  N   . THR A 1 39  ? 0.532   28.287 8.929  1.00 32.97 ? 218 THR A N   1 
ATOM   233  C  CA  . THR A 1 39  ? 0.515   29.738 8.898  1.00 32.09 ? 218 THR A CA  1 
ATOM   234  C  C   . THR A 1 39  ? 1.253   30.316 10.105 1.00 31.05 ? 218 THR A C   1 
ATOM   235  O  O   . THR A 1 39  ? 1.991   31.288 9.968  1.00 29.67 ? 218 THR A O   1 
ATOM   236  C  CB  . THR A 1 39  ? -0.933  30.267 8.853  1.00 31.83 ? 218 THR A CB  1 
ATOM   237  O  OG1 . THR A 1 39  ? -1.578  29.783 7.663  1.00 32.90 ? 218 THR A OG1 1 
ATOM   238  C  CG2 . THR A 1 39  ? -0.945  31.787 8.833  1.00 30.47 ? 218 THR A CG2 1 
ATOM   239  N  N   . GLY A 1 40  ? 1.060   29.707 11.270 1.00 29.23 ? 219 GLY A N   1 
ATOM   240  C  CA  . GLY A 1 40  ? 1.741   30.176 12.467 1.00 30.01 ? 219 GLY A CA  1 
ATOM   241  C  C   . GLY A 1 40  ? 3.247   30.116 12.293 1.00 29.67 ? 219 GLY A C   1 
ATOM   242  O  O   . GLY A 1 40  ? 3.970   31.027 12.689 1.00 27.44 ? 219 GLY A O   1 
ATOM   243  N  N   . GLN A 1 41  ? 3.731   29.031 11.693 1.00 28.57 ? 220 GLN A N   1 
ATOM   244  C  CA  . GLN A 1 41  ? 5.158   28.885 11.463 1.00 29.44 ? 220 GLN A CA  1 
ATOM   245  C  C   . GLN A 1 41  ? 5.643   29.920 10.438 1.00 27.60 ? 220 GLN A C   1 
ATOM   246  O  O   . GLN A 1 41  ? 6.758   30.425 10.549 1.00 26.44 ? 220 GLN A O   1 
ATOM   247  C  CB  . GLN A 1 41  ? 5.468   27.458 10.983 1.00 31.02 ? 220 GLN A CB  1 
ATOM   248  C  CG  . GLN A 1 41  ? 6.721   26.861 11.606 1.00 38.32 ? 220 GLN A CG  1 
ATOM   249  C  CD  . GLN A 1 41  ? 7.996   27.470 11.058 1.00 41.82 ? 220 GLN A CD  1 
ATOM   250  O  OE1 . GLN A 1 41  ? 9.069   27.352 11.661 1.00 44.83 ? 220 GLN A OE1 1 
ATOM   251  N  NE2 . GLN A 1 41  ? 7.892   28.110 9.899  1.00 45.16 ? 220 GLN A NE2 1 
ATOM   252  N  N   . GLN A 1 42  ? 4.809   30.242 9.447  1.00 27.34 ? 221 GLN A N   1 
ATOM   253  C  CA  . GLN A 1 42  ? 5.179   31.239 8.437  1.00 27.20 ? 221 GLN A CA  1 
ATOM   254  C  C   . GLN A 1 42  ? 5.303   32.621 9.088  1.00 25.25 ? 221 GLN A C   1 
ATOM   255  O  O   . GLN A 1 42  ? 6.182   33.413 8.744  1.00 24.41 ? 221 GLN A O   1 
ATOM   256  C  CB  . GLN A 1 42  ? 4.137   31.295 7.303  1.00 30.62 ? 221 GLN A CB  1 
ATOM   257  C  CG  . GLN A 1 42  ? 4.207   30.120 6.336  1.00 36.92 ? 221 GLN A CG  1 
ATOM   258  C  CD  . GLN A 1 42  ? 3.104   30.131 5.282  1.00 40.24 ? 221 GLN A CD  1 
ATOM   259  O  OE1 . GLN A 1 42  ? 3.060   29.263 4.403  1.00 43.67 ? 221 GLN A OE1 1 
ATOM   260  N  NE2 . GLN A 1 42  ? 2.206   31.107 5.368  1.00 41.58 ? 221 GLN A NE2 1 
ATOM   261  N  N   . ILE A 1 43  ? 4.411   32.899 10.027 1.00 24.60 ? 222 ILE A N   1 
ATOM   262  C  CA  . ILE A 1 43  ? 4.441   34.176 10.741 1.00 23.21 ? 222 ILE A CA  1 
ATOM   263  C  C   . ILE A 1 43  ? 5.716   34.214 11.571 1.00 21.77 ? 222 ILE A C   1 
ATOM   264  O  O   . ILE A 1 43  ? 6.391   35.237 11.640 1.00 23.33 ? 222 ILE A O   1 
ATOM   265  C  CB  . ILE A 1 43  ? 3.222   34.323 11.648 1.00 22.24 ? 222 ILE A CB  1 
ATOM   266  C  CG1 . ILE A 1 43  ? 1.978   34.563 10.785 1.00 23.79 ? 222 ILE A CG1 1 
ATOM   267  C  CG2 . ILE A 1 43  ? 3.422   35.504 12.616 1.00 23.96 ? 222 ILE A CG2 1 
ATOM   268  C  CD1 . ILE A 1 43  ? 0.684   34.480 11.523 1.00 23.05 ? 222 ILE A CD1 1 
ATOM   269  N  N   . GLY A 1 44  ? 6.040   33.088 12.195 1.00 23.49 ? 223 GLY A N   1 
ATOM   270  C  CA  . GLY A 1 44  ? 7.263   33.002 12.974 1.00 22.90 ? 223 GLY A CA  1 
ATOM   271  C  C   . GLY A 1 44  ? 8.480   33.268 12.107 1.00 24.67 ? 223 GLY A C   1 
ATOM   272  O  O   . GLY A 1 44  ? 9.403   33.972 12.509 1.00 24.43 ? 223 GLY A O   1 
ATOM   273  N  N   . ASP A 1 45  ? 8.499   32.702 10.899 1.00 23.80 ? 224 ASP A N   1 
ATOM   274  C  CA  . ASP A 1 45  ? 9.639   32.924 10.022 1.00 25.73 ? 224 ASP A CA  1 
ATOM   275  C  C   . ASP A 1 45  ? 9.758   34.399 9.652  1.00 23.96 ? 224 ASP A C   1 
ATOM   276  O  O   . ASP A 1 45  ? 10.863  34.938 9.588  1.00 23.70 ? 224 ASP A O   1 
ATOM   277  C  CB  . ASP A 1 45  ? 9.523   32.078 8.752  1.00 28.77 ? 224 ASP A CB  1 
ATOM   278  C  CG  . ASP A 1 45  ? 9.706   30.596 9.022  1.00 33.98 ? 224 ASP A CG  1 
ATOM   279  O  OD1 . ASP A 1 45  ? 10.367  30.246 10.021 1.00 35.94 ? 224 ASP A OD1 1 
ATOM   280  O  OD2 . ASP A 1 45  ? 9.205   29.774 8.227  1.00 37.14 ? 224 ASP A OD2 1 
ATOM   281  N  N   . GLU A 1 46  ? 8.623   35.058 9.426  1.00 22.35 ? 225 GLU A N   1 
ATOM   282  C  CA  . GLU A 1 46  ? 8.636   36.467 9.071  1.00 22.06 ? 225 GLU A CA  1 
ATOM   283  C  C   . GLU A 1 46  ? 9.126   37.345 10.219 1.00 21.20 ? 225 GLU A C   1 
ATOM   284  O  O   . GLU A 1 46  ? 9.887   38.290 10.002 1.00 21.14 ? 225 GLU A O   1 
ATOM   285  C  CB  . GLU A 1 46  ? 7.244   36.915 8.609  1.00 25.01 ? 225 GLU A CB  1 
ATOM   286  C  CG  . GLU A 1 46  ? 6.792   36.203 7.332  1.00 28.28 ? 225 GLU A CG  1 
ATOM   287  C  CD  . GLU A 1 46  ? 5.566   36.841 6.688  1.00 32.31 ? 225 GLU A CD  1 
ATOM   288  O  OE1 . GLU A 1 46  ? 4.832   37.573 7.385  1.00 30.96 ? 225 GLU A OE1 1 
ATOM   289  O  OE2 . GLU A 1 46  ? 5.328   36.589 5.483  1.00 31.34 ? 225 GLU A OE2 1 
ATOM   290  N  N   . VAL A 1 47  ? 8.682   37.041 11.433 1.00 21.35 ? 226 VAL A N   1 
ATOM   291  C  CA  . VAL A 1 47  ? 9.127   37.816 12.587 1.00 20.71 ? 226 VAL A CA  1 
ATOM   292  C  C   . VAL A 1 47  ? 10.619  37.589 12.825 1.00 19.87 ? 226 VAL A C   1 
ATOM   293  O  O   . VAL A 1 47  ? 11.356  38.529 13.098 1.00 20.52 ? 226 VAL A O   1 
ATOM   294  C  CB  . VAL A 1 47  ? 8.339   37.440 13.845 1.00 21.12 ? 226 VAL A CB  1 
ATOM   295  C  CG1 . VAL A 1 47  ? 8.963   38.106 15.061 1.00 24.44 ? 226 VAL A CG1 1 
ATOM   296  C  CG2 . VAL A 1 47  ? 6.882   37.874 13.683 1.00 22.39 ? 226 VAL A CG2 1 
ATOM   297  N  N   . ARG A 1 48  ? 11.067  36.342 12.706 1.00 22.51 ? 227 ARG A N   1 
ATOM   298  C  CA  . ARG A 1 48  ? 12.482  36.051 12.879 1.00 23.44 ? 227 ARG A CA  1 
ATOM   299  C  C   . ARG A 1 48  ? 13.328  36.767 11.834 1.00 24.22 ? 227 ARG A C   1 
ATOM   300  O  O   . ARG A 1 48  ? 14.423  37.241 12.142 1.00 23.93 ? 227 ARG A O   1 
ATOM   301  C  CB  . ARG A 1 48  ? 12.727  34.540 12.830 1.00 27.30 ? 227 ARG A CB  1 
ATOM   302  C  CG  . ARG A 1 48  ? 12.587  33.883 14.194 1.00 31.86 ? 227 ARG A CG  1 
ATOM   303  C  CD  . ARG A 1 48  ? 12.782  32.374 14.138 1.00 37.30 ? 227 ARG A CD  1 
ATOM   304  N  NE  . ARG A 1 48  ? 11.536  31.682 13.837 1.00 40.64 ? 227 ARG A NE  1 
ATOM   305  C  CZ  . ARG A 1 48  ? 11.302  31.014 12.714 1.00 41.71 ? 227 ARG A CZ  1 
ATOM   306  N  NH1 . ARG A 1 48  ? 12.236  30.943 11.772 1.00 43.39 ? 227 ARG A NH1 1 
ATOM   307  N  NH2 . ARG A 1 48  ? 10.135  30.412 12.539 1.00 42.44 ? 227 ARG A NH2 1 
ATOM   308  N  N   . ALA A 1 49  ? 12.820  36.861 10.603 1.00 24.50 ? 228 ALA A N   1 
ATOM   309  C  CA  . ALA A 1 49  ? 13.555  37.555 9.541  1.00 25.01 ? 228 ALA A CA  1 
ATOM   310  C  C   . ALA A 1 49  ? 13.667  39.036 9.879  1.00 24.49 ? 228 ALA A C   1 
ATOM   311  O  O   . ALA A 1 49  ? 14.685  39.663 9.600  1.00 24.12 ? 228 ALA A O   1 
ATOM   312  C  CB  . ALA A 1 49  ? 12.862  37.383 8.205  1.00 27.37 ? 228 ALA A CB  1 
ATOM   313  N  N   . LEU A 1 50  ? 12.612  39.599 10.471 1.00 24.03 ? 229 LEU A N   1 
ATOM   314  C  CA  . LEU A 1 50  ? 12.651  40.997 10.882 1.00 23.96 ? 229 LEU A CA  1 
ATOM   315  C  C   . LEU A 1 50  ? 13.741  41.175 11.930 1.00 22.97 ? 229 LEU A C   1 
ATOM   316  O  O   . LEU A 1 50  ? 14.478  42.159 11.917 1.00 24.35 ? 229 LEU A O   1 
ATOM   317  C  CB  . LEU A 1 50  ? 11.293  41.441 11.474 1.00 23.75 ? 229 LEU A CB  1 
ATOM   318  C  CG  . LEU A 1 50  ? 10.175  41.619 10.438 1.00 25.49 ? 229 LEU A CG  1 
ATOM   319  C  CD1 . LEU A 1 50  ? 8.797   41.794 11.119 1.00 25.10 ? 229 LEU A CD1 1 
ATOM   320  C  CD2 . LEU A 1 50  ? 10.508  42.824 9.565  1.00 24.51 ? 229 LEU A CD2 1 
ATOM   321  N  N   . HIS A 1 51  ? 13.851  40.222 12.847 1.00 22.33 ? 230 HIS A N   1 
ATOM   322  C  CA  . HIS A 1 51  ? 14.862  40.325 13.895 1.00 24.05 ? 230 HIS A CA  1 
ATOM   323  C  C   . HIS A 1 51  ? 16.268  40.233 13.306 1.00 23.87 ? 230 HIS A C   1 
ATOM   324  O  O   . HIS A 1 51  ? 17.125  41.075 13.574 1.00 22.45 ? 230 HIS A O   1 
ATOM   325  C  CB  . HIS A 1 51  ? 14.652  39.221 14.930 1.00 26.88 ? 230 HIS A CB  1 
ATOM   326  C  CG  . HIS A 1 51  ? 15.426  39.421 16.196 1.00 30.58 ? 230 HIS A CG  1 
ATOM   327  N  ND1 . HIS A 1 51  ? 15.273  38.604 17.294 1.00 33.09 ? 230 HIS A ND1 1 
ATOM   328  C  CD2 . HIS A 1 51  ? 16.360  40.340 16.536 1.00 32.60 ? 230 HIS A CD2 1 
ATOM   329  C  CE1 . HIS A 1 51  ? 16.084  39.009 18.257 1.00 33.06 ? 230 HIS A CE1 1 
ATOM   330  N  NE2 . HIS A 1 51  ? 16.755  40.060 17.823 1.00 33.87 ? 230 HIS A NE2 1 
ATOM   331  N  N   . ASP A 1 52  ? 16.473  39.214 12.480 1.00 26.66 ? 231 ASP A N   1 
ATOM   332  C  CA  . ASP A 1 52  ? 17.767  38.969 11.845 1.00 29.85 ? 231 ASP A CA  1 
ATOM   333  C  C   . ASP A 1 52  ? 18.213  40.051 10.862 1.00 30.93 ? 231 ASP A C   1 
ATOM   334  O  O   . ASP A 1 52  ? 19.401  40.152 10.552 1.00 32.71 ? 231 ASP A O   1 
ATOM   335  C  CB  . ASP A 1 52  ? 17.742  37.599 11.157 1.00 31.01 ? 231 ASP A CB  1 
ATOM   336  C  CG  . ASP A 1 52  ? 17.594  36.453 12.147 1.00 33.53 ? 231 ASP A CG  1 
ATOM   337  O  OD1 . ASP A 1 52  ? 17.243  35.336 11.722 1.00 35.41 ? 231 ASP A OD1 1 
ATOM   338  O  OD2 . ASP A 1 52  ? 17.836  36.663 13.355 1.00 37.13 ? 231 ASP A OD2 1 
ATOM   339  N  N   . THR A 1 53  ? 17.279  40.850 10.357 1.00 31.49 ? 232 THR A N   1 
ATOM   340  C  CA  . THR A 1 53  ? 17.649  41.913 9.431  1.00 31.06 ? 232 THR A CA  1 
ATOM   341  C  C   . THR A 1 53  ? 17.679  43.280 10.117 1.00 30.79 ? 232 THR A C   1 
ATOM   342  O  O   . THR A 1 53  ? 17.681  44.319 9.456  1.00 31.55 ? 232 THR A O   1 
ATOM   343  C  CB  . THR A 1 53  ? 16.720  41.967 8.201  1.00 31.62 ? 232 THR A CB  1 
ATOM   344  O  OG1 . THR A 1 53  ? 15.358  42.106 8.616  1.00 32.25 ? 232 THR A OG1 1 
ATOM   345  C  CG2 . THR A 1 53  ? 16.866  40.688 7.376  1.00 32.57 ? 232 THR A CG2 1 
ATOM   346  N  N   . GLY A 1 54  ? 17.688  43.257 11.448 1.00 28.92 ? 233 GLY A N   1 
ATOM   347  C  CA  . GLY A 1 54  ? 17.775  44.477 12.235 1.00 28.63 ? 233 GLY A CA  1 
ATOM   348  C  C   . GLY A 1 54  ? 16.618  45.451 12.201 1.00 26.80 ? 233 GLY A C   1 
ATOM   349  O  O   . GLY A 1 54  ? 16.822  46.656 12.351 1.00 27.39 ? 233 GLY A O   1 
ATOM   350  N  N   . LYS A 1 55  ? 15.402  44.950 12.038 1.00 25.41 ? 234 LYS A N   1 
ATOM   351  C  CA  . LYS A 1 55  ? 14.248  45.842 11.972 1.00 24.47 ? 234 LYS A CA  1 
ATOM   352  C  C   . LYS A 1 55  ? 13.691  46.224 13.343 1.00 23.49 ? 234 LYS A C   1 
ATOM   353  O  O   . LYS A 1 55  ? 12.894  47.156 13.455 1.00 24.27 ? 234 LYS A O   1 
ATOM   354  C  CB  . LYS A 1 55  ? 13.152  45.218 11.119 1.00 27.08 ? 234 LYS A CB  1 
ATOM   355  C  CG  . LYS A 1 55  ? 13.554  45.029 9.652  1.00 30.15 ? 234 LYS A CG  1 
ATOM   356  C  CD  . LYS A 1 55  ? 13.867  46.370 9.007  1.00 34.42 ? 234 LYS A CD  1 
ATOM   357  C  CE  . LYS A 1 55  ? 14.091  46.236 7.508  1.00 36.10 ? 234 LYS A CE  1 
ATOM   358  N  NZ  . LYS A 1 55  ? 14.095  47.577 6.853  1.00 40.81 ? 234 LYS A NZ  1 
ATOM   359  N  N   . PHE A 1 56  ? 14.110  45.513 14.378 1.00 22.23 ? 235 PHE A N   1 
ATOM   360  C  CA  . PHE A 1 56  ? 13.648  45.806 15.735 1.00 20.83 ? 235 PHE A CA  1 
ATOM   361  C  C   . PHE A 1 56  ? 14.509  46.877 16.390 1.00 21.16 ? 235 PHE A C   1 
ATOM   362  O  O   . PHE A 1 56  ? 15.688  47.044 16.052 1.00 21.21 ? 235 PHE A O   1 
ATOM   363  C  CB  . PHE A 1 56  ? 13.745  44.549 16.619 1.00 21.70 ? 235 PHE A CB  1 
ATOM   364  C  CG  . PHE A 1 56  ? 12.607  43.579 16.461 1.00 20.54 ? 235 PHE A CG  1 
ATOM   365  C  CD1 . PHE A 1 56  ? 11.487  43.659 17.273 1.00 18.71 ? 235 PHE A CD1 1 
ATOM   366  C  CD2 . PHE A 1 56  ? 12.681  42.546 15.541 1.00 22.59 ? 235 PHE A CD2 1 
ATOM   367  C  CE1 . PHE A 1 56  ? 10.471  42.722 17.181 1.00 19.22 ? 235 PHE A CE1 1 
ATOM   368  C  CE2 . PHE A 1 56  ? 11.669  41.607 15.442 1.00 20.82 ? 235 PHE A CE2 1 
ATOM   369  C  CZ  . PHE A 1 56  ? 10.565  41.690 16.262 1.00 22.74 ? 235 PHE A CZ  1 
ATOM   370  N  N   . THR A 1 57  ? 13.922  47.600 17.340 1.00 19.13 ? 236 THR A N   1 
ATOM   371  C  CA  . THR A 1 57  ? 14.675  48.585 18.111 1.00 19.14 ? 236 THR A CA  1 
ATOM   372  C  C   . THR A 1 57  ? 15.604  47.782 19.041 1.00 19.81 ? 236 THR A C   1 
ATOM   373  O  O   . THR A 1 57  ? 15.479  46.552 19.138 1.00 19.77 ? 236 THR A O   1 
ATOM   374  C  CB  . THR A 1 57  ? 13.748  49.445 18.981 1.00 18.25 ? 236 THR A CB  1 
ATOM   375  O  OG1 . THR A 1 57  ? 13.036  48.612 19.910 1.00 19.72 ? 236 THR A OG1 1 
ATOM   376  C  CG2 . THR A 1 57  ? 12.753  50.191 18.108 1.00 17.88 ? 236 THR A CG2 1 
ATOM   377  N  N   . ASP A 1 58  ? 16.514  48.472 19.728 1.00 19.81 ? 237 ASP A N   1 
ATOM   378  C  CA  . ASP A 1 58  ? 17.469  47.810 20.616 1.00 21.80 ? 237 ASP A CA  1 
ATOM   379  C  C   . ASP A 1 58  ? 16.873  47.301 21.922 1.00 21.11 ? 237 ASP A C   1 
ATOM   380  O  O   . ASP A 1 58  ? 17.496  46.490 22.606 1.00 22.60 ? 237 ASP A O   1 
ATOM   381  C  CB  . ASP A 1 58  ? 18.652  48.745 20.940 1.00 24.88 ? 237 ASP A CB  1 
ATOM   382  C  CG  . ASP A 1 58  ? 19.656  48.864 19.797 1.00 28.37 ? 237 ASP A CG  1 
ATOM   383  O  OD1 . ASP A 1 58  ? 20.659  49.599 19.963 1.00 29.55 ? 237 ASP A OD1 1 
ATOM   384  O  OD2 . ASP A 1 58  ? 19.455  48.233 18.743 1.00 27.64 ? 237 ASP A OD2 1 
ATOM   385  N  N   . GLY A 1 59  ? 15.689  47.791 22.283 1.00 19.58 ? 238 GLY A N   1 
ATOM   386  C  CA  . GLY A 1 59  ? 15.046  47.345 23.513 1.00 21.32 ? 238 GLY A CA  1 
ATOM   387  C  C   . GLY A 1 59  ? 14.851  48.450 24.536 1.00 20.59 ? 238 GLY A C   1 
ATOM   388  O  O   . GLY A 1 59  ? 15.669  49.373 24.631 1.00 21.23 ? 238 GLY A O   1 
ATOM   389  N  N   . GLN A 1 60  ? 13.757  48.358 25.288 1.00 20.85 ? 239 GLN A N   1 
ATOM   390  C  CA  . GLN A 1 60  ? 13.419  49.358 26.291 1.00 21.93 ? 239 GLN A CA  1 
ATOM   391  C  C   . GLN A 1 60  ? 14.515  49.488 27.328 1.00 23.85 ? 239 GLN A C   1 
ATOM   392  O  O   . GLN A 1 60  ? 15.022  48.487 27.815 1.00 22.30 ? 239 GLN A O   1 
ATOM   393  C  CB  . GLN A 1 60  ? 12.107  48.998 26.989 1.00 22.40 ? 239 GLN A CB  1 
ATOM   394  C  CG  . GLN A 1 60  ? 11.669  50.080 27.971 1.00 27.74 ? 239 GLN A CG  1 
ATOM   395  C  CD  . GLN A 1 60  ? 10.293  49.862 28.571 1.00 30.51 ? 239 GLN A CD  1 
ATOM   396  O  OE1 . GLN A 1 60  ? 9.836   50.669 29.389 1.00 32.33 ? 239 GLN A OE1 1 
ATOM   397  N  NE2 . GLN A 1 60  ? 9.623   48.781 28.177 1.00 31.10 ? 239 GLN A NE2 1 
ATOM   398  N  N   . LEU A 1 61  ? 14.880  50.721 27.665 1.00 24.16 ? 240 LEU A N   1 
ATOM   399  C  CA  . LEU A 1 61  ? 15.919  50.935 28.663 1.00 28.15 ? 240 LEU A CA  1 
ATOM   400  C  C   . LEU A 1 61  ? 15.345  50.526 30.019 1.00 30.53 ? 240 LEU A C   1 
ATOM   401  O  O   . LEU A 1 61  ? 14.380  51.131 30.498 1.00 31.53 ? 240 LEU A O   1 
ATOM   402  C  CB  . LEU A 1 61  ? 16.337  52.415 28.675 1.00 27.52 ? 240 LEU A CB  1 
ATOM   403  C  CG  . LEU A 1 61  ? 17.538  52.786 29.549 1.00 30.19 ? 240 LEU A CG  1 
ATOM   404  C  CD1 . LEU A 1 61  ? 18.724  51.928 29.168 1.00 26.86 ? 240 LEU A CD1 1 
ATOM   405  C  CD2 . LEU A 1 61  ? 17.868  54.265 29.367 1.00 30.24 ? 240 LEU A CD2 1 
ATOM   406  N  N   . VAL A 1 62  ? 15.927  49.489 30.619 1.00 32.58 ? 241 VAL A N   1 
ATOM   407  C  CA  . VAL A 1 62  ? 15.477  48.975 31.913 1.00 35.48 ? 241 VAL A CA  1 
ATOM   408  C  C   . VAL A 1 62  ? 16.230  49.626 33.064 1.00 37.68 ? 241 VAL A C   1 
ATOM   409  O  O   . VAL A 1 62  ? 15.634  50.065 34.044 1.00 38.82 ? 241 VAL A O   1 
ATOM   410  C  CB  . VAL A 1 62  ? 15.695  47.446 32.022 1.00 35.65 ? 241 VAL A CB  1 
ATOM   411  C  CG1 . VAL A 1 62  ? 15.141  46.935 33.350 1.00 34.67 ? 241 VAL A CG1 1 
ATOM   412  C  CG2 . VAL A 1 62  ? 15.032  46.737 30.862 1.00 34.58 ? 241 VAL A CG2 1 
ATOM   413  N  N   . SER A 1 63  ? 17.549  49.669 32.945 1.00 40.69 ? 242 SER A N   1 
ATOM   414  C  CA  . SER A 1 63  ? 18.375  50.281 33.975 1.00 43.93 ? 242 SER A CA  1 
ATOM   415  C  C   . SER A 1 63  ? 19.344  51.254 33.323 1.00 45.12 ? 242 SER A C   1 
ATOM   416  O  O   . SER A 1 63  ? 20.136  50.866 32.461 1.00 44.77 ? 242 SER A O   1 
ATOM   417  C  CB  . SER A 1 63  ? 19.145  49.207 34.752 1.00 45.12 ? 242 SER A CB  1 
ATOM   418  O  OG  . SER A 1 63  ? 19.992  48.460 33.897 1.00 48.73 ? 242 SER A OG  1 
ATOM   419  N  N   . GLN A 1 64  ? 19.254  52.520 33.729 1.00 46.96 ? 243 GLN A N   1 
ATOM   420  C  CA  . GLN A 1 64  ? 20.108  53.581 33.204 1.00 49.09 ? 243 GLN A CA  1 
ATOM   421  C  C   . GLN A 1 64  ? 21.235  53.903 34.177 1.00 51.32 ? 243 GLN A C   1 
ATOM   422  O  O   . GLN A 1 64  ? 22.323  54.299 33.760 1.00 52.66 ? 243 GLN A O   1 
ATOM   423  C  CB  . GLN A 1 64  ? 19.291  54.852 32.957 1.00 48.08 ? 243 GLN A CB  1 
ATOM   424  C  CG  . GLN A 1 64  ? 20.111  56.022 32.427 1.00 47.34 ? 243 GLN A CG  1 
ATOM   425  C  CD  . GLN A 1 64  ? 19.319  57.319 32.367 1.00 47.76 ? 243 GLN A CD  1 
ATOM   426  O  OE1 . GLN A 1 64  ? 18.904  57.860 33.396 1.00 45.95 ? 243 GLN A OE1 1 
ATOM   427  N  NE2 . GLN A 1 64  ? 19.108  57.825 31.158 1.00 46.87 ? 243 GLN A NE2 1 
ATOM   428  N  N   . LYS A 1 65  ? 20.958  53.743 35.471 1.00 53.04 ? 244 LYS A N   1 
ATOM   429  C  CA  . LYS A 1 65  ? 21.928  54.014 36.538 1.00 55.35 ? 244 LYS A CA  1 
ATOM   430  C  C   . LYS A 1 65  ? 23.337  53.593 36.117 1.00 56.49 ? 244 LYS A C   1 
ATOM   431  O  O   . LYS A 1 65  ? 24.338  54.141 36.593 1.00 56.99 ? 244 LYS A O   1 
ATOM   432  C  CB  . LYS A 1 65  ? 21.525  53.260 37.812 1.00 55.42 ? 244 LYS A CB  1 
ATOM   433  C  CG  . LYS A 1 65  ? 22.299  53.651 39.065 1.00 55.85 ? 244 LYS A CG  1 
ATOM   434  C  CD  . LYS A 1 65  ? 21.905  55.038 39.554 1.00 55.96 ? 244 LYS A CD  1 
ATOM   435  C  CE  . LYS A 1 65  ? 22.567  55.364 40.885 1.00 55.97 ? 244 LYS A CE  1 
ATOM   436  N  NZ  . LYS A 1 65  ? 22.133  56.688 41.422 1.00 55.34 ? 244 LYS A NZ  1 
ATOM   437  N  N   . SER A 1 66  ? 23.397  52.620 35.211 1.00 57.20 ? 245 SER A N   1 
ATOM   438  C  CA  . SER A 1 66  ? 24.653  52.094 34.695 1.00 57.53 ? 245 SER A CA  1 
ATOM   439  C  C   . SER A 1 66  ? 25.405  53.138 33.875 1.00 58.05 ? 245 SER A C   1 
ATOM   440  O  O   . SER A 1 66  ? 25.161  54.341 33.997 1.00 57.91 ? 245 SER A O   1 
ATOM   441  C  CB  . SER A 1 66  ? 24.369  50.872 33.827 1.00 57.82 ? 245 SER A CB  1 
ATOM   442  O  OG  . SER A 1 66  ? 23.521  49.961 34.507 1.00 58.48 ? 245 SER A OG  1 
ATOM   443  N  N   . ASP A 1 67  ? 26.322  52.669 33.035 1.00 58.11 ? 246 ASP A N   1 
ATOM   444  C  CA  . ASP A 1 67  ? 27.100  53.570 32.195 1.00 58.04 ? 246 ASP A CA  1 
ATOM   445  C  C   . ASP A 1 67  ? 27.272  52.993 30.797 1.00 57.43 ? 246 ASP A C   1 
ATOM   446  O  O   . ASP A 1 67  ? 28.125  52.134 30.573 1.00 57.53 ? 246 ASP A O   1 
ATOM   447  C  CB  . ASP A 1 67  ? 28.480  53.828 32.816 1.00 58.50 ? 246 ASP A CB  1 
ATOM   448  C  CG  . ASP A 1 67  ? 29.231  54.954 32.119 1.00 59.60 ? 246 ASP A CG  1 
ATOM   449  O  OD1 . ASP A 1 67  ? 28.811  56.123 32.258 1.00 60.55 ? 246 ASP A OD1 1 
ATOM   450  O  OD2 . ASP A 1 67  ? 30.233  54.674 31.426 1.00 59.96 ? 246 ASP A OD2 1 
ATOM   451  N  N   . SER A 1 68  ? 26.445  53.464 29.867 1.00 56.65 ? 247 SER A N   1 
ATOM   452  C  CA  . SER A 1 68  ? 26.495  53.027 28.475 1.00 55.68 ? 247 SER A CA  1 
ATOM   453  C  C   . SER A 1 68  ? 26.572  51.508 28.323 1.00 54.82 ? 247 SER A C   1 
ATOM   454  O  O   . SER A 1 68  ? 25.549  50.840 28.169 1.00 54.35 ? 247 SER A O   1 
ATOM   455  C  CB  . SER A 1 68  ? 27.690  53.684 27.772 1.00 55.58 ? 247 SER A CB  1 
ATOM   456  O  OG  . SER A 1 68  ? 27.777  53.296 26.410 1.00 56.30 ? 247 SER A OG  1 
ATOM   457  N  N   . SER A 1 69  ? 27.786  50.969 28.367 1.00 53.64 ? 248 SER A N   1 
ATOM   458  C  CA  . SER A 1 69  ? 27.996  49.533 28.220 1.00 52.18 ? 248 SER A CA  1 
ATOM   459  C  C   . SER A 1 69  ? 27.284  48.682 29.264 1.00 50.59 ? 248 SER A C   1 
ATOM   460  O  O   . SER A 1 69  ? 26.983  47.518 29.011 1.00 50.17 ? 248 SER A O   1 
ATOM   461  C  CB  . SER A 1 69  ? 29.494  49.213 28.246 1.00 53.11 ? 248 SER A CB  1 
