data_2G33
# 
_entry.id   2G33 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2G33         
RCSB  RCSB036627   
WWPDB D_1000036627 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2g34 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2G33 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-02-17 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, C.R.' 1 
'Zlotnick, A.' 2 
# 
_citation.id                        primary 
_citation.title                     'Global Structural Changes in Hepatitis B Virus Capsids Induced by the Assembly Effector HAP1.' 
_citation.journal_abbrev            J.Virol. 
_citation.journal_volume            80 
_citation.page_first                11055 
_citation.page_last                 11061 
_citation.year                      2006 
_citation.journal_id_ASTM           JOVIAM 
_citation.country                   US 
_citation.journal_id_ISSN           0022-538X 
_citation.journal_id_CSD            0825 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16943288 
_citation.pdbx_database_id_DOI      10.1128/JVI.00933-06 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bourne, C.R.' 1 
primary 'Finn, M.G.'   2 
primary 'Zlotnick, A.' 3 
# 
_cell.length_a           558.400 
_cell.length_b           327.145 
_cell.length_c           562.237 
_cell.angle_alpha        90.00 
_cell.angle_beta         109.12 
_cell.angle_gamma        90.00 
_cell.entry_id           2G33 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              960 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         2G33 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Core antigen' 
_entity.formula_weight             16791.104 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              'C48A, C61A, C107A' 
_entity.pdbx_fragment              'Assembly domain residues 1 to 149' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAILAWGDLMTLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHASPHHTALRQAILAWGDLMTLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISALTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVC
;
_entity_poly.pdbx_strand_id                 C,D,B,A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ILE n 
1 4   ASP n 
1 5   PRO n 
1 6   TYR n 
1 7   LYS n 
1 8   GLU n 
1 9   PHE n 
1 10  GLY n 
1 11  ALA n 
1 12  THR n 
1 13  VAL n 
1 14  GLU n 
1 15  LEU n 
1 16  LEU n 
1 17  SER n 
1 18  PHE n 
1 19  LEU n 
1 20  PRO n 
1 21  SER n 
1 22  ASP n 
1 23  PHE n 
1 24  PHE n 
1 25  PRO n 
1 26  SER n 
1 27  VAL n 
1 28  ARG n 
1 29  ASP n 
1 30  LEU n 
1 31  LEU n 
1 32  ASP n 
1 33  THR n 
1 34  ALA n 
1 35  ALA n 
1 36  ALA n 
1 37  LEU n 
1 38  TYR n 
1 39  ARG n 
1 40  ASP n 
1 41  ALA n 
1 42  LEU n 
1 43  GLU n 
1 44  SER n 
1 45  PRO n 
1 46  GLU n 
1 47  HIS n 
1 48  ALA n 
1 49  SER n 
1 50  PRO n 
1 51  HIS n 
1 52  HIS n 
1 53  THR n 
1 54  ALA n 
1 55  LEU n 
1 56  ARG n 
1 57  GLN n 
1 58  ALA n 
1 59  ILE n 
1 60  LEU n 
1 61  ALA n 
1 62  TRP n 
1 63  GLY n 
1 64  ASP n 
1 65  LEU n 
1 66  MET n 
1 67  THR n 
1 68  LEU n 
1 69  ALA n 
1 70  THR n 
1 71  TRP n 
1 72  VAL n 
1 73  GLY n 
1 74  THR n 
1 75  ASN n 
1 76  LEU n 
1 77  GLU n 
1 78  ASP n 
1 79  PRO n 
1 80  ALA n 
1 81  SER n 
1 82  ARG n 
1 83  ASP n 
1 84  LEU n 
1 85  VAL n 
1 86  VAL n 
1 87  SER n 
1 88  TYR n 
1 89  VAL n 
1 90  ASN n 
1 91  THR n 
1 92  ASN n 
1 93  VAL n 
1 94  GLY n 
1 95  LEU n 
1 96  LYS n 
1 97  PHE n 
1 98  ARG n 
1 99  GLN n 
1 100 LEU n 
1 101 LEU n 
1 102 TRP n 
1 103 PHE n 
1 104 HIS n 
1 105 ILE n 
1 106 SER n 
1 107 ALA n 
1 108 LEU n 
1 109 THR n 
1 110 PHE n 
1 111 GLY n 
1 112 ARG n 
1 113 GLU n 
1 114 THR n 
1 115 VAL n 
1 116 LEU n 
1 117 GLU n 
1 118 TYR n 
1 119 LEU n 
1 120 VAL n 
1 121 SER n 
1 122 PHE n 
1 123 GLY n 
1 124 VAL n 
1 125 TRP n 
1 126 ILE n 
1 127 ARG n 
1 128 THR n 
1 129 PRO n 
1 130 PRO n 
1 131 ALA n 
1 132 TYR n 
1 133 ARG n 
1 134 PRO n 
1 135 PRO n 
1 136 ASN n 
1 137 ALA n 
1 138 PRO n 
1 139 ILE n 
1 140 LEU n 
1 141 SER n 
1 142 THR n 
1 143 LEU n 
1 144 PRO n 
1 145 GLU n 
1 146 THR n 
1 147 THR n 
1 148 VAL n 
1 149 VAL n 
1 150 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Orthohepadnavirus 
_entity_src_gen.pdbx_gene_src_gene                 C 
_entity_src_gen.gene_src_species                   'Hepatitis B virus' 
_entity_src_gen.gene_src_strain                    adyw 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Hepatitis B virus subtype adyw' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10419 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 DE3 Gold' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CORA_HBVAY 
_struct_ref.pdbx_db_accession          P03147 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2G33 C 1 ? 149 ? P03147 1 ? 149 ? 1 149 
2 1 2G33 D 1 ? 149 ? P03147 1 ? 149 ? 1 149 
3 1 2G33 B 1 ? 149 ? P03147 1 ? 149 ? 1 149 
4 1 2G33 A 1 ? 149 ? P03147 1 ? 149 ? 1 149 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2G33 ALA C 48  ? UNP P03147 CYS 48  ENGINEERED 48  1  
1 2G33 ALA C 61  ? UNP P03147 CYS 61  ENGINEERED 61  2  
1 2G33 ALA C 107 ? UNP P03147 CYS 107 ENGINEERED 107 3  
1 2G33 CYS C 150 ? UNP P03147 ?   ?   INSERTION  150 4  
2 2G33 ALA D 48  ? UNP P03147 CYS 48  ENGINEERED 48  5  
2 2G33 ALA D 61  ? UNP P03147 CYS 61  ENGINEERED 61  6  
2 2G33 ALA D 107 ? UNP P03147 CYS 107 ENGINEERED 107 7  
2 2G33 CYS D 150 ? UNP P03147 ?   ?   INSERTION  150 8  
3 2G33 ALA B 48  ? UNP P03147 CYS 48  ENGINEERED 48  9  
3 2G33 ALA B 61  ? UNP P03147 CYS 61  ENGINEERED 61  10 
3 2G33 ALA B 107 ? UNP P03147 CYS 107 ENGINEERED 107 11 
3 2G33 CYS B 150 ? UNP P03147 ?   ?   INSERTION  150 12 
4 2G33 ALA A 48  ? UNP P03147 CYS 48  ENGINEERED 48  13 
4 2G33 ALA A 61  ? UNP P03147 CYS 61  ENGINEERED 61  14 
4 2G33 ALA A 107 ? UNP P03147 CYS 107 ENGINEERED 107 15 
4 2G33 CYS A 150 ? UNP P03147 ?   ?   INSERTION  150 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2G33 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      6.3 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   80.4 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              9.5 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'PEG 5000 MME, butanediol, KCl, NaCl, bicarbonate, pH 9.5, VAPOR DIFFUSION, HANGING DROP, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           77 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2004-12-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
# 
_reflns.entry_id                     2G33 
_reflns.d_resolution_high            3.950 
_reflns.d_resolution_low             40.000 
_reflns.number_obs                   666347 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_netI_over_sigmaI        10.500 
_reflns.pdbx_chi_squared             1.068 
_reflns.pdbx_redundancy              2.000 
_reflns.percent_possible_obs         81.100 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   1 
_reflns.number_all                   824879 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.95 
_reflns_shell.d_res_low              4.02 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      26503 
_reflns_shell.Rmerge_I_obs           0.482 
_reflns_shell.meanI_over_sigI_obs    1.3 
_reflns_shell.pdbx_Rsym_value        0.482 
_reflns_shell.pdbx_chi_squared       1.141 
_reflns_shell.pdbx_redundancy        1.60 
_reflns_shell.percent_possible_obs   64.60 
_reflns_shell.number_unique_all      26503 
_reflns_shell.percent_possible_all   64.6 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.ls_d_res_high                            3.960 
_refine.ls_d_res_low                             40.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    79.200 
_refine.ls_number_reflns_obs                     653450 
_refine.ls_R_factor_R_work                       0.36 
_refine.ls_R_factor_R_free                       0.372 
_refine.ls_percent_reflns_R_free                 0.800 
_refine.ls_number_reflns_R_free                  6675 
_refine.B_iso_mean                               106.159 
_refine.solvent_model_param_bsol                 10.000 
_refine.entry_id                                 2G33 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     821636 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1QGT' 
_refine.pdbx_ls_cross_valid_method               'Not applicable' 
_refine.pdbx_R_Free_selection_details            'Selected as thin shells; due to 60-fold NCS R-free is not applicable' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  
;Refinement was limited to positional refinement and grouped B-factor refinement. This was alternated with 60-fold NCS averaging with RAVE.
;
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2G33 
_refine_analyze.Luzzati_coordinate_error_obs    1.08 
_refine_analyze.Luzzati_sigma_a_obs             1.46 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4658 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4658 
_refine_hist.d_res_high                       3.960 
_refine_hist.d_res_low                        40.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg        1.99 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d           0.01 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.8 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.34 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
3.960 4.140  8 . 52162 . 0.48  0.473 . 445 . . 52607 . 'X-RAY DIFFRACTION' 
4.140 4.360  8 . 70204 . 0.484 0.506 . 890 . . 71094 . 'X-RAY DIFFRACTION' 
4.360 4.630  8 . 76117 . 0.474 0.5   . 890 . . 77007 . 'X-RAY DIFFRACTION' 
4.630 4.990  8 . 84051 . 0.444 0.451 . 890 . . 84941 . 'X-RAY DIFFRACTION' 
4.990 5.490  8 . 89962 . 0.42  0.437 . 890 . . 90852 . 'X-RAY DIFFRACTION' 
5.490 6.280  8 . 92716 . 0.397 0.394 . 890 . . 93606 . 'X-RAY DIFFRACTION' 
6.280 7.900  8 . 92600 . 0.341 0.373 . 890 . . 93490 . 'X-RAY DIFFRACTION' 
7.900 40.000 8 . 88963 . 0.249 0.243 . 890 . . 89853 . 'X-RAY DIFFRACTION' 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       CNS_TOPPAR:protein_rep.param 
_pdbx_xplor_file.topol_file       ? 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1  given    ? 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000    
0.000000   
2  generate ? 0.447239  0.347018  0.824315  0.203815  0.857880  -0.471643 -0.870927 0.379041  0.312911  -57.524719 43.583790   
174.303477 
3  generate ? -0.447170 0.765352  0.462935  0.676773  0.627918  -0.384189 -0.584781 0.141557  -0.798782 75.553458  -12.960152  
295.465578 
4  generate ? -0.447185 0.676882  -0.584725 0.765262  0.627907  0.141504  0.462997  -0.384264 -0.798756 215.325060 -91.490006  
196.043853 
5  generate ? 0.447215  0.203868  -0.870835 0.346993  0.857867  0.378947  0.824412  -0.471751 0.312952  168.630503 -83.480299  
13.436082  
6  generate ? -0.471693 0.097649  0.876298  -0.481892 0.803825  -0.348839 -0.738475 -0.586833 -0.332132 21.614648  91.624443   
246.470518 
7  generate ? -0.954250 0.252243  -0.160677 0.252126  0.390138  -0.885504 -0.160617 -0.885591 -0.435888 205.746603 93.574785   
205.482901 
8  generate ? -0.235429 -0.175648 -0.955850 0.963490  0.086539  -0.253259 0.127296  -0.980693 0.148890  243.626923 -58.271845  
100.148122 
9  generate ? 0.691385  -0.594695 -0.410320 0.669119  0.312590  0.674156  -0.272622 -0.740711 0.614058  82.906184  -154.068553 
76.035287  
10 generate ? 0.545367  -0.425788 0.722010  -0.224176 0.755898  0.615084  -0.807698 -0.497293 0.316770  -54.305020 -61.427526  
166.467610 
11 generate ? -0.471686 -0.481809 -0.738454 0.097557  0.803788  -0.586825 0.876394  -0.348916 -0.332102 236.347840 68.879878   
94.879777  
12 generate ? 0.333985  -0.856926 -0.392646 0.718540  0.500979  -0.482307 0.610081  -0.121089 0.783071  113.767072 -3.985885   
-28.628433 
13 generate ? 0.316683  -0.768076 0.556609  0.843523  0.496310  0.205101  -0.433827 0.404648  0.805041  -11.233091 -107.553197 
67.491548  
14 generate ? -0.499681 -0.338045 0.797474  0.299785  0.796232  0.525424  -0.812685 0.501742  -0.296555 34.093220  -98.695594  
250.405249 
15 generate ? -0.986920 -0.161122 -0.002919 -0.161248 0.986267  0.035988  -0.002924 0.036014  -0.999348 187.106625 10.345966   
267.332031 
16 generate ? -0.789356 0.538714  0.294539  0.538635  0.377535  0.753160  0.294521  0.753224  -0.588179 129.886877 -152.239005 
185.555224 
17 generate ? -0.499755 0.299878  -0.812594 -0.338103 0.796278  0.501615  0.797503  0.525435  -0.296523 250.112780 -35.490715  
98.919526  
18 generate ? 0.545322  -0.224173 -0.807660 -0.425790 0.755922  -0.497303 0.722017  0.615115  0.316790  150.292601 106.096774  
24.258877  
19 generate ? 0.901615  -0.309219 0.302522  0.396754  0.312237  -0.863121 0.172383  0.898326  0.404182  -31.625573 76.854295   
64.751646  
20 generate ? 0.076739  0.162271  0.983718  0.992802  0.078381  -0.090293 -0.091824 0.983683  -0.155119 -44.236929 -82.805860  
164.438328 
21 generate ? -0.104776 0.183107  -0.977460 -0.992190 -0.085910 0.090157  -0.067540 0.979382  0.190687  234.779461 79.626631   
115.966154 
22 generate ? 0.841759  -0.249778 -0.478588 -0.539777 -0.383833 -0.749148 0.003332  0.889038  -0.457926 78.412198  148.672569  
195.773963 
23 generate ? 0.742375  -0.103583 0.661926  0.332814  -0.800557 -0.498330 0.581512  0.590274  -0.559852 -64.315693 32.414943   
154.511735 
24 generate ? -0.265583 0.419655  0.867930  0.419692  -0.760184 0.495989  0.867974  0.495971  0.025767  3.840899   -108.482384 
49.202327  
25 generate ? -0.789152 0.596837  -0.145268 -0.399206 -0.318507 0.859693  0.466838  0.736454  0.489625  188.692083 -79.303779  
25.379872  
26 generate ? 0.683015  0.710560  0.168956  0.442830  -0.218850 -0.869429 -0.580915 0.668755  -0.464165 8.376532   72.530320   
251.240222 
27 generate ? 0.303147  0.910638  0.280757  0.910659  -0.363633 0.196197  0.280751  0.196188  -0.939514 29.504707  -114.026637 
232.898371 
28 generate ? 0.076661  0.992838  -0.091756 0.162294  0.078426  0.983567  0.983799  -0.090387 -0.155088 100.692361 -148.062587 
61.538166  
29 generate ? 0.316555  0.843563  -0.433784 -0.768048 0.496416  0.404561  0.556642  0.205067  0.805063  123.560587 17.459002   
-26.026540 
30 generate ? 0.691303  0.669105  -0.272656 -0.594668 0.312689  -0.740655 -0.410404 0.674244  0.614042  66.506324  153.793063  
91.215893  
31 generate ? 0.191954  -0.293131 -0.936566 0.487989  -0.799564 0.350153  -0.851517 -0.524251 -0.010424 200.651141 -95.495155  
214.243593 
32 generate ? 0.841788  -0.539862 0.003423  -0.249674 -0.383868 0.888932  -0.478603 -0.749189 -0.457920 13.586204  -97.381663  
238.560947 
33 generate ? 0.263468  -0.169728 0.949593  -0.964100 -0.079010 0.253395  0.032069  -0.982373 -0.184458 -57.770140 55.194679   
153.622885 
34 generate ? -0.743788 0.305759  0.594369  -0.667977 -0.306292 -0.678169 -0.025231 -0.901552 0.432046  85.194150  151.378627  
76.810927  
35 generate ? 0.683018  0.442806  -0.580806 0.710611  -0.218883 0.668653  0.169011  -0.869545 -0.464135 108.083655 -158.069327 
178.262280 
36 generate ? 0.901565  0.396744  0.172435  -0.309148 0.312268  0.898231  0.302590  -0.863248 0.404201  -13.144432 -91.938031  
49.741359  
37 generate ? 0.333899  0.718579  0.610009  -0.856915 0.501080  -0.121049 -0.392645 -0.482353 0.783055  -17.659073 96.020487   
65.165100  
38 generate ? -0.235484 0.963548  0.127203  -0.175693 0.086622  -0.980576 -0.955903 -0.253243 0.148862  100.778744 146.053983  
203.218464 
39 generate ? -0.019717 0.793112  -0.608761 0.793092  -0.358339 -0.492513 -0.608780 -0.492542 -0.621944 178.491957 -10.982289  
273.116413 
40 generate ? -0.106649 0.763472  0.636964  -0.723495 -0.498941 0.476981  0.682057  -0.410088 0.605590  20.267123  2.038429    
-12.151865 
41 generate ? -0.446841 0.859400  -0.248687 -0.840685 -0.498301 -0.211814 -0.305966 0.114423  0.945141  170.702296 105.051279  
36.296347  
42 generate ? 0.191904  0.487941  -0.851485 -0.293075 -0.799502 -0.524248 -0.936670 0.350236  -0.010435 190.515498 94.773736   
223.625754 
43 generate ? 0.926860  0.162438  -0.338384 0.162557  -0.986296 -0.028547 -0.338445 -0.028531 -0.940564 52.325572  -14.591079  
290.953399 
44 generate ? 0.742344  0.332726  0.581528  -0.103458 -0.800538 0.590246  0.661984  -0.498440 -0.559840 -52.893730 -71.904591  
145.234869 
45 generate ? 0.577342  -0.768206 0.276803  -0.768100 -0.625916 -0.134792 0.276796  -0.134807 -0.951426 1.605148   87.735557   
234.343652 
46 generate ? -0.139439 -0.353763 0.924846  -0.353702 -0.854598 -0.380124 0.924944  -0.380230 -0.005963 -16.839796 81.145774   
46.708424  
47 generate ? -0.939940 -0.001316 0.341303  -0.001310 -0.999972 -0.007441 0.341368  -0.007482 0.939912  136.967102 -2.011196   
-24.109969 
48 generate ? -0.717898 -0.197935 -0.667389 -0.197915 -0.861135 0.468222  -0.667449 0.468310  0.579032  250.470064 -46.815333  
119.757017 
49 generate ? 0.219834  -0.671899 -0.707252 -0.671818 -0.629956 0.389515  -0.707357 0.389620  -0.589879 166.811687 8.651168    
279.490063 
50 generate ? -0.106549 -0.723562 0.681969  0.763471  -0.499031 -0.409970 0.637003  0.476996  0.605580  11.921646  -19.438111  
-6.523552  
51 generate ? -0.789073 -0.399210 0.466829  0.596799  -0.318572 0.736421  -0.145305 0.859801  0.489612  105.385018 -156.565607 
83.177202  
52 generate ? -0.840845 -0.439348 -0.316085 -0.439389 0.212938  0.872637  -0.316163 0.872772  -0.372092 214.747254 -76.419950  
214.350443 
53 generate ? -0.190318 -0.788508 -0.584813 -0.913118 0.360971  -0.189569 0.360550  0.497983  -0.788687 188.873584 110.240589  
205.719322 
54 generate ? 0.263503  -0.964161 0.032019  -0.169709 -0.079051 -0.982264 0.949640  0.253381  -0.184451 63.520320  145.457152  
69.211447  
55 generate ? -0.104680 -0.992224 -0.067465 0.183109  -0.085998 0.979274  -0.977535 0.090249  0.190677  111.407854 -149.705161 
200.207175 
56 generate ? -0.190291 -0.913112 0.360576  -0.788514 0.360956  0.497924  -0.584865 -0.189522 -0.788699 62.425266  6.704801    
293.609057 
57 generate ? -0.585248 -0.712703 0.386632  -0.712743 0.224767  -0.664420 0.386699  -0.664498 -0.639519 96.424612  154.585648  
181.520019 
58 generate ? -0.743735 -0.667956 -0.025307 0.305707  -0.306355 -0.901439 0.594488  -0.678279 0.432056  166.420077 89.571323   
18.843314  
59 generate ? -0.446728 -0.840710 -0.305954 0.859374  -0.498418 0.114420  -0.248656 -0.211818 0.945146  175.680192 -98.490803  
30.392607  
60 generate ? -0.787986 0.229492  -0.571342 0.229464  -0.751618 -0.618369 -0.571317 -0.618417 0.539605  244.907386 58.247084   
114.276524 
# 
_struct.entry_id                  2G33 
_struct.title                     'Human Hepatitis B Virus T=4 capsid, strain adyw' 
_struct.pdbx_descriptor           'Core antigen' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2G33 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'virus, capsid, hepadnavirus, four-helix bundle, icosahedral' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 6   ? GLY A 10  ? TYR C 6   GLY C 10  5 ? 5  
HELX_P HELX_P2  2  THR A 12  ? SER A 17  ? THR C 12  SER C 17  1 ? 6  
HELX_P HELX_P3  3  SER A 26  ? ALA A 36  ? SER C 26  ALA C 36  1 ? 11 
HELX_P HELX_P4  4  TYR A 38  ? GLU A 43  ? TYR C 38  GLU C 43  1 ? 6  
HELX_P HELX_P5  5  SER A 49  ? THR A 67  ? SER C 49  THR C 67  1 ? 19 
HELX_P HELX_P6  6  VAL A 85  ? GLY A 111 ? VAL C 85  GLY C 111 1 ? 27 
HELX_P HELX_P7  7  GLY A 111 ? THR A 128 ? GLY C 111 THR C 128 1 ? 18 
HELX_P HELX_P8  8  TYR B 6   ? GLY B 10  ? TYR D 6   GLY D 10  5 ? 5  
HELX_P HELX_P9  9  SER B 26  ? GLU B 43  ? SER D 26  GLU D 43  1 ? 18 
HELX_P HELX_P10 10 SER B 49  ? ASP B 64  ? SER D 49  ASP D 64  1 ? 16 
HELX_P HELX_P11 11 LEU B 68  ? VAL B 72  ? LEU D 68  VAL D 72  5 ? 5  
HELX_P HELX_P12 12 VAL B 85  ? VAL B 93  ? VAL D 85  VAL D 93  1 ? 9  
HELX_P HELX_P13 13 LEU B 95  ? GLY B 111 ? LEU D 95  GLY D 111 1 ? 17 
HELX_P HELX_P14 14 GLY B 111 ? ILE B 126 ? GLY D 111 ILE D 126 1 ? 16 
HELX_P HELX_P15 15 PRO B 129 ? ARG B 133 ? PRO D 129 ARG D 133 5 ? 5  
HELX_P HELX_P16 16 TYR C 6   ? GLY C 10  ? TYR B 6   GLY B 10  5 ? 5  
HELX_P HELX_P17 17 LEU C 15  ? LEU C 19  ? LEU B 15  LEU B 19  5 ? 5  
HELX_P HELX_P18 18 SER C 26  ? GLU C 43  ? SER B 26  GLU B 43  1 ? 18 
HELX_P HELX_P19 19 SER C 49  ? ASP C 64  ? SER B 49  ASP B 64  1 ? 16 
HELX_P HELX_P20 20 LEU C 68  ? GLY C 73  ? LEU B 68  GLY B 73  1 ? 6  
HELX_P HELX_P21 21 SER C 81  ? VAL C 93  ? SER B 81  VAL B 93  1 ? 13 
HELX_P HELX_P22 22 VAL C 93  ? LEU C 108 ? VAL B 93  LEU B 108 1 ? 16 
HELX_P HELX_P23 23 ARG C 112 ? ARG C 127 ? ARG B 112 ARG B 127 1 ? 16 
HELX_P HELX_P24 24 TYR D 6   ? GLY D 10  ? TYR A 6   GLY A 10  5 ? 5  
HELX_P HELX_P25 25 THR D 12  ? SER D 17  ? THR A 12  SER A 17  1 ? 6  
HELX_P HELX_P26 26 SER D 26  ? ALA D 34  ? SER A 26  ALA A 34  1 ? 9  
HELX_P HELX_P27 27 ALA D 34  ? ARG D 39  ? ALA A 34  ARG A 39  1 ? 6  
HELX_P HELX_P28 28 ASP D 40  ? LEU D 42  ? ASP A 40  LEU A 42  5 ? 3  
HELX_P HELX_P29 29 SER D 49  ? ASN D 75  ? SER A 49  ASN A 75  1 ? 27 
HELX_P HELX_P30 30 ASP D 78  ? VAL D 86  ? ASP A 78  VAL A 86  1 ? 9  
HELX_P HELX_P31 31 THR D 91  ? GLY D 111 ? THR A 91  GLY A 111 1 ? 21 
HELX_P HELX_P32 32 GLY D 111 ? ARG D 127 ? GLY A 111 ARG A 127 1 ? 17 
HELX_P HELX_P33 33 PRO D 129 ? ARG D 133 ? PRO A 129 ARG A 133 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2G33 
_atom_sites.fract_transf_matrix[1][1]   0.001791 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000621 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003057 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001882 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 1   ? 201.329 96.479  110.766 1.00 131.35 ? 1   MET C N   1 
ATOM 2    C CA  . MET A 1 1   ? 200.041 95.953  111.313 1.00 131.35 ? 1   MET C CA  1 
ATOM 3    C C   . MET A 1 1   ? 200.167 95.307  112.704 1.00 131.35 ? 1   MET C C   1 
ATOM 4    O O   . MET A 1 1   ? 201.126 94.581  112.991 1.00 131.35 ? 1   MET C O   1 
ATOM 5    C CB  . MET A 1 1   ? 199.434 94.945  110.341 1.00 124.39 ? 1   MET C CB  1 
ATOM 6    C CG  . MET A 1 1   ? 198.195 94.265  110.893 1.00 124.39 ? 1   MET C CG  1 
ATOM 7    S SD  . MET A 1 1   ? 197.666 92.902  109.857 1.00 124.39 ? 1   MET C SD  1 
ATOM 8    C CE  . MET A 1 1   ? 198.904 91.674  110.208 1.00 124.39 ? 1   MET C CE  1 
ATOM 9    N N   . ASP A 1 2   ? 199.167 95.555  113.550 1.00 135.46 ? 2   ASP C N   1 
ATOM 10   C CA  . ASP A 1 2   ? 199.158 95.051  114.920 1.00 135.46 ? 2   ASP C CA  1 
ATOM 11   C C   . ASP A 1 2   ? 198.327 93.797  115.180 1.00 135.46 ? 2   ASP C C   1 
ATOM 12   O O   . ASP A 1 2   ? 197.120 93.759  114.919 1.00 135.46 ? 2   ASP C O   1 
ATOM 13   C CB  . ASP A 1 2   ? 198.705 96.177  115.871 1.00 139.38 ? 2   ASP C CB  1 
ATOM 14   C CG  . ASP A 1 2   ? 198.597 95.725  117.328 1.00 139.38 ? 2   ASP C CG  1 
ATOM 15   O OD1 . ASP A 1 2   ? 197.654 94.965  117.659 1.00 139.38 ? 2   ASP C OD1 1 
ATOM 16   O OD2 . ASP A 1 2   ? 199.456 96.137  118.142 1.00 139.38 ? 2   ASP C OD2 1 
ATOM 17   N N   . ILE A 1 3   ? 199.009 92.777  115.702 1.00 125.69 ? 3   ILE C N   1 
ATOM 18   C CA  . ILE A 1 3   ? 198.412 91.492  116.082 1.00 125.69 ? 3   ILE C CA  1 
ATOM 19   C C   . ILE A 1 3   ? 199.311 90.836  117.155 1.00 125.69 ? 3   ILE C C   1 
ATOM 20   O O   . ILE A 1 3   ? 200.527 91.030  117.159 1.00 125.69 ? 3   ILE C O   1 
ATOM 21   C CB  . ILE A 1 3   ? 198.252 90.549  114.865 1.00 82.08  ? 3   ILE C CB  1 
ATOM 22   C CG1 . ILE A 1 3   ? 199.621 90.131  114.334 1.00 82.08  ? 3   ILE C CG1 1 
ATOM 23   C CG2 . ILE A 1 3   ? 197.440 91.233  113.781 1.00 82.08  ? 3   ILE C CG2 1 
ATOM 24   C CD1 . ILE A 1 3   ? 200.250 88.994  115.109 1.00 82.08  ? 3   ILE C CD1 1 
ATOM 25   N N   . ASP A 1 4   ? 198.706 90.047  118.041 1.00 92.80  ? 4   ASP C N   1 
ATOM 26   C CA  . ASP A 1 4   ? 199.404 89.404  119.165 1.00 92.80  ? 4   ASP C CA  1 
ATOM 27   C C   . ASP A 1 4   ? 199.481 87.867  119.054 1.00 92.80  ? 4   ASP C C   1 
ATOM 28   O O   . ASP A 1 4   ? 198.486 87.218  118.749 1.00 92.80  ? 4   ASP C O   1 
ATOM 29   C CB  . ASP A 1 4   ? 198.664 89.804  120.457 1.00 74.52  ? 4   ASP C CB  1 
ATOM 30   C CG  . ASP A 1 4   ? 199.478 89.593  121.714 1.00 74.52  ? 4   ASP C CG  1 
ATOM 31   O OD1 . ASP A 1 4   ? 200.036 88.496  121.899 1.00 74.52  ? 4   ASP C OD1 1 
ATOM 32   O OD2 . ASP A 1 4   ? 199.532 90.535  122.530 1.00 74.52  ? 4   ASP C OD2 1 
ATOM 33   N N   . PRO A 1 5   ? 200.668 87.274  119.324 1.00 56.36  ? 5   PRO C N   1 
ATOM 34   C CA  . PRO A 1 5   ? 201.005 85.832  119.291 1.00 56.36  ? 5   PRO C CA  1 
ATOM 35   C C   . PRO A 1 5   ? 200.311 84.999  120.338 1.00 56.36  ? 5   PRO C C   1 
ATOM 36   O O   . PRO A 1 5   ? 200.460 83.775  120.358 1.00 56.36  ? 5   PRO C O   1 
ATOM 37   C CB  . PRO A 1 5   ? 202.508 85.803  119.550 1.00 67.87  ? 5   PRO C CB  1 
ATOM 38   C CG  . PRO A 1 5   ? 202.963 87.114  119.059 1.00 67.87  ? 5   PRO C CG  1 
ATOM 39   C CD  . PRO A 1 5   ? 201.889 88.076  119.500 1.00 67.87  ? 5   PRO C CD  1 
ATOM 40   N N   . TYR A 1 6   ? 199.566 85.687  121.199 1.00 72.94  ? 6   TYR C N   1 
ATOM 41   C CA  . TYR A 1 6   ? 198.868 85.082  122.327 1.00 72.94  ? 6   TYR C CA  1 
ATOM 42   C C   . TYR A 1 6   ? 197.352 85.072  122.291 1.00 72.94  ? 6   TYR C C   1 
ATOM 43   O O   . TYR A 1 6   ? 196.748 84.143  122.831 1.00 72.94  ? 6   TYR C O   1 
ATOM 44   C CB  . TYR A 1 6   ? 199.324 85.777  123.596 1.00 97.73  ? 6   TYR C CB  1 
ATOM 45   C CG  . TYR A 1 6   ? 200.814 85.721  123.759 1.00 97.73  ? 6   TYR C CG  1 
ATOM 46   C CD1 . TYR A 1 6   ? 201.423 84.611  124.325 1.00 97.73  ? 6   TYR C CD1 1 
ATOM 47   C CD2 . TYR A 1 6   ? 201.628 86.758  123.317 1.00 97.73  ? 6   TYR C CD2 1 
ATOM 48   C CE1 . TYR A 1 6   ? 202.813 84.530  124.453 1.00 97.73  ? 6   TYR C CE1 1 
ATOM 49   C CE2 . TYR A 1 6   ? 203.022 86.685  123.442 1.00 97.73  ? 6   TYR C CE2 1 
ATOM 50   C CZ  . TYR A 1 6   ? 203.607 85.564  124.016 1.00 97.73  ? 6   TYR C CZ  1 
ATOM 51   O OH  . TYR A 1 6   ? 204.976 85.467  124.191 1.00 97.73  ? 6   TYR C OH  1 
ATOM 52   N N   . LYS A 1 7   ? 196.742 86.101  121.689 1.00 189.16 ? 7   LYS C N   1 
ATOM 53   C CA  . LYS A 1 7   ? 195.278 86.192  121.587 1.00 189.16 ? 7   LYS C CA  1 
ATOM 54   C C   . LYS A 1 7   ? 194.758 84.785  121.303 1.00 189.16 ? 7   LYS C C   1 
ATOM 55   O O   . LYS A 1 7   ? 193.620 84.444  121.632 1.00 189.16 ? 7   LYS C O   1 
ATOM 56   C CB  . LYS A 1 7   ? 194.856 87.160  120.444 1.00 122.62 ? 7   LYS C CB  1 
ATOM 57   C CG  . LYS A 1 7   ? 194.382 88.589  120.884 1.00 122.62 ? 7   LYS C CG  1 
ATOM 58   C CD  . LYS A 1 7   ? 194.093 89.552  119.693 1.00 122.62 ? 7   LYS C CD  1 
ATOM 59   C CE  . LYS A 1 7   ? 193.861 91.005  120.151 1.00 122.62 ? 7   LYS C CE  1 
ATOM 60   N NZ  . LYS A 1 7   ? 193.982 92.003  119.039 1.00 122.62 ? 7   LYS C NZ  1 
ATOM 61   N N   . GLU A 1 8   ? 195.637 83.977  120.715 1.00 84.03  ? 8   GLU C N   1 
ATOM 62   C CA  . GLU A 1 8   ? 195.377 82.593  120.330 1.00 84.03  ? 8   GLU C CA  1 
ATOM 63   C C   . GLU A 1 8   ? 195.269 81.589  121.478 1.00 84.03  ? 8   GLU C C   1 
ATOM 64   O O   . GLU A 1 8   ? 194.335 80.771  121.535 1.00 84.03  ? 8   GLU C O   1 
ATOM 65   C CB  . GLU A 1 8   ? 196.478 82.171  119.374 1.00 107.36 ? 8   GLU C CB  1 
ATOM 66   C CG  . GLU A 1 8   ? 196.530 80.718  119.082 1.00 107.36 ? 8   GLU C CG  1 
ATOM 67   C CD  . GLU A 1 8   ? 197.350 80.457  117.858 1.00 107.36 ? 8   GLU C CD  1 
ATOM 68   O OE1 . GLU A 1 8   ? 197.967 81.423  117.348 1.00 107.36 ? 8   GLU C OE1 1 
ATOM 69   O OE2 . GLU A 1 8   ? 197.377 79.295  117.410 1.00 107.36 ? 8   GLU C OE2 1 
ATOM 70   N N   . PHE A 1 9   ? 196.244 81.639  122.376 1.00 86.83  ? 9   PHE C N   1 
ATOM 71   C CA  . PHE A 1 9   ? 196.247 80.761  123.527 1.00 86.83  ? 9   PHE C CA  1 
ATOM 72   C C   . PHE A 1 9   ? 195.738 81.547  124.719 1.00 86.83  ? 9   PHE C C   1 
ATOM 73   O O   . PHE A 1 9   ? 196.407 81.596  125.748 1.00 86.83  ? 9   PHE C O   1 
ATOM 74   C CB  . PHE A 1 9   ? 197.652 80.285  123.824 1.00 82.52  ? 9   PHE C CB  1 
ATOM 75   C CG  . PHE A 1 9   ? 198.363 79.756  122.635 1.00 82.52  ? 9   PHE C CG  1 
ATOM 76   C CD1 . PHE A 1 9   ? 199.029 80.609  121.775 1.00 82.52  ? 9   PHE C CD1 1 
ATOM 77   C CD2 . PHE A 1 9   ? 198.384 78.391  122.375 1.00 82.52  ? 9   PHE C CD2 1 
ATOM 78   C CE1 . PHE A 1 9   ? 199.715 80.103  120.669 1.00 82.52  ? 9   PHE C CE1 1 
ATOM 79   C CE2 . PHE A 1 9   ? 199.067 77.872  121.269 1.00 82.52  ? 9   PHE C CE2 1 
ATOM 80   C CZ  . PHE A 1 9   ? 199.732 78.725  120.420 1.00 82.52  ? 9   PHE C CZ  1 
ATOM 81   N N   . GLY A 1 10  ? 194.563 82.164  124.570 1.00 118.52 ? 10  GLY C N   1 
ATOM 82   C CA  . GLY A 1 10  ? 193.972 82.959  125.639 1.00 118.52 ? 10  GLY C CA  1 
ATOM 83   C C   . GLY A 1 10  ? 194.999 83.691  126.486 1.00 118.52 ? 10  GLY C C   1 
ATOM 84   O O   . GLY A 1 10  ? 195.097 83.452  127.693 1.00 118.52 ? 10  GLY C O   1 