ATOM   462  O  OG  . SER A 1 69  ? 30.148  49.754 27.110 1.00 54.20 ? 248 SER A OG  1 
ATOM   463  N  N   . LYS A 1 70  ? 27.011  49.255 30.433 1.00 48.69 ? 249 LYS A N   1 
ATOM   464  C  CA  . LYS A 1 70  ? 26.343  48.506 31.492 1.00 47.16 ? 249 LYS A CA  1 
ATOM   465  C  C   . LYS A 1 70  ? 24.817  48.592 31.428 1.00 44.93 ? 249 LYS A C   1 
ATOM   466  O  O   . LYS A 1 70  ? 24.117  47.924 32.193 1.00 44.62 ? 249 LYS A O   1 
ATOM   467  C  CB  . LYS A 1 70  ? 26.828  48.984 32.864 1.00 48.97 ? 249 LYS A CB  1 
ATOM   468  C  CG  . LYS A 1 70  ? 28.337  48.874 33.075 1.00 51.10 ? 249 LYS A CG  1 
ATOM   469  C  CD  . LYS A 1 70  ? 28.719  49.304 34.485 1.00 52.50 ? 249 LYS A CD  1 
ATOM   470  C  CE  . LYS A 1 70  ? 28.177  50.694 34.797 1.00 53.32 ? 249 LYS A CE  1 
ATOM   471  N  NZ  . LYS A 1 70  ? 28.391  51.083 36.216 1.00 53.57 ? 249 LYS A NZ  1 
ATOM   472  N  N   . ASP A 1 71  ? 24.299  49.413 30.518 1.00 41.84 ? 250 ASP A N   1 
ATOM   473  C  CA  . ASP A 1 71  ? 22.853  49.561 30.374 1.00 38.64 ? 250 ASP A CA  1 
ATOM   474  C  C   . ASP A 1 71  ? 22.173  48.218 30.119 1.00 35.87 ? 250 ASP A C   1 
ATOM   475  O  O   . ASP A 1 71  ? 22.715  47.346 29.445 1.00 34.72 ? 250 ASP A O   1 
ATOM   476  C  CB  . ASP A 1 71  ? 22.501  50.484 29.199 1.00 38.85 ? 250 ASP A CB  1 
ATOM   477  C  CG  . ASP A 1 71  ? 22.834  51.944 29.460 1.00 41.12 ? 250 ASP A CG  1 
ATOM   478  O  OD1 . ASP A 1 71  ? 23.069  52.326 30.628 1.00 39.16 ? 250 ASP A OD1 1 
ATOM   479  O  OD2 . ASP A 1 71  ? 22.837  52.717 28.475 1.00 39.86 ? 250 ASP A OD2 1 
ATOM   480  N  N   . ILE A 1 72  ? 20.967  48.064 30.647 1.00 33.63 ? 251 ILE A N   1 
ATOM   481  C  CA  . ILE A 1 72  ? 20.210  46.838 30.424 1.00 31.87 ? 251 ILE A CA  1 
ATOM   482  C  C   . ILE A 1 72  ? 18.985  47.223 29.600 1.00 28.10 ? 251 ILE A C   1 
ATOM   483  O  O   . ILE A 1 72  ? 18.279  48.166 29.957 1.00 28.46 ? 251 ILE A O   1 
ATOM   484  C  CB  . ILE A 1 72  ? 19.744  46.214 31.750 1.00 32.27 ? 251 ILE A CB  1 
ATOM   485  C  CG1 . ILE A 1 72  ? 20.965  45.740 32.536 1.00 33.63 ? 251 ILE A CG1 1 
ATOM   486  C  CG2 . ILE A 1 72  ? 18.801  45.042 31.490 1.00 33.27 ? 251 ILE A CG2 1 
ATOM   487  C  CD1 . ILE A 1 72  ? 21.905  44.904 31.709 1.00 33.11 ? 251 ILE A CD1 1 
ATOM   488  N  N   . ARG A 1 73  ? 18.758  46.520 28.492 1.00 27.31 ? 252 ARG A N   1 
ATOM   489  C  CA  . ARG A 1 73  ? 17.585  46.792 27.654 1.00 24.61 ? 252 ARG A CA  1 
ATOM   490  C  C   . ARG A 1 73  ? 16.658  45.583 27.616 1.00 23.15 ? 252 ARG A C   1 
ATOM   491  O  O   . ARG A 1 73  ? 17.102  44.439 27.760 1.00 24.61 ? 252 ARG A O   1 
ATOM   492  C  CB  . ARG A 1 73  ? 18.012  47.225 26.238 1.00 24.20 ? 252 ARG A CB  1 
ATOM   493  C  CG  . ARG A 1 73  ? 18.541  48.674 26.246 1.00 25.08 ? 252 ARG A CG  1 
ATOM   494  C  CD  . ARG A 1 73  ? 19.080  49.182 24.914 1.00 24.54 ? 252 ARG A CD  1 
ATOM   495  N  NE  . ARG A 1 73  ? 19.543  50.568 25.051 1.00 25.36 ? 252 ARG A NE  1 
ATOM   496  C  CZ  . ARG A 1 73  ? 18.754  51.640 25.025 1.00 24.81 ? 252 ARG A CZ  1 
ATOM   497  N  NH1 . ARG A 1 73  ? 17.440  51.509 24.851 1.00 22.62 ? 252 ARG A NH1 1 
ATOM   498  N  NH2 . ARG A 1 73  ? 19.274  52.854 25.198 1.00 23.97 ? 252 ARG A NH2 1 
ATOM   499  N  N   . GLY A 1 74  ? 15.367  45.844 27.448 1.00 21.14 ? 253 GLY A N   1 
ATOM   500  C  CA  . GLY A 1 74  ? 14.383  44.774 27.438 1.00 19.57 ? 253 GLY A CA  1 
ATOM   501  C  C   . GLY A 1 74  ? 13.669  44.564 26.114 1.00 18.58 ? 253 GLY A C   1 
ATOM   502  O  O   . GLY A 1 74  ? 14.308  44.362 25.086 1.00 19.28 ? 253 GLY A O   1 
ATOM   503  N  N   . ASP A 1 75  ? 12.342  44.630 26.146 1.00 18.78 ? 254 ASP A N   1 
ATOM   504  C  CA  . ASP A 1 75  ? 11.535  44.397 24.947 1.00 18.81 ? 254 ASP A CA  1 
ATOM   505  C  C   . ASP A 1 75  ? 11.936  45.266 23.769 1.00 18.42 ? 254 ASP A C   1 
ATOM   506  O  O   . ASP A 1 75  ? 12.154  46.464 23.912 1.00 18.74 ? 254 ASP A O   1 
ATOM   507  C  CB  . ASP A 1 75  ? 10.040  44.577 25.272 1.00 19.72 ? 254 ASP A CB  1 
ATOM   508  C  CG  . ASP A 1 75  ? 9.671   46.016 25.602 1.00 22.20 ? 254 ASP A CG  1 
ATOM   509  O  OD1 . ASP A 1 75  ? 9.187   46.727 24.691 1.00 22.02 ? 254 ASP A OD1 1 
ATOM   510  O  OD2 . ASP A 1 75  ? 9.867   46.450 26.767 1.00 20.87 ? 254 ASP A OD2 1 
ATOM   511  N  N   . LYS A 1 76  ? 12.026  44.634 22.598 1.00 17.62 ? 255 LYS A N   1 
ATOM   512  C  CA  . LYS A 1 76  ? 12.406  45.295 21.358 1.00 16.93 ? 255 LYS A CA  1 
ATOM   513  C  C   . LYS A 1 76  ? 11.138  45.315 20.518 1.00 17.03 ? 255 LYS A C   1 
ATOM   514  O  O   . LYS A 1 76  ? 10.375  44.357 20.543 1.00 17.02 ? 255 LYS A O   1 
ATOM   515  C  CB  . LYS A 1 76  ? 13.455  44.457 20.612 1.00 19.31 ? 255 LYS A CB  1 
ATOM   516  C  CG  . LYS A 1 76  ? 14.698  44.100 21.417 1.00 22.80 ? 255 LYS A CG  1 
ATOM   517  C  CD  . LYS A 1 76  ? 15.575  43.138 20.609 1.00 28.68 ? 255 LYS A CD  1 
ATOM   518  C  CE  . LYS A 1 76  ? 16.968  43.006 21.212 1.00 33.20 ? 255 LYS A CE  1 
ATOM   519  N  NZ  . LYS A 1 76  ? 17.840  42.118 20.376 1.00 37.94 ? 255 LYS A NZ  1 
ATOM   520  N  N   . ILE A 1 77  ? 10.910  46.386 19.768 1.00 16.75 ? 256 ILE A N   1 
ATOM   521  C  CA  . ILE A 1 77  ? 9.696   46.429 18.974 1.00 17.13 ? 256 ILE A CA  1 
ATOM   522  C  C   . ILE A 1 77  ? 9.911   46.899 17.552 1.00 17.58 ? 256 ILE A C   1 
ATOM   523  O  O   . ILE A 1 77  ? 10.951  47.468 17.189 1.00 18.44 ? 256 ILE A O   1 
ATOM   524  C  CB  . ILE A 1 77  ? 8.615   47.360 19.609 1.00 18.18 ? 256 ILE A CB  1 
ATOM   525  C  CG1 . ILE A 1 77  ? 9.154   48.783 19.734 1.00 19.56 ? 256 ILE A CG1 1 
ATOM   526  C  CG2 . ILE A 1 77  ? 8.172   46.824 20.974 1.00 19.61 ? 256 ILE A CG2 1 
ATOM   527  C  CD1 . ILE A 1 77  ? 8.095   49.773 20.232 1.00 21.82 ? 256 ILE A CD1 1 
ATOM   528  N  N   . THR A 1 78  ? 8.915   46.621 16.732 1.00 19.34 ? 257 THR A N   1 
ATOM   529  C  CA  . THR A 1 78  ? 8.928   47.100 15.363 1.00 20.68 ? 257 THR A CA  1 
ATOM   530  C  C   . THR A 1 78  ? 7.470   47.187 14.954 1.00 20.05 ? 257 THR A C   1 
ATOM   531  O  O   . THR A 1 78  ? 6.675   46.297 15.261 1.00 19.70 ? 257 THR A O   1 
ATOM   532  C  CB  . THR A 1 78  ? 9.731   46.188 14.401 1.00 23.60 ? 257 THR A CB  1 
ATOM   533  O  OG1 . THR A 1 78  ? 9.800   46.833 13.125 1.00 26.27 ? 257 THR A OG1 1 
ATOM   534  C  CG2 . THR A 1 78  ? 9.091   44.823 14.231 1.00 23.94 ? 257 THR A CG2 1 
ATOM   535  N  N   . TRP A 1 79  ? 7.115   48.289 14.295 1.00 21.05 ? 258 TRP A N   1 
ATOM   536  C  CA  . TRP A 1 79  ? 5.744   48.523 13.847 1.00 21.16 ? 258 TRP A CA  1 
ATOM   537  C  C   . TRP A 1 79  ? 5.585   47.996 12.424 1.00 22.57 ? 258 TRP A C   1 
ATOM   538  O  O   . TRP A 1 79  ? 6.371   48.346 11.548 1.00 21.49 ? 258 TRP A O   1 
ATOM   539  C  CB  . TRP A 1 79  ? 5.435   50.023 13.871 1.00 23.26 ? 258 TRP A CB  1 
ATOM   540  C  CG  . TRP A 1 79  ? 5.305   50.603 15.258 1.00 23.47 ? 258 TRP A CG  1 
ATOM   541  C  CD1 . TRP A 1 79  ? 6.238   51.331 15.943 1.00 25.07 ? 258 TRP A CD1 1 
ATOM   542  C  CD2 . TRP A 1 79  ? 4.169   50.489 16.122 1.00 24.10 ? 258 TRP A CD2 1 
ATOM   543  N  NE1 . TRP A 1 79  ? 5.746   51.681 17.184 1.00 25.56 ? 258 TRP A NE1 1 
ATOM   544  C  CE2 . TRP A 1 79  ? 4.480   51.174 17.316 1.00 24.36 ? 258 TRP A CE2 1 
ATOM   545  C  CE3 . TRP A 1 79  ? 2.919   49.872 16.001 1.00 22.82 ? 258 TRP A CE3 1 
ATOM   546  C  CZ2 . TRP A 1 79  ? 3.586   51.257 18.381 1.00 26.53 ? 258 TRP A CZ2 1 
ATOM   547  C  CZ3 . TRP A 1 79  ? 2.030   49.955 17.058 1.00 25.05 ? 258 TRP A CZ3 1 
ATOM   548  C  CH2 . TRP A 1 79  ? 2.366   50.640 18.232 1.00 25.49 ? 258 TRP A CH2 1 
ATOM   549  N  N   . ILE A 1 80  ? 4.557   47.183 12.206 1.00 22.11 ? 259 ILE A N   1 
ATOM   550  C  CA  . ILE A 1 80  ? 4.304   46.552 10.910 1.00 23.03 ? 259 ILE A CA  1 
ATOM   551  C  C   . ILE A 1 80  ? 2.919   46.904 10.370 1.00 24.45 ? 259 ILE A C   1 
ATOM   552  O  O   . ILE A 1 80  ? 1.911   46.702 11.036 1.00 22.90 ? 259 ILE A O   1 
ATOM   553  C  CB  . ILE A 1 80  ? 4.436   45.006 11.047 1.00 23.74 ? 259 ILE A CB  1 
ATOM   554  C  CG1 . ILE A 1 80  ? 5.891   44.633 11.352 1.00 24.28 ? 259 ILE A CG1 1 
ATOM   555  C  CG2 . ILE A 1 80  ? 3.965   44.297 9.777  1.00 23.69 ? 259 ILE A CG2 1 
ATOM   556  C  CD1 . ILE A 1 80  ? 6.880   45.101 10.310 1.00 25.85 ? 259 ILE A CD1 1 
ATOM   557  N  N   . GLU A 1 81  ? 2.875   47.425 9.147  1.00 25.27 ? 260 GLU A N   1 
ATOM   558  C  CA  . GLU A 1 81  ? 1.615   47.804 8.527  1.00 27.73 ? 260 GLU A CA  1 
ATOM   559  C  C   . GLU A 1 81  ? 0.921   46.564 7.954  1.00 28.34 ? 260 GLU A C   1 
ATOM   560  O  O   . GLU A 1 81  ? -0.309  46.505 7.890  1.00 28.15 ? 260 GLU A O   1 
ATOM   561  C  CB  . GLU A 1 81  ? 1.898   48.844 7.440  1.00 30.48 ? 260 GLU A CB  1 
ATOM   562  C  CG  . GLU A 1 81  ? 0.692   49.599 6.913  1.00 37.08 ? 260 GLU A CG  1 
ATOM   563  C  CD  . GLU A 1 81  ? -0.145  48.764 5.980  1.00 39.41 ? 260 GLU A CD  1 
ATOM   564  O  OE1 . GLU A 1 81  ? 0.432   47.899 5.285  1.00 42.04 ? 260 GLU A OE1 1 
ATOM   565  O  OE2 . GLU A 1 81  ? -1.374  48.984 5.924  1.00 43.33 ? 260 GLU A OE2 1 
ATOM   566  N  N   . GLY A 1 82  ? 1.711   45.575 7.538  1.00 27.26 ? 261 GLY A N   1 
ATOM   567  C  CA  . GLY A 1 82  ? 1.148   44.345 7.017  1.00 29.29 ? 261 GLY A CA  1 
ATOM   568  C  C   . GLY A 1 82  ? 1.265   44.118 5.518  1.00 29.45 ? 261 GLY A C   1 
ATOM   569  O  O   . GLY A 1 82  ? 0.975   43.029 5.030  1.00 30.39 ? 261 GLY A O   1 
ATOM   570  N  N   . LYS A 1 83  ? 1.686   45.135 4.781  1.00 32.21 ? 262 LYS A N   1 
ATOM   571  C  CA  . LYS A 1 83  ? 1.812   44.991 3.332  1.00 33.69 ? 262 LYS A CA  1 
ATOM   572  C  C   . LYS A 1 83  ? 3.261   45.008 2.861  1.00 35.55 ? 262 LYS A C   1 
ATOM   573  O  O   . LYS A 1 83  ? 3.531   44.817 1.674  1.00 34.47 ? 262 LYS A O   1 
ATOM   574  C  CB  . LYS A 1 83  ? 1.033   46.105 2.632  1.00 34.79 ? 262 LYS A CB  1 
ATOM   575  C  CG  . LYS A 1 83  ? -0.458  46.097 2.962  1.00 34.36 ? 262 LYS A CG  1 
ATOM   576  C  CD  . LYS A 1 83  ? -1.179  47.263 2.310  1.00 35.80 ? 262 LYS A CD  1 
ATOM   577  C  CE  . LYS A 1 83  ? -2.693  47.181 2.525  1.00 37.57 ? 262 LYS A CE  1 
ATOM   578  N  NZ  . LYS A 1 83  ? -3.098  47.359 3.955  1.00 37.01 ? 262 LYS A NZ  1 
ATOM   579  N  N   . GLU A 1 84  ? 4.190   45.228 3.788  1.00 34.87 ? 263 GLU A N   1 
ATOM   580  C  CA  . GLU A 1 84  ? 5.606   45.275 3.448  1.00 34.94 ? 263 GLU A CA  1 
ATOM   581  C  C   . GLU A 1 84  ? 6.089   43.920 2.941  1.00 34.89 ? 263 GLU A C   1 
ATOM   582  O  O   . GLU A 1 84  ? 5.569   42.873 3.332  1.00 35.50 ? 263 GLU A O   1 
ATOM   583  C  CB  . GLU A 1 84  ? 6.449   45.672 4.676  1.00 34.70 ? 263 GLU A CB  1 
ATOM   584  C  CG  . GLU A 1 84  ? 6.076   46.995 5.333  1.00 32.74 ? 263 GLU A CG  1 
ATOM   585  C  CD  . GLU A 1 84  ? 5.114   46.817 6.502  1.00 31.11 ? 263 GLU A CD  1 
ATOM   586  O  OE1 . GLU A 1 84  ? 4.336   45.840 6.493  1.00 27.01 ? 263 GLU A OE1 1 
ATOM   587  O  OE2 . GLU A 1 84  ? 5.135   47.666 7.418  1.00 31.74 ? 263 GLU A OE2 1 
ATOM   588  N  N   . PRO A 1 85  ? 7.082   43.925 2.039  1.00 34.84 ? 264 PRO A N   1 
ATOM   589  C  CA  . PRO A 1 85  ? 7.626   42.679 1.499  1.00 35.13 ? 264 PRO A CA  1 
ATOM   590  C  C   . PRO A 1 85  ? 8.175   41.857 2.667  1.00 34.02 ? 264 PRO A C   1 
ATOM   591  O  O   . PRO A 1 85  ? 8.895   42.388 3.512  1.00 35.28 ? 264 PRO A O   1 
ATOM   592  C  CB  . PRO A 1 85  ? 8.739   43.168 0.573  1.00 35.17 ? 264 PRO A CB  1 
ATOM   593  C  CG  . PRO A 1 85  ? 8.197   44.460 0.069  1.00 36.27 ? 264 PRO A CG  1 
ATOM   594  C  CD  . PRO A 1 85  ? 7.640   45.091 1.333  1.00 34.71 ? 264 PRO A CD  1 
ATOM   595  N  N   . GLY A 1 86  ? 7.818   40.581 2.723  1.00 33.86 ? 265 GLY A N   1 
ATOM   596  C  CA  . GLY A 1 86  ? 8.298   39.731 3.796  1.00 33.60 ? 265 GLY A CA  1 
ATOM   597  C  C   . GLY A 1 86  ? 7.450   39.801 5.052  1.00 33.79 ? 265 GLY A C   1 
ATOM   598  O  O   . GLY A 1 86  ? 7.769   39.160 6.055  1.00 33.10 ? 265 GLY A O   1 
ATOM   599  N  N   . CYS A 1 87  ? 6.374   40.580 5.008  1.00 32.87 ? 266 CYS A N   1 
ATOM   600  C  CA  . CYS A 1 87  ? 5.494   40.717 6.167  1.00 30.78 ? 266 CYS A CA  1 
ATOM   601  C  C   . CYS A 1 87  ? 4.053   40.422 5.818  1.00 30.63 ? 266 CYS A C   1 
ATOM   602  O  O   . CYS A 1 87  ? 3.154   40.735 6.591  1.00 29.44 ? 266 CYS A O   1 
ATOM   603  C  CB  . CYS A 1 87  ? 5.564   42.141 6.728  1.00 31.03 ? 266 CYS A CB  1 
ATOM   604  S  SG  . CYS A 1 87  ? 7.186   42.660 7.295  1.00 34.03 ? 266 CYS A SG  1 
ATOM   605  N  N   . GLU A 1 88  ? 3.821   39.809 4.664  1.00 29.29 ? 267 GLU A N   1 
ATOM   606  C  CA  . GLU A 1 88  ? 2.455   39.546 4.242  1.00 29.76 ? 267 GLU A CA  1 
ATOM   607  C  C   . GLU A 1 88  ? 1.648   38.542 5.049  1.00 27.74 ? 267 GLU A C   1 
ATOM   608  O  O   . GLU A 1 88  ? 0.418   38.612 5.070  1.00 27.68 ? 267 GLU A O   1 
ATOM   609  C  CB  . GLU A 1 88  ? 2.456   39.166 2.764  1.00 30.70 ? 267 GLU A CB  1 
ATOM   610  C  CG  . GLU A 1 88  ? 3.148   40.224 1.932  1.00 34.51 ? 267 GLU A CG  1 
ATOM   611  C  CD  . GLU A 1 88  ? 2.997   39.980 0.455  1.00 36.39 ? 267 GLU A CD  1 
ATOM   612  O  OE1 . GLU A 1 88  ? 3.337   38.871 0.006  1.00 38.53 ? 267 GLU A OE1 1 
ATOM   613  O  OE2 . GLU A 1 88  ? 2.537   40.898 -0.248 1.00 40.55 ? 267 GLU A OE2 1 
ATOM   614  N  N   . THR A 1 89  ? 2.314   37.616 5.726  1.00 25.40 ? 268 THR A N   1 
ATOM   615  C  CA  . THR A 1 89  ? 1.573   36.652 6.511  1.00 25.36 ? 268 THR A CA  1 
ATOM   616  C  C   . THR A 1 89  ? 1.191   37.365 7.814  1.00 24.63 ? 268 THR A C   1 
ATOM   617  O  O   . THR A 1 89  ? 0.170   37.061 8.417  1.00 24.01 ? 268 THR A O   1 
ATOM   618  C  CB  . THR A 1 89  ? 2.397   35.389 6.782  1.00 25.46 ? 268 THR A CB  1 
ATOM   619  O  OG1 . THR A 1 89  ? 3.013   34.967 5.553  1.00 30.09 ? 268 THR A OG1 1 
ATOM   620  C  CG2 . THR A 1 89  ? 1.500   34.268 7.264  1.00 27.69 ? 268 THR A CG2 1 
ATOM   621  N  N   . ILE A 1 90  ? 2.015   38.319 8.230  1.00 24.92 ? 269 ILE A N   1 
ATOM   622  C  CA  . ILE A 1 90  ? 1.683   39.101 9.422  1.00 23.71 ? 269 ILE A CA  1 
ATOM   623  C  C   . ILE A 1 90  ? 0.464   39.929 9.014  1.00 24.92 ? 269 ILE A C   1 
ATOM   624  O  O   . ILE A 1 90  ? -0.466  40.127 9.796  1.00 23.29 ? 269 ILE A O   1 
ATOM   625  C  CB  . ILE A 1 90  ? 2.840   40.024 9.834  1.00 22.73 ? 269 ILE A CB  1 
ATOM   626  C  CG1 . ILE A 1 90  ? 3.985   39.174 10.417 1.00 22.63 ? 269 ILE A CG1 1 
ATOM   627  C  CG2 . ILE A 1 90  ? 2.345   41.055 10.879 1.00 23.19 ? 269 ILE A CG2 1 
ATOM   628  C  CD1 . ILE A 1 90  ? 5.300   39.907 10.566 1.00 24.46 ? 269 ILE A CD1 1 
ATOM   629  N  N   . GLY A 1 91  ? 0.464   40.396 7.768  1.00 26.53 ? 270 GLY A N   1 
ATOM   630  C  CA  . GLY A 1 91  ? -0.669  41.155 7.273  1.00 26.68 ? 270 GLY A CA  1 
ATOM   631  C  C   . GLY A 1 91  ? -1.905  40.267 7.273  1.00 26.80 ? 270 GLY A C   1 
ATOM   632  O  O   . GLY A 1 91  ? -3.001  40.713 7.600  1.00 27.10 ? 270 GLY A O   1 
ATOM   633  N  N   . LEU A 1 92  ? -1.727  38.999 6.913  1.00 27.98 ? 271 LEU A N   1 
ATOM   634  C  CA  . LEU A 1 92  ? -2.829  38.052 6.895  1.00 27.39 ? 271 LEU A CA  1 
ATOM   635  C  C   . LEU A 1 92  ? -3.366  37.844 8.310  1.00 26.94 ? 271 LEU A C   1 
ATOM   636  O  O   . LEU A 1 92  ? -4.570  37.717 8.511  1.00 25.54 ? 271 LEU A O   1 
ATOM   637  C  CB  . LEU A 1 92  ? -2.371  36.718 6.305  1.00 30.54 ? 271 LEU A CB  1 
ATOM   638  C  CG  . LEU A 1 92  ? -3.444  35.640 6.164  1.00 32.87 ? 271 LEU A CG  1 
ATOM   639  C  CD1 . LEU A 1 92  ? -4.526  36.126 5.197  1.00 34.01 ? 271 LEU A CD1 1 
ATOM   640  C  CD2 . LEU A 1 92  ? -2.806  34.354 5.636  1.00 34.86 ? 271 LEU A CD2 1 
ATOM   641  N  N   . LEU A 1 93  ? -2.470  37.799 9.296  1.00 24.20 ? 272 LEU A N   1 
ATOM   642  C  CA  . LEU A 1 93  ? -2.897  37.647 10.687 1.00 22.25 ? 272 LEU A CA  1 
ATOM   643  C  C   . LEU A 1 93  ? -3.733  38.860 11.098 1.00 20.01 ? 272 LEU A C   1 
ATOM   644  O  O   . LEU A 1 93  ? -4.771  38.716 11.743 1.00 20.29 ? 272 LEU A O   1 
ATOM   645  C  CB  . LEU A 1 93  ? -1.673  37.543 11.620 1.00 21.51 ? 272 LEU A CB  1 
ATOM   646  C  CG  . LEU A 1 93  ? -1.911  37.856 13.112 1.00 20.32 ? 272 LEU A CG  1 
ATOM   647  C  CD1 . LEU A 1 93  ? -2.753  36.779 13.788 1.00 22.48 ? 272 LEU A CD1 1 
ATOM   648  C  CD2 . LEU A 1 93  ? -0.540  37.972 13.815 1.00 19.35 ? 272 LEU A CD2 1 
ATOM   649  N  N   . MET A 1 94  ? -3.270  40.047 10.717 1.00 20.92 ? 273 MET A N   1 
ATOM   650  C  CA  . MET A 1 94  ? -3.953  41.299 11.066 1.00 22.34 ? 273 MET A CA  1 
ATOM   651  C  C   . MET A 1 94  ? -5.349  41.314 10.471 1.00 24.45 ? 273 MET A C   1 
ATOM   652  O  O   . MET A 1 94  ? -6.318  41.706 11.131 1.00 23.39 ? 273 MET A O   1 
ATOM   653  C  CB  . MET A 1 94  ? -3.160  42.500 10.557 1.00 22.05 ? 273 MET A CB  1 
ATOM   654  C  CG  . MET A 1 94  ? -1.806  42.676 11.259 1.00 20.33 ? 273 MET A CG  1 
ATOM   655  S  SD  . MET A 1 94  ? -0.637  43.747 10.433 1.00 23.39 ? 273 MET A SD  1 
ATOM   656  C  CE  . MET A 1 94  ? -1.352  45.361 10.765 1.00 21.59 ? 273 MET A CE  1 
ATOM   657  N  N   . SER A 1 95  ? -5.444  40.898 9.213  1.00 24.74 ? 274 SER A N   1 
ATOM   658  C  CA  . SER A 1 95  ? -6.741  40.845 8.548  1.00 26.34 ? 274 SER A CA  1 
ATOM   659  C  C   . SER A 1 95  ? -7.657  39.848 9.245  1.00 25.14 ? 274 SER A C   1 
ATOM   660  O  O   . SER A 1 95  ? -8.861  40.067 9.321  1.00 26.20 ? 274 SER A O   1 
ATOM   661  C  CB  . SER A 1 95  ? -6.565  40.460 7.078  1.00 26.76 ? 274 SER A CB  1 
ATOM   662  O  OG  . SER A 1 95  ? -5.829  41.462 6.398  1.00 31.98 ? 274 SER A OG  1 
ATOM   663  N  N   . SER A 1 96  ? -7.082  38.760 9.764  1.00 26.43 ? 275 SER A N   1 
ATOM   664  C  CA  . SER A 1 96  ? -7.856  37.734 10.447 1.00 25.17 ? 275 SER A CA  1 
ATOM   665  C  C   . SER A 1 96  ? -8.349  38.245 11.789 1.00 25.97 ? 275 SER A C   1 
ATOM   666  O  O   . SER A 1 96  ? -9.442  37.893 12.238 1.00 24.63 ? 275 SER A O   1 
ATOM   667  C  CB  . SER A 1 96  ? -7.021  36.468 10.663 1.00 28.37 ? 275 SER A CB  1 
ATOM   668  O  OG  . SER A 1 96  ? -6.528  35.963 9.433  1.00 28.05 ? 275 SER A OG  1 
ATOM   669  N  N   . MET A 1 97  ? -7.522  39.047 12.455 1.00 23.16 ? 276 MET A N   1 
ATOM   670  C  CA  . MET A 1 97  ? -7.940  39.621 13.726 1.00 22.46 ? 276 MET A CA  1 
ATOM   671  C  C   . MET A 1 97  ? -9.073  40.611 13.411 1.00 21.50 ? 276 MET A C   1 
ATOM   672  O  O   . MET A 1 97  ? -10.078 40.654 14.110 1.00 21.24 ? 276 MET A O   1 
ATOM   673  C  CB  . MET A 1 97  ? -6.785  40.392 14.384 1.00 21.11 ? 276 MET A CB  1 
ATOM   674  C  CG  . MET A 1 97  ? -5.571  39.570 14.771 1.00 24.20 ? 276 MET A CG  1 
ATOM   675  S  SD  . MET A 1 97  ? -4.298  40.738 15.368 1.00 24.66 ? 276 MET A SD  1 
ATOM   676  C  CE  . MET A 1 97  ? -3.242  39.649 16.387 1.00 24.60 ? 276 MET A CE  1 
ATOM   677  N  N   . ASP A 1 98  ? -8.894  41.393 12.348 1.00 24.23 ? 277 ASP A N   1 
ATOM   678  C  CA  . ASP A 1 98  ? -9.896  42.390 11.958 1.00 25.44 ? 277 ASP A CA  1 
ATOM   679  C  C   . ASP A 1 98  ? -11.224 41.707 11.658 1.00 26.43 ? 277 ASP A C   1 
ATOM   680  O  O   . ASP A 1 98  ? -12.291 42.212 12.018 1.00 25.15 ? 277 ASP A O   1 
ATOM   681  C  CB  . ASP A 1 98  ? -9.440  43.172 10.723 1.00 25.88 ? 277 ASP A CB  1 
ATOM   682  C  CG  . ASP A 1 98  ? -8.346  44.181 11.031 1.00 26.36 ? 277 ASP A CG  1 
ATOM   683  O  OD1 . ASP A 1 98  ? -7.827  44.797 10.078 1.00 27.52 ? 277 ASP A OD1 1 
ATOM   684  O  OD2 . ASP A 1 98  ? -8.005  44.365 12.223 1.00 26.97 ? 277 ASP A OD2 1 
ATOM   685  N  N   . ASP A 1 99  ? -11.159 40.555 11.001 1.00 26.30 ? 278 ASP A N   1 
ATOM   686  C  CA  . ASP A 1 99  ? -12.375 39.814 10.666 1.00 28.60 ? 278 ASP A CA  1 
ATOM   687  C  C   . ASP A 1 99  ? -13.140 39.417 11.918 1.00 27.37 ? 278 ASP A C   1 
ATOM   688  O  O   . ASP A 1 99  ? -14.358 39.554 11.968 1.00 27.60 ? 278 ASP A O   1 
ATOM   689  C  CB  . ASP A 1 99  ? -12.028 38.570 9.854  1.00 30.11 ? 278 ASP A CB  1 
ATOM   690  C  CG  . ASP A 1 99  ? -11.595 38.902 8.439  1.00 34.19 ? 278 ASP A CG  1 