ATOM 85   N N   . ALA A 1 11  ? 195.761 84.585  125.859 1.00 117.91 ? 11  ALA C N   1 
ATOM 86   C CA  . ALA A 1 11  ? 196.797 85.329  126.568 1.00 117.91 ? 11  ALA C CA  1 
ATOM 87   C C   . ALA A 1 11  ? 197.312 86.567  125.820 1.00 117.91 ? 11  ALA C C   1 
ATOM 88   O O   . ALA A 1 11  ? 197.004 86.766  124.647 1.00 117.91 ? 11  ALA C O   1 
ATOM 89   C CB  . ALA A 1 11  ? 197.936 84.408  126.871 1.00 20.00  ? 11  ALA C CB  1 
ATOM 90   N N   . THR A 1 12  ? 198.110 87.388  126.504 1.00 49.03  ? 12  THR C N   1 
ATOM 91   C CA  . THR A 1 12  ? 198.643 88.612  125.910 1.00 49.03  ? 12  THR C CA  1 
ATOM 92   C C   . THR A 1 12  ? 200.135 88.903  126.135 1.00 49.03  ? 12  THR C C   1 
ATOM 93   O O   . THR A 1 12  ? 200.769 88.440  127.092 1.00 49.03  ? 12  THR C O   1 
ATOM 94   C CB  . THR A 1 12  ? 197.808 89.875  126.368 1.00 111.81 ? 12  THR C CB  1 
ATOM 95   O OG1 . THR A 1 12  ? 198.455 91.079  125.928 1.00 111.81 ? 12  THR C OG1 1 
ATOM 96   C CG2 . THR A 1 12  ? 197.649 89.919  127.884 1.00 111.81 ? 12  THR C CG2 1 
ATOM 97   N N   . VAL A 1 13  ? 200.681 89.681  125.207 1.00 80.93  ? 13  VAL C N   1 
ATOM 98   C CA  . VAL A 1 13  ? 202.070 90.106  125.250 1.00 80.93  ? 13  VAL C CA  1 
ATOM 99   C C   . VAL A 1 13  ? 202.209 91.018  126.463 1.00 80.93  ? 13  VAL C C   1 
ATOM 100  O O   . VAL A 1 13  ? 202.947 90.715  127.406 1.00 80.93  ? 13  VAL C O   1 
ATOM 101  C CB  . VAL A 1 13  ? 202.446 90.890  123.949 1.00 107.11 ? 13  VAL C CB  1 
ATOM 102  C CG1 . VAL A 1 13  ? 201.509 92.097  123.750 1.00 107.11 ? 13  VAL C CG1 1 
ATOM 103  C CG2 . VAL A 1 13  ? 203.894 91.346  124.014 1.00 107.11 ? 13  VAL C CG2 1 
ATOM 104  N N   . GLU A 1 14  ? 201.469 92.127  126.421 1.00 137.86 ? 14  GLU C N   1 
ATOM 105  C CA  . GLU A 1 14  ? 201.446 93.131  127.478 1.00 137.86 ? 14  GLU C CA  1 
ATOM 106  C C   . GLU A 1 14  ? 201.504 92.430  128.820 1.00 137.86 ? 14  GLU C C   1 
ATOM 107  O O   . GLU A 1 14  ? 202.024 92.959  129.805 1.00 137.86 ? 14  GLU C O   1 
ATOM 108  C CB  . GLU A 1 14  ? 200.154 93.944  127.396 1.00 142.46 ? 14  GLU C CB  1 
ATOM 109  C CG  . GLU A 1 14  ? 199.985 94.935  128.535 1.00 142.46 ? 14  GLU C CG  1 
ATOM 110  C CD  . GLU A 1 14  ? 198.546 95.060  128.992 1.00 142.46 ? 14  GLU C CD  1 
ATOM 111  O OE1 . GLU A 1 14  ? 198.261 95.985  129.779 1.00 142.46 ? 14  GLU C OE1 1 
ATOM 112  O OE2 . GLU A 1 14  ? 197.704 94.233  128.573 1.00 142.46 ? 14  GLU C OE2 1 
ATOM 113  N N   . LEU A 1 15  ? 200.951 91.226  128.831 1.00 54.33  ? 15  LEU C N   1 
ATOM 114  C CA  . LEU A 1 15  ? 200.907 90.397  130.017 1.00 54.33  ? 15  LEU C CA  1 
ATOM 115  C C   . LEU A 1 15  ? 202.281 89.947  130.469 1.00 54.33  ? 15  LEU C C   1 
ATOM 116  O O   . LEU A 1 15  ? 202.653 90.079  131.633 1.00 54.33  ? 15  LEU C O   1 
ATOM 117  C CB  . LEU A 1 15  ? 200.060 89.160  129.749 1.00 56.31  ? 15  LEU C CB  1 
ATOM 118  C CG  . LEU A 1 15  ? 199.968 88.131  130.878 1.00 56.31  ? 15  LEU C CG  1 
ATOM 119  C CD1 . LEU A 1 15  ? 198.912 87.129  130.521 1.00 56.31  ? 15  LEU C CD1 1 
ATOM 120  C CD2 . LEU A 1 15  ? 201.298 87.446  131.114 1.00 56.31  ? 15  LEU C CD2 1 
ATOM 121  N N   . LEU A 1 16  ? 203.027 89.363  129.551 1.00 72.13  ? 16  LEU C N   1 
ATOM 122  C CA  . LEU A 1 16  ? 204.340 88.891  129.913 1.00 72.13  ? 16  LEU C CA  1 
ATOM 123  C C   . LEU A 1 16  ? 205.239 90.038  130.367 1.00 72.13  ? 16  LEU C C   1 
ATOM 124  O O   . LEU A 1 16  ? 206.129 89.842  131.194 1.00 72.13  ? 16  LEU C O   1 
ATOM 125  C CB  . LEU A 1 16  ? 204.912 88.108  128.741 1.00 69.96  ? 16  LEU C CB  1 
ATOM 126  C CG  . LEU A 1 16  ? 203.960 86.933  128.469 1.00 69.96  ? 16  LEU C CG  1 
ATOM 127  C CD1 . LEU A 1 16  ? 204.514 85.997  127.403 1.00 69.96  ? 16  LEU C CD1 1 
ATOM 128  C CD2 . LEU A 1 16  ? 203.770 86.175  129.767 1.00 69.96  ? 16  LEU C CD2 1 
ATOM 129  N N   . SER A 1 17  ? 204.985 91.238  129.850 1.00 145.81 ? 17  SER C N   1 
ATOM 130  C CA  . SER A 1 17  ? 205.747 92.415  130.256 1.00 145.81 ? 17  SER C CA  1 
ATOM 131  C C   . SER A 1 17  ? 205.572 92.520  131.771 1.00 145.81 ? 17  SER C C   1 
ATOM 132  O O   . SER A 1 17  ? 206.239 93.318  132.446 1.00 145.81 ? 17  SER C O   1 
ATOM 133  C CB  . SER A 1 17  ? 205.191 93.672  129.580 1.00 130.11 ? 17  SER C CB  1 
ATOM 134  O OG  . SER A 1 17  ? 205.704 94.849  130.185 1.00 130.11 ? 17  SER C OG  1 
ATOM 135  N N   . PHE A 1 18  ? 204.659 91.691  132.282 1.00 95.41  ? 18  PHE C N   1 
ATOM 136  C CA  . PHE A 1 18  ? 204.342 91.630  133.700 1.00 95.41  ? 18  PHE C CA  1 
ATOM 137  C C   . PHE A 1 18  ? 205.496 91.002  134.427 1.00 95.41  ? 18  PHE C C   1 
ATOM 138  O O   . PHE A 1 18  ? 205.604 91.074  135.649 1.00 95.41  ? 18  PHE C O   1 
ATOM 139  C CB  . PHE A 1 18  ? 203.108 90.776  133.963 1.00 106.43 ? 18  PHE C CB  1 
ATOM 140  C CG  . PHE A 1 18  ? 202.564 90.931  135.344 1.00 106.43 ? 18  PHE C CG  1 
ATOM 141  C CD1 . PHE A 1 18  ? 201.722 91.989  135.656 1.00 106.43 ? 18  PHE C CD1 1 
ATOM 142  C CD2 . PHE A 1 18  ? 202.938 90.059  136.355 1.00 106.43 ? 18  PHE C CD2 1 
ATOM 143  C CE1 . PHE A 1 18  ? 201.265 92.175  136.962 1.00 106.43 ? 18  PHE C CE1 1 
ATOM 144  C CE2 . PHE A 1 18  ? 202.484 90.243  137.661 1.00 106.43 ? 18  PHE C CE2 1 
ATOM 145  C CZ  . PHE A 1 18  ? 201.652 91.296  137.967 1.00 106.43 ? 18  PHE C CZ  1 
ATOM 146  N N   . LEU A 1 19  ? 206.368 90.367  133.672 1.00 101.93 ? 19  LEU C N   1 
ATOM 147  C CA  . LEU A 1 19  ? 207.490 89.744  134.312 1.00 101.93 ? 19  LEU C CA  1 
ATOM 148  C C   . LEU A 1 19  ? 208.826 90.376  134.012 1.00 101.93 ? 19  LEU C C   1 
ATOM 149  O O   . LEU A 1 19  ? 209.135 90.780  132.884 1.00 101.93 ? 19  LEU C O   1 
ATOM 150  C CB  . LEU A 1 19  ? 207.502 88.267  133.987 1.00 89.96  ? 19  LEU C CB  1 
ATOM 151  C CG  . LEU A 1 19  ? 206.213 87.645  134.514 1.00 89.96  ? 19  LEU C CG  1 
ATOM 152  C CD1 . LEU A 1 19  ? 206.235 86.150  134.274 1.00 89.96  ? 19  LEU C CD1 1 
ATOM 153  C CD2 . LEU A 1 19  ? 206.089 87.945  135.994 1.00 89.96  ? 19  LEU C CD2 1 
ATOM 154  N N   . PRO A 1 20  ? 209.643 90.478  135.049 1.00 87.75  ? 20  PRO C N   1 
ATOM 155  C CA  . PRO A 1 20  ? 210.969 91.066  134.944 1.00 87.75  ? 20  PRO C CA  1 
ATOM 156  C C   . PRO A 1 20  ? 211.758 90.391  133.844 1.00 87.75  ? 20  PRO C C   1 
ATOM 157  O O   . PRO A 1 20  ? 211.800 89.165  133.739 1.00 87.75  ? 20  PRO C O   1 
ATOM 158  C CB  . PRO A 1 20  ? 211.548 90.833  136.331 1.00 77.13  ? 20  PRO C CB  1 
ATOM 159  C CG  . PRO A 1 20  ? 210.300 90.855  137.212 1.00 77.13  ? 20  PRO C CG  1 
ATOM 160  C CD  . PRO A 1 20  ? 209.376 89.998  136.414 1.00 77.13  ? 20  PRO C CD  1 
ATOM 161  N N   . SER A 1 21  ? 212.362 91.220  133.010 1.00 91.97  ? 21  SER C N   1 
ATOM 162  C CA  . SER A 1 21  ? 213.163 90.739  131.913 1.00 91.97  ? 21  SER C CA  1 
ATOM 163  C C   . SER A 1 21  ? 214.223 89.793  132.475 1.00 91.97  ? 21  SER C C   1 
ATOM 164  O O   . SER A 1 21  ? 214.584 88.791  131.841 1.00 91.97  ? 21  SER C O   1 
ATOM 165  C CB  . SER A 1 21  ? 213.820 91.936  131.220 1.00 141.78 ? 21  SER C CB  1 
ATOM 166  O OG  . SER A 1 21  ? 212.859 92.952  130.963 1.00 141.78 ? 21  SER C OG  1 
ATOM 167  N N   . ASP A 1 22  ? 214.705 90.107  133.678 1.00 120.30 ? 22  ASP C N   1 
ATOM 168  C CA  . ASP A 1 22  ? 215.739 89.288  134.289 1.00 120.30 ? 22  ASP C CA  1 
ATOM 169  C C   . ASP A 1 22  ? 215.200 87.934  134.733 1.00 120.30 ? 22  ASP C C   1 
ATOM 170  O O   . ASP A 1 22  ? 215.983 87.054  135.069 1.00 120.30 ? 22  ASP C O   1 
ATOM 171  C CB  . ASP A 1 22  ? 216.437 90.015  135.466 1.00 97.56  ? 22  ASP C CB  1 
ATOM 172  C CG  . ASP A 1 22  ? 215.495 90.377  136.556 1.00 97.56  ? 22  ASP C CG  1 
ATOM 173  O OD1 . ASP A 1 22  ? 214.528 89.613  136.714 1.00 97.56  ? 22  ASP C OD1 1 
ATOM 174  O OD2 . ASP A 1 22  ? 215.722 91.397  137.244 1.00 97.56  ? 22  ASP C OD2 1 
ATOM 175  N N   . PHE A 1 23  ? 213.881 87.741  134.700 1.00 101.44 ? 23  PHE C N   1 
ATOM 176  C CA  . PHE A 1 23  ? 213.328 86.452  135.117 1.00 101.44 ? 23  PHE C CA  1 
ATOM 177  C C   . PHE A 1 23  ? 213.637 85.251  134.223 1.00 101.44 ? 23  PHE C C   1 
ATOM 178  O O   . PHE A 1 23  ? 214.295 84.302  134.648 1.00 101.44 ? 23  PHE C O   1 
ATOM 179  C CB  . PHE A 1 23  ? 211.795 86.501  135.264 1.00 137.13 ? 23  PHE C CB  1 
ATOM 180  C CG  . PHE A 1 23  ? 211.139 85.118  135.555 1.00 137.13 ? 23  PHE C CG  1 
ATOM 181  C CD1 . PHE A 1 23  ? 211.438 83.978  134.782 1.00 137.13 ? 23  PHE C CD1 1 
ATOM 182  C CD2 . PHE A 1 23  ? 210.202 84.966  136.585 1.00 137.13 ? 23  PHE C CD2 1 
ATOM 183  C CE1 . PHE A 1 23  ? 210.830 82.726  135.021 1.00 137.13 ? 23  PHE C CE1 1 
ATOM 184  C CE2 . PHE A 1 23  ? 209.577 83.697  136.834 1.00 137.13 ? 23  PHE C CE2 1 
ATOM 185  C CZ  . PHE A 1 23  ? 209.898 82.585  136.047 1.00 137.13 ? 23  PHE C CZ  1 
ATOM 186  N N   . PHE A 1 24  ? 213.107 85.265  133.006 1.00 92.59  ? 24  PHE C N   1 
ATOM 187  C CA  . PHE A 1 24  ? 213.246 84.125  132.121 1.00 92.59  ? 24  PHE C CA  1 
ATOM 188  C C   . PHE A 1 24  ? 214.635 83.667  131.811 1.00 92.59  ? 24  PHE C C   1 
ATOM 189  O O   . PHE A 1 24  ? 215.565 84.467  131.605 1.00 92.59  ? 24  PHE C O   1 
ATOM 190  C CB  . PHE A 1 24  ? 212.553 84.347  130.788 1.00 122.32 ? 24  PHE C CB  1 
ATOM 191  C CG  . PHE A 1 24  ? 211.215 85.021  130.885 1.00 122.32 ? 24  PHE C CG  1 
ATOM 192  C CD1 . PHE A 1 24  ? 210.306 84.910  129.839 1.00 122.32 ? 24  PHE C CD1 1 
ATOM 193  C CD2 . PHE A 1 24  ? 210.912 85.876  131.936 1.00 122.32 ? 24  PHE C CD2 1 
ATOM 194  C CE1 . PHE A 1 24  ? 209.137 85.645  129.835 1.00 122.32 ? 24  PHE C CE1 1 
ATOM 195  C CE2 . PHE A 1 24  ? 209.743 86.616  131.937 1.00 122.32 ? 24  PHE C CE2 1 
ATOM 196  C CZ  . PHE A 1 24  ? 208.856 86.503  130.885 1.00 122.32 ? 24  PHE C CZ  1 
ATOM 197  N N   . PRO A 1 25  ? 214.786 82.345  131.745 1.00 87.48  ? 25  PRO C N   1 
ATOM 198  C CA  . PRO A 1 25  ? 216.009 81.605  131.456 1.00 87.48  ? 25  PRO C CA  1 
ATOM 199  C C   . PRO A 1 25  ? 216.639 82.060  130.151 1.00 87.48  ? 25  PRO C C   1 
ATOM 200  O O   . PRO A 1 25  ? 215.943 82.449  129.200 1.00 87.48  ? 25  PRO C O   1 
ATOM 201  C CB  . PRO A 1 25  ? 215.513 80.174  131.394 1.00 85.91  ? 25  PRO C CB  1 
ATOM 202  C CG  . PRO A 1 25  ? 214.470 80.171  132.484 1.00 85.91  ? 25  PRO C CG  1 
ATOM 203  C CD  . PRO A 1 25  ? 213.722 81.439  132.216 1.00 85.91  ? 25  PRO C CD  1 
ATOM 204  N N   . SER A 1 26  ? 217.965 82.037  130.120 1.00 89.29  ? 26  SER C N   1 
ATOM 205  C CA  . SER A 1 26  ? 218.671 82.423  128.917 1.00 89.29  ? 26  SER C CA  1 
ATOM 206  C C   . SER A 1 26  ? 218.361 81.359  127.877 1.00 89.29  ? 26  SER C C   1 
ATOM 207  O O   . SER A 1 26  ? 218.295 80.163  128.180 1.00 89.29  ? 26  SER C O   1 
ATOM 208  C CB  . SER A 1 26  ? 220.184 82.501  129.167 1.00 130.33 ? 26  SER C CB  1 
ATOM 209  O OG  . SER A 1 26  ? 220.738 81.231  129.475 1.00 130.33 ? 26  SER C OG  1 
ATOM 210  N N   . VAL A 1 27  ? 218.140 81.818  126.658 1.00 39.45  ? 27  VAL C N   1 
ATOM 211  C CA  . VAL A 1 27  ? 217.854 80.944  125.539 1.00 39.45  ? 27  VAL C CA  1 
ATOM 212  C C   . VAL A 1 27  ? 218.587 79.609  125.661 1.00 39.45  ? 27  VAL C C   1 
ATOM 213  O O   . VAL A 1 27  ? 217.952 78.561  125.765 1.00 39.45  ? 27  VAL C O   1 
ATOM 214  C CB  . VAL A 1 27  ? 218.276 81.638  124.238 1.00 98.37  ? 27  VAL C CB  1 
ATOM 215  C CG1 . VAL A 1 27  ? 217.949 80.784  123.045 1.00 98.37  ? 27  VAL C CG1 1 
ATOM 216  C CG2 . VAL A 1 27  ? 217.583 82.978  124.142 1.00 98.37  ? 27  VAL C CG2 1 
ATOM 217  N N   . ARG A 1 28  ? 219.922 79.663  125.655 1.00 89.43  ? 28  ARG C N   1 
ATOM 218  C CA  . ARG A 1 28  ? 220.763 78.465  125.748 1.00 89.43  ? 28  ARG C CA  1 
ATOM 219  C C   . ARG A 1 28  ? 220.087 77.377  126.587 1.00 89.43  ? 28  ARG C C   1 
ATOM 220  O O   . ARG A 1 28  ? 219.798 76.281  126.095 1.00 89.43  ? 28  ARG C O   1 
ATOM 221  C CB  . ARG A 1 28  ? 222.152 78.830  126.333 1.00 146.30 ? 28  ARG C CB  1 
ATOM 222  C CG  . ARG A 1 28  ? 223.139 77.658  126.543 1.00 146.30 ? 28  ARG C CG  1 
ATOM 223  C CD  . ARG A 1 28  ? 223.107 76.645  125.385 1.00 146.30 ? 28  ARG C CD  1 
ATOM 224  N NE  . ARG A 1 28  ? 223.149 77.270  124.056 1.00 146.30 ? 28  ARG C NE  1 
ATOM 225  C CZ  . ARG A 1 28  ? 222.909 76.631  122.908 1.00 146.30 ? 28  ARG C CZ  1 
ATOM 226  N NH1 . ARG A 1 28  ? 222.607 75.336  122.909 1.00 146.30 ? 28  ARG C NH1 1 
ATOM 227  N NH2 . ARG A 1 28  ? 222.964 77.290  121.753 1.00 146.30 ? 28  ARG C NH2 1 
ATOM 228  N N   . ASP A 1 29  ? 219.809 77.704  127.841 1.00 74.99  ? 29  ASP C N   1 
ATOM 229  C CA  . ASP A 1 29  ? 219.184 76.771  128.752 1.00 74.99  ? 29  ASP C CA  1 
ATOM 230  C C   . ASP A 1 29  ? 217.984 76.117  128.097 1.00 74.99  ? 29  ASP C C   1 
ATOM 231  O O   . ASP A 1 29  ? 217.973 74.911  127.862 1.00 74.99  ? 29  ASP C O   1 
ATOM 232  C CB  . ASP A 1 29  ? 218.736 77.500  130.020 1.00 97.14  ? 29  ASP C CB  1 
ATOM 233  C CG  . ASP A 1 29  ? 219.858 78.294  130.678 1.00 97.14  ? 29  ASP C CG  1 
ATOM 234  O OD1 . ASP A 1 29  ? 220.996 77.771  130.824 1.00 97.14  ? 29  ASP C OD1 1 
ATOM 235  O OD2 . ASP A 1 29  ? 219.580 79.450  131.065 1.00 97.14  ? 29  ASP C OD2 1 
ATOM 236  N N   . LEU A 1 30  ? 216.991 76.948  127.788 1.00 36.85  ? 30  LEU C N   1 
ATOM 237  C CA  . LEU A 1 30  ? 215.717 76.530  127.186 1.00 36.85  ? 30  LEU C CA  1 
ATOM 238  C C   . LEU A 1 30  ? 215.786 75.543  126.043 1.00 36.85  ? 30  LEU C C   1 
ATOM 239  O O   . LEU A 1 30  ? 215.208 74.458  126.121 1.00 36.85  ? 30  LEU C O   1 
ATOM 240  C CB  . LEU A 1 30  ? 214.929 77.746  126.709 1.00 77.41  ? 30  LEU C CB  1 
ATOM 241  C CG  . LEU A 1 30  ? 214.400 78.705  127.777 1.00 77.41  ? 30  LEU C CG  1 
ATOM 242  C CD1 . LEU A 1 30  ? 215.453 79.751  128.125 1.00 77.41  ? 30  LEU C CD1 1 
ATOM 243  C CD2 . LEU A 1 30  ? 213.148 79.380  127.248 1.00 77.41  ? 30  LEU C CD2 1 
ATOM 244  N N   . LEU A 1 31  ? 216.452 75.952  124.971 1.00 55.06  ? 31  LEU C N   1 
ATOM 245  C CA  . LEU A 1 31  ? 216.630 75.116  123.799 1.00 55.06  ? 31  LEU C CA  1 
ATOM 246  C C   . LEU A 1 31  ? 217.048 73.717  124.230 1.00 55.06  ? 31  LEU C C   1 
ATOM 247  O O   . LEU A 1 31  ? 216.396 72.718  123.887 1.00 55.06  ? 31  LEU C O   1 
ATOM 248  C CB  . LEU A 1 31  ? 217.716 75.721  122.937 1.00 81.66  ? 31  LEU C CB  1 
ATOM 249  C CG  . LEU A 1 31  ? 217.513 77.222  122.834 1.00 81.66  ? 31  LEU C CG  1 
ATOM 250  C CD1 . LEU A 1 31  ? 218.617 77.816  121.979 1.00 81.66  ? 31  LEU C CD1 1 
ATOM 251  C CD2 . LEU A 1 31  ? 216.141 77.501  122.258 1.00 81.66  ? 31  LEU C CD2 1 
ATOM 252  N N   . ASP A 1 32  ? 218.150 73.653  124.975 1.00 101.85 ? 32  ASP C N   1 
ATOM 253  C CA  . ASP A 1 32  ? 218.644 72.376  125.468 1.00 101.85 ? 32  ASP C CA  1 
ATOM 254  C C   . ASP A 1 32  ? 217.482 71.678  126.185 1.00 101.85 ? 32  ASP C C   1 
ATOM 255  O O   . ASP A 1 32  ? 217.060 70.601  125.765 1.00 101.85 ? 32  ASP C O   1 
ATOM 256  C CB  . ASP A 1 32  ? 219.842 72.574  126.419 1.00 105.41 ? 32  ASP C CB  1 
ATOM 257  C CG  . ASP A 1 32  ? 221.004 73.337  125.770 1.00 105.41 ? 32  ASP C CG  1 
ATOM 258  O OD1 . ASP A 1 32  ? 221.200 73.230  124.536 1.00 105.41 ? 32  ASP C OD1 1 
ATOM 259  O OD2 . ASP A 1 32  ? 221.739 74.030  126.512 1.00 105.41 ? 32  ASP C OD2 1 
ATOM 260  N N   . THR A 1 33  ? 216.955 72.312  127.239 1.00 102.11 ? 33  THR C N   1 
ATOM 261  C CA  . THR A 1 33  ? 215.820 71.774  128.017 1.00 102.11 ? 33  THR C CA  1 
ATOM 262  C C   . THR A 1 33  ? 214.774 71.160  127.086 1.00 102.11 ? 33  THR C C   1 
ATOM 263  O O   . THR A 1 33  ? 214.377 69.995  127.202 1.00 102.11 ? 33  THR C O   1 
ATOM 264  C CB  . THR A 1 33  ? 215.090 72.890  128.852 1.00 54.59  ? 33  THR C CB  1 
ATOM 265  O OG1 . THR A 1 33  ? 215.890 73.290  129.980 1.00 54.59  ? 33  THR C OG1 1 
ATOM 266  C CG2 . THR A 1 33  ? 213.735 72.385  129.340 1.00 54.59  ? 33  THR C CG2 1 
ATOM 267  N N   . ALA A 1 34  ? 214.337 71.984  126.155 1.00 54.82  ? 34  ALA C N   1 
ATOM 268  C CA  . ALA A 1 34  ? 213.346 71.603  125.179 1.00 54.82  ? 34  ALA C CA  1 
ATOM 269  C C   . ALA A 1 34  ? 213.663 70.361  124.347 1.00 54.82  ? 34  ALA C C   1 
ATOM 270  O O   . ALA A 1 34  ? 213.380 69.231  124.747 1.00 54.82  ? 34  ALA C O   1 
ATOM 271  C CB  . ALA A 1 34  ? 213.113 72.763  124.270 1.00 20.00  ? 34  ALA C CB  1 
ATOM 272  N N   . ALA A 1 35  ? 214.240 70.607  123.176 1.00 135.20 ? 35  ALA C N   1 
ATOM 273  C CA  . ALA A 1 35  ? 214.586 69.573  122.218 1.00 135.20 ? 35  ALA C CA  1 
ATOM 274  C C   . ALA A 1 35  ? 215.323 68.376  122.816 1.00 135.20 ? 35  ALA C C   1 
ATOM 275  O O   . ALA A 1 35  ? 215.520 67.365  122.137 1.00 135.20 ? 35  ALA C O   1 
ATOM 276  C CB  . ALA A 1 35  ? 215.394 70.190  121.068 1.00 46.11  ? 35  ALA C CB  1 
ATOM 277  N N   . ALA A 1 36  ? 215.741 68.479  124.074 1.00 114.32 ? 36  ALA C N   1 
ATOM 278  C CA  . ALA A 1 36  ? 216.424 67.362  124.724 1.00 114.32 ? 36  ALA C CA  1 
ATOM 279  C C   . ALA A 1 36  ? 215.352 66.655  125.541 1.00 114.32 ? 36  ALA C C   1 
ATOM 280  O O   . ALA A 1 36  ? 215.622 65.901  126.477 1.00 114.32 ? 36  ALA C O   1 
ATOM 281  C CB  . ALA A 1 36  ? 217.540 67.869  125.633 1.00 154.54 ? 36  ALA C CB  1 
ATOM 282  N N   . LEU A 1 37  ? 214.116 66.903  125.148 1.00 96.53  ? 37  LEU C N   1 
ATOM 283  C CA  . LEU A 1 37  ? 212.984 66.335  125.835 1.00 96.53  ? 37  LEU C CA  1 
ATOM 284  C C   . LEU A 1 37  ? 211.827 66.033  124.857 1.00 96.53  ? 37  LEU C C   1 
ATOM 285  O O   . LEU A 1 37  ? 211.005 65.129  125.086 1.00 96.53  ? 37  LEU C O   1 
ATOM 286  C CB  . LEU A 1 37  ? 212.586 67.325  126.930 1.00 38.57  ? 37  LEU C CB  1 
ATOM 287  C CG  . LEU A 1 37  ? 211.143 67.351  127.402 1.00 38.57  ? 37  LEU C CG  1 
ATOM 288  C CD1 . LEU A 1 37  ? 210.712 65.961  127.853 1.00 38.57  ? 37  LEU C CD1 1 
ATOM 289  C CD2 . LEU A 1 37  ? 211.016 68.370  128.509 1.00 38.57  ? 37  LEU C CD2 1 
ATOM 290  N N   . TYR A 1 38  ? 211.794 66.765  123.747 1.00 91.33  ? 38  TYR C N   1 
ATOM 291  C CA  . TYR A 1 38  ? 210.748 66.577  122.766 1.00 91.33  ? 38  TYR C CA  1 
ATOM 292  C C   . TYR A 1 38  ? 211.237 66.180  121.404 1.00 91.33  ? 38  TYR C C   1 
ATOM 293  O O   . TYR A 1 38  ? 210.497 65.554  120.662 1.00 91.33  ? 38  TYR C O   1 
ATOM 294  C CB  . TYR A 1 38  ? 209.933 67.837  122.677 1.00 61.43  ? 38  TYR C CB  1 
ATOM 295  C CG  . TYR A 1 38  ? 209.276 68.136  123.989 1.00 61.43  ? 38  TYR C CG  1 
ATOM 296  C CD1 . TYR A 1 38  ? 208.408 67.218  124.590 1.00 61.43  ? 38  TYR C CD1 1 
ATOM 297  C CD2 . TYR A 1 38  ? 209.492 69.342  124.627 1.00 61.43  ? 38  TYR C CD2 1 
ATOM 298  C CE1 . TYR A 1 38  ? 207.767 67.516  125.807 1.00 61.43  ? 38  TYR C CE1 1 
ATOM 299  C CE2 . TYR A 1 38  ? 208.859 69.651  125.835 1.00 61.43  ? 38  TYR C CE2 1 
ATOM 300  C CZ  . TYR A 1 38  ? 208.002 68.747  126.419 1.00 61.43  ? 38  TYR C CZ  1 
ATOM 301  O OH  . TYR A 1 38  ? 207.385 69.104  127.600 1.00 61.43  ? 38  TYR C OH  1 
ATOM 302  N N   . ARG A 1 39  ? 212.474 66.561  121.086 1.00 97.37  ? 39  ARG C N   1 
ATOM 303  C CA  . ARG A 1 39  ? 213.128 66.231  119.809 1.00 97.37  ? 39  ARG C CA  1 
ATOM 304  C C   . ARG A 1 39  ? 212.177 65.316  119.013 1.00 97.37  ? 39  ARG C C   1 
ATOM 305  O O   . ARG A 1 39  ? 211.447 65.783  118.126 1.00 97.37  ? 39  ARG C O   1 
ATOM 306  C CB  . ARG A 1 39  ? 214.484 65.517  120.095 1.00 117.57 ? 39  ARG C CB  1 
ATOM 307  C CG  . ARG A 1 39  ? 215.634 65.733  119.077 1.00 117.57 ? 39  ARG C CG  1 
ATOM 308  C CD  . ARG A 1 39  ? 216.997 65.249  119.633 1.00 117.57 ? 39  ARG C CD  1 
ATOM 309  N NE  . ARG A 1 39  ? 218.081 65.297  118.640 1.00 117.57 ? 39  ARG C NE  1 
ATOM 310  C CZ  . ARG A 1 39  ? 218.829 66.368  118.354 1.00 117.57 ? 39  ARG C CZ  1 
ATOM 311  N NH1 . ARG A 1 39  ? 218.637 67.516  118.984 1.00 117.57 ? 39  ARG C NH1 1 
ATOM 312  N NH2 . ARG A 1 39  ? 219.776 66.295  117.424 1.00 117.57 ? 39  ARG C NH2 1 
ATOM 313  N N   . ASP A 1 40  ? 212.166 64.027  119.375 1.00 148.35 ? 40  ASP C N   1 
ATOM 314  C CA  . ASP A 1 40  ? 211.317 63.016  118.733 1.00 148.35 ? 40  ASP C CA  1 
ATOM 315  C C   . ASP A 1 40  ? 209.969 63.600  118.330 1.00 148.35 ? 40  ASP C C   1 
ATOM 316  O O   . ASP A 1 40  ? 209.577 63.557  117.161 1.00 148.35 ? 40  ASP C O   1 
ATOM 317  C CB  . ASP A 1 40  ? 211.073 61.831  119.683 1.00 109.53 ? 40  ASP C CB  1 
ATOM 318  C CG  . ASP A 1 40  ? 212.318 60.977  119.904 1.00 109.53 ? 40  ASP C CG  1 
ATOM 319  O OD1 . ASP A 1 40  ? 213.304 61.105  119.134 1.00 109.53 ? 40  ASP C OD1 1 
ATOM 320  O OD2 . ASP A 1 40  ? 212.298 60.157  120.849 1.00 109.53 ? 40  ASP C OD2 1 
ATOM 321  N N   . ALA A 1 41  ? 209.273 64.140  119.324 1.00 79.09  ? 41  ALA C N   1 
ATOM 322  C CA  . ALA A 1 41  ? 207.958 64.753  119.145 1.00 79.09  ? 41  ALA C CA  1 
ATOM 323  C C   . ALA A 1 41  ? 207.915 65.798  118.031 1.00 79.09  ? 41  ALA C C   1 
ATOM 324  O O   . ALA A 1 41  ? 206.928 65.920  117.303 1.00 79.09  ? 41  ALA C O   1 
ATOM 325  C CB  . ALA A 1 41  ? 207.503 65.399  120.474 1.00 57.91  ? 41  ALA C CB  1 
ATOM 326  N N   . LEU A 1 42  ? 209.004 66.535  117.896 1.00 63.22  ? 42  LEU C N   1 
ATOM 327  C CA  . LEU A 1 42  ? 209.080 67.607  116.923 1.00 63.22  ? 42  LEU C CA  1 
ATOM 328  C C   . LEU A 1 42  ? 209.539 67.222  115.534 1.00 63.22  ? 42  LEU C C   1 
ATOM 329  O O   . LEU A 1 42  ? 208.983 67.685  114.544 1.00 63.22  ? 42  LEU C O   1 
ATOM 330  C CB  . LEU A 1 42  ? 209.964 68.692  117.499 1.00 44.91  ? 42  LEU C CB  1 
ATOM 331  C CG  . LEU A 1 42  ? 209.413 68.894  118.912 1.00 44.91  ? 42  LEU C CG  1 
ATOM 332  C CD1 . LEU A 1 42  ? 210.458 69.458  119.848 1.00 44.91  ? 42  LEU C CD1 1 
ATOM 333  C CD2 . LEU A 1 42  ? 208.187 69.776  118.820 1.00 44.91  ? 42  LEU C CD2 1 
ATOM 334  N N   . GLU A 1 43  ? 210.553 66.379  115.449 1.00 133.11 ? 43  GLU C N   1 
ATOM 335  C CA  . GLU A 1 43  ? 211.038 65.944  114.150 1.00 133.11 ? 43  GLU C CA  1 
ATOM 336  C C   . GLU A 1 43  ? 209.998 64.913  113.643 1.00 133.11 ? 43  GLU C C   1 
ATOM 337  O O   . GLU A 1 43  ? 210.316 63.970  112.907 1.00 133.11 ? 43  GLU C O   1 
ATOM 338  C CB  . GLU A 1 43  ? 212.461 65.365  114.329 1.00 116.06 ? 43  GLU C CB  1 
ATOM 339  C CG  . GLU A 1 43  ? 213.410 66.358  115.085 1.00 116.06 ? 43  GLU C CG  1 
ATOM 340  C CD  . GLU A 1 43  ? 214.849 65.864  115.307 1.00 116.06 ? 43  GLU C CD  1 
ATOM 341  O OE1 . GLU A 1 43  ? 215.037 64.747  115.841 1.00 116.06 ? 43  GLU C OE1 1 
ATOM 342  O OE2 . GLU A 1 43  ? 215.794 66.614  114.963 1.00 116.06 ? 43  GLU C OE2 1 
ATOM 343  N N   . SER A 1 44  ? 208.743 65.155  114.046 1.00 76.82  ? 44  SER C N   1 
ATOM 344  C CA  . SER A 1 44  ? 207.568 64.326  113.736 1.00 76.82  ? 44  SER C CA  1 
ATOM 345  C C   . SER A 1 44  ? 206.567 65.011  112.789 1.00 76.82  ? 44  SER C C   1 
ATOM 346  O O   . SER A 1 44  ? 206.545 66.235  112.688 1.00 76.82  ? 44  SER C O   1 
ATOM 347  C CB  . SER A 1 44  ? 206.850 63.955  115.051 1.00 88.59  ? 44  SER C CB  1 
ATOM 348  O OG  . SER A 1 44  ? 205.583 63.341  114.839 1.00 88.59  ? 44  SER C OG  1 
ATOM 349  N N   . PRO A 1 45  ? 205.741 64.214  112.070 1.00 83.27  ? 45  PRO C N   1 
ATOM 350  C CA  . PRO A 1 45  ? 204.723 64.702  111.124 1.00 83.27  ? 45  PRO C CA  1 
ATOM 351  C C   . PRO A 1 45  ? 203.360 65.043  111.767 1.00 83.27  ? 45  PRO C C   1 
ATOM 352  O O   . PRO A 1 45  ? 202.400 65.421  111.069 1.00 83.27  ? 45  PRO C O   1 
ATOM 353  C CB  . PRO A 1 45  ? 204.588 63.540  110.120 1.00 77.97  ? 45  PRO C CB  1 
ATOM 354  C CG  . PRO A 1 45  ? 205.858 62.737  110.291 1.00 77.97  ? 45  PRO C CG  1 
ATOM 355  C CD  . PRO A 1 45  ? 206.054 62.801  111.779 1.00 77.97  ? 45  PRO C CD  1 
ATOM 356  N N   . GLU A 1 46  ? 203.273 64.905  113.088 1.00 95.45  ? 46  GLU C N   1 
ATOM 357  C CA  . GLU A 1 46  ? 202.015 65.165  113.784 1.00 95.45  ? 46  GLU C CA  1 
ATOM 358  C C   . GLU A 1 46  ? 201.976 66.537  114.462 1.00 95.45  ? 46  GLU C C   1 
ATOM 359  O O   . GLU A 1 46  ? 202.803 66.818  115.332 1.00 95.45  ? 46  GLU C O   1 
ATOM 360  C CB  . GLU A 1 46  ? 201.760 64.066  114.834 1.00 116.11 ? 46  GLU C CB  1 
ATOM 361  C CG  . GLU A 1 46  ? 201.700 62.649  114.274 1.00 116.11 ? 46  GLU C CG  1 
ATOM 362  C CD  . GLU A 1 46  ? 200.800 62.538  113.054 1.00 116.11 ? 46  GLU C CD  1 
ATOM 363  O OE1 . GLU A 1 46  ? 199.746 63.212  113.030 1.00 116.11 ? 46  GLU C OE1 1 
ATOM 364  O OE2 . GLU A 1 46  ? 201.142 61.771  112.125 1.00 116.11 ? 46  GLU C OE2 1 
ATOM 365  N N   . HIS A 1 47  ? 201.026 67.387  114.063 1.00 110.56 ? 47  HIS C N   1 
ATOM 366  C CA  . HIS A 1 47  ? 200.905 68.701  114.686 1.00 110.56 ? 47  HIS C CA  1 
ATOM 367  C C   . HIS A 1 47  ? 200.124 68.577  115.992 1.00 110.56 ? 47  HIS C C   1 
ATOM 368  O O   . HIS A 1 47  ? 199.256 69.389  116.312 1.00 110.56 ? 47  HIS C O   1 
ATOM 369  C CB  . HIS A 1 47  ? 200.229 69.736  113.759 1.00 177.92 ? 47  HIS C CB  1 
ATOM 370  C CG  . HIS A 1 47  ? 199.308 69.166  112.716 1.00 177.92 ? 47  HIS C CG  1 
ATOM 371  N ND1 . HIS A 1 47  ? 199.732 68.275  111.761 1.00 177.92 ? 47  HIS C ND1 1 
ATOM 372  C CD2 . HIS A 1 47  ? 198.029 69.493  112.378 1.00 177.92 ? 47  HIS C CD2 1 
ATOM 373  C CE1 . HIS A 1 47  ? 198.770 68.072  110.872 1.00 177.92 ? 47  HIS C CE1 1 
ATOM 374  N NE2 . HIS A 1 47  ? 197.729 68.802  111.229 1.00 177.92 ? 47  HIS C NE2 1 
ATOM 375  N N   . ALA A 1 48  ? 200.497 67.543  116.745 1.00 115.02 ? 48  ALA C N   1 
ATOM 376  C CA  . ALA A 1 48  ? 199.898 67.153  118.034 1.00 115.02 ? 48  ALA C CA  1 
ATOM 377  C C   . ALA A 1 48  ? 199.120 68.242  118.752 1.00 115.02 ? 48  ALA C C   1 
ATOM 378  O O   . ALA A 1 48  ? 198.161 67.967  119.486 1.00 115.02 ? 48  ALA C O   1 
ATOM 379  C CB  . ALA A 1 48  ? 200.961 66.593  118.956 1.00 63.44  ? 48  ALA C CB  1 
ATOM 380  N N   . SER A 1 49  ? 199.528 69.481  118.544 1.00 105.29 ? 49  SER C N   1 
ATOM 381  C CA  . SER A 1 49  ? 198.822 70.585  119.145 1.00 105.29 ? 49  SER C CA  1 
ATOM 382  C C   . SER A 1 49  ? 199.452 71.812  118.576 1.00 105.29 ? 49  SER C C   1 
ATOM 383  O O   . SER A 1 49  ? 200.557 71.753  118.042 1.00 105.29 ? 49  SER C O   1 
ATOM 384  C CB  . SER A 1 49  ? 198.995 70.592  120.660 1.00 60.71  ? 49  SER C CB  1 
ATOM 385  O OG  . SER A 1 49  ? 200.174 71.287  121.018 1.00 60.71  ? 49  SER C OG  1 
ATOM 386  N N   . PRO A 1 50  ? 198.751 72.942  118.674 1.00 85.01  ? 50  PRO C N   1 
ATOM 387  C CA  . PRO A 1 50  ? 199.246 74.220  118.170 1.00 85.01  ? 50  PRO C CA  1 
ATOM 388  C C   . PRO A 1 50  ? 200.558 74.585  118.868 1.00 85.01  ? 50  PRO C C   1 
ATOM 389  O O   . PRO A 1 50  ? 201.521 75.010  118.230 1.00 85.01  ? 50  PRO C O   1 
ATOM 390  C CB  . PRO A 1 50  ? 198.103 75.184  118.501 1.00 110.14 ? 50  PRO C CB  1 
ATOM 391  C CG  . PRO A 1 50  ? 197.504 74.581  119.739 1.00 110.14 ? 50  PRO C CG  1 
ATOM 392  C CD  . PRO A 1 50  ? 197.462 73.117  119.363 1.00 110.14 ? 50  PRO C CD  1 
ATOM 393  N N   . HIS A 1 51  ? 200.603 74.414  120.179 1.00 54.82  ? 51  HIS C N   1 
ATOM 394  C CA  . HIS A 1 51  ? 201.816 74.726  120.903 1.00 54.82  ? 51  HIS C CA  1 
ATOM 395  C C   . HIS A 1 51  ? 203.006 74.211  120.115 1.00 54.82  ? 51  HIS C C   1 
ATOM 396  O O   . HIS A 1 51  ? 203.915 74.969  119.774 1.00 54.82  ? 51  HIS C O   1 
ATOM 397  C CB  . HIS A 1 51  ? 201.759 74.082  122.268 1.00 104.42 ? 51  HIS C CB  1 
ATOM 398  C CG  . HIS A 1 51  ? 200.834 74.779  123.211 1.00 104.42 ? 51  HIS C CG  1 
ATOM 399  N ND1 . HIS A 1 51  ? 201.162 75.968  123.825 1.00 104.42 ? 51  HIS C ND1 1 
ATOM 400  C CD2 . HIS A 1 51  ? 199.594 74.457  123.650 1.00 104.42 ? 51  HIS C CD2 1 
ATOM 401  C CE1 . HIS A 1 51  ? 200.166 76.345  124.606 1.00 104.42 ? 51  HIS C CE1 1 
ATOM 402  N NE2 . HIS A 1 51  ? 199.201 75.446  124.519 1.00 104.42 ? 51  HIS C NE2 1 
ATOM 403  N N   . HIS A 1 52  ? 202.988 72.921  119.805 1.00 75.39  ? 52  HIS C N   1 
ATOM 404  C CA  . HIS A 1 52  ? 204.066 72.335  119.022 1.00 75.39  ? 52  HIS C CA  1 
ATOM 405  C C   . HIS A 1 52  ? 204.205 73.199  117.792 1.00 75.39  ? 52  HIS C C   1 
ATOM 406  O O   . HIS A 1 52  ? 205.064 74.080  117.713 1.00 75.39  ? 52  HIS C O   1 
ATOM 407  C CB  . HIS A 1 52  ? 203.705 70.920  118.573 1.00 105.77 ? 52  HIS C CB  1 
ATOM 408  C CG  . HIS A 1 52  ? 203.447 69.984  119.702 1.00 105.77 ? 52  HIS C CG  1 
ATOM 409  N ND1 . HIS A 1 52  ? 202.324 70.073  120.494 1.00 105.77 ? 52  HIS C ND1 1 
ATOM 410  C CD2 . HIS A 1 52  ? 204.199 68.983  120.218 1.00 105.77 ? 52  HIS C CD2 1 
ATOM 411  C CE1 . HIS A 1 52  ? 202.398 69.169  121.455 1.00 105.77 ? 52  HIS C CE1 1 
ATOM 412  N NE2 . HIS A 1 52  ? 203.526 68.496  121.311 1.00 105.77 ? 52  HIS C NE2 1 
ATOM 413  N N   . THR A 1 53  ? 203.326 72.908  116.839 1.00 125.28 ? 53  THR C N   1 
ATOM 414  C CA  . THR A 1 53  ? 203.228 73.597  115.564 1.00 125.28 ? 53  THR C CA  1 
ATOM 415  C C   . THR A 1 53  ? 203.874 74.972  115.640 1.00 125.28 ? 53  THR C C   1 