ATOM   691  O  OD1 . ASP A 1 99  ? -11.012 38.017 7.773  1.00 36.00 ? 278 ASP A OD1 1 
ATOM   692  O  OD2 . ASP A 1 99  ? -11.839 40.045 7.987  1.00 36.14 ? 278 ASP A OD2 1 
ATOM   693  N  N   . LEU A 1 100 ? -12.429 38.923 12.932 1.00 26.92 ? 279 LEU A N   1 
ATOM   694  C  CA  . LEU A 1 100 ? -13.079 38.532 14.182 1.00 25.31 ? 279 LEU A CA  1 
ATOM   695  C  C   . LEU A 1 100 ? -13.735 39.734 14.857 1.00 25.79 ? 279 LEU A C   1 
ATOM   696  O  O   . LEU A 1 100 ? -14.864 39.665 15.353 1.00 25.07 ? 279 LEU A O   1 
ATOM   697  C  CB  . LEU A 1 100 ? -12.055 37.920 15.149 1.00 27.95 ? 279 LEU A CB  1 
ATOM   698  C  CG  . LEU A 1 100 ? -11.475 36.565 14.752 1.00 28.04 ? 279 LEU A CG  1 
ATOM   699  C  CD1 . LEU A 1 100 ? -10.397 36.159 15.753 1.00 28.93 ? 279 LEU A CD1 1 
ATOM   700  C  CD2 . LEU A 1 100 ? -12.597 35.523 14.727 1.00 29.64 ? 279 LEU A CD2 1 
ATOM   701  N  N   . ILE A 1 101 ? -13.010 40.842 14.910 1.00 24.63 ? 280 ILE A N   1 
ATOM   702  C  CA  . ILE A 1 101 ? -13.552 42.040 15.526 1.00 24.99 ? 280 ILE A CA  1 
ATOM   703  C  C   . ILE A 1 101 ? -14.802 42.506 14.767 1.00 25.52 ? 280 ILE A C   1 
ATOM   704  O  O   . ILE A 1 101 ? -15.796 42.886 15.382 1.00 25.00 ? 280 ILE A O   1 
ATOM   705  C  CB  . ILE A 1 101 ? -12.485 43.162 15.549 1.00 25.69 ? 280 ILE A CB  1 
ATOM   706  C  CG1 . ILE A 1 101 ? -11.388 42.798 16.558 1.00 24.56 ? 280 ILE A CG1 1 
ATOM   707  C  CG2 . ILE A 1 101 ? -13.124 44.500 15.894 1.00 26.37 ? 280 ILE A CG2 1 
ATOM   708  C  CD1 . ILE A 1 101 ? -11.855 42.801 18.014 1.00 26.18 ? 280 ILE A CD1 1 
ATOM   709  N  N   . ARG A 1 102 ? -14.756 42.474 13.437 1.00 27.42 ? 281 ARG A N   1 
ATOM   710  C  CA  . ARG A 1 102 ? -15.918 42.890 12.643 1.00 29.65 ? 281 ARG A CA  1 
ATOM   711  C  C   . ARG A 1 102 ? -17.155 42.082 13.032 1.00 30.04 ? 281 ARG A C   1 
ATOM   712  O  O   . ARG A 1 102 ? -18.249 42.631 13.195 1.00 29.48 ? 281 ARG A O   1 
ATOM   713  C  CB  . ARG A 1 102 ? -15.673 42.690 11.142 1.00 33.58 ? 281 ARG A CB  1 
ATOM   714  C  CG  . ARG A 1 102 ? -14.708 43.652 10.488 1.00 38.53 ? 281 ARG A CG  1 
ATOM   715  C  CD  . ARG A 1 102 ? -15.059 43.795 9.007  1.00 42.34 ? 281 ARG A CD  1 
ATOM   716  N  NE  . ARG A 1 102 ? -14.050 44.525 8.245  1.00 46.48 ? 281 ARG A NE  1 
ATOM   717  C  CZ  . ARG A 1 102 ? -12.878 44.012 7.875  1.00 47.57 ? 281 ARG A CZ  1 
ATOM   718  N  NH1 . ARG A 1 102 ? -12.015 44.744 7.179  1.00 48.77 ? 281 ARG A NH1 1 
ATOM   719  N  NH2 . ARG A 1 102 ? -12.575 42.761 8.196  1.00 47.99 ? 281 ARG A NH2 1 
ATOM   720  N  N   . HIS A 1 103 ? -16.981 40.770 13.172 1.00 30.48 ? 282 HIS A N   1 
ATOM   721  C  CA  . HIS A 1 103 ? -18.083 39.886 13.531 1.00 31.13 ? 282 HIS A CA  1 
ATOM   722  C  C   . HIS A 1 103 ? -18.538 40.064 14.971 1.00 31.35 ? 282 HIS A C   1 
ATOM   723  O  O   . HIS A 1 103 ? -19.592 39.570 15.355 1.00 32.52 ? 282 HIS A O   1 
ATOM   724  C  CB  . HIS A 1 103 ? -17.680 38.430 13.305 1.00 33.08 ? 282 HIS A CB  1 
ATOM   725  C  CG  . HIS A 1 103 ? -17.490 38.079 11.867 1.00 35.04 ? 282 HIS A CG  1 
ATOM   726  N  ND1 . HIS A 1 103 ? -16.461 37.274 11.428 1.00 37.63 ? 282 HIS A ND1 1 
ATOM   727  C  CD2 . HIS A 1 103 ? -18.207 38.408 10.768 1.00 36.12 ? 282 HIS A CD2 1 
ATOM   728  C  CE1 . HIS A 1 103 ? -16.551 37.124 10.118 1.00 38.19 ? 282 HIS A CE1 1 
ATOM   729  N  NE2 . HIS A 1 103 ? -17.602 37.802 9.693  1.00 38.56 ? 282 HIS A NE2 1 
ATOM   730  N  N   . CYS A 1 104 ? -17.733 40.764 15.764 1.00 30.70 ? 283 CYS A N   1 
ATOM   731  C  CA  . CYS A 1 104 ? -18.043 41.032 17.169 1.00 31.51 ? 283 CYS A CA  1 
ATOM   732  C  C   . CYS A 1 104 ? -18.632 42.416 17.365 1.00 33.28 ? 283 CYS A C   1 
ATOM   733  O  O   . CYS A 1 104 ? -19.245 42.690 18.395 1.00 33.62 ? 283 CYS A O   1 
ATOM   734  C  CB  . CYS A 1 104 ? -16.784 41.017 18.029 1.00 30.91 ? 283 CYS A CB  1 
ATOM   735  S  SG  . CYS A 1 104 ? -16.020 39.457 18.298 1.00 30.38 ? 283 CYS A SG  1 
ATOM   736  N  N   . ASN A 1 105 ? -18.406 43.302 16.404 1.00 35.45 ? 284 ASN A N   1 
ATOM   737  C  CA  . ASN A 1 105 ? -18.876 44.673 16.545 1.00 36.31 ? 284 ASN A CA  1 
ATOM   738  C  C   . ASN A 1 105 ? -20.339 44.805 16.912 1.00 36.30 ? 284 ASN A C   1 
ATOM   739  O  O   . ASN A 1 105 ? -21.219 44.205 16.293 1.00 36.14 ? 284 ASN A O   1 
ATOM   740  C  CB  . ASN A 1 105 ? -18.575 45.491 15.290 1.00 37.65 ? 284 ASN A CB  1 
ATOM   741  C  CG  . ASN A 1 105 ? -17.676 46.680 15.585 1.00 38.38 ? 284 ASN A CG  1 
ATOM   742  O  OD1 . ASN A 1 105 ? -17.691 47.225 16.698 1.00 36.61 ? 284 ASN A OD1 1 
ATOM   743  N  ND2 . ASN A 1 105 ? -16.901 47.098 14.590 1.00 38.64 ? 284 ASN A ND2 1 
ATOM   744  N  N   . GLY A 1 106 ? -20.580 45.609 17.941 1.00 36.63 ? 285 GLY A N   1 
ATOM   745  C  CA  . GLY A 1 106 ? -21.923 45.816 18.426 1.00 36.17 ? 285 GLY A CA  1 
ATOM   746  C  C   . GLY A 1 106 ? -22.197 44.845 19.554 1.00 35.97 ? 285 GLY A C   1 
ATOM   747  O  O   . GLY A 1 106 ? -23.240 44.931 20.203 1.00 36.46 ? 285 GLY A O   1 
ATOM   748  N  N   . LYS A 1 107 ? -21.265 43.920 19.792 1.00 34.09 ? 286 LYS A N   1 
ATOM   749  C  CA  . LYS A 1 107 ? -21.442 42.933 20.855 1.00 32.72 ? 286 LYS A CA  1 
ATOM   750  C  C   . LYS A 1 107 ? -20.362 42.929 21.945 1.00 31.85 ? 286 LYS A C   1 
ATOM   751  O  O   . LYS A 1 107 ? -20.472 42.186 22.915 1.00 32.34 ? 286 LYS A O   1 
ATOM   752  C  CB  . LYS A 1 107 ? -21.557 41.527 20.249 1.00 34.39 ? 286 LYS A CB  1 
ATOM   753  C  CG  . LYS A 1 107 ? -22.737 41.353 19.288 1.00 37.58 ? 286 LYS A CG  1 
ATOM   754  C  CD  . LYS A 1 107 ? -23.006 39.872 19.010 1.00 39.83 ? 286 LYS A CD  1 
ATOM   755  C  CE  . LYS A 1 107 ? -24.241 39.660 18.133 1.00 41.37 ? 286 LYS A CE  1 
ATOM   756  N  NZ  . LYS A 1 107 ? -24.007 40.012 16.698 1.00 42.80 ? 286 LYS A NZ  1 
ATOM   757  N  N   . LEU A 1 108 ? -19.320 43.741 21.784 1.00 29.86 ? 287 LEU A N   1 
ATOM   758  C  CA  . LEU A 1 108 ? -18.249 43.814 22.783 1.00 28.83 ? 287 LEU A CA  1 
ATOM   759  C  C   . LEU A 1 108 ? -18.545 44.989 23.704 1.00 28.20 ? 287 LEU A C   1 
ATOM   760  O  O   . LEU A 1 108 ? -18.174 46.117 23.410 1.00 27.93 ? 287 LEU A O   1 
ATOM   761  C  CB  . LEU A 1 108 ? -16.898 44.008 22.091 1.00 28.65 ? 287 LEU A CB  1 
ATOM   762  C  CG  . LEU A 1 108 ? -16.401 42.793 21.303 1.00 28.37 ? 287 LEU A CG  1 
ATOM   763  C  CD1 . LEU A 1 108 ? -15.167 43.158 20.506 1.00 29.77 ? 287 LEU A CD1 1 
ATOM   764  C  CD2 . LEU A 1 108 ? -16.101 41.656 22.263 1.00 28.63 ? 287 LEU A CD2 1 
ATOM   765  N  N   . GLY A 1 109 ? -19.206 44.721 24.824 1.00 27.42 ? 288 GLY A N   1 
ATOM   766  C  CA  . GLY A 1 109 ? -19.582 45.805 25.714 1.00 27.71 ? 288 GLY A CA  1 
ATOM   767  C  C   . GLY A 1 109 ? -20.475 46.716 24.886 1.00 28.57 ? 288 GLY A C   1 
ATOM   768  O  O   . GLY A 1 109 ? -21.224 46.242 24.030 1.00 28.53 ? 288 GLY A O   1 
ATOM   769  N  N   . SER A 1 110 ? -20.407 48.019 25.125 1.00 27.87 ? 289 SER A N   1 
ATOM   770  C  CA  . SER A 1 110 ? -21.202 48.954 24.338 1.00 28.45 ? 289 SER A CA  1 
ATOM   771  C  C   . SER A 1 110 ? -20.271 49.717 23.403 1.00 27.24 ? 289 SER A C   1 
ATOM   772  O  O   . SER A 1 110 ? -20.615 50.784 22.898 1.00 27.61 ? 289 SER A O   1 
ATOM   773  C  CB  . SER A 1 110 ? -21.950 49.937 25.237 1.00 27.84 ? 289 SER A CB  1 
ATOM   774  O  OG  . SER A 1 110 ? -21.062 50.728 25.997 1.00 28.88 ? 289 SER A OG  1 
ATOM   775  N  N   . TYR A 1 111 ? -19.087 49.163 23.170 1.00 26.05 ? 290 TYR A N   1 
ATOM   776  C  CA  . TYR A 1 111 ? -18.123 49.809 22.289 1.00 24.19 ? 290 TYR A CA  1 
ATOM   777  C  C   . TYR A 1 111 ? -18.526 49.653 20.834 1.00 23.25 ? 290 TYR A C   1 
ATOM   778  O  O   . TYR A 1 111 ? -19.211 48.701 20.460 1.00 25.12 ? 290 TYR A O   1 
ATOM   779  C  CB  . TYR A 1 111 ? -16.734 49.180 22.446 1.00 20.85 ? 290 TYR A CB  1 
ATOM   780  C  CG  . TYR A 1 111 ? -16.073 49.366 23.789 1.00 23.27 ? 290 TYR A CG  1 
ATOM   781  C  CD1 . TYR A 1 111 ? -15.825 50.635 24.299 1.00 22.49 ? 290 TYR A CD1 1 
ATOM   782  C  CD2 . TYR A 1 111 ? -15.619 48.266 24.513 1.00 25.01 ? 290 TYR A CD2 1 
ATOM   783  C  CE1 . TYR A 1 111 ? -15.137 50.802 25.478 1.00 24.24 ? 290 TYR A CE1 1 
ATOM   784  C  CE2 . TYR A 1 111 ? -14.937 48.424 25.693 1.00 25.28 ? 290 TYR A CE2 1 
ATOM   785  C  CZ  . TYR A 1 111 ? -14.692 49.690 26.170 1.00 24.79 ? 290 TYR A CZ  1 
ATOM   786  O  OH  . TYR A 1 111 ? -13.961 49.833 27.318 1.00 25.49 ? 290 TYR A OH  1 
ATOM   787  N  N   . LYS A 1 112 ? -18.076 50.590 20.012 1.00 22.34 ? 291 LYS A N   1 
ATOM   788  C  CA  . LYS A 1 112 ? -18.304 50.553 18.578 1.00 23.12 ? 291 LYS A CA  1 
ATOM   789  C  C   . LYS A 1 112 ? -16.918 50.754 17.989 1.00 22.65 ? 291 LYS A C   1 
ATOM   790  O  O   . LYS A 1 112 ? -16.416 51.878 17.931 1.00 22.35 ? 291 LYS A O   1 
ATOM   791  C  CB  . LYS A 1 112 ? -19.235 51.680 18.130 1.00 25.07 ? 291 LYS A CB  1 
ATOM   792  C  CG  . LYS A 1 112 ? -20.662 51.485 18.581 1.00 29.13 ? 291 LYS A CG  1 
ATOM   793  C  CD  . LYS A 1 112 ? -21.266 50.232 17.975 1.00 32.67 ? 291 LYS A CD  1 
ATOM   794  C  CE  . LYS A 1 112 ? -22.571 49.868 18.663 1.00 35.92 ? 291 LYS A CE  1 
ATOM   795  N  NZ  . LYS A 1 112 ? -23.531 51.022 18.670 1.00 38.81 ? 291 LYS A NZ  1 
ATOM   796  N  N   . ILE A 1 113 ? -16.293 49.658 17.574 1.00 22.57 ? 292 ILE A N   1 
ATOM   797  C  CA  . ILE A 1 113 ? -14.943 49.717 17.018 1.00 22.75 ? 292 ILE A CA  1 
ATOM   798  C  C   . ILE A 1 113 ? -14.901 50.212 15.574 1.00 25.31 ? 292 ILE A C   1 
ATOM   799  O  O   . ILE A 1 113 ? -15.611 49.690 14.716 1.00 27.78 ? 292 ILE A O   1 
ATOM   800  C  CB  . ILE A 1 113 ? -14.271 48.332 17.130 1.00 23.61 ? 292 ILE A CB  1 
ATOM   801  C  CG1 . ILE A 1 113 ? -14.104 47.988 18.610 1.00 24.12 ? 292 ILE A CG1 1 
ATOM   802  C  CG2 . ILE A 1 113 ? -12.918 48.332 16.424 1.00 21.76 ? 292 ILE A CG2 1 
ATOM   803  C  CD1 . ILE A 1 113 ? -13.475 46.639 18.871 1.00 26.60 ? 292 ILE A CD1 1 
ATOM   804  N  N   . ASN A 1 114 ? -14.071 51.214 15.302 1.00 23.65 ? 293 ASN A N   1 
ATOM   805  C  CA  . ASN A 1 114 ? -13.991 51.767 13.949 1.00 25.33 ? 293 ASN A CA  1 
ATOM   806  C  C   . ASN A 1 114 ? -12.575 51.887 13.415 1.00 25.64 ? 293 ASN A C   1 
ATOM   807  O  O   . ASN A 1 114 ? -12.327 52.556 12.411 1.00 26.28 ? 293 ASN A O   1 
ATOM   808  C  CB  . ASN A 1 114 ? -14.689 53.138 13.903 1.00 27.77 ? 293 ASN A CB  1 
ATOM   809  C  CG  . ASN A 1 114 ? -13.956 54.204 14.700 1.00 30.34 ? 293 ASN A CG  1 
ATOM   810  O  OD1 . ASN A 1 114 ? -13.081 53.907 15.509 1.00 30.53 ? 293 ASN A OD1 1 
ATOM   811  N  ND2 . ASN A 1 114 ? -14.329 55.469 14.480 1.00 32.21 ? 293 ASN A ND2 1 
ATOM   812  N  N   . GLY A 1 115 ? -11.632 51.230 14.074 1.00 23.85 ? 294 GLY A N   1 
ATOM   813  C  CA  . GLY A 1 115 ? -10.273 51.315 13.594 1.00 21.99 ? 294 GLY A CA  1 
ATOM   814  C  C   . GLY A 1 115 ? -9.315  50.620 14.529 1.00 21.31 ? 294 GLY A C   1 
ATOM   815  O  O   . GLY A 1 115 ? -9.713  50.116 15.568 1.00 20.08 ? 294 GLY A O   1 
ATOM   816  N  N   . ARG A 1 116 ? -8.047  50.601 14.146 1.00 21.18 ? 295 ARG A N   1 
ATOM   817  C  CA  . ARG A 1 116 ? -7.024  49.954 14.960 1.00 21.40 ? 295 ARG A CA  1 
ATOM   818  C  C   . ARG A 1 116 ? -5.659  50.544 14.653 1.00 21.81 ? 295 ARG A C   1 
ATOM   819  O  O   . ARG A 1 116 ? -5.498  51.345 13.736 1.00 20.39 ? 295 ARG A O   1 
ATOM   820  C  CB  . ARG A 1 116 ? -6.999  48.445 14.682 1.00 22.86 ? 295 ARG A CB  1 
ATOM   821  C  CG  . ARG A 1 116 ? -6.625  48.089 13.250 1.00 24.74 ? 295 ARG A CG  1 
ATOM   822  C  CD  . ARG A 1 116 ? -6.014  46.694 13.166 1.00 27.04 ? 295 ARG A CD  1 
ATOM   823  N  NE  . ARG A 1 116 ? -5.920  46.246 11.781 1.00 28.34 ? 295 ARG A NE  1 
ATOM   824  C  CZ  . ARG A 1 116 ? -5.004  46.662 10.907 1.00 28.69 ? 295 ARG A CZ  1 
ATOM   825  N  NH1 . ARG A 1 116 ? -4.066  47.544 11.257 1.00 25.74 ? 295 ARG A NH1 1 
ATOM   826  N  NH2 . ARG A 1 116 ? -5.042  46.204 9.663  1.00 28.75 ? 295 ARG A NH2 1 
ATOM   827  N  N   . THR A 1 117 ? -4.673  50.140 15.444 1.00 20.13 ? 296 THR A N   1 
ATOM   828  C  CA  . THR A 1 117 ? -3.303  50.590 15.254 1.00 19.38 ? 296 THR A CA  1 
ATOM   829  C  C   . THR A 1 117 ? -2.660  49.652 14.256 1.00 17.95 ? 296 THR A C   1 
ATOM   830  O  O   . THR A 1 117 ? -3.277  48.674 13.818 1.00 19.91 ? 296 THR A O   1 
ATOM   831  C  CB  . THR A 1 117 ? -2.490  50.440 16.561 1.00 17.42 ? 296 THR A CB  1 
ATOM   832  O  OG1 . THR A 1 117 ? -2.507  49.061 16.967 1.00 17.60 ? 296 THR A OG1 1 
ATOM   833  C  CG2 . THR A 1 117 ? -3.097  51.273 17.665 1.00 18.44 ? 296 THR A CG2 1 
ATOM   834  N  N   . LYS A 1 118 ? -1.418  49.957 13.898 1.00 20.62 ? 297 LYS A N   1 
ATOM   835  C  CA  . LYS A 1 118 ? -0.635  49.064 13.054 1.00 20.21 ? 297 LYS A CA  1 
ATOM   836  C  C   . LYS A 1 118 ? -0.250  47.963 14.037 1.00 20.32 ? 297 LYS A C   1 
ATOM   837  O  O   . LYS A 1 118 ? -0.576  48.068 15.221 1.00 21.24 ? 297 LYS A O   1 
ATOM   838  C  CB  . LYS A 1 118 ? 0.625   49.763 12.538 1.00 24.04 ? 297 LYS A CB  1 
ATOM   839  C  CG  . LYS A 1 118 ? 0.318   50.833 11.497 1.00 28.77 ? 297 LYS A CG  1 
ATOM   840  C  CD  . LYS A 1 118 ? 1.567   51.528 11.004 1.00 34.27 ? 297 LYS A CD  1 
ATOM   841  C  CE  . LYS A 1 118 ? 1.190   52.669 10.062 1.00 36.73 ? 297 LYS A CE  1 
ATOM   842  N  NZ  . LYS A 1 118 ? 2.392   53.376 9.561  1.00 40.70 ? 297 LYS A NZ  1 
ATOM   843  N  N   . ALA A 1 119 ? 0.416   46.914 13.566 1.00 18.49 ? 298 ALA A N   1 
ATOM   844  C  CA  . ALA A 1 119 ? 0.811   45.831 14.474 1.00 17.71 ? 298 ALA A CA  1 
ATOM   845  C  C   . ALA A 1 119 ? 2.121   46.152 15.168 1.00 18.39 ? 298 ALA A C   1 
ATOM   846  O  O   . ALA A 1 119 ? 3.066   46.660 14.554 1.00 18.46 ? 298 ALA A O   1 
ATOM   847  C  CB  . ALA A 1 119 ? 0.945   44.518 13.721 1.00 17.13 ? 298 ALA A CB  1 
ATOM   848  N  N   . MET A 1 120 ? 2.178   45.881 16.472 1.00 16.29 ? 299 MET A N   1 
ATOM   849  C  CA  . MET A 1 120 ? 3.420   46.111 17.187 1.00 15.82 ? 299 MET A CA  1 
ATOM   850  C  C   . MET A 1 120 ? 4.010   44.724 17.432 1.00 16.27 ? 299 MET A C   1 
ATOM   851  O  O   . MET A 1 120 ? 3.440   43.932 18.164 1.00 16.24 ? 299 MET A O   1 
ATOM   852  C  CB  . MET A 1 120 ? 3.173   46.805 18.540 1.00 16.55 ? 299 MET A CB  1 
ATOM   853  C  CG  . MET A 1 120 ? 4.473   47.141 19.225 1.00 18.97 ? 299 MET A CG  1 
ATOM   854  S  SD  . MET A 1 120 ? 4.222   47.738 20.898 1.00 22.39 ? 299 MET A SD  1 
ATOM   855  C  CE  . MET A 1 120 ? 3.743   46.223 21.695 1.00 19.12 ? 299 MET A CE  1 
ATOM   856  N  N   . VAL A 1 121 ? 5.118   44.410 16.767 1.00 15.63 ? 300 VAL A N   1 
ATOM   857  C  CA  . VAL A 1 121 ? 5.766   43.119 16.971 1.00 16.28 ? 300 VAL A CA  1 
ATOM   858  C  C   . VAL A 1 121 ? 6.777   43.344 18.095 1.00 14.49 ? 300 VAL A C   1 
ATOM   859  O  O   . VAL A 1 121 ? 7.587   44.266 18.022 1.00 14.31 ? 300 VAL A O   1 
ATOM   860  C  CB  . VAL A 1 121 ? 6.492   42.668 15.691 1.00 17.85 ? 300 VAL A CB  1 
ATOM   861  C  CG1 . VAL A 1 121 ? 7.116   41.288 15.905 1.00 18.58 ? 300 VAL A CG1 1 
ATOM   862  C  CG2 . VAL A 1 121 ? 5.504   42.630 14.527 1.00 20.40 ? 300 VAL A CG2 1 
ATOM   863  N  N   . ALA A 1 122 ? 6.697   42.532 19.144 1.00 15.35 ? 301 ALA A N   1 
ATOM   864  C  CA  . ALA A 1 122 ? 7.603   42.690 20.286 1.00 16.24 ? 301 ALA A CA  1 
ATOM   865  C  C   . ALA A 1 122 ? 8.458   41.459 20.455 1.00 17.01 ? 301 ALA A C   1 
ATOM   866  O  O   . ALA A 1 122 ? 8.017   40.346 20.200 1.00 17.57 ? 301 ALA A O   1 
ATOM   867  C  CB  . ALA A 1 122 ? 6.816   42.908 21.566 1.00 16.21 ? 301 ALA A CB  1 
ATOM   868  N  N   . CYS A 1 123 ? 9.688   41.672 20.893 1.00 15.64 ? 302 CYS A N   1 
ATOM   869  C  CA  . CYS A 1 123 ? 10.595  40.567 21.136 1.00 18.47 ? 302 CYS A CA  1 
ATOM   870  C  C   . CYS A 1 123 ? 11.283  40.781 22.472 1.00 17.18 ? 302 CYS A C   1 
ATOM   871  O  O   . CYS A 1 123 ? 12.001  41.772 22.644 1.00 19.71 ? 302 CYS A O   1 
ATOM   872  C  CB  . CYS A 1 123 ? 11.658  40.499 20.047 1.00 18.17 ? 302 CYS A CB  1 
ATOM   873  S  SG  . CYS A 1 123 ? 13.060  39.384 20.460 1.00 24.42 ? 302 CYS A SG  1 
ATOM   874  N  N   . TYR A 1 124 ? 11.029  39.891 23.431 1.00 17.88 ? 303 TYR A N   1 
ATOM   875  C  CA  . TYR A 1 124 ? 11.731  39.955 24.716 1.00 19.07 ? 303 TYR A CA  1 
ATOM   876  C  C   . TYR A 1 124 ? 12.921  39.046 24.394 1.00 20.56 ? 303 TYR A C   1 
ATOM   877  O  O   . TYR A 1 124 ? 12.748  37.867 24.114 1.00 19.98 ? 303 TYR A O   1 
ATOM   878  C  CB  . TYR A 1 124 ? 10.847  39.402 25.838 1.00 18.02 ? 303 TYR A CB  1 
ATOM   879  C  CG  . TYR A 1 124 ? 9.724   40.340 26.213 1.00 20.34 ? 303 TYR A CG  1 
ATOM   880  C  CD1 . TYR A 1 124 ? 8.592   40.469 25.415 1.00 20.16 ? 303 TYR A CD1 1 
ATOM   881  C  CD2 . TYR A 1 124 ? 9.822   41.150 27.341 1.00 18.02 ? 303 TYR A CD2 1 
ATOM   882  C  CE1 . TYR A 1 124 ? 7.593   41.387 25.734 1.00 20.28 ? 303 TYR A CE1 1 
ATOM   883  C  CE2 . TYR A 1 124 ? 8.830   42.064 27.659 1.00 20.64 ? 303 TYR A CE2 1 
ATOM   884  C  CZ  . TYR A 1 124 ? 7.727   42.182 26.857 1.00 21.29 ? 303 TYR A CZ  1 
ATOM   885  O  OH  . TYR A 1 124 ? 6.767   43.121 27.156 1.00 20.60 ? 303 TYR A OH  1 
ATOM   886  N  N   . PRO A 1 125 ? 14.144  39.596 24.441 1.00 22.06 ? 304 PRO A N   1 
ATOM   887  C  CA  . PRO A 1 125 ? 15.399  38.908 24.130 1.00 23.11 ? 304 PRO A CA  1 
ATOM   888  C  C   . PRO A 1 125 ? 15.812  37.684 24.935 1.00 24.32 ? 304 PRO A C   1 
ATOM   889  O  O   . PRO A 1 125 ? 16.685  36.934 24.500 1.00 28.10 ? 304 PRO A O   1 
ATOM   890  C  CB  . PRO A 1 125 ? 16.422  40.043 24.172 1.00 23.14 ? 304 PRO A CB  1 
ATOM   891  C  CG  . PRO A 1 125 ? 15.905  40.907 25.255 1.00 23.88 ? 304 PRO A CG  1 
ATOM   892  C  CD  . PRO A 1 125 ? 14.403  40.943 24.991 1.00 21.77 ? 304 PRO A CD  1 
ATOM   893  N  N   . GLY A 1 126 ? 15.198  37.480 26.092 1.00 23.50 ? 305 GLY A N   1 
ATOM   894  C  CA  . GLY A 1 126 ? 15.536  36.306 26.886 1.00 23.48 ? 305 GLY A CA  1 
ATOM   895  C  C   . GLY A 1 126 ? 16.676  36.549 27.857 1.00 24.73 ? 305 GLY A C   1 
ATOM   896  O  O   . GLY A 1 126 ? 17.341  35.598 28.287 1.00 24.72 ? 305 GLY A O   1 
ATOM   897  N  N   . ASN A 1 127 ? 16.883  37.817 28.206 1.00 22.40 ? 306 ASN A N   1 
ATOM   898  C  CA  . ASN A 1 127 ? 17.939  38.216 29.135 1.00 22.77 ? 306 ASN A CA  1 
ATOM   899  C  C   . ASN A 1 127 ? 17.378  38.515 30.519 1.00 23.08 ? 306 ASN A C   1 
ATOM   900  O  O   . ASN A 1 127 ? 17.946  39.299 31.285 1.00 24.37 ? 306 ASN A O   1 
ATOM   901  C  CB  . ASN A 1 127 ? 18.675  39.447 28.608 1.00 23.31 ? 306 ASN A CB  1 
ATOM   902  C  CG  . ASN A 1 127 ? 17.785  40.668 28.546 1.00 23.77 ? 306 ASN A CG  1 
ATOM   903  O  OD1 . ASN A 1 127 ? 16.556  40.550 28.554 1.00 23.46 ? 306 ASN A OD1 1 
ATOM   904  N  ND2 . ASN A 1 127 ? 18.399  41.854 28.471 1.00 24.02 ? 306 ASN A ND2 1 
ATOM   905  N  N   . GLY A 1 128 ? 16.260  37.885 30.849 1.00 20.82 ? 307 GLY A N   1 
ATOM   906  C  CA  . GLY A 1 128 ? 15.670  38.087 32.158 1.00 22.60 ? 307 GLY A CA  1 
ATOM   907  C  C   . GLY A 1 128 ? 14.829  39.330 32.333 1.00 22.66 ? 307 GLY A C   1 
ATOM   908  O  O   . GLY A 1 128 ? 14.430  39.649 33.446 1.00 23.57 ? 307 GLY A O   1 
ATOM   909  N  N   . THR A 1 129 ? 14.569  40.048 31.245 1.00 22.60 ? 308 THR A N   1 
ATOM   910  C  CA  . THR A 1 129 ? 13.736  41.244 31.338 1.00 21.42 ? 308 THR A CA  1 
ATOM   911  C  C   . THR A 1 129 ? 12.275  40.857 31.060 1.00 19.96 ? 308 THR A C   1 
ATOM   912  O  O   . THR A 1 129 ? 12.005  39.860 30.402 1.00 21.40 ? 308 THR A O   1 
ATOM   913  C  CB  . THR A 1 129 ? 14.163  42.318 30.309 1.00 20.57 ? 308 THR A CB  1 
ATOM   914  O  OG1 . THR A 1 129 ? 14.268  41.721 29.013 1.00 20.56 ? 308 THR A OG1 1 
ATOM   915  C  CG2 . THR A 1 129 ? 15.519  42.916 30.697 1.00 21.44 ? 308 THR A CG2 1 
ATOM   916  N  N   . GLY A 1 130 ? 11.356  41.646 31.593 1.00 20.15 ? 309 GLY A N   1 
ATOM   917  C  CA  . GLY A 1 130 ? 9.934   41.409 31.386 1.00 19.36 ? 309 GLY A CA  1 
ATOM   918  C  C   . GLY A 1 130 ? 9.355   42.780 31.108 1.00 17.31 ? 309 GLY A C   1 
ATOM   919  O  O   . GLY A 1 130 ? 10.023  43.608 30.477 1.00 19.92 ? 309 GLY A O   1 
ATOM   920  N  N   . TYR A 1 131 ? 8.136   43.021 31.567 1.00 15.99 ? 310 TYR A N   1 
ATOM   921  C  CA  . TYR A 1 131 ? 7.494   44.316 31.401 1.00 18.54 ? 310 TYR A CA  1 
ATOM   922  C  C   . TYR A 1 131 ? 6.742   44.582 32.692 1.00 17.55 ? 310 TYR A C   1 
ATOM   923  O  O   . TYR A 1 131 ? 5.940   43.764 33.121 1.00 17.72 ? 310 TYR A O   1 
ATOM   924  C  CB  . TYR A 1 131 ? 6.529   44.288 30.204 1.00 17.14 ? 310 TYR A CB  1 
ATOM   925  C  CG  . TYR A 1 131 ? 6.199   45.667 29.663 1.00 17.50 ? 310 TYR A CG  1 
ATOM   926  C  CD1 . TYR A 1 131 ? 5.288   46.496 30.307 1.00 19.06 ? 310 TYR A CD1 1 
ATOM   927  C  CD2 . TYR A 1 131 ? 6.846   46.156 28.541 1.00 19.59 ? 310 TYR A CD2 1 
ATOM   928  C  CE1 . TYR A 1 131 ? 5.033   47.780 29.843 1.00 19.89 ? 310 TYR A CE1 1 
ATOM   929  C  CE2 . TYR A 1 131 ? 6.602   47.427 28.073 1.00 18.96 ? 310 TYR A CE2 1 
ATOM   930  C  CZ  . TYR A 1 131 ? 5.697   48.239 28.723 1.00 21.53 ? 310 TYR A CZ  1 
ATOM   931  O  OH  . TYR A 1 131 ? 5.475   49.525 28.261 1.00 24.34 ? 310 TYR A OH  1 
ATOM   932  N  N   . VAL A 1 132 ? 7.016   45.728 33.310 1.00 21.12 ? 311 VAL A N   1 
ATOM   933  C  CA  . VAL A 1 132 ? 6.388   46.078 34.577 1.00 22.27 ? 311 VAL A CA  1 
ATOM   934  C  C   . VAL A 1 132 ? 4.869   46.146 34.539 1.00 22.96 ? 311 VAL A C   1 
ATOM   935  O  O   . VAL A 1 132 ? 4.265   46.302 33.488 1.00 21.43 ? 311 VAL A O   1 
ATOM   936  C  CB  . VAL A 1 132 ? 6.927   47.426 35.102 1.00 23.26 ? 311 VAL A CB  1 
ATOM   937  C  CG1 . VAL A 1 132 ? 8.430   47.355 35.214 1.00 23.82 ? 311 VAL A CG1 1 
ATOM   938  C  CG2 . VAL A 1 132 ? 6.505   48.571 34.185 1.00 23.46 ? 311 VAL A CG2 1 
ATOM   939  N  N   . ARG A 1 133 ? 4.251   46.013 35.706 1.00 21.14 ? 312 ARG A N   1 
ATOM   940  C  CA  . ARG A 1 133 ? 2.798   46.087 35.784 1.00 22.46 ? 312 ARG A CA  1 
ATOM   941  C  C   . ARG A 1 133 ? 2.327   47.416 35.168 1.00 22.14 ? 312 ARG A C   1 
ATOM   942  O  O   . ARG A 1 133 ? 2.884   48.479 35.461 1.00 23.56 ? 312 ARG A O   1 
ATOM   943  C  CB  . ARG A 1 133 ? 2.374   45.990 37.253 1.00 24.16 ? 312 ARG A CB  1 
ATOM   944  C  CG  . ARG A 1 133 ? 0.884   45.989 37.476 1.00 27.33 ? 312 ARG A CG  1 
ATOM   945  C  CD  . ARG A 1 133 ? 0.555   46.156 38.961 1.00 30.75 ? 312 ARG A CD  1 
ATOM   946  N  NE  . ARG A 1 133 ? -0.884  46.097 39.198 1.00 32.84 ? 312 ARG A NE  1 
ATOM   947  C  CZ  . ARG A 1 133 ? -1.511  45.090 39.799 1.00 32.90 ? 312 ARG A CZ  1 
ATOM   948  N  NH1 . ARG A 1 133 ? -0.833  44.037 40.237 1.00 33.94 ? 312 ARG A NH1 1 
ATOM   949  N  NH2 . ARG A 1 133 ? -2.825  45.135 39.953 1.00 35.47 ? 312 ARG A NH2 1 
ATOM   950  N  N   . HIS A 1 134 ? 1.314   47.361 34.307 1.00 19.76 ? 313 HIS A N   1 
ATOM   951  C  CA  . HIS A 1 134 ? 0.817   48.574 33.659 1.00 18.78 ? 313 HIS A CA  1 
ATOM   952  C  C   . HIS A 1 134 ? -0.595  48.372 33.125 1.00 17.47 ? 313 HIS A C   1 
ATOM   953  O  O   . HIS A 1 134 ? -1.111  47.263 33.128 1.00 18.17 ? 313 HIS A O   1 
ATOM   954  C  CB  . HIS A 1 134 ? 1.713   48.933 32.473 1.00 17.85 ? 313 HIS A CB  1 
ATOM   955  C  CG  . HIS A 1 134 ? 1.666   47.925 31.365 1.00 16.99 ? 313 HIS A CG  1 
ATOM   956  N  ND1 . HIS A 1 134 ? 2.249   46.682 31.463 1.00 17.10 ? 313 HIS A ND1 1 
ATOM   957  C  CD2 . HIS A 1 134 ? 1.043   47.953 30.164 1.00 17.56 ? 313 HIS A CD2 1 
ATOM   958  C  CE1 . HIS A 1 134 ? 1.982   45.982 30.374 1.00 18.04 ? 313 HIS A CE1 1 
ATOM   959  N  NE2 . HIS A 1 134 ? 1.252   46.733 29.569 1.00 15.92 ? 313 HIS A NE2 1 
ATOM   960  N  N   . VAL A 1 135 ? -1.213  49.469 32.694 1.00 18.73 ? 314 VAL A N   1 
ATOM   961  C  CA  . VAL A 1 135 ? -2.534  49.412 32.063 1.00 18.45 ? 314 VAL A CA  1 
ATOM   962  C  C   . VAL A 1 135 ? -2.233  49.971 30.670 1.00 18.29 ? 314 VAL A C   1 
ATOM   963  O  O   . VAL A 1 135 ? -1.578  51.006 30.537 1.00 18.19 ? 314 VAL A O   1 
ATOM   964  C  CB  . VAL A 1 135 ? -3.559  50.322 32.781 1.00 20.40 ? 314 VAL A CB  1 
ATOM   965  C  CG1 . VAL A 1 135 ? -4.768  50.587 31.863 1.00 18.07 ? 314 VAL A CG1 1 
ATOM   966  C  CG2 . VAL A 1 135 ? -4.030  49.664 34.047 1.00 21.40 ? 314 VAL A CG2 1 
ATOM   967  N  N   . ASP A 1 136 ? -2.683  49.283 29.624 1.00 17.48 ? 315 ASP A N   1 
ATOM   968  C  CA  . ASP A 1 136 ? -2.405  49.755 28.279 1.00 18.19 ? 315 ASP A CA  1 
ATOM   969  C  C   . ASP A 1 136 ? -2.961  51.163 28.027 1.00 19.23 ? 315 ASP A C   1 
ATOM   970  O  O   . ASP A 1 136 ? -2.246  52.036 27.542 1.00 19.69 ? 315 ASP A O   1 
ATOM   971  C  CB  . ASP A 1 136 ? -2.991  48.781 27.246 1.00 17.83 ? 315 ASP A CB  1 
ATOM   972  C  CG  . ASP A 1 136 ? -2.129  47.539 27.045 1.00 18.97 ? 315 ASP A CG  1 
ATOM   973  O  OD1 . ASP A 1 136 ? -1.035  47.419 27.659 1.00 18.41 ? 315 ASP A OD1 1 
ATOM   974  O  OD2 . ASP A 1 136 ? -2.553  46.668 26.260 1.00 15.39 ? 315 ASP A OD2 1 
ATOM   975  N  N   . ASN A 1 137 ? -4.224  51.388 28.374 1.00 17.45 ? 316 ASN A N   1 
ATOM   976  C  CA  . ASN A 1 137 ? -4.861  52.695 28.154 1.00 18.39 ? 316 ASN A CA  1 
ATOM   977  C  C   . ASN A 1 137 ? -5.527  53.178 29.428 1.00 20.44 ? 316 ASN A C   1 
ATOM   978  O  O   . ASN A 1 137 ? -6.703  52.937 29.665 1.00 23.31 ? 316 ASN A O   1 
ATOM   979  C  CB  . ASN A 1 137 ? -5.910  52.581 27.039 1.00 16.55 ? 316 ASN A CB  1 
ATOM   980  C  CG  . ASN A 1 137 ? -6.733  53.844 26.871 1.00 17.99 ? 316 ASN A CG  1 
ATOM   981  O  OD1 . ASN A 1 137 ? -6.291  54.948 27.213 1.00 19.88 ? 316 ASN A OD1 1 
ATOM   982  N  ND2 . ASN A 1 137 ? -7.946  53.689 26.344 1.00 18.44 ? 316 ASN A ND2 1 
ATOM   983  N  N   . PRO A 1 138 ? -4.767  53.863 30.279 1.00 22.45 ? 317 PRO A N   1 
ATOM   984  C  CA  . PRO A 1 138 ? -5.351  54.349 31.527 1.00 25.11 ? 317 PRO A CA  1 
ATOM   985  C  C   . PRO A 1 138 ? -5.942  55.752 31.443 1.00 26.85 ? 317 PRO A C   1 
ATOM   986  O  O   . PRO A 1 138 ? -6.712  56.155 32.319 1.00 30.90 ? 317 PRO A O   1 
ATOM   987  C  CB  . PRO A 1 138 ? -4.167  54.289 32.487 1.00 25.40 ? 317 PRO A CB  1 
ATOM   988  C  CG  . PRO A 1 138 ? -3.038  54.735 31.613 1.00 23.46 ? 317 PRO A CG  1 
ATOM   989  C  CD  . PRO A 1 138 ? -3.296  53.933 30.318 1.00 24.11 ? 317 PRO A CD  1 
ATOM   990  N  N   . ASN A 1 139 ? -5.614  56.484 30.385 1.00 27.19 ? 318 ASN A N   1 
ATOM   991  C  CA  . ASN A 1 139 ? -6.084  57.862 30.255 1.00 29.96 ? 318 ASN A CA  1 
ATOM   992  C  C   . ASN A 1 139 ? -7.106  58.176 29.164 1.00 28.62 ? 318 ASN A C   1 
ATOM   993  O  O   . ASN A 1 139 ? -7.271  59.339 28.803 1.00 30.95 ? 318 ASN A O   1 
ATOM   994  C  CB  . ASN A 1 139 ? -4.884  58.797 30.083 1.00 31.74 ? 318 ASN A CB  1 
ATOM   995  C  CG  . ASN A 1 139 ? -3.839  58.610 31.162 1.00 34.93 ? 318 ASN A CG  1 
ATOM   996  O  OD1 . ASN A 1 139 ? -4.168  58.486 32.342 1.00 37.76 ? 318 ASN A OD1 1 
ATOM   997  N  ND2 . ASN A 1 139 ? -2.572  58.592 30.764 1.00 36.25 ? 318 ASN A ND2 1 
ATOM   998  N  N   . GLY A 1 140 ? -7.788  57.166 28.636 1.00 26.50 ? 319 GLY A N   1 
ATOM   999  C  CA  . GLY A 1 140 ? -8.794  57.413 27.611 1.00 25.56 ? 319 GLY A CA  1 
ATOM   1000 C  C   . GLY A 1 140 ? -8.276  57.835 26.247 1.00 23.34 ? 319 GLY A C   1 
ATOM   1001 O  O   . GLY A 1 140 ? -8.774  58.798 25.662 1.00 24.08 ? 319 GLY A O   1 
ATOM   1002 N  N   . ASP A 1 141 ? -7.301  57.108 25.714 1.00 21.61 ? 320 ASP A N   1 
ATOM   1003 C  CA  . ASP A 1 141 ? -6.735  57.469 24.424 1.00 20.26 ? 320 ASP A CA  1 
ATOM   1004 C  C   . ASP A 1 141 ? -7.464  56.876 23.228 1.00 19.61 ? 320 ASP A C   1 
ATOM   1005 O  O   . ASP A 1 141 ? -7.053  57.079 22.084 1.00 22.00 ? 320 ASP A O   1 
ATOM   1006 C  CB  . ASP A 1 141 ? -5.234  57.121 24.378 1.00 23.28 ? 320 ASP A CB  1 
ATOM   1007 C  CG  . ASP A 1 141 ? -4.954  55.622 24.409 1.00 25.56 ? 320 ASP A CG  1 
ATOM   1008 O  OD1 . ASP A 1 141 ? -3.806  55.262 24.749 1.00 27.16 ? 320 ASP A OD1 1 
ATOM   1009 O  OD2 . ASP A 1 141 ? -5.843  54.808 24.089 1.00 22.85 ? 320 ASP A OD2 1 
ATOM   1010 N  N   . GLY A 1 142 ? -8.550  56.158 23.493 1.00 19.63 ? 321 GLY A N   1 
ATOM   1011 C  CA  . GLY A 1 142 ? -9.317  55.562 22.412 1.00 18.39 ? 321 GLY A CA  1 
ATOM   1012 C  C   . GLY A 1 142 ? -9.269  54.043 22.328 1.00 18.13 ? 321 GLY A C   1 
ATOM   1013 O  O   . GLY A 1 142 ? -10.206 53.400 21.866 1.00 18.44 ? 321 GLY A O   1 
ATOM   1014 N  N   . ARG A 1 143 ? -8.192  53.442 22.815 1.00 16.22 ? 322 ARG A N   1 
ATOM   1015 C  CA  . ARG A 1 143 ? -8.075  51.990 22.713 1.00 15.11 ? 322 ARG A CA  1 
ATOM   1016 C  C   . ARG A 1 143 ? -8.978  51.233 23.680 1.00 17.49 ? 322 ARG A C   1 
ATOM   1017 O  O   . ARG A 1 143 ? -8.934  51.461 24.885 1.00 19.75 ? 322 ARG A O   1 
ATOM   1018 C  CB  . ARG A 1 143 ? -6.608  51.599 22.927 1.00 18.25 ? 322 ARG A CB  1 
ATOM   1019 C  CG  . ARG A 1 143 ? -5.712  52.141 21.848 1.00 19.51 ? 322 ARG A CG  1 
ATOM   1020 C  CD  . ARG A 1 143 ? -4.255  51.770 22.112 1.00 22.65 ? 322 ARG A CD  1 
ATOM   1021 N  NE  . ARG A 1 143 ? -3.715  52.564 23.207 1.00 22.64 ? 322 ARG A NE  1 
ATOM   1022 C  CZ  . ARG A 1 143 ? -2.637  52.229 23.909 1.00 26.63 ? 322 ARG A CZ  1 
ATOM   1023 N  NH1 . ARG A 1 143 ? -1.985  51.108 23.635 1.00 25.82 ? 322 ARG A NH1 1 
ATOM   1024 N  NH2 . ARG A 1 143 ? -2.203  53.025 24.879 1.00 26.46 ? 322 ARG A NH2 1 
ATOM   1025 N  N   . CYS A 1 144 ? -9.819  50.340 23.153 1.00 17.91 ? 323 CYS A N   1 
ATOM   1026 C  CA  . CYS A 1 144 ? -10.707 49.595 24.031 1.00 18.28 ? 323 CYS A CA  1 
ATOM   1027 C  C   . CYS A 1 144 ? -10.386 48.112 24.120 1.00 17.97 ? 323 CYS A C   1 
ATOM   1028 O  O   . CYS A 1 144 ? -10.684 47.497 25.126 1.00 17.94 ? 323 CYS A O   1 
ATOM   1029 C  CB  . CYS A 1 144 ? -12.174 49.787 23.625 1.00 20.91 ? 323 CYS A CB  1 
ATOM   1030 S  SG  . CYS A 1 144 ? -12.603 49.181 21.998 1.00 22.61 ? 323 CYS A SG  1 
ATOM   1031 N  N   . VAL A 1 145 ? -9.789  47.544 23.073 1.00 16.95 ? 324 VAL A N   1 
ATOM   1032 C  CA  . VAL A 1 145 ? -9.441  46.117 23.085 1.00 16.39 ? 324 VAL A CA  1 
ATOM   1033 C  C   . VAL A 1 145 ? -8.009  45.862 22.649 1.00 15.26 ? 324 VAL A C   1 
ATOM   1034 O  O   . VAL A 1 145 ? -7.566  46.365 21.616 1.00 16.84 ? 324 VAL A O   1 
ATOM   1035 C  CB  . VAL A 1 145 ? -10.355 45.284 22.135 1.00 15.10 ? 324 VAL A CB  1 
ATOM   1036 C  CG1 . VAL A 1 145 ? -9.899  43.825 22.117 1.00 19.42 ? 324 VAL A CG1 1 
ATOM   1037 C  CG2 . VAL A 1 145 ? -11.808 45.350 22.606 1.00 16.95 ? 324 VAL A CG2 1 
ATOM   1038 N  N   . THR A 1 146 ? -7.292  45.081 23.456 1.00 15.28 ? 325 THR A N   1 
ATOM   1039 C  CA  . THR A 1 146 ? -5.922  44.682 23.139 1.00 14.21 ? 325 THR A CA  1 
ATOM   1040 C  C   . THR A 1 146 ? -5.986  43.261 22.577 1.00 14.34 ? 325 THR A C   1 
ATOM   1041 O  O   . THR A 1 146 ? -6.599  42.376 23.175 1.00 16.66 ? 325 THR A O   1 
ATOM   1042 C  CB  . THR A 1 146 ? -5.029  44.652 24.399 1.00 12.21 ? 325 THR A CB  1 
ATOM   1043 O  OG1 . THR A 1 146 ? -5.007  45.957 24.990 1.00 12.62 ? 325 THR A OG1 1 
ATOM   1044 C  CG2 . THR A 1 146 ? -3.571  44.237 24.031 1.00 14.18 ? 325 THR A CG2 1 
ATOM   1045 N  N   . CYS A 1 147 ? -5.344  43.056 21.432 1.00 13.40 ? 326 CYS A N   1 
ATOM   1046 C  CA  . CYS A 1 147 ? -5.315  41.738 20.788 1.00 15.49 ? 326 CYS A CA  1 
ATOM   1047 C  C   . CYS A 1 147 ? -3.853  41.315 20.610 1.00 14.23 ? 326 CYS A C   1 
ATOM   1048 O  O   . CYS A 1 147 ? -3.077  42.008 19.969 1.00 16.26 ? 326 CYS A O   1 
ATOM   1049 C  CB  . CYS A 1 147 ? -6.006  41.830 19.430 1.00 17.39 ? 326 CYS A CB  1 
ATOM   1050 S  SG  . CYS A 1 147 ? -6.010  40.277 18.486 1.00 22.31 ? 326 CYS A SG  1 
ATOM   1051 N  N   . ILE A 1 148 ? -3.471  40.189 21.202 1.00 13.87 ? 327 ILE A N   1 
ATOM   1052 C  CA  . ILE A 1 148 ? -2.101  39.707 21.084 1.00 13.67 ? 327 ILE A CA  1 
ATOM   1053 C  C   . ILE A 1 148 ? -2.045  38.291 20.493 1.00 13.24 ? 327 ILE A C   1 
ATOM   1054 O  O   . ILE A 1 148 ? -2.795  37.406 20.917 1.00 15.40 ? 327 ILE A O   1 
ATOM   1055 C  CB  . ILE A 1 148 ? -1.393  39.677 22.488 1.00 13.42 ? 327 ILE A CB  1 
ATOM   1056 C  CG1 . ILE A 1 148 ? -1.598  41.010 23.210 1.00 13.26 ? 327 ILE A CG1 1 
ATOM   1057 C  CG2 . ILE A 1 148 ? 0.106   39.420 22.309 1.00 13.50 ? 327 ILE A CG2 1 
ATOM   1058 C  CD1 . ILE A 1 148 ? -0.815  41.119 24.580 1.00 15.54 ? 327 ILE A CD1 1 
ATOM   1059 N  N   . TYR A 1 149 ? -1.146  38.096 19.534 1.00 13.69 ? 328 TYR A N   1 
ATOM   1060 C  CA  . TYR A 1 149 ? -0.926  36.768 18.935 1.00 15.85 ? 328 TYR A CA  1 
ATOM   1061 C  C   . TYR A 1 149 ? 0.487   36.329 19.333 1.00 15.67 ? 328 TYR A C   1 
ATOM   1062 O  O   . TYR A 1 149 ? 1.444   37.075 19.129 1.00 15.54 ? 328 TYR A O   1 
ATOM   1063 C  CB  . TYR A 1 149 ? -1.035  36.842 17.416 1.00 15.22 ? 328 TYR A CB  1 
ATOM   1064 C  CG  . TYR A 1 149 ? -0.814  35.505 16.722 1.00 17.64 ? 328 TYR A CG  1 
ATOM   1065 C  CD1 . TYR A 1 149 ? -1.752  34.484 16.821 1.00 19.82 ? 328 TYR A CD1 1 
ATOM   1066 C  CD2 . TYR A 1 149 ? 0.311   35.286 15.944 1.00 18.12 ? 328 TYR A CD2 1 
ATOM   1067 C  CE1 . TYR A 1 149 ? -1.574  33.274 16.142 1.00 20.95 ? 328 TYR A CE1 1 
ATOM   1068 C  CE2 . TYR A 1 149 ? 0.491   34.087 15.268 1.00 21.78 ? 328 TYR A CE2 1 
ATOM   1069 C  CZ  . TYR A 1 149 ? -0.458  33.093 15.371 1.00 21.33 ? 328 TYR A CZ  1 
ATOM   1070 O  OH  . TYR A 1 149 ? -0.279  31.915 14.672 1.00 23.22 ? 328 TYR A OH  1 
ATOM   1071 N  N   . TYR A 1 150 ? 0.609   35.121 19.889 1.00 15.43 ? 329 TYR A N   1 
ATOM   1072 C  CA  . TYR A 1 150 ? 1.898   34.570 20.314 1.00 18.06 ? 329 TYR A CA  1 
ATOM   1073 C  C   . TYR A 1 150 ? 2.419   33.540 19.317 1.00 19.23 ? 329 TYR A C   1 
ATOM   1074 O  O   . TYR A 1 150 ? 1.646   32.795 18.725 1.00 20.11 ? 329 TYR A O   1 
ATOM   1075 C  CB  . TYR A 1 150 ? 1.760   33.920 21.687 1.00 16.39 ? 329 TYR A CB  1 
ATOM   1076 C  CG  . TYR A 1 150 ? 1.384   34.895 22.766 1.00 14.19 ? 329 TYR A CG  1 
ATOM   1077 C  CD1 . TYR A 1 150 ? 2.307   35.814 23.257 1.00 16.24 ? 329 TYR A CD1 1 
ATOM   1078 C  CD2 . TYR A 1 150 ? 0.093   34.918 23.277 1.00 17.30 ? 329 TYR A CD2 1 
ATOM   1079 C  CE1 . TYR A 1 150 ? 1.940   36.737 24.241 1.00 15.38 ? 329 TYR A CE1 1 
ATOM   1080 C  CE2 . TYR A 1 150 ? -0.276  35.833 24.251 1.00 18.03 ? 329 TYR A CE2 1 
ATOM   1081 C  CZ  . TYR A 1 150 ? 0.651   36.734 24.726 1.00 16.85 ? 329 TYR A CZ  1 
ATOM   1082 O  OH  . TYR A 1 150 ? 0.280   37.637 25.699 1.00 19.08 ? 329 TYR A OH  1 
ATOM   1083 N  N   . LEU A 1 151 ? 3.731   33.469 19.142 1.00 22.43 ? 330 LEU A N   1 
ATOM   1084 C  CA  . LEU A 1 151 ? 4.273   32.536 18.155 1.00 25.66 ? 330 LEU A CA  1 
ATOM   1085 C  C   . LEU A 1 151 ? 5.506   31.765 18.621 1.00 25.76 ? 330 LEU A C   1 
ATOM   1086 O  O   . LEU A 1 151 ? 6.396   31.446 17.830 1.00 27.86 ? 330 LEU A O   1 
ATOM   1087 C  CB  . LEU A 1 151 ? 4.576   33.303 16.854 1.00 30.36 ? 330 LEU A CB  1 
ATOM   1088 C  CG  . LEU A 1 151 ? 5.346   34.625 16.993 1.00 30.90 ? 330 LEU A CG  1 
ATOM   1089 C  CD1 . LEU A 1 151 ? 6.298   34.817 15.823 1.00 32.88 ? 330 LEU A CD1 1 
ATOM   1090 C  CD2 . LEU A 1 151 ? 4.370   35.780 17.085 1.00 31.10 ? 330 LEU A CD2 1 
ATOM   1091 N  N   . ASN A 1 152 ? 5.527   31.439 19.904 1.00 24.83 ? 331 ASN A N   1 
ATOM   1092 C  CA  . ASN A 1 152 ? 6.644   30.727 20.511 1.00 25.67 ? 331 ASN A CA  1 
ATOM   1093 C  C   . ASN A 1 152 ? 6.392   29.231 20.612 1.00 27.59 ? 331 ASN A C   1 
ATOM   1094 O  O   . ASN A 1 152 ? 5.748   28.763 21.544 1.00 26.82 ? 331 ASN A O   1 
ATOM   1095 C  CB  . ASN A 1 152 ? 6.883   31.347 21.879 1.00 23.52 ? 331 ASN A CB  1 
ATOM   1096 C  CG  . ASN A 1 152 ? 6.984   32.845 21.777 1.00 19.63 ? 331 ASN A CG  1 
ATOM   1097 O  OD1 . ASN A 1 152 ? 7.902   33.355 21.138 1.00 20.97 ? 331 ASN A OD1 1 
ATOM   1098 N  ND2 . ASN A 1 152 ? 6.016   33.561 22.355 1.00 19.48 ? 331 ASN A ND2 1 
ATOM   1099 N  N   . LYS A 1 153 ? 6.926   28.488 19.649 1.00 31.42 ? 332 LYS A N   1 
ATOM   1100 C  CA  . LYS A 1 153 ? 6.716   27.048 19.628 1.00 36.00 ? 332 LYS A CA  1 
ATOM   1101 C  C   . LYS A 1 153 ? 7.378   26.326 20.783 1.00 36.99 ? 332 LYS A C   1 
ATOM   1102 O  O   . LYS A 1 153 ? 8.549   26.561 21.094 1.00 37.07 ? 332 LYS A O   1 
ATOM   1103 C  CB  . LYS A 1 153 ? 7.181   26.455 18.296 1.00 38.93 ? 332 LYS A CB  1 
ATOM   1104 C  CG  . LYS A 1 153 ? 6.700   25.018 18.093 1.00 42.19 ? 332 LYS A CG  1 
ATOM   1105 C  CD  . LYS A 1 153 ? 6.658   24.625 16.622 1.00 44.46 ? 332 LYS A CD  1 
ATOM   1106 C  CE  . LYS A 1 153 ? 5.975   23.272 16.440 1.00 45.52 ? 332 LYS A CE  1 
ATOM   1107 N  NZ  . LYS A 1 153 ? 4.555   23.277 16.908 1.00 46.31 ? 332 LYS A NZ  1 
ATOM   1108 N  N   . ASP A 1 154 ? 6.601   25.458 21.424 1.00 38.33 ? 333 ASP A N   1 
ATOM   1109 C  CA  . ASP A 1 154 ? 7.055   24.661 22.558 1.00 39.86 ? 333 ASP A CA  1 
ATOM   1110 C  C   . ASP A 1 154 ? 7.547   25.521 23.715 1.00 39.52 ? 333 ASP A C   1 
ATOM   1111 O  O   . ASP A 1 154 ? 8.608   25.254 24.277 1.00 38.79 ? 333 ASP A O   1 
ATOM   1112 C  CB  . ASP A 1 154 ? 8.173   23.704 22.119 1.00 41.92 ? 333 ASP A CB  1 
ATOM   1113 C  CG  . ASP A 1 154 ? 7.694   22.659 21.118 1.00 44.21 ? 333 ASP A CG  1 
ATOM   1114 O  OD1 . ASP A 1 154 ? 6.736   21.921 21.441 1.00 45.29 ? 333 ASP A OD1 1 
ATOM   1115 O  OD2 . ASP A 1 154 ? 8.280   22.575 20.013 1.00 44.43 ? 333 ASP A OD2 1 
ATOM   1116 N  N   . TRP A 1 155 ? 6.781   26.552 24.071 1.00 37.90 ? 334 TRP A N   1 
ATOM   1117 C  CA  . TRP A 1 155 ? 7.171   27.429 25.170 1.00 37.26 ? 334 TRP A CA  1 
ATOM   1118 C  C   . TRP A 1 155 ? 6.787   26.831 26.514 1.00 39.23 ? 334 TRP A C   1 
ATOM   1119 O  O   . TRP A 1 155 ? 5.623   26.498 26.749 1.00 40.00 ? 334 TRP A O   1 
ATOM   1120 C  CB  . TRP A 1 155 ? 6.519   28.816 25.029 1.00 33.08 ? 334 TRP A CB  1 
ATOM   1121 C  CG  . TRP A 1 155 ? 6.980   29.806 26.067 1.00 27.56 ? 334 TRP A CG  1 
ATOM   1122 C  CD1 . TRP A 1 155 ? 6.468   29.990 27.317 1.00 26.22 ? 334 TRP A CD1 1 
ATOM   1123 C  CD2 . TRP A 1 155 ? 8.078   30.716 25.948 1.00 25.78 ? 334 TRP A CD2 1 
ATOM   1124 N  NE1 . TRP A 1 155 ? 7.182   30.961 27.988 1.00 25.78 ? 334 TRP A NE1 1 
ATOM   1125 C  CE2 . TRP A 1 155 ? 8.173   31.423 27.164 1.00 24.35 ? 334 TRP A CE2 1 
ATOM   1126 C  CE3 . TRP A 1 155 ? 8.993   31.000 24.930 1.00 24.45 ? 334 TRP A CE3 1 
ATOM   1127 C  CZ2 . TRP A 1 155 ? 9.141   32.395 27.387 1.00 23.05 ? 334 TRP A CZ2 1 
ATOM   1128 C  CZ3 . TRP A 1 155 ? 9.958   31.967 25.155 1.00 23.83 ? 334 TRP A CZ3 1 
ATOM   1129 C  CH2 . TRP A 1 155 ? 10.022  32.651 26.371 1.00 23.34 ? 334 TRP A CH2 1 
ATOM   1130 N  N   . ASP A 1 156 ? 7.777   26.700 27.392 1.00 40.13 ? 335 ASP A N   1 
ATOM   1131 C  CA  . ASP A 1 156 ? 7.567   26.150 28.722 1.00 41.88 ? 335 ASP A CA  1 
ATOM   1132 C  C   . ASP A 1 156 ? 7.905   27.217 29.762 1.00 41.58 ? 335 ASP A C   1 
ATOM   1133 O  O   . ASP A 1 156 ? 9.074   27.439 30.068 1.00 41.45 ? 335 ASP A O   1 
ATOM   1134 C  CB  . ASP A 1 156 ? 8.473   24.936 28.924 1.00 44.31 ? 335 ASP A CB  1 
ATOM   1135 C  CG  . ASP A 1 156 ? 8.046   24.083 30.091 1.00 46.31 ? 335 ASP A CG  1 
ATOM   1136 O  OD1 . ASP A 1 156 ? 7.512   24.642 31.075 1.00 47.29 ? 335 ASP A OD1 1 
ATOM   1137 O  OD2 . ASP A 1 156 ? 8.255   22.850 30.023 1.00 47.89 ? 335 ASP A OD2 1 
ATOM   1138 N  N   . ALA A 1 157 ? 6.878   27.861 30.309 1.00 41.23 ? 336 ALA A N   1 
ATOM   1139 C  CA  . ALA A 1 157 ? 7.057   28.925 31.294 1.00 41.74 ? 336 ALA A CA  1 
ATOM   1140 C  C   . ALA A 1 157 ? 7.802   28.516 32.563 1.00 41.85 ? 336 ALA A C   1 
ATOM   1141 O  O   . ALA A 1 157 ? 8.603   29.285 33.098 1.00 40.32 ? 336 ALA A O   1 
ATOM   1142 C  CB  . ALA A 1 157 ? 5.708   29.512 31.659 1.00 42.76 ? 336 ALA A CB  1 
ATOM   1143 N  N   . LYS A 1 158 ? 7.537   27.313 33.056 1.00 41.83 ? 337 LYS A N   1 
ATOM   1144 C  CA  . LYS A 1 158 ? 8.209   26.859 34.265 1.00 41.92 ? 337 LYS A CA  1 
ATOM   1145 C  C   . LYS A 1 158 ? 9.716   26.895 34.043 1.00 39.69 ? 337 LYS A C   1 
ATOM   1146 O  O   . LYS A 1 158 ? 10.495  26.983 34.991 1.00 41.12 ? 337 LYS A O   1 
ATOM   1147 C  CB  . LYS A 1 158 ? 7.743   25.441 34.617 1.00 43.80 ? 337 LYS A CB  1 
ATOM   1148 C  CG  . LYS A 1 158 ? 6.241   25.349 34.841 1.00 47.15 ? 337 LYS A CG  1 
ATOM   1149 C  CD  . LYS A 1 158 ? 5.815   26.095 36.099 1.00 49.23 ? 337 LYS A CD  1 