ATOM 416  O O   . THR A 1 53  ? 204.961 75.195  115.105 1.00 125.28 ? 53  THR C O   1 
ATOM 417  C CB  . THR A 1 53  ? 201.747 73.762  115.180 1.00 200.00 ? 53  THR C CB  1 
ATOM 418  O OG1 . THR A 1 53  ? 201.091 72.484  115.229 1.00 200.00 ? 53  THR C OG1 1 
ATOM 419  C CG2 . THR A 1 53  ? 201.619 74.371  113.792 1.00 200.00 ? 53  THR C CG2 1 
ATOM 420  N N   . ALA A 1 54  ? 203.186 75.882  116.320 1.00 114.74 ? 54  ALA C N   1 
ATOM 421  C CA  . ALA A 1 54  ? 203.647 77.253  116.501 1.00 114.74 ? 54  ALA C CA  1 
ATOM 422  C C   . ALA A 1 54  ? 205.124 77.257  116.823 1.00 114.74 ? 54  ALA C C   1 
ATOM 423  O O   . ALA A 1 54  ? 205.983 77.433  115.956 1.00 114.74 ? 54  ALA C O   1 
ATOM 424  C CB  . ALA A 1 54  ? 202.879 77.907  117.639 1.00 129.99 ? 54  ALA C CB  1 
ATOM 425  N N   . LEU A 1 55  ? 205.392 77.086  118.104 1.00 50.04  ? 55  LEU C N   1 
ATOM 426  C CA  . LEU A 1 55  ? 206.734 77.022  118.619 1.00 50.04  ? 55  LEU C CA  1 
ATOM 427  C C   . LEU A 1 55  ? 207.810 76.739  117.568 1.00 50.04  ? 55  LEU C C   1 
ATOM 428  O O   . LEU A 1 55  ? 208.681 77.571  117.312 1.00 50.04  ? 55  LEU C O   1 
ATOM 429  C CB  . LEU A 1 55  ? 206.745 75.950  119.683 1.00 20.25  ? 55  LEU C CB  1 
ATOM 430  C CG  . LEU A 1 55  ? 208.087 75.445  120.169 1.00 20.25  ? 55  LEU C CG  1 
ATOM 431  C CD1 . LEU A 1 55  ? 207.947 75.131  121.674 1.00 20.25  ? 55  LEU C CD1 1 
ATOM 432  C CD2 . LEU A 1 55  ? 208.533 74.234  119.315 1.00 20.25  ? 55  LEU C CD2 1 
ATOM 433  N N   . ARG A 1 56  ? 207.739 75.553  116.975 1.00 65.00  ? 56  ARG C N   1 
ATOM 434  C CA  . ARG A 1 56  ? 208.685 75.127  115.955 1.00 65.00  ? 56  ARG C CA  1 
ATOM 435  C C   . ARG A 1 56  ? 209.178 76.323  115.139 1.00 65.00  ? 56  ARG C C   1 
ATOM 436  O O   . ARG A 1 56  ? 210.383 76.524  114.978 1.00 65.00  ? 56  ARG C O   1 
ATOM 437  C CB  . ARG A 1 56  ? 208.017 74.084  115.050 1.00 119.28 ? 56  ARG C CB  1 
ATOM 438  C CG  . ARG A 1 56  ? 207.298 72.970  115.823 1.00 119.28 ? 56  ARG C CG  1 
ATOM 439  C CD  . ARG A 1 56  ? 207.022 71.742  114.958 1.00 119.28 ? 56  ARG C CD  1 
ATOM 440  N NE  . ARG A 1 56  ? 206.297 70.702  115.686 1.00 119.28 ? 56  ARG C NE  1 
ATOM 441  C CZ  . ARG A 1 56  ? 206.190 69.438  115.283 1.00 119.28 ? 56  ARG C CZ  1 
ATOM 442  N NH1 . ARG A 1 56  ? 206.768 69.048  114.155 1.00 119.28 ? 56  ARG C NH1 1 
ATOM 443  N NH2 . ARG A 1 56  ? 205.502 68.560  116.003 1.00 119.28 ? 56  ARG C NH2 1 
ATOM 444  N N   . GLN A 1 57  ? 208.237 77.119  114.640 1.00 95.69  ? 57  GLN C N   1 
ATOM 445  C CA  . GLN A 1 57  ? 208.561 78.310  113.859 1.00 95.69  ? 57  GLN C CA  1 
ATOM 446  C C   . GLN A 1 57  ? 209.635 79.056  114.605 1.00 95.69  ? 57  GLN C C   1 
ATOM 447  O O   . GLN A 1 57  ? 210.785 79.166  114.165 1.00 95.69  ? 57  GLN C O   1 
ATOM 448  C CB  . GLN A 1 57  ? 207.330 79.209  113.736 1.00 129.33 ? 57  GLN C CB  1 
ATOM 449  C CG  . GLN A 1 57  ? 206.193 78.572  112.974 1.00 129.33 ? 57  GLN C CG  1 
ATOM 450  C CD  . GLN A 1 57  ? 206.602 78.217  111.569 1.00 129.33 ? 57  GLN C CD  1 
ATOM 451  O OE1 . GLN A 1 57  ? 207.124 79.065  110.850 1.00 129.33 ? 57  GLN C OE1 1 
ATOM 452  N NE2 . GLN A 1 57  ? 206.376 76.965  111.165 1.00 129.33 ? 57  GLN C NE2 1 
ATOM 453  N N   . ALA A 1 58  ? 209.214 79.561  115.753 1.00 94.59  ? 58  ALA C N   1 
ATOM 454  C CA  . ALA A 1 58  ? 210.055 80.309  116.660 1.00 94.59  ? 58  ALA C CA  1 
ATOM 455  C C   . ALA A 1 58  ? 211.521 79.946  116.523 1.00 94.59  ? 58  ALA C C   1 
ATOM 456  O O   . ALA A 1 58  ? 212.377 80.782  116.217 1.00 94.59  ? 58  ALA C O   1 
ATOM 457  C CB  . ALA A 1 58  ? 209.602 80.046  118.071 1.00 20.00  ? 58  ALA C CB  1 
ATOM 458  N N   . ILE A 1 59  ? 211.804 78.681  116.757 1.00 83.16  ? 59  ILE C N   1 
ATOM 459  C CA  . ILE A 1 59  ? 213.163 78.213  116.677 1.00 83.16  ? 59  ILE C CA  1 
ATOM 460  C C   . ILE A 1 59  ? 213.822 78.589  115.359 1.00 83.16  ? 59  ILE C C   1 
ATOM 461  O O   . ILE A 1 59  ? 214.746 79.392  115.318 1.00 83.16  ? 59  ILE C O   1 
ATOM 462  C CB  . ILE A 1 59  ? 213.222 76.695  116.834 1.00 20.00  ? 59  ILE C CB  1 
ATOM 463  C CG1 . ILE A 1 59  ? 212.651 76.280  118.197 1.00 20.00  ? 59  ILE C CG1 1 
ATOM 464  C CG2 . ILE A 1 59  ? 214.660 76.233  116.631 1.00 20.00  ? 59  ILE C CG2 1 
ATOM 465  C CD1 . ILE A 1 59  ? 211.158 76.438  118.322 1.00 20.00  ? 59  ILE C CD1 1 
ATOM 466  N N   . LEU A 1 60  ? 213.331 78.001  114.282 1.00 128.72 ? 60  LEU C N   1 
ATOM 467  C CA  . LEU A 1 60  ? 213.883 78.242  112.968 1.00 128.72 ? 60  LEU C CA  1 
ATOM 468  C C   . LEU A 1 60  ? 214.037 79.712  112.614 1.00 128.72 ? 60  LEU C C   1 
ATOM 469  O O   . LEU A 1 60  ? 215.067 80.108  112.074 1.00 128.72 ? 60  LEU C O   1 
ATOM 470  C CB  . LEU A 1 60  ? 213.025 77.517  111.949 1.00 106.87 ? 60  LEU C CB  1 
ATOM 471  C CG  . LEU A 1 60  ? 212.887 76.062  112.414 1.00 106.87 ? 60  LEU C CG  1 
ATOM 472  C CD1 . LEU A 1 60  ? 211.912 75.314  111.542 1.00 106.87 ? 60  LEU C CD1 1 
ATOM 473  C CD2 . LEU A 1 60  ? 214.255 75.388  112.391 1.00 106.87 ? 60  LEU C CD2 1 
ATOM 474  N N   . ALA A 1 61  ? 213.027 80.523  112.914 1.00 108.27 ? 61  ALA C N   1 
ATOM 475  C CA  . ALA A 1 61  ? 213.108 81.954  112.629 1.00 108.27 ? 61  ALA C CA  1 
ATOM 476  C C   . ALA A 1 61  ? 214.272 82.527  113.433 1.00 108.27 ? 61  ALA C C   1 
ATOM 477  O O   . ALA A 1 61  ? 214.897 83.512  113.041 1.00 108.27 ? 61  ALA C O   1 
ATOM 478  C CB  . ALA A 1 61  ? 211.816 82.636  113.017 1.00 118.85 ? 61  ALA C CB  1 
ATOM 479  N N   . TRP A 1 62  ? 214.543 81.889  114.567 1.00 74.95  ? 62  TRP C N   1 
ATOM 480  C CA  . TRP A 1 62  ? 215.635 82.273  115.454 1.00 74.95  ? 62  TRP C CA  1 
ATOM 481  C C   . TRP A 1 62  ? 216.941 81.610  115.008 1.00 74.95  ? 62  TRP C C   1 
ATOM 482  O O   . TRP A 1 62  ? 218.000 82.239  114.990 1.00 74.95  ? 62  TRP C O   1 
ATOM 483  C CB  . TRP A 1 62  ? 215.314 81.859  116.894 1.00 109.07 ? 62  TRP C CB  1 
ATOM 484  C CG  . TRP A 1 62  ? 216.522 81.793  117.788 1.00 109.07 ? 62  TRP C CG  1 
ATOM 485  C CD1 . TRP A 1 62  ? 217.450 80.789  117.851 1.00 109.07 ? 62  TRP C CD1 1 
ATOM 486  C CD2 . TRP A 1 62  ? 216.947 82.786  118.724 1.00 109.07 ? 62  TRP C CD2 1 
ATOM 487  N NE1 . TRP A 1 62  ? 218.425 81.100  118.770 1.00 109.07 ? 62  TRP C NE1 1 
ATOM 488  C CE2 . TRP A 1 62  ? 218.140 82.321  119.322 1.00 109.07 ? 62  TRP C CE2 1 
ATOM 489  C CE3 . TRP A 1 62  ? 216.434 84.028  119.116 1.00 109.07 ? 62  TRP C CE3 1 
ATOM 490  C CZ2 . TRP A 1 62  ? 218.828 83.052  120.290 1.00 109.07 ? 62  TRP C CZ2 1 
ATOM 491  C CZ3 . TRP A 1 62  ? 217.118 84.756  120.079 1.00 109.07 ? 62  TRP C CZ3 1 
ATOM 492  C CH2 . TRP A 1 62  ? 218.304 84.263  120.655 1.00 109.07 ? 62  TRP C CH2 1 
ATOM 493  N N   . GLY A 1 63  ? 216.863 80.325  114.677 1.00 129.11 ? 63  GLY C N   1 
ATOM 494  C CA  . GLY A 1 63  ? 218.042 79.621  114.222 1.00 129.11 ? 63  GLY C CA  1 
ATOM 495  C C   . GLY A 1 63  ? 218.647 80.429  113.091 1.00 129.11 ? 63  GLY C C   1 
ATOM 496  O O   . GLY A 1 63  ? 219.864 80.448  112.934 1.00 129.11 ? 63  GLY C O   1 
ATOM 497  N N   . ASP A 1 64  ? 217.796 81.107  112.315 1.00 82.73  ? 64  ASP C N   1 
ATOM 498  C CA  . ASP A 1 64  ? 218.242 81.929  111.188 1.00 82.73  ? 64  ASP C CA  1 
ATOM 499  C C   . ASP A 1 64  ? 218.993 83.151  111.681 1.00 82.73  ? 64  ASP C C   1 
ATOM 500  O O   . ASP A 1 64  ? 219.684 83.821  110.915 1.00 82.73  ? 64  ASP C O   1 
ATOM 501  C CB  . ASP A 1 64  ? 217.053 82.379  110.334 1.00 115.48 ? 64  ASP C CB  1 
ATOM 502  C CG  . ASP A 1 64  ? 216.403 81.226  109.578 1.00 115.48 ? 64  ASP C CG  1 
ATOM 503  O OD1 . ASP A 1 64  ? 217.147 80.381  109.025 1.00 115.48 ? 64  ASP C OD1 1 
ATOM 504  O OD2 . ASP A 1 64  ? 215.151 81.170  109.522 1.00 115.48 ? 64  ASP C OD2 1 
ATOM 505  N N   . LEU A 1 65  ? 218.852 83.425  112.972 1.00 79.43  ? 65  LEU C N   1 
ATOM 506  C CA  . LEU A 1 65  ? 219.513 84.554  113.601 1.00 79.43  ? 65  LEU C CA  1 
ATOM 507  C C   . LEU A 1 65  ? 220.844 84.135  114.207 1.00 79.43  ? 65  LEU C C   1 
ATOM 508  O O   . LEU A 1 65  ? 221.796 84.902  114.186 1.00 79.43  ? 65  LEU C O   1 
ATOM 509  C CB  . LEU A 1 65  ? 218.599 85.142  114.655 1.00 57.69  ? 65  LEU C CB  1 
ATOM 510  C CG  . LEU A 1 65  ? 217.243 85.420  114.011 1.00 57.69  ? 65  LEU C CG  1 
ATOM 511  C CD1 . LEU A 1 65  ? 216.287 85.960  115.045 1.00 57.69  ? 65  LEU C CD1 1 
ATOM 512  C CD2 . LEU A 1 65  ? 217.421 86.399  112.876 1.00 57.69  ? 65  LEU C CD2 1 
ATOM 513  N N   . MET A 1 66  ? 220.921 82.932  114.763 1.00 159.24 ? 66  MET C N   1 
ATOM 514  C CA  . MET A 1 66  ? 222.203 82.480  115.276 1.00 159.24 ? 66  MET C CA  1 
ATOM 515  C C   . MET A 1 66  ? 223.013 81.987  114.062 1.00 159.24 ? 66  MET C C   1 
ATOM 516  O O   . MET A 1 66  ? 224.203 81.675  114.177 1.00 159.24 ? 66  MET C O   1 
ATOM 517  C CB  . MET A 1 66  ? 222.028 81.371  116.311 1.00 138.97 ? 66  MET C CB  1 
ATOM 518  C CG  . MET A 1 66  ? 221.880 81.884  117.733 1.00 138.97 ? 66  MET C CG  1 
ATOM 519  S SD  . MET A 1 66  ? 222.044 80.550  118.950 1.00 138.97 ? 66  MET C SD  1 
ATOM 520  C CE  . MET A 1 66  ? 223.727 80.864  119.621 1.00 138.97 ? 66  MET C CE  1 
ATOM 521  N N   . THR A 1 67  ? 222.340 81.928  112.906 1.00 136.01 ? 67  THR C N   1 
ATOM 522  C CA  . THR A 1 67  ? 222.920 81.534  111.605 1.00 136.01 ? 67  THR C CA  1 
ATOM 523  C C   . THR A 1 67  ? 223.093 82.859  110.855 1.00 136.01 ? 67  THR C C   1 
ATOM 524  O O   . THR A 1 67  ? 223.478 82.909  109.690 1.00 136.01 ? 67  THR C O   1 
ATOM 525  C CB  . THR A 1 67  ? 221.956 80.570  110.796 1.00 105.82 ? 67  THR C CB  1 
ATOM 526  O OG1 . THR A 1 67  ? 222.054 79.237  111.320 1.00 105.82 ? 67  THR C OG1 1 
ATOM 527  C CG2 . THR A 1 67  ? 222.302 80.534  109.308 1.00 105.82 ? 67  THR C CG2 1 
ATOM 528  N N   . LEU A 1 68  ? 222.801 83.939  111.565 1.00 108.24 ? 68  LEU C N   1 
ATOM 529  C CA  . LEU A 1 68  ? 222.917 85.280  111.027 1.00 108.24 ? 68  LEU C CA  1 
ATOM 530  C C   . LEU A 1 68  ? 224.061 86.020  111.708 1.00 108.24 ? 68  LEU C C   1 
ATOM 531  O O   . LEU A 1 68  ? 224.922 86.598  111.041 1.00 108.24 ? 68  LEU C O   1 
ATOM 532  C CB  . LEU A 1 68  ? 221.637 86.059  111.277 1.00 64.91  ? 68  LEU C CB  1 
ATOM 533  C CG  . LEU A 1 68  ? 221.859 87.543  110.985 1.00 64.91  ? 68  LEU C CG  1 
ATOM 534  C CD1 . LEU A 1 68  ? 221.610 87.778  109.504 1.00 64.91  ? 68  LEU C CD1 1 
ATOM 535  C CD2 . LEU A 1 68  ? 220.949 88.400  111.828 1.00 64.91  ? 68  LEU C CD2 1 
ATOM 536  N N   . ALA A 1 69  ? 224.036 86.014  113.042 1.00 137.41 ? 69  ALA C N   1 
ATOM 537  C CA  . ALA A 1 69  ? 225.045 86.677  113.873 1.00 137.41 ? 69  ALA C CA  1 
ATOM 538  C C   . ALA A 1 69  ? 226.438 86.122  113.642 1.00 137.41 ? 69  ALA C C   1 
ATOM 539  O O   . ALA A 1 69  ? 227.427 86.785  113.967 1.00 137.41 ? 69  ALA C O   1 
ATOM 540  C CB  . ALA A 1 69  ? 224.697 86.540  115.343 1.00 116.42 ? 69  ALA C CB  1 
ATOM 541  N N   . THR A 1 70  ? 226.513 84.896  113.125 1.00 200.00 ? 70  THR C N   1 
ATOM 542  C CA  . THR A 1 70  ? 227.796 84.276  112.820 1.00 200.00 ? 70  THR C CA  1 
ATOM 543  C C   . THR A 1 70  ? 228.318 84.913  111.514 1.00 200.00 ? 70  THR C C   1 
ATOM 544  O O   . THR A 1 70  ? 229.512 85.220  111.400 1.00 200.00 ? 70  THR C O   1 
ATOM 545  C CB  . THR A 1 70  ? 227.652 82.728  112.702 1.00 98.24  ? 70  THR C CB  1 
ATOM 546  O OG1 . THR A 1 70  ? 226.488 82.403  111.928 1.00 98.24  ? 70  THR C OG1 1 
ATOM 547  C CG2 . THR A 1 70  ? 227.551 82.094  114.104 1.00 98.24  ? 70  THR C CG2 1 
ATOM 548  N N   . TRP A 1 71  ? 227.410 85.139  110.556 1.00 154.81 ? 71  TRP C N   1 
ATOM 549  C CA  . TRP A 1 71  ? 227.726 85.782  109.267 1.00 154.81 ? 71  TRP C CA  1 
ATOM 550  C C   . TRP A 1 71  ? 227.984 87.317  109.465 1.00 154.81 ? 71  TRP C C   1 
ATOM 551  O O   . TRP A 1 71  ? 228.165 88.074  108.507 1.00 154.81 ? 71  TRP C O   1 
ATOM 552  C CB  . TRP A 1 71  ? 226.561 85.529  108.287 1.00 183.16 ? 71  TRP C CB  1 
ATOM 553  C CG  . TRP A 1 71  ? 226.783 85.950  106.843 1.00 183.16 ? 71  TRP C CG  1 
ATOM 554  C CD1 . TRP A 1 71  ? 227.277 85.185  105.809 1.00 183.16 ? 71  TRP C CD1 1 
ATOM 555  C CD2 . TRP A 1 71  ? 226.445 87.219  106.274 1.00 183.16 ? 71  TRP C CD2 1 
ATOM 556  N NE1 . TRP A 1 71  ? 227.254 85.907  104.634 1.00 183.16 ? 71  TRP C NE1 1 
ATOM 557  C CE2 . TRP A 1 71  ? 226.749 87.158  104.890 1.00 183.16 ? 71  TRP C CE2 1 
ATOM 558  C CE3 . TRP A 1 71  ? 225.911 88.408  106.802 1.00 183.16 ? 71  TRP C CE3 1 
ATOM 559  C CZ2 . TRP A 1 71  ? 226.530 88.246  104.025 1.00 183.16 ? 71  TRP C CZ2 1 
ATOM 560  C CZ3 . TRP A 1 71  ? 225.695 89.487  105.946 1.00 183.16 ? 71  TRP C CZ3 1 
ATOM 561  C CH2 . TRP A 1 71  ? 226.005 89.398  104.571 1.00 183.16 ? 71  TRP C CH2 1 
ATOM 562  N N   . VAL A 1 72  ? 228.014 87.758  110.723 1.00 200.00 ? 72  VAL C N   1 
ATOM 563  C CA  . VAL A 1 72  ? 228.274 89.161  111.079 1.00 200.00 ? 72  VAL C CA  1 
ATOM 564  C C   . VAL A 1 72  ? 229.725 89.257  111.608 1.00 200.00 ? 72  VAL C C   1 
ATOM 565  O O   . VAL A 1 72  ? 230.098 90.196  112.321 1.00 200.00 ? 72  VAL C O   1 
ATOM 566  C CB  . VAL A 1 72  ? 227.256 89.643  112.165 1.00 159.60 ? 72  VAL C CB  1 
ATOM 567  C CG1 . VAL A 1 72  ? 227.591 91.048  112.648 1.00 159.60 ? 72  VAL C CG1 1 
ATOM 568  C CG2 . VAL A 1 72  ? 225.840 89.595  111.595 1.00 159.60 ? 72  VAL C CG2 1 
ATOM 569  N N   . GLY A 1 73  ? 230.526 88.254  111.246 1.00 161.02 ? 73  GLY C N   1 
ATOM 570  C CA  . GLY A 1 73  ? 231.925 88.173  111.637 1.00 161.02 ? 73  GLY C CA  1 
ATOM 571  C C   . GLY A 1 73  ? 232.719 87.645  110.447 1.00 161.02 ? 73  GLY C C   1 
ATOM 572  O O   . GLY A 1 73  ? 233.952 87.708  110.435 1.00 161.02 ? 73  GLY C O   1 
ATOM 573  N N   . THR A 1 74  ? 231.992 87.124  109.451 1.00 200.00 ? 74  THR C N   1 
ATOM 574  C CA  . THR A 1 74  ? 232.558 86.582  108.200 1.00 200.00 ? 74  THR C CA  1 
ATOM 575  C C   . THR A 1 74  ? 232.740 87.718  107.187 1.00 200.00 ? 74  THR C C   1 
ATOM 576  O O   . THR A 1 74  ? 233.712 87.746  106.420 1.00 200.00 ? 74  THR C O   1 
ATOM 577  C CB  . THR A 1 74  ? 231.613 85.505  107.536 1.00 108.21 ? 74  THR C CB  1 
ATOM 578  O OG1 . THR A 1 74  ? 231.539 84.339  108.368 1.00 108.21 ? 74  THR C OG1 1 
ATOM 579  C CG2 . THR A 1 74  ? 232.121 85.101  106.132 1.00 108.21 ? 74  THR C CG2 1 
ATOM 580  N N   . ASN A 1 75  ? 231.786 88.646  107.194 1.00 190.44 ? 75  ASN C N   1 
ATOM 581  C CA  . ASN A 1 75  ? 231.810 89.782  106.284 1.00 190.44 ? 75  ASN C CA  1 
ATOM 582  C C   . ASN A 1 75  ? 231.645 91.132  107.005 1.00 190.44 ? 75  ASN C C   1 
ATOM 583  O O   . ASN A 1 75  ? 231.447 92.156  106.349 1.00 190.44 ? 75  ASN C O   1 
ATOM 584  C CB  . ASN A 1 75  ? 230.711 89.622  105.210 1.00 153.66 ? 75  ASN C CB  1 
ATOM 585  C CG  . ASN A 1 75  ? 230.917 88.386  104.317 1.00 153.66 ? 75  ASN C CG  1 
ATOM 586  O OD1 . ASN A 1 75  ? 231.937 88.254  103.640 1.00 153.66 ? 75  ASN C OD1 1 
ATOM 587  N ND2 . ASN A 1 75  ? 229.938 87.485  104.315 1.00 153.66 ? 75  ASN C ND2 1 
ATOM 588  N N   . LEU A 1 76  ? 231.744 91.146  108.336 1.00 200.00 ? 76  LEU C N   1 
ATOM 589  C CA  . LEU A 1 76  ? 231.590 92.395  109.091 1.00 200.00 ? 76  LEU C CA  1 
ATOM 590  C C   . LEU A 1 76  ? 232.535 92.650  110.283 1.00 200.00 ? 76  LEU C C   1 
ATOM 591  O O   . LEU A 1 76  ? 232.078 92.858  111.415 1.00 200.00 ? 76  LEU C O   1 
ATOM 592  C CB  . LEU A 1 76  ? 230.144 92.534  109.575 1.00 200.00 ? 76  LEU C CB  1 
ATOM 593  C CG  . LEU A 1 76  ? 229.091 92.904  108.530 1.00 200.00 ? 76  LEU C CG  1 
ATOM 594  C CD1 . LEU A 1 76  ? 227.710 92.833  109.176 1.00 200.00 ? 76  LEU C CD1 1 
ATOM 595  C CD2 . LEU A 1 76  ? 229.376 94.305  107.969 1.00 200.00 ? 76  LEU C CD2 1 
ATOM 596  N N   . GLU A 1 77  ? 233.845 92.646  110.029 1.00 200.00 ? 77  GLU C N   1 
ATOM 597  C CA  . GLU A 1 77  ? 234.832 92.930  111.077 1.00 200.00 ? 77  GLU C CA  1 
ATOM 598  C C   . GLU A 1 77  ? 235.053 94.453  111.066 1.00 200.00 ? 77  GLU C C   1 
ATOM 599  O O   . GLU A 1 77  ? 236.184 94.928  111.089 1.00 200.00 ? 77  GLU C O   1 
ATOM 600  C CB  . GLU A 1 77  ? 236.158 92.171  110.804 1.00 156.16 ? 77  GLU C CB  1 
ATOM 601  C CG  . GLU A 1 77  ? 236.929 92.541  109.508 1.00 156.16 ? 77  GLU C CG  1 
ATOM 602  C CD  . GLU A 1 77  ? 236.429 91.821  108.252 1.00 156.16 ? 77  GLU C CD  1 
ATOM 603  O OE1 . GLU A 1 77  ? 235.620 90.877  108.380 1.00 156.16 ? 77  GLU C OE1 1 
ATOM 604  O OE2 . GLU A 1 77  ? 236.860 92.195  107.135 1.00 156.16 ? 77  GLU C OE2 1 
ATOM 605  N N   . ASP A 1 78  ? 233.945 95.196  111.050 1.00 200.00 ? 78  ASP C N   1 
ATOM 606  C CA  . ASP A 1 78  ? 233.946 96.654  110.970 1.00 200.00 ? 78  ASP C CA  1 
ATOM 607  C C   . ASP A 1 78  ? 234.156 97.486  112.282 1.00 200.00 ? 78  ASP C C   1 
ATOM 608  O O   . ASP A 1 78  ? 235.043 97.161  113.082 1.00 200.00 ? 78  ASP C O   1 
ATOM 609  C CB  . ASP A 1 78  ? 232.670 97.065  110.208 1.00 162.43 ? 78  ASP C CB  1 
ATOM 610  C CG  . ASP A 1 78  ? 232.847 97.057  108.690 1.00 162.43 ? 78  ASP C CG  1 
ATOM 611  O OD1 . ASP A 1 78  ? 233.988 96.879  108.220 1.00 162.43 ? 78  ASP C OD1 1 
ATOM 612  O OD2 . ASP A 1 78  ? 231.840 97.242  107.967 1.00 162.43 ? 78  ASP C OD2 1 
ATOM 613  N N   . PRO A 1 79  ? 233.342 98.546  112.537 1.00 199.71 ? 79  PRO C N   1 
ATOM 614  C CA  . PRO A 1 79  ? 233.565 99.331  113.765 1.00 199.71 ? 79  PRO C CA  1 
ATOM 615  C C   . PRO A 1 79  ? 233.652 98.615  115.127 1.00 199.71 ? 79  PRO C C   1 
ATOM 616  O O   . PRO A 1 79  ? 234.465 97.710  115.367 1.00 199.71 ? 79  PRO C O   1 
ATOM 617  C CB  . PRO A 1 79  ? 232.381 100.308 113.766 1.00 148.52 ? 79  PRO C CB  1 
ATOM 618  C CG  . PRO A 1 79  ? 232.017 100.428 112.357 1.00 148.52 ? 79  PRO C CG  1 
ATOM 619  C CD  . PRO A 1 79  ? 232.071 98.989  111.930 1.00 148.52 ? 79  PRO C CD  1 
ATOM 620  N N   . ALA A 1 80  ? 232.810 99.102  116.034 1.00 200.00 ? 80  ALA C N   1 
ATOM 621  C CA  . ALA A 1 80  ? 232.696 98.561  117.381 1.00 200.00 ? 80  ALA C CA  1 
ATOM 622  C C   . ALA A 1 80  ? 231.452 97.678  117.386 1.00 200.00 ? 80  ALA C C   1 
ATOM 623  O O   . ALA A 1 80  ? 231.293 96.824  118.266 1.00 200.00 ? 80  ALA C O   1 
ATOM 624  C CB  . ALA A 1 80  ? 232.545 99.699  118.417 1.00 56.31  ? 80  ALA C CB  1 
ATOM 625  N N   . SER A 1 81  ? 230.580 97.887  116.392 1.00 200.00 ? 81  SER C N   1 
ATOM 626  C CA  . SER A 1 81  ? 229.326 97.126  116.253 1.00 200.00 ? 81  SER C CA  1 
ATOM 627  C C   . SER A 1 81  ? 229.387 95.847  115.366 1.00 200.00 ? 81  SER C C   1 
ATOM 628  O O   . SER A 1 81  ? 229.157 95.864  114.166 1.00 200.00 ? 81  SER C O   1 
ATOM 629  C CB  . SER A 1 81  ? 228.188 98.062  115.768 1.00 167.91 ? 81  SER C CB  1 
ATOM 630  O OG  . SER A 1 81  ? 228.453 98.643  114.491 1.00 167.91 ? 81  SER C OG  1 
ATOM 631  N N   . ARG A 1 82  ? 229.723 94.760  116.045 1.00 190.85 ? 82  ARG C N   1 
ATOM 632  C CA  . ARG A 1 82  ? 229.832 93.388  115.582 1.00 190.85 ? 82  ARG C CA  1 
ATOM 633  C C   . ARG A 1 82  ? 229.553 92.804  116.965 1.00 190.85 ? 82  ARG C C   1 
ATOM 634  O O   . ARG A 1 82  ? 229.380 91.596  117.155 1.00 190.85 ? 82  ARG C O   1 
ATOM 635  C CB  . ARG A 1 82  ? 231.261 93.063  115.105 1.00 162.55 ? 82  ARG C CB  1 
ATOM 636  C CG  . ARG A 1 82  ? 231.508 91.582  114.913 1.00 162.55 ? 82  ARG C CG  1 
ATOM 637  C CD  . ARG A 1 82  ? 232.621 91.281  113.891 1.00 162.55 ? 82  ARG C CD  1 
ATOM 638  N NE  . ARG A 1 82  ? 233.997 91.600  114.308 1.00 162.55 ? 82  ARG C NE  1 
ATOM 639  C CZ  . ARG A 1 82  ? 234.542 92.821  114.332 1.00 162.55 ? 82  ARG C CZ  1 
ATOM 640  N NH1 . ARG A 1 82  ? 233.843 93.895  113.964 1.00 162.55 ? 82  ARG C NH1 1 
ATOM 641  N NH2 . ARG A 1 82  ? 235.806 92.975  114.723 1.00 162.55 ? 82  ARG C NH2 1 
ATOM 642  N N   . ASP A 1 83  ? 229.530 93.750  117.916 1.00 200.00 ? 83  ASP C N   1 
ATOM 643  C CA  . ASP A 1 83  ? 229.274 93.580  119.356 1.00 200.00 ? 83  ASP C CA  1 
ATOM 644  C C   . ASP A 1 83  ? 227.888 94.157  119.765 1.00 200.00 ? 83  ASP C C   1 
ATOM 645  O O   . ASP A 1 83  ? 226.967 93.392  120.072 1.00 200.00 ? 83  ASP C O   1 
ATOM 646  C CB  . ASP A 1 83  ? 230.353 94.296  120.208 1.00 158.36 ? 83  ASP C CB  1 
ATOM 647  C CG  . ASP A 1 83  ? 231.750 93.686  120.064 1.00 158.36 ? 83  ASP C CG  1 
ATOM 648  O OD1 . ASP A 1 83  ? 231.878 92.463  119.830 1.00 158.36 ? 83  ASP C OD1 1 
ATOM 649  O OD2 . ASP A 1 83  ? 232.731 94.445  120.207 1.00 158.36 ? 83  ASP C OD2 1 
ATOM 650  N N   . LEU A 1 84  ? 227.740 95.492  119.737 1.00 200.00 ? 84  LEU C N   1 
ATOM 651  C CA  . LEU A 1 84  ? 226.483 96.174  120.126 1.00 200.00 ? 84  LEU C CA  1 
ATOM 652  C C   . LEU A 1 84  ? 225.262 96.003  119.196 1.00 200.00 ? 84  LEU C C   1 
ATOM 653  O O   . LEU A 1 84  ? 224.376 96.865  119.143 1.00 200.00 ? 84  LEU C O   1 
ATOM 654  C CB  . LEU A 1 84  ? 226.736 97.683  120.388 1.00 141.60 ? 84  LEU C CB  1 
ATOM 655  C CG  . LEU A 1 84  ? 225.599 98.540  121.000 1.00 141.60 ? 84  LEU C CG  1 
ATOM 656  C CD1 . LEU A 1 84  ? 225.228 98.016  122.386 1.00 141.60 ? 84  LEU C CD1 1 
ATOM 657  C CD2 . LEU A 1 84  ? 226.019 100.004 121.089 1.00 141.60 ? 84  LEU C CD2 1 
ATOM 658  N N   . VAL A 1 85  ? 225.228 94.890  118.467 1.00 171.66 ? 85  VAL C N   1 
ATOM 659  C CA  . VAL A 1 85  ? 224.100 94.550  117.599 1.00 171.66 ? 85  VAL C CA  1 
ATOM 660  C C   . VAL A 1 85  ? 223.504 93.320  118.276 1.00 171.66 ? 85  VAL C C   1 
ATOM 661  O O   . VAL A 1 85  ? 222.284 93.189  118.438 1.00 171.66 ? 85  VAL C O   1 
ATOM 662  C CB  . VAL A 1 85  ? 224.549 94.192  116.133 1.00 120.22 ? 85  VAL C CB  1 
ATOM 663  C CG1 . VAL A 1 85  ? 225.184 95.406  115.479 1.00 120.22 ? 85  VAL C CG1 1 
ATOM 664  C CG2 . VAL A 1 85  ? 225.525 92.992  116.121 1.00 120.22 ? 85  VAL C CG2 1 
ATOM 665  N N   . VAL A 1 86  ? 224.417 92.446  118.692 1.00 182.02 ? 86  VAL C N   1 
ATOM 666  C CA  . VAL A 1 86  ? 224.095 91.216  119.374 1.00 182.02 ? 86  VAL C CA  1 
ATOM 667  C C   . VAL A 1 86  ? 223.559 91.574  120.758 1.00 182.02 ? 86  VAL C C   1 
ATOM 668  O O   . VAL A 1 86  ? 222.768 90.827  121.325 1.00 182.02 ? 86  VAL C O   1 
ATOM 669  C CB  . VAL A 1 86  ? 225.354 90.296  119.456 1.00 108.73 ? 86  VAL C CB  1 
ATOM 670  C CG1 . VAL A 1 86  ? 225.014 89.019  120.205 1.00 108.73 ? 86  VAL C CG1 1 
ATOM 671  C CG2 . VAL A 1 86  ? 225.873 89.963  118.024 1.00 108.73 ? 86  VAL C CG2 1 
ATOM 672  N N   . SER A 1 87  ? 223.972 92.728  121.285 1.00 200.00 ? 87  SER C N   1 
ATOM 673  C CA  . SER A 1 87  ? 223.485 93.201  122.587 1.00 200.00 ? 87  SER C CA  1 
ATOM 674  C C   . SER A 1 87  ? 221.981 93.425  122.425 1.00 200.00 ? 87  SER C C   1 
ATOM 675  O O   . SER A 1 87  ? 221.182 92.584  122.838 1.00 200.00 ? 87  SER C O   1 
ATOM 676  C CB  . SER A 1 87  ? 224.179 94.514  122.993 1.00 118.83 ? 87  SER C CB  1 
ATOM 677  O OG  . SER A 1 87  ? 223.551 95.126  124.117 1.00 118.83 ? 87  SER C OG  1 
ATOM 678  N N   . TYR A 1 88  ? 221.616 94.557  121.819 1.00 126.95 ? 88  TYR C N   1 
ATOM 679  C CA  . TYR A 1 88  ? 220.227 94.921  121.524 1.00 126.95 ? 88  TYR C CA  1 
ATOM 680  C C   . TYR A 1 88  ? 219.393 93.651  121.419 1.00 126.95 ? 88  TYR C C   1 
ATOM 681  O O   . TYR A 1 88  ? 218.325 93.531  122.012 1.00 126.95 ? 88  TYR C O   1 
ATOM 682  C CB  . TYR A 1 88  ? 220.215 95.675  120.197 1.00 155.10 ? 88  TYR C CB  1 
ATOM 683  C CG  . TYR A 1 88  ? 219.025 95.411  119.312 1.00 155.10 ? 88  TYR C CG  1 
ATOM 684  C CD1 . TYR A 1 88  ? 217.858 96.159  119.450 1.00 155.10 ? 88  TYR C CD1 1 
ATOM 685  C CD2 . TYR A 1 88  ? 219.086 94.455  118.295 1.00 155.10 ? 88  TYR C CD2 1 
ATOM 686  C CE1 . TYR A 1 88  ? 216.781 95.974  118.593 1.00 155.10 ? 88  TYR C CE1 1 
ATOM 687  C CE2 . TYR A 1 88  ? 218.015 94.259  117.432 1.00 155.10 ? 88  TYR C CE2 1 
ATOM 688  C CZ  . TYR A 1 88  ? 216.863 95.027  117.584 1.00 155.10 ? 88  TYR C CZ  1 
ATOM 689  O OH  . TYR A 1 88  ? 215.800 94.884  116.719 1.00 155.10 ? 88  TYR C OH  1 
ATOM 690  N N   . VAL A 1 89  ? 219.915 92.712  120.639 1.00 153.97 ? 89  VAL C N   1 
ATOM 691  C CA  . VAL A 1 89  ? 219.301 91.411  120.440 1.00 153.97 ? 89  VAL C CA  1 
ATOM 692  C C   . VAL A 1 89  ? 219.108 90.766  121.809 1.00 153.97 ? 89  VAL C C   1 
ATOM 693  O O   . VAL A 1 89  ? 218.029 90.850  122.393 1.00 153.97 ? 89  VAL C O   1 
ATOM 694  C CB  . VAL A 1 89  ? 220.219 90.517  119.564 1.00 34.97  ? 89  VAL C CB  1 
ATOM 695  C CG1 . VAL A 1 89  ? 219.687 89.085  119.503 1.00 34.97  ? 89  VAL C CG1 1 
ATOM 696  C CG2 . VAL A 1 89  ? 220.349 91.139  118.183 1.00 34.97  ? 89  VAL C CG2 1 
ATOM 697  N N   . ASN A 1 90  ? 220.177 90.154  122.315 1.00 133.03 ? 90  ASN C N   1 
ATOM 698  C CA  . ASN A 1 90  ? 220.190 89.482  123.613 1.00 133.03 ? 90  ASN C CA  1 
ATOM 699  C C   . ASN A 1 90  ? 219.668 90.343  124.779 1.00 133.03 ? 90  ASN C C   1 
ATOM 700  O O   . ASN A 1 90  ? 219.494 89.840  125.893 1.00 133.03 ? 90  ASN C O   1 
ATOM 701  C CB  . ASN A 1 90  ? 221.615 88.979  123.917 1.00 141.40 ? 90  ASN C CB  1 
ATOM 702  C CG  . ASN A 1 90  ? 222.046 87.838  122.995 1.00 141.40 ? 90  ASN C CG  1 
ATOM 703  O OD1 . ASN A 1 90  ? 221.588 86.706  123.136 1.00 141.40 ? 90  ASN C OD1 1 
ATOM 704  N ND2 . ASN A 1 90  ? 222.921 88.139  122.041 1.00 141.40 ? 90  ASN C ND2 1 
ATOM 705  N N   . THR A 1 91  ? 219.416 91.628  124.530 1.00 200.00 ? 91  THR C N   1 
ATOM 706  C CA  . THR A 1 91  ? 218.894 92.530  125.568 1.00 200.00 ? 91  THR C CA  1 
ATOM 707  C C   . THR A 1 91  ? 217.461 92.984  125.269 1.00 200.00 ? 91  THR C C   1 
ATOM 708  O O   . THR A 1 91  ? 216.633 93.105  126.177 1.00 200.00 ? 91  THR C O   1 
ATOM 709  C CB  . THR A 1 91  ? 219.785 93.808  125.743 1.00 140.92 ? 91  THR C CB  1 
ATOM 710  O OG1 . THR A 1 91  ? 220.963 93.481  126.499 1.00 140.92 ? 91  THR C OG1 1 
ATOM 711  C CG2 . THR A 1 91  ? 219.009 94.921  126.464 1.00 140.92 ? 91  THR C CG2 1 
ATOM 712  N N   . ASN A 1 92  ? 217.178 93.232  123.994 1.00 170.63 ? 92  ASN C N   1 
ATOM 713  C CA  . ASN A 1 92  ? 215.857 93.690  123.574 1.00 170.63 ? 92  ASN C CA  1 
ATOM 714  C C   . ASN A 1 92  ? 214.950 92.630  122.939 1.00 170.63 ? 92  ASN C C   1 
ATOM 715  O O   . ASN A 1 92  ? 213.800 92.465  123.359 1.00 170.63 ? 92  ASN C O   1 
ATOM 716  C CB  . ASN A 1 92  ? 215.998 94.880  122.615 1.00 166.97 ? 92  ASN C CB  1 
ATOM 717  C CG  . ASN A 1 92  ? 214.672 95.281  121.972 1.00 166.97 ? 92  ASN C CG  1 
ATOM 718  O OD1 . ASN A 1 92  ? 213.665 95.485  122.658 1.00 166.97 ? 92  ASN C OD1 1 
ATOM 719  N ND2 . ASN A 1 92  ? 214.672 95.403  120.650 1.00 166.97 ? 92  ASN C ND2 1 
ATOM 720  N N   . VAL A 1 93  ? 215.447 91.920  121.931 1.00 123.88 ? 93  VAL C N   1 
ATOM 721  C CA  . VAL A 1 93  ? 214.629 90.904  121.272 1.00 123.88 ? 93  VAL C CA  1 
ATOM 722  C C   . VAL A 1 93  ? 214.850 89.485  121.787 1.00 123.88 ? 93  VAL C C   1 
ATOM 723  O O   . VAL A 1 93  ? 213.920 88.683  121.807 1.00 123.88 ? 93  VAL C O   1 
ATOM 724  C CB  . VAL A 1 93  ? 214.868 90.874  119.773 1.00 56.91  ? 93  VAL C CB  1 
ATOM 725  C CG1 . VAL A 1 93  ? 216.284 90.381  119.496 1.00 56.91  ? 93  VAL C CG1 1 
ATOM 726  C CG2 . VAL A 1 93  ? 213.827 89.976  119.110 1.00 56.91  ? 93  VAL C CG2 1 
ATOM 727  N N   . GLY A 1 94  ? 216.081 89.161  122.169 1.00 117.99 ? 94  GLY C N   1 
ATOM 728  C CA  . GLY A 1 94  ? 216.337 87.834  122.691 1.00 117.99 ? 94  GLY C CA  1 
ATOM 729  C C   . GLY A 1 94  ? 215.289 87.596  123.758 1.00 117.99 ? 94  GLY C C   1 
ATOM 730  O O   . GLY A 1 94  ? 214.785 86.493  123.932 1.00 117.99 ? 94  GLY C O   1 
ATOM 731  N N   . LEU A 1 95  ? 214.957 88.667  124.467 1.00 79.38  ? 95  LEU C N   1 
ATOM 732  C CA  . LEU A 1 95  ? 213.950 88.639  125.514 1.00 79.38  ? 95  LEU C CA  1 
ATOM 733  C C   . LEU A 1 95  ? 212.570 88.382  124.918 1.00 79.38  ? 95  LEU C C   1 
ATOM 734  O O   . LEU A 1 95  ? 211.841 87.516  125.389 1.00 79.38  ? 95  LEU C O   1 
ATOM 735  C CB  . LEU A 1 95  ? 213.922 89.979  126.243 1.00 139.91 ? 95  LEU C CB  1 
ATOM 736  C CG  . LEU A 1 95  ? 212.789 90.133  127.255 1.00 139.91 ? 95  LEU C CG  1 
ATOM 737  C CD1 . LEU A 1 95  ? 213.104 89.290  128.481 1.00 139.91 ? 95  LEU C CD1 1 
ATOM 738  C CD2 . LEU A 1 95  ? 212.623 91.601  127.636 1.00 139.91 ? 95  LEU C CD2 1 
ATOM 739  N N   . LYS A 1 96  ? 212.213 89.153  123.889 1.00 86.96  ? 96  LYS C N   1 
ATOM 740  C CA  . LYS A 1 96  ? 210.913 89.024  123.221 1.00 86.96  ? 96  LYS C CA  1 
ATOM 741  C C   . LYS A 1 96  ? 210.689 87.568  122.778 1.00 86.96  ? 96  LYS C C   1 
ATOM 742  O O   . LYS A 1 96  ? 209.545 87.105  122.660 1.00 86.96  ? 96  LYS C O   1 
ATOM 743  C CB  . LYS A 1 96  ? 210.852 89.991  122.021 1.00 120.28 ? 96  LYS C CB  1 
ATOM 744  C CG  . LYS A 1 96  ? 209.477 90.124  121.371 1.00 120.28 ? 96  LYS C CG  1 
ATOM 745  C CD  . LYS A 1 96  ? 209.464 91.136  120.213 1.00 120.28 ? 96  LYS C CD  1 
ATOM 746  C CE  . LYS A 1 96  ? 208.165 91.025  119.384 1.00 120.28 ? 96  LYS C CE  1 
ATOM 747  N NZ  . LYS A 1 96  ? 207.959 89.653  118.775 1.00 120.28 ? 96  LYS C NZ  1 