ATOM   1150 C  CE  . LYS A 1 158 ? 5.911   25.204 37.338 1.00 51.03 ? 337 LYS A CE  1 
ATOM   1151 N  NZ  . LYS A 1 158 ? 7.279   24.654 37.556 1.00 52.63 ? 337 LYS A NZ  1 
ATOM   1152 N  N   . VAL A 1 159 ? 10.118  26.849 32.776 1.00 38.04 ? 338 VAL A N   1 
ATOM   1153 C  CA  . VAL A 1 159 ? 11.524  26.873 32.399 1.00 35.76 ? 338 VAL A CA  1 
ATOM   1154 C  C   . VAL A 1 159 ? 12.003  28.195 31.801 1.00 34.87 ? 338 VAL A C   1 
ATOM   1155 O  O   . VAL A 1 159 ? 13.070  28.695 32.162 1.00 33.49 ? 338 VAL A O   1 
ATOM   1156 C  CB  . VAL A 1 159 ? 11.832  25.760 31.377 1.00 37.80 ? 338 VAL A CB  1 
ATOM   1157 C  CG1 . VAL A 1 159 ? 13.159  26.029 30.689 1.00 38.55 ? 338 VAL A CG1 1 
ATOM   1158 C  CG2 . VAL A 1 159 ? 11.873  24.414 32.081 1.00 38.72 ? 338 VAL A CG2 1 
ATOM   1159 N  N   . SER A 1 160 ? 11.213  28.765 30.896 1.00 30.78 ? 339 SER A N   1 
ATOM   1160 C  CA  . SER A 1 160 ? 11.600  30.001 30.225 1.00 28.60 ? 339 SER A CA  1 
ATOM   1161 C  C   . SER A 1 160 ? 10.967  31.296 30.738 1.00 26.30 ? 339 SER A C   1 
ATOM   1162 O  O   . SER A 1 160 ? 11.300  32.370 30.239 1.00 26.25 ? 339 SER A O   1 
ATOM   1163 C  CB  . SER A 1 160 ? 11.318  29.881 28.726 1.00 29.04 ? 339 SER A CB  1 
ATOM   1164 O  OG  . SER A 1 160 ? 11.979  28.767 28.152 1.00 31.48 ? 339 SER A OG  1 
ATOM   1165 N  N   . GLY A 1 161 ? 10.068  31.194 31.715 1.00 25.42 ? 340 GLY A N   1 
ATOM   1166 C  CA  . GLY A 1 161 ? 9.408   32.374 32.268 1.00 22.59 ? 340 GLY A CA  1 
ATOM   1167 C  C   . GLY A 1 161 ? 8.485   33.024 31.252 1.00 22.29 ? 340 GLY A C   1 
ATOM   1168 O  O   . GLY A 1 161 ? 7.799   32.324 30.518 1.00 20.60 ? 340 GLY A O   1 
ATOM   1169 N  N   . GLY A 1 162 ? 8.454   34.360 31.238 1.00 21.00 ? 341 GLY A N   1 
ATOM   1170 C  CA  . GLY A 1 162 ? 7.651   35.091 30.264 1.00 20.30 ? 341 GLY A CA  1 
ATOM   1171 C  C   . GLY A 1 162 ? 6.140   35.013 30.327 1.00 20.65 ? 341 GLY A C   1 
ATOM   1172 O  O   . GLY A 1 162 ? 5.455   35.331 29.349 1.00 19.31 ? 341 GLY A O   1 
ATOM   1173 N  N   . ILE A 1 163 ? 5.593   34.591 31.455 1.00 20.44 ? 342 ILE A N   1 
ATOM   1174 C  CA  . ILE A 1 163 ? 4.144   34.539 31.558 1.00 20.17 ? 342 ILE A CA  1 
ATOM   1175 C  C   . ILE A 1 163 ? 3.547   35.940 31.604 1.00 19.53 ? 342 ILE A C   1 
ATOM   1176 O  O   . ILE A 1 163 ? 4.143   36.872 32.150 1.00 19.54 ? 342 ILE A O   1 
ATOM   1177 C  CB  . ILE A 1 163 ? 3.719   33.776 32.828 1.00 24.23 ? 342 ILE A CB  1 
ATOM   1178 C  CG1 . ILE A 1 163 ? 4.094   32.303 32.673 1.00 27.06 ? 342 ILE A CG1 1 
ATOM   1179 C  CG2 . ILE A 1 163 ? 2.233   33.924 33.064 1.00 26.13 ? 342 ILE A CG2 1 
ATOM   1180 C  CD1 . ILE A 1 163 ? 3.712   31.449 33.875 1.00 30.92 ? 342 ILE A CD1 1 
ATOM   1181 N  N   . LEU A 1 164 ? 2.385   36.097 30.976 1.00 19.38 ? 343 LEU A N   1 
ATOM   1182 C  CA  . LEU A 1 164 ? 1.657   37.353 31.020 1.00 18.31 ? 343 LEU A CA  1 
ATOM   1183 C  C   . LEU A 1 164 ? 0.695   37.180 32.194 1.00 20.25 ? 343 LEU A C   1 
ATOM   1184 O  O   . LEU A 1 164 ? -0.144  36.291 32.175 1.00 21.62 ? 343 LEU A O   1 
ATOM   1185 C  CB  . LEU A 1 164 ? 0.856   37.564 29.724 1.00 21.23 ? 343 LEU A CB  1 
ATOM   1186 C  CG  . LEU A 1 164 ? -0.296  38.568 29.871 1.00 22.63 ? 343 LEU A CG  1 
ATOM   1187 C  CD1 . LEU A 1 164 ? 0.269   39.928 30.184 1.00 22.10 ? 343 LEU A CD1 1 
ATOM   1188 C  CD2 . LEU A 1 164 ? -1.131  38.630 28.592 1.00 23.92 ? 343 LEU A CD2 1 
ATOM   1189 N  N   . ARG A 1 165 ? 0.841   37.999 33.227 1.00 20.06 ? 344 ARG A N   1 
ATOM   1190 C  CA  . ARG A 1 165 ? -0.039  37.898 34.388 1.00 21.41 ? 344 ARG A CA  1 
ATOM   1191 C  C   . ARG A 1 165 ? -0.989  39.084 34.352 1.00 21.76 ? 344 ARG A C   1 
ATOM   1192 O  O   . ARG A 1 165 ? -0.545  40.221 34.313 1.00 21.17 ? 344 ARG A O   1 
ATOM   1193 C  CB  . ARG A 1 165 ? 0.793   37.920 35.677 1.00 21.39 ? 344 ARG A CB  1 
ATOM   1194 C  CG  . ARG A 1 165 ? -0.051  37.925 36.944 1.00 23.00 ? 344 ARG A CG  1 
ATOM   1195 C  CD  . ARG A 1 165 ? 0.797   37.582 38.174 1.00 26.54 ? 344 ARG A CD  1 
ATOM   1196 N  NE  . ARG A 1 165 ? 1.226   36.187 38.173 1.00 28.33 ? 344 ARG A NE  1 
ATOM   1197 C  CZ  . ARG A 1 165 ? 2.055   35.656 39.069 1.00 31.74 ? 344 ARG A CZ  1 
ATOM   1198 N  NH1 . ARG A 1 165 ? 2.558   36.401 40.049 1.00 30.66 ? 344 ARG A NH1 1 
ATOM   1199 N  NH2 . ARG A 1 165 ? 2.377   34.372 38.994 1.00 31.98 ? 344 ARG A NH2 1 
ATOM   1200 N  N   . ILE A 1 166 ? -2.291  38.807 34.297 1.00 23.21 ? 345 ILE A N   1 
ATOM   1201 C  CA  . ILE A 1 166 ? -3.294  39.863 34.278 1.00 25.05 ? 345 ILE A CA  1 
ATOM   1202 C  C   . ILE A 1 166 ? -4.046  39.815 35.594 1.00 28.66 ? 345 ILE A C   1 
ATOM   1203 O  O   . ILE A 1 166 ? -4.275  38.732 36.139 1.00 29.11 ? 345 ILE A O   1 
ATOM   1204 C  CB  . ILE A 1 166 ? -4.312  39.671 33.145 1.00 25.76 ? 345 ILE A CB  1 
ATOM   1205 C  CG1 . ILE A 1 166 ? -3.594  39.618 31.806 1.00 25.00 ? 345 ILE A CG1 1 
ATOM   1206 C  CG2 . ILE A 1 166 ? -5.313  40.831 33.128 1.00 24.30 ? 345 ILE A CG2 1 
ATOM   1207 C  CD1 . ILE A 1 166 ? -4.524  39.332 30.649 1.00 26.79 ? 345 ILE A CD1 1 
ATOM   1208 N  N   . PHE A 1 167 ? -4.422  40.986 36.093 1.00 30.15 ? 346 PHE A N   1 
ATOM   1209 C  CA  . PHE A 1 167 ? -5.155  41.096 37.352 1.00 33.70 ? 346 PHE A CA  1 
ATOM   1210 C  C   . PHE A 1 167 ? -6.543  41.686 37.079 1.00 35.30 ? 346 PHE A C   1 
ATOM   1211 O  O   . PHE A 1 167 ? -6.772  42.872 37.303 1.00 36.54 ? 346 PHE A O   1 
ATOM   1212 C  CB  . PHE A 1 167 ? -4.394  42.006 38.322 1.00 32.66 ? 346 PHE A CB  1 
ATOM   1213 C  CG  . PHE A 1 167 ? -2.940  41.639 38.507 1.00 34.90 ? 346 PHE A CG  1 
ATOM   1214 C  CD1 . PHE A 1 167 ? -1.979  42.031 37.582 1.00 34.18 ? 346 PHE A CD1 1 
ATOM   1215 C  CD2 . PHE A 1 167 ? -2.529  40.916 39.618 1.00 35.05 ? 346 PHE A CD2 1 
ATOM   1216 C  CE1 . PHE A 1 167 ? -0.646  41.713 37.764 1.00 35.37 ? 346 PHE A CE1 1 
ATOM   1217 C  CE2 . PHE A 1 167 ? -1.193  40.594 39.802 1.00 34.61 ? 346 PHE A CE2 1 
ATOM   1218 C  CZ  . PHE A 1 167 ? -0.251  40.993 38.878 1.00 35.55 ? 346 PHE A CZ  1 
ATOM   1219 N  N   . PRO A 1 168 ? -7.482  40.857 36.594 1.00 38.44 ? 347 PRO A N   1 
ATOM   1220 C  CA  . PRO A 1 168 ? -8.867  41.209 36.257 1.00 41.54 ? 347 PRO A CA  1 
ATOM   1221 C  C   . PRO A 1 168 ? -9.615  42.007 37.319 1.00 45.34 ? 347 PRO A C   1 
ATOM   1222 O  O   . PRO A 1 168 ? -9.690  41.595 38.477 1.00 44.97 ? 347 PRO A O   1 
ATOM   1223 C  CB  . PRO A 1 168 ? -9.513  39.850 36.009 1.00 41.50 ? 347 PRO A CB  1 
ATOM   1224 C  CG  . PRO A 1 168 ? -8.384  39.043 35.471 1.00 41.14 ? 347 PRO A CG  1 
ATOM   1225 C  CD  . PRO A 1 168 ? -7.254  39.418 36.386 1.00 39.03 ? 347 PRO A CD  1 
ATOM   1226 N  N   . GLU A 1 169 ? -10.171 43.145 36.908 1.00 48.43 ? 348 GLU A N   1 
ATOM   1227 C  CA  . GLU A 1 169 ? -10.930 44.017 37.799 1.00 52.36 ? 348 GLU A CA  1 
ATOM   1228 C  C   . GLU A 1 169 ? -10.160 44.250 39.087 1.00 53.70 ? 348 GLU A C   1 
ATOM   1229 O  O   . GLU A 1 169 ? -8.999  44.663 39.068 1.00 54.97 ? 348 GLU A O   1 
ATOM   1230 C  CB  . GLU A 1 169 ? -12.283 43.380 38.136 1.00 53.53 ? 348 GLU A CB  1 
ATOM   1231 C  CG  . GLU A 1 169 ? -13.040 42.814 36.940 1.00 56.17 ? 348 GLU A CG  1 
ATOM   1232 C  CD  . GLU A 1 169 ? -13.385 43.867 35.894 1.00 57.88 ? 348 GLU A CD  1 
ATOM   1233 O  OE1 . GLU A 1 169 ? -14.102 44.838 36.230 1.00 59.08 ? 348 GLU A OE1 1 
ATOM   1234 O  OE2 . GLU A 1 169 ? -12.943 43.715 34.733 1.00 58.26 ? 348 GLU A OE2 1 
ATOM   1235 N  N   . GLY A 1 170 ? -10.831 43.978 40.203 1.00 55.13 ? 349 GLY A N   1 
ATOM   1236 C  CA  . GLY A 1 170 ? -10.230 44.130 41.514 1.00 55.39 ? 349 GLY A CA  1 
ATOM   1237 C  C   . GLY A 1 170 ? -10.372 42.826 42.279 1.00 56.41 ? 349 GLY A C   1 
ATOM   1238 O  O   . GLY A 1 170 ? -10.541 42.819 43.500 1.00 57.13 ? 349 GLY A O   1 
ATOM   1239 N  N   . LYS A 1 171 ? -10.312 41.718 41.545 1.00 56.38 ? 350 LYS A N   1 
ATOM   1240 C  CA  . LYS A 1 171 ? -10.426 40.385 42.125 1.00 56.57 ? 350 LYS A CA  1 
ATOM   1241 C  C   . LYS A 1 171 ? -9.098  39.944 42.742 1.00 56.52 ? 350 LYS A C   1 
ATOM   1242 O  O   . LYS A 1 171 ? -8.027  40.361 42.297 1.00 57.15 ? 350 LYS A O   1 
ATOM   1243 C  CB  . LYS A 1 171 ? -10.868 39.386 41.049 1.00 56.76 ? 350 LYS A CB  1 
ATOM   1244 C  CG  . LYS A 1 171 ? -10.878 37.931 41.498 1.00 56.54 ? 350 LYS A CG  1 
ATOM   1245 C  CD  . LYS A 1 171 ? -11.600 37.047 40.493 1.00 56.40 ? 350 LYS A CD  1 
ATOM   1246 C  CE  . LYS A 1 171 ? -11.069 37.247 39.081 1.00 56.18 ? 350 LYS A CE  1 
ATOM   1247 N  NZ  . LYS A 1 171 ? -9.642  36.843 38.951 1.00 56.36 ? 350 LYS A NZ  1 
ATOM   1248 N  N   . ALA A 1 172 ? -9.171  39.104 43.771 1.00 55.79 ? 351 ALA A N   1 
ATOM   1249 C  CA  . ALA A 1 172 ? -7.969  38.628 44.444 1.00 55.67 ? 351 ALA A CA  1 
ATOM   1250 C  C   . ALA A 1 172 ? -7.019  37.923 43.480 1.00 55.40 ? 351 ALA A C   1 
ATOM   1251 O  O   . ALA A 1 172 ? -5.968  38.464 43.115 1.00 56.15 ? 351 ALA A O   1 
ATOM   1252 C  CB  . ALA A 1 172 ? -8.346  37.687 45.594 1.00 55.50 ? 351 ALA A CB  1 
ATOM   1253 N  N   . GLN A 1 173 ? -7.398  36.722 43.060 1.00 53.97 ? 352 GLN A N   1 
ATOM   1254 C  CA  . GLN A 1 173 ? -6.573  35.934 42.153 1.00 52.36 ? 352 GLN A CA  1 
ATOM   1255 C  C   . GLN A 1 173 ? -6.373  36.578 40.780 1.00 50.64 ? 352 GLN A C   1 
ATOM   1256 O  O   . GLN A 1 173 ? -7.241  37.280 40.267 1.00 51.57 ? 352 GLN A O   1 
ATOM   1257 C  CB  . GLN A 1 173 ? -7.178  34.538 41.976 1.00 53.48 ? 352 GLN A CB  1 
ATOM   1258 C  CG  . GLN A 1 173 ? -6.272  33.561 41.251 1.00 54.08 ? 352 GLN A CG  1 
ATOM   1259 C  CD  . GLN A 1 173 ? -5.024  33.235 42.045 1.00 54.96 ? 352 GLN A CD  1 
ATOM   1260 O  OE1 . GLN A 1 173 ? -5.102  32.672 43.139 1.00 55.84 ? 352 GLN A OE1 1 
ATOM   1261 N  NE2 . GLN A 1 173 ? -3.866  33.589 41.503 1.00 54.52 ? 352 GLN A NE2 1 
ATOM   1262 N  N   . PHE A 1 174 ? -5.213  36.321 40.193 1.00 47.60 ? 353 PHE A N   1 
ATOM   1263 C  CA  . PHE A 1 174 ? -4.875  36.847 38.880 1.00 44.02 ? 353 PHE A CA  1 
ATOM   1264 C  C   . PHE A 1 174 ? -4.909  35.728 37.848 1.00 42.13 ? 353 PHE A C   1 
ATOM   1265 O  O   . PHE A 1 174 ? -5.163  34.573 38.185 1.00 40.41 ? 353 PHE A O   1 
ATOM   1266 C  CB  . PHE A 1 174 ? -3.493  37.490 38.930 1.00 44.39 ? 353 PHE A CB  1 
ATOM   1267 C  CG  . PHE A 1 174 ? -2.498  36.721 39.751 1.00 44.97 ? 353 PHE A CG  1 
ATOM   1268 C  CD1 . PHE A 1 174 ? -2.022  35.496 39.321 1.00 44.36 ? 353 PHE A CD1 1 
ATOM   1269 C  CD2 . PHE A 1 174 ? -2.040  37.231 40.954 1.00 44.12 ? 353 PHE A CD2 1 
ATOM   1270 C  CE1 . PHE A 1 174 ? -1.105  34.792 40.077 1.00 45.07 ? 353 PHE A CE1 1 
ATOM   1271 C  CE2 . PHE A 1 174 ? -1.124  36.535 41.715 1.00 45.11 ? 353 PHE A CE2 1 
ATOM   1272 C  CZ  . PHE A 1 174 ? -0.654  35.312 41.276 1.00 45.19 ? 353 PHE A CZ  1 
ATOM   1273 N  N   . ALA A 1 175 ? -4.663  36.069 36.588 1.00 38.08 ? 354 ALA A N   1 
ATOM   1274 C  CA  . ALA A 1 175 ? -4.677  35.072 35.530 1.00 35.96 ? 354 ALA A CA  1 
ATOM   1275 C  C   . ALA A 1 175 ? -3.341  35.033 34.817 1.00 34.66 ? 354 ALA A C   1 
ATOM   1276 O  O   . ALA A 1 175 ? -2.854  36.066 34.353 1.00 32.13 ? 354 ALA A O   1 
ATOM   1277 C  CB  . ALA A 1 175 ? -5.775  35.380 34.534 1.00 37.14 ? 354 ALA A CB  1 
ATOM   1278 N  N   . ASP A 1 176 ? -2.757  33.838 34.744 1.00 32.15 ? 355 ASP A N   1 
ATOM   1279 C  CA  . ASP A 1 176 ? -1.480  33.626 34.067 1.00 31.57 ? 355 ASP A CA  1 
ATOM   1280 C  C   . ASP A 1 176 ? -1.726  33.060 32.676 1.00 29.92 ? 355 ASP A C   1 
ATOM   1281 O  O   . ASP A 1 176 ? -2.436  32.066 32.498 1.00 31.12 ? 355 ASP A O   1 
ATOM   1282 C  CB  . ASP A 1 176 ? -0.590  32.667 34.865 1.00 31.21 ? 355 ASP A CB  1 
ATOM   1283 C  CG  . ASP A 1 176 ? -0.087  33.280 36.151 1.00 33.02 ? 355 ASP A CG  1 
ATOM   1284 O  OD1 . ASP A 1 176 ? -0.015  34.523 36.223 1.00 33.24 ? 355 ASP A OD1 1 
ATOM   1285 O  OD2 . ASP A 1 176 ? 0.251   32.526 37.085 1.00 34.74 ? 355 ASP A OD2 1 
ATOM   1286 N  N   . ILE A 1 177 ? -1.149  33.709 31.676 1.00 27.22 ? 356 ILE A N   1 
ATOM   1287 C  CA  . ILE A 1 177 ? -1.315  33.264 30.306 1.00 25.64 ? 356 ILE A CA  1 
ATOM   1288 C  C   . ILE A 1 177 ? 0.051   32.973 29.717 1.00 24.20 ? 356 ILE A C   1 
ATOM   1289 O  O   . ILE A 1 177 ? 0.893   33.862 29.652 1.00 21.53 ? 356 ILE A O   1 
ATOM   1290 C  CB  . ILE A 1 177 ? -1.978  34.353 29.455 1.00 26.03 ? 356 ILE A CB  1 
ATOM   1291 C  CG1 . ILE A 1 177 ? -3.254  34.847 30.143 1.00 29.94 ? 356 ILE A CG1 1 
ATOM   1292 C  CG2 . ILE A 1 177 ? -2.253  33.827 28.044 1.00 25.19 ? 356 ILE A CG2 1 
ATOM   1293 C  CD1 . ILE A 1 177 ? -4.189  33.743 30.551 1.00 33.00 ? 356 ILE A CD1 1 
ATOM   1294 N  N   . GLU A 1 178 ? 0.275   31.731 29.300 1.00 24.32 ? 357 GLU A N   1 
ATOM   1295 C  CA  . GLU A 1 178 ? 1.550   31.367 28.694 1.00 23.87 ? 357 GLU A CA  1 
ATOM   1296 C  C   . GLU A 1 178 ? 1.548   31.876 27.253 1.00 21.75 ? 357 GLU A C   1 
ATOM   1297 O  O   . GLU A 1 178 ? 0.536   31.767 26.559 1.00 21.75 ? 357 GLU A O   1 
ATOM   1298 C  CB  . GLU A 1 178 ? 1.733   29.853 28.708 1.00 29.03 ? 357 GLU A CB  1 
ATOM   1299 C  CG  . GLU A 1 178 ? 1.681   29.255 30.108 1.00 34.38 ? 357 GLU A CG  1 
ATOM   1300 C  CD  . GLU A 1 178 ? 2.206   27.834 30.154 1.00 39.45 ? 357 GLU A CD  1 
ATOM   1301 O  OE1 . GLU A 1 178 ? 1.767   27.008 29.327 1.00 42.21 ? 357 GLU A OE1 1 
ATOM   1302 O  OE2 . GLU A 1 178 ? 3.053   27.541 31.023 1.00 43.30 ? 357 GLU A OE2 1 
ATOM   1303 N  N   . PRO A 1 179 ? 2.677   32.437 26.791 1.00 19.46 ? 358 PRO A N   1 
ATOM   1304 C  CA  . PRO A 1 179 ? 2.787   32.963 25.422 1.00 19.62 ? 358 PRO A CA  1 
ATOM   1305 C  C   . PRO A 1 179 ? 2.985   31.849 24.397 1.00 18.63 ? 358 PRO A C   1 
ATOM   1306 O  O   . PRO A 1 179 ? 3.948   31.850 23.643 1.00 18.13 ? 358 PRO A O   1 
ATOM   1307 C  CB  . PRO A 1 179 ? 3.998   33.891 25.518 1.00 21.41 ? 358 PRO A CB  1 
ATOM   1308 C  CG  . PRO A 1 179 ? 4.896   33.122 26.476 1.00 20.66 ? 358 PRO A CG  1 
ATOM   1309 C  CD  . PRO A 1 179 ? 3.896   32.742 27.568 1.00 20.60 ? 358 PRO A CD  1 
ATOM   1310 N  N   . LYS A 1 180 ? 2.041   30.912 24.379 1.00 22.07 ? 359 LYS A N   1 
ATOM   1311 C  CA  . LYS A 1 180 ? 2.077   29.745 23.498 1.00 25.07 ? 359 LYS A CA  1 
ATOM   1312 C  C   . LYS A 1 180 ? 1.929   29.989 22.001 1.00 24.41 ? 359 LYS A C   1 
ATOM   1313 O  O   . LYS A 1 180 ? 1.190   30.866 21.565 1.00 23.79 ? 359 LYS A O   1 
ATOM   1314 C  CB  . LYS A 1 180 ? 0.994   28.751 23.918 1.00 29.04 ? 359 LYS A CB  1 
ATOM   1315 C  CG  . LYS A 1 180 ? 1.171   28.151 25.293 1.00 33.89 ? 359 LYS A CG  1 
ATOM   1316 C  CD  . LYS A 1 180 ? 0.076   27.120 25.546 1.00 37.33 ? 359 LYS A CD  1 
ATOM   1317 C  CE  . LYS A 1 180 ? 0.243   26.430 26.880 1.00 38.46 ? 359 LYS A CE  1 
ATOM   1318 N  NZ  . LYS A 1 180 ? -0.868  25.451 27.100 1.00 41.79 ? 359 LYS A NZ  1 
ATOM   1319 N  N   . PHE A 1 181 ? 2.626   29.174 21.215 1.00 23.45 ? 360 PHE A N   1 
ATOM   1320 C  CA  . PHE A 1 181 ? 2.564   29.257 19.756 1.00 23.77 ? 360 PHE A CA  1 
ATOM   1321 C  C   . PHE A 1 181 ? 1.123   29.182 19.236 1.00 22.75 ? 360 PHE A C   1 
ATOM   1322 O  O   . PHE A 1 181 ? 0.349   28.314 19.657 1.00 23.46 ? 360 PHE A O   1 
ATOM   1323 C  CB  . PHE A 1 181 ? 3.391   28.105 19.151 1.00 26.55 ? 360 PHE A CB  1 
ATOM   1324 C  CG  . PHE A 1 181 ? 3.214   27.932 17.665 1.00 28.29 ? 360 PHE A CG  1 
ATOM   1325 C  CD1 . PHE A 1 181 ? 2.317   26.998 17.164 1.00 30.14 ? 360 PHE A CD1 1 
ATOM   1326 C  CD2 . PHE A 1 181 ? 3.953   28.688 16.773 1.00 29.89 ? 360 PHE A CD2 1 
ATOM   1327 C  CE1 . PHE A 1 181 ? 2.164   26.824 15.798 1.00 29.86 ? 360 PHE A CE1 1 
ATOM   1328 C  CE2 . PHE A 1 181 ? 3.808   28.522 15.407 1.00 31.52 ? 360 PHE A CE2 1 
ATOM   1329 C  CZ  . PHE A 1 181 ? 2.908   27.584 14.916 1.00 30.94 ? 360 PHE A CZ  1 
ATOM   1330 N  N   . ASP A 1 182 ? 0.778   30.092 18.325 1.00 21.09 ? 361 ASP A N   1 
ATOM   1331 C  CA  . ASP A 1 182 ? -0.547  30.133 17.697 1.00 23.72 ? 361 ASP A CA  1 
ATOM   1332 C  C   . ASP A 1 182 ? -1.702  30.454 18.654 1.00 23.02 ? 361 ASP A C   1 
ATOM   1333 O  O   . ASP A 1 182 ? -2.860  30.120 18.387 1.00 23.59 ? 361 ASP A O   1 
ATOM   1334 C  CB  . ASP A 1 182 ? -0.810  28.799 16.977 1.00 24.09 ? 361 ASP A CB  1 
ATOM   1335 C  CG  . ASP A 1 182 ? -1.866  28.914 15.878 1.00 26.57 ? 361 ASP A CG  1 
ATOM   1336 O  OD1 . ASP A 1 182 ? -2.445  27.866 15.516 1.00 27.29 ? 361 ASP A OD1 1 
ATOM   1337 O  OD2 . ASP A 1 182 ? -2.106  30.025 15.355 1.00 24.92 ? 361 ASP A OD2 1 
ATOM   1338 N  N   . ARG A 1 183 ? -1.393  31.113 19.768 1.00 21.46 ? 362 ARG A N   1 
ATOM   1339 C  CA  . ARG A 1 183 ? -2.422  31.491 20.728 1.00 18.59 ? 362 ARG A CA  1 
ATOM   1340 C  C   . ARG A 1 183 ? -2.801  32.954 20.483 1.00 20.01 ? 362 ARG A C   1 
ATOM   1341 O  O   . ARG A 1 183 ? -1.937  33.796 20.265 1.00 17.34 ? 362 ARG A O   1 
ATOM   1342 C  CB  . ARG A 1 183 ? -1.908  31.307 22.160 1.00 19.80 ? 362 ARG A CB  1 
ATOM   1343 C  CG  . ARG A 1 183 ? -2.725  32.008 23.245 1.00 19.75 ? 362 ARG A CG  1 
ATOM   1344 C  CD  . ARG A 1 183 ? -2.275  31.570 24.634 1.00 23.12 ? 362 ARG A CD  1 
ATOM   1345 N  NE  . ARG A 1 183 ? -2.736  30.215 24.942 1.00 23.42 ? 362 ARG A NE  1 
ATOM   1346 C  CZ  . ARG A 1 183 ? -2.566  29.613 26.113 1.00 27.01 ? 362 ARG A CZ  1 
ATOM   1347 N  NH1 . ARG A 1 183 ? -1.931  30.237 27.098 1.00 26.55 ? 362 ARG A NH1 1 
ATOM   1348 N  NH2 . ARG A 1 183 ? -3.072  28.397 26.318 1.00 28.00 ? 362 ARG A NH2 1 
ATOM   1349 N  N   . LEU A 1 184 ? -4.100  33.234 20.509 1.00 18.82 ? 363 LEU A N   1 
ATOM   1350 C  CA  . LEU A 1 184 ? -4.610  34.584 20.303 1.00 18.53 ? 363 LEU A CA  1 
ATOM   1351 C  C   . LEU A 1 184 ? -5.277  35.007 21.600 1.00 19.29 ? 363 LEU A C   1 
ATOM   1352 O  O   . LEU A 1 184 ? -6.006  34.227 22.213 1.00 22.05 ? 363 LEU A O   1 
ATOM   1353 C  CB  . LEU A 1 184 ? -5.638  34.600 19.167 1.00 20.79 ? 363 LEU A CB  1 
ATOM   1354 C  CG  . LEU A 1 184 ? -6.203  35.987 18.840 1.00 21.58 ? 363 LEU A CG  1 
ATOM   1355 C  CD1 . LEU A 1 184 ? -5.151  36.860 18.201 1.00 21.83 ? 363 LEU A CD1 1 
ATOM   1356 C  CD2 . LEU A 1 184 ? -7.403  35.804 17.910 1.00 23.59 ? 363 LEU A CD2 1 
ATOM   1357 N  N   . LEU A 1 185 ? -5.017  36.239 22.025 1.00 18.08 ? 364 LEU A N   1 
ATOM   1358 C  CA  . LEU A 1 185 ? -5.567  36.749 23.269 1.00 17.15 ? 364 LEU A CA  1 
ATOM   1359 C  C   . LEU A 1 185 ? -6.221  38.120 23.062 1.00 17.07 ? 364 LEU A C   1 
ATOM   1360 O  O   . LEU A 1 185 ? -5.701  38.947 22.318 1.00 17.63 ? 364 LEU A O   1 
ATOM   1361 C  CB  . LEU A 1 185 ? -4.426  36.892 24.295 1.00 17.63 ? 364 LEU A CB  1 
ATOM   1362 C  CG  . LEU A 1 185 ? -4.642  37.689 25.585 1.00 19.26 ? 364 LEU A CG  1 
ATOM   1363 C  CD1 . LEU A 1 185 ? -5.554  36.933 26.550 1.00 20.89 ? 364 LEU A CD1 1 
ATOM   1364 C  CD2 . LEU A 1 185 ? -3.297  37.935 26.232 1.00 18.88 ? 364 LEU A CD2 1 
ATOM   1365 N  N   . PHE A 1 186 ? -7.370  38.326 23.702 1.00 16.97 ? 365 PHE A N   1 
ATOM   1366 C  CA  . PHE A 1 186 ? -8.070  39.617 23.682 1.00 18.21 ? 365 PHE A CA  1 
ATOM   1367 C  C   . PHE A 1 186 ? -8.317  40.006 25.142 1.00 16.44 ? 365 PHE A C   1 
ATOM   1368 O  O   . PHE A 1 186 ? -8.582  39.151 25.974 1.00 19.25 ? 365 PHE A O   1 
ATOM   1369 C  CB  . PHE A 1 186 ? -9.465  39.526 23.039 1.00 18.16 ? 365 PHE A CB  1 
ATOM   1370 C  CG  . PHE A 1 186 ? -9.462  39.211 21.565 1.00 20.65 ? 365 PHE A CG  1 
ATOM   1371 C  CD1 . PHE A 1 186 ? -9.317  40.210 20.624 1.00 22.05 ? 365 PHE A CD1 1 
ATOM   1372 C  CD2 . PHE A 1 186 ? -9.653  37.903 21.129 1.00 23.72 ? 365 PHE A CD2 1 
ATOM   1373 C  CE1 . PHE A 1 186 ? -9.375  39.907 19.249 1.00 23.35 ? 365 PHE A CE1 1 
ATOM   1374 C  CE2 . PHE A 1 186 ? -9.708  37.597 19.777 1.00 23.26 ? 365 PHE A CE2 1 
ATOM   1375 C  CZ  . PHE A 1 186 ? -9.569  38.604 18.837 1.00 23.16 ? 365 PHE A CZ  1 
ATOM   1376 N  N   . PHE A 1 187 ? -8.210  41.294 25.456 1.00 16.04 ? 366 PHE A N   1 
ATOM   1377 C  CA  . PHE A 1 187 ? -8.577  41.776 26.785 1.00 16.99 ? 366 PHE A CA  1 
ATOM   1378 C  C   . PHE A 1 187 ? -8.872  43.265 26.716 1.00 18.04 ? 366 PHE A C   1 
ATOM   1379 O  O   . PHE A 1 187 ? -8.386  43.959 25.816 1.00 17.65 ? 366 PHE A O   1 
ATOM   1380 C  CB  . PHE A 1 187 ? -7.534  41.465 27.888 1.00 16.49 ? 366 PHE A CB  1 
ATOM   1381 C  CG  . PHE A 1 187 ? -6.172  42.061 27.668 1.00 16.24 ? 366 PHE A CG  1 
ATOM   1382 C  CD1 . PHE A 1 187 ? -5.163  41.306 27.087 1.00 17.64 ? 366 PHE A CD1 1 
ATOM   1383 C  CD2 . PHE A 1 187 ? -5.880  43.347 28.101 1.00 17.62 ? 366 PHE A CD2 1 
ATOM   1384 C  CE1 . PHE A 1 187 ? -3.869  41.815 26.941 1.00 17.20 ? 366 PHE A CE1 1 
ATOM   1385 C  CE2 . PHE A 1 187 ? -4.592  43.869 27.963 1.00 17.90 ? 366 PHE A CE2 1 
ATOM   1386 C  CZ  . PHE A 1 187 ? -3.588  43.099 27.385 1.00 14.62 ? 366 PHE A CZ  1 
ATOM   1387 N  N   . TRP A 1 188 ? -9.717  43.752 27.627 1.00 17.00 ? 367 TRP A N   1 
ATOM   1388 C  CA  . TRP A 1 188 ? -10.054 45.178 27.643 1.00 17.58 ? 367 TRP A CA  1 
ATOM   1389 C  C   . TRP A 1 188 ? -8.786  45.959 27.976 1.00 17.37 ? 367 TRP A C   1 
ATOM   1390 O  O   . TRP A 1 188 ? -8.096  45.652 28.939 1.00 17.74 ? 367 TRP A O   1 
ATOM   1391 C  CB  . TRP A 1 188 ? -11.114 45.503 28.704 1.00 18.19 ? 367 TRP A CB  1 
ATOM   1392 C  CG  . TRP A 1 188 ? -12.449 44.780 28.611 1.00 19.60 ? 367 TRP A CG  1 
ATOM   1393 C  CD1 . TRP A 1 188 ? -13.100 44.169 29.646 1.00 20.59 ? 367 TRP A CD1 1 
ATOM   1394 C  CD2 . TRP A 1 188 ? -13.319 44.652 27.466 1.00 19.84 ? 367 TRP A CD2 1 
ATOM   1395 N  NE1 . TRP A 1 188 ? -14.308 43.672 29.226 1.00 19.64 ? 367 TRP A NE1 1 
ATOM   1396 C  CE2 . TRP A 1 188 ? -14.467 43.949 27.894 1.00 21.43 ? 367 TRP A CE2 1 
ATOM   1397 C  CE3 . TRP A 1 188 ? -13.241 45.061 26.132 1.00 20.48 ? 367 TRP A CE3 1 
ATOM   1398 C  CZ2 . TRP A 1 188 ? -15.528 43.643 27.033 1.00 19.58 ? 367 TRP A CZ2 1 
ATOM   1399 C  CZ3 . TRP A 1 188 ? -14.306 44.755 25.272 1.00 20.88 ? 367 TRP A CZ3 1 
ATOM   1400 C  CH2 . TRP A 1 188 ? -15.428 44.053 25.730 1.00 22.49 ? 367 TRP A CH2 1 
ATOM   1401 N  N   . SER A 1 189 ? -8.498  46.983 27.179 1.00 16.74 ? 368 SER A N   1 
ATOM   1402 C  CA  . SER A 1 189 ? -7.288  47.778 27.337 1.00 14.49 ? 368 SER A CA  1 
ATOM   1403 C  C   . SER A 1 189 ? -7.279  48.741 28.520 1.00 17.46 ? 368 SER A C   1 
ATOM   1404 O  O   . SER A 1 189 ? -6.213  49.189 28.931 1.00 17.33 ? 368 SER A O   1 
ATOM   1405 C  CB  . SER A 1 189 ? -7.032  48.586 26.056 1.00 16.13 ? 368 SER A CB  1 
ATOM   1406 O  OG  . SER A 1 189 ? -7.132  47.752 24.909 1.00 15.52 ? 368 SER A OG  1 
ATOM   1407 N  N   . ASP A 1 190 ? -8.450  49.041 29.073 1.00 18.03 ? 369 ASP A N   1 
ATOM   1408 C  CA  . ASP A 1 190 ? -8.501  50.015 30.160 1.00 19.82 ? 369 ASP A CA  1 
ATOM   1409 C  C   . ASP A 1 190 ? -8.088  49.511 31.529 1.00 19.94 ? 369 ASP A C   1 
ATOM   1410 O  O   . ASP A 1 190 ? -7.501  48.446 31.659 1.00 20.16 ? 369 ASP A O   1 
ATOM   1411 C  CB  . ASP A 1 190 ? -9.886  50.681 30.242 1.00 20.43 ? 369 ASP A CB  1 
ATOM   1412 C  CG  . ASP A 1 190 ? -11.000 49.716 30.594 1.00 21.10 ? 369 ASP A CG  1 
ATOM   1413 O  OD1 . ASP A 1 190 ? -10.727 48.623 31.137 1.00 22.20 ? 369 ASP A OD1 1 
ATOM   1414 O  OD2 . ASP A 1 190 ? -12.179 50.068 30.351 1.00 24.46 ? 369 ASP A OD2 1 
ATOM   1415 N  N   . ARG A 1 191 ? -8.383  50.306 32.557 1.00 22.31 ? 370 ARG A N   1 
ATOM   1416 C  CA  . ARG A 1 191 ? -7.998  49.955 33.918 1.00 24.93 ? 370 ARG A CA  1 
ATOM   1417 C  C   . ARG A 1 191 ? -8.533  48.637 34.481 1.00 24.68 ? 370 ARG A C   1 
ATOM   1418 O  O   . ARG A 1 191 ? -8.064  48.177 35.515 1.00 26.07 ? 370 ARG A O   1 
ATOM   1419 C  CB  . ARG A 1 191 ? -8.348  51.117 34.850 1.00 28.04 ? 370 ARG A CB  1 
ATOM   1420 C  CG  . ARG A 1 191 ? -7.550  52.372 34.556 1.00 34.17 ? 370 ARG A CG  1 
ATOM   1421 C  CD  . ARG A 1 191 ? -8.189  53.587 35.202 1.00 38.58 ? 370 ARG A CD  1 
ATOM   1422 N  NE  . ARG A 1 191 ? -7.432  54.801 34.920 1.00 42.91 ? 370 ARG A NE  1 
ATOM   1423 C  CZ  . ARG A 1 191 ? -6.379  55.207 35.621 1.00 45.79 ? 370 ARG A CZ  1 
ATOM   1424 N  NH1 . ARG A 1 191 ? -5.753  56.329 35.287 1.00 48.38 ? 370 ARG A NH1 1 
ATOM   1425 N  NH2 . ARG A 1 191 ? -5.957  54.498 36.659 1.00 47.89 ? 370 ARG A NH2 1 
ATOM   1426 N  N   . ARG A 1 192 ? -9.483  48.011 33.794 1.00 24.41 ? 371 ARG A N   1 
ATOM   1427 C  CA  . ARG A 1 192 ? -10.015 46.732 34.257 1.00 24.22 ? 371 ARG A CA  1 
ATOM   1428 C  C   . ARG A 1 192 ? -8.970  45.623 34.170 1.00 24.70 ? 371 ARG A C   1 
ATOM   1429 O  O   . ARG A 1 192 ? -9.070  44.619 34.884 1.00 25.46 ? 371 ARG A O   1 
ATOM   1430 C  CB  . ARG A 1 192 ? -11.229 46.335 33.430 1.00 25.81 ? 371 ARG A CB  1 
ATOM   1431 C  CG  . ARG A 1 192 ? -12.501 47.108 33.778 1.00 25.60 ? 371 ARG A CG  1 
ATOM   1432 C  CD  . ARG A 1 192 ? -13.616 46.737 32.821 1.00 28.62 ? 371 ARG A CD  1 
ATOM   1433 N  NE  . ARG A 1 192 ? -13.399 47.334 31.508 1.00 24.83 ? 371 ARG A NE  1 
ATOM   1434 C  CZ  . ARG A 1 192 ? -14.272 47.275 30.510 1.00 26.25 ? 371 ARG A CZ  1 
ATOM   1435 N  NH1 . ARG A 1 192 ? -15.424 46.639 30.669 1.00 27.44 ? 371 ARG A NH1 1 
ATOM   1436 N  NH2 . ARG A 1 192 ? -13.994 47.867 29.355 1.00 26.26 ? 371 ARG A NH2 1 
ATOM   1437 N  N   . ASN A 1 193 ? -7.957  45.820 33.318 1.00 22.84 ? 372 ASN A N   1 
ATOM   1438 C  CA  . ASN A 1 193 ? -6.921  44.813 33.130 1.00 21.47 ? 372 ASN A CA  1 
ATOM   1439 C  C   . ASN A 1 193 ? -5.457  45.210 33.284 1.00 21.62 ? 372 ASN A C   1 
ATOM   1440 O  O   . ASN A 1 193 ? -4.707  45.280 32.292 1.00 20.60 ? 372 ASN A O   1 
ATOM   1441 C  CB  . ASN A 1 193 ? -7.095  44.142 31.757 1.00 21.23 ? 372 ASN A CB  1 
ATOM   1442 C  CG  . ASN A 1 193 ? -8.324  43.265 31.693 1.00 22.45 ? 372 ASN A CG  1 
ATOM   1443 O  OD1 . ASN A 1 193 ? -8.564  42.454 32.589 1.00 24.22 ? 372 ASN A OD1 1 
ATOM   1444 N  ND2 . ASN A 1 193 ? -9.100  43.406 30.628 1.00 21.85 ? 372 ASN A ND2 1 
ATOM   1445 N  N   . PRO A 1 194 ? -5.020  45.486 34.522 1.00 21.59 ? 373 PRO A N   1 
ATOM   1446 C  CA  . PRO A 1 194 ? -3.614  45.845 34.706 1.00 21.66 ? 373 PRO A CA  1 
ATOM   1447 C  C   . PRO A 1 194 ? -2.896  44.519 34.443 1.00 20.78 ? 373 PRO A C   1 
ATOM   1448 O  O   . PRO A 1 194 ? -3.450  43.454 34.716 1.00 22.20 ? 373 PRO A O   1 
ATOM   1449 C  CB  . PRO A 1 194 ? -3.532  46.247 36.186 1.00 22.74 ? 373 PRO A CB  1 
ATOM   1450 C  CG  . PRO A 1 194 ? -4.952  46.534 36.567 1.00 23.91 ? 373 PRO A CG  1 
ATOM   1451 C  CD  . PRO A 1 194 ? -5.740  45.507 35.809 1.00 22.89 ? 373 PRO A CD  1 
ATOM   1452 N  N   . HIS A 1 195 ? -1.689  44.566 33.896 1.00 20.56 ? 374 HIS A N   1 
ATOM   1453 C  CA  . HIS A 1 195 ? -0.990  43.329 33.613 1.00 19.69 ? 374 HIS A CA  1 
ATOM   1454 C  C   . HIS A 1 195 ? 0.505   43.530 33.530 1.00 17.90 ? 374 HIS A C   1 
ATOM   1455 O  O   . HIS A 1 195 ? 0.999   44.654 33.523 1.00 18.31 ? 374 HIS A O   1 
ATOM   1456 C  CB  . HIS A 1 195 ? -1.507  42.702 32.310 1.00 19.74 ? 374 HIS A CB  1 
ATOM   1457 C  CG  . HIS A 1 195 ? -1.469  43.630 31.137 1.00 19.00 ? 374 HIS A CG  1 
ATOM   1458 N  ND1 . HIS A 1 195 ? -2.345  44.686 30.995 1.00 17.76 ? 374 HIS A ND1 1 
ATOM   1459 C  CD2 . HIS A 1 195 ? -0.618  43.702 30.087 1.00 18.69 ? 374 HIS A CD2 1 
ATOM   1460 C  CE1 . HIS A 1 195 ? -2.027  45.376 29.914 1.00 18.65 ? 374 HIS A CE1 1 
ATOM   1461 N  NE2 . HIS A 1 195 ? -0.981  44.801 29.348 1.00 16.62 ? 374 HIS A NE2 1 
ATOM   1462 N  N   . GLU A 1 196 ? 1.229   42.425 33.439 1.00 18.39 ? 375 GLU A N   1 
ATOM   1463 C  CA  . GLU A 1 196 ? 2.681   42.500 33.399 1.00 19.38 ? 375 GLU A CA  1 
ATOM   1464 C  C   . GLU A 1 196 ? 3.259   41.261 32.732 1.00 16.78 ? 375 GLU A C   1 
ATOM   1465 O  O   . GLU A 1 196 ? 2.595   40.237 32.635 1.00 18.34 ? 375 GLU A O   1 
ATOM   1466 C  CB  . GLU A 1 196 ? 3.213   42.581 34.833 1.00 21.88 ? 375 GLU A CB  1 
ATOM   1467 C  CG  . GLU A 1 196 ? 3.042   41.267 35.585 1.00 25.88 ? 375 GLU A CG  1 
ATOM   1468 C  CD  . GLU A 1 196 ? 3.280   41.389 37.085 1.00 32.30 ? 375 GLU A CD  1 
ATOM   1469 O  OE1 . GLU A 1 196 ? 3.295   40.342 37.771 1.00 33.42 ? 375 GLU A OE1 1 
ATOM   1470 O  OE2 . GLU A 1 196 ? 3.442   42.522 37.575 1.00 32.43 ? 375 GLU A OE2 1 
ATOM   1471 N  N   . VAL A 1 197 ? 4.490   41.367 32.246 1.00 15.85 ? 376 VAL A N   1 
ATOM   1472 C  CA  . VAL A 1 197 ? 5.142   40.213 31.650 1.00 17.38 ? 376 VAL A CA  1 
ATOM   1473 C  C   . VAL A 1 197 ? 6.264   39.813 32.593 1.00 17.09 ? 376 VAL A C   1 
ATOM   1474 O  O   . VAL A 1 197 ? 7.164   40.619 32.862 1.00 19.40 ? 376 VAL A O   1 
ATOM   1475 C  CB  . VAL A 1 197 ? 5.766   40.535 30.287 1.00 15.70 ? 376 VAL A CB  1 
ATOM   1476 C  CG1 . VAL A 1 197 ? 6.580   39.338 29.782 1.00 18.16 ? 376 VAL A CG1 1 
ATOM   1477 C  CG2 . VAL A 1 197 ? 4.652   40.861 29.289 1.00 19.73 ? 376 VAL A CG2 1 
ATOM   1478 N  N   . GLN A 1 198 ? 6.208   38.583 33.103 1.00 19.08 ? 377 GLN A N   1 
ATOM   1479 C  CA  . GLN A 1 198 ? 7.254   38.117 34.009 1.00 21.76 ? 377 GLN A CA  1 
ATOM   1480 C  C   . GLN A 1 198 ? 8.547   37.904 33.239 1.00 21.64 ? 377 GLN A C   1 
ATOM   1481 O  O   . GLN A 1 198 ? 8.532   37.647 32.037 1.00 20.33 ? 377 GLN A O   1 
ATOM   1482 C  CB  . GLN A 1 198 ? 6.824   36.816 34.680 1.00 23.55 ? 377 GLN A CB  1 
ATOM   1483 C  CG  . GLN A 1 198 ? 5.461   36.923 35.336 1.00 29.28 ? 377 GLN A CG  1 
ATOM   1484 C  CD  . GLN A 1 198 ? 5.163   35.751 36.247 1.00 32.88 ? 377 GLN A CD  1 
ATOM   1485 O  OE1 . GLN A 1 198 ? 5.252   34.592 35.838 1.00 36.28 ? 377 GLN A OE1 1 
ATOM   1486 N  NE2 . GLN A 1 198 ? 4.804   36.048 37.489 1.00 34.54 ? 377 GLN A NE2 1 
ATOM   1487 N  N   . PRO A 1 199 ? 9.695   38.007 33.923 1.00 20.86 ? 378 PRO A N   1 
ATOM   1488 C  CA  . PRO A 1 199 ? 10.991  37.823 33.265 1.00 20.84 ? 378 PRO A CA  1 
ATOM   1489 C  C   . PRO A 1 199 ? 11.024  36.660 32.278 1.00 20.63 ? 378 PRO A C   1 
ATOM   1490 O  O   . PRO A 1 199 ? 10.582  35.551 32.577 1.00 21.01 ? 378 PRO A O   1 
ATOM   1491 C  CB  . PRO A 1 199 ? 11.944  37.620 34.444 1.00 22.11 ? 378 PRO A CB  1 
ATOM   1492 C  CG  . PRO A 1 199 ? 11.354  38.528 35.471 1.00 22.83 ? 378 PRO A CG  1 
ATOM   1493 C  CD  . PRO A 1 199 ? 9.865   38.245 35.367 1.00 22.43 ? 378 PRO A CD  1 
ATOM   1494 N  N   . ALA A 1 200 ? 11.533  36.932 31.082 1.00 19.42 ? 379 ALA A N   1 
ATOM   1495 C  CA  . ALA A 1 200 ? 11.627  35.906 30.051 1.00 19.90 ? 379 ALA A CA  1 
ATOM   1496 C  C   . ALA A 1 200 ? 13.094  35.512 29.930 1.00 19.67 ? 379 ALA A C   1 
ATOM   1497 O  O   . ALA A 1 200 ? 13.949  36.383 29.842 1.00 20.78 ? 379 ALA A O   1 
ATOM   1498 C  CB  . ALA A 1 200 ? 11.133  36.457 28.722 1.00 21.43 ? 379 ALA A CB  1 
ATOM   1499 N  N   . TYR A 1 201 ? 13.365  34.204 29.915 1.00 20.07 ? 380 TYR A N   1 
ATOM   1500 C  CA  . TYR A 1 201 ? 14.724  33.689 29.809 1.00 21.98 ? 380 TYR A CA  1 
ATOM   1501 C  C   . TYR A 1 201 ? 15.026  32.998 28.479 1.00 23.50 ? 380 TYR A C   1 
ATOM   1502 O  O   . TYR A 1 201 ? 16.005  32.258 28.339 1.00 24.08 ? 380 TYR A O   1 
ATOM   1503 C  CB  . TYR A 1 201 ? 14.992  32.750 30.990 1.00 22.93 ? 380 TYR A CB  1 
ATOM   1504 C  CG  . TYR A 1 201 ? 14.937  33.475 32.310 1.00 22.68 ? 380 TYR A CG  1 
ATOM   1505 C  CD1 . TYR A 1 201 ? 16.000  34.266 32.731 1.00 22.54 ? 380 TYR A CD1 1 
ATOM   1506 C  CD2 . TYR A 1 201 ? 13.814  33.399 33.124 1.00 24.95 ? 380 TYR A CD2 1 
ATOM   1507 C  CE1 . TYR A 1 201 ? 15.948  34.962 33.923 1.00 26.26 ? 380 TYR A CE1 1 
ATOM   1508 C  CE2 . TYR A 1 201 ? 13.752  34.096 34.323 1.00 27.18 ? 380 TYR A CE2 1 
ATOM   1509 C  CZ  . TYR A 1 201 ? 14.829  34.878 34.713 1.00 26.24 ? 380 TYR A CZ  1 
ATOM   1510 O  OH  . TYR A 1 201 ? 14.778  35.602 35.881 1.00 30.40 ? 380 TYR A OH  1 
ATOM   1511 N  N   . ALA A 1 202 ? 14.167  33.243 27.495 1.00 22.21 ? 381 ALA A N   1 
ATOM   1512 C  CA  . ALA A 1 202 ? 14.337  32.717 26.146 1.00 20.36 ? 381 ALA A CA  1 
ATOM   1513 C  C   . ALA A 1 202 ? 13.675  33.764 25.264 1.00 20.02 ? 381 ALA A C   1 
ATOM   1514 O  O   . ALA A 1 202 ? 12.880  34.552 25.762 1.00 19.53 ? 381 ALA A O   1 
ATOM   1515 C  CB  . ALA A 1 202 ? 13.635  31.371 25.969 1.00 23.16 ? 381 ALA A CB  1 
ATOM   1516 N  N   . THR A 1 203 ? 14.028  33.780 23.981 1.00 21.37 ? 382 THR A N   1 
ATOM   1517 C  CA  . THR A 1 203 ? 13.467  34.739 23.024 1.00 20.91 ? 382 THR A CA  1 
ATOM   1518 C  C   . THR A 1 203 ? 11.958  34.522 22.945 1.00 19.64 ? 382 THR A C   1 
ATOM   1519 O  O   . THR A 1 203 ? 11.491  33.423 22.659 1.00 21.25 ? 382 THR A O   1 
ATOM   1520 C  CB  . THR A 1 203 ? 14.100  34.553 21.643 1.00 23.52 ? 382 THR A CB  1 
ATOM   1521 O  OG1 . THR A 1 203 ? 15.527  34.626 21.770 1.00 24.99 ? 382 THR A OG1 1 
ATOM   1522 C  CG2 . THR A 1 203 ? 13.624  35.624 20.686 1.00 22.99 ? 382 THR A CG2 1 
ATOM   1523 N  N   . ARG A 1 204 ? 11.213  35.593 23.192 1.00 18.54 ? 383 ARG A N   1 
ATOM   1524 C  CA  . ARG A 1 204 ? 9.755   35.549 23.241 1.00 15.71 ? 383 ARG A CA  1 
ATOM   1525 C  C   . ARG A 1 204 ? 9.160   36.584 22.276 1.00 15.74 ? 383 ARG A C   1 
ATOM   1526 O  O   . ARG A 1 204 ? 9.390   37.778 22.421 1.00 16.57 ? 383 ARG A O   1 
ATOM   1527 C  CB  . ARG A 1 204 ? 9.322   35.875 24.679 1.00 16.04 ? 383 ARG A CB  1 
ATOM   1528 C  CG  . ARG A 1 204 ? 7.825   35.848 24.980 1.00 14.87 ? 383 ARG A CG  1 
ATOM   1529 C  CD  . ARG A 1 204 ? 7.640   36.504 26.325 1.00 17.53 ? 383 ARG A CD  1 
ATOM   1530 N  NE  . ARG A 1 204 ? 6.304   36.454 26.914 1.00 15.56 ? 383 ARG A NE  1 
ATOM   1531 C  CZ  . ARG A 1 204 ? 5.311   37.295 26.649 1.00 17.31 ? 383 ARG A CZ  1 
ATOM   1532 N  NH1 . ARG A 1 204 ? 5.465   38.270 25.767 1.00 16.54 ? 383 ARG A NH1 1 
ATOM   1533 N  NH2 . ARG A 1 204 ? 4.184   37.206 27.337 1.00 16.98 ? 383 ARG A NH2 1 
ATOM   1534 N  N   . TYR A 1 205 ? 8.371   36.115 21.318 1.00 14.50 ? 384 TYR A N   1 
ATOM   1535 C  CA  . TYR A 1 205 ? 7.757   37.015 20.334 1.00 16.94 ? 384 TYR A CA  1 
ATOM   1536 C  C   . TYR A 1 205 ? 6.246   37.093 20.505 1.00 13.39 ? 384 TYR A C   1 
ATOM   1537 O  O   . TYR A 1 205 ? 5.606   36.104 20.850 1.00 16.62 ? 384 TYR A O   1 
ATOM   1538 C  CB  . TYR A 1 205 ? 8.003   36.506 18.924 1.00 15.45 ? 384 TYR A CB  1 
ATOM   1539 C  CG  . TYR A 1 205 ? 9.441   36.486 18.478 1.00 20.31 ? 384 TYR A CG  1 
ATOM   1540 C  CD1 . TYR A 1 205 ? 10.121  37.666 18.214 1.00 20.26 ? 384 TYR A CD1 1 
ATOM   1541 C  CD2 . TYR A 1 205 ? 10.103  35.282 18.273 1.00 22.50 ? 384 TYR A CD2 1 
ATOM   1542 C  CE1 . TYR A 1 205 ? 11.419  37.651 17.748 1.00 24.29 ? 384 TYR A CE1 1 
ATOM   1543 C  CE2 . TYR A 1 205 ? 11.401  35.256 17.808 1.00 24.70 ? 384 TYR A CE2 1 
ATOM   1544 C  CZ  . TYR A 1 205 ? 12.052  36.439 17.545 1.00 24.78 ? 384 TYR A CZ  1 
ATOM   1545 O  OH  . TYR A 1 205 ? 13.340  36.417 17.066 1.00 29.47 ? 384 TYR A OH  1 
ATOM   1546 N  N   . ALA A 1 206 ? 5.691   38.276 20.245 1.00 13.96 ? 385 ALA A N   1 
ATOM   1547 C  CA  . ALA A 1 206 ? 4.247   38.495 20.296 1.00 13.63 ? 385 ALA A CA  1 
ATOM   1548 C  C   . ALA A 1 206 ? 3.916   39.599 19.311 1.00 13.90 ? 385 ALA A C   1 
ATOM   1549 O  O   . ALA A 1 206 ? 4.751   40.459 19.023 1.00 15.84 ? 385 ALA A O   1 
ATOM   1550 C  CB  . ALA A 1 206 ? 3.792   38.918 21.703 1.00 15.73 ? 385 ALA A CB  1 
ATOM   1551 N  N   . ILE A 1 207 ? 2.697   39.563 18.778 1.00 12.93 ? 386 ILE A N   1 
ATOM   1552 C  CA  . ILE A 1 207 ? 2.265   40.611 17.860 1.00 13.55 ? 386 ILE A CA  1 
ATOM   1553 C  C   . ILE A 1 207 ? 1.003   41.201 18.456 1.00 12.46 ? 386 ILE A C   1 
ATOM   1554 O  O   . ILE A 1 207 ? 0.051   40.485 18.711 1.00 14.37 ? 386 ILE A O   1 
ATOM   1555 C  CB  . ILE A 1 207 ? 1.947   40.046 16.464 1.00 14.47 ? 386 ILE A CB  1 
ATOM   1556 C  CG1 . ILE A 1 207 ? 3.220   39.440 15.861 1.00 18.28 ? 386 ILE A CG1 1 
ATOM   1557 C  CG2 . ILE A 1 207 ? 1.417   41.170 15.574 1.00 16.99 ? 386 ILE A CG2 1 
ATOM   1558 C  CD1 . ILE A 1 207 ? 3.031   38.804 14.469 1.00 18.99 ? 386 ILE A CD1 1 
ATOM   1559 N  N   . THR A 1 208 ? 0.998   42.513 18.677 1.00 13.75 ? 387 THR A N   1 
ATOM   1560 C  CA  . THR A 1 208 ? -0.161  43.183 19.270 1.00 14.67 ? 387 THR A CA  1 
ATOM   1561 C  C   . THR A 1 208 ? -0.814  44.224 18.386 1.00 12.67 ? 387 THR A C   1 
ATOM   1562 O  O   . THR A 1 208 ? -0.137  44.966 17.698 1.00 13.85 ? 387 THR A O   1 
ATOM   1563 C  CB  . THR A 1 208 ? 0.232   43.943 20.551 1.00 14.54 ? 387 THR A CB  1 
ATOM   1564 O  OG1 . THR A 1 208 ? 0.755   43.012 21.501 1.00 16.10 ? 387 THR A OG1 1 
ATOM   1565 C  CG2 . THR A 1 208 ? -0.995  44.657 21.155 1.00 14.70 ? 387 THR A CG2 1 
ATOM   1566 N  N   . VAL A 1 209 ? -2.136  44.254 18.394 1.00 14.69 ? 388 VAL A N   1 
ATOM   1567 C  CA  . VAL A 1 209 ? -2.849  45.319 17.692 1.00 15.26 ? 388 VAL A CA  1 
ATOM   1568 C  C   . VAL A 1 209 ? -3.882  45.805 18.708 1.00 14.05 ? 388 VAL A C   1 
ATOM   1569 O  O   . VAL A 1 209 ? -4.431  45.012 19.462 1.00 15.82 ? 388 VAL A O   1 
ATOM   1570 C  CB  . VAL A 1 209 ? -3.601  44.840 16.426 1.00 19.27 ? 388 VAL A CB  1 
ATOM   1571 C  CG1 . VAL A 1 209 ? -2.616  44.355 15.364 1.00 21.41 ? 388 VAL A CG1 1 
ATOM   1572 C  CG2 . VAL A 1 209 ? -4.582  43.798 16.787 1.00 24.44 ? 388 VAL A CG2 1 
ATOM   1573 N  N   . TRP A 1 210 ? -4.127  47.113 18.742 1.00 13.51 ? 389 TRP A N   1 
ATOM   1574 C  CA  . TRP A 1 210 ? -5.131  47.684 19.633 1.00 13.47 ? 389 TRP A CA  1 
ATOM   1575 C  C   . TRP A 1 210 ? -6.281  48.243 18.791 1.00 14.73 ? 389 TRP A C   1 
ATOM   1576 O  O   . TRP A 1 210 ? -6.047  48.945 17.809 1.00 17.04 ? 389 TRP A O   1 
ATOM   1577 C  CB  . TRP A 1 210 ? -4.540  48.837 20.446 1.00 15.28 ? 389 TRP A CB  1 
ATOM   1578 C  CG  . TRP A 1 210 ? -3.613  48.394 21.520 1.00 13.10 ? 389 TRP A CG  1 
ATOM   1579 C  CD1 . TRP A 1 210 ? -3.956  47.996 22.792 1.00 15.27 ? 389 TRP A CD1 1 
ATOM   1580 C  CD2 . TRP A 1 210 ? -2.192  48.366 21.460 1.00 14.40 ? 389 TRP A CD2 1 
ATOM   1581 N  NE1 . TRP A 1 210 ? -2.813  47.735 23.530 1.00 14.66 ? 389 TRP A NE1 1 
ATOM   1582 C  CE2 . TRP A 1 210 ? -1.721  47.950 22.733 1.00 14.70 ? 389 TRP A CE2 1 
ATOM   1583 C  CE3 . TRP A 1 210 ? -1.259  48.654 20.457 1.00 15.21 ? 389 TRP A CE3 1 
ATOM   1584 C  CZ2 . TRP A 1 210 ? -0.361  47.814 23.023 1.00 16.52 ? 389 TRP A CZ2 1 
ATOM   1585 C  CZ3 . TRP A 1 210 ? 0.095   48.522 20.751 1.00 18.30 ? 389 TRP A CZ3 1 
ATOM   1586 C  CH2 . TRP A 1 210 ? 0.529   48.103 22.026 1.00 17.47 ? 389 TRP A CH2 1 
ATOM   1587 N  N   . TYR A 1 211 ? -7.503  47.939 19.203 1.00 14.56 ? 390 TYR A N   1 
ATOM   1588 C  CA  . TYR A 1 211 ? -8.702  48.419 18.512 1.00 16.43 ? 390 TYR A CA  1 
ATOM   1589 C  C   . TYR A 1 211 ? -9.295  49.625 19.216 1.00 18.40 ? 390 TYR A C   1 
ATOM   1590 O  O   . TYR A 1 211 ? -9.350  49.662 20.441 1.00 17.41 ? 390 TYR A O   1 
ATOM   1591 C  CB  . TYR A 1 211 ? -9.729  47.293 18.421 1.00 17.54 ? 390 TYR A CB  1 
ATOM   1592 C  CG  . TYR A 1 211 ? -9.310  46.221 17.455 1.00 17.71 ? 390 TYR A CG  1 
ATOM   1593 C  CD1 . TYR A 1 211 ? -9.577  46.343 16.093 1.00 20.58 ? 390 TYR A CD1 1 
ATOM   1594 C  CD2 . TYR A 1 211 ? -8.574  45.121 17.881 1.00 18.92 ? 390 TYR A CD2 1 
ATOM   1595 C  CE1 . TYR A 1 211 ? -9.114  45.407 15.186 1.00 18.28 ? 390 TYR A CE1 1 
ATOM   1596 C  CE2 . TYR A 1 211 ? -8.108  44.184 16.975 1.00 18.73 ? 390 TYR A CE2 1 
ATOM   1597 C  CZ  . TYR A 1 211 ? -8.377  44.339 15.624 1.00 20.32 ? 390 TYR A CZ  1 
ATOM   1598 O  OH  . TYR A 1 211 ? -7.852  43.459 14.697 1.00 22.35 ? 390 TYR A OH  1 
ATOM   1599 N  N   . PHE A 1 212 ? -9.733  50.603 18.427 1.00 17.74 ? 391 PHE A N   1 
ATOM   1600 C  CA  . PHE A 1 212 ? -10.305 51.841 18.947 1.00 18.70 ? 391 PHE A CA  1 
ATOM   1601 C  C   . PHE A 1 212 ? -11.822 51.880 19.025 1.00 19.53 ? 391 PHE A C   1 
ATOM   1602 O  O   . PHE A 1 212 ? -12.503 51.392 18.114 1.00 20.46 ? 391 PHE A O   1 
ATOM   1603 C  CB  . PHE A 1 212 ? -9.923  53.032 18.062 1.00 19.27 ? 391 PHE A CB  1 
ATOM   1604 C  CG  . PHE A 1 212 ? -8.459  53.329 18.010 1.00 22.49 ? 391 PHE A CG  1 
ATOM   1605 C  CD1 . PHE A 1 212 ? -7.716  53.012 16.883 1.00 24.48 ? 391 PHE A CD1 1 
ATOM   1606 C  CD2 . PHE A 1 212 ? -7.829  53.954 19.072 1.00 25.09 ? 391 PHE A CD2 1 
ATOM   1607 C  CE1 . PHE A 1 212 ? -6.368  53.312 16.816 1.00 26.89 ? 391 PHE A CE1 1 
ATOM   1608 C  CE2 . PHE A 1 212 ? -6.486  54.257 19.014 1.00 26.81 ? 391 PHE A CE2 1 