ATOM 748  N N   . PHE A 1 97  ? 211.801 86.860  122.559 1.00 60.90  ? 97  PHE C N   1 
ATOM 749  C CA  . PHE A 1 97  ? 211.786 85.457  122.150 1.00 60.90  ? 97  PHE C CA  1 
ATOM 750  C C   . PHE A 1 97  ? 211.893 84.509  123.330 1.00 60.90  ? 97  PHE C C   1 
ATOM 751  O O   . PHE A 1 97  ? 211.011 83.683  123.501 1.00 60.90  ? 97  PHE C O   1 
ATOM 752  C CB  . PHE A 1 97  ? 212.890 85.170  121.125 1.00 151.69 ? 97  PHE C CB  1 
ATOM 753  C CG  . PHE A 1 97  ? 212.387 85.105  119.702 1.00 151.69 ? 97  PHE C CG  1 
ATOM 754  C CD1 . PHE A 1 97  ? 211.434 86.027  119.238 1.00 151.69 ? 97  PHE C CD1 1 
ATOM 755  C CD2 . PHE A 1 97  ? 212.858 84.129  118.824 1.00 151.69 ? 97  PHE C CD2 1 
ATOM 756  C CE1 . PHE A 1 97  ? 210.954 85.980  117.921 1.00 151.69 ? 97  PHE C CE1 1 
ATOM 757  C CE2 . PHE A 1 97  ? 212.387 84.072  117.505 1.00 151.69 ? 97  PHE C CE2 1 
ATOM 758  C CZ  . PHE A 1 97  ? 211.432 85.001  117.054 1.00 151.69 ? 97  PHE C CZ  1 
ATOM 759  N N   . ARG A 1 98  ? 212.933 84.608  124.160 1.00 72.77  ? 98  ARG C N   1 
ATOM 760  C CA  . ARG A 1 98  ? 212.996 83.699  125.313 1.00 72.77  ? 98  ARG C CA  1 
ATOM 761  C C   . ARG A 1 98  ? 211.715 83.894  126.133 1.00 72.77  ? 98  ARG C C   1 
ATOM 762  O O   . ARG A 1 98  ? 211.290 83.010  126.879 1.00 72.77  ? 98  ARG C O   1 
ATOM 763  C CB  . ARG A 1 98  ? 214.265 83.924  126.184 1.00 99.73  ? 98  ARG C CB  1 
ATOM 764  C CG  . ARG A 1 98  ? 214.418 85.267  126.862 1.00 99.73  ? 98  ARG C CG  1 
ATOM 765  C CD  . ARG A 1 98  ? 215.612 85.273  127.801 1.00 99.73  ? 98  ARG C CD  1 
ATOM 766  N NE  . ARG A 1 98  ? 215.842 86.619  128.318 1.00 99.73  ? 98  ARG C NE  1 
ATOM 767  C CZ  . ARG A 1 98  ? 216.784 86.952  129.199 1.00 99.73  ? 98  ARG C CZ  1 
ATOM 768  N NH1 . ARG A 1 98  ? 217.607 86.024  129.682 1.00 99.73  ? 98  ARG C NH1 1 
ATOM 769  N NH2 . ARG A 1 98  ? 216.911 88.221  129.590 1.00 99.73  ? 98  ARG C NH2 1 
ATOM 770  N N   . GLN A 1 99  ? 211.088 85.054  125.953 1.00 90.22  ? 99  GLN C N   1 
ATOM 771  C CA  . GLN A 1 99  ? 209.850 85.377  126.649 1.00 90.22  ? 99  GLN C CA  1 
ATOM 772  C C   . GLN A 1 99  ? 208.896 84.285  126.245 1.00 90.22  ? 99  GLN C C   1 
ATOM 773  O O   . GLN A 1 99  ? 208.710 83.278  126.924 1.00 90.22  ? 99  GLN C O   1 
ATOM 774  C CB  . GLN A 1 99  ? 209.319 86.738  126.177 1.00 117.97 ? 99  GLN C CB  1 
ATOM 775  C CG  . GLN A 1 99  ? 208.374 87.411  127.162 1.00 117.97 ? 99  GLN C CG  1 
ATOM 776  C CD  . GLN A 1 99  ? 208.436 88.928  127.100 1.00 117.97 ? 99  GLN C CD  1 
ATOM 777  O OE1 . GLN A 1 99  ? 209.363 89.493  126.524 1.00 117.97 ? 99  GLN C OE1 1 
ATOM 778  N NE2 . GLN A 1 99  ? 207.457 89.596  127.712 1.00 117.97 ? 99  GLN C NE2 1 
ATOM 779  N N   . LEU A 1 100 ? 208.293 84.514  125.104 1.00 77.90  ? 100 LEU C N   1 
ATOM 780  C CA  . LEU A 1 100 ? 207.385 83.565  124.521 1.00 77.90  ? 100 LEU C CA  1 
ATOM 781  C C   . LEU A 1 100 ? 207.903 82.127  124.607 1.00 77.90  ? 100 LEU C C   1 
ATOM 782  O O   . LEU A 1 100 ? 207.219 81.223  125.079 1.00 77.90  ? 100 LEU C O   1 
ATOM 783  C CB  . LEU A 1 100 ? 207.219 83.960  123.062 1.00 78.50  ? 100 LEU C CB  1 
ATOM 784  C CG  . LEU A 1 100 ? 206.908 83.047  121.861 1.00 78.50  ? 100 LEU C CG  1 
ATOM 785  C CD1 . LEU A 1 100 ? 207.140 83.878  120.597 1.00 78.50  ? 100 LEU C CD1 1 
ATOM 786  C CD2 . LEU A 1 100 ? 207.804 81.845  121.765 1.00 78.50  ? 100 LEU C CD2 1 
ATOM 787  N N   . LEU A 1 101 ? 209.119 81.932  124.115 1.00 66.22  ? 101 LEU C N   1 
ATOM 788  C CA  . LEU A 1 101 ? 209.740 80.618  124.055 1.00 66.22  ? 101 LEU C CA  1 
ATOM 789  C C   . LEU A 1 101 ? 209.416 79.834  125.294 1.00 66.22  ? 101 LEU C C   1 
ATOM 790  O O   . LEU A 1 101 ? 208.656 78.867  125.251 1.00 66.22  ? 101 LEU C O   1 
ATOM 791  C CB  . LEU A 1 101 ? 211.247 80.767  123.895 1.00 127.76 ? 101 LEU C CB  1 
ATOM 792  C CG  . LEU A 1 101 ? 211.936 79.681  123.083 1.00 127.76 ? 101 LEU C CG  1 
ATOM 793  C CD1 . LEU A 1 101 ? 212.706 80.318  121.938 1.00 127.76 ? 101 LEU C CD1 1 
ATOM 794  C CD2 . LEU A 1 101 ? 212.861 78.897  123.985 1.00 127.76 ? 101 LEU C CD2 1 
ATOM 795  N N   . TRP A 1 102 ? 209.993 80.267  126.403 1.00 68.59  ? 102 TRP C N   1 
ATOM 796  C CA  . TRP A 1 102 ? 209.747 79.619  127.673 1.00 68.59  ? 102 TRP C CA  1 
ATOM 797  C C   . TRP A 1 102 ? 208.309 79.191  127.721 1.00 68.59  ? 102 TRP C C   1 
ATOM 798  O O   . TRP A 1 102 ? 207.970 78.011  127.683 1.00 68.59  ? 102 TRP C O   1 
ATOM 799  C CB  . TRP A 1 102 ? 209.960 80.597  128.803 1.00 69.73  ? 102 TRP C CB  1 
ATOM 800  C CG  . TRP A 1 102 ? 209.276 80.164  130.053 1.00 69.73  ? 102 TRP C CG  1 
ATOM 801  C CD1 . TRP A 1 102 ? 209.631 79.136  130.872 1.00 69.73  ? 102 TRP C CD1 1 
ATOM 802  C CD2 . TRP A 1 102 ? 208.156 80.784  130.660 1.00 69.73  ? 102 TRP C CD2 1 
ATOM 803  N NE1 . TRP A 1 102 ? 208.805 79.083  131.965 1.00 69.73  ? 102 TRP C NE1 1 
ATOM 804  C CE2 . TRP A 1 102 ? 207.885 80.090  131.858 1.00 69.73  ? 102 TRP C CE2 1 
ATOM 805  C CE3 . TRP A 1 102 ? 207.346 81.862  130.310 1.00 69.73  ? 102 TRP C CE3 1 
ATOM 806  C CZ2 . TRP A 1 102 ? 206.853 80.444  132.711 1.00 69.73  ? 102 TRP C CZ2 1 
ATOM 807  C CZ3 . TRP A 1 102 ? 206.314 82.215  131.159 1.00 69.73  ? 102 TRP C CZ3 1 
ATOM 808  C CH2 . TRP A 1 102 ? 206.076 81.505  132.347 1.00 69.73  ? 102 TRP C CH2 1 
ATOM 809  N N   . PHE A 1 103 ? 207.478 80.208  127.838 1.00 58.48  ? 103 PHE C N   1 
ATOM 810  C CA  . PHE A 1 103 ? 206.052 80.059  127.881 1.00 58.48  ? 103 PHE C CA  1 
ATOM 811  C C   . PHE A 1 103 ? 205.560 78.700  127.378 1.00 58.48  ? 103 PHE C C   1 
ATOM 812  O O   . PHE A 1 103 ? 205.224 77.823  128.181 1.00 58.48  ? 103 PHE C O   1 
ATOM 813  C CB  . PHE A 1 103 ? 205.458 81.186  127.061 1.00 104.65 ? 103 PHE C CB  1 
ATOM 814  C CG  . PHE A 1 103 ? 204.072 80.933  126.615 1.00 104.65 ? 103 PHE C CG  1 
ATOM 815  C CD1 . PHE A 1 103 ? 203.012 81.175  127.464 1.00 104.65 ? 103 PHE C CD1 1 
ATOM 816  C CD2 . PHE A 1 103 ? 203.823 80.458  125.333 1.00 104.65 ? 103 PHE C CD2 1 
ATOM 817  C CE1 . PHE A 1 103 ? 201.716 80.955  127.048 1.00 104.65 ? 103 PHE C CE1 1 
ATOM 818  C CE2 . PHE A 1 103 ? 202.531 80.231  124.903 1.00 104.65 ? 103 PHE C CE2 1 
ATOM 819  C CZ  . PHE A 1 103 ? 201.470 80.482  125.763 1.00 104.65 ? 103 PHE C CZ  1 
ATOM 820  N N   . HIS A 1 104 ? 205.531 78.522  126.058 1.00 56.33  ? 104 HIS C N   1 
ATOM 821  C CA  . HIS A 1 104 ? 205.056 77.278  125.461 1.00 56.33  ? 104 HIS C CA  1 
ATOM 822  C C   . HIS A 1 104 ? 205.516 76.085  126.257 1.00 56.33  ? 104 HIS C C   1 
ATOM 823  O O   . HIS A 1 104 ? 204.752 75.491  127.026 1.00 56.33  ? 104 HIS C O   1 
ATOM 824  C CB  . HIS A 1 104 ? 205.552 77.166  124.028 1.00 94.72  ? 104 HIS C CB  1 
ATOM 825  C CG  . HIS A 1 104 ? 204.687 77.887  123.045 1.00 94.72  ? 104 HIS C CG  1 
ATOM 826  N ND1 . HIS A 1 104 ? 203.505 77.360  122.572 1.00 94.72  ? 104 HIS C ND1 1 
ATOM 827  C CD2 . HIS A 1 104 ? 204.809 79.109  122.476 1.00 94.72  ? 104 HIS C CD2 1 
ATOM 828  C CE1 . HIS A 1 104 ? 202.936 78.226  121.752 1.00 94.72  ? 104 HIS C CE1 1 
ATOM 829  N NE2 . HIS A 1 104 ? 203.707 79.296  121.677 1.00 94.72  ? 104 HIS C NE2 1 
ATOM 830  N N   . ILE A 1 105 ? 206.781 75.754  126.054 1.00 72.19  ? 105 ILE C N   1 
ATOM 831  C CA  . ILE A 1 105 ? 207.445 74.653  126.732 1.00 72.19  ? 105 ILE C CA  1 
ATOM 832  C C   . ILE A 1 105 ? 206.779 74.205  128.035 1.00 72.19  ? 105 ILE C C   1 
ATOM 833  O O   . ILE A 1 105 ? 206.520 73.015  128.277 1.00 72.19  ? 105 ILE C O   1 
ATOM 834  C CB  . ILE A 1 105 ? 208.871 75.062  127.057 1.00 111.79 ? 105 ILE C CB  1 
ATOM 835  C CG1 . ILE A 1 105 ? 209.558 75.564  125.786 1.00 111.79 ? 105 ILE C CG1 1 
ATOM 836  C CG2 . ILE A 1 105 ? 209.603 73.898  127.692 1.00 111.79 ? 105 ILE C CG2 1 
ATOM 837  C CD1 . ILE A 1 105 ? 211.031 75.861  125.959 1.00 111.79 ? 105 ILE C CD1 1 
ATOM 838  N N   . SER A 1 106 ? 206.534 75.186  128.880 1.00 100.97 ? 106 SER C N   1 
ATOM 839  C CA  . SER A 1 106 ? 205.919 74.964  130.160 1.00 100.97 ? 106 SER C CA  1 
ATOM 840  C C   . SER A 1 106 ? 204.587 74.243  129.984 1.00 100.97 ? 106 SER C C   1 
ATOM 841  O O   . SER A 1 106 ? 204.439 73.066  130.342 1.00 100.97 ? 106 SER C O   1 
ATOM 842  C CB  . SER A 1 106 ? 205.747 76.325  130.793 1.00 39.21  ? 106 SER C CB  1 
ATOM 843  O OG  . SER A 1 106 ? 206.896 77.093  130.470 1.00 39.21  ? 106 SER C OG  1 
ATOM 844  N N   . ALA A 1 107 ? 203.625 74.958  129.416 1.00 98.62  ? 107 ALA C N   1 
ATOM 845  C CA  . ALA A 1 107 ? 202.306 74.407  129.181 1.00 98.62  ? 107 ALA C CA  1 
ATOM 846  C C   . ALA A 1 107 ? 202.421 72.956  128.720 1.00 98.62  ? 107 ALA C C   1 
ATOM 847  O O   . ALA A 1 107 ? 201.666 72.089  129.179 1.00 98.62  ? 107 ALA C O   1 
ATOM 848  C CB  . ALA A 1 107 ? 201.594 75.233  128.138 1.00 20.00  ? 107 ALA C CB  1 
ATOM 849  N N   . LEU A 1 108 ? 203.375 72.696  127.824 1.00 72.88  ? 108 LEU C N   1 
ATOM 850  C CA  . LEU A 1 108 ? 203.587 71.344  127.309 1.00 72.88  ? 108 LEU C CA  1 
ATOM 851  C C   . LEU A 1 108 ? 204.074 70.413  128.387 1.00 72.88  ? 108 LEU C C   1 
ATOM 852  O O   . LEU A 1 108 ? 204.744 69.422  128.116 1.00 72.88  ? 108 LEU C O   1 
ATOM 853  C CB  . LEU A 1 108 ? 204.588 71.323  126.159 1.00 78.88  ? 108 LEU C CB  1 
ATOM 854  C CG  . LEU A 1 108 ? 203.922 71.645  124.836 1.00 78.88  ? 108 LEU C CG  1 
ATOM 855  C CD1 . LEU A 1 108 ? 203.662 73.141  124.760 1.00 78.88  ? 108 LEU C CD1 1 
ATOM 856  C CD2 . LEU A 1 108 ? 204.804 71.196  123.716 1.00 78.88  ? 108 LEU C CD2 1 
ATOM 857  N N   . THR A 1 109 ? 203.708 70.719  129.616 1.00 123.26 ? 109 THR C N   1 
ATOM 858  C CA  . THR A 1 109 ? 204.108 69.893  130.710 1.00 123.26 ? 109 THR C CA  1 
ATOM 859  C C   . THR A 1 109 ? 203.173 70.161  131.859 1.00 123.26 ? 109 THR C C   1 
ATOM 860  O O   . THR A 1 109 ? 202.926 69.300  132.712 1.00 123.26 ? 109 THR C O   1 
ATOM 861  C CB  . THR A 1 109 ? 205.508 70.237  131.137 1.00 60.94  ? 109 THR C CB  1 
ATOM 862  O OG1 . THR A 1 109 ? 206.353 70.409  129.989 1.00 60.94  ? 109 THR C OG1 1 
ATOM 863  C CG2 . THR A 1 109 ? 206.027 69.126  131.972 1.00 60.94  ? 109 THR C CG2 1 
ATOM 864  N N   . PHE A 1 110 ? 202.608 71.360  131.852 1.00 115.74 ? 110 PHE C N   1 
ATOM 865  C CA  . PHE A 1 110 ? 201.733 71.734  132.952 1.00 115.74 ? 110 PHE C CA  1 
ATOM 866  C C   . PHE A 1 110 ? 200.296 72.035  132.598 1.00 115.74 ? 110 PHE C C   1 
ATOM 867  O O   . PHE A 1 110 ? 199.407 71.944  133.447 1.00 115.74 ? 110 PHE C O   1 
ATOM 868  C CB  . PHE A 1 110 ? 202.372 72.887  133.721 1.00 82.05  ? 110 PHE C CB  1 
ATOM 869  C CG  . PHE A 1 110 ? 203.816 72.618  134.093 1.00 82.05  ? 110 PHE C CG  1 
ATOM 870  C CD1 . PHE A 1 110 ? 204.812 72.623  133.114 1.00 82.05  ? 110 PHE C CD1 1 
ATOM 871  C CD2 . PHE A 1 110 ? 204.176 72.291  135.409 1.00 82.05  ? 110 PHE C CD2 1 
ATOM 872  C CE1 . PHE A 1 110 ? 206.122 72.309  133.434 1.00 82.05  ? 110 PHE C CE1 1 
ATOM 873  C CE2 . PHE A 1 110 ? 205.494 71.973  135.737 1.00 82.05  ? 110 PHE C CE2 1 
ATOM 874  C CZ  . PHE A 1 110 ? 206.463 71.985  134.744 1.00 82.05  ? 110 PHE C CZ  1 
ATOM 875  N N   . GLY A 1 111 ? 200.079 72.401  131.344 1.00 74.59  ? 111 GLY C N   1 
ATOM 876  C CA  . GLY A 1 111 ? 198.737 72.661  130.880 1.00 74.59  ? 111 GLY C CA  1 
ATOM 877  C C   . GLY A 1 111 ? 198.457 74.125  130.807 1.00 74.59  ? 111 GLY C C   1 
ATOM 878  O O   . GLY A 1 111 ? 198.687 74.854  131.767 1.00 74.59  ? 111 GLY C O   1 
ATOM 879  N N   . ARG A 1 112 ? 197.985 74.532  129.638 1.00 44.57  ? 112 ARG C N   1 
ATOM 880  C CA  . ARG A 1 112 ? 197.610 75.911  129.356 1.00 44.57  ? 112 ARG C CA  1 
ATOM 881  C C   . ARG A 1 112 ? 197.125 76.612  130.630 1.00 44.57  ? 112 ARG C C   1 
ATOM 882  O O   . ARG A 1 112 ? 197.729 77.565  131.124 1.00 44.57  ? 112 ARG C O   1 
ATOM 883  C CB  . ARG A 1 112 ? 196.460 75.910  128.341 1.00 118.67 ? 112 ARG C CB  1 
ATOM 884  C CG  . ARG A 1 112 ? 196.836 75.945  126.878 1.00 118.67 ? 112 ARG C CG  1 
ATOM 885  C CD  . ARG A 1 112 ? 196.656 77.358  126.362 1.00 118.67 ? 112 ARG C CD  1 
ATOM 886  N NE  . ARG A 1 112 ? 195.332 77.879  126.690 1.00 118.67 ? 112 ARG C NE  1 
ATOM 887  C CZ  . ARG A 1 112 ? 194.213 77.570  126.039 1.00 118.67 ? 112 ARG C CZ  1 
ATOM 888  N NH1 . ARG A 1 112 ? 194.242 76.738  124.999 1.00 118.67 ? 112 ARG C NH1 1 
ATOM 889  N NH2 . ARG A 1 112 ? 193.057 78.086  126.441 1.00 118.67 ? 112 ARG C NH2 1 
ATOM 890  N N   . GLU A 1 113 ? 196.002 76.109  131.137 1.00 83.66  ? 113 GLU C N   1 
ATOM 891  C CA  . GLU A 1 113 ? 195.358 76.647  132.320 1.00 83.66  ? 113 GLU C CA  1 
ATOM 892  C C   . GLU A 1 113 ? 196.341 76.738  133.478 1.00 83.66  ? 113 GLU C C   1 
ATOM 893  O O   . GLU A 1 113 ? 196.628 77.834  133.968 1.00 83.66  ? 113 GLU C O   1 
ATOM 894  C CB  . GLU A 1 113 ? 194.151 75.771  132.698 1.00 131.83 ? 113 GLU C CB  1 
ATOM 895  C CG  . GLU A 1 113 ? 193.080 75.630  131.602 1.00 131.83 ? 113 GLU C CG  1 
ATOM 896  C CD  . GLU A 1 113 ? 192.609 76.975  131.042 1.00 131.83 ? 113 GLU C CD  1 
ATOM 897  O OE1 . GLU A 1 113 ? 192.335 77.898  131.841 1.00 131.83 ? 113 GLU C OE1 1 
ATOM 898  O OE2 . GLU A 1 113 ? 192.503 77.108  129.801 1.00 131.83 ? 113 GLU C OE2 1 
ATOM 899  N N   . THR A 1 114 ? 196.861 75.580  133.892 1.00 86.69  ? 114 THR C N   1 
ATOM 900  C CA  . THR A 1 114 ? 197.811 75.467  135.009 1.00 86.69  ? 114 THR C CA  1 
ATOM 901  C C   . THR A 1 114 ? 198.797 76.615  134.965 1.00 86.69  ? 114 THR C C   1 
ATOM 902  O O   . THR A 1 114 ? 199.212 77.149  135.994 1.00 86.69  ? 114 THR C O   1 
ATOM 903  C CB  . THR A 1 114 ? 198.607 74.129  134.944 1.00 112.40 ? 114 THR C CB  1 
ATOM 904  O OG1 . THR A 1 114 ? 197.698 73.038  134.739 1.00 112.40 ? 114 THR C OG1 1 
ATOM 905  C CG2 . THR A 1 114 ? 199.371 73.882  136.246 1.00 112.40 ? 114 THR C CG2 1 
ATOM 906  N N   . VAL A 1 115 ? 199.140 76.991  133.742 1.00 55.93  ? 115 VAL C N   1 
ATOM 907  C CA  . VAL A 1 115 ? 200.088 78.060  133.475 1.00 55.93  ? 115 VAL C CA  1 
ATOM 908  C C   . VAL A 1 115 ? 199.586 79.452  133.756 1.00 55.93  ? 115 VAL C C   1 
ATOM 909  O O   . VAL A 1 115 ? 200.090 80.125  134.636 1.00 55.93  ? 115 VAL C O   1 
ATOM 910  C CB  . VAL A 1 115 ? 200.521 78.075  132.015 1.00 54.90  ? 115 VAL C CB  1 
ATOM 911  C CG1 . VAL A 1 115 ? 201.472 79.257  131.790 1.00 54.90  ? 115 VAL C CG1 1 
ATOM 912  C CG2 . VAL A 1 115 ? 201.154 76.722  131.629 1.00 54.90  ? 115 VAL C CG2 1 
ATOM 913  N N   . LEU A 1 116 ? 198.625 79.893  132.959 1.00 58.83  ? 116 LEU C N   1 
ATOM 914  C CA  . LEU A 1 116 ? 198.067 81.217  133.121 1.00 58.83  ? 116 LEU C CA  1 
ATOM 915  C C   . LEU A 1 116 ? 197.953 81.547  134.598 1.00 58.83  ? 116 LEU C C   1 
ATOM 916  O O   . LEU A 1 116 ? 198.513 82.538  135.050 1.00 58.83  ? 116 LEU C O   1 
ATOM 917  C CB  . LEU A 1 116 ? 196.709 81.280  132.438 1.00 93.33  ? 116 LEU C CB  1 
ATOM 918  C CG  . LEU A 1 116 ? 196.795 80.740  131.003 1.00 93.33  ? 116 LEU C CG  1 
ATOM 919  C CD1 . LEU A 1 116 ? 195.464 80.981  130.245 1.00 93.33  ? 116 LEU C CD1 1 
ATOM 920  C CD2 . LEU A 1 116 ? 197.961 81.422  130.295 1.00 93.33  ? 116 LEU C CD2 1 
ATOM 921  N N   . GLU A 1 117 ? 197.260 80.701  135.355 1.00 94.23  ? 117 GLU C N   1 
ATOM 922  C CA  . GLU A 1 117 ? 197.111 80.920  136.792 1.00 94.23  ? 117 GLU C CA  1 
ATOM 923  C C   . GLU A 1 117 ? 198.445 81.129  137.487 1.00 94.23  ? 117 GLU C C   1 
ATOM 924  O O   . GLU A 1 117 ? 198.505 81.736  138.557 1.00 94.23  ? 117 GLU C O   1 
ATOM 925  C CB  . GLU A 1 117 ? 196.426 79.736  137.440 1.00 133.05 ? 117 GLU C CB  1 
ATOM 926  C CG  . GLU A 1 117 ? 194.981 79.593  137.077 1.00 133.05 ? 117 GLU C CG  1 
ATOM 927  C CD  . GLU A 1 117 ? 194.469 78.200  137.379 1.00 133.05 ? 117 GLU C CD  1 
ATOM 928  O OE1 . GLU A 1 117 ? 194.441 77.812  138.569 1.00 133.05 ? 117 GLU C OE1 1 
ATOM 929  O OE2 . GLU A 1 117 ? 194.104 77.485  136.423 1.00 133.05 ? 117 GLU C OE2 1 
ATOM 930  N N   . TYR A 1 118 ? 199.507 80.582  136.905 1.00 75.86  ? 118 TYR C N   1 
ATOM 931  C CA  . TYR A 1 118 ? 200.839 80.755  137.463 1.00 75.86  ? 118 TYR C CA  1 
ATOM 932  C C   . TYR A 1 118 ? 201.062 82.248  137.506 1.00 75.86  ? 118 TYR C C   1 
ATOM 933  O O   . TYR A 1 118 ? 200.797 82.893  138.518 1.00 75.86  ? 118 TYR C O   1 
ATOM 934  C CB  . TYR A 1 118 ? 201.907 80.134  136.558 1.00 97.44  ? 118 TYR C CB  1 
ATOM 935  C CG  . TYR A 1 118 ? 203.305 80.160  137.149 1.00 97.44  ? 118 TYR C CG  1 
ATOM 936  C CD1 . TYR A 1 118 ? 203.979 78.977  137.436 1.00 97.44  ? 118 TYR C CD1 1 
ATOM 937  C CD2 . TYR A 1 118 ? 203.933 81.353  137.477 1.00 97.44  ? 118 TYR C CD2 1 
ATOM 938  C CE1 . TYR A 1 118 ? 205.251 78.972  138.048 1.00 97.44  ? 118 TYR C CE1 1 
ATOM 939  C CE2 . TYR A 1 118 ? 205.206 81.360  138.090 1.00 97.44  ? 118 TYR C CE2 1 
ATOM 940  C CZ  . TYR A 1 118 ? 205.858 80.169  138.376 1.00 97.44  ? 118 TYR C CZ  1 
ATOM 941  O OH  . TYR A 1 118 ? 207.094 80.192  139.006 1.00 97.44  ? 118 TYR C OH  1 
ATOM 942  N N   . LEU A 1 119 ? 201.549 82.770  136.381 1.00 72.23  ? 119 LEU C N   1 
ATOM 943  C CA  . LEU A 1 119 ? 201.832 84.192  136.184 1.00 72.23  ? 119 LEU C CA  1 
ATOM 944  C C   . LEU A 1 119 ? 201.013 85.008  137.121 1.00 72.23  ? 119 LEU C C   1 
ATOM 945  O O   . LEU A 1 119 ? 201.510 85.638  138.051 1.00 72.23  ? 119 LEU C O   1 
ATOM 946  C CB  . LEU A 1 119 ? 201.413 84.640  134.808 1.00 45.93  ? 119 LEU C CB  1 
ATOM 947  C CG  . LEU A 1 119 ? 201.786 83.800  133.611 1.00 45.93  ? 119 LEU C CG  1 
ATOM 948  C CD1 . LEU A 1 119 ? 201.216 82.373  133.664 1.00 45.93  ? 119 LEU C CD1 1 
ATOM 949  C CD2 . LEU A 1 119 ? 201.247 84.562  132.437 1.00 45.93  ? 119 LEU C CD2 1 
ATOM 950  N N   . VAL A 1 120 ? 199.730 85.013  136.805 1.00 71.30  ? 120 VAL C N   1 
ATOM 951  C CA  . VAL A 1 120 ? 198.745 85.714  137.583 1.00 71.30  ? 120 VAL C CA  1 
ATOM 952  C C   . VAL A 1 120 ? 199.165 85.694  139.066 1.00 71.30  ? 120 VAL C C   1 
ATOM 953  O O   . VAL A 1 120 ? 199.902 86.593  139.523 1.00 71.30  ? 120 VAL C O   1 
ATOM 954  C CB  . VAL A 1 120 ? 197.355 85.035  137.417 1.00 92.86  ? 120 VAL C CB  1 
ATOM 955  C CG1 . VAL A 1 120 ? 196.260 85.972  137.865 1.00 92.86  ? 120 VAL C CG1 1 
ATOM 956  C CG2 . VAL A 1 120 ? 197.134 84.630  135.967 1.00 92.86  ? 120 VAL C CG2 1 
ATOM 957  N N   . SER A 1 121 ? 198.726 84.653  139.792 1.00 135.04 ? 121 SER C N   1 
ATOM 958  C CA  . SER A 1 121 ? 199.003 84.508  141.228 1.00 135.04 ? 121 SER C CA  1 
ATOM 959  C C   . SER A 1 121 ? 200.482 84.654  141.598 1.00 135.04 ? 121 SER C C   1 
ATOM 960  O O   . SER A 1 121 ? 200.809 84.909  142.755 1.00 135.04 ? 121 SER C O   1 
ATOM 961  C CB  . SER A 1 121 ? 198.411 83.182  141.783 1.00 56.92  ? 121 SER C CB  1 
ATOM 962  O OG  . SER A 1 121 ? 197.068 83.342  142.281 1.00 56.92  ? 121 SER C OG  1 
ATOM 963  N N   . PHE A 1 122 ? 201.377 84.519  140.625 1.00 77.61  ? 122 PHE C N   1 
ATOM 964  C CA  . PHE A 1 122 ? 202.796 84.689  140.916 1.00 77.61  ? 122 PHE C CA  1 
ATOM 965  C C   . PHE A 1 122 ? 203.260 86.124  140.714 1.00 77.61  ? 122 PHE C C   1 
ATOM 966  O O   . PHE A 1 122 ? 203.740 86.762  141.644 1.00 77.61  ? 122 PHE C O   1 
ATOM 967  C CB  . PHE A 1 122 ? 203.671 83.776  140.048 1.00 133.05 ? 122 PHE C CB  1 
ATOM 968  C CG  . PHE A 1 122 ? 205.168 84.037  140.191 1.00 133.05 ? 122 PHE C CG  1 
ATOM 969  C CD1 . PHE A 1 122 ? 205.747 85.208  139.681 1.00 133.05 ? 122 PHE C CD1 1 
ATOM 970  C CD2 . PHE A 1 122 ? 205.994 83.110  140.840 1.00 133.05 ? 122 PHE C CD2 1 
ATOM 971  C CE1 . PHE A 1 122 ? 207.106 85.452  139.813 1.00 133.05 ? 122 PHE C CE1 1 
ATOM 972  C CE2 . PHE A 1 122 ? 207.361 83.347  140.975 1.00 133.05 ? 122 PHE C CE2 1 
ATOM 973  C CZ  . PHE A 1 122 ? 207.915 84.522  140.460 1.00 133.05 ? 122 PHE C CZ  1 
ATOM 974  N N   . GLY A 1 123 ? 203.150 86.621  139.490 1.00 93.39  ? 123 GLY C N   1 
ATOM 975  C CA  . GLY A 1 123 ? 203.594 87.972  139.209 1.00 93.39  ? 123 GLY C CA  1 
ATOM 976  C C   . GLY A 1 123 ? 203.279 88.939  140.330 1.00 93.39  ? 123 GLY C C   1 
ATOM 977  O O   . GLY A 1 123 ? 203.882 90.012  140.467 1.00 93.39  ? 123 GLY C O   1 
ATOM 978  N N   . VAL A 1 124 ? 202.318 88.536  141.143 1.00 76.80  ? 124 VAL C N   1 
ATOM 979  C CA  . VAL A 1 124 ? 201.895 89.333  142.262 1.00 76.80  ? 124 VAL C CA  1 
ATOM 980  C C   . VAL A 1 124 ? 202.739 89.047  143.493 1.00 76.80  ? 124 VAL C C   1 
ATOM 981  O O   . VAL A 1 124 ? 202.891 89.899  144.368 1.00 76.80  ? 124 VAL C O   1 
ATOM 982  C CB  . VAL A 1 124 ? 200.453 89.052  142.544 1.00 20.46  ? 124 VAL C CB  1 
ATOM 983  C CG1 . VAL A 1 124 ? 199.851 90.232  143.320 1.00 20.46  ? 124 VAL C CG1 1 
ATOM 984  C CG2 . VAL A 1 124 ? 199.744 88.804  141.221 1.00 20.46  ? 124 VAL C CG2 1 
ATOM 985  N N   . TRP A 1 125 ? 203.282 87.840  143.558 1.00 104.28 ? 125 TRP C N   1 
ATOM 986  C CA  . TRP A 1 125 ? 204.131 87.473  144.672 1.00 104.28 ? 125 TRP C CA  1 
ATOM 987  C C   . TRP A 1 125 ? 205.150 88.583  144.742 1.00 104.28 ? 125 TRP C C   1 
ATOM 988  O O   . TRP A 1 125 ? 205.150 89.383  145.676 1.00 104.28 ? 125 TRP C O   1 
ATOM 989  C CB  . TRP A 1 125 ? 204.870 86.162  144.408 1.00 126.61 ? 125 TRP C CB  1 
ATOM 990  C CG  . TRP A 1 125 ? 205.451 85.586  145.645 1.00 126.61 ? 125 TRP C CG  1 
ATOM 991  C CD1 . TRP A 1 125 ? 204.817 84.783  146.539 1.00 126.61 ? 125 TRP C CD1 1 
ATOM 992  C CD2 . TRP A 1 125 ? 206.744 85.850  146.190 1.00 126.61 ? 125 TRP C CD2 1 
ATOM 993  N NE1 . TRP A 1 125 ? 205.628 84.532  147.617 1.00 126.61 ? 125 TRP C NE1 1 
ATOM 994  C CE2 . TRP A 1 125 ? 206.821 85.176  147.429 1.00 126.61 ? 125 TRP C CE2 1 
ATOM 995  C CE3 . TRP A 1 125 ? 207.843 86.593  145.757 1.00 126.61 ? 125 TRP C CE3 1 
ATOM 996  C CZ2 . TRP A 1 125 ? 207.956 85.223  148.243 1.00 126.61 ? 125 TRP C CZ2 1 
ATOM 997  C CZ3 . TRP A 1 125 ? 208.970 86.642  146.564 1.00 126.61 ? 125 TRP C CZ3 1 
ATOM 998  C CH2 . TRP A 1 125 ? 209.018 85.960  147.796 1.00 126.61 ? 125 TRP C CH2 1 
ATOM 999  N N   . ILE A 1 126 ? 205.997 88.644  143.720 1.00 115.27 ? 126 ILE C N   1 
ATOM 1000 C CA  . ILE A 1 126 ? 207.042 89.648  143.670 1.00 115.27 ? 126 ILE C CA  1 
ATOM 1001 C C   . ILE A 1 126 ? 206.516 91.063  143.680 1.00 115.27 ? 126 ILE C C   1 
ATOM 1002 O O   . ILE A 1 126 ? 207.115 91.950  144.283 1.00 115.27 ? 126 ILE C O   1 
ATOM 1003 C CB  . ILE A 1 126 ? 207.913 89.513  142.428 1.00 109.44 ? 126 ILE C CB  1 
ATOM 1004 C CG1 . ILE A 1 126 ? 208.941 90.656  142.429 1.00 109.44 ? 126 ILE C CG1 1 
ATOM 1005 C CG2 . ILE A 1 126 ? 207.039 89.527  141.184 1.00 109.44 ? 126 ILE C CG2 1 
ATOM 1006 C CD1 . ILE A 1 126 ? 210.089 90.508  141.462 1.00 109.44 ? 126 ILE C CD1 1 
ATOM 1007 N N   . ARG A 1 127 ? 205.402 91.278  142.999 1.00 82.50  ? 127 ARG C N   1 
ATOM 1008 C CA  . ARG A 1 127 ? 204.827 92.607  142.933 1.00 82.50  ? 127 ARG C CA  1 
ATOM 1009 C C   . ARG A 1 127 ? 204.338 93.049  144.321 1.00 82.50  ? 127 ARG C C   1 
ATOM 1010 O O   . ARG A 1 127 ? 204.074 94.233  144.547 1.00 82.50  ? 127 ARG C O   1 
ATOM 1011 C CB  . ARG A 1 127 ? 203.682 92.607  141.916 1.00 99.34  ? 127 ARG C CB  1 
ATOM 1012 C CG  . ARG A 1 127 ? 203.299 93.976  141.397 1.00 99.34  ? 127 ARG C CG  1 
ATOM 1013 C CD  . ARG A 1 127 ? 204.337 94.549  140.443 1.00 99.34  ? 127 ARG C CD  1 
ATOM 1014 N NE  . ARG A 1 127 ? 204.343 93.894  139.137 1.00 99.34  ? 127 ARG C NE  1 
ATOM 1015 C CZ  . ARG A 1 127 ? 204.770 94.478  138.019 1.00 99.34  ? 127 ARG C CZ  1 
ATOM 1016 N NH1 . ARG A 1 127 ? 205.224 95.730  138.034 1.00 99.34  ? 127 ARG C NH1 1 
ATOM 1017 N NH2 . ARG A 1 127 ? 204.752 93.810  136.879 1.00 99.34  ? 127 ARG C NH2 1 
ATOM 1018 N N   . THR A 1 128 ? 204.261 92.091  145.246 1.00 94.15  ? 128 THR C N   1 
ATOM 1019 C CA  . THR A 1 128 ? 203.799 92.316  146.620 1.00 94.15  ? 128 THR C CA  1 
ATOM 1020 C C   . THR A 1 128 ? 204.947 92.406  147.646 1.00 94.15  ? 128 THR C C   1 
ATOM 1021 O O   . THR A 1 128 ? 205.882 91.618  147.605 1.00 94.15  ? 128 THR C O   1 
ATOM 1022 C CB  . THR A 1 128 ? 202.831 91.177  147.037 1.00 73.41  ? 128 THR C CB  1 
ATOM 1023 O OG1 . THR A 1 128 ? 201.626 91.257  146.261 1.00 73.41  ? 128 THR C OG1 1 
ATOM 1024 C CG2 . THR A 1 128 ? 202.499 91.261  148.508 1.00 73.41  ? 128 THR C CG2 1 
ATOM 1025 N N   . PRO A 1 129 ? 204.875 93.364  148.586 1.00 98.15  ? 129 PRO C N   1 
ATOM 1026 C CA  . PRO A 1 129 ? 205.856 93.624  149.650 1.00 98.15  ? 129 PRO C CA  1 
ATOM 1027 C C   . PRO A 1 129 ? 206.471 92.419  150.380 1.00 98.15  ? 129 PRO C C   1 
ATOM 1028 O O   . PRO A 1 129 ? 205.873 91.343  150.451 1.00 98.15  ? 129 PRO C O   1 
ATOM 1029 C CB  . PRO A 1 129 ? 205.087 94.539  150.582 1.00 92.91  ? 129 PRO C CB  1 
ATOM 1030 C CG  . PRO A 1 129 ? 204.351 95.360  149.613 1.00 92.91  ? 129 PRO C CG  1 
ATOM 1031 C CD  . PRO A 1 129 ? 203.772 94.332  148.681 1.00 92.91  ? 129 PRO C CD  1 
ATOM 1032 N N   . PRO A 1 130 ? 207.669 92.614  150.968 1.00 86.33  ? 130 PRO C N   1 
ATOM 1033 C CA  . PRO A 1 130 ? 208.452 91.613  151.706 1.00 86.33  ? 130 PRO C CA  1 
ATOM 1034 C C   . PRO A 1 130 ? 207.744 90.710  152.717 1.00 86.33  ? 130 PRO C C   1 
ATOM 1035 O O   . PRO A 1 130 ? 207.252 89.636  152.368 1.00 86.33  ? 130 PRO C O   1 
ATOM 1036 C CB  . PRO A 1 130 ? 209.556 92.456  152.358 1.00 127.02 ? 130 PRO C CB  1 
ATOM 1037 C CG  . PRO A 1 130 ? 208.893 93.788  152.553 1.00 127.02 ? 130 PRO C CG  1 
ATOM 1038 C CD  . PRO A 1 130 ? 208.211 93.963  151.218 1.00 127.02 ? 130 PRO C CD  1 
ATOM 1039 N N   . ALA A 1 131 ? 207.723 91.148  153.974 1.00 148.89 ? 131 ALA C N   1 
ATOM 1040 C CA  . ALA A 1 131 ? 207.118 90.378  155.060 1.00 148.89 ? 131 ALA C CA  1 
ATOM 1041 C C   . ALA A 1 131 ? 205.607 90.164  154.921 1.00 148.89 ? 131 ALA C C   1 
ATOM 1042 O O   . ALA A 1 131 ? 204.977 89.584  155.815 1.00 148.89 ? 131 ALA C O   1 
ATOM 1043 C CB  . ALA A 1 131 ? 207.442 91.040  156.424 1.00 87.26  ? 131 ALA C CB  1 
ATOM 1044 N N   . TYR A 1 132 ? 205.032 90.616  153.804 1.00 95.26  ? 132 TYR C N   1 
ATOM 1045 C CA  . TYR A 1 132 ? 203.594 90.463  153.561 1.00 95.26  ? 132 TYR C CA  1 
ATOM 1046 C C   . TYR A 1 132 ? 203.291 89.449  152.452 1.00 95.26  ? 132 TYR C C   1 
ATOM 1047 O O   . TYR A 1 132 ? 202.197 89.445  151.885 1.00 95.26  ? 132 TYR C O   1 
ATOM 1048 C CB  . TYR A 1 132 ? 202.963 91.800  153.182 1.00 111.23 ? 132 TYR C CB  1 
ATOM 1049 C CG  . TYR A 1 132 ? 203.144 92.880  154.205 1.00 111.23 ? 132 TYR C CG  1 
ATOM 1050 C CD1 . TYR A 1 132 ? 204.401 93.433  154.444 1.00 111.23 ? 132 TYR C CD1 1 
ATOM 1051 C CD2 . TYR A 1 132 ? 202.061 93.363  154.926 1.00 111.23 ? 132 TYR C CD2 1 
ATOM 1052 C CE1 . TYR A 1 132 ? 204.576 94.448  155.376 1.00 111.23 ? 132 TYR C CE1 1 
ATOM 1053 C CE2 . TYR A 1 132 ? 202.222 94.376  155.861 1.00 111.23 ? 132 TYR C CE2 1 
ATOM 1054 C CZ  . TYR A 1 132 ? 203.488 94.918  156.082 1.00 111.23 ? 132 TYR C CZ  1 
ATOM 1055 O OH  . TYR A 1 132 ? 203.686 95.936  156.994 1.00 111.23 ? 132 TYR C OH  1 
ATOM 1056 N N   . ARG A 1 133 ? 204.262 88.599  152.134 1.00 146.75 ? 133 ARG C N   1 
ATOM 1057 C CA  . ARG A 1 133 ? 204.077 87.579  151.103 1.00 146.75 ? 133 ARG C CA  1 
ATOM 1058 C C   . ARG A 1 133 ? 204.698 86.278  151.584 1.00 146.75 ? 133 ARG C C   1 
ATOM 1059 O O   . ARG A 1 133 ? 205.691 86.291  152.312 1.00 146.75 ? 133 ARG C O   1 
ATOM 1060 C CB  . ARG A 1 133 ? 204.738 88.011  149.796 1.00 116.57 ? 133 ARG C CB  1 
ATOM 1061 C CG  . ARG A 1 133 ? 206.220 88.272  149.938 1.00 116.57 ? 133 ARG C CG  1 
ATOM 1062 C CD  . ARG A 1 133 ? 206.793 88.813  148.661 1.00 116.57 ? 133 ARG C CD  1 
ATOM 1063 N NE  . ARG A 1 133 ? 208.187 89.211  148.823 1.00 116.57 ? 133 ARG C NE  1 
ATOM 1064 C CZ  . ARG A 1 133 ? 208.914 89.780  147.866 1.00 116.57 ? 133 ARG C CZ  1 
ATOM 1065 N NH1 . ARG A 1 133 ? 208.376 90.021  146.678 1.00 116.57 ? 133 ARG C NH1 1 
ATOM 1066 N NH2 . ARG A 1 133 ? 210.180 90.103  148.092 1.00 116.57 ? 133 ARG C NH2 1 
ATOM 1067 N N   . PRO A 1 134 ? 204.123 85.134  151.176 1.00 107.96 ? 134 PRO C N   1 
ATOM 1068 C CA  . PRO A 1 134 ? 204.630 83.817  151.576 1.00 107.96 ? 134 PRO C CA  1 
ATOM 1069 C C   . PRO A 1 134 ? 206.153 83.715  151.580 1.00 107.96 ? 134 PRO C C   1 
ATOM 1070 O O   . PRO A 1 134 ? 206.863 84.546  151.008 1.00 107.96 ? 134 PRO C O   1 
ATOM 1071 C CB  . PRO A 1 134 ? 203.970 82.873  150.574 1.00 73.38  ? 134 PRO C CB  1 
ATOM 1072 C CG  . PRO A 1 134 ? 202.613 83.516  150.408 1.00 73.38  ? 134 PRO C CG  1 
ATOM 1073 C CD  . PRO A 1 134 ? 202.950 85.003  150.290 1.00 73.38  ? 134 PRO C CD  1 
ATOM 1074 N N   . PRO A 1 135 ? 206.673 82.677  152.232 1.00 119.72 ? 135 PRO C N   1 
ATOM 1075 C CA  . PRO A 1 135 ? 208.122 82.488  152.306 1.00 119.72 ? 135 PRO C CA  1 
ATOM 1076 C C   . PRO A 1 135 ? 208.744 82.401  150.918 1.00 119.72 ? 135 PRO C C   1 
ATOM 1077 O O   . PRO A 1 135 ? 209.716 83.083  150.593 1.00 119.72 ? 135 PRO C O   1 
ATOM 1078 C CB  . PRO A 1 135 ? 208.259 81.166  153.070 1.00 97.31  ? 135 PRO C CB  1 
ATOM 1079 C CG  . PRO A 1 135 ? 206.931 81.024  153.810 1.00 97.31  ? 135 PRO C CG  1 
ATOM 1080 C CD  . PRO A 1 135 ? 205.952 81.524  152.798 1.00 97.31  ? 135 PRO C CD  1 
ATOM 1081 N N   . ASN A 1 136 ? 208.128 81.559  150.104 1.00 157.72 ? 136 ASN C N   1 
ATOM 1082 C CA  . ASN A 1 136 ? 208.582 81.263  148.759 1.00 157.72 ? 136 ASN C CA  1 
ATOM 1083 C C   . ASN A 1 136 ? 207.524 81.577  147.716 1.00 157.72 ? 136 ASN C C   1 
ATOM 1084 O O   . ASN A 1 136 ? 206.342 81.701  148.039 1.00 157.72 ? 136 ASN C O   1 
ATOM 1085 C CB  . ASN A 1 136 ? 208.884 79.781  148.702 1.00 118.20 ? 136 ASN C CB  1 
ATOM 1086 C CG  . ASN A 1 136 ? 207.832 78.968  149.441 1.00 118.20 ? 136 ASN C CG  1 
ATOM 1087 O OD1 . ASN A 1 136 ? 206.629 79.239  149.326 1.00 118.20 ? 136 ASN C OD1 1 
ATOM 1088 N ND2 . ASN A 1 136 ? 208.276 77.980  150.211 1.00 118.20 ? 136 ASN C ND2 1 
ATOM 1089 N N   . ALA A 1 137 ? 207.960 81.667  146.460 1.00 129.62 ? 137 ALA C N   1 
ATOM 1090 C CA  . ALA A 1 137 ? 207.070 81.946  145.335 1.00 129.62 ? 137 ALA C CA  1 
ATOM 1091 C C   . ALA A 1 137 ? 206.499 80.629  144.815 1.00 129.62 ? 137 ALA C C   1 
ATOM 1092 O O   . ALA A 1 137 ? 207.254 79.745  144.415 1.00 129.62 ? 137 ALA C O   1 
ATOM 1093 C CB  . ALA A 1 137 ? 207.835 82.645  144.232 1.00 63.03  ? 137 ALA C CB  1 
ATOM 1094 N N   . PRO A 1 138 ? 205.155 80.491  144.797 1.00 153.75 ? 138 PRO C N   1 
ATOM 1095 C CA  . PRO A 1 138 ? 204.462 79.276  144.332 1.00 153.75 ? 138 PRO C CA  1 
ATOM 1096 C C   . PRO A 1 138 ? 204.915 78.848  142.942 1.00 153.75 ? 138 PRO C C   1 
ATOM 1097 O O   . PRO A 1 138 ? 205.047 79.691  142.047 1.00 153.75 ? 138 PRO C O   1 
ATOM 1098 C CB  . PRO A 1 138 ? 202.980 79.682  144.353 1.00 177.26 ? 138 PRO C CB  1 
ATOM 1099 C CG  . PRO A 1 138 ? 202.923 80.782  145.383 1.00 177.26 ? 138 PRO C CG  1 
ATOM 1100 C CD  . PRO A 1 138 ? 204.181 81.565  145.068 1.00 177.26 ? 138 PRO C CD  1 
ATOM 1101 N N   . ILE A 1 139 ? 205.156 77.550  142.766 1.00 102.54 ? 139 ILE C N   1 
ATOM 1102 C CA  . ILE A 1 139 ? 205.590 77.054  141.478 1.00 102.54 ? 139 ILE C CA  1 
ATOM 1103 C C   . ILE A 1 139 ? 205.115 75.640  141.173 1.00 102.54 ? 139 ILE C C   1 
ATOM 1104 O O   . ILE A 1 139 ? 204.621 74.893  142.021 1.00 102.54 ? 139 ILE C O   1 
ATOM 1105 C CB  . ILE A 1 139 ? 207.139 77.160  141.316 1.00 79.47  ? 139 ILE C CB  1 
ATOM 1106 C CG1 . ILE A 1 139 ? 207.548 78.636  141.376 1.00 79.47  ? 139 ILE C CG1 1 
ATOM 1107 C CG2 . ILE A 1 139 ? 207.606 76.533  140.003 1.00 79.47  ? 139 ILE C CG2 1 
ATOM 1108 C CD1 . ILE A 1 139 ? 208.922 78.939  140.857 1.00 79.47  ? 139 ILE C CD1 1 
ATOM 1109 N N   . LEU A 1 140 ? 205.244 75.347  139.893 1.00 114.03 ? 140 LEU C N   1 
ATOM 1110 C CA  . LEU A 1 140 ? 204.886 74.121  139.183 1.00 114.03 ? 140 LEU C CA  1 
ATOM 1111 C C   . LEU A 1 140 ? 204.981 72.678  139.734 1.00 114.03 ? 140 LEU C C   1 
ATOM 1112 O O   . LEU A 1 140 ? 206.049 72.159  140.068 1.00 114.03 ? 140 LEU C O   1 
ATOM 1113 C CB  . LEU A 1 140 ? 205.650 74.176  137.875 1.00 67.44  ? 140 LEU C CB  1 
ATOM 1114 C CG  . LEU A 1 140 ? 205.645 75.618  137.354 1.00 67.44  ? 140 LEU C CG  1 
ATOM 1115 C CD1 . LEU A 1 140 ? 206.297 75.781  135.981 1.00 67.44  ? 140 LEU C CD1 1 
ATOM 1116 C CD2 . LEU A 1 140 ? 204.191 76.038  137.278 1.00 67.44  ? 140 LEU C CD2 1 
ATOM 1117 N N   . SER A 1 141 ? 203.829 72.025  139.726 1.00 159.98 ? 141 SER C N   1 
ATOM 1118 C CA  . SER A 1 141 ? 203.666 70.637  140.136 1.00 159.98 ? 141 SER C CA  1 
ATOM 1119 C C   . SER A 1 141 ? 202.468 70.234  139.316 1.00 159.98 ? 141 SER C C   1 
ATOM 1120 O O   . SER A 1 141 ? 201.413 70.865  139.380 1.00 159.98 ? 141 SER C O   1 
ATOM 1121 C CB  . SER A 1 141 ? 203.349 70.482  141.625 1.00 108.90 ? 141 SER C CB  1 
ATOM 1122 O OG  . SER A 1 141 ? 203.345 69.107  142.021 1.00 108.90 ? 141 SER C OG  1 
ATOM 1123 N N   . THR A 1 142 ? 202.661 69.186  138.529 1.00 191.17 ? 142 THR C N   1 
ATOM 1124 C CA  . THR A 1 142 ? 201.642 68.683  137.613 1.00 191.17 ? 142 THR C CA  1 
ATOM 1125 C C   . THR A 1 142 ? 200.220 68.384  138.076 1.00 191.17 ? 142 THR C C   1 
ATOM 1126 O O   . THR A 1 142 ? 199.291 69.153  137.818 1.00 191.17 ? 142 THR C O   1 
ATOM 1127 C CB  . THR A 1 142 ? 202.138 67.411  136.870 1.00 148.66 ? 142 THR C CB  1 
ATOM 1128 O OG1 . THR A 1 142 ? 203.389 67.697  136.232 1.00 148.66 ? 142 THR C OG1 1 
ATOM 1129 C CG2 . THR A 1 142 ? 201.111 66.978  135.785 1.00 148.66 ? 142 THR C CG2 1 
ATOM 1130 N N   . LEU A 1 143 ? 200.061 67.225  138.703 1.00 200.00 ? 143 LEU C N   1 
ATOM 1131 C CA  . LEU A 1 143 ? 198.755 66.732  139.121 1.00 200.00 ? 143 LEU C CA  1 
ATOM 1132 C C   . LEU A 1 143 ? 197.630 67.728  139.556 1.00 200.00 ? 143 LEU C C   1 
ATOM 1133 O O   . LEU A 1 143 ? 196.661 67.898  138.785 1.00 200.00 ? 143 LEU C O   1 
ATOM 1134 C CB  . LEU A 1 143 ? 198.950 65.573  140.125 1.00 140.27 ? 143 LEU C CB  1 
ATOM 1135 C CG  . LEU A 1 143 ? 199.667 64.345  139.496 1.00 140.27 ? 143 LEU C CG  1 
ATOM 1136 C CD1 . LEU A 1 143 ? 199.273 63.037  140.195 1.00 140.27 ? 143 LEU C CD1 1 
ATOM 1137 C CD2 . LEU A 1 143 ? 199.300 64.247  137.989 1.00 140.27 ? 143 LEU C CD2 1 
ATOM 1138 N N   . PRO A 1 144 ? 197.726 68.408  140.752 1.00 200.00 ? 144 PRO C N   1 
ATOM 1139 C CA  . PRO A 1 144 ? 196.644 69.349  141.135 1.00 200.00 ? 144 PRO C CA  1 
ATOM 1140 C C   . PRO A 1 144 ? 196.007 70.552  140.391 1.00 200.00 ? 144 PRO C C   1 
ATOM 1141 O O   . PRO A 1 144 ? 194.985 71.052  140.931 1.00 200.00 ? 144 PRO C O   1 
ATOM 1142 C CB  . PRO A 1 144 ? 197.082 69.857  142.521 1.00 113.99 ? 144 PRO C CB  1 
ATOM 1143 C CG  . PRO A 1 144 ? 197.569 68.607  143.159 1.00 113.99 ? 144 PRO C CG  1 
ATOM 1144 C CD  . PRO A 1 144 ? 198.191 67.734  141.995 1.00 113.99 ? 144 PRO C CD  1 
ATOM 1145 N N   . GLU A 1 145 ? 196.461 71.074  139.239 1.00 199.55 ? 145 GLU C N   1 
ATOM 1146 C CA  . GLU A 1 145 ? 195.699 72.280  138.884 1.00 199.55 ? 145 GLU C CA  1 
ATOM 1147 C C   . GLU A 1 145 ? 195.029 72.847  137.620 1.00 199.55 ? 145 GLU C C   1 
ATOM 1148 O O   . GLU A 1 145 ? 195.511 72.789  136.496 1.00 199.55 ? 145 GLU C O   1 
ATOM 1149 C CB  . GLU A 1 145 ? 196.444 73.450  139.516 1.00 157.53 ? 145 GLU C CB  1 
ATOM 1150 C CG  . GLU A 1 145 ? 196.730 73.260  141.051 1.00 157.53 ? 145 GLU C CG  1 
ATOM 1151 C CD  . GLU A 1 145 ? 197.120 74.548  141.752 1.00 157.53 ? 145 GLU C CD  1 
ATOM 1152 O OE1 . GLU A 1 145 ? 197.327 75.535  141.025 1.00 157.53 ? 145 GLU C OE1 1 
ATOM 1153 O OE2 . GLU A 1 145 ? 197.223 74.576  143.006 1.00 157.53 ? 145 GLU C OE2 1 
ATOM 1154 N N   . THR A 1 146 ? 193.898 73.491  137.893 1.00 200.00 ? 146 THR C N   1 
ATOM 1155 C CA  . THR A 1 146 ? 193.035 74.199  136.925 1.00 200.00 ? 146 THR C CA  1 
ATOM 1156 C C   . THR A 1 146 ? 191.872 74.701  137.787 1.00 200.00 ? 146 THR C C   1 
ATOM 1157 O O   . THR A 1 146 ? 191.231 73.884  138.430 1.00 200.00 ? 146 THR C O   1 
ATOM 1158 C CB  . THR A 1 146 ? 192.464 73.283  135.784 1.00 141.75 ? 146 THR C CB  1 
ATOM 1159 O OG1 . THR A 1 146 ? 193.533 72.867  134.910 1.00 141.75 ? 146 THR C OG1 1 
ATOM 1160 C CG2 . THR A 1 146 ? 191.388 74.053  134.925 1.00 141.75 ? 146 THR C CG2 1 
ATOM 1161 N N   . THR A 1 147 ? 191.600 76.025  137.755 1.00 200.00 ? 147 THR C N   1 
ATOM 1162 C CA  . THR A 1 147 ? 190.555 76.729  138.579 1.00 200.00 ? 147 THR C CA  1 
ATOM 1163 C C   . THR A 1 147 ? 190.041 75.823  139.760 1.00 200.00 ? 147 THR C C   1 
ATOM 1164 O O   . THR A 1 147 ? 190.897 75.008  140.230 1.00 200.00 ? 147 THR C O   1 
ATOM 1165 C CB  . THR A 1 147 ? 189.332 77.244  137.691 1.00 169.08 ? 147 THR C CB  1 
ATOM 1166 O OG1 . THR A 1 147 ? 189.748 78.266  136.777 1.00 169.08 ? 147 THR C OG1 1 
ATOM 1167 C CG2 . THR A 1 147 ? 188.199 77.870  138.517 1.00 169.08 ? 147 THR C CG2 1 
ATOM 1168 N N   . MET B 1 1   ? 219.175 72.788  115.473 1.00 136.57 ? 1   MET D N   1 
ATOM 1169 C CA  . MET B 1 1   ? 219.242 71.344  115.105 1.00 136.57 ? 1   MET D CA  1 
ATOM 1170 C C   . MET B 1 1   ? 218.380 71.057  113.882 1.00 136.57 ? 1   MET D C   1 
ATOM 1171 O O   . MET B 1 1   ? 217.338 71.689  113.670 1.00 136.57 ? 1   MET D O   1 
ATOM 1172 C CB  . MET B 1 1   ? 218.720 70.474  116.235 1.00 128.44 ? 1   MET D CB  1 
ATOM 1173 C CG  . MET B 1 1   ? 217.204 70.363  116.198 1.00 128.44 ? 1   MET D CG  1 
ATOM 1174 S SD  . MET B 1 1   ? 216.582 69.669  117.684 1.00 128.44 ? 1   MET D SD  1 
ATOM 1175 C CE  . MET B 1 1   ? 217.635 70.559  118.909 1.00 128.44 ? 1   MET D CE  1 
ATOM 1176 N N   . ASP B 1 2   ? 218.808 70.061  113.114 1.00 161.18 ? 2   ASP D N   1 
ATOM 1177 C CA  . ASP B 1 2   ? 218.112 69.634  111.904 1.00 161.18 ? 2   ASP D CA  1 
ATOM 1178 C C   . ASP B 1 2   ? 216.643 69.214  112.130 1.00 161.18 ? 2   ASP D C   1 
ATOM 1179 O O   . ASP B 1 2   ? 216.367 68.147  112.693 1.00 161.18 ? 2   ASP D O   1 
ATOM 1180 C CB  . ASP B 1 2   ? 218.911 68.487  111.252 1.00 140.94 ? 2   ASP D CB  1 
ATOM 1181 C CG  . ASP B 1 2   ? 218.192 67.850  110.062 1.00 140.94 ? 2   ASP D CG  1 
ATOM 1182 O OD1 . ASP B 1 2   ? 217.180 67.144  110.275 1.00 140.94 ? 2   ASP D OD1 1 
ATOM 1183 O OD2 . ASP B 1 2   ? 218.644 68.050  108.911 1.00 140.94 ? 2   ASP D OD2 1 
ATOM 1184 N N   . ILE B 1 3   ? 215.715 70.077  111.700 1.00 121.11 ? 3   ILE D N   1 
ATOM 1185 C CA  . ILE B 1 3   ? 214.265 69.833  111.787 1.00 121.11 ? 3   ILE D CA  1 
ATOM 1186 C C   . ILE B 1 3   ? 213.537 70.670  110.716 1.00 121.11 ? 3   ILE D C   1 
ATOM 1187 O O   . ILE B 1 3   ? 213.943 71.799  110.417 1.00 121.11 ? 3   ILE D O   1 
ATOM 1188 C CB  . ILE B 1 3   ? 213.694 70.183  113.180 1.00 61.79  ? 3   ILE D CB  1 
ATOM 1189 C CG1 . ILE B 1 3   ? 213.532 71.699  113.321 1.00 61.79  ? 3   ILE D CG1 1 
ATOM 1190 C CG2 . ILE B 1 3   ? 214.606 69.611  114.272 1.00 61.79  ? 3   ILE D CG2 1 
ATOM 1191 C CD1 . ILE B 1 3   ? 212.242 72.244  112.736 1.00 61.79  ? 3   ILE D CD1 1 
ATOM 1192 N N   . ASP B 1 4   ? 212.449 70.120  110.172 1.00 93.89  ? 4   ASP D N   1 
ATOM 1193 C CA  . ASP B 1 4   ? 211.674 70.752  109.092 1.00 93.89  ? 4   ASP D CA  1 
ATOM 1194 C C   . ASP B 1 4   ? 210.325 71.314  109.540 1.00 93.89  ? 4   ASP D C   1 
ATOM 1195 O O   . ASP B 1 4   ? 209.622 70.690  110.335 1.00 93.89  ? 4   ASP D O   1 
ATOM 1196 C CB  . ASP B 1 4   ? 211.434 69.715  107.980 1.00 98.46  ? 4   ASP D CB  1 
ATOM 1197 C CG  . ASP B 1 4   ? 211.439 70.316  106.582 1.00 98.46  ? 4   ASP D CG  1 
ATOM 1198 O OD1 . ASP B 1 4   ? 210.598 71.186  106.294 1.00 98.46  ? 4   ASP D OD1 1 
ATOM 1199 O OD2 . ASP B 1 4   ? 212.288 69.901  105.763 1.00 98.46  ? 4   ASP D OD2 1 
ATOM 1200 N N   . PRO B 1 5   ? 209.943 72.494  109.009 1.00 75.96  ? 5   PRO D N   1 
ATOM 1201 C CA  . PRO B 1 5   ? 208.702 73.255  109.261 1.00 75.96  ? 5   PRO D CA  1 
ATOM 1202 C C   . PRO B 1 5   ? 207.585 72.795  108.351 1.00 75.96  ? 5   PRO D C   1 
ATOM 1203 O O   . PRO B 1 5   ? 206.631 73.534  108.122 1.00 75.96  ? 5   PRO D O   1 
ATOM 1204 C CB  . PRO B 1 5   ? 209.072 74.699  108.904 1.00 68.11  ? 5   PRO D CB  1 
ATOM 1205 C CG  . PRO B 1 5   ? 210.573 74.665  108.645 1.00 68.11  ? 5   PRO D CG  1 
ATOM 1206 C CD  . PRO B 1 5   ? 210.859 73.281  108.173 1.00 68.11  ? 5   PRO D CD  1 
ATOM 1207 N N   . TYR B 1 6   ? 207.717 71.579  107.833 1.00 78.77  ? 6   TYR D N   1 
ATOM 1208 C CA  . TYR B 1 6   ? 206.760 71.045  106.883 1.00 78.77  ? 6   TYR D CA  1 
ATOM 1209 C C   . TYR B 1 6   ? 206.372 69.601  107.118 1.00 78.77  ? 6   TYR D C   1 
ATOM 1210 O O   . TYR B 1 6   ? 205.268 69.212  106.758 1.00 78.77  ? 6   TYR D O   1 
ATOM 1211 C CB  . TYR B 1 6   ? 207.343 71.158  105.475 1.00 104.30 ? 6   TYR D CB  1 
ATOM 1212 C CG  . TYR B 1 6   ? 207.652 72.567  105.022 1.00 104.30 ? 6   TYR D CG  1 
ATOM 1213 C CD1 . TYR B 1 6   ? 206.734 73.285  104.268 1.00 104.30 ? 6   TYR D CD1 1 
ATOM 1214 C CD2 . TYR B 1 6   ? 208.865 73.182  105.330 1.00 104.30 ? 6   TYR D CD2 1 
ATOM 1215 C CE1 . TYR B 1 6   ? 207.011 74.581  103.820 1.00 104.30 ? 6   TYR D CE1 1 
ATOM 1216 C CE2 . TYR B 1 6   ? 209.148 74.485  104.888 1.00 104.30 ? 6   TYR D CE2 1 
ATOM 1217 C CZ  . TYR B 1 6   ? 208.211 75.177  104.129 1.00 104.30 ? 6   TYR D CZ  1 
ATOM 1218 O OH  . TYR B 1 6   ? 208.460 76.452  103.657 1.00 104.30 ? 6   TYR D OH  1 
ATOM 1219 N N   . LYS B 1 7   ? 207.278 68.802  107.688 1.00 177.46 ? 7   LYS D N   1 
ATOM 1220 C CA  . LYS B 1 7   ? 206.991 67.384  107.935 1.00 177.46 ? 7   LYS D CA  1 
ATOM 1221 C C   . LYS B 1 7   ? 205.620 67.340  108.605 1.00 177.46 ? 7   LYS D C   1 
ATOM 1222 O O   . LYS B 1 7   ? 204.940 66.307  108.610 1.00 177.46 ? 7   LYS D O   1 
ATOM 1223 C CB  . LYS B 1 7   ? 208.086 66.732  108.831 1.00 119.36 ? 7   LYS D CB  1 
ATOM 1224 C CG  . LYS B 1 7   ? 208.386 65.217  108.518 1.00 119.36 ? 7   LYS D CG  1 
ATOM 1225 C CD  . LYS B 1 7   ? 209.622 64.624  109.265 1.00 119.36 ? 7   LYS D CD  1 
ATOM 1226 C CE  . LYS B 1 7   ? 209.882 63.147  108.878 1.00 119.36 ? 7   LYS D CE  1 
ATOM 1227 N NZ  . LYS B 1 7   ? 211.098 62.538  109.509 1.00 119.36 ? 7   LYS D NZ  1 
ATOM 1228 N N   . GLU B 1 8   ? 205.214 68.496  109.131 1.00 74.61  ? 8   GLU D N   1 
ATOM 1229 C CA  . GLU B 1 8   ? 203.929 68.656  109.805 1.00 74.61  ? 8   GLU D CA  1 
ATOM 1230 C C   . GLU B 1 8   ? 202.729 68.658  108.846 1.00 74.61  ? 8   GLU D C   1 
ATOM 1231 O O   . GLU B 1 8   ? 201.580 68.421  109.249 1.00 74.61  ? 8   GLU D O   1 
ATOM 1232 C CB  . GLU B 1 8   ? 203.946 69.950  110.597 1.00 137.57 ? 8   GLU D CB  1 
ATOM 1233 C CG  . GLU B 1 8   ? 202.742 70.127  111.466 1.00 137.57 ? 8   GLU D CG  1 
ATOM 1234 C CD  . GLU B 1 8   ? 202.882 71.326  112.356 1.00 137.57 ? 8   GLU D CD  1 
ATOM 1235 O OE1 . GLU B 1 8   ? 204.016 71.835  112.477 1.00 137.57 ? 8   GLU D OE1 1 
ATOM 1236 O OE2 . GLU B 1 8   ? 201.868 71.752  112.940 1.00 137.57 ? 8   GLU D OE2 1 
ATOM 1237 N N   . PHE B 1 9   ? 203.013 68.921  107.575 1.00 89.86  ? 9   PHE D N   1 
ATOM 1238 C CA  . PHE B 1 9   ? 201.994 68.962  106.537 1.00 89.86  ? 9   PHE D CA  1 
ATOM 1239 C C   . PHE B 1 9   ? 202.354 68.003  105.399 1.00 89.86  ? 9   PHE D C   1 
ATOM 1240 O O   . PHE B 1 9   ? 202.250 68.356  104.220 1.00 89.86  ? 9   PHE D O   1 
ATOM 1241 C CB  . PHE B 1 9   ? 201.876 70.381  106.003 1.00 88.83  ? 9   PHE D CB  1 
ATOM 1242 C CG  . PHE B 1 9   ? 201.790 71.428  107.080 1.00 88.83  ? 9   PHE D CG  1 
ATOM 1243 C CD1 . PHE B 1 9   ? 202.883 71.718  107.884 1.00 88.83  ? 9   PHE D CD1 1 
ATOM 1244 C CD2 . PHE B 1 9   ? 200.618 72.147  107.277 1.00 88.83  ? 9   PHE D CD2 1 
ATOM 1245 C CE1 . PHE B 1 9   ? 202.805 72.715  108.866 1.00 88.83  ? 9   PHE D CE1 1 
ATOM 1246 C CE2 . PHE B 1 9   ? 200.536 73.149  108.260 1.00 88.83  ? 9   PHE D CE2 1 
ATOM 1247 C CZ  . PHE B 1 9   ? 201.627 73.431  109.050 1.00 88.83  ? 9   PHE D CZ  1 
ATOM 1248 N N   . GLY B 1 10  ? 202.783 66.794  105.775 1.00 156.95 ? 10  GLY D N   1 
ATOM 1249 C CA  . GLY B 1 10  ? 203.166 65.767  104.813 1.00 156.95 ? 10  GLY D CA  1 
ATOM 1250 C C   . GLY B 1 10  ? 204.106 66.245  103.723 1.00 156.95 ? 10  GLY D C   1 
ATOM 1251 O O   . GLY B 1 10  ? 204.339 65.532  102.741 1.00 156.95 ? 10  GLY D O   1 
ATOM 1252 N N   . ALA B 1 11  ? 204.657 67.444  103.917 1.00 108.34 ? 11  ALA D N   1 
ATOM 1253 C CA  . ALA B 1 11  ? 205.561 68.080  102.960 1.00 108.34 ? 11  ALA D CA  1 
ATOM 1254 C C   . ALA B 1 11  ? 206.950 68.456  103.519 1.00 108.34 ? 11  ALA D C   1 
ATOM 1255 O O   . ALA B 1 11  ? 207.148 68.500  104.733 1.00 108.34 ? 11  ALA D O   1 
ATOM 1256 C CB  . ALA B 1 11  ? 204.883 69.304  102.396 1.00 20.00  ? 11  ALA D CB  1 
ATOM 1257 N N   . THR B 1 12  ? 207.897 68.733  102.614 1.00 64.82  ? 12  THR D N   1 
ATOM 1258 C CA  . THR B 1 12  ? 209.278 69.091  102.963 1.00 64.82  ? 12  THR D CA  1 
ATOM 1259 C C   . THR B 1 12  ? 209.863 70.306  102.211 1.00 64.82  ? 12  THR D C   1 
ATOM 1260 O O   . THR B 1 12  ? 209.358 70.751  101.177 1.00 64.82  ? 12  THR D O   1 
ATOM 1261 C CB  . THR B 1 12  ? 210.239 67.863  102.768 1.00 60.35  ? 12  THR D CB  1 
ATOM 1262 O OG1 . THR B 1 12  ? 211.601 68.282  102.902 1.00 60.35  ? 12  THR D OG1 1 
ATOM 1263 C CG2 . THR B 1 12  ? 210.046 67.214  101.406 1.00 60.35  ? 12  THR D CG2 1 
ATOM 1264 N N   . VAL B 1 13  ? 210.930 70.854  102.775 1.00 68.72  ? 13  VAL D N   1 
ATOM 1265 C CA  . VAL B 1 13  ? 211.614 71.991  102.188 1.00 68.72  ? 13  VAL D CA  1 
ATOM 1266 C C   . VAL B 1 13  ? 212.325 71.499  100.940 1.00 68.72  ? 13  VAL D C   1 
ATOM 1267 O O   . VAL B 1 13  ? 212.190 72.078  99.860  1.00 68.72  ? 13  VAL D O   1 
ATOM 1268 C CB  . VAL B 1 13  ? 212.665 72.576  103.167 1.00 81.02  ? 13  VAL D CB  1 
ATOM 1269 C CG1 . VAL B 1 13  ? 213.585 71.468  103.706 1.00 81.02  ? 13  VAL D CG1 1 
ATOM 1270 C CG2 . VAL B 1 13  ? 213.487 73.634  102.454 1.00 81.02  ? 13  VAL D CG2 1 
ATOM 1271 N N   . GLU B 1 14  ? 213.084 70.418  101.126 1.00 109.30 ? 14  GLU D N   1 
ATOM 1272 C CA  . GLU B 1 14  ? 213.857 69.765  100.079 1.00 109.30 ? 14  GLU D CA  1 
ATOM 1273 C C   . GLU B 1 14  ? 212.929 69.606  98.903  1.00 109.30 ? 14  GLU D C   1 
ATOM 1274 O O   . GLU B 1 14  ? 213.347 69.430  97.762  1.00 109.30 ? 14  GLU D O   1 
ATOM 1275 C CB  . GLU B 1 14  ? 214.325 68.395  100.578 1.00 110.82 ? 14  GLU D CB  1 
ATOM 1276 C CG  . GLU B 1 14  ? 215.227 68.475  101.806 1.00 110.82 ? 14  GLU D CG  1 
ATOM 1277 C CD  . GLU B 1 14  ? 215.212 67.209  102.649 1.00 110.82 ? 14  GLU D CD  1 
ATOM 1278 O OE1 . GLU B 1 14  ? 215.413 66.102  102.093 1.00 110.82 ? 14  GLU D OE1 1 
ATOM 1279 O OE2 . GLU B 1 14  ? 215.007 67.328  103.878 1.00 110.82 ? 14  GLU D OE2 1 
ATOM 1280 N N   . LEU B 1 15  ? 211.650 69.713  99.220  1.00 67.08  ? 15  LEU D N   1 
ATOM 1281 C CA  . LEU B 1 15  ? 210.567 69.576  98.272  1.00 67.08  ? 15  LEU D CA  1 
ATOM 1282 C C   . LEU B 1 15  ? 210.225 70.849  97.510  1.00 67.08  ? 15  LEU D C   1 
ATOM 1283 O O   . LEU B 1 15  ? 209.291 70.902  96.701  1.00 67.08  ? 15  LEU D O   1 
ATOM 1284 C CB  . LEU B 1 15  ? 209.359 69.113  99.046  1.00 59.87  ? 15  LEU D CB  1 
ATOM 1285 C CG  . LEU B 1 15  ? 208.077 68.821  98.290  1.00 59.87  ? 15  LEU D CG  1 
ATOM 1286 C CD1 . LEU B 1 15  ? 207.374 67.635  98.942  1.00 59.87  ? 15  LEU D CD1 1 
ATOM 1287 C CD2 . LEU B 1 15  ? 207.214 70.037  98.299  1.00 59.87  ? 15  LEU D CD2 1 
ATOM 1288 N N   . LEU B 1 16  ? 210.993 71.888  97.749  1.00 73.97  ? 16  LEU D N   1 
ATOM 1289 C CA  . LEU B 1 16  ? 210.693 73.126  97.089  1.00 73.97  ? 16  LEU D CA  1 
ATOM 1290 C C   . LEU B 1 16  ? 211.901 73.633  96.326  1.00 73.97  ? 16  LEU D C   1 
ATOM 1291 O O   . LEU B 1 16  ? 211.793 74.632  95.625  1.00 73.97  ? 16  LEU D O   1 
ATOM 1292 C CB  . LEU B 1 16  ? 210.173 74.105  98.147  1.00 29.63  ? 16  LEU D CB  1 
ATOM 1293 C CG  . LEU B 1 16  ? 209.057 73.356  98.924  1.00 29.63  ? 16  LEU D CG  1 
ATOM 1294 C CD1 . LEU B 1 16  ? 208.501 74.075  100.147 1.00 29.63  ? 16  LEU D CD1 1 
ATOM 1295 C CD2 . LEU B 1 16  ? 207.956 73.120  97.939  1.00 29.63  ? 16  LEU D CD2 1 
ATOM 1296 N N   . SER B 1 17  ? 213.040 72.932  96.441  1.00 178.95 ? 17  SER D N   1 
ATOM 1297 C CA  . SER B 1 17  ? 214.245 73.294  95.685  1.00 178.95 ? 17  SER D CA  1 
ATOM 1298 C C   . SER B 1 17  ? 213.692 73.216  94.275  1.00 178.95 ? 17  SER D C   1 
ATOM 1299 O O   . SER B 1 17  ? 214.289 73.685  93.306  1.00 178.95 ? 17  SER D O   1 
ATOM 1300 C CB  . SER B 1 17  ? 215.370 72.252  95.888  1.00 106.11 ? 17  SER D CB  1 
ATOM 1301 O OG  . SER B 1 17  ? 216.503 72.503  95.057  1.00 106.11 ? 17  SER D OG  1 
ATOM 1302 N N   . PHE B 1 18  ? 212.546 72.543  94.208  1.00 163.69 ? 18  PHE D N   1 
ATOM 1303 C CA  . PHE B 1 18  ? 211.748 72.353  93.010  1.00 163.69 ? 18  PHE D CA  1 
ATOM 1304 C C   . PHE B 1 18  ? 211.652 73.698  92.359  1.00 163.69 ? 18  PHE D C   1 
ATOM 1305 O O   . PHE B 1 18  ? 212.343 74.028  91.399  1.00 163.69 ? 18  PHE D O   1 
ATOM 1306 C CB  . PHE B 1 18  ? 210.333 71.963  93.413  1.00 105.37 ? 18  PHE D CB  1 
ATOM 1307 C CG  . PHE B 1 18  ? 210.132 70.498  93.573  1.00 105.37 ? 18  PHE D CG  1 
ATOM 1308 C CD1 . PHE B 1 18  ? 209.128 69.850  92.850  1.00 105.37 ? 18  PHE D CD1 1 
ATOM 1309 C CD2 . PHE B 1 18  ? 210.954 69.739  94.400  1.00 105.37 ? 18  PHE D CD2 1 
ATOM 1310 C CE1 . PHE B 1 18  ? 208.935 68.448  92.933  1.00 105.37 ? 18  PHE D CE1 1 
ATOM 1311 C CE2 . PHE B 1 18  ? 210.773 68.331  94.496  1.00 105.37 ? 18  PHE D CE2 1 
ATOM 1312 C CZ  . PHE B 1 18  ? 209.760 67.689  93.756  1.00 105.37 ? 18  PHE D CZ  1 
ATOM 1313 N N   . LEU B 1 19  ? 210.762 74.468  92.957  1.00 88.39  ? 19  LEU D N   1 
ATOM 1314 C CA  . LEU B 1 19  ? 210.438 75.827  92.574  1.00 88.39  ? 19  LEU D CA  1 
ATOM 1315 C C   . LEU B 1 19  ? 211.595 76.805  92.478  1.00 88.39  ? 19  LEU D C   1 
ATOM 1316 O O   . LEU B 1 19  ? 212.361 77.022  93.418  1.00 88.39  ? 19  LEU D O   1 
ATOM 1317 C CB  . LEU B 1 19  ? 209.423 76.358  93.560  1.00 95.99  ? 19  LEU D CB  1 
ATOM 1318 C CG  . LEU B 1 19  ? 208.725 75.158  94.181  1.00 95.99  ? 19  LEU D CG  1 
ATOM 1319 C CD1 . LEU B 1 19  ? 207.766 75.599  95.249  1.00 95.99  ? 19  LEU D CD1 1 
ATOM 1320 C CD2 . LEU B 1 19  ? 208.012 74.416  93.083  1.00 95.99  ? 19  LEU D CD2 1 
ATOM 1321 N N   . PRO B 1 20  ? 211.712 77.439  91.326  1.00 87.96  ? 20  PRO D N   1 
ATOM 1322 C CA  . PRO B 1 20  ? 212.774 78.402  91.107  1.00 87.96  ? 20  PRO D CA  1 
ATOM 1323 C C   . PRO B 1 20  ? 212.698 79.438  92.187  1.00 87.96  ? 20  PRO D C   1 
ATOM 1324 O O   . PRO B 1 20  ? 211.627 79.956  92.492  1.00 87.96  ? 20  PRO D O   1 
ATOM 1325 C CB  . PRO B 1 20  ? 212.427 78.988  89.756  1.00 91.82  ? 20  PRO D CB  1 
ATOM 1326 C CG  . PRO B 1 20  ? 211.706 77.882  89.098  1.00 91.82  ? 20  PRO D CG  1 
ATOM 1327 C CD  . PRO B 1 20  ? 210.813 77.382  90.172  1.00 91.82  ? 20  PRO D CD  1 
ATOM 1328 N N   . SER B 1 21  ? 213.847 79.729  92.770  1.00 73.95  ? 21  SER D N   1 
ATOM 1329 C CA  . SER B 1 21  ? 213.929 80.727  93.815  1.00 73.95  ? 21  SER D CA  1 
ATOM 1330 C C   . SER B 1 21  ? 213.208 81.980  93.281  1.00 73.95  ? 21  SER D C   1 
ATOM 1331 O O   . SER B 1 21  ? 212.392 82.595  93.975  1.00 73.95  ? 21  SER D O   1 
ATOM 1332 C CB  . SER B 1 21  ? 215.412 81.011  94.124  1.00 111.75 ? 21  SER D CB  1 
ATOM 1333 O OG  . SER B 1 21  ? 216.157 79.805  94.291  1.00 111.75 ? 21  SER D OG  1 
ATOM 1334 N N   . ASP B 1 22  ? 213.510 82.333  92.030  1.00 95.64  ? 22  ASP D N   1 
ATOM 1335 C CA  . ASP B 1 22  ? 212.895 83.486  91.376  1.00 95.64  ? 22  ASP D CA  1 
ATOM 1336 C C   . ASP B 1 22  ? 211.499 83.113  90.921  1.00 95.64  ? 22  ASP D C   1 
ATOM 1337 O O   . ASP B 1 22  ? 211.231 82.960  89.736  1.00 95.64  ? 22  ASP D O   1 
ATOM 1338 C CB  . ASP B 1 22  ? 213.749 83.993  90.181  1.00 106.71 ? 22  ASP D CB  1 
ATOM 1339 C CG  . ASP B 1 22  ? 214.137 82.888  89.179  1.00 106.71 ? 22  ASP D CG  1 
ATOM 1340 O OD1 . ASP B 1 22  ? 213.241 82.249  88.582  1.00 106.71 ? 22  ASP D OD1 1 
ATOM 1341 O OD2 . ASP B 1 22  ? 215.357 82.674  88.979  1.00 106.71 ? 22  ASP D OD2 1 
ATOM 1342 N N   . PHE B 1 23  ? 210.613 82.958  91.894  1.00 94.18  ? 23  PHE D N   1 
ATOM 1343 C CA  . PHE B 1 23  ? 209.230 82.588  91.620  1.00 94.18  ? 23  PHE D CA  1 
ATOM 1344 C C   . PHE B 1 23  ? 208.285 83.255  92.604  1.00 94.18  ? 23  PHE D C   1 
ATOM 1345 O O   . PHE B 1 23  ? 207.336 83.957  92.227  1.00 94.18  ? 23  PHE D O   1 
ATOM 1346 C CB  . PHE B 1 23  ? 209.085 81.060  91.713  1.00 95.58  ? 23  PHE D CB  1 
ATOM 1347 C CG  . PHE B 1 23  ? 207.646 80.553  91.820  1.00 95.58  ? 23  PHE D CG  1 
ATOM 1348 C CD1 . PHE B 1 23  ? 207.340 79.247  91.438  1.00 95.58  ? 23  PHE D CD1 1 
ATOM 1349 C CD2 . PHE B 1 23  ? 206.615 81.337  92.329  1.00 95.58  ? 23  PHE D CD2 1 
ATOM 1350 C CE1 . PHE B 1 23  ? 206.044 78.738  91.561  1.00 95.58  ? 23  PHE D CE1 1 
ATOM 1351 C CE2 . PHE B 1 23  ? 205.325 80.836  92.454  1.00 95.58  ? 23  PHE D CE2 1 
ATOM 1352 C CZ  . PHE B 1 23  ? 205.040 79.538  92.070  1.00 95.58  ? 23  PHE D CZ  1 
ATOM 1353 N N   . PHE B 1 24  ? 208.535 82.980  93.874  1.00 116.22 ? 24  PHE D N   1 
ATOM 1354 C CA  . PHE B 1 24  ? 207.729 83.506  94.954  1.00 116.22 ? 24  PHE D CA  1 
ATOM 1355 C C   . PHE B 1 24  ? 207.747 85.014  94.928  1.00 116.22 ? 24  PHE D C   1 
ATOM 1356 O O   . PHE B 1 24  ? 208.803 85.639  95.039  1.00 116.22 ? 24  PHE D O   1 
ATOM 1357 C CB  . PHE B 1 24  ? 208.277 83.008  96.270  1.00 131.57 ? 24  PHE D CB  1 
ATOM 1358 C CG  . PHE B 1 24  ? 208.506 81.537  96.290  1.00 131.57 ? 24  PHE D CG  1 
ATOM 1359 C CD1 . PHE B 1 24  ? 207.628 80.692  96.951  1.00 131.57 ? 24  PHE D CD1 1 
ATOM 1360 C CD2 . PHE B 1 24  ? 209.608 80.991  95.644  1.00 131.57 ? 24  PHE D CD2 1 
ATOM 1361 C CE1 . PHE B 1 24  ? 207.846 79.316  96.973  1.00 131.57 ? 24  PHE D CE1 1 
ATOM 1362 C CE2 . PHE B 1 24  ? 209.838 79.619  95.657  1.00 131.57 ? 24  PHE D CE2 1 
ATOM 1363 C CZ  . PHE B 1 24  ? 208.958 78.777  96.323  1.00 131.57 ? 24  PHE D CZ  1 
ATOM 1364 N N   . PRO B 1 25  ? 206.566 85.618  94.784  1.00 93.38  ? 25  PRO D N   1 
ATOM 1365 C CA  . PRO B 1 25  ? 206.325 87.064  94.725  1.00 93.38  ? 25  PRO D CA  1 
ATOM 1366 C C   . PRO B 1 25  ? 206.974 87.876  95.845  1.00 93.38  ? 25  PRO D C   1 
ATOM 1367 O O   . PRO B 1 25  ? 207.103 87.417  96.989  1.00 93.38  ? 25  PRO D O   1 
ATOM 1368 C CB  . PRO B 1 25  ? 204.808 87.153  94.753  1.00 69.51  ? 25  PRO D CB  1 
ATOM 1369 C CG  . PRO B 1 25  ? 204.402 85.882  94.046  1.00 69.51  ? 25  PRO D CG  1 
ATOM 1370 C CD  . PRO B 1 25  ? 205.308 84.863  94.653  1.00 69.51  ? 25  PRO D CD  1 
ATOM 1371 N N   . SER B 1 26  ? 207.388 89.092  95.508  1.00 118.52 ? 26  SER D N   1 
ATOM 1372 C CA  . SER B 1 26  ? 208.011 89.941  96.501  1.00 118.52 ? 26  SER D CA  1 
ATOM 1373 C C   . SER B 1 26  ? 207.095 89.914  97.706  1.00 118.52 ? 26  SER D C   1 
ATOM 1374 O O   . SER B 1 26  ? 205.871 89.959  97.579  1.00 118.52 ? 26  SER D O   1 
ATOM 1375 C CB  . SER B 1 26  ? 208.176 91.381  95.989  1.00 121.35 ? 26  SER D CB  1 
ATOM 1376 O OG  . SER B 1 26  ? 206.927 92.016  95.765  1.00 121.35 ? 26  SER D OG  1 
ATOM 1377 N N   . VAL B 1 27  ? 207.708 89.778  98.868  1.00 56.35  ? 27  VAL D N   1 
ATOM 1378 C CA  . VAL B 1 27  ? 206.997 89.764  100.131 1.00 56.35  ? 27  VAL D CA  1 
ATOM 1379 C C   . VAL B 1 27  ? 205.866 90.805  100.126 1.00 56.35  ? 27  VAL D C   1 
ATOM 1380 O O   . VAL B 1 27  ? 204.710 90.467  100.382 1.00 56.35  ? 27  VAL D O   1 
ATOM 1381 C CB  . VAL B 1 27  ? 207.980 90.100  101.259 1.00 74.33  ? 27  VAL D CB  1 
ATOM 1382 C CG1 . VAL B 1 27  ? 207.390 89.750  102.608 1.00 74.33  ? 27  VAL D CG1 1 
ATOM 1383 C CG2 . VAL B 1 27  ? 209.291 89.379  101.006 1.00 74.33  ? 27  VAL D CG2 1 
ATOM 1384 N N   . ARG B 1 28  ? 206.206 92.066  99.835  1.00 100.24 ? 28  ARG D N   1 
ATOM 1385 C CA  . ARG B 1 28  ? 205.218 93.151  99.810  1.00 100.24 ? 28  ARG D CA  1 
ATOM 1386 C C   . ARG B 1 28  ? 203.906 92.640  99.231  1.00 100.24 ? 28  ARG D C   1 
ATOM 1387 O O   . ARG B 1 28  ? 202.862 92.748  99.875  1.00 100.24 ? 28  ARG D O   1 
ATOM 1388 C CB  . ARG B 1 28  ? 205.747 94.357  99.000  1.00 130.28 ? 28  ARG D CB  1 
ATOM 1389 C CG  . ARG B 1 28  ? 204.799 95.586  98.890  1.00 130.28 ? 28  ARG D CG  1 
ATOM 1390 C CD  . ARG B 1 28  ? 204.007 95.887  100.185 1.00 130.28 ? 28  ARG D CD  1 
ATOM 1391 N NE  . ARG B 1 28  ? 204.837 95.903  101.394 1.00 130.28 ? 28  ARG D NE  1 
ATOM 1392 C CZ  . ARG B 1 28  ? 204.363 95.896  102.641 1.00 130.28 ? 28  ARG D CZ  1 
ATOM 1393 N NH1 . ARG B 1 28  ? 203.055 95.876  102.861 1.00 130.28 ? 28  ARG D NH1 1 
ATOM 1394 N NH2 . ARG B 1 28  ? 205.201 95.896  103.673 1.00 130.28 ? 28  ARG D NH2 1 
ATOM 1395 N N   . ASP B 1 29  ? 203.969 92.063  98.030  1.00 100.68 ? 29  ASP D N   1 
ATOM 1396 C CA  . ASP B 1 29  ? 202.782 91.517  97.373  1.00 100.68 ? 29  ASP D CA  1 
ATOM 1397 C C   . ASP B 1 29  ? 202.103 90.537  98.338  1.00 100.68 ? 29  ASP D C   1 
ATOM 1398 O O   . ASP B 1 29  ? 200.932 90.704  98.668  1.00 100.68 ? 29  ASP D O   1 
ATOM 1399 C CB  . ASP B 1 29  ? 203.150 90.796  96.055  1.00 95.95  ? 29  ASP D CB  1 
ATOM 1400 C CG  . ASP B 1 29  ? 203.563 91.762  94.930  1.00 95.95  ? 29  ASP D CG  1 
ATOM 1401 O OD1 . ASP B 1 29  ? 202.830 92.750  94.674  1.00 95.95  ? 29  ASP D OD1 1 
ATOM 1402 O OD2 . ASP B 1 29  ? 204.615 91.517  94.287  1.00 95.95  ? 29  ASP D OD2 1 
ATOM 1403 N N   . LEU B 1 30  ? 202.855 89.538  98.803  1.00 56.81  ? 30  LEU D N   1 
ATOM 1404 C CA  . LEU B 1 30  ? 202.353 88.516  99.744  1.00 56.81  ? 30  LEU D CA  1 
ATOM 1405 C C   . LEU B 1 30  ? 201.692 89.033  101.020 1.00 56.81  ? 30  LEU D C   1 
ATOM 1406 O O   . LEU B 1 30  ? 200.536 88.718  101.306 1.00 56.81  ? 30  LEU D O   1 
ATOM 1407 C CB  . LEU B 1 30  ? 203.484 87.577  100.164 1.00 113.85 ? 30  LEU D CB  1 
ATOM 1408 C CG  . LEU B 1 30  ? 203.873 86.418  99.249  1.00 113.85 ? 30  LEU D CG  1 
ATOM 1409 C CD1 . LEU B 1 30  ? 204.702 86.929  98.091  1.00 113.85 ? 30  LEU D CD1 1 