ATOM   1609 C  CZ  . PHE A 1 212 ? -5.753  53.933 17.880 1.00 25.95 ? 391 PHE A CZ  1 
ATOM   1610 N  N   . ASP A 1 213 ? -12.335 52.481 20.100 1.00 19.05 ? 392 ASP A N   1 
ATOM   1611 C  CA  . ASP A 1 213 ? -13.776 52.692 20.252 1.00 18.80 ? 392 ASP A CA  1 
ATOM   1612 C  C   . ASP A 1 213 ? -14.019 54.060 19.602 1.00 17.88 ? 392 ASP A C   1 
ATOM   1613 O  O   . ASP A 1 213 ? -13.288 55.021 19.850 1.00 16.87 ? 392 ASP A O   1 
ATOM   1614 C  CB  . ASP A 1 213 ? -14.196 52.760 21.716 1.00 20.81 ? 392 ASP A CB  1 
ATOM   1615 C  CG  . ASP A 1 213 ? -15.607 53.308 21.877 1.00 22.84 ? 392 ASP A CG  1 
ATOM   1616 O  OD1 . ASP A 1 213 ? -16.554 52.643 21.404 1.00 22.21 ? 392 ASP A OD1 1 
ATOM   1617 O  OD2 . ASP A 1 213 ? -15.757 54.405 22.459 1.00 21.27 ? 392 ASP A OD2 1 
ATOM   1618 N  N   . ALA A 1 214 ? -15.055 54.154 18.776 1.00 16.44 ? 393 ALA A N   1 
ATOM   1619 C  CA  . ALA A 1 214 ? -15.346 55.396 18.062 1.00 18.51 ? 393 ALA A CA  1 
ATOM   1620 C  C   . ALA A 1 214 ? -15.554 56.623 18.940 1.00 18.16 ? 393 ALA A C   1 
ATOM   1621 O  O   . ALA A 1 214 ? -15.009 57.696 18.659 1.00 18.11 ? 393 ALA A O   1 
ATOM   1622 C  CB  . ALA A 1 214 ? -16.562 55.196 17.169 1.00 19.57 ? 393 ALA A CB  1 
ATOM   1623 N  N   . ASP A 1 215 ? -16.359 56.493 19.985 1.00 16.44 ? 394 ASP A N   1 
ATOM   1624 C  CA  . ASP A 1 215 ? -16.583 57.655 20.831 1.00 16.72 ? 394 ASP A CA  1 
ATOM   1625 C  C   . ASP A 1 215 ? -15.355 58.081 21.616 1.00 17.00 ? 394 ASP A C   1 
ATOM   1626 O  O   . ASP A 1 215 ? -15.011 59.252 21.653 1.00 16.23 ? 394 ASP A O   1 
ATOM   1627 C  CB  . ASP A 1 215 ? -17.724 57.416 21.812 1.00 17.72 ? 394 ASP A CB  1 
ATOM   1628 C  CG  . ASP A 1 215 ? -18.027 58.640 22.642 1.00 19.30 ? 394 ASP A CG  1 
ATOM   1629 O  OD1 . ASP A 1 215 ? -17.412 58.816 23.723 1.00 21.40 ? 394 ASP A OD1 1 
ATOM   1630 O  OD2 . ASP A 1 215 ? -18.865 59.457 22.196 1.00 20.05 ? 394 ASP A OD2 1 
ATOM   1631 N  N   . GLU A 1 216 ? -14.682 57.129 22.243 1.00 16.01 ? 395 GLU A N   1 
ATOM   1632 C  CA  . GLU A 1 216 ? -13.520 57.503 23.031 1.00 17.81 ? 395 GLU A CA  1 
ATOM   1633 C  C   . GLU A 1 216 ? -12.437 58.142 22.177 1.00 18.34 ? 395 GLU A C   1 
ATOM   1634 O  O   . GLU A 1 216 ? -11.814 59.138 22.567 1.00 18.14 ? 395 GLU A O   1 
ATOM   1635 C  CB  . GLU A 1 216 ? -12.973 56.278 23.765 1.00 19.37 ? 395 GLU A CB  1 
ATOM   1636 C  CG  . GLU A 1 216 ? -11.776 56.599 24.641 1.00 23.36 ? 395 GLU A CG  1 
ATOM   1637 C  CD  . GLU A 1 216 ? -11.294 55.393 25.442 1.00 25.64 ? 395 GLU A CD  1 
ATOM   1638 O  OE1 . GLU A 1 216 ? -10.089 55.336 25.757 1.00 24.89 ? 395 GLU A OE1 1 
ATOM   1639 O  OE2 . GLU A 1 216 ? -12.121 54.510 25.759 1.00 28.54 ? 395 GLU A OE2 1 
ATOM   1640 N  N   . ARG A 1 217 ? -12.214 57.587 20.999 1.00 19.17 ? 396 ARG A N   1 
ATOM   1641 C  CA  . ARG A 1 217 ? -11.176 58.130 20.136 1.00 20.65 ? 396 ARG A CA  1 
ATOM   1642 C  C   . ARG A 1 217 ? -11.570 59.507 19.601 1.00 19.76 ? 396 ARG A C   1 
ATOM   1643 O  O   . ARG A 1 217 ? -10.722 60.400 19.467 1.00 20.07 ? 396 ARG A O   1 
ATOM   1644 C  CB  . ARG A 1 217 ? -10.904 57.158 18.984 1.00 23.18 ? 396 ARG A CB  1 
ATOM   1645 C  CG  . ARG A 1 217 ? -9.743  57.541 18.078 1.00 28.40 ? 396 ARG A CG  1 
ATOM   1646 C  CD  . ARG A 1 217 ? -8.422  57.638 18.845 1.00 33.43 ? 396 ARG A CD  1 
ATOM   1647 N  NE  . ARG A 1 217 ? -7.279  57.659 17.934 1.00 37.94 ? 396 ARG A NE  1 
ATOM   1648 C  CZ  . ARG A 1 217 ? -6.043  58.021 18.275 1.00 40.35 ? 396 ARG A CZ  1 
ATOM   1649 N  NH1 . ARG A 1 217 ? -5.769  58.406 19.521 1.00 40.70 ? 396 ARG A NH1 1 
ATOM   1650 N  NH2 . ARG A 1 217 ? -5.076  57.994 17.366 1.00 40.93 ? 396 ARG A NH2 1 
ATOM   1651 N  N   . ALA A 1 218 ? -12.853 59.702 19.314 1.00 18.22 ? 397 ALA A N   1 
ATOM   1652 C  CA  . ALA A 1 218 ? -13.277 60.999 18.805 1.00 18.14 ? 397 ALA A CA  1 
ATOM   1653 C  C   . ALA A 1 218 ? -13.002 62.117 19.809 1.00 20.33 ? 397 ALA A C   1 
ATOM   1654 O  O   . ALA A 1 218 ? -12.584 63.212 19.431 1.00 22.30 ? 397 ALA A O   1 
ATOM   1655 C  CB  . ALA A 1 218 ? -14.775 60.968 18.445 1.00 18.37 ? 397 ALA A CB  1 
ATOM   1656 N  N   . ARG A 1 219 ? -13.222 61.855 21.092 1.00 18.95 ? 398 ARG A N   1 
ATOM   1657 C  CA  . ARG A 1 219 ? -13.007 62.907 22.063 1.00 20.27 ? 398 ARG A CA  1 
ATOM   1658 C  C   . ARG A 1 219 ? -11.573 62.948 22.550 1.00 22.47 ? 398 ARG A C   1 
ATOM   1659 O  O   . ARG A 1 219 ? -11.148 63.922 23.156 1.00 23.01 ? 398 ARG A O   1 
ATOM   1660 C  CB  . ARG A 1 219 ? -13.991 62.780 23.233 1.00 20.91 ? 398 ARG A CB  1 
ATOM   1661 C  CG  . ARG A 1 219 ? -13.866 61.545 24.064 1.00 20.55 ? 398 ARG A CG  1 
ATOM   1662 C  CD  . ARG A 1 219 ? -15.059 61.450 25.045 1.00 21.10 ? 398 ARG A CD  1 
ATOM   1663 N  NE  . ARG A 1 219 ? -16.343 61.308 24.352 1.00 19.48 ? 398 ARG A NE  1 
ATOM   1664 C  CZ  . ARG A 1 219 ? -17.273 62.260 24.287 1.00 19.95 ? 398 ARG A CZ  1 
ATOM   1665 N  NH1 . ARG A 1 219 ? -17.070 63.429 24.873 1.00 21.09 ? 398 ARG A NH1 1 
ATOM   1666 N  NH2 . ARG A 1 219 ? -18.404 62.043 23.636 1.00 17.93 ? 398 ARG A NH2 1 
ATOM   1667 N  N   . ALA A 1 220 ? -10.813 61.897 22.263 1.00 25.01 ? 399 ALA A N   1 
ATOM   1668 C  CA  . ALA A 1 220 ? -9.410  61.880 22.662 1.00 27.59 ? 399 ALA A CA  1 
ATOM   1669 C  C   . ALA A 1 220 ? -8.683  62.915 21.816 1.00 30.71 ? 399 ALA A C   1 
ATOM   1670 O  O   . ALA A 1 220 ? -7.727  63.537 22.269 1.00 31.80 ? 399 ALA A O   1 
ATOM   1671 C  CB  . ALA A 1 220 ? -8.798  60.490 22.433 1.00 25.86 ? 399 ALA A CB  1 
ATOM   1672 N  N   . LYS A 1 221 ? -9.142  63.096 20.582 1.00 35.63 ? 400 LYS A N   1 
ATOM   1673 C  CA  . LYS A 1 221 ? -8.528  64.063 19.683 1.00 39.58 ? 400 LYS A CA  1 
ATOM   1674 C  C   . LYS A 1 221 ? -8.456  65.416 20.378 1.00 41.94 ? 400 LYS A C   1 
ATOM   1675 O  O   . LYS A 1 221 ? -7.543  66.201 20.128 1.00 42.19 ? 400 LYS A O   1 
ATOM   1676 C  CB  . LYS A 1 221 ? -9.322  64.165 18.379 1.00 40.62 ? 400 LYS A CB  1 
ATOM   1677 C  CG  . LYS A 1 221 ? -9.210  62.923 17.513 1.00 43.15 ? 400 LYS A CG  1 
ATOM   1678 C  CD  . LYS A 1 221 ? -10.121 62.996 16.301 1.00 45.68 ? 400 LYS A CD  1 
ATOM   1679 C  CE  . LYS A 1 221 ? -9.808  64.202 15.440 1.00 46.45 ? 400 LYS A CE  1 
ATOM   1680 N  NZ  . LYS A 1 221 ? -10.737 64.290 14.276 1.00 48.39 ? 400 LYS A NZ  1 
ATOM   1681 N  N   . VAL A 1 222 ? -9.425  65.674 21.251 1.00 44.55 ? 401 VAL A N   1 
ATOM   1682 C  CA  . VAL A 1 222 ? -9.456  66.910 22.028 1.00 48.11 ? 401 VAL A CA  1 
ATOM   1683 C  C   . VAL A 1 222 ? -8.769  66.592 23.359 1.00 50.57 ? 401 VAL A C   1 
ATOM   1684 O  O   . VAL A 1 222 ? -9.381  66.635 24.428 1.00 50.40 ? 401 VAL A O   1 
ATOM   1685 C  CB  . VAL A 1 222 ? -10.902 67.383 22.305 1.00 48.12 ? 401 VAL A CB  1 
ATOM   1686 C  CG1 . VAL A 1 222 ? -11.063 68.828 21.860 1.00 49.36 ? 401 VAL A CG1 1 
ATOM   1687 C  CG2 . VAL A 1 222 ? -11.897 66.492 21.587 1.00 49.04 ? 401 VAL A CG2 1 
ATOM   1688 N  N   . LYS A 1 223 ? -7.490  66.244 23.259 1.00 52.68 ? 402 LYS A N   1 
ATOM   1689 C  CA  . LYS A 1 223 ? -6.645  65.906 24.399 1.00 54.88 ? 402 LYS A CA  1 
ATOM   1690 C  C   . LYS A 1 223 ? -5.214  65.926 23.887 1.00 56.53 ? 402 LYS A C   1 
ATOM   1691 O  O   . LYS A 1 223 ? -4.276  66.230 24.625 1.00 57.03 ? 402 LYS A O   1 
ATOM   1692 C  CB  . LYS A 1 223 ? -6.969  64.506 24.921 1.00 55.64 ? 402 LYS A CB  1 
ATOM   1693 C  CG  . LYS A 1 223 ? -5.839  63.877 25.731 1.00 56.43 ? 402 LYS A CG  1 
ATOM   1694 C  CD  . LYS A 1 223 ? -6.046  62.376 25.908 1.00 56.58 ? 402 LYS A CD  1 
ATOM   1695 C  CE  . LYS A 1 223 ? -4.815  61.724 26.529 1.00 57.03 ? 402 LYS A CE  1 
ATOM   1696 N  NZ  . LYS A 1 223 ? -4.932  60.241 26.618 1.00 56.04 ? 402 LYS A NZ  1 
ATOM   1697 N  N   . TYR A 1 224 ? -5.070  65.606 22.605 1.00 57.96 ? 403 TYR A N   1 
ATOM   1698 C  CA  . TYR A 1 224 ? -3.777  65.563 21.936 1.00 59.15 ? 403 TYR A CA  1 
ATOM   1699 C  C   . TYR A 1 224 ? -2.791  64.696 22.719 1.00 60.30 ? 403 TYR A C   1 
ATOM   1700 O  O   . TYR A 1 224 ? -1.669  65.168 23.010 1.00 60.97 ? 403 TYR A O   1 
ATOM   1701 C  CB  . TYR A 1 224 ? -3.213  66.976 21.771 1.00 59.14 ? 403 TYR A CB  1 
ATOM   1702 C  CG  . TYR A 1 224 ? -4.183  67.963 21.158 1.00 58.60 ? 403 TYR A CG  1 
ATOM   1703 C  CD1 . TYR A 1 224 ? -5.193  68.532 21.919 1.00 58.68 ? 403 TYR A CD1 1 
ATOM   1704 C  CD2 . TYR A 1 224 ? -4.092  68.318 19.818 1.00 58.63 ? 403 TYR A CD2 1 
ATOM   1705 C  CE1 . TYR A 1 224 ? -6.085  69.427 21.367 1.00 57.53 ? 403 TYR A CE1 1 
ATOM   1706 C  CE2 . TYR A 1 224 ? -4.984  69.212 19.255 1.00 57.73 ? 403 TYR A CE2 1 
ATOM   1707 C  CZ  . TYR A 1 224 ? -5.978  69.762 20.037 1.00 57.65 ? 403 TYR A CZ  1 
ATOM   1708 O  OH  . TYR A 1 224 ? -6.885  70.638 19.493 1.00 56.75 ? 403 TYR A OH  1 
HETATM 1709 FE FE  . FE2 B 2 .   ? 0.326   45.740 27.871 1.00 15.89 ? 501 FE2 A FE  1 
HETATM 1710 C  C1  . 4HG C 3 .   ? 6.402   47.732 23.948 1.00 32.53 ? 801 4HG A C1  1 
HETATM 1711 C  C2  . 4HG C 3 .   ? 5.605   48.926 24.148 1.00 36.55 ? 801 4HG A C2  1 
HETATM 1712 C  C3  . 4HG C 3 .   ? 4.348   48.772 24.866 1.00 36.57 ? 801 4HG A C3  1 
HETATM 1713 C  C4  . 4HG C 3 .   ? 5.894   46.467 24.465 1.00 29.14 ? 801 4HG A C4  1 
HETATM 1714 C  C5  . 4HG C 3 .   ? 4.620   46.347 25.178 1.00 25.41 ? 801 4HG A C5  1 
HETATM 1715 C  C6  . 4HG C 3 .   ? 3.801   47.537 25.405 1.00 29.77 ? 801 4HG A C6  1 
HETATM 1716 C  C7  . 4HG C 3 .   ? 2.561   47.422 26.170 1.00 24.70 ? 801 4HG A C7  1 
HETATM 1717 N  N1  . 4HG C 3 .   ? 2.123   46.191 26.702 1.00 19.45 ? 801 4HG A N1  1 
HETATM 1718 C  C8  . 4HG C 3 .   ? 2.909   45.036 26.474 1.00 19.43 ? 801 4HG A C8  1 
HETATM 1719 C  C9  . 4HG C 3 .   ? 4.152   45.073 25.705 1.00 22.20 ? 801 4HG A C9  1 
HETATM 1720 I  I1  . 4HG C 3 .   ? 3.255   50.452 25.281 1.00 66.97 ? 801 4HG A I1  1 
HETATM 1721 O  O1  . 4HG C 3 .   ? 4.832   43.935 25.524 1.00 22.30 ? 801 4HG A O1  1 
HETATM 1722 C  C10 . 4HG C 3 .   ? 2.322   43.788 27.058 1.00 19.34 ? 801 4HG A C10 1 
HETATM 1723 C  C11 . 4HG C 3 .   ? 2.019   41.436 26.967 1.00 17.78 ? 801 4HG A C11 1 
HETATM 1724 C  C12 . 4HG C 3 .   ? 2.639   40.204 26.313 1.00 15.81 ? 801 4HG A C12 1 
HETATM 1725 O  O2  . 4HG C 3 .   ? 2.223   39.085 26.655 1.00 18.02 ? 801 4HG A O2  1 
HETATM 1726 O  O3  . 4HG C 3 .   ? 1.408   43.881 27.875 1.00 21.41 ? 801 4HG A O3  1 
HETATM 1727 O  O4  . 4HG C 3 .   ? 3.593   40.351 25.512 1.00 20.40 ? 801 4HG A O4  1 
HETATM 1728 N  N2  . 4HG C 3 .   ? 2.775   42.591 26.678 1.00 17.73 ? 801 4HG A N2  1 
HETATM 1729 O  O   . HOH D 4 .   ? -0.570  44.936 26.165 1.00 16.42 ? 601 HOH A O   1 
HETATM 1730 O  O   . HOH D 4 .   ? 0.792   50.995 25.712 1.00 14.32 ? 602 HOH A O   1 
HETATM 1731 O  O   . HOH D 4 .   ? 3.392   42.463 20.997 1.00 15.90 ? 603 HOH A O   1 
HETATM 1732 O  O   . HOH D 4 .   ? 1.109   44.279 23.974 1.00 19.29 ? 604 HOH A O   1 
HETATM 1733 O  O   . HOH D 4 .   ? -4.685  47.233 30.197 1.00 18.80 ? 605 HOH A O   1 
HETATM 1734 O  O   . HOH D 4 .   ? 16.687  54.351 24.777 1.00 27.55 ? 606 HOH A O   1 
HETATM 1735 O  O   . HOH D 4 .   ? 7.051   51.106 26.609 1.00 25.04 ? 607 HOH A O   1 
HETATM 1736 O  O   . HOH D 4 .   ? 10.140  31.954 20.171 1.00 34.29 ? 608 HOH A O   1 
HETATM 1737 O  O   . HOH D 4 .   ? 4.184   24.497 20.352 1.00 43.09 ? 609 HOH A O   1 
HETATM 1738 O  O   . HOH D 4 .   ? -10.491 32.418 27.524 1.00 25.33 ? 610 HOH A O   1 
HETATM 1739 O  O   . HOH D 4 .   ? -11.258 59.984 25.326 1.00 29.83 ? 611 HOH A O   1 
HETATM 1740 O  O   . HOH D 4 .   ? -8.719  54.710 29.935 1.00 30.85 ? 612 HOH A O   1 
HETATM 1741 O  O   . HOH D 4 .   ? 6.949   38.967 23.246 1.00 24.00 ? 613 HOH A O   1 
HETATM 1742 O  O   . HOH D 4 .   ? 7.040   33.558 34.209 1.00 24.25 ? 614 HOH A O   1 
HETATM 1743 O  O   . HOH D 4 .   ? -1.827  29.534 29.772 1.00 30.35 ? 615 HOH A O   1 
HETATM 1744 O  O   . HOH D 4 .   ? 9.579   34.560 34.911 1.00 25.36 ? 616 HOH A O   1 
HETATM 1745 O  O   . HOH D 4 .   ? 4.447   41.520 23.232 1.00 38.87 ? 617 HOH A O   1 
HETATM 1746 O  O   . HOH D 4 .   ? 16.972  51.126 18.926 1.00 23.45 ? 618 HOH A O   1 
HETATM 1747 O  O   . HOH D 4 .   ? 13.726  38.952 28.174 1.00 21.65 ? 619 HOH A O   1 
HETATM 1748 O  O   . HOH D 4 .   ? 12.492  44.107 32.834 1.00 42.17 ? 620 HOH A O   1 
HETATM 1749 O  O   . HOH D 4 .   ? 17.887  48.529 16.126 1.00 36.83 ? 621 HOH A O   1 
HETATM 1750 O  O   . HOH D 4 .   ? -11.120 54.615 28.800 1.00 37.15 ? 622 HOH A O   1 
HETATM 1751 O  O   . HOH D 4 .   ? -11.187 48.873 27.354 1.00 21.65 ? 623 HOH A O   1 
HETATM 1752 O  O   . HOH D 4 .   ? 8.172   41.593 35.345 1.00 44.17 ? 624 HOH A O   1 
HETATM 1753 O  O   . HOH D 4 .   ? 5.787   45.104 37.907 1.00 33.32 ? 625 HOH A O   1 
HETATM 1754 O  O   . HOH D 4 .   ? -0.460  52.702 14.732 1.00 29.45 ? 626 HOH A O   1 
HETATM 1755 O  O   . HOH D 4 .   ? -18.939 43.745 28.563 1.00 35.02 ? 627 HOH A O   1 
HETATM 1756 O  O   . HOH D 4 .   ? -2.304  27.737 20.596 1.00 26.27 ? 628 HOH A O   1 
HETATM 1757 O  O   . HOH D 4 .   ? -17.401 46.483 28.557 1.00 42.93 ? 629 HOH A O   1 
HETATM 1758 O  O   . HOH D 4 .   ? 16.074  31.770 22.974 1.00 42.10 ? 630 HOH A O   1 
HETATM 1759 O  O   . HOH D 4 .   ? -14.686 54.285 26.545 1.00 38.32 ? 631 HOH A O   1 
HETATM 1760 O  O   . HOH D 4 .   ? 16.266  43.336 14.904 1.00 29.22 ? 632 HOH A O   1 
HETATM 1761 O  O   . HOH D 4 .   ? -3.859  56.340 27.901 1.00 27.90 ? 633 HOH A O   1 
HETATM 1762 O  O   . HOH D 4 .   ? 10.439  27.078 26.692 1.00 38.24 ? 634 HOH A O   1 
HETATM 1763 O  O   . HOH D 4 .   ? -20.509 47.733 15.676 1.00 58.13 ? 635 HOH A O   1 
HETATM 1764 O  O   . HOH D 4 .   ? -16.613 57.393 25.827 1.00 26.44 ? 636 HOH A O   1 
HETATM 1765 O  O   . HOH D 4 .   ? -13.241 51.901 28.545 1.00 47.98 ? 637 HOH A O   1 
HETATM 1766 O  O   . HOH D 4 .   ? 14.696  33.722 17.387 1.00 50.18 ? 638 HOH A O   1 
HETATM 1767 O  O   . HOH D 4 .   ? 11.752  49.373 14.734 1.00 40.41 ? 639 HOH A O   1 
HETATM 1768 O  O   . HOH D 4 .   ? 8.823   47.547 31.628 1.00 28.12 ? 640 HOH A O   1 
HETATM 1769 O  O   . HOH D 4 .   ? -10.533 35.654 11.124 1.00 37.12 ? 641 HOH A O   1 
HETATM 1770 O  O   . HOH D 4 .   ? -13.859 57.986 16.067 1.00 30.88 ? 642 HOH A O   1 
HETATM 1771 O  O   . HOH D 4 .   ? -11.114 52.111 26.753 1.00 31.51 ? 643 HOH A O   1 
HETATM 1772 O  O   . HOH D 4 .   ? 4.605   49.340 37.396 1.00 34.17 ? 644 HOH A O   1 
HETATM 1773 O  O   . HOH D 4 .   ? 20.636  44.395 27.686 1.00 45.27 ? 645 HOH A O   1 
HETATM 1774 O  O   . HOH D 4 .   ? 3.921   26.689 22.760 1.00 38.57 ? 646 HOH A O   1 
HETATM 1775 O  O   . HOH D 4 .   ? 14.318  27.843 27.210 1.00 44.42 ? 647 HOH A O   1 
HETATM 1776 O  O   . HOH D 4 .   ? 0.133   51.988 33.629 1.00 32.59 ? 648 HOH A O   1 
HETATM 1777 O  O   . HOH D 4 .   ? 2.766   51.397 34.863 1.00 34.61 ? 649 HOH A O   1 
HETATM 1778 O  O   . HOH D 4 .   ? 10.077  39.435 7.324  1.00 30.30 ? 650 HOH A O   1 
HETATM 1779 O  O   . HOH D 4 .   ? 11.059  45.465 28.781 1.00 29.38 ? 651 HOH A O   1 
HETATM 1780 O  O   . HOH D 4 .   ? -18.660 54.044 20.801 1.00 39.02 ? 652 HOH A O   1 
HETATM 1781 O  O   . HOH D 4 .   ? 2.649   51.169 28.163 1.00 33.03 ? 653 HOH A O   1 
HETATM 1782 O  O   . HOH D 4 .   ? 9.239   50.333 13.875 1.00 34.42 ? 654 HOH A O   1 
HETATM 1783 O  O   . HOH D 4 .   ? 17.000  44.304 24.342 1.00 22.49 ? 655 HOH A O   1 
HETATM 1784 O  O   . HOH D 4 .   ? -18.989 48.743 27.590 1.00 34.02 ? 656 HOH A O   1 
HETATM 1785 O  O   . HOH D 4 .   ? -11.181 41.854 32.833 1.00 26.62 ? 657 HOH A O   1 
HETATM 1786 O  O   . HOH D 4 .   ? -1.751  25.379 15.874 1.00 31.56 ? 658 HOH A O   1 
HETATM 1787 O  O   . HOH D 4 .   ? 21.299  42.157 29.124 1.00 37.33 ? 659 HOH A O   1 
HETATM 1788 O  O   . HOH D 4 .   ? 19.287  43.180 24.875 1.00 34.39 ? 660 HOH A O   1 
HETATM 1789 O  O   . HOH D 4 .   ? -22.938 35.881 21.058 1.00 41.49 ? 661 HOH A O   1 
HETATM 1790 O  O   . HOH D 4 .   ? -2.170  48.218 9.096  1.00 32.68 ? 662 HOH A O   1 
HETATM 1791 O  O   . HOH D 4 .   ? -18.521 46.282 19.956 1.00 35.98 ? 663 HOH A O   1 
HETATM 1792 O  O   . HOH D 4 .   ? -16.296 42.160 30.861 1.00 40.75 ? 664 HOH A O   1 
HETATM 1793 O  O   . HOH D 4 .   ? -9.833  52.895 32.544 1.00 39.61 ? 665 HOH A O   1 
HETATM 1794 O  O   . HOH D 4 .   ? -2.069  27.010 9.123  1.00 32.47 ? 666 HOH A O   1 
HETATM 1795 O  O   . HOH D 4 .   ? -9.323  27.922 21.913 1.00 34.39 ? 667 HOH A O   1 
HETATM 1796 O  O   . HOH D 4 .   ? -5.853  53.000 11.511 1.00 40.73 ? 668 HOH A O   1 
HETATM 1797 O  O   . HOH D 4 .   ? -3.260  43.562 42.366 1.00 40.59 ? 669 HOH A O   1 
HETATM 1798 O  O   . HOH D 4 .   ? 17.054  30.211 26.932 1.00 39.08 ? 670 HOH A O   1 
HETATM 1799 O  O   . HOH D 4 .   ? 0.101   53.126 29.282 1.00 48.63 ? 671 HOH A O   1 
HETATM 1800 O  O   . HOH D 4 .   ? -1.536  39.573 3.517  1.00 36.73 ? 672 HOH A O   1 
HETATM 1801 O  O   . HOH D 4 .   ? 10.253  44.817 4.045  1.00 40.97 ? 673 HOH A O   1 
HETATM 1802 O  O   . HOH D 4 .   ? -2.135  53.513 35.194 1.00 49.73 ? 674 HOH A O   1 
HETATM 1803 O  O   . HOH D 4 .   ? 13.427  33.788 9.150  1.00 36.25 ? 675 HOH A O   1 
HETATM 1804 O  O   . HOH D 4 .   ? 15.657  38.563 35.688 1.00 41.75 ? 676 HOH A O   1 
HETATM 1805 O  O   . HOH D 4 .   ? 0.864   25.859 20.925 1.00 40.56 ? 677 HOH A O   1 
HETATM 1806 O  O   . HOH D 4 .   ? -2.655  48.113 39.113 1.00 42.97 ? 678 HOH A O   1 
HETATM 1807 O  O   . HOH D 4 .   ? 6.645   34.419 4.491  1.00 38.64 ? 679 HOH A O   1 
HETATM 1808 O  O   . HOH D 4 .   ? -9.381  29.459 14.397 1.00 43.64 ? 680 HOH A O   1 
HETATM 1809 O  O   . HOH D 4 .   ? -6.244  66.422 17.567 1.00 38.48 ? 681 HOH A O   1 
HETATM 1810 O  O   . HOH D 4 .   ? -17.135 33.279 9.312  1.00 38.26 ? 682 HOH A O   1 
HETATM 1811 O  O   . HOH D 4 .   ? -12.359 60.291 15.405 1.00 38.98 ? 683 HOH A O   1 
HETATM 1812 O  O   . HOH D 4 .   ? 18.386  44.688 6.719  1.00 43.27 ? 684 HOH A O   1 
HETATM 1813 O  O   . HOH D 4 .   ? 20.020  41.418 14.203 1.00 45.62 ? 685 HOH A O   1 
HETATM 1814 O  O   . HOH D 4 .   ? 5.406   33.998 39.828 1.00 47.97 ? 686 HOH A O   1 
HETATM 1815 O  O   . HOH D 4 .   ? -23.186 52.055 22.839 1.00 45.15 ? 687 HOH A O   1 
HETATM 1816 O  O   . HOH D 4 .   ? -3.100  54.388 14.327 1.00 45.96 ? 688 HOH A O   1 
HETATM 1817 O  O   . HOH D 4 .   ? 21.674  38.107 10.065 1.00 43.91 ? 689 HOH A O   1 
HETATM 1818 O  O   . HOH D 4 .   ? -0.727  42.054 2.953  1.00 47.12 ? 690 HOH A O   1 
HETATM 1819 O  O   . HOH D 4 .   ? -8.947  30.495 28.987 1.00 46.76 ? 691 HOH A O   1 
HETATM 1820 O  O   . HOH D 4 .   ? -17.080 30.837 32.036 1.00 50.36 ? 692 HOH A O   1 
HETATM 1821 O  O   . HOH D 4 .   ? -1.554  23.572 9.435  1.00 50.95 ? 693 HOH A O   1 
HETATM 1822 O  O   . HOH D 4 .   ? 16.871  37.018 21.516 1.00 43.11 ? 694 HOH A O   1 
HETATM 1823 O  O   . HOH D 4 .   ? 16.039  34.752 9.671  1.00 47.72 ? 695 HOH A O   1 
HETATM 1824 O  O   . HOH D 4 .   ? 15.022  50.797 14.951 1.00 34.62 ? 696 HOH A O   1 
HETATM 1825 O  O   . HOH D 4 .   ? -21.824 39.875 13.677 1.00 45.72 ? 697 HOH A O   1 
HETATM 1826 O  O   . HOH D 4 .   ? 19.157  47.767 13.798 1.00 48.19 ? 698 HOH A O   1 
HETATM 1827 O  O   . HOH D 4 .   ? 9.810   29.228 22.059 1.00 39.32 ? 699 HOH A O   1 
HETATM 1828 O  O   . HOH D 4 .   ? 20.477  40.487 31.456 1.00 45.10 ? 700 HOH A O   1 
HETATM 1829 O  O   . HOH D 4 .   ? 4.983   27.087 7.239  1.00 42.74 ? 701 HOH A O   1 
HETATM 1830 O  O   . HOH D 4 .   ? 6.183   47.553 38.984 1.00 48.47 ? 702 HOH A O   1 
HETATM 1831 O  O   . HOH D 4 .   ? -11.446 31.312 13.195 1.00 40.42 ? 703 HOH A O   1 
HETATM 1832 O  O   . HOH D 4 .   ? 19.537  37.711 25.294 1.00 53.22 ? 704 HOH A O   1 
HETATM 1833 O  O   . HOH D 4 .   ? -11.974 38.149 34.725 1.00 39.80 ? 705 HOH A O   1 
HETATM 1834 O  O   . HOH D 4 .   ? -9.325  27.499 17.638 1.00 53.60 ? 706 HOH A O   1 
HETATM 1835 O  O   . HOH D 4 .   ? 18.191  33.253 29.528 1.00 37.99 ? 707 HOH A O   1 
HETATM 1836 O  O   . HOH D 4 .   ? 1.204   29.930 36.201 1.00 45.23 ? 708 HOH A O   1 
HETATM 1837 O  O   . HOH D 4 .   ? 12.489  49.271 11.510 1.00 48.10 ? 709 HOH A O   1 