ATOM 1410 C CD2 . LEU B 1 30  ? 204.654 85.392  100.052 1.00 113.85 ? 30  LEU D CD2 1 
ATOM 1411 N N   . LEU B 1 31  ? 202.468 89.776  101.807 1.00 69.78  ? 31  LEU D N   1 
ATOM 1412 C CA  . LEU B 1 31  ? 201.999 90.381  103.049 1.00 69.78  ? 31  LEU D CA  1 
ATOM 1413 C C   . LEU B 1 31  ? 200.646 91.022  102.784 1.00 69.78  ? 31  LEU D C   1 
ATOM 1414 O O   . LEU B 1 31  ? 199.644 90.690  103.436 1.00 69.78  ? 31  LEU D O   1 
ATOM 1415 C CB  . LEU B 1 31  ? 202.971 91.466  103.483 1.00 122.51 ? 31  LEU D CB  1 
ATOM 1416 C CG  . LEU B 1 31  ? 204.389 90.953  103.649 1.00 122.51 ? 31  LEU D CG  1 
ATOM 1417 C CD1 . LEU B 1 31  ? 205.336 92.127  103.869 1.00 122.51 ? 31  LEU D CD1 1 
ATOM 1418 C CD2 . LEU B 1 31  ? 204.418 89.972  104.808 1.00 122.51 ? 31  LEU D CD2 1 
ATOM 1419 N N   . ASP B 1 32  ? 200.640 91.952  101.822 1.00 129.59 ? 32  ASP D N   1 
ATOM 1420 C CA  . ASP B 1 32  ? 199.430 92.666  101.417 1.00 129.59 ? 32  ASP D CA  1 
ATOM 1421 C C   . ASP B 1 32  ? 198.306 91.647  101.177 1.00 129.59 ? 32  ASP D C   1 
ATOM 1422 O O   . ASP B 1 32  ? 197.230 91.766  101.755 1.00 129.59 ? 32  ASP D O   1 
ATOM 1423 C CB  . ASP B 1 32  ? 199.685 93.515  100.146 1.00 110.77 ? 32  ASP D CB  1 
ATOM 1424 C CG  . ASP B 1 32  ? 200.534 94.781  100.416 1.00 110.77 ? 32  ASP D CG  1 
ATOM 1425 O OD1 . ASP B 1 32  ? 200.771 95.128  101.601 1.00 110.77 ? 32  ASP D OD1 1 
ATOM 1426 O OD2 . ASP B 1 32  ? 200.956 95.441  99.432  1.00 110.77 ? 32  ASP D OD2 1 
ATOM 1427 N N   . THR B 1 33  ? 198.569 90.639  100.346 1.00 77.40  ? 33  THR D N   1 
ATOM 1428 C CA  . THR B 1 33  ? 197.598 89.574  100.039 1.00 77.40  ? 33  THR D CA  1 
ATOM 1429 C C   . THR B 1 33  ? 196.802 89.135  101.255 1.00 77.40  ? 33  THR D C   1 
ATOM 1430 O O   . THR B 1 33  ? 195.590 89.353  101.382 1.00 77.40  ? 33  THR D O   1 
ATOM 1431 C CB  . THR B 1 33  ? 198.307 88.299  99.542  1.00 63.32  ? 33  THR D CB  1 
ATOM 1432 O OG1 . THR B 1 33  ? 198.983 88.572  98.314  1.00 63.32  ? 33  THR D OG1 1 
ATOM 1433 C CG2 . THR B 1 33  ? 197.311 87.171  99.329  1.00 63.32  ? 33  THR D CG2 1 
ATOM 1434 N N   . ALA B 1 34  ? 197.534 88.461  102.124 1.00 67.43  ? 34  ALA D N   1 
ATOM 1435 C CA  . ALA B 1 34  ? 197.049 87.918  103.373 1.00 67.43  ? 34  ALA D CA  1 
ATOM 1436 C C   . ALA B 1 34  ? 196.061 88.782  104.162 1.00 67.43  ? 34  ALA D C   1 
ATOM 1437 O O   . ALA B 1 34  ? 194.853 88.506  104.209 1.00 67.43  ? 34  ALA D O   1 
ATOM 1438 C CB  . ALA B 1 34  ? 198.234 87.625  104.215 1.00 20.00  ? 34  ALA D CB  1 
ATOM 1439 N N   . ALA B 1 35  ? 196.611 89.809  104.802 1.00 151.53 ? 35  ALA D N   1 
ATOM 1440 C CA  . ALA B 1 35  ? 195.855 90.740  105.619 1.00 151.53 ? 35  ALA D CA  1 
ATOM 1441 C C   . ALA B 1 35  ? 194.636 91.340  104.900 1.00 151.53 ? 35  ALA D C   1 
ATOM 1442 O O   . ALA B 1 35  ? 193.767 91.943  105.544 1.00 151.53 ? 35  ALA D O   1 
ATOM 1443 C CB  . ALA B 1 35  ? 196.791 91.852  106.104 1.00 92.06  ? 35  ALA D CB  1 
ATOM 1444 N N   . ALA B 1 36  ? 194.574 91.174  103.576 1.00 81.06  ? 36  ALA D N   1 
ATOM 1445 C CA  . ALA B 1 36  ? 193.469 91.707  102.764 1.00 81.06  ? 36  ALA D CA  1 
ATOM 1446 C C   . ALA B 1 36  ? 192.517 90.563  102.526 1.00 81.06  ? 36  ALA D C   1 
ATOM 1447 O O   . ALA B 1 36  ? 191.845 90.471  101.497 1.00 81.06  ? 36  ALA D O   1 
ATOM 1448 C CB  . ALA B 1 36  ? 194.001 92.237  101.417 1.00 123.46 ? 36  ALA D CB  1 
ATOM 1449 N N   . LEU B 1 37  ? 192.427 89.708  103.521 1.00 110.48 ? 37  LEU D N   1 
ATOM 1450 C CA  . LEU B 1 37  ? 191.624 88.546  103.338 1.00 110.48 ? 37  LEU D CA  1 
ATOM 1451 C C   . LEU B 1 37  ? 191.408 87.836  104.679 1.00 110.48 ? 37  LEU D C   1 
ATOM 1452 O O   . LEU B 1 37  ? 190.474 87.040  104.844 1.00 110.48 ? 37  LEU D O   1 
ATOM 1453 C CB  . LEU B 1 37  ? 192.393 87.704  102.324 1.00 36.87  ? 37  LEU D CB  1 
ATOM 1454 C CG  . LEU B 1 37  ? 191.952 86.289  102.006 1.00 36.87  ? 37  LEU D CG  1 
ATOM 1455 C CD1 . LEU B 1 37  ? 190.393 86.180  101.906 1.00 36.87  ? 37  LEU D CD1 1 
ATOM 1456 C CD2 . LEU B 1 37  ? 192.673 85.875  100.734 1.00 36.87  ? 37  LEU D CD2 1 
ATOM 1457 N N   . TYR B 1 38  ? 192.265 88.169  105.644 1.00 77.59  ? 38  TYR D N   1 
ATOM 1458 C CA  . TYR B 1 38  ? 192.214 87.586  106.980 1.00 77.59  ? 38  TYR D CA  1 
ATOM 1459 C C   . TYR B 1 38  ? 192.554 88.572  108.112 1.00 77.59  ? 38  TYR D C   1 
ATOM 1460 O O   . TYR B 1 38  ? 192.860 88.157  109.224 1.00 77.59  ? 38  TYR D O   1 
ATOM 1461 C CB  . TYR B 1 38  ? 193.183 86.423  107.029 1.00 59.60  ? 38  TYR D CB  1 
ATOM 1462 C CG  . TYR B 1 38  ? 193.069 85.467  105.851 1.00 59.60  ? 38  TYR D CG  1 
ATOM 1463 C CD1 . TYR B 1 38  ? 194.065 85.414  104.874 1.00 59.60  ? 38  TYR D CD1 1 
ATOM 1464 C CD2 . TYR B 1 38  ? 192.019 84.539  105.768 1.00 59.60  ? 38  TYR D CD2 1 
ATOM 1465 C CE1 . TYR B 1 38  ? 194.038 84.430  103.824 1.00 59.60  ? 38  TYR D CE1 1 
ATOM 1466 C CE2 . TYR B 1 38  ? 191.974 83.542  104.723 1.00 59.60  ? 38  TYR D CE2 1 
ATOM 1467 C CZ  . TYR B 1 38  ? 192.994 83.488  103.750 1.00 59.60  ? 38  TYR D CZ  1 
ATOM 1468 O OH  . TYR B 1 38  ? 192.980 82.506  102.749 1.00 59.60  ? 38  TYR D OH  1 
ATOM 1469 N N   . ARG B 1 39  ? 192.496 89.872  107.832 1.00 129.86 ? 39  ARG D N   1 
ATOM 1470 C CA  . ARG B 1 39  ? 192.813 90.898  108.838 1.00 129.86 ? 39  ARG D CA  1 
ATOM 1471 C C   . ARG B 1 39  ? 192.106 90.554  110.150 1.00 129.86 ? 39  ARG D C   1 
ATOM 1472 O O   . ARG B 1 39  ? 192.741 90.481  111.207 1.00 129.86 ? 39  ARG D O   1 
ATOM 1473 C CB  . ARG B 1 39  ? 192.380 92.298  108.342 1.00 149.99 ? 39  ARG D CB  1 
ATOM 1474 C CG  . ARG B 1 39  ? 193.090 93.492  109.012 1.00 149.99 ? 39  ARG D CG  1 
ATOM 1475 C CD  . ARG B 1 39  ? 192.886 94.794  108.228 1.00 149.99 ? 39  ARG D CD  1 
ATOM 1476 N NE  . ARG B 1 39  ? 193.626 95.951  108.761 1.00 149.99 ? 39  ARG D NE  1 
ATOM 1477 C CZ  . ARG B 1 39  ? 194.958 96.061  108.816 1.00 149.99 ? 39  ARG D CZ  1 
ATOM 1478 N NH1 . ARG B 1 39  ? 195.738 95.081  108.380 1.00 149.99 ? 39  ARG D NH1 1 
ATOM 1479 N NH2 . ARG B 1 39  ? 195.520 97.172  109.288 1.00 149.99 ? 39  ARG D NH2 1 
ATOM 1480 N N   . ASP B 1 40  ? 190.795 90.319  110.070 1.00 143.22 ? 40  ASP D N   1 
ATOM 1481 C CA  . ASP B 1 40  ? 190.001 89.979  111.248 1.00 143.22 ? 40  ASP D CA  1 
ATOM 1482 C C   . ASP B 1 40  ? 190.188 88.513  111.578 1.00 143.22 ? 40  ASP D C   1 
ATOM 1483 O O   . ASP B 1 40  ? 190.199 88.121  112.745 1.00 143.22 ? 40  ASP D O   1 
ATOM 1484 C CB  . ASP B 1 40  ? 188.512 90.267  111.008 1.00 131.51 ? 40  ASP D CB  1 
ATOM 1485 C CG  . ASP B 1 40  ? 188.220 91.760  110.815 1.00 131.51 ? 40  ASP D CG  1 
ATOM 1486 O OD1 . ASP B 1 40  ? 188.856 92.604  111.496 1.00 131.51 ? 40  ASP D OD1 1 
ATOM 1487 O OD2 . ASP B 1 40  ? 187.335 92.092  109.994 1.00 131.51 ? 40  ASP D OD2 1 
ATOM 1488 N N   . ALA B 1 41  ? 190.343 87.712  110.533 1.00 72.65  ? 41  ALA D N   1 
ATOM 1489 C CA  . ALA B 1 41  ? 190.536 86.279  110.690 1.00 72.65  ? 41  ALA D CA  1 
ATOM 1490 C C   . ALA B 1 41  ? 191.805 85.912  111.479 1.00 72.65  ? 41  ALA D C   1 
ATOM 1491 O O   . ALA B 1 41  ? 192.013 84.745  111.821 1.00 72.65  ? 41  ALA D O   1 
ATOM 1492 C CB  . ALA B 1 41  ? 190.566 85.618  109.307 1.00 74.85  ? 41  ALA D CB  1 
ATOM 1493 N N   . LEU B 1 42  ? 192.641 86.901  111.783 1.00 61.87  ? 42  LEU D N   1 
ATOM 1494 C CA  . LEU B 1 42  ? 193.888 86.632  112.492 1.00 61.87  ? 42  LEU D CA  1 
ATOM 1495 C C   . LEU B 1 42  ? 194.105 87.421  113.761 1.00 61.87  ? 42  LEU D C   1 
ATOM 1496 O O   . LEU B 1 42  ? 194.714 86.914  114.696 1.00 61.87  ? 42  LEU D O   1 
ATOM 1497 C CB  . LEU B 1 42  ? 195.057 86.861  111.558 1.00 46.07  ? 42  LEU D CB  1 
ATOM 1498 C CG  . LEU B 1 42  ? 195.063 85.870  110.402 1.00 46.07  ? 42  LEU D CG  1 
ATOM 1499 C CD1 . LEU B 1 42  ? 195.388 86.560  109.092 1.00 46.07  ? 42  LEU D CD1 1 
ATOM 1500 C CD2 . LEU B 1 42  ? 196.062 84.790  110.715 1.00 46.07  ? 42  LEU D CD2 1 
ATOM 1501 N N   . GLU B 1 43  ? 193.638 88.666  113.797 1.00 137.35 ? 43  GLU D N   1 
ATOM 1502 C CA  . GLU B 1 43  ? 193.767 89.468  115.010 1.00 137.35 ? 43  GLU D CA  1 
ATOM 1503 C C   . GLU B 1 43  ? 192.761 88.786  115.960 1.00 137.35 ? 43  GLU D C   1 
ATOM 1504 O O   . GLU B 1 43  ? 192.422 89.297  117.033 1.00 137.35 ? 43  GLU D O   1 
ATOM 1505 C CB  . GLU B 1 43  ? 193.392 90.945  114.730 1.00 123.61 ? 43  GLU D CB  1 
ATOM 1506 C CG  . GLU B 1 43  ? 194.211 91.617  113.588 1.00 123.61 ? 43  GLU D CG  1 
ATOM 1507 C CD  . GLU B 1 43  ? 193.988 93.137  113.434 1.00 123.61 ? 43  GLU D CD  1 
ATOM 1508 O OE1 . GLU B 1 43  ? 192.816 93.578  113.325 1.00 123.61 ? 43  GLU D OE1 1 
ATOM 1509 O OE2 . GLU B 1 43  ? 194.998 93.887  113.407 1.00 123.61 ? 43  GLU D OE2 1 
ATOM 1510 N N   . SER B 1 44  ? 192.324 87.600  115.520 1.00 93.80  ? 44  SER D N   1 
ATOM 1511 C CA  . SER B 1 44  ? 191.359 86.722  116.187 1.00 93.80  ? 44  SER D CA  1 
ATOM 1512 C C   . SER B 1 44  ? 191.908 85.791  117.282 1.00 93.80  ? 44  SER D C   1 
ATOM 1513 O O   . SER B 1 44  ? 193.055 85.347  117.212 1.00 93.80  ? 44  SER D O   1 
ATOM 1514 C CB  . SER B 1 44  ? 190.659 85.857  115.132 1.00 68.20  ? 44  SER D CB  1 
ATOM 1515 O OG  . SER B 1 44  ? 190.012 84.738  115.729 1.00 68.20  ? 44  SER D OG  1 
ATOM 1516 N N   . PRO B 1 45  ? 191.077 85.494  118.309 1.00 87.19  ? 45  PRO D N   1 
ATOM 1517 C CA  . PRO B 1 45  ? 191.362 84.628  119.467 1.00 87.19  ? 45  PRO D CA  1 
ATOM 1518 C C   . PRO B 1 45  ? 191.199 83.115  119.200 1.00 87.19  ? 45  PRO D C   1 
ATOM 1519 O O   . PRO B 1 45  ? 191.527 82.272  120.048 1.00 87.19  ? 45  PRO D O   1 
ATOM 1520 C CB  . PRO B 1 45  ? 190.367 85.132  120.527 1.00 112.30 ? 45  PRO D CB  1 
ATOM 1521 C CG  . PRO B 1 45  ? 190.109 86.571  120.123 1.00 112.30 ? 45  PRO D CG  1 
ATOM 1522 C CD  . PRO B 1 45  ? 189.957 86.403  118.633 1.00 112.30 ? 45  PRO D CD  1 
ATOM 1523 N N   . GLU B 1 46  ? 190.684 82.775  118.024 1.00 111.42 ? 46  GLU D N   1 
ATOM 1524 C CA  . GLU B 1 46  ? 190.465 81.373  117.663 1.00 111.42 ? 46  GLU D CA  1 
ATOM 1525 C C   . GLU B 1 46  ? 191.639 80.854  116.826 1.00 111.42 ? 46  GLU D C   1 
ATOM 1526 O O   . GLU B 1 46  ? 191.859 81.358  115.723 1.00 111.42 ? 46  GLU D O   1 
ATOM 1527 C CB  . GLU B 1 46  ? 189.165 81.243  116.841 1.00 121.41 ? 46  GLU D CB  1 
ATOM 1528 C CG  . GLU B 1 46  ? 187.884 81.659  117.557 1.00 121.41 ? 46  GLU D CG  1 
ATOM 1529 C CD  . GLU B 1 46  ? 187.686 80.911  118.864 1.00 121.41 ? 46  GLU D CD  1 
ATOM 1530 O OE1 . GLU B 1 46  ? 188.060 79.715  118.933 1.00 121.41 ? 46  GLU D OE1 1 
ATOM 1531 O OE2 . GLU B 1 46  ? 187.151 81.517  119.818 1.00 121.41 ? 46  GLU D OE2 1 
ATOM 1532 N N   . HIS B 1 47  ? 192.410 79.881  117.311 1.00 108.22 ? 47  HIS D N   1 
ATOM 1533 C CA  . HIS B 1 47  ? 193.491 79.402  116.454 1.00 108.22 ? 47  HIS D CA  1 
ATOM 1534 C C   . HIS B 1 47  ? 192.895 78.428  115.465 1.00 108.22 ? 47  HIS D C   1 
ATOM 1535 O O   . HIS B 1 47  ? 193.236 77.247  115.426 1.00 108.22 ? 47  HIS D O   1 
ATOM 1536 C CB  . HIS B 1 47  ? 194.639 78.752  117.237 1.00 163.10 ? 47  HIS D CB  1 
ATOM 1537 C CG  . HIS B 1 47  ? 194.226 77.806  118.323 1.00 163.10 ? 47  HIS D CG  1 
ATOM 1538 N ND1 . HIS B 1 47  ? 193.729 78.230  119.544 1.00 163.10 ? 47  HIS D ND1 1 
ATOM 1539 C CD2 . HIS B 1 47  ? 194.397 76.467  118.451 1.00 163.10 ? 47  HIS D CD2 1 
ATOM 1540 C CE1 . HIS B 1 47  ? 193.626 77.209  120.367 1.00 163.10 ? 47  HIS D CE1 1 
ATOM 1541 N NE2 . HIS B 1 47  ? 194.027 76.118  119.727 1.00 163.10 ? 47  HIS D NE2 1 
ATOM 1542 N N   . ALA B 1 48  ? 191.985 78.983  114.667 1.00 124.35 ? 48  ALA D N   1 
ATOM 1543 C CA  . ALA B 1 48  ? 191.201 78.297  113.630 1.00 124.35 ? 48  ALA D CA  1 
ATOM 1544 C C   . ALA B 1 48  ? 191.790 77.018  113.082 1.00 124.35 ? 48  ALA D C   1 
ATOM 1545 O O   . ALA B 1 48  ? 191.059 76.139  112.616 1.00 124.35 ? 48  ALA D O   1 
ATOM 1546 C CB  . ALA B 1 48  ? 190.923 79.235  112.484 1.00 97.36  ? 48  ALA D CB  1 
ATOM 1547 N N   . SER B 1 49  ? 193.113 76.922  113.114 1.00 120.42 ? 49  SER D N   1 
ATOM 1548 C CA  . SER B 1 49  ? 193.788 75.724  112.640 1.00 120.42 ? 49  SER D CA  1 
ATOM 1549 C C   . SER B 1 49  ? 195.266 75.924  112.815 1.00 120.42 ? 49  SER D C   1 
ATOM 1550 O O   . SER B 1 49  ? 195.695 76.998  113.235 1.00 120.42 ? 49  SER D O   1 
ATOM 1551 C CB  . SER B 1 49  ? 193.518 75.490  111.158 1.00 55.99  ? 49  SER D CB  1 
ATOM 1552 O OG  . SER B 1 49  ? 194.431 76.232  110.375 1.00 55.99  ? 49  SER D OG  1 
ATOM 1553 N N   . PRO B 1 50  ? 196.065 74.886  112.494 1.00 116.40 ? 50  PRO D N   1 
ATOM 1554 C CA  . PRO B 1 50  ? 197.520 74.963  112.609 1.00 116.40 ? 50  PRO D CA  1 
ATOM 1555 C C   . PRO B 1 50  ? 198.014 76.043  111.664 1.00 116.40 ? 50  PRO D C   1 
ATOM 1556 O O   . PRO B 1 50  ? 198.716 76.968  112.060 1.00 116.40 ? 50  PRO D O   1 
ATOM 1557 C CB  . PRO B 1 50  ? 197.975 73.577  112.161 1.00 127.31 ? 50  PRO D CB  1 
ATOM 1558 C CG  . PRO B 1 50  ? 196.880 72.700  112.636 1.00 127.31 ? 50  PRO D CG  1 
ATOM 1559 C CD  . PRO B 1 50  ? 195.659 73.499  112.193 1.00 127.31 ? 50  PRO D CD  1 
ATOM 1560 N N   . HIS B 1 51  ? 197.641 75.908  110.401 1.00 48.73  ? 51  HIS D N   1 
ATOM 1561 C CA  . HIS B 1 51  ? 198.030 76.876  109.390 1.00 48.73  ? 51  HIS D CA  1 
ATOM 1562 C C   . HIS B 1 51  ? 198.029 78.277  109.979 1.00 48.73  ? 51  HIS D C   1 
ATOM 1563 O O   . HIS B 1 51  ? 199.082 78.885  110.119 1.00 48.73  ? 51  HIS D O   1 
ATOM 1564 C CB  . HIS B 1 51  ? 197.070 76.787  108.215 1.00 121.73 ? 51  HIS D CB  1 
ATOM 1565 C CG  . HIS B 1 51  ? 197.284 75.579  107.355 1.00 121.73 ? 51  HIS D CG  1 
ATOM 1566 N ND1 . HIS B 1 51  ? 198.339 75.470  106.475 1.00 121.73 ? 51  HIS D ND1 1 
ATOM 1567 C CD2 . HIS B 1 51  ? 196.586 74.421  107.248 1.00 121.73 ? 51  HIS D CD2 1 
ATOM 1568 C CE1 . HIS B 1 51  ? 198.282 74.300  105.862 1.00 121.73 ? 51  HIS D CE1 1 
ATOM 1569 N NE2 . HIS B 1 51  ? 197.229 73.643  106.312 1.00 121.73 ? 51  HIS D NE2 1 
ATOM 1570 N N   . HIS B 1 52  ? 196.855 78.778  110.351 1.00 78.66  ? 52  HIS D N   1 
ATOM 1571 C CA  . HIS B 1 52  ? 196.754 80.113  110.945 1.00 78.66  ? 52  HIS D CA  1 
ATOM 1572 C C   . HIS B 1 52  ? 197.863 80.349  111.957 1.00 78.66  ? 52  HIS D C   1 
ATOM 1573 O O   . HIS B 1 52  ? 198.708 81.241  111.808 1.00 78.66  ? 52  HIS D O   1 
ATOM 1574 C CB  . HIS B 1 52  ? 195.405 80.269  111.640 1.00 107.71 ? 52  HIS D CB  1 
ATOM 1575 C CG  . HIS B 1 52  ? 194.252 80.042  110.727 1.00 107.71 ? 52  HIS D CG  1 
ATOM 1576 N ND1 . HIS B 1 52  ? 193.926 78.793  110.250 1.00 107.71 ? 52  HIS D ND1 1 
ATOM 1577 C CD2 . HIS B 1 52  ? 193.413 80.913  110.119 1.00 107.71 ? 52  HIS D CD2 1 
ATOM 1578 C CE1 . HIS B 1 52  ? 192.937 78.904  109.381 1.00 107.71 ? 52  HIS D CE1 1 
ATOM 1579 N NE2 . HIS B 1 52  ? 192.608 80.180  109.283 1.00 107.71 ? 52  HIS D NE2 1 
ATOM 1580 N N   . THR B 1 53  ? 197.824 79.528  112.997 1.00 97.72  ? 53  THR D N   1 
ATOM 1581 C CA  . THR B 1 53  ? 198.784 79.559  114.083 1.00 97.72  ? 53  THR D CA  1 
ATOM 1582 C C   . THR B 1 53  ? 200.173 79.833  113.545 1.00 97.72  ? 53  THR D C   1 
ATOM 1583 O O   . THR B 1 53  ? 200.868 80.733  114.009 1.00 97.72  ? 53  THR D O   1 
ATOM 1584 C CB  . THR B 1 53  ? 198.793 78.211  114.802 1.00 151.92 ? 53  THR D CB  1 
ATOM 1585 O OG1 . THR B 1 53  ? 197.453 77.865  115.192 1.00 151.92 ? 53  THR D OG1 1 
ATOM 1586 C CG2 . THR B 1 53  ? 199.689 78.269  116.016 1.00 151.92 ? 53  THR D CG2 1 
ATOM 1587 N N   . ALA B 1 54  ? 200.558 79.044  112.549 1.00 68.84  ? 54  ALA D N   1 
ATOM 1588 C CA  . ALA B 1 54  ? 201.864 79.156  111.909 1.00 68.84  ? 54  ALA D CA  1 
ATOM 1589 C C   . ALA B 1 54  ? 202.192 80.591  111.542 1.00 68.84  ? 54  ALA D C   1 
ATOM 1590 O O   . ALA B 1 54  ? 202.958 81.257  112.233 1.00 68.84  ? 54  ALA D O   1 
ATOM 1591 C CB  . ALA B 1 54  ? 201.913 78.277  110.660 1.00 71.33  ? 54  ALA D CB  1 
ATOM 1592 N N   . LEU B 1 55  ? 201.613 81.051  110.441 1.00 71.22  ? 55  LEU D N   1 
ATOM 1593 C CA  . LEU B 1 55  ? 201.807 82.406  109.943 1.00 71.22  ? 55  LEU D CA  1 
ATOM 1594 C C   . LEU B 1 55  ? 202.250 83.373  110.986 1.00 71.22  ? 55  LEU D C   1 
ATOM 1595 O O   . LEU B 1 55  ? 203.414 83.763  111.045 1.00 71.22  ? 55  LEU D O   1 
ATOM 1596 C CB  . LEU B 1 55  ? 200.517 82.936  109.371 1.00 47.12  ? 55  LEU D CB  1 
ATOM 1597 C CG  . LEU B 1 55  ? 200.233 82.207  108.081 1.00 47.12  ? 55  LEU D CG  1 
ATOM 1598 C CD1 . LEU B 1 55  ? 199.895 80.761  108.360 1.00 47.12  ? 55  LEU D CD1 1 
ATOM 1599 C CD2 . LEU B 1 55  ? 199.109 82.896  107.397 1.00 47.12  ? 55  LEU D CD2 1 
ATOM 1600 N N   . ARG B 1 56  ? 201.275 83.781  111.781 1.00 75.30  ? 56  ARG D N   1 
ATOM 1601 C CA  . ARG B 1 56  ? 201.477 84.705  112.868 1.00 75.30  ? 56  ARG D CA  1 
ATOM 1602 C C   . ARG B 1 56  ? 202.951 84.723  113.345 1.00 75.30  ? 56  ARG D C   1 
ATOM 1603 O O   . ARG B 1 56  ? 203.638 85.758  113.259 1.00 75.30  ? 56  ARG D O   1 
ATOM 1604 C CB  . ARG B 1 56  ? 200.508 84.301  113.983 1.00 127.34 ? 56  ARG D CB  1 
ATOM 1605 C CG  . ARG B 1 56  ? 199.145 83.835  113.430 1.00 127.34 ? 56  ARG D CG  1 
ATOM 1606 C CD  . ARG B 1 56  ? 198.066 83.707  114.508 1.00 127.34 ? 56  ARG D CD  1 
ATOM 1607 N NE  . ARG B 1 56  ? 196.766 83.314  113.955 1.00 127.34 ? 56  ARG D NE  1 
ATOM 1608 C CZ  . ARG B 1 56  ? 195.618 83.350  114.628 1.00 127.34 ? 56  ARG D CZ  1 
ATOM 1609 N NH1 . ARG B 1 56  ? 195.599 83.765  115.887 1.00 127.34 ? 56  ARG D NH1 1 
ATOM 1610 N NH2 . ARG B 1 56  ? 194.485 82.966  114.048 1.00 127.34 ? 56  ARG D NH2 1 
ATOM 1611 N N   . GLN B 1 57  ? 203.432 83.568  113.814 1.00 125.41 ? 57  GLN D N   1 
ATOM 1612 C CA  . GLN B 1 57  ? 204.809 83.398  114.311 1.00 125.41 ? 57  GLN D CA  1 
ATOM 1613 C C   . GLN B 1 57  ? 205.842 83.918  113.322 1.00 125.41 ? 57  GLN D C   1 
ATOM 1614 O O   . GLN B 1 57  ? 206.845 84.532  113.695 1.00 125.41 ? 57  GLN D O   1 
ATOM 1615 C CB  . GLN B 1 57  ? 205.080 81.917  114.567 1.00 132.13 ? 57  GLN D CB  1 
ATOM 1616 C CG  . GLN B 1 57  ? 204.025 81.249  115.426 1.00 132.13 ? 57  GLN D CG  1 
ATOM 1617 C CD  . GLN B 1 57  ? 204.122 81.660  116.873 1.00 132.13 ? 57  GLN D CD  1 
ATOM 1618 O OE1 . GLN B 1 57  ? 205.154 81.450  117.510 1.00 132.13 ? 57  GLN D OE1 1 
ATOM 1619 N NE2 . GLN B 1 57  ? 203.049 82.249  117.406 1.00 132.13 ? 57  GLN D NE2 1 
ATOM 1620 N N   . ALA B 1 58  ? 205.573 83.633  112.057 1.00 70.18  ? 58  ALA D N   1 
ATOM 1621 C CA  . ALA B 1 58  ? 206.407 84.029  110.943 1.00 70.18  ? 58  ALA D CA  1 
ATOM 1622 C C   . ALA B 1 58  ? 206.438 85.541  110.775 1.00 70.18  ? 58  ALA D C   1 
ATOM 1623 O O   . ALA B 1 58  ? 207.493 86.176  110.791 1.00 70.18  ? 58  ALA D O   1 
ATOM 1624 C CB  . ALA B 1 58  ? 205.874 83.390  109.691 1.00 50.34  ? 58  ALA D CB  1 
ATOM 1625 N N   . ILE B 1 59  ? 205.267 86.119  110.597 1.00 70.15  ? 59  ILE D N   1 
ATOM 1626 C CA  . ILE B 1 59  ? 205.183 87.549  110.418 1.00 70.15  ? 59  ILE D CA  1 
ATOM 1627 C C   . ILE B 1 59  ? 205.856 88.298  111.541 1.00 70.15  ? 59  ILE D C   1 
ATOM 1628 O O   . ILE B 1 59  ? 206.626 89.221  111.306 1.00 70.15  ? 59  ILE D O   1 
ATOM 1629 C CB  . ILE B 1 59  ? 203.737 88.028  110.378 1.00 35.98  ? 59  ILE D CB  1 
ATOM 1630 C CG1 . ILE B 1 59  ? 203.026 87.442  109.163 1.00 35.98  ? 59  ILE D CG1 1 
ATOM 1631 C CG2 . ILE B 1 59  ? 203.705 89.555  110.384 1.00 35.98  ? 59  ILE D CG2 1 
ATOM 1632 C CD1 . ILE B 1 59  ? 202.836 85.964  109.251 1.00 35.98  ? 59  ILE D CD1 1 
ATOM 1633 N N   . LEU B 1 60  ? 205.550 87.908  112.767 1.00 114.56 ? 60  LEU D N   1 
ATOM 1634 C CA  . LEU B 1 60  ? 206.121 88.603  113.888 1.00 114.56 ? 60  LEU D CA  1 
ATOM 1635 C C   . LEU B 1 60  ? 207.620 88.467  114.000 1.00 114.56 ? 60  LEU D C   1 
ATOM 1636 O O   . LEU B 1 60  ? 208.303 89.457  114.241 1.00 114.56 ? 60  LEU D O   1 
ATOM 1637 C CB  . LEU B 1 60  ? 205.406 88.196  115.165 1.00 129.69 ? 60  LEU D CB  1 
ATOM 1638 C CG  . LEU B 1 60  ? 204.020 88.841  115.052 1.00 129.69 ? 60  LEU D CG  1 
ATOM 1639 C CD1 . LEU B 1 60  ? 203.236 88.630  116.312 1.00 129.69 ? 60  LEU D CD1 1 
ATOM 1640 C CD2 . LEU B 1 60  ? 204.169 90.339  114.797 1.00 129.69 ? 60  LEU D CD2 1 
ATOM 1641 N N   . ALA B 1 61  ? 208.157 87.268  113.819 1.00 114.64 ? 61  ALA D N   1 
ATOM 1642 C CA  . ALA B 1 61  ? 209.609 87.138  113.876 1.00 114.64 ? 61  ALA D CA  1 
ATOM 1643 C C   . ALA B 1 61  ? 210.190 88.015  112.749 1.00 114.64 ? 61  ALA D C   1 
ATOM 1644 O O   . ALA B 1 61  ? 211.283 88.571  112.879 1.00 114.64 ? 61  ALA D O   1 
ATOM 1645 C CB  . ALA B 1 61  ? 210.022 85.671  113.697 1.00 137.71 ? 61  ALA D CB  1 
ATOM 1646 N N   . TRP B 1 62  ? 209.428 88.145  111.661 1.00 61.19  ? 62  TRP D N   1 
ATOM 1647 C CA  . TRP B 1 62  ? 209.811 88.949  110.499 1.00 61.19  ? 62  TRP D CA  1 
ATOM 1648 C C   . TRP B 1 62  ? 209.511 90.427  110.724 1.00 61.19  ? 62  TRP D C   1 
ATOM 1649 O O   . TRP B 1 62  ? 210.231 91.303  110.236 1.00 61.19  ? 62  TRP D O   1 
ATOM 1650 C CB  . TRP B 1 62  ? 209.074 88.459  109.246 1.00 115.14 ? 62  TRP D CB  1 
ATOM 1651 C CG  . TRP B 1 62  ? 209.060 89.452  108.091 1.00 115.14 ? 62  TRP D CG  1 
ATOM 1652 C CD1 . TRP B 1 62  ? 208.148 90.450  107.877 1.00 115.14 ? 62  TRP D CD1 1 
ATOM 1653 C CD2 . TRP B 1 62  ? 209.995 89.529  106.999 1.00 115.14 ? 62  TRP D CD2 1 
ATOM 1654 N NE1 . TRP B 1 62  ? 208.455 91.137  106.722 1.00 115.14 ? 62  TRP D NE1 1 
ATOM 1655 C CE2 . TRP B 1 62  ? 209.582 90.593  106.163 1.00 115.14 ? 62  TRP D CE2 1 
ATOM 1656 C CE3 . TRP B 1 62  ? 211.140 88.802  106.645 1.00 115.14 ? 62  TRP D CE3 1 
ATOM 1657 C CZ2 . TRP B 1 62  ? 210.274 90.948  104.999 1.00 115.14 ? 62  TRP D CZ2 1 
ATOM 1658 C CZ3 . TRP B 1 62  ? 211.831 89.157  105.485 1.00 115.14 ? 62  TRP D CZ3 1 
ATOM 1659 C CH2 . TRP B 1 62  ? 211.391 90.220  104.678 1.00 115.14 ? 62  TRP D CH2 1 
ATOM 1660 N N   . GLY B 1 63  ? 208.434 90.701  111.453 1.00 144.79 ? 63  GLY D N   1 
ATOM 1661 C CA  . GLY B 1 63  ? 208.076 92.072  111.754 1.00 144.79 ? 63  GLY D CA  1 
ATOM 1662 C C   . GLY B 1 63  ? 209.132 92.638  112.685 1.00 144.79 ? 63  GLY D C   1 
ATOM 1663 O O   . GLY B 1 63  ? 209.286 93.852  112.792 1.00 144.79 ? 63  GLY D O   1 
ATOM 1664 N N   . ASP B 1 64  ? 209.844 91.743  113.372 1.00 86.02  ? 64  ASP D N   1 
ATOM 1665 C CA  . ASP B 1 64  ? 210.924 92.115  114.284 1.00 86.02  ? 64  ASP D CA  1 
ATOM 1666 C C   . ASP B 1 64  ? 212.170 92.364  113.434 1.00 86.02  ? 64  ASP D C   1 
ATOM 1667 O O   . ASP B 1 64  ? 213.139 92.973  113.890 1.00 86.02  ? 64  ASP D O   1 
ATOM 1668 C CB  . ASP B 1 64  ? 211.222 90.989  115.287 1.00 148.87 ? 64  ASP D CB  1 
ATOM 1669 C CG  . ASP B 1 64  ? 210.209 90.916  116.425 1.00 148.87 ? 64  ASP D CG  1 
ATOM 1670 O OD1 . ASP B 1 64  ? 209.709 91.982  116.867 1.00 148.87 ? 64  ASP D OD1 1 
ATOM 1671 O OD2 . ASP B 1 64  ? 209.939 89.779  116.889 1.00 148.87 ? 64  ASP D OD2 1 
ATOM 1672 N N   . LEU B 1 65  ? 212.129 91.883  112.194 1.00 84.16  ? 65  LEU D N   1 
ATOM 1673 C CA  . LEU B 1 65  ? 213.232 92.047  111.251 1.00 84.16  ? 65  LEU D CA  1 
ATOM 1674 C C   . LEU B 1 65  ? 213.116 93.339  110.475 1.00 84.16  ? 65  LEU D C   1 
ATOM 1675 O O   . LEU B 1 65  ? 214.106 94.041  110.299 1.00 84.16  ? 65  LEU D O   1 
ATOM 1676 C CB  . LEU B 1 65  ? 213.268 90.884  110.284 1.00 71.82  ? 65  LEU D CB  1 
ATOM 1677 C CG  . LEU B 1 65  ? 213.450 89.596  111.072 1.00 71.82  ? 65  LEU D CG  1 
ATOM 1678 C CD1 . LEU B 1 65  ? 213.413 88.434  110.122 1.00 71.82  ? 65  LEU D CD1 1 
ATOM 1679 C CD2 . LEU B 1 65  ? 214.757 89.638  111.843 1.00 71.82  ? 65  LEU D CD2 1 
ATOM 1680 N N   . MET B 1 66  ? 211.915 93.646  109.992 1.00 158.01 ? 66  MET D N   1 
ATOM 1681 C CA  . MET B 1 66  ? 211.712 94.899  109.279 1.00 158.01 ? 66  MET D CA  1 
ATOM 1682 C C   . MET B 1 66  ? 211.588 96.043  110.304 1.00 158.01 ? 66  MET D C   1 
ATOM 1683 O O   . MET B 1 66  ? 211.494 97.217  109.933 1.00 158.01 ? 66  MET D O   1 
ATOM 1684 C CB  . MET B 1 66  ? 210.474 94.837  108.374 1.00 144.92 ? 66  MET D CB  1 
ATOM 1685 C CG  . MET B 1 66  ? 210.778 94.463  106.916 1.00 144.92 ? 66  MET D CG  1 
ATOM 1686 S SD  . MET B 1 66  ? 209.404 94.835  105.757 1.00 144.92 ? 66  MET D SD  1 
ATOM 1687 C CE  . MET B 1 66  ? 210.052 96.243  104.842 1.00 144.92 ? 66  MET D CE  1 
ATOM 1688 N N   . THR B 1 67  ? 211.579 95.688  111.592 1.00 140.47 ? 67  THR D N   1 
ATOM 1689 C CA  . THR B 1 67  ? 211.531 96.669  112.688 1.00 140.47 ? 67  THR D CA  1 
ATOM 1690 C C   . THR B 1 67  ? 212.988 96.739  113.156 1.00 140.47 ? 67  THR D C   1 
ATOM 1691 O O   . THR B 1 67  ? 213.374 97.609  113.928 1.00 140.47 ? 67  THR D O   1 
ATOM 1692 C CB  . THR B 1 67  ? 210.591 96.211  113.881 1.00 125.48 ? 67  THR D CB  1 
ATOM 1693 O OG1 . THR B 1 67  ? 209.221 96.212  113.454 1.00 125.48 ? 67  THR D OG1 1 
ATOM 1694 C CG2 . THR B 1 67  ? 210.715 97.152  115.086 1.00 125.48 ? 67  THR D CG2 1 
ATOM 1695 N N   . LEU B 1 68  ? 213.785 95.793  112.664 1.00 111.94 ? 68  LEU D N   1 
ATOM 1696 C CA  . LEU B 1 68  ? 215.209 95.712  112.959 1.00 111.94 ? 68  LEU D CA  1 
ATOM 1697 C C   . LEU B 1 68  ? 215.937 96.359  111.804 1.00 111.94 ? 68  LEU D C   1 
ATOM 1698 O O   . LEU B 1 68  ? 216.659 97.335  111.974 1.00 111.94 ? 68  LEU D O   1 
ATOM 1699 C CB  . LEU B 1 68  ? 215.689 94.265  113.033 1.00 68.88  ? 68  LEU D CB  1 
ATOM 1700 C CG  . LEU B 1 68  ? 217.227 94.194  112.923 1.00 68.88  ? 68  LEU D CG  1 
ATOM 1701 C CD1 . LEU B 1 68  ? 217.820 94.687  114.240 1.00 68.88  ? 68  LEU D CD1 1 
ATOM 1702 C CD2 . LEU B 1 68  ? 217.716 92.794  112.630 1.00 68.88  ? 68  LEU D CD2 1 
ATOM 1703 N N   . ALA B 1 69  ? 215.749 95.769  110.628 1.00 140.83 ? 69  ALA D N   1 
ATOM 1704 C CA  . ALA B 1 69  ? 216.353 96.238  109.384 1.00 140.83 ? 69  ALA D CA  1 
ATOM 1705 C C   . ALA B 1 69  ? 216.439 97.757  109.293 1.00 140.83 ? 69  ALA D C   1 
ATOM 1706 O O   . ALA B 1 69  ? 217.359 98.294  108.671 1.00 140.83 ? 69  ALA D O   1 
ATOM 1707 C CB  . ALA B 1 69  ? 215.562 95.707  108.194 1.00 161.57 ? 69  ALA D CB  1 
ATOM 1708 N N   . THR B 1 70  ? 215.468 98.442  109.895 1.00 200.00 ? 70  THR D N   1 
ATOM 1709 C CA  . THR B 1 70  ? 215.436 99.902  109.894 1.00 200.00 ? 70  THR D CA  1 
ATOM 1710 C C   . THR B 1 70  ? 215.940 100.452 111.251 1.00 200.00 ? 70  THR D C   1 
ATOM 1711 O O   . THR B 1 70  ? 215.285 101.267 111.903 1.00 200.00 ? 70  THR D O   1 
ATOM 1712 C CB  . THR B 1 70  ? 213.994 100.428 109.537 1.00 100.79 ? 70  THR D CB  1 
ATOM 1713 O OG1 . THR B 1 70  ? 213.032 99.903  110.464 1.00 100.79 ? 70  THR D OG1 1 
ATOM 1714 C CG2 . THR B 1 70  ? 213.606 100.000 108.097 1.00 100.79 ? 70  THR D CG2 1 
ATOM 1715 N N   . TRP B 1 71  ? 217.123 99.970  111.646 1.00 146.47 ? 71  TRP D N   1 
ATOM 1716 C CA  . TRP B 1 71  ? 217.839 100.334 112.880 1.00 146.47 ? 71  TRP D CA  1 
ATOM 1717 C C   . TRP B 1 71  ? 219.299 99.995  112.542 1.00 146.47 ? 71  TRP D C   1 
ATOM 1718 O O   . TRP B 1 71  ? 220.232 100.281 113.296 1.00 146.47 ? 71  TRP D O   1 
ATOM 1719 C CB  . TRP B 1 71  ? 217.362 99.475  114.062 1.00 167.60 ? 71  TRP D CB  1 
ATOM 1720 C CG  . TRP B 1 71  ? 217.880 99.885  115.440 1.00 167.60 ? 71  TRP D CG  1 
ATOM 1721 C CD1 . TRP B 1 71  ? 217.343 100.830 116.282 1.00 167.60 ? 71  TRP D CD1 1 
ATOM 1722 C CD2 . TRP B 1 71  ? 218.997 99.315  116.144 1.00 167.60 ? 71  TRP D CD2 1 
ATOM 1723 N NE1 . TRP B 1 71  ? 218.053 100.874 117.465 1.00 167.60 ? 71  TRP D NE1 1 
ATOM 1724 C CE2 . TRP B 1 71  ? 219.072 99.956  117.407 1.00 167.60 ? 71  TRP D CE2 1 
ATOM 1725 C CE3 . TRP B 1 71  ? 219.943 98.323  115.830 1.00 167.60 ? 71  TRP D CE3 1 
ATOM 1726 C CZ2 . TRP B 1 71  ? 220.056 99.634  118.358 1.00 167.60 ? 71  TRP D CZ2 1 
ATOM 1727 C CZ3 . TRP B 1 71  ? 220.923 98.003  116.776 1.00 167.60 ? 71  TRP D CZ3 1 
ATOM 1728 C CH2 . TRP B 1 71  ? 220.969 98.659  118.025 1.00 167.60 ? 71  TRP D CH2 1 
ATOM 1729 N N   . VAL B 1 72  ? 219.459 99.368  111.379 1.00 199.43 ? 72  VAL D N   1 
ATOM 1730 C CA  . VAL B 1 72  ? 220.752 98.962  110.840 1.00 199.43 ? 72  VAL D CA  1 
ATOM 1731 C C   . VAL B 1 72  ? 221.223 100.103 109.932 1.00 199.43 ? 72  VAL D C   1 
ATOM 1732 O O   . VAL B 1 72  ? 222.324 100.077 109.374 1.00 199.43 ? 72  VAL D O   1 
ATOM 1733 C CB  . VAL B 1 72  ? 220.611 97.666  109.996 1.00 105.27 ? 72  VAL D CB  1 
ATOM 1734 C CG1 . VAL B 1 72  ? 221.981 97.152  109.584 1.00 105.27 ? 72  VAL D CG1 1 
ATOM 1735 C CG2 . VAL B 1 72  ? 219.833 96.612  110.779 1.00 105.27 ? 72  VAL D CG2 1 
ATOM 1736 N N   . GLY B 1 73  ? 220.353 101.099 109.787 1.00 162.68 ? 73  GLY D N   1 
ATOM 1737 C CA  . GLY B 1 73  ? 220.657 102.262 108.976 1.00 162.68 ? 73  GLY D CA  1 
ATOM 1738 C C   . GLY B 1 73  ? 220.663 103.511 109.846 1.00 162.68 ? 73  GLY D C   1 
ATOM 1739 O O   . GLY B 1 73  ? 221.205 104.543 109.440 1.00 162.68 ? 73  GLY D O   1 
ATOM 1740 N N   . THR B 1 74  ? 220.059 103.412 111.037 1.00 200.00 ? 74  THR D N   1 
ATOM 1741 C CA  . THR B 1 74  ? 219.982 104.523 112.007 1.00 200.00 ? 74  THR D CA  1 
ATOM 1742 C C   . THR B 1 74  ? 221.281 104.629 112.811 1.00 200.00 ? 74  THR D C   1 
ATOM 1743 O O   . THR B 1 74  ? 221.997 105.635 112.741 1.00 200.00 ? 74  THR D O   1 
ATOM 1744 C CB  . THR B 1 74  ? 218.786 104.341 113.030 1.00 88.42  ? 74  THR D CB  1 
ATOM 1745 O OG1 . THR B 1 74  ? 217.531 104.443 112.341 1.00 88.42  ? 74  THR D OG1 1 
ATOM 1746 C CG2 . THR B 1 74  ? 218.835 105.411 114.146 1.00 88.42  ? 74  THR D CG2 1 
ATOM 1747 N N   . ASN B 1 75  ? 221.576 103.578 113.572 1.00 193.06 ? 75  ASN D N   1 
ATOM 1748 C CA  . ASN B 1 75  ? 222.770 103.531 114.404 1.00 193.06 ? 75  ASN D CA  1 
ATOM 1749 C C   . ASN B 1 75  ? 223.929 102.810 113.713 1.00 193.06 ? 75  ASN D C   1 
ATOM 1750 O O   . ASN B 1 75  ? 224.657 102.051 114.349 1.00 193.06 ? 75  ASN D O   1 
ATOM 1751 C CB  . ASN B 1 75  ? 222.438 102.846 115.738 1.00 127.95 ? 75  ASN D CB  1 
ATOM 1752 C CG  . ASN B 1 75  ? 221.486 103.671 116.605 1.00 127.95 ? 75  ASN D CG  1 
ATOM 1753 O OD1 . ASN B 1 75  ? 221.856 104.730 117.115 1.00 127.95 ? 75  ASN D OD1 1 
ATOM 1754 N ND2 . ASN B 1 75  ? 220.256 103.189 116.771 1.00 127.95 ? 75  ASN D ND2 1 
ATOM 1755 N N   . LEU B 1 76  ? 224.097 103.062 112.415 1.00 200.00 ? 76  LEU D N   1 
ATOM 1756 C CA  . LEU B 1 76  ? 225.166 102.446 111.620 1.00 200.00 ? 76  LEU D CA  1 
ATOM 1757 C C   . LEU B 1 76  ? 225.314 103.057 110.224 1.00 200.00 ? 76  LEU D C   1 
ATOM 1758 O O   . LEU B 1 76  ? 224.380 103.017 109.418 1.00 200.00 ? 76  LEU D O   1 
ATOM 1759 C CB  . LEU B 1 76  ? 224.924 100.941 111.481 1.00 158.68 ? 76  LEU D CB  1 
ATOM 1760 C CG  . LEU B 1 76  ? 225.510 100.078 112.597 1.00 158.68 ? 76  LEU D CG  1 
ATOM 1761 C CD1 . LEU B 1 76  ? 224.805 98.738  112.639 1.00 158.68 ? 76  LEU D CD1 1 
ATOM 1762 C CD2 . LEU B 1 76  ? 227.003 99.918  112.376 1.00 158.68 ? 76  LEU D CD2 1 
ATOM 1763 N N   . GLU B 1 77  ? 226.494 103.616 109.949 1.00 200.00 ? 77  GLU D N   1 
ATOM 1764 C CA  . GLU B 1 77  ? 226.794 104.236 108.655 1.00 200.00 ? 77  GLU D CA  1 
ATOM 1765 C C   . GLU B 1 77  ? 228.266 104.007 108.290 1.00 200.00 ? 77  GLU D C   1 
ATOM 1766 O O   . GLU B 1 77  ? 228.954 104.924 107.834 1.00 200.00 ? 77  GLU D O   1 
ATOM 1767 C CB  . GLU B 1 77  ? 226.485 105.750 108.694 1.00 154.16 ? 77  GLU D CB  1 
ATOM 1768 C CG  . GLU B 1 77  ? 227.435 106.636 109.532 1.00 154.16 ? 77  GLU D CG  1 
ATOM 1769 C CD  . GLU B 1 77  ? 227.167 106.599 111.034 1.00 154.16 ? 77  GLU D CD  1 
ATOM 1770 O OE1 . GLU B 1 77  ? 226.089 106.126 111.450 1.00 154.16 ? 77  GLU D OE1 1 
ATOM 1771 O OE2 . GLU B 1 77  ? 228.034 107.066 111.802 1.00 154.16 ? 77  GLU D OE2 1 
ATOM 1772 N N   . ASP B 1 78  ? 228.734 102.772 108.470 1.00 200.00 ? 78  ASP D N   1 
ATOM 1773 C CA  . ASP B 1 78  ? 230.130 102.438 108.201 1.00 200.00 ? 78  ASP D CA  1 
ATOM 1774 C C   . ASP B 1 78  ? 230.495 102.286 106.710 1.00 200.00 ? 78  ASP D C   1 
ATOM 1775 O O   . ASP B 1 78  ? 230.558 103.290 105.999 1.00 200.00 ? 78  ASP D O   1 
ATOM 1776 C CB  . ASP B 1 78  ? 230.514 101.203 109.021 1.00 188.27 ? 78  ASP D CB  1 
ATOM 1777 C CG  . ASP B 1 78  ? 229.977 101.260 110.437 1.00 188.27 ? 78  ASP D CG  1 
ATOM 1778 O OD1 . ASP B 1 78  ? 230.183 102.290 111.116 1.00 188.27 ? 78  ASP D OD1 1 
ATOM 1779 O OD2 . ASP B 1 78  ? 229.354 100.271 110.874 1.00 188.27 ? 78  ASP D OD2 1 
ATOM 1780 N N   . PRO B 1 79  ? 230.742 101.057 106.205 1.00 199.43 ? 79  PRO D N   1 
ATOM 1781 C CA  . PRO B 1 79  ? 231.079 101.090 104.775 1.00 199.43 ? 79  PRO D CA  1 
ATOM 1782 C C   . PRO B 1 79  ? 229.845 101.202 103.874 1.00 199.43 ? 79  PRO D C   1 
ATOM 1783 O O   . PRO B 1 79  ? 228.785 101.660 104.311 1.00 199.43 ? 79  PRO D O   1 
ATOM 1784 C CB  . PRO B 1 79  ? 231.842 99.780  104.577 1.00 162.89 ? 79  PRO D CB  1 
ATOM 1785 C CG  . PRO B 1 79  ? 231.116 98.854  105.487 1.00 162.89 ? 79  PRO D CG  1 
ATOM 1786 C CD  . PRO B 1 79  ? 230.859 99.683  106.737 1.00 162.89 ? 79  PRO D CD  1 
ATOM 1787 N N   . ALA B 1 80  ? 229.992 100.803 102.613 1.00 198.53 ? 80  ALA D N   1 
ATOM 1788 C CA  . ALA B 1 80  ? 228.880 100.836 101.668 1.00 198.53 ? 80  ALA D CA  1 
ATOM 1789 C C   . ALA B 1 80  ? 228.079 99.540  101.857 1.00 198.53 ? 80  ALA D C   1 
ATOM 1790 O O   . ALA B 1 80  ? 227.502 99.009  100.901 1.00 198.53 ? 80  ALA D O   1 
ATOM 1791 C CB  . ALA B 1 80  ? 229.409 100.933 100.228 1.00 53.39  ? 80  ALA D CB  1 
ATOM 1792 N N   . SER B 1 81  ? 228.042 99.045  103.100 1.00 200.00 ? 81  SER D N   1 
ATOM 1793 C CA  . SER B 1 81  ? 227.335 97.797  103.425 1.00 200.00 ? 81  SER D CA  1 
ATOM 1794 C C   . SER B 1 81  ? 226.292 97.771  104.578 1.00 200.00 ? 81  SER D C   1 
ATOM 1795 O O   . SER B 1 81  ? 225.931 96.689  105.029 1.00 200.00 ? 81  SER D O   1 
ATOM 1796 C CB  . SER B 1 81  ? 228.359 96.661  103.642 1.00 166.32 ? 81  SER D CB  1 
ATOM 1797 O OG  . SER B 1 81  ? 229.015 96.757  104.904 1.00 166.32 ? 81  SER D OG  1 
ATOM 1798 N N   . ARG B 1 82  ? 225.814 98.920  105.068 1.00 194.71 ? 82  ARG D N   1 
ATOM 1799 C CA  . ARG B 1 82  ? 224.772 98.894  106.102 1.00 194.71 ? 82  ARG D CA  1 
ATOM 1800 C C   . ARG B 1 82  ? 223.539 98.687  105.224 1.00 194.71 ? 82  ARG D C   1 
ATOM 1801 O O   . ARG B 1 82  ? 222.400 98.689  105.689 1.00 194.71 ? 82  ARG D O   1 
ATOM 1802 C CB  . ARG B 1 82  ? 224.694 100.228 106.865 1.00 165.01 ? 82  ARG D CB  1 
ATOM 1803 C CG  . ARG B 1 82  ? 224.370 101.417 105.975 1.00 165.01 ? 82  ARG D CG  1 
ATOM 1804 C CD  . ARG B 1 82  ? 224.449 102.714 106.746 1.00 165.01 ? 82  ARG D CD  1 
ATOM 1805 N NE  . ARG B 1 82  ? 224.712 103.866 105.884 1.00 165.01 ? 82  ARG D NE  1 
ATOM 1806 C CZ  . ARG B 1 82  ? 225.835 104.046 105.191 1.00 165.01 ? 82  ARG D CZ  1 
ATOM 1807 N NH1 . ARG B 1 82  ? 226.813 103.152 105.252 1.00 165.01 ? 82  ARG D NH1 1 
ATOM 1808 N NH2 . ARG B 1 82  ? 225.981 105.123 104.432 1.00 165.01 ? 82  ARG D NH2 1 
ATOM 1809 N N   . ASP B 1 83  ? 223.833 98.546  103.925 1.00 200.00 ? 83  ASP D N   1 
ATOM 1810 C CA  . ASP B 1 83  ? 222.877 98.295  102.833 1.00 200.00 ? 83  ASP D CA  1 
ATOM 1811 C C   . ASP B 1 83  ? 223.040 96.846  102.312 1.00 200.00 ? 83  ASP D C   1 
ATOM 1812 O O   . ASP B 1 83  ? 222.110 96.288  101.728 1.00 200.00 ? 83  ASP D O   1 
ATOM 1813 C CB  . ASP B 1 83  ? 223.117 99.247  101.635 1.00 142.45 ? 83  ASP D CB  1 
ATOM 1814 C CG  . ASP B 1 83  ? 222.671 100.682 101.895 1.00 142.45 ? 83  ASP D CG  1 
ATOM 1815 O OD1 . ASP B 1 83  ? 221.921 100.931 102.863 1.00 142.45 ? 83  ASP D OD1 1 
ATOM 1816 O OD2 . ASP B 1 83  ? 223.068 101.564 101.103 1.00 142.45 ? 83  ASP D OD2 1 
ATOM 1817 N N   . LEU B 1 84  ? 224.220 96.250  102.524 1.00 200.00 ? 84  LEU D N   1 
ATOM 1818 C CA  . LEU B 1 84  ? 224.518 94.879  102.069 1.00 200.00 ? 84  LEU D CA  1 
ATOM 1819 C C   . LEU B 1 84  ? 223.860 93.795  102.944 1.00 200.00 ? 84  LEU D C   1 
ATOM 1820 O O   . LEU B 1 84  ? 223.792 92.619  102.562 1.00 200.00 ? 84  LEU D O   1 
ATOM 1821 C CB  . LEU B 1 84  ? 226.048 94.649  101.997 1.00 124.45 ? 84  LEU D CB  1 
ATOM 1822 C CG  . LEU B 1 84  ? 226.522 93.399  101.226 1.00 124.45 ? 84  LEU D CG  1 
ATOM 1823 C CD1 . LEU B 1 84  ? 226.232 93.578  99.727  1.00 124.45 ? 84  LEU D CD1 1 
ATOM 1824 C CD2 . LEU B 1 84  ? 228.012 93.155  101.452 1.00 124.45 ? 84  LEU D CD2 1 
ATOM 1825 N N   . VAL B 1 85  ? 223.377 94.191  104.117 1.00 166.81 ? 85  VAL D N   1 
ATOM 1826 C CA  . VAL B 1 85  ? 222.710 93.241  105.000 1.00 166.81 ? 85  VAL D CA  1 
ATOM 1827 C C   . VAL B 1 85  ? 221.553 92.654  104.187 1.00 166.81 ? 85  VAL D C   1 
ATOM 1828 O O   . VAL B 1 85  ? 221.292 91.446  104.198 1.00 166.81 ? 85  VAL D O   1 
ATOM 1829 C CB  . VAL B 1 85  ? 222.152 93.947  106.318 1.00 71.71  ? 85  VAL D CB  1 
ATOM 1830 C CG1 . VAL B 1 85  ? 223.298 94.618  107.089 1.00 71.71  ? 85  VAL D CG1 1 
ATOM 1831 C CG2 . VAL B 1 85  ? 221.049 94.983  105.984 1.00 71.71  ? 85  VAL D CG2 1 
ATOM 1832 N N   . VAL B 1 86  ? 220.913 93.549  103.442 1.00 125.60 ? 86  VAL D N   1 
ATOM 1833 C CA  . VAL B 1 86  ? 219.761 93.270  102.602 1.00 125.60 ? 86  VAL D CA  1 
ATOM 1834 C C   . VAL B 1 86  ? 220.078 92.559  101.263 1.00 125.60 ? 86  VAL D C   1 
ATOM 1835 O O   . VAL B 1 86  ? 219.174 92.280  100.474 1.00 125.60 ? 86  VAL D O   1 
ATOM 1836 C CB  . VAL B 1 86  ? 219.001 94.611  102.358 1.00 100.17 ? 86  VAL D CB  1 
ATOM 1837 C CG1 . VAL B 1 86  ? 217.680 94.357  101.718 1.00 100.17 ? 86  VAL D CG1 1 
ATOM 1838 C CG2 . VAL B 1 86  ? 218.772 95.342  103.686 1.00 100.17 ? 86  VAL D CG2 1 
ATOM 1839 N N   . SER B 1 87  ? 221.352 92.258  101.008 1.00 200.00 ? 87  SER D N   1 
ATOM 1840 C CA  . SER B 1 87  ? 221.750 91.563  99.773  1.00 200.00 ? 87  SER D CA  1 
ATOM 1841 C C   . SER B 1 87  ? 222.005 90.089  100.075 1.00 200.00 ? 87  SER D C   1 
ATOM 1842 O O   . SER B 1 87  ? 222.491 89.330  99.236  1.00 200.00 ? 87  SER D O   1 
ATOM 1843 C CB  . SER B 1 87  ? 223.010 92.198  99.159  1.00 131.04 ? 87  SER D CB  1 
ATOM 1844 O OG  . SER B 1 87  ? 223.456 91.472  98.022  1.00 131.04 ? 87  SER D OG  1 
ATOM 1845 N N   . TYR B 1 88  ? 221.678 89.714  101.304 1.00 147.60 ? 88  TYR D N   1 
ATOM 1846 C CA  . TYR B 1 88  ? 221.801 88.352  101.798 1.00 147.60 ? 88  TYR D CA  1 
ATOM 1847 C C   . TYR B 1 88  ? 220.386 88.044  102.258 1.00 147.60 ? 88  TYR D C   1 
ATOM 1848 O O   . TYR B 1 88  ? 219.870 86.937  102.100 1.00 147.60 ? 88  TYR D O   1 
ATOM 1849 C CB  . TYR B 1 88  ? 222.753 88.318  102.990 1.00 180.29 ? 88  TYR D CB  1 
ATOM 1850 C CG  . TYR B 1 88  ? 222.376 87.307  104.047 1.00 180.29 ? 88  TYR D CG  1 
ATOM 1851 C CD1 . TYR B 1 88  ? 222.683 85.958  103.887 1.00 180.29 ? 88  TYR D CD1 1 
ATOM 1852 C CD2 . TYR B 1 88  ? 221.719 87.703  105.218 1.00 180.29 ? 88  TYR D CD2 1 
ATOM 1853 C CE1 . TYR B 1 88  ? 222.353 85.023  104.871 1.00 180.29 ? 88  TYR D CE1 1 
ATOM 1854 C CE2 . TYR B 1 88  ? 221.384 86.779  106.206 1.00 180.29 ? 88  TYR D CE2 1 
ATOM 1855 C CZ  . TYR B 1 88  ? 221.705 85.441  106.029 1.00 180.29 ? 88  TYR D CZ  1 
ATOM 1856 O OH  . TYR B 1 88  ? 221.391 84.525  107.012 1.00 180.29 ? 88  TYR D OH  1 
ATOM 1857 N N   . VAL B 1 89  ? 219.775 89.069  102.836 1.00 123.33 ? 89  VAL D N   1 
ATOM 1858 C CA  . VAL B 1 89  ? 218.417 88.995  103.331 1.00 123.33 ? 89  VAL D CA  1 
ATOM 1859 C C   . VAL B 1 89  ? 217.505 88.684  102.153 1.00 123.33 ? 89  VAL D C   1 
ATOM 1860 O O   . VAL B 1 89  ? 217.188 87.527  101.891 1.00 123.33 ? 89  VAL D O   1 
ATOM 1861 C CB  . VAL B 1 89  ? 218.015 90.341  103.997 1.00 35.85  ? 89  VAL D CB  1 
ATOM 1862 C CG1 . VAL B 1 89  ? 216.524 90.380  104.279 1.00 35.85  ? 89  VAL D CG1 1 
ATOM 1863 C CG2 . VAL B 1 89  ? 218.812 90.522  105.279 1.00 35.85  ? 89  VAL D CG2 1 
ATOM 1864 N N   . ASN B 1 90  ? 217.124 89.722  101.422 1.00 109.65 ? 90  ASN D N   1 
ATOM 1865 C CA  . ASN B 1 90  ? 216.242 89.579  100.273 1.00 109.65 ? 90  ASN D CA  1 
ATOM 1866 C C   . ASN B 1 90  ? 216.812 88.652  99.182  1.00 109.65 ? 90  ASN D C   1 
ATOM 1867 O O   . ASN B 1 90  ? 216.296 88.619  98.062  1.00 109.65 ? 90  ASN D O   1 
ATOM 1868 C CB  . ASN B 1 90  ? 215.935 90.975  99.697  1.00 110.54 ? 90  ASN D CB  1 
ATOM 1869 C CG  . ASN B 1 90  ? 215.322 91.932  100.742 1.00 110.54 ? 90  ASN D CG  1 
ATOM 1870 O OD1 . ASN B 1 90  ? 215.776 91.996  101.889 1.00 110.54 ? 90  ASN D OD1 1 
ATOM 1871 N ND2 . ASN B 1 90  ? 214.303 92.689  100.333 1.00 110.54 ? 90  ASN D ND2 1 
ATOM 1872 N N   . THR B 1 91  ? 217.861 87.896  99.520  1.00 176.08 ? 91  THR D N   1 
ATOM 1873 C CA  . THR B 1 91  ? 218.515 86.962  98.584  1.00 176.08 ? 91  THR D CA  1 
ATOM 1874 C C   . THR B 1 91  ? 218.604 85.515  99.087  1.00 176.08 ? 91  THR D C   1 
ATOM 1875 O O   . THR B 1 91  ? 218.269 84.578  98.357  1.00 176.08 ? 91  THR D O   1 
ATOM 1876 C CB  . THR B 1 91  ? 219.976 87.412  98.234  1.00 184.68 ? 91  THR D CB  1 
ATOM 1877 O OG1 . THR B 1 91  ? 219.939 88.607  97.440  1.00 184.68 ? 91  THR D OG1 1 
ATOM 1878 C CG2 . THR B 1 91  ? 220.726 86.305  97.462  1.00 184.68 ? 91  THR D CG2 1 
ATOM 1879 N N   . ASN B 1 92  ? 219.070 85.344  100.324 1.00 161.12 ? 92  ASN D N   1 
ATOM 1880 C CA  . ASN B 1 92  ? 219.236 84.016  100.923 1.00 161.12 ? 92  ASN D CA  1 
ATOM 1881 C C   . ASN B 1 92  ? 218.193 83.652  101.999 1.00 161.12 ? 92  ASN D C   1 
ATOM 1882 O O   . ASN B 1 92  ? 217.980 82.467  102.292 1.00 161.12 ? 92  ASN D O   1 
ATOM 1883 C CB  . ASN B 1 92  ? 220.654 83.895  101.504 1.00 156.93 ? 92  ASN D CB  1 
ATOM 1884 C CG  . ASN B 1 92  ? 220.912 82.545  102.158 1.00 156.93 ? 92  ASN D CG  1 
ATOM 1885 O OD1 . ASN B 1 92  ? 220.888 81.503  101.499 1.00 156.93 ? 92  ASN D OD1 1 
ATOM 1886 N ND2 . ASN B 1 92  ? 221.159 82.561  103.463 1.00 156.93 ? 92  ASN D ND2 1 
ATOM 1887 N N   . VAL B 1 93  ? 217.551 84.664  102.586 1.00 133.79 ? 93  VAL D N   1 
ATOM 1888 C CA  . VAL B 1 93  ? 216.526 84.432  103.613 1.00 133.79 ? 93  VAL D CA  1 
ATOM 1889 C C   . VAL B 1 93  ? 215.154 84.986  103.233 1.00 133.79 ? 93  VAL D C   1 
ATOM 1890 O O   . VAL B 1 93  ? 214.136 84.314  103.416 1.00 133.79 ? 93  VAL D O   1 
ATOM 1891 C CB  . VAL B 1 93  ? 216.891 85.057  104.962 1.00 72.25  ? 93  VAL D CB  1 
ATOM 1892 C CG1 . VAL B 1 93  ? 216.874 86.588  104.857 1.00 72.25  ? 93  VAL D CG1 1 
ATOM 1893 C CG2 . VAL B 1 93  ? 215.895 84.582  106.013 1.00 72.25  ? 93  VAL D CG2 1 
ATOM 1894 N N   . GLY B 1 94  ? 215.121 86.222  102.737 1.00 117.29 ? 94  GLY D N   1 
ATOM 1895 C CA  . GLY B 1 94  ? 213.859 86.793  102.319 1.00 117.29 ? 94  GLY D CA  1 
ATOM 1896 C C   . GLY B 1 94  ? 213.251 85.771  101.383 1.00 117.29 ? 94  GLY D C   1 
ATOM 1897 O O   . GLY B 1 94  ? 212.063 85.800  101.084 1.00 117.29 ? 94  GLY D O   1 
ATOM 1898 N N   . LEU B 1 95  ? 214.099 84.861  100.915 1.00 85.70  ? 95  LEU D N   1 
ATOM 1899 C CA  . LEU B 1 95  ? 213.682 83.787  100.032 1.00 85.70  ? 95  LEU D CA  1 
ATOM 1900 C C   . LEU B 1 95  ? 212.964 82.718  100.857 1.00 85.70  ? 95  LEU D C   1 
ATOM 1901 O O   . LEU B 1 95  ? 211.816 82.420  100.577 1.00 85.70  ? 95  LEU D O   1 
ATOM 1902 C CB  . LEU B 1 95  ? 214.893 83.188  99.304  1.00 120.61 ? 95  LEU D CB  1 
ATOM 1903 C CG  . LEU B 1 95  ? 214.704 82.005  98.344  1.00 120.61 ? 95  LEU D CG  1 
ATOM 1904 C CD1 . LEU B 1 95  ? 215.733 82.081  97.228  1.00 120.61 ? 95  LEU D CD1 1 
ATOM 1905 C CD2 . LEU B 1 95  ? 214.830 80.695  99.104  1.00 120.61 ? 95  LEU D CD2 1 
ATOM 1906 N N   . LYS B 1 96  ? 213.596 82.161  101.891 1.00 87.70  ? 96  LYS D N   1 
ATOM 1907 C CA  . LYS B 1 96  ? 212.906 81.127  102.665 1.00 87.70  ? 96  LYS D CA  1 
ATOM 1908 C C   . LYS B 1 96  ? 211.677 81.659  103.386 1.00 87.70  ? 96  LYS D C   1 
ATOM 1909 O O   . LYS B 1 96  ? 210.790 80.892  103.755 1.00 87.70  ? 96  LYS D O   1 
ATOM 1910 C CB  . LYS B 1 96  ? 213.851 80.419  103.655 1.00 101.89 ? 96  LYS D CB  1 
ATOM 1911 C CG  . LYS B 1 96  ? 214.530 81.296  104.684 1.00 101.89 ? 96  LYS D CG  1 
ATOM 1912 C CD  . LYS B 1 96  ? 214.991 80.480  105.901 1.00 101.89 ? 96  LYS D CD  1 
ATOM 1913 C CE  . LYS B 1 96  ? 215.938 79.335  105.534 1.00 101.89 ? 96  LYS D CE  1 
ATOM 1914 N NZ  . LYS B 1 96  ? 216.416 78.590  106.739 1.00 101.89 ? 96  LYS D NZ  1 
ATOM 1915 N N   . PHE B 1 97  ? 211.612 82.973  103.570 1.00 63.04  ? 97  PHE D N   1 
ATOM 1916 C CA  . PHE B 1 97  ? 210.454 83.573  104.228 1.00 63.04  ? 97  PHE D CA  1 
ATOM 1917 C C   . PHE B 1 97  ? 209.406 83.921  103.204 1.00 63.04  ? 97  PHE D C   1 
ATOM 1918 O O   . PHE B 1 97  ? 208.284 84.209  103.564 1.00 63.04  ? 97  PHE D O   1 
ATOM 1919 C CB  . PHE B 1 97  ? 210.826 84.832  105.017 1.00 146.84 ? 97  PHE D CB  1 
ATOM 1920 C CG  . PHE B 1 97  ? 210.941 84.608  106.505 1.00 146.84 ? 97  PHE D CG  1 
ATOM 1921 C CD1 . PHE B 1 97  ? 210.338 85.487  107.403 1.00 146.84 ? 97  PHE D CD1 1 
ATOM 1922 C CD2 . PHE B 1 97  ? 211.643 83.509  107.010 1.00 146.84 ? 97  PHE D CD2 1 
ATOM 1923 C CE1 . PHE B 1 97  ? 210.431 85.271  108.789 1.00 146.84 ? 97  PHE D CE1 1 
ATOM 1924 C CE2 . PHE B 1 97  ? 211.745 83.279  108.395 1.00 146.84 ? 97  PHE D CE2 1 
ATOM 1925 C CZ  . PHE B 1 97  ? 211.138 84.160  109.284 1.00 146.84 ? 97  PHE D CZ  1 
ATOM 1926 N N   . ARG B 1 98  ? 209.804 83.934  101.934 1.00 68.51  ? 98  ARG D N   1 
ATOM 1927 C CA  . ARG B 1 98  ? 208.879 84.191  100.839 1.00 68.51  ? 98  ARG D CA  1 
ATOM 1928 C C   . ARG B 1 98  ? 208.306 82.798  100.624 1.00 68.51  ? 98  ARG D C   1 
ATOM 1929 O O   . ARG B 1 98  ? 207.102 82.638  100.468 1.00 68.51  ? 98  ARG D O   1 
ATOM 1930 C CB  . ARG B 1 98  ? 209.611 84.670  99.556  1.00 106.60 ? 98  ARG D CB  1 
ATOM 1931 C CG  . ARG B 1 98  ? 209.611 86.176  99.247  1.00 106.60 ? 98  ARG D CG  1 
ATOM 1932 C CD  . ARG B 1 98  ? 210.103 86.476  97.811  1.00 106.60 ? 98  ARG D CD  1 
ATOM 1933 N NE  . ARG B 1 98  ? 211.446 85.948  97.523  1.00 106.60 ? 98  ARG D NE  1 
ATOM 1934 C CZ  . ARG B 1 98  ? 212.013 85.887  96.311  1.00 106.60 ? 98  ARG D CZ  1 
ATOM 1935 N NH1 . ARG B 1 98  ? 211.365 86.321  95.235  1.00 106.60 ? 98  ARG D NH1 1 
ATOM 1936 N NH2 . ARG B 1 98  ? 213.237 85.383  96.171  1.00 106.60 ? 98  ARG D NH2 1 
ATOM 1937 N N   . GLN B 1 99  ? 209.191 81.795  100.638 1.00 89.20  ? 99  GLN D N   1 
ATOM 1938 C CA  . GLN B 1 99  ? 208.802 80.390  100.455 1.00 89.20  ? 99  GLN D CA  1 
ATOM 1939 C C   . GLN B 1 99  ? 207.682 80.144  101.416 1.00 89.20  ? 99  GLN D C   1 
ATOM 1940 O O   . GLN B 1 99  ? 206.522 80.413  101.113 1.00 89.20  ? 99  GLN D O   1 
ATOM 1941 C CB  . GLN B 1 99  ? 209.954 79.407  100.781 1.00 136.01 ? 99  GLN D CB  1 
ATOM 1942 C CG  . GLN B 1 99  ? 210.827 79.005  99.586  1.00 136.01 ? 99  GLN D CG  1 
ATOM 1943 C CD  . GLN B 1 99  ? 211.882 77.960  99.934  1.00 136.01 ? 99  GLN D CD  1 
ATOM 1944 O OE1 . GLN B 1 99  ? 212.611 78.104  100.918 1.00 136.01 ? 99  GLN D OE1 1 
ATOM 1945 N NE2 . GLN B 1 99  ? 211.976 76.909  99.118  1.00 136.01 ? 99  GLN D NE2 1 
ATOM 1946 N N   . LEU B 1 100 ? 208.050 79.656  102.590 1.00 113.31 ? 100 LEU D N   1 
ATOM 1947 C CA  . LEU B 1 100 ? 207.095 79.375  103.631 1.00 113.31 ? 100 LEU D CA  1 
ATOM 1948 C C   . LEU B 1 100 ? 205.865 80.245  103.469 1.00 113.31 ? 100 LEU D C   1 
ATOM 1949 O O   . LEU B 1 100 ? 204.787 79.781  103.087 1.00 113.31 ? 100 LEU D O   1 
ATOM 1950 C CB  . LEU B 1 100 ? 207.750 79.650  104.967 1.00 106.16 ? 100 LEU D CB  1 
ATOM 1951 C CG  . LEU B 1 100 ? 206.835 79.542  106.169 1.00 106.16 ? 100 LEU D CG  1 
ATOM 1952 C CD1 . LEU B 1 100 ? 207.673 79.225  107.388 1.00 106.16 ? 100 LEU D CD1 1 
ATOM 1953 C CD2 . LEU B 1 100 ? 206.069 80.823  106.343 1.00 106.16 ? 100 LEU D CD2 1 
ATOM 1954 N N   . LEU B 1 101 ? 206.058 81.526  103.739 1.00 62.38  ? 101 LEU D N   1 
ATOM 1955 C CA  . LEU B 1 101 ? 204.987 82.492  103.652 1.00 62.38  ? 101 LEU D CA  1 
ATOM 1956 C C   . LEU B 1 101 ? 203.909 82.091  102.675 1.00 62.38  ? 101 LEU D C   1 
ATOM 1957 O O   . LEU B 1 101 ? 202.781 81.842  103.073 1.00 62.38  ? 101 LEU D O   1 
ATOM 1958 C CB  . LEU B 1 101 ? 205.550 83.848  103.270 1.00 152.74 ? 101 LEU D CB  1 
ATOM 1959 C CG  . LEU B 1 101 ? 204.959 85.005  104.066 1.00 152.74 ? 101 LEU D CG  1 
ATOM 1960 C CD1 . LEU B 1 101 ? 206.055 85.988  104.486 1.00 152.74 ? 101 LEU D CD1 1 
ATOM 1961 C CD2 . LEU B 1 101 ? 203.905 85.678  103.221 1.00 152.74 ? 101 LEU D CD2 1 
ATOM 1962 N N   . TRP B 1 102 ? 204.255 82.031  101.396 1.00 71.08  ? 102 TRP D N   1 
ATOM 1963 C CA  . TRP B 1 102 ? 203.306 81.659  100.357 1.00 71.08  ? 102 TRP D CA  1 
ATOM 1964 C C   . TRP B 1 102 ? 202.612 80.386  100.692 1.00 71.08  ? 102 TRP D C   1 
ATOM 1965 O O   . TRP B 1 102 ? 201.405 80.353  100.911 1.00 71.08  ? 102 TRP D O   1 
ATOM 1966 C CB  . TRP B 1 102 ? 204.025 81.420  99.067  1.00 90.98  ? 102 TRP D CB  1 
ATOM 1967 C CG  . TRP B 1 102 ? 203.164 80.821  98.015  1.00 90.98  ? 102 TRP D CG  1 
ATOM 1968 C CD1 . TRP B 1 102 ? 202.144 81.424  97.334  1.00 90.98  ? 102 TRP D CD1 1 
ATOM 1969 C CD2 . TRP B 1 102 ? 203.326 79.532  97.433  1.00 90.98  ? 102 TRP D CD2 1 
ATOM 1970 N NE1 . TRP B 1 102 ? 201.664 80.588  96.348  1.00 90.98  ? 102 TRP D NE1 1 
ATOM 1971 C CE2 . TRP B 1 102 ? 202.378 79.429  96.381  1.00 90.98  ? 102 TRP D CE2 1 
ATOM 1972 C CE3 . TRP B 1 102 ? 204.180 78.466  97.688  1.00 90.98  ? 102 TRP D CE3 1 
ATOM 1973 C CZ2 . TRP B 1 102 ? 202.282 78.285  95.585  1.00 90.98  ? 102 TRP D CZ2 1 
ATOM 1974 C CZ3 . TRP B 1 102 ? 204.081 77.337  96.902  1.00 90.98  ? 102 TRP D CZ3 1 
ATOM 1975 C CH2 . TRP B 1 102 ? 203.140 77.254  95.857  1.00 90.98  ? 102 TRP D CH2 1 
ATOM 1976 N N   . PHE B 1 103 ? 203.402 79.326  100.671 1.00 78.90  ? 103 PHE D N   1 
ATOM 1977 C CA  . PHE B 1 103 ? 202.895 78.018  100.995 1.00 78.90  ? 103 PHE D CA  1 
ATOM 1978 C C   . PHE B 1 103 ? 201.492 78.110  101.579 1.00 78.90  ? 103 PHE D C   1 
ATOM 1979 O O   . PHE B 1 103 ? 200.487 78.026  100.867 1.00 78.90  ? 103 PHE D O   1 
ATOM 1980 C CB  . PHE B 1 103 ? 203.810 77.343  102.014 1.00 127.96 ? 103 PHE D CB  1 
ATOM 1981 C CG  . PHE B 1 103 ? 203.388 75.951  102.368 1.00 127.96 ? 103 PHE D CG  1 
ATOM 1982 C CD1 . PHE B 1 103 ? 203.269 74.985  101.376 1.00 127.96 ? 103 PHE D CD1 1 
ATOM 1983 C CD2 . PHE B 1 103 ? 203.138 75.590  103.690 1.00 127.96 ? 103 PHE D CD2 1 
ATOM 1984 C CE1 . PHE B 1 103 ? 202.912 73.669  101.697 1.00 127.96 ? 103 PHE D CE1 1 
ATOM 1985 C CE2 . PHE B 1 103 ? 202.780 74.272  104.021 1.00 127.96 ? 103 PHE D CE2 1 
ATOM 1986 C CZ  . PHE B 1 103 ? 202.670 73.315  103.021 1.00 127.96 ? 103 PHE D CZ  1 
ATOM 1987 N N   . HIS B 1 104 ? 201.449 78.310  102.889 1.00 91.18  ? 104 HIS D N   1 
ATOM 1988 C CA  . HIS B 1 104 ? 200.210 78.404  103.644 1.00 91.18  ? 104 HIS D CA  1 
ATOM 1989 C C   . HIS B 1 104 ? 199.054 79.032  102.928 1.00 91.18  ? 104 HIS D C   1 
ATOM 1990 O O   . HIS B 1 104 ? 198.158 78.345  102.431 1.00 91.18  ? 104 HIS D O   1 
ATOM 1991 C CB  . HIS B 1 104 ? 200.494 79.141  104.931 1.00 90.90  ? 104 HIS D CB  1 
ATOM 1992 C CG  . HIS B 1 104 ? 201.360 78.354  105.851 1.00 90.90  ? 104 HIS D CG  1 
ATOM 1993 N ND1 . HIS B 1 104 ? 200.892 77.257  106.544 1.00 90.90  ? 104 HIS D ND1 1 
ATOM 1994 C CD2 . HIS B 1 104 ? 202.683 78.434  106.118 1.00 90.90  ? 104 HIS D CD2 1 
ATOM 1995 C CE1 . HIS B 1 104 ? 201.891 76.694  107.201 1.00 90.90  ? 104 HIS D CE1 1 
ATOM 1996 N NE2 . HIS B 1 104 ? 202.988 77.388  106.959 1.00 90.90  ? 104 HIS D NE2 1 
ATOM 1997 N N   . ILE B 1 105 ? 199.084 80.349  102.902 1.00 83.79  ? 105 ILE D N   1 
ATOM 1998 C CA  . ILE B 1 105 ? 198.076 81.145  102.243 1.00 83.79  ? 105 ILE D CA  1 
ATOM 1999 C C   . ILE B 1 105 ? 197.279 80.349  101.232 1.00 83.79  ? 105 ILE D C   1 
ATOM 2000 O O   . ILE B 1 105 ? 196.045 80.265  101.267 1.00 83.79  ? 105 ILE D O   1 
ATOM 2001 C CB  . ILE B 1 105 ? 198.752 82.267  101.520 1.00 83.23  ? 105 ILE D CB  1 
ATOM 2002 C CG1 . ILE B 1 105 ? 199.811 82.867  102.441 1.00 83.23  ? 105 ILE D CG1 1 
ATOM 2003 C CG2 . ILE B 1 105 ? 197.717 83.271  101.067 1.00 83.23  ? 105 ILE D CG2 1 
ATOM 2004 C CD1 . ILE B 1 105 ? 200.517 84.080  101.876 1.00 83.23  ? 105 ILE D CD1 1 
ATOM 2005 N N   . SER B 1 106 ? 198.030 79.758  100.326 1.00 91.44  ? 106 SER D N   1 
ATOM 2006 C CA  . SER B 1 106 ? 197.482 78.949  99.270  1.00 91.44  ? 106 SER D CA  1 
ATOM 2007 C C   . SER B 1 106 ? 196.567 77.856  99.812  1.00 91.44  ? 106 SER D C   1 
ATOM 2008 O O   . SER B 1 106 ? 195.341 77.934  99.683  1.00 91.44  ? 106 SER D O   1 
ATOM 2009 C CB  . SER B 1 106 ? 198.651 78.365  98.497  1.00 63.85  ? 106 SER D CB  1 
ATOM 2010 O OG  . SER B 1 106 ? 199.682 79.344  98.442  1.00 63.85  ? 106 SER D OG  1 
ATOM 2011 N N   . ALA B 1 107 ? 197.164 76.850  100.439 1.00 79.84  ? 107 ALA D N   1 
ATOM 2012 C CA  . ALA B 1 107 ? 196.389 75.752  100.982 1.00 79.84  ? 107 ALA D CA  1 
ATOM 2013 C C   . ALA B 1 107 ? 195.277 76.280  101.869 1.00 79.84  ? 107 ALA D C   1 
ATOM 2014 O O   . ALA B 1 107 ? 194.325 75.552  102.155 1.00 79.84  ? 107 ALA D O   1 
ATOM 2015 C CB  . ALA B 1 107 ? 197.272 74.824  101.764 1.00 69.38  ? 107 ALA D CB  1 
ATOM 2016 N N   . LEU B 1 108 ? 195.399 77.540  102.294 1.00 70.27  ? 108 LEU D N   1 
ATOM 2017 C CA  . LEU B 1 108 ? 194.394 78.176  103.151 1.00 70.27  ? 108 LEU D CA  1 
ATOM 2018 C C   . LEU B 1 108 ? 193.239 78.681  102.339 1.00 70.27  ? 108 LEU D C   1 
ATOM 2019 O O   . LEU B 1 108 ? 192.332 79.343  102.852 1.00 70.27  ? 108 LEU D O   1 
ATOM 2020 C CB  . LEU B 1 108 ? 194.969 79.365  103.893 1.00 85.60  ? 108 LEU D CB  1 
ATOM 2021 C CG  . LEU B 1 108 ? 194.799 79.192  105.388 1.00 85.60  ? 108 LEU D CG  1 
ATOM 2022 C CD1 . LEU B 1 108 ? 195.902 78.282  105.855 1.00 85.60  ? 108 LEU D CD1 1 
ATOM 2023 C CD2 . LEU B 1 108 ? 194.865 80.512  106.100 1.00 85.60  ? 108 LEU D CD2 1 
ATOM 2024 N N   . THR B 1 109 ? 193.295 78.381  101.055 1.00 117.91 ? 109 THR D N   1 
ATOM 2025 C CA  . THR B 1 109 ? 192.266 78.805  100.154 1.00 117.91 ? 109 THR D CA  1 
ATOM 2026 C C   . THR B 1 109 ? 192.105 77.704  99.111  1.00 117.91 ? 109 THR D C   1 
ATOM 2027 O O   . THR B 1 109 ? 191.148 77.705  98.337  1.00 117.91 ? 109 THR D O   1 
ATOM 2028 C CB  . THR B 1 109 ? 192.668 80.150  99.509  1.00 44.21  ? 109 THR D CB  1 
ATOM 2029 O OG1 . THR B 1 109 ? 193.600 80.842  100.356 1.00 44.21  ? 109 THR D OG1 1 
ATOM 2030 C CG2 . THR B 1 109 ? 191.440 81.031  99.356  1.00 44.21  ? 109 THR D CG2 1 
ATOM 2031 N N   . PHE B 1 110 ? 193.027 76.740  99.130  1.00 60.58  ? 110 PHE D N   1 
ATOM 2032 C CA  . PHE B 1 110 ? 193.016 75.635  98.159  1.00 60.58  ? 110 PHE D CA  1 
ATOM 2033 C C   . PHE B 1 110 ? 193.251 74.206  98.683  1.00 60.58  ? 110 PHE D C   1 
ATOM 2034 O O   . PHE B 1 110 ? 193.538 73.296  97.897  1.00 60.58  ? 110 PHE D O   1 
ATOM 2035 C CB  . PHE B 1 110 ? 194.045 75.913  97.059  1.00 107.58 ? 110 PHE D CB  1 
ATOM 2036 C CG  . PHE B 1 110 ? 193.901 77.268  96.413  1.00 107.58 ? 110 PHE D CG  1 
ATOM 2037 C CD1 . PHE B 1 110 ? 194.250 78.425  97.102  1.00 107.58 ? 110 PHE D CD1 1 
ATOM 2038 C CD2 . PHE B 1 110 ? 193.410 77.385  95.111  1.00 107.58 ? 110 PHE D CD2 1 
ATOM 2039 C CE1 . PHE B 1 110 ? 194.115 79.672  96.511  1.00 107.58 ? 110 PHE D CE1 1 
ATOM 2040 C CE2 . PHE B 1 110 ? 193.271 78.636  94.506  1.00 107.58 ? 110 PHE D CE2 1 
ATOM 2041 C CZ  . PHE B 1 110 ? 193.626 79.779  95.211  1.00 107.58 ? 110 PHE D CZ  1 
ATOM 2042 N N   . GLY B 1 111 ? 193.132 74.017  99.996  1.00 79.25  ? 111 GLY D N   1 
ATOM 2043 C CA  . GLY B 1 111 ? 193.327 72.704  100.586 1.00 79.25  ? 111 GLY D CA  1 
ATOM 2044 C C   . GLY B 1 111 ? 194.729 72.159  100.407 1.00 79.25  ? 111 GLY D C   1 
ATOM 2045 O O   . GLY B 1 111 ? 195.175 71.901  99.286  1.00 79.25  ? 111 GLY D O   1 
ATOM 2046 N N   . ARG B 1 112 ? 195.429 72.001  101.523 1.00 47.47  ? 112 ARG D N   1 
ATOM 2047 C CA  . ARG B 1 112 ? 196.784 71.457  101.516 1.00 47.47  ? 112 ARG D CA  1 
ATOM 2048 C C   . ARG B 1 112 ? 196.900 70.330  100.488 1.00 47.47  ? 112 ARG D C   1 
ATOM 2049 O O   . ARG B 1 112 ? 197.731 70.376  99.584  1.00 47.47  ? 112 ARG D O   1 
ATOM 2050 C CB  . ARG B 1 112 ? 197.127 70.934  102.915 1.00 115.20 ? 112 ARG D CB  1 
ATOM 2051 C CG  . ARG B 1 112 ? 195.965 70.221  103.591 1.00 115.20 ? 112 ARG D CG  1 
ATOM 2052 C CD  . ARG B 1 112 ? 196.239 70.005  105.058 1.00 115.20 ? 112 ARG D CD  1 
ATOM 2053 N NE  . ARG B 1 112 ? 197.347 69.086  105.274 1.00 115.20 ? 112 ARG D NE  1 
ATOM 2054 C CZ  . ARG B 1 112 ? 197.789 68.736  106.476 1.00 115.20 ? 112 ARG D CZ  1 
ATOM 2055 N NH1 . ARG B 1 112 ? 197.216 69.236  107.565 1.00 115.20 ? 112 ARG D NH1 1 
ATOM 2056 N NH2 . ARG B 1 112 ? 198.792 67.875  106.592 1.00 115.20 ? 112 ARG D NH2 1 
ATOM 2057 N N   . GLU B 1 113 ? 196.046 69.321  100.625 1.00 78.18  ? 113 GLU D N   1 
ATOM 2058 C CA  . GLU B 1 113 ? 196.069 68.197  99.704  1.00 78.18  ? 113 GLU D CA  1 
ATOM 2059 C C   . GLU B 1 113 ? 196.067 68.699  98.259  1.00 78.18  ? 113 GLU D C   1 
ATOM 2060 O O   . GLU B 1 113 ? 196.981 68.391  97.487  1.00 78.18  ? 113 GLU D O   1 
ATOM 2061 C CB  . GLU B 1 113 ? 194.868 67.265  99.965  1.00 117.31 ? 113 GLU D CB  1 
ATOM 2062 C CG  . GLU B 1 113 ? 194.965 66.435  101.265 1.00 117.31 ? 113 GLU D CG  1 
ATOM 2063 C CD  . GLU B 1 113 ? 196.195 65.507  101.318 1.00 117.31 ? 113 GLU D CD  1 
ATOM 2064 O OE1 . GLU B 1 113 ? 196.362 64.652  100.412 1.00 117.31 ? 113 GLU D OE1 1 
ATOM 2065 O OE2 . GLU B 1 113 ? 196.992 65.632  102.277 1.00 117.31 ? 113 GLU D OE2 1 
ATOM 2066 N N   . THR B 1 114 ? 195.053 69.492  97.911  1.00 71.84  ? 114 THR D N   1 
ATOM 2067 C CA  . THR B 1 114 ? 194.913 70.037  96.557  1.00 71.84  ? 114 THR D CA  1 
ATOM 2068 C C   . THR B 1 114 ? 196.193 70.787  96.166  1.00 71.84  ? 114 THR D C   1 
ATOM 2069 O O   . THR B 1 114 ? 196.505 70.940  94.982  1.00 71.84  ? 114 THR D O   1 
ATOM 2070 C CB  . THR B 1 114 ? 193.643 70.982  96.448  1.00 100.27 ? 114 THR D CB  1 
ATOM 2071 O OG1 . THR B 1 114 ? 192.446 70.244  96.754  1.00 100.27 ? 114 THR D OG1 1 