HETATM 1838 O  O   . HOH D 4 .   ? 17.786  44.169 16.846 1.00 50.69 ? 710 HOH A O   1 
HETATM 1839 O  O   . HOH D 4 .   ? 9.713   31.597 15.794 1.00 56.44 ? 711 HOH A O   1 
HETATM 1840 O  O   . HOH D 4 .   ? 11.412  24.489 23.714 1.00 53.03 ? 712 HOH A O   1 
HETATM 1841 O  O   . HOH D 4 .   ? -23.228 36.187 23.626 1.00 42.63 ? 713 HOH A O   1 
HETATM 1842 O  O   . HOH D 4 .   ? -7.996  51.477 11.095 1.00 34.00 ? 714 HOH A O   1 
HETATM 1843 O  O   . HOH D 4 .   ? 10.264  47.081 8.541  1.00 50.82 ? 715 HOH A O   1 
HETATM 1844 O  O   . HOH D 4 .   ? 12.113  40.785 6.229  1.00 49.25 ? 716 HOH A O   1 
HETATM 1845 O  O   . HOH D 4 .   ? 13.337  50.266 7.642  1.00 56.99 ? 717 HOH A O   1 
HETATM 1846 O  O   . HOH D 4 .   ? 4.653   43.040 -0.518 1.00 41.46 ? 718 HOH A O   1 
HETATM 1847 O  O   . HOH D 4 .   ? 17.657  41.799 33.822 1.00 50.67 ? 719 HOH A O   1 
HETATM 1848 O  O   . HOH D 4 .   ? 1.200   25.682 3.969  1.00 58.01 ? 720 HOH A O   1 
HETATM 1849 O  O   . HOH D 4 .   ? -4.032  62.014 20.306 1.00 47.41 ? 721 HOH A O   1 
HETATM 1850 O  O   . HOH D 4 .   ? -4.956  30.217 29.545 1.00 57.82 ? 722 HOH A O   1 
HETATM 1851 O  O   . HOH D 4 .   ? -7.676  32.938 31.063 1.00 47.48 ? 723 HOH A O   1 
HETATM 1852 O  O   . HOH D 4 .   ? 16.730  33.351 19.043 1.00 60.91 ? 724 HOH A O   1 
HETATM 1853 O  O   . HOH D 4 .   ? -7.222  59.078 14.150 1.00 42.03 ? 725 HOH A O   1 
HETATM 1854 O  O   . HOH D 4 .   ? -9.774  55.359 14.186 1.00 44.83 ? 726 HOH A O   1 
HETATM 1855 O  O   . HOH D 4 .   ? -3.857  51.496 10.501 1.00 43.58 ? 727 HOH A O   1 
HETATM 1856 O  O   . HOH D 4 .   ? -11.015 50.184 10.029 1.00 42.53 ? 728 HOH A O   1 
HETATM 1857 O  O   . HOH D 4 .   ? -0.704  49.747 36.896 1.00 49.97 ? 729 HOH A O   1 
HETATM 1858 O  O   . HOH D 4 .   ? -3.129  58.393 12.516 1.00 57.07 ? 730 HOH A O   1 
HETATM 1859 O  O   . HOH D 4 .   ? -2.961  44.760 6.689  1.00 49.48 ? 731 HOH A O   1 
HETATM 1860 O  O   . HOH D 4 .   ? 18.760  39.470 20.834 1.00 57.42 ? 732 HOH A O   1 
HETATM 1861 O  O   . HOH D 4 .   ? 16.222  35.462 7.203  1.00 51.64 ? 733 HOH A O   1 
HETATM 1862 O  O   . HOH D 4 .   ? 9.145   48.202 10.814 1.00 48.41 ? 734 HOH A O   1 
HETATM 1863 O  O   . HOH D 4 .   ? 5.605   51.000 9.692  1.00 58.42 ? 735 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   180 ?   ?   ?   A . n 
A 1 2   PRO 2   181 ?   ?   ?   A . n 
A 1 3   ASN 3   182 ?   ?   ?   A . n 
A 1 4   GLY 4   183 ?   ?   ?   A . n 
A 1 5   GLN 5   184 ?   ?   ?   A . n 
A 1 6   THR 6   185 ?   ?   ?   A . n 
A 1 7   LYS 7   186 ?   ?   ?   A . n 
A 1 8   PRO 8   187 ?   ?   ?   A . n 
A 1 9   LEU 9   188 188 LEU LEU A . n 
A 1 10  PRO 10  189 189 PRO PRO A . n 
A 1 11  ALA 11  190 190 ALA ALA A . n 
A 1 12  LEU 12  191 191 LEU LEU A . n 
A 1 13  LYS 13  192 192 LYS LYS A . n 
A 1 14  LEU 14  193 193 LEU LEU A . n 
A 1 15  ALA 15  194 194 ALA ALA A . n 
A 1 16  LEU 16  195 195 LEU LEU A . n 
A 1 17  GLU 17  196 196 GLU GLU A . n 
A 1 18  TYR 18  197 197 TYR TYR A . n 
A 1 19  ILE 19  198 198 ILE ILE A . n 
A 1 20  VAL 20  199 199 VAL VAL A . n 
A 1 21  PRO 21  200 200 PRO PRO A . n 
A 1 22  CYS 22  201 201 CYS CYS A . n 
A 1 23  MET 23  202 202 MET MET A . n 
A 1 24  ASN 24  203 203 ASN ASN A . n 
A 1 25  LYS 25  204 204 LYS LYS A . n 
A 1 26  HIS 26  205 205 HIS HIS A . n 
A 1 27  GLY 27  206 206 GLY GLY A . n 
A 1 28  ILE 28  207 207 ILE ILE A . n 
A 1 29  CYS 29  208 208 CYS CYS A . n 
A 1 30  VAL 30  209 209 VAL VAL A . n 
A 1 31  VAL 31  210 210 VAL VAL A . n 
A 1 32  ASP 32  211 211 ASP ASP A . n 
A 1 33  ASP 33  212 212 ASP ASP A . n 
A 1 34  PHE 34  213 213 PHE PHE A . n 
A 1 35  LEU 35  214 214 LEU LEU A . n 
A 1 36  GLY 36  215 215 GLY GLY A . n 
A 1 37  LYS 37  216 216 LYS LYS A . n 
A 1 38  GLU 38  217 217 GLU GLU A . n 
A 1 39  THR 39  218 218 THR THR A . n 
A 1 40  GLY 40  219 219 GLY GLY A . n 
A 1 41  GLN 41  220 220 GLN GLN A . n 
A 1 42  GLN 42  221 221 GLN GLN A . n 
A 1 43  ILE 43  222 222 ILE ILE A . n 
A 1 44  GLY 44  223 223 GLY GLY A . n 
A 1 45  ASP 45  224 224 ASP ASP A . n 
A 1 46  GLU 46  225 225 GLU GLU A . n 
A 1 47  VAL 47  226 226 VAL VAL A . n 
A 1 48  ARG 48  227 227 ARG ARG A . n 
A 1 49  ALA 49  228 228 ALA ALA A . n 
A 1 50  LEU 50  229 229 LEU LEU A . n 
A 1 51  HIS 51  230 230 HIS HIS A . n 
A 1 52  ASP 52  231 231 ASP ASP A . n 
A 1 53  THR 53  232 232 THR THR A . n 
A 1 54  GLY 54  233 233 GLY GLY A . n 
A 1 55  LYS 55  234 234 LYS LYS A . n 
A 1 56  PHE 56  235 235 PHE PHE A . n 
A 1 57  THR 57  236 236 THR THR A . n 
A 1 58  ASP 58  237 237 ASP ASP A . n 
A 1 59  GLY 59  238 238 GLY GLY A . n 
A 1 60  GLN 60  239 239 GLN GLN A . n 
A 1 61  LEU 61  240 240 LEU LEU A . n 
A 1 62  VAL 62  241 241 VAL VAL A . n 
A 1 63  SER 63  242 242 SER SER A . n 
A 1 64  GLN 64  243 243 GLN GLN A . n 
A 1 65  LYS 65  244 244 LYS LYS A . n 
A 1 66  SER 66  245 245 SER SER A . n 
A 1 67  ASP 67  246 246 ASP ASP A . n 
A 1 68  SER 68  247 247 SER SER A . n 
A 1 69  SER 69  248 248 SER SER A . n 
A 1 70  LYS 70  249 249 LYS LYS A . n 
A 1 71  ASP 71  250 250 ASP ASP A . n 
A 1 72  ILE 72  251 251 ILE ILE A . n 
A 1 73  ARG 73  252 252 ARG ARG A . n 
A 1 74  GLY 74  253 253 GLY GLY A . n 
A 1 75  ASP 75  254 254 ASP ASP A . n 
A 1 76  LYS 76  255 255 LYS LYS A . n 
A 1 77  ILE 77  256 256 ILE ILE A . n 
A 1 78  THR 78  257 257 THR THR A . n 
A 1 79  TRP 79  258 258 TRP TRP A . n 
A 1 80  ILE 80  259 259 ILE ILE A . n 
A 1 81  GLU 81  260 260 GLU GLU A . n 
A 1 82  GLY 82  261 261 GLY GLY A . n 
A 1 83  LYS 83  262 262 LYS LYS A . n 
A 1 84  GLU 84  263 263 GLU GLU A . n 
A 1 85  PRO 85  264 264 PRO PRO A . n 
A 1 86  GLY 86  265 265 GLY GLY A . n 
A 1 87  CYS 87  266 266 CYS CYS A . n 
A 1 88  GLU 88  267 267 GLU GLU A . n 
A 1 89  THR 89  268 268 THR THR A . n 
A 1 90  ILE 90  269 269 ILE ILE A . n 
A 1 91  GLY 91  270 270 GLY GLY A . n 
A 1 92  LEU 92  271 271 LEU LEU A . n 
A 1 93  LEU 93  272 272 LEU LEU A . n 
A 1 94  MET 94  273 273 MET MET A . n 
A 1 95  SER 95  274 274 SER SER A . n 
A 1 96  SER 96  275 275 SER SER A . n 
A 1 97  MET 97  276 276 MET MET A . n 
A 1 98  ASP 98  277 277 ASP ASP A . n 
A 1 99  ASP 99  278 278 ASP ASP A . n 
A 1 100 LEU 100 279 279 LEU LEU A . n 
A 1 101 ILE 101 280 280 ILE ILE A . n 
A 1 102 ARG 102 281 281 ARG ARG A . n 
A 1 103 HIS 103 282 282 HIS HIS A . n 
A 1 104 CYS 104 283 283 CYS CYS A . n 
A 1 105 ASN 105 284 284 ASN ASN A . n 
A 1 106 GLY 106 285 285 GLY GLY A . n 
A 1 107 LYS 107 286 286 LYS LYS A . n 
A 1 108 LEU 108 287 287 LEU LEU A . n 
A 1 109 GLY 109 288 288 GLY GLY A . n 
A 1 110 SER 110 289 289 SER SER A . n 
A 1 111 TYR 111 290 290 TYR TYR A . n 
A 1 112 LYS 112 291 291 LYS LYS A . n 
A 1 113 ILE 113 292 292 ILE ILE A . n 
A 1 114 ASN 114 293 293 ASN ASN A . n 
A 1 115 GLY 115 294 294 GLY GLY A . n 
A 1 116 ARG 116 295 295 ARG ARG A . n 
A 1 117 THR 117 296 296 THR THR A . n 
A 1 118 LYS 118 297 297 LYS LYS A . n 
A 1 119 ALA 119 298 298 ALA ALA A . n 
A 1 120 MET 120 299 299 MET MET A . n 
A 1 121 VAL 121 300 300 VAL VAL A . n 
A 1 122 ALA 122 301 301 ALA ALA A . n 
A 1 123 CYS 123 302 302 CYS CYS A . n 
A 1 124 TYR 124 303 303 TYR TYR A . n 
A 1 125 PRO 125 304 304 PRO PRO A . n 
A 1 126 GLY 126 305 305 GLY GLY A . n 
A 1 127 ASN 127 306 306 ASN ASN A . n 
A 1 128 GLY 128 307 307 GLY GLY A . n 
A 1 129 THR 129 308 308 THR THR A . n 
A 1 130 GLY 130 309 309 GLY GLY A . n 
A 1 131 TYR 131 310 310 TYR TYR A . n 
A 1 132 VAL 132 311 311 VAL VAL A . n 
A 1 133 ARG 133 312 312 ARG ARG A . n 
A 1 134 HIS 134 313 313 HIS HIS A . n 
A 1 135 VAL 135 314 314 VAL VAL A . n 
A 1 136 ASP 136 315 315 ASP ASP A . n 
A 1 137 ASN 137 316 316 ASN ASN A . n 
A 1 138 PRO 138 317 317 PRO PRO A . n 
A 1 139 ASN 139 318 318 ASN ASN A . n 
A 1 140 GLY 140 319 319 GLY GLY A . n 
A 1 141 ASP 141 320 320 ASP ASP A . n 
A 1 142 GLY 142 321 321 GLY GLY A . n 
A 1 143 ARG 143 322 322 ARG ARG A . n 
A 1 144 CYS 144 323 323 CYS CYS A . n 
A 1 145 VAL 145 324 324 VAL VAL A . n 
A 1 146 THR 146 325 325 THR THR A . n 
A 1 147 CYS 147 326 326 CYS CYS A . n 
A 1 148 ILE 148 327 327 ILE ILE A . n 
A 1 149 TYR 149 328 328 TYR TYR A . n 
A 1 150 TYR 150 329 329 TYR TYR A . n 
A 1 151 LEU 151 330 330 LEU LEU A . n 
A 1 152 ASN 152 331 331 ASN ASN A . n 
A 1 153 LYS 153 332 332 LYS LYS A . n 
A 1 154 ASP 154 333 333 ASP ASP A . n 
A 1 155 TRP 155 334 334 TRP TRP A . n 
A 1 156 ASP 156 335 335 ASP ASP A . n 
A 1 157 ALA 157 336 336 ALA ALA A . n 
A 1 158 LYS 158 337 337 LYS LYS A . n 
A 1 159 VAL 159 338 338 VAL VAL A . n 
A 1 160 SER 160 339 339 SER SER A . n 
A 1 161 GLY 161 340 340 GLY GLY A . n 
A 1 162 GLY 162 341 341 GLY GLY A . n 
A 1 163 ILE 163 342 342 ILE ILE A . n 
A 1 164 LEU 164 343 343 LEU LEU A . n 
A 1 165 ARG 165 344 344 ARG ARG A . n 
A 1 166 ILE 166 345 345 ILE ILE A . n 
A 1 167 PHE 167 346 346 PHE PHE A . n 
A 1 168 PRO 168 347 347 PRO PRO A . n 
A 1 169 GLU 169 348 348 GLU GLU A . n 
A 1 170 GLY 170 349 349 GLY GLY A . n 
A 1 171 LYS 171 350 350 LYS LYS A . n 
A 1 172 ALA 172 351 351 ALA ALA A . n 
A 1 173 GLN 173 352 352 GLN GLN A . n 
A 1 174 PHE 174 353 353 PHE PHE A . n 
A 1 175 ALA 175 354 354 ALA ALA A . n 
A 1 176 ASP 176 355 355 ASP ASP A . n 
A 1 177 ILE 177 356 356 ILE ILE A . n 
A 1 178 GLU 178 357 357 GLU GLU A . n 
A 1 179 PRO 179 358 358 PRO PRO A . n 
A 1 180 LYS 180 359 359 LYS LYS A . n 
A 1 181 PHE 181 360 360 PHE PHE A . n 
A 1 182 ASP 182 361 361 ASP ASP A . n 
A 1 183 ARG 183 362 362 ARG ARG A . n 
A 1 184 LEU 184 363 363 LEU LEU A . n 
A 1 185 LEU 185 364 364 LEU LEU A . n 
A 1 186 PHE 186 365 365 PHE PHE A . n 
A 1 187 PHE 187 366 366 PHE PHE A . n 
A 1 188 TRP 188 367 367 TRP TRP A . n 
A 1 189 SER 189 368 368 SER SER A . n 
A 1 190 ASP 190 369 369 ASP ASP A . n 
A 1 191 ARG 191 370 370 ARG ARG A . n 
A 1 192 ARG 192 371 371 ARG ARG A . n 
A 1 193 ASN 193 372 372 ASN ASN A . n 
A 1 194 PRO 194 373 373 PRO PRO A . n 
A 1 195 HIS 195 374 374 HIS HIS A . n 
A 1 196 GLU 196 375 375 GLU GLU A . n 
A 1 197 VAL 197 376 376 VAL VAL A . n 
A 1 198 GLN 198 377 377 GLN GLN A . n 
A 1 199 PRO 199 378 378 PRO PRO A . n 
A 1 200 ALA 200 379 379 ALA ALA A . n 
A 1 201 TYR 201 380 380 TYR TYR A . n 
A 1 202 ALA 202 381 381 ALA ALA A . n 
A 1 203 THR 203 382 382 THR THR A . n 
A 1 204 ARG 204 383 383 ARG ARG A . n 
A 1 205 TYR 205 384 384 TYR TYR A . n 
A 1 206 ALA 206 385 385 ALA ALA A . n 
A 1 207 ILE 207 386 386 ILE ILE A . n 
A 1 208 THR 208 387 387 THR THR A . n 
A 1 209 VAL 209 388 388 VAL VAL A . n 
A 1 210 TRP 210 389 389 TRP TRP A . n 
A 1 211 TYR 211 390 390 TYR TYR A . n 
A 1 212 PHE 212 391 391 PHE PHE A . n 
A 1 213 ASP 213 392 392 ASP ASP A . n 
A 1 214 ALA 214 393 393 ALA ALA A . n 
A 1 215 ASP 215 394 394 ASP ASP A . n 
A 1 216 GLU 216 395 395 GLU GLU A . n 
A 1 217 ARG 217 396 396 ARG ARG A . n 
A 1 218 ALA 218 397 397 ALA ALA A . n 
A 1 219 ARG 219 398 398 ARG ARG A . n 
A 1 220 ALA 220 399 399 ALA ALA A . n 
A 1 221 LYS 221 400 400 LYS LYS A . n 
A 1 222 VAL 222 401 401 VAL VAL A . n 
A 1 223 LYS 223 402 402 LYS LYS A . n 
A 1 224 TYR 224 403 403 TYR TYR A . n 
A 1 225 LEU 225 404 ?   ?   ?   A . n 
A 1 226 THR 226 405 ?   ?   ?   A . n 
A 1 227 GLY 227 406 ?   ?   ?   A . n 
A 1 228 GLU 228 407 ?   ?   ?   A . n 
A 1 229 LYS 229 408 ?   ?   ?   A . n 
A 1 230 GLY 230 409 ?   ?   ?   A . n 
A 1 231 VAL 231 410 ?   ?   ?   A . n 
A 1 232 ARG 232 411 ?   ?   ?   A . n 
A 1 233 VAL 233 412 ?   ?   ?   A . n 
A 1 234 GLU 234 413 ?   ?   ?   A . n 
A 1 235 LEU 235 414 ?   ?   ?   A . n 
A 1 236 ASN 236 415 ?   ?   ?   A . n 
A 1 237 LYS 237 416 ?   ?   ?   A . n 
A 1 238 PRO 238 417 ?   ?   ?   A . n 
A 1 239 HIS 239 418 ?   ?   ?   A . n 
A 1 240 HIS 240 419 ?   ?   ?   A . n 
A 1 241 HIS 241 420 ?   ?   ?   A . n 
A 1 242 HIS 242 421 ?   ?   ?   A . n 
A 1 243 HIS 243 422 ?   ?   ?   A . n 
A 1 244 HIS 244 423 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE2 1   501 501 FE2 FE2 A . 
C 3 4HG 1   801 801 4HG 4HG A . 
D 4 HOH 1   601 601 HOH HOH A . 
D 4 HOH 2   602 602 HOH HOH A . 
D 4 HOH 3   603 603 HOH HOH A . 
D 4 HOH 4   604 604 HOH HOH A . 
D 4 HOH 5   605 605 HOH HOH A . 
D 4 HOH 6   606 606 HOH HOH A . 
D 4 HOH 7   607 607 HOH HOH A . 
D 4 HOH 8   608 608 HOH HOH A . 
D 4 HOH 9   609 609 HOH HOH A . 
D 4 HOH 10  610 610 HOH HOH A . 
D 4 HOH 11  611 611 HOH HOH A . 
D 4 HOH 12  612 612 HOH HOH A . 
D 4 HOH 13  613 613 HOH HOH A . 
D 4 HOH 14  614 614 HOH HOH A . 
D 4 HOH 15  615 615 HOH HOH A . 
D 4 HOH 16  616 616 HOH HOH A . 
D 4 HOH 17  617 617 HOH HOH A . 
D 4 HOH 18  618 618 HOH HOH A . 
D 4 HOH 19  619 619 HOH HOH A . 
D 4 HOH 20  620 620 HOH HOH A . 
D 4 HOH 21  621 621 HOH HOH A . 
D 4 HOH 22  622 622 HOH HOH A . 
D 4 HOH 23  623 623 HOH HOH A . 
D 4 HOH 24  624 624 HOH HOH A . 
D 4 HOH 25  625 625 HOH HOH A . 
D 4 HOH 26  626 626 HOH HOH A . 
D 4 HOH 27  627 627 HOH HOH A . 
D 4 HOH 28  628 628 HOH HOH A . 
D 4 HOH 29  629 629 HOH HOH A . 
D 4 HOH 30  630 630 HOH HOH A . 
D 4 HOH 31  631 631 HOH HOH A . 
D 4 HOH 32  632 632 HOH HOH A . 
D 4 HOH 33  633 633 HOH HOH A . 
D 4 HOH 34  634 634 HOH HOH A . 
D 4 HOH 35  635 635 HOH HOH A . 
D 4 HOH 36  636 636 HOH HOH A . 
D 4 HOH 37  637 637 HOH HOH A . 
D 4 HOH 38  638 638 HOH HOH A . 
D 4 HOH 39  639 639 HOH HOH A . 
D 4 HOH 40  640 640 HOH HOH A . 
D 4 HOH 41  641 641 HOH HOH A . 
D 4 HOH 42  642 642 HOH HOH A . 
D 4 HOH 43  643 643 HOH HOH A . 
D 4 HOH 44  644 644 HOH HOH A . 
D 4 HOH 45  645 645 HOH HOH A . 
D 4 HOH 46  646 646 HOH HOH A . 
D 4 HOH 47  647 647 HOH HOH A . 
D 4 HOH 48  648 648 HOH HOH A . 
D 4 HOH 49  649 649 HOH HOH A . 
D 4 HOH 50  650 650 HOH HOH A . 
D 4 HOH 51  651 651 HOH HOH A . 
D 4 HOH 52  652 652 HOH HOH A . 
D 4 HOH 53  653 653 HOH HOH A . 
D 4 HOH 54  654 654 HOH HOH A . 
D 4 HOH 55  655 655 HOH HOH A . 
D 4 HOH 56  656 656 HOH HOH A . 
D 4 HOH 57  657 657 HOH HOH A . 
D 4 HOH 58  658 658 HOH HOH A . 
D 4 HOH 59  659 659 HOH HOH A . 
D 4 HOH 60  660 660 HOH HOH A . 
D 4 HOH 61  661 661 HOH HOH A . 
D 4 HOH 62  662 662 HOH HOH A . 
D 4 HOH 63  663 663 HOH HOH A . 
D 4 HOH 64  664 664 HOH HOH A . 
D 4 HOH 65  665 665 HOH HOH A . 
D 4 HOH 66  666 666 HOH HOH A . 
D 4 HOH 67  667 667 HOH HOH A . 
D 4 HOH 68  668 668 HOH HOH A . 
D 4 HOH 69  669 669 HOH HOH A . 
D 4 HOH 70  670 670 HOH HOH A . 
D 4 HOH 71  671 671 HOH HOH A . 
D 4 HOH 72  672 672 HOH HOH A . 
D 4 HOH 73  673 673 HOH HOH A . 
D 4 HOH 74  674 674 HOH HOH A . 
D 4 HOH 75  675 675 HOH HOH A . 
D 4 HOH 76  676 676 HOH HOH A . 
D 4 HOH 77  677 677 HOH HOH A . 
D 4 HOH 78  678 678 HOH HOH A . 
D 4 HOH 79  679 679 HOH HOH A . 
D 4 HOH 80  680 680 HOH HOH A . 
D 4 HOH 81  681 681 HOH HOH A . 
D 4 HOH 82  682 682 HOH HOH A . 
D 4 HOH 83  683 683 HOH HOH A . 
D 4 HOH 84  684 684 HOH HOH A . 
D 4 HOH 85  685 685 HOH HOH A . 
D 4 HOH 86  686 686 HOH HOH A . 
D 4 HOH 87  687 687 HOH HOH A . 
D 4 HOH 88  688 688 HOH HOH A . 
D 4 HOH 89  689 689 HOH HOH A . 
D 4 HOH 90  690 690 HOH HOH A . 
D 4 HOH 91  691 691 HOH HOH A . 
D 4 HOH 92  692 692 HOH HOH A . 
D 4 HOH 93  693 693 HOH HOH A . 
D 4 HOH 94  694 694 HOH HOH A . 
D 4 HOH 95  695 695 HOH HOH A . 
D 4 HOH 96  696 696 HOH HOH A . 
D 4 HOH 97  697 697 HOH HOH A . 
D 4 HOH 98  698 698 HOH HOH A . 
D 4 HOH 99  699 699 HOH HOH A . 
D 4 HOH 100 700 700 HOH HOH A . 
D 4 HOH 101 701 701 HOH HOH A . 
D 4 HOH 102 702 702 HOH HOH A . 
D 4 HOH 103 703 703 HOH HOH A . 
D 4 HOH 104 704 704 HOH HOH A . 
D 4 HOH 105 705 705 HOH HOH A . 
D 4 HOH 106 706 706 HOH HOH A . 
D 4 HOH 107 707 707 HOH HOH A . 
D 4 HOH 108 708 708 HOH HOH A . 
D 4 HOH 109 709 709 HOH HOH A . 
D 4 HOH 110 710 710 HOH HOH A . 
D 4 HOH 111 711 711 HOH HOH A . 
D 4 HOH 112 712 712 HOH HOH A . 
D 4 HOH 113 713 713 HOH HOH A . 
D 4 HOH 114 714 714 HOH HOH A . 
D 4 HOH 115 715 715 HOH HOH A . 
D 4 HOH 116 716 716 HOH HOH A . 
D 4 HOH 117 717 717 HOH HOH A . 
D 4 HOH 118 718 718 HOH HOH A . 
D 4 HOH 119 719 719 HOH HOH A . 
D 4 HOH 120 720 720 HOH HOH A . 
D 4 HOH 121 721 721 HOH HOH A . 
D 4 HOH 122 722 722 HOH HOH A . 
D 4 HOH 123 723 723 HOH HOH A . 
D 4 HOH 124 724 724 HOH HOH A . 
D 4 HOH 125 725 725 HOH HOH A . 
D 4 HOH 126 726 726 HOH HOH A . 
D 4 HOH 127 727 727 HOH HOH A . 
D 4 HOH 128 728 728 HOH HOH A . 
D 4 HOH 129 729 729 HOH HOH A . 
D 4 HOH 130 730 730 HOH HOH A . 
D 4 HOH 131 731 731 HOH HOH A . 
D 4 HOH 132 732 732 HOH HOH A . 
D 4 HOH 133 733 733 HOH HOH A . 
D 4 HOH 134 734 734 HOH HOH A . 
D 4 HOH 135 735 735 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 134 ? A HIS 313 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 OD1 ? A ASP 136 ? A ASP 315 ? 1_555 89.4  ? 
2  NE2 ? A HIS 134 ? A HIS 313 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 195 ? A HIS 374 ? 1_555 85.6  ? 
3  OD1 ? A ASP 136 ? A ASP 315 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 195 ? A HIS 374 ? 1_555 91.3  ? 
4  NE2 ? A HIS 134 ? A HIS 313 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O   ? D HOH .   ? A HOH 601 ? 1_555 175.4 ? 
5  OD1 ? A ASP 136 ? A ASP 315 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O   ? D HOH .   ? A HOH 601 ? 1_555 87.1  ? 
6  NE2 ? A HIS 195 ? A HIS 374 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O   ? D HOH .   ? A HOH 601 ? 1_555 97.5  ? 
7  NE2 ? A HIS 134 ? A HIS 313 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O3  ? C 4HG .   ? A 4HG 801 ? 1_555 100.3 ? 
8  OD1 ? A ASP 136 ? A ASP 315 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O3  ? C 4HG .   ? A 4HG 801 ? 1_555 169.6 ? 
9  NE2 ? A HIS 195 ? A HIS 374 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O3  ? C 4HG .   ? A 4HG 801 ? 1_555 85.9  ? 
10 O   ? D HOH .   ? A HOH 601 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O3  ? C 4HG .   ? A 4HG 801 ? 1_555 83.4  ? 
11 NE2 ? A HIS 134 ? A HIS 313 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N1  ? C 4HG .   ? A 4HG 801 ? 1_555 88.5  ? 
12 OD1 ? A ASP 136 ? A ASP 315 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N1  ? C 4HG .   ? A 4HG 801 ? 1_555 107.6 ? 
13 NE2 ? A HIS 195 ? A HIS 374 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N1  ? C 4HG .   ? A 4HG 801 ? 1_555 160.1 ? 
14 O   ? D HOH .   ? A HOH 601 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N1  ? C 4HG .   ? A 4HG 801 ? 1_555 89.7  ? 
15 O3  ? C 4HG .   ? A 4HG 801 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N1  ? C 4HG .   ? A 4HG 801 ? 1_555 76.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ALS5.0.2  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
SOLVE     phasing           . ? 3 
CNX       refinement        . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 197 ? ? -136.57 -57.26  
2 1 LYS A 244 ? ? -37.41  -26.52  
3 1 SER A 245 ? ? -66.37  -159.97 
4 1 SER A 247 ? ? 47.19   -86.20  
5 1 PHE A 346 ? ? -116.26 79.10   
6 1 GLU A 348 ? ? 47.99   -126.51 
7 1 ALA A 351 ? ? -57.70  -72.54  
8 1 ASP A 369 ? ? -78.51  -167.15 
9 1 LYS A 402 ? ? -165.78 -29.97  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 180 ? A MET 1   
2  1 Y 1 A PRO 181 ? A PRO 2   
3  1 Y 1 A ASN 182 ? A ASN 3   
4  1 Y 1 A GLY 183 ? A GLY 4   
5  1 Y 1 A GLN 184 ? A GLN 5   
6  1 Y 1 A THR 185 ? A THR 6   
7  1 Y 1 A LYS 186 ? A LYS 7   
8  1 Y 1 A PRO 187 ? A PRO 8   
9  1 Y 1 A LEU 404 ? A LEU 225 
10 1 Y 1 A THR 405 ? A THR 226 
11 1 Y 1 A GLY 406 ? A GLY 227 
12 1 Y 1 A GLU 407 ? A GLU 228 
13 1 Y 1 A LYS 408 ? A LYS 229 
14 1 Y 1 A GLY 409 ? A GLY 230 
15 1 Y 1 A VAL 410 ? A VAL 231 
16 1 Y 1 A ARG 411 ? A ARG 232 
17 1 Y 1 A VAL 412 ? A VAL 233 
18 1 Y 1 A GLU 413 ? A GLU 234 
19 1 Y 1 A LEU 414 ? A LEU 235 
20 1 Y 1 A ASN 415 ? A ASN 236 
21 1 Y 1 A LYS 416 ? A LYS 237 
22 1 Y 1 A PRO 417 ? A PRO 238 
23 1 Y 1 A HIS 418 ? A HIS 239 
24 1 Y 1 A HIS 419 ? A HIS 240 
25 1 Y 1 A HIS 420 ? A HIS 241 
26 1 Y 1 A HIS 421 ? A HIS 242 
27 1 Y 1 A HIS 422 ? A HIS 243 
28 1 Y 1 A HIS 423 ? A HIS 244 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (II) ION'                                           FE2 
3 'N-[(4-HYDROXY-8-IODOISOQUINOLIN-3-YL)CARBONYL]GLYCINE' 4HG 
4 water                                                   HOH 
#