ATOM 2072 C CG2 . THR B 1 114 ? 193.501 71.552  95.044  1.00 100.27 ? 114 THR D CG2 1 
ATOM 2073 N N   . VAL B 1 115 ? 196.943 71.214  97.178  1.00 48.88  ? 115 VAL D N   1 
ATOM 2074 C CA  . VAL B 1 115 ? 198.197 71.940  96.976  1.00 48.88  ? 115 VAL D CA  1 
ATOM 2075 C C   . VAL B 1 115 ? 199.397 71.091  96.629  1.00 48.88  ? 115 VAL D C   1 
ATOM 2076 O O   . VAL B 1 115 ? 200.071 71.338  95.645  1.00 48.88  ? 115 VAL D O   1 
ATOM 2077 C CB  . VAL B 1 115 ? 198.616 72.700  98.211  1.00 28.91  ? 115 VAL D CB  1 
ATOM 2078 C CG1 . VAL B 1 115 ? 200.091 73.116  98.082  1.00 28.91  ? 115 VAL D CG1 1 
ATOM 2079 C CG2 . VAL B 1 115 ? 197.705 73.890  98.406  1.00 28.91  ? 115 VAL D CG2 1 
ATOM 2080 N N   . LEU B 1 116 ? 199.705 70.133  97.488  1.00 50.21  ? 116 LEU D N   1 
ATOM 2081 C CA  . LEU B 1 116 ? 200.830 69.264  97.236  1.00 50.21  ? 116 LEU D CA  1 
ATOM 2082 C C   . LEU B 1 116 ? 200.688 68.808  95.808  1.00 50.21  ? 116 LEU D C   1 
ATOM 2083 O O   . LEU B 1 116 ? 201.607 68.962  95.015  1.00 50.21  ? 116 LEU D O   1 
ATOM 2084 C CB  . LEU B 1 116 ? 200.778 68.082  98.181  1.00 56.43  ? 116 LEU D CB  1 
ATOM 2085 C CG  . LEU B 1 116 ? 200.479 68.546  99.605  1.00 56.43  ? 116 LEU D CG  1 
ATOM 2086 C CD1 . LEU B 1 116 ? 200.949 67.471  100.602 1.00 56.43  ? 116 LEU D CD1 1 
ATOM 2087 C CD2 . LEU B 1 116 ? 201.182 69.874  99.869  1.00 56.43  ? 116 LEU D CD2 1 
ATOM 2088 N N   . GLU B 1 117 ? 199.511 68.282  95.481  1.00 90.59  ? 117 GLU D N   1 
ATOM 2089 C CA  . GLU B 1 117 ? 199.230 67.827  94.131  1.00 90.59  ? 117 GLU D CA  1 
ATOM 2090 C C   . GLU B 1 117 ? 199.543 68.913  93.095  1.00 90.59  ? 117 GLU D C   1 
ATOM 2091 O O   . GLU B 1 117 ? 199.392 68.684  91.895  1.00 90.59  ? 117 GLU D O   1 
ATOM 2092 C CB  . GLU B 1 117 ? 197.773 67.371  94.027  1.00 128.09 ? 117 GLU D CB  1 
ATOM 2093 C CG  . GLU B 1 117 ? 197.505 66.050  94.748  1.00 128.09 ? 117 GLU D CG  1 
ATOM 2094 C CD  . GLU B 1 117 ? 196.024 65.682  94.813  1.00 128.09 ? 117 GLU D CD  1 
ATOM 2095 O OE1 . GLU B 1 117 ? 195.363 65.615  93.751  1.00 128.09 ? 117 GLU D OE1 1 
ATOM 2096 O OE2 . GLU B 1 117 ? 195.520 65.449  95.934  1.00 128.09 ? 117 GLU D OE2 1 
ATOM 2097 N N   . TYR B 1 118 ? 199.961 70.092  93.572  1.00 69.19  ? 118 TYR D N   1 
ATOM 2098 C CA  . TYR B 1 118 ? 200.365 71.214  92.708  1.00 69.19  ? 118 TYR D CA  1 
ATOM 2099 C C   . TYR B 1 118 ? 201.842 70.977  92.465  1.00 69.19  ? 118 TYR D C   1 
ATOM 2100 O O   . TYR B 1 118 ? 202.252 70.574  91.379  1.00 69.19  ? 118 TYR D O   1 
ATOM 2101 C CB  . TYR B 1 118 ? 200.222 72.577  93.414  1.00 88.01  ? 118 TYR D CB  1 
ATOM 2102 C CG  . TYR B 1 118 ? 200.482 73.810  92.535  1.00 88.01  ? 118 TYR D CG  1 
ATOM 2103 C CD1 . TYR B 1 118 ? 199.478 74.769  92.333  1.00 88.01  ? 118 TYR D CD1 1 
ATOM 2104 C CD2 . TYR B 1 118 ? 201.708 74.016  91.896  1.00 88.01  ? 118 TYR D CD2 1 
ATOM 2105 C CE1 . TYR B 1 118 ? 199.682 75.906  91.512  1.00 88.01  ? 118 TYR D CE1 1 
ATOM 2106 C CE2 . TYR B 1 118 ? 201.922 75.155  91.069  1.00 88.01  ? 118 TYR D CE2 1 
ATOM 2107 C CZ  . TYR B 1 118 ? 200.902 76.095  90.883  1.00 88.01  ? 118 TYR D CZ  1 
ATOM 2108 O OH  . TYR B 1 118 ? 201.093 77.214  90.083  1.00 88.01  ? 118 TYR D OH  1 
ATOM 2109 N N   . LEU B 1 119 ? 202.627 71.237  93.505  1.00 52.16  ? 119 LEU D N   1 
ATOM 2110 C CA  . LEU B 1 119 ? 204.075 71.052  93.485  1.00 52.16  ? 119 LEU D CA  1 
ATOM 2111 C C   . LEU B 1 119 ? 204.408 69.852  92.657  1.00 52.16  ? 119 LEU D C   1 
ATOM 2112 O O   . LEU B 1 119 ? 205.199 69.916  91.720  1.00 52.16  ? 119 LEU D O   1 
ATOM 2113 C CB  . LEU B 1 119 ? 204.590 70.773  94.876  1.00 47.54  ? 119 LEU D CB  1 
ATOM 2114 C CG  . LEU B 1 119 ? 204.237 71.795  95.937  1.00 47.54  ? 119 LEU D CG  1 
ATOM 2115 C CD1 . LEU B 1 119 ? 202.760 72.092  96.036  1.00 47.54  ? 119 LEU D CD1 1 
ATOM 2116 C CD2 . LEU B 1 119 ? 204.659 71.196  97.204  1.00 47.54  ? 119 LEU D CD2 1 
ATOM 2117 N N   . VAL B 1 120 ? 203.812 68.742  93.059  1.00 62.09  ? 120 VAL D N   1 
ATOM 2118 C CA  . VAL B 1 120 ? 203.976 67.481  92.377  1.00 62.09  ? 120 VAL D CA  1 
ATOM 2119 C C   . VAL B 1 120 ? 204.021 67.766  90.877  1.00 62.09  ? 120 VAL D C   1 
ATOM 2120 O O   . VAL B 1 120 ? 205.062 67.588  90.229  1.00 62.09  ? 120 VAL D O   1 
ATOM 2121 C CB  . VAL B 1 120 ? 202.772 66.567  92.663  1.00 115.88 ? 120 VAL D CB  1 
ATOM 2122 C CG1 . VAL B 1 120 ? 203.102 65.157  92.280  1.00 115.88 ? 120 VAL D CG1 1 
ATOM 2123 C CG2 . VAL B 1 120 ? 202.379 66.646  94.128  1.00 115.88 ? 120 VAL D CG2 1 
ATOM 2124 N N   . SER B 1 121 ? 202.885 68.238  90.353  1.00 97.73  ? 121 SER D N   1 
ATOM 2125 C CA  . SER B 1 121 ? 202.699 68.553  88.931  1.00 97.73  ? 121 SER D CA  1 
ATOM 2126 C C   . SER B 1 121 ? 203.799 69.468  88.381  1.00 97.73  ? 121 SER D C   1 
ATOM 2127 O O   . SER B 1 121 ? 204.358 69.253  87.292  1.00 97.73  ? 121 SER D O   1 
ATOM 2128 C CB  . SER B 1 121 ? 201.314 69.198  88.732  1.00 82.46  ? 121 SER D CB  1 
ATOM 2129 O OG  . SER B 1 121 ? 200.260 68.370  89.226  1.00 82.46  ? 121 SER D OG  1 
ATOM 2130 N N   . PHE B 1 122 ? 204.109 70.483  89.172  1.00 52.01  ? 122 PHE D N   1 
ATOM 2131 C CA  . PHE B 1 122 ? 205.120 71.464  88.840  1.00 52.01  ? 122 PHE D CA  1 
ATOM 2132 C C   . PHE B 1 122 ? 206.546 70.896  88.826  1.00 52.01  ? 122 PHE D C   1 
ATOM 2133 O O   . PHE B 1 122 ? 207.318 71.185  87.913  1.00 52.01  ? 122 PHE D O   1 
ATOM 2134 C CB  . PHE B 1 122 ? 205.043 72.600  89.843  1.00 127.12 ? 122 PHE D CB  1 
ATOM 2135 C CG  . PHE B 1 122 ? 205.523 73.898  89.309  1.00 127.12 ? 122 PHE D CG  1 
ATOM 2136 C CD1 . PHE B 1 122 ? 204.647 74.755  88.651  1.00 127.12 ? 122 PHE D CD1 1 
ATOM 2137 C CD2 . PHE B 1 122 ? 206.854 74.269  89.452  1.00 127.12 ? 122 PHE D CD2 1 
ATOM 2138 C CE1 . PHE B 1 122 ? 205.089 75.968  88.144  1.00 127.12 ? 122 PHE D CE1 1 
ATOM 2139 C CE2 . PHE B 1 122 ? 207.311 75.477  88.950  1.00 127.12 ? 122 PHE D CE2 1 
ATOM 2140 C CZ  . PHE B 1 122 ? 206.426 76.331  88.293  1.00 127.12 ? 122 PHE D CZ  1 
ATOM 2141 N N   . GLY B 1 123 ? 206.884 70.087  89.832  1.00 107.57 ? 123 GLY D N   1 
ATOM 2142 C CA  . GLY B 1 123 ? 208.220 69.500  89.941  1.00 107.57 ? 123 GLY D CA  1 
ATOM 2143 C C   . GLY B 1 123 ? 208.616 68.619  88.781  1.00 107.57 ? 123 GLY D C   1 
ATOM 2144 O O   . GLY B 1 123 ? 209.510 67.754  88.846  1.00 107.57 ? 123 GLY D O   1 
ATOM 2145 N N   . VAL B 1 124 ? 207.909 68.868  87.697  1.00 92.38  ? 124 VAL D N   1 
ATOM 2146 C CA  . VAL B 1 124 ? 208.105 68.163  86.480  1.00 92.38  ? 124 VAL D CA  1 
ATOM 2147 C C   . VAL B 1 124 ? 207.927 69.195  85.397  1.00 92.38  ? 124 VAL D C   1 
ATOM 2148 O O   . VAL B 1 124 ? 208.750 69.281  84.493  1.00 92.38  ? 124 VAL D O   1 
ATOM 2149 C CB  . VAL B 1 124 ? 207.094 67.061  86.390  1.00 64.04  ? 124 VAL D CB  1 
ATOM 2150 C CG1 . VAL B 1 124 ? 207.344 66.224  85.145  1.00 64.04  ? 124 VAL D CG1 1 
ATOM 2151 C CG2 . VAL B 1 124 ? 207.217 66.209  87.646  1.00 64.04  ? 124 VAL D CG2 1 
ATOM 2152 N N   . TRP B 1 125 ? 206.879 70.005  85.495  1.00 72.11  ? 125 TRP D N   1 
ATOM 2153 C CA  . TRP B 1 125 ? 206.697 71.038  84.483  1.00 72.11  ? 125 TRP D CA  1 
ATOM 2154 C C   . TRP B 1 125 ? 208.025 71.771  84.323  1.00 72.11  ? 125 TRP D C   1 
ATOM 2155 O O   . TRP B 1 125 ? 208.358 72.260  83.245  1.00 72.11  ? 125 TRP D O   1 
ATOM 2156 C CB  . TRP B 1 125 ? 205.630 72.065  84.879  1.00 122.96 ? 125 TRP D CB  1 
ATOM 2157 C CG  . TRP B 1 125 ? 205.286 73.028  83.738  1.00 122.96 ? 125 TRP D CG  1 
ATOM 2158 C CD1 . TRP B 1 125 ? 204.388 72.815  82.723  1.00 122.96 ? 125 TRP D CD1 1 
ATOM 2159 C CD2 . TRP B 1 125 ? 205.876 74.309  83.479  1.00 122.96 ? 125 TRP D CD2 1 
ATOM 2160 N NE1 . TRP B 1 125 ? 204.385 73.880  81.852  1.00 122.96 ? 125 TRP D NE1 1 
ATOM 2161 C CE2 . TRP B 1 125 ? 205.288 74.810  82.290  1.00 122.96 ? 125 TRP D CE2 1 
ATOM 2162 C CE3 . TRP B 1 125 ? 206.844 75.083  84.132  1.00 122.96 ? 125 TRP D CE3 1 
ATOM 2163 C CZ2 . TRP B 1 125 ? 205.637 76.048  81.745  1.00 122.96 ? 125 TRP D CZ2 1 
ATOM 2164 C CZ3 . TRP B 1 125 ? 207.189 76.314  83.588  1.00 122.96 ? 125 TRP D CZ3 1 
ATOM 2165 C CH2 . TRP B 1 125 ? 206.586 76.784  82.405  1.00 122.96 ? 125 TRP D CH2 1 
ATOM 2166 N N   . ILE B 1 126 ? 208.787 71.845  85.403  1.00 69.25  ? 126 ILE D N   1 
ATOM 2167 C CA  . ILE B 1 126 ? 210.069 72.521  85.358  1.00 69.25  ? 126 ILE D CA  1 
ATOM 2168 C C   . ILE B 1 126 ? 211.214 71.580  84.957  1.00 69.25  ? 126 ILE D C   1 
ATOM 2169 O O   . ILE B 1 126 ? 211.899 71.818  83.961  1.00 69.25  ? 126 ILE D O   1 
ATOM 2170 C CB  . ILE B 1 126 ? 210.394 73.147  86.723  1.00 100.70 ? 126 ILE D CB  1 
ATOM 2171 C CG1 . ILE B 1 126 ? 211.816 73.727  86.693  1.00 100.70 ? 126 ILE D CG1 1 
ATOM 2172 C CG2 . ILE B 1 126 ? 210.217 72.094  87.831  1.00 100.70 ? 126 ILE D CG2 1 
ATOM 2173 C CD1 . ILE B 1 126 ? 212.396 74.162  88.062  1.00 100.70 ? 126 ILE D CD1 1 
ATOM 2174 N N   . ARG B 1 127 ? 211.409 70.514  85.736  1.00 92.37  ? 127 ARG D N   1 
ATOM 2175 C CA  . ARG B 1 127 ? 212.478 69.547  85.499  1.00 92.37  ? 127 ARG D CA  1 
ATOM 2176 C C   . ARG B 1 127 ? 212.426 69.033  84.059  1.00 92.37  ? 127 ARG D C   1 
ATOM 2177 O O   . ARG B 1 127 ? 213.176 68.146  83.674  1.00 92.37  ? 127 ARG D O   1 
ATOM 2178 C CB  . ARG B 1 127 ? 212.366 68.399  86.522  1.00 154.30 ? 127 ARG D CB  1 
ATOM 2179 C CG  . ARG B 1 127 ? 212.381 68.865  88.004  1.00 154.30 ? 127 ARG D CG  1 
ATOM 2180 C CD  . ARG B 1 127 ? 213.802 69.183  88.553  1.00 154.30 ? 127 ARG D CD  1 
ATOM 2181 N NE  . ARG B 1 127 ? 213.837 70.290  89.524  1.00 154.30 ? 127 ARG D NE  1 
ATOM 2182 C CZ  . ARG B 1 127 ? 214.771 70.461  90.466  1.00 154.30 ? 127 ARG D CZ  1 
ATOM 2183 N NH1 . ARG B 1 127 ? 215.772 69.597  90.602  1.00 154.30 ? 127 ARG D NH1 1 
ATOM 2184 N NH2 . ARG B 1 127 ? 214.719 71.520  91.266  1.00 154.30 ? 127 ARG D NH2 1 
ATOM 2185 N N   . THR B 1 128 ? 211.547 69.645  83.269  1.00 113.97 ? 128 THR D N   1 
ATOM 2186 C CA  . THR B 1 128 ? 211.322 69.322  81.859  1.00 113.97 ? 128 THR D CA  1 
ATOM 2187 C C   . THR B 1 128 ? 212.041 70.269  80.880  1.00 113.97 ? 128 THR D C   1 
ATOM 2188 O O   . THR B 1 128 ? 211.714 71.457  80.811  1.00 113.97 ? 128 THR D O   1 
ATOM 2189 C CB  . THR B 1 128 ? 209.817 69.384  81.558  1.00 56.83  ? 128 THR D CB  1 
ATOM 2190 O OG1 . THR B 1 128 ? 209.164 68.294  82.213  1.00 56.83  ? 128 THR D OG1 1 
ATOM 2191 C CG2 . THR B 1 128 ? 209.551 69.330  80.058  1.00 56.83  ? 128 THR D CG2 1 
ATOM 2192 N N   . PRO B 1 129 ? 213.005 69.747  80.090  1.00 75.50  ? 129 PRO D N   1 
ATOM 2193 C CA  . PRO B 1 129 ? 213.792 70.501  79.102  1.00 75.50  ? 129 PRO D CA  1 
ATOM 2194 C C   . PRO B 1 129 ? 213.045 71.525  78.237  1.00 75.50  ? 129 PRO D C   1 
ATOM 2195 O O   . PRO B 1 129 ? 212.039 71.212  77.602  1.00 75.50  ? 129 PRO D O   1 
ATOM 2196 C CB  . PRO B 1 129 ? 214.447 69.396  78.290  1.00 130.91 ? 129 PRO D CB  1 
ATOM 2197 C CG  . PRO B 1 129 ? 214.796 68.418  79.373  1.00 130.91 ? 129 PRO D CG  1 
ATOM 2198 C CD  . PRO B 1 129 ? 213.487 68.355  80.163  1.00 130.91 ? 129 PRO D CD  1 
ATOM 2199 N N   . PRO B 1 130 ? 213.575 72.764  78.185  1.00 94.16  ? 130 PRO D N   1 
ATOM 2200 C CA  . PRO B 1 130 ? 213.099 73.956  77.467  1.00 94.16  ? 130 PRO D CA  1 
ATOM 2201 C C   . PRO B 1 130 ? 212.188 73.794  76.244  1.00 94.16  ? 130 PRO D C   1 
ATOM 2202 O O   . PRO B 1 130 ? 211.002 74.142  76.296  1.00 94.16  ? 130 PRO D O   1 
ATOM 2203 C CB  . PRO B 1 130 ? 214.402 74.684  77.138  1.00 121.58 ? 130 PRO D CB  1 
ATOM 2204 C CG  . PRO B 1 130 ? 215.203 74.453  78.380  1.00 121.58 ? 130 PRO D CG  1 
ATOM 2205 C CD  . PRO B 1 130 ? 214.970 72.972  78.638  1.00 121.58 ? 130 PRO D CD  1 
ATOM 2206 N N   . ALA B 1 131 ? 212.747 73.292  75.146  1.00 137.67 ? 131 ALA D N   1 
ATOM 2207 C CA  . ALA B 1 131 ? 211.984 73.112  73.910  1.00 137.67 ? 131 ALA D CA  1 
ATOM 2208 C C   . ALA B 1 131 ? 210.724 72.259  74.099  1.00 137.67 ? 131 ALA D C   1 
ATOM 2209 O O   . ALA B 1 131 ? 209.664 72.571  73.545  1.00 137.67 ? 131 ALA D O   1 
ATOM 2210 C CB  . ALA B 1 131 ? 212.883 72.499  72.830  1.00 88.97  ? 131 ALA D CB  1 
ATOM 2211 N N   . TYR B 1 132 ? 210.851 71.196  74.894  1.00 83.98  ? 132 TYR D N   1 
ATOM 2212 C CA  . TYR B 1 132 ? 209.755 70.265  75.176  1.00 83.98  ? 132 TYR D CA  1 
ATOM 2213 C C   . TYR B 1 132 ? 208.836 70.677  76.333  1.00 83.98  ? 132 TYR D C   1 
ATOM 2214 O O   . TYR B 1 132 ? 207.917 69.952  76.721  1.00 83.98  ? 132 TYR D O   1 
ATOM 2215 C CB  . TYR B 1 132 ? 210.348 68.878  75.431  1.00 95.91  ? 132 TYR D CB  1 
ATOM 2216 C CG  . TYR B 1 132 ? 211.010 68.302  74.206  1.00 95.91  ? 132 TYR D CG  1 
ATOM 2217 C CD1 . TYR B 1 132 ? 211.007 69.007  72.998  1.00 95.91  ? 132 TYR D CD1 1 
ATOM 2218 C CD2 . TYR B 1 132 ? 211.596 67.045  74.231  1.00 95.91  ? 132 TYR D CD2 1 
ATOM 2219 C CE1 . TYR B 1 132 ? 211.563 68.473  71.832  1.00 95.91  ? 132 TYR D CE1 1 
ATOM 2220 C CE2 . TYR B 1 132 ? 212.175 66.496  73.074  1.00 95.91  ? 132 TYR D CE2 1 
ATOM 2221 C CZ  . TYR B 1 132 ? 212.155 67.221  71.865  1.00 95.91  ? 132 TYR D CZ  1 
ATOM 2222 O OH  . TYR B 1 132 ? 212.744 66.755  70.689  1.00 95.91  ? 132 TYR D OH  1 
ATOM 2223 N N   . ARG B 1 133 ? 209.092 71.846  76.892  1.00 126.66 ? 133 ARG D N   1 
ATOM 2224 C CA  . ARG B 1 133 ? 208.270 72.332  77.976  1.00 126.66 ? 133 ARG D CA  1 
ATOM 2225 C C   . ARG B 1 133 ? 207.118 73.097  77.322  1.00 126.66 ? 133 ARG D C   1 
ATOM 2226 O O   . ARG B 1 133 ? 207.307 73.779  76.306  1.00 126.66 ? 133 ARG D O   1 
ATOM 2227 C CB  . ARG B 1 133 ? 209.101 73.242  78.861  1.00 109.26 ? 133 ARG D CB  1 
ATOM 2228 C CG  . ARG B 1 133 ? 208.486 73.578  80.180  1.00 109.26 ? 133 ARG D CG  1 
ATOM 2229 C CD  . ARG B 1 133 ? 209.422 74.523  80.896  1.00 109.26 ? 133 ARG D CD  1 
ATOM 2230 N NE  . ARG B 1 133 ? 210.695 73.895  81.257  1.00 109.26 ? 133 ARG D NE  1 
ATOM 2231 C CZ  . ARG B 1 133 ? 211.871 74.525  81.259  1.00 109.26 ? 133 ARG D CZ  1 
ATOM 2232 N NH1 . ARG B 1 133 ? 211.945 75.802  80.904  1.00 109.26 ? 133 ARG D NH1 1 
ATOM 2233 N NH2 . ARG B 1 133 ? 212.975 73.892  81.645  1.00 109.26 ? 133 ARG D NH2 1 
ATOM 2234 N N   . PRO B 1 134 ? 205.905 72.975  77.884  1.00 96.97  ? 134 PRO D N   1 
ATOM 2235 C CA  . PRO B 1 134 ? 204.680 73.622  77.402  1.00 96.97  ? 134 PRO D CA  1 
ATOM 2236 C C   . PRO B 1 134 ? 204.696 75.131  77.468  1.00 96.97  ? 134 PRO D C   1 
ATOM 2237 O O   . PRO B 1 134 ? 205.518 75.738  78.160  1.00 96.97  ? 134 PRO D O   1 
ATOM 2238 C CB  . PRO B 1 134 ? 203.596 73.048  78.305  1.00 80.07  ? 134 PRO D CB  1 
ATOM 2239 C CG  . PRO B 1 134 ? 204.137 71.727  78.666  1.00 80.07  ? 134 PRO D CG  1 
ATOM 2240 C CD  . PRO B 1 134 ? 205.586 72.035  78.962  1.00 80.07  ? 134 PRO D CD  1 
ATOM 2241 N N   . PRO B 1 135 ? 203.763 75.759  76.745  1.00 156.16 ? 135 PRO D N   1 
ATOM 2242 C CA  . PRO B 1 135 ? 203.652 77.217  76.712  1.00 156.16 ? 135 PRO D CA  1 
ATOM 2243 C C   . PRO B 1 135 ? 203.225 77.728  78.081  1.00 156.16 ? 135 PRO D C   1 
ATOM 2244 O O   . PRO B 1 135 ? 203.931 78.500  78.737  1.00 156.16 ? 135 PRO D O   1 
ATOM 2245 C CB  . PRO B 1 135 ? 202.588 77.449  75.640  1.00 130.17 ? 135 PRO D CB  1 
ATOM 2246 C CG  . PRO B 1 135 ? 201.699 76.231  75.781  1.00 130.17 ? 135 PRO D CG  1 
ATOM 2247 C CD  . PRO B 1 135 ? 202.704 75.121  75.936  1.00 130.17 ? 135 PRO D CD  1 
ATOM 2248 N N   . ASN B 1 136 ? 202.057 77.262  78.502  1.00 142.56 ? 136 ASN D N   1 
ATOM 2249 C CA  . ASN B 1 136 ? 201.483 77.637  79.776  1.00 142.56 ? 136 ASN D CA  1 
ATOM 2250 C C   . ASN B 1 136 ? 201.962 76.691  80.874  1.00 142.56 ? 136 ASN D C   1 
ATOM 2251 O O   . ASN B 1 136 ? 202.435 75.584  80.600  1.00 142.56 ? 136 ASN D O   1 
ATOM 2252 C CB  . ASN B 1 136 ? 199.955 77.589  79.684  1.00 132.66 ? 136 ASN D CB  1 
ATOM 2253 C CG  . ASN B 1 136 ? 199.431 76.187  79.416  1.00 132.66 ? 136 ASN D CG  1 
ATOM 2254 O OD1 . ASN B 1 136 ? 199.742 75.577  78.391  1.00 132.66 ? 136 ASN D OD1 1 
ATOM 2255 N ND2 . ASN B 1 136 ? 198.634 75.668  80.343  1.00 132.66 ? 136 ASN D ND2 1 
ATOM 2256 N N   . ALA B 1 137 ? 201.829 77.147  82.117  1.00 108.88 ? 137 ALA D N   1 
ATOM 2257 C CA  . ALA B 1 137 ? 202.222 76.382  83.290  1.00 108.88 ? 137 ALA D CA  1 
ATOM 2258 C C   . ALA B 1 137 ? 200.980 75.991  84.079  1.00 108.88 ? 137 ALA D C   1 
ATOM 2259 O O   . ALA B 1 137 ? 199.856 76.326  83.701  1.00 108.88 ? 137 ALA D O   1 
ATOM 2260 C CB  . ALA B 1 137 ? 203.141 77.214  84.164  1.00 68.60  ? 137 ALA D CB  1 
ATOM 2261 N N   . PRO B 1 138 ? 201.166 75.261  85.185  1.00 82.09  ? 138 PRO D N   1 
ATOM 2262 C CA  . PRO B 1 138 ? 200.027 74.845  86.005  1.00 82.09  ? 138 PRO D CA  1 
ATOM 2263 C C   . PRO B 1 138 ? 199.748 75.838  87.137  1.00 82.09  ? 138 PRO D C   1 
ATOM 2264 O O   . PRO B 1 138 ? 200.681 76.448  87.685  1.00 82.09  ? 138 PRO D O   1 
ATOM 2265 C CB  . PRO B 1 138 ? 200.468 73.475  86.515  1.00 96.84  ? 138 PRO D CB  1 
ATOM 2266 C CG  . PRO B 1 138 ? 201.917 73.690  86.757  1.00 96.84  ? 138 PRO D CG  1 
ATOM 2267 C CD  . PRO B 1 138 ? 202.364 74.471  85.527  1.00 96.84  ? 138 PRO D CD  1 
ATOM 2268 N N   . ILE B 1 139 ? 198.469 76.003  87.479  1.00 88.40  ? 139 ILE D N   1 
ATOM 2269 C CA  . ILE B 1 139 ? 198.094 76.927  88.536  1.00 88.40  ? 139 ILE D CA  1 
ATOM 2270 C C   . ILE B 1 139 ? 196.870 76.513  89.346  1.00 88.40  ? 139 ILE D C   1 
ATOM 2271 O O   . ILE B 1 139 ? 196.299 75.437  89.144  1.00 88.40  ? 139 ILE D O   1 
ATOM 2272 C CB  . ILE B 1 139 ? 197.895 78.326  87.963  1.00 78.49  ? 139 ILE D CB  1 
ATOM 2273 C CG1 . ILE B 1 139 ? 199.099 78.657  87.078  1.00 78.49  ? 139 ILE D CG1 1 
ATOM 2274 C CG2 . ILE B 1 139 ? 197.813 79.357  89.087  1.00 78.49  ? 139 ILE D CG2 1 
ATOM 2275 C CD1 . ILE B 1 139 ? 198.839 79.657  85.970  1.00 78.49  ? 139 ILE D CD1 1 
ATOM 2276 N N   . LEU B 1 140 ? 196.478 77.413  90.243  1.00 82.63  ? 140 LEU D N   1 
ATOM 2277 C CA  . LEU B 1 140 ? 195.394 77.242  91.206  1.00 82.63  ? 140 LEU D CA  1 
ATOM 2278 C C   . LEU B 1 140 ? 193.916 77.344  90.756  1.00 82.63  ? 140 LEU D C   1 
ATOM 2279 O O   . LEU B 1 140 ? 193.304 78.425  90.644  1.00 82.63  ? 140 LEU D O   1 
ATOM 2280 C CB  . LEU B 1 140 ? 195.743 78.172  92.363  1.00 78.70  ? 140 LEU D CB  1 
ATOM 2281 C CG  . LEU B 1 140 ? 197.220 77.837  92.696  1.00 78.70  ? 140 LEU D CG  1 
ATOM 2282 C CD1 . LEU B 1 140 ? 198.013 79.082  93.041  1.00 78.70  ? 140 LEU D CD1 1 
ATOM 2283 C CD2 . LEU B 1 140 ? 197.274 76.813  93.818  1.00 78.70  ? 140 LEU D CD2 1 
ATOM 2284 N N   . SER B 1 141 ? 193.361 76.150  90.550  1.00 199.25 ? 141 SER D N   1 
ATOM 2285 C CA  . SER B 1 141 ? 192.008 75.942  90.050  1.00 199.25 ? 141 SER D CA  1 
ATOM 2286 C C   . SER B 1 141 ? 190.867 75.702  91.038  1.00 199.25 ? 141 SER D C   1 
ATOM 2287 O O   . SER B 1 141 ? 190.641 74.569  91.473  1.00 199.25 ? 141 SER D O   1 
ATOM 2288 C CB  . SER B 1 141 ? 192.022 74.772  89.049  1.00 111.20 ? 141 SER D CB  1 
ATOM 2289 O OG  . SER B 1 141 ? 192.254 73.520  89.696  1.00 111.20 ? 141 SER D OG  1 
ATOM 2290 N N   . THR B 1 142 ? 190.136 76.764  91.376  1.00 197.48 ? 142 THR D N   1 
ATOM 2291 C CA  . THR B 1 142 ? 188.981 76.601  92.244  1.00 197.48 ? 142 THR D CA  1 
ATOM 2292 C C   . THR B 1 142 ? 187.869 76.367  91.225  1.00 197.48 ? 142 THR D C   1 
ATOM 2293 O O   . THR B 1 142 ? 186.859 77.055  91.168  1.00 197.48 ? 142 THR D O   1 
ATOM 2294 C CB  . THR B 1 142 ? 188.738 77.808  93.172  1.00 91.17  ? 142 THR D CB  1 
ATOM 2295 O OG1 . THR B 1 142 ? 189.205 79.021  92.551  1.00 91.17  ? 142 THR D OG1 1 
ATOM 2296 C CG2 . THR B 1 142 ? 189.410 77.486  94.579  1.00 91.17  ? 142 THR D CG2 1 
ATOM 2297 N N   . LEU B 1 143 ? 188.235 75.415  90.355  1.00 200.00 ? 143 LEU D N   1 
ATOM 2298 C CA  . LEU B 1 143 ? 187.555 74.761  89.208  1.00 200.00 ? 143 LEU D CA  1 
ATOM 2299 C C   . LEU B 1 143 ? 187.269 75.294  87.782  1.00 200.00 ? 143 LEU D C   1 
ATOM 2300 O O   . LEU B 1 143 ? 186.581 74.621  87.015  1.00 200.00 ? 143 LEU D O   1 
ATOM 2301 C CB  . LEU B 1 143 ? 186.336 73.979  89.687  1.00 126.14 ? 143 LEU D CB  1 
ATOM 2302 C CG  . LEU B 1 143 ? 186.712 72.462  89.804  1.00 126.14 ? 143 LEU D CG  1 
ATOM 2303 C CD1 . LEU B 1 143 ? 188.071 72.247  90.554  1.00 126.14 ? 143 LEU D CD1 1 
ATOM 2304 C CD2 . LEU B 1 143 ? 185.610 71.643  90.484  1.00 126.14 ? 143 LEU D CD2 1 
ATOM 2305 N N   . PRO B 1 144 ? 187.787 76.491  87.394  1.00 200.00 ? 144 PRO D N   1 
ATOM 2306 C CA  . PRO B 1 144 ? 187.545 76.966  85.997  1.00 200.00 ? 144 PRO D CA  1 
ATOM 2307 C C   . PRO B 1 144 ? 188.291 76.076  84.918  1.00 200.00 ? 144 PRO D C   1 
ATOM 2308 O O   . PRO B 1 144 ? 189.130 75.204  85.249  1.00 200.00 ? 144 PRO D O   1 
ATOM 2309 C CB  . PRO B 1 144 ? 188.125 78.382  86.008  1.00 75.78  ? 144 PRO D CB  1 
ATOM 2310 C CG  . PRO B 1 144 ? 187.648 78.887  87.502  1.00 75.78  ? 144 PRO D CG  1 
ATOM 2311 C CD  . PRO B 1 144 ? 187.649 77.619  88.380  1.00 75.78  ? 144 PRO D CD  1 
ATOM 2312 N N   . GLU B 1 145 ? 187.956 76.295  83.641  1.00 182.13 ? 145 GLU D N   1 
ATOM 2313 C CA  . GLU B 1 145 ? 188.554 75.600  82.486  1.00 182.13 ? 145 GLU D CA  1 
ATOM 2314 C C   . GLU B 1 145 ? 188.342 76.373  81.146  1.00 182.13 ? 145 GLU D C   1 
ATOM 2315 O O   . GLU B 1 145 ? 187.666 77.403  81.116  1.00 182.13 ? 145 GLU D O   1 
ATOM 2316 C CB  . GLU B 1 145 ? 188.011 74.153  82.363  1.00 200.00 ? 145 GLU D CB  1 
ATOM 2317 C CG  . GLU B 1 145 ? 188.347 73.479  81.000  1.00 137.63 ? 145 GLU D CG  1 
ATOM 2318 C CD  . GLU B 1 145 ? 188.440 71.949  81.013  1.00 137.63 ? 145 GLU D CD  1 
ATOM 2319 O OE1 . GLU B 1 145 ? 187.600 71.304  81.676  1.00 137.63 ? 145 GLU D OE1 1 
ATOM 2320 O OE2 . GLU B 1 145 ? 189.362 71.412  80.343  1.00 137.63 ? 145 GLU D OE2 1 
ATOM 2321 N N   . THR B 1 146 ? 188.948 75.872  80.058  1.00 200.00 ? 146 THR D N   1 
ATOM 2322 C CA  . THR B 1 146 ? 188.883 76.451  78.691  1.00 200.00 ? 146 THR D CA  1 
ATOM 2323 C C   . THR B 1 146 ? 187.886 75.714  77.767  1.00 200.00 ? 146 THR D C   1 
ATOM 2324 O O   . THR B 1 146 ? 187.282 76.384  76.903  1.00 200.00 ? 146 THR D O   1 
ATOM 2325 C CB  . THR B 1 146 ? 190.275 76.435  77.996  1.00 189.59 ? 146 THR D CB  1 
ATOM 2326 O OG1 . THR B 1 146 ? 191.179 77.261  78.743  1.00 79.55  ? 146 THR D OG1 1 
ATOM 2327 C CG2 . THR B 1 146 ? 190.154 76.934  76.558  1.00 79.55  ? 146 THR D CG2 1 
ATOM 2328 N N   . MET C 1 1   ? 182.083 116.161 152.044 1.00 120.38 ? 1   MET B N   1 
ATOM 2329 C CA  . MET C 1 1   ? 181.220 116.006 153.252 1.00 120.38 ? 1   MET B CA  1 
ATOM 2330 C C   . MET C 1 1   ? 181.316 114.571 153.775 1.00 120.38 ? 1   MET B C   1 
ATOM 2331 O O   . MET C 1 1   ? 181.802 113.676 153.075 1.00 120.38 ? 1   MET B O   1 
ATOM 2332 C CB  . MET C 1 1   ? 179.758 116.317 152.911 1.00 91.01  ? 1   MET B CB  1 
ATOM 2333 C CG  . MET C 1 1   ? 178.964 115.076 152.541 1.00 91.01  ? 1   MET B CG  1 
ATOM 2334 S SD  . MET C 1 1   ? 177.716 115.413 151.329 1.00 91.01  ? 1   MET B SD  1 
ATOM 2335 C CE  . MET C 1 1   ? 178.642 115.394 149.765 1.00 91.01  ? 1   MET B CE  1 
ATOM 2336 N N   . ASP C 1 2   ? 180.832 114.372 155.002 1.00 147.74 ? 2   ASP B N   1 
ATOM 2337 C CA  . ASP C 1 2   ? 180.835 113.071 155.683 1.00 147.74 ? 2   ASP B CA  1 
ATOM 2338 C C   . ASP C 1 2   ? 180.243 111.952 154.812 1.00 147.74 ? 2   ASP B C   1 
ATOM 2339 O O   . ASP C 1 2   ? 179.028 111.732 154.824 1.00 147.74 ? 2   ASP B O   1 
ATOM 2340 C CB  . ASP C 1 2   ? 180.045 113.185 157.012 1.00 123.59 ? 2   ASP B CB  1 
ATOM 2341 C CG  . ASP C 1 2   ? 180.126 111.915 157.886 1.00 123.59 ? 2   ASP B CG  1 
ATOM 2342 O OD1 . ASP C 1 2   ? 181.247 111.534 158.301 1.00 123.59 ? 2   ASP B OD1 1 
ATOM 2343 O OD2 . ASP C 1 2   ? 179.063 111.304 158.174 1.00 123.59 ? 2   ASP B OD2 1 
ATOM 2344 N N   . ILE C 1 3   ? 181.103 111.261 154.054 1.00 112.99 ? 3   ILE B N   1 
ATOM 2345 C CA  . ILE C 1 3   ? 180.684 110.144 153.188 1.00 112.99 ? 3   ILE B CA  1 
ATOM 2346 C C   . ILE C 1 3   ? 181.852 109.182 152.909 1.00 112.99 ? 3   ILE B C   1 
ATOM 2347 O O   . ILE C 1 3   ? 182.862 109.554 152.309 1.00 112.99 ? 3   ILE B O   1 
ATOM 2348 C CB  . ILE C 1 3   ? 180.100 110.656 151.836 1.00 70.70  ? 3   ILE B CB  1 
ATOM 2349 C CG1 . ILE C 1 3   ? 181.228 111.134 150.905 1.00 70.70  ? 3   ILE B CG1 1 
ATOM 2350 C CG2 . ILE C 1 3   ? 179.072 111.782 152.106 1.00 70.70  ? 3   ILE B CG2 1 
ATOM 2351 C CD1 . ILE C 1 3   ? 181.679 110.091 149.882 1.00 70.70  ? 3   ILE B CD1 1 
ATOM 2352 N N   . ASP C 1 4   ? 181.706 107.940 153.356 1.00 111.13 ? 4   ASP B N   1 
ATOM 2353 C CA  . ASP C 1 4   ? 182.756 106.936 153.182 1.00 111.13 ? 4   ASP B CA  1 
ATOM 2354 C C   . ASP C 1 4   ? 182.654 106.268 151.813 1.00 111.13 ? 4   ASP B C   1 
ATOM 2355 O O   . ASP C 1 4   ? 181.574 105.848 151.398 1.00 111.13 ? 4   ASP B O   1 
ATOM 2356 C CB  . ASP C 1 4   ? 182.657 105.877 154.300 1.00 84.24  ? 4   ASP B CB  1 
ATOM 2357 C CG  . ASP C 1 4   ? 183.942 105.078 154.481 1.00 84.24  ? 4   ASP B CG  1 
ATOM 2358 O OD1 . ASP C 1 4   ? 184.386 104.442 153.502 1.00 84.24  ? 4   ASP B OD1 1 
ATOM 2359 O OD2 . ASP C 1 4   ? 184.496 105.087 155.606 1.00 84.24  ? 4   ASP B OD2 1 
ATOM 2360 N N   . PRO C 1 5   ? 183.785 106.171 151.093 1.00 61.10  ? 5   PRO B N   1 
ATOM 2361 C CA  . PRO C 1 5   ? 183.862 105.555 149.762 1.00 61.10  ? 5   PRO B CA  1 
ATOM 2362 C C   . PRO C 1 5   ? 183.872 104.036 149.818 1.00 61.10  ? 5   PRO B C   1 
ATOM 2363 O O   . PRO C 1 5   ? 184.158 103.375 148.822 1.00 61.10  ? 5   PRO B O   1 
ATOM 2364 C CB  . PRO C 1 5   ? 185.170 106.103 149.210 1.00 67.30  ? 5   PRO B CB  1 
ATOM 2365 C CG  . PRO C 1 5   ? 186.017 106.212 150.443 1.00 67.30  ? 5   PRO B CG  1 
ATOM 2366 C CD  . PRO C 1 5   ? 185.067 106.806 151.451 1.00 67.30  ? 5   PRO B CD  1 
ATOM 2367 N N   . TYR C 1 6   ? 183.548 103.499 150.989 1.00 58.25  ? 6   TYR B N   1 
ATOM 2368 C CA  . TYR C 1 6   ? 183.550 102.063 151.211 1.00 58.25  ? 6   TYR B CA  1 
ATOM 2369 C C   . TYR C 1 6   ? 182.246 101.527 151.771 1.00 58.25  ? 6   TYR B C   1 
ATOM 2370 O O   . TYR C 1 6   ? 181.928 100.353 151.563 1.00 58.25  ? 6   TYR B O   1 
ATOM 2371 C CB  . TYR C 1 6   ? 184.668 101.703 152.176 1.00 94.59  ? 6   TYR B CB  1 
ATOM 2372 C CG  . TYR C 1 6   ? 186.051 102.060 151.686 1.00 94.59  ? 6   TYR B CG  1 
ATOM 2373 C CD1 . TYR C 1 6   ? 186.800 101.157 150.945 1.00 94.59  ? 6   TYR B CD1 1 
ATOM 2374 C CD2 . TYR C 1 6   ? 186.632 103.282 151.997 1.00 94.59  ? 6   TYR B CD2 1 
ATOM 2375 C CE1 . TYR C 1 6   ? 188.115 101.457 150.529 1.00 94.59  ? 6   TYR B CE1 1 
ATOM 2376 C CE2 . TYR C 1 6   ? 187.948 103.594 151.582 1.00 94.59  ? 6   TYR B CE2 1 
ATOM 2377 C CZ  . TYR C 1 6   ? 188.686 102.672 150.852 1.00 94.59  ? 6   TYR B CZ  1 
ATOM 2378 O OH  . TYR C 1 6   ? 189.997 102.936 150.481 1.00 94.59  ? 6   TYR B OH  1 
ATOM 2379 N N   . LYS C 1 7   ? 181.516 102.375 152.501 1.00 131.72 ? 7   LYS B N   1 
ATOM 2380 C CA  . LYS C 1 7   ? 180.234 101.990 153.102 1.00 131.72 ? 7   LYS B CA  1 
ATOM 2381 C C   . LYS C 1 7   ? 179.494 101.128 152.090 1.00 131.72 ? 7   LYS B C   1 
ATOM 2382 O O   . LYS C 1 7   ? 178.772 100.198 152.446 1.00 131.72 ? 7   LYS B O   1 
ATOM 2383 C CB  . LYS C 1 7   ? 179.380 103.236 153.459 1.00 128.99 ? 7   LYS B CB  1 
ATOM 2384 C CG  . LYS C 1 7   ? 179.268 103.571 154.981 1.00 128.99 ? 7   LYS B CG  1 
ATOM 2385 C CD  . LYS C 1 7   ? 178.334 104.783 155.299 1.00 128.99 ? 7   LYS B CD  1 
ATOM 2386 C CE  . LYS C 1 7   ? 178.243 105.110 156.822 1.00 128.99 ? 7   LYS B CE  1 
ATOM 2387 N NZ  . LYS C 1 7   ? 177.445 106.346 157.183 1.00 128.99 ? 7   LYS B NZ  1 
ATOM 2388 N N   . GLU C 1 8   ? 179.710 101.447 150.821 1.00 75.58  ? 8   GLU B N   1 
ATOM 2389 C CA  . GLU C 1 8   ? 179.100 100.751 149.698 1.00 75.58  ? 8   GLU B CA  1 
ATOM 2390 C C   . GLU C 1 8   ? 179.440 99.261  149.591 1.00 75.58  ? 8   GLU B C   1 
ATOM 2391 O O   . GLU C 1 8   ? 178.689 98.464  149.006 1.00 75.58  ? 8   GLU B O   1 
ATOM 2392 C CB  . GLU C 1 8   ? 179.520 101.476 148.435 1.00 104.08 ? 8   GLU B CB  1 
ATOM 2393 C CG  . GLU C 1 8   ? 179.295 100.734 147.174 1.00 104.08 ? 8   GLU B CG  1 
ATOM 2394 C CD  . GLU C 1 8   ? 179.598 101.607 146.004 1.00 104.08 ? 8   GLU B CD  1 
ATOM 2395 O OE1 . GLU C 1 8   ? 180.370 102.572 146.186 1.00 104.08 ? 8   GLU B OE1 1 
ATOM 2396 O OE2 . GLU C 1 8   ? 179.071 101.330 144.912 1.00 104.08 ? 8   GLU B OE2 1 
ATOM 2397 N N   . PHE C 1 9   ? 180.572 98.892  150.172 1.00 88.88  ? 9   PHE B N   1 
ATOM 2398 C CA  . PHE C 1 9   ? 181.037 97.519  150.136 1.00 88.88  ? 9   PHE B CA  1 
ATOM 2399 C C   . PHE C 1 9   ? 181.072 96.892  151.520 1.00 88.88  ? 9   PHE B C   1 
ATOM 2400 O O   . PHE C 1 9   ? 181.959 96.094  151.811 1.00 88.88  ? 9   PHE B O   1 
ATOM 2401 C CB  . PHE C 1 9   ? 182.425 97.502  149.523 1.00 83.27  ? 9   PHE B CB  1 
ATOM 2402 C CG  . PHE C 1 9   ? 182.500 98.223  148.214 1.00 83.27  ? 9   PHE B CG  1 
ATOM 2403 C CD1 . PHE C 1 9   ? 181.984 97.649  147.054 1.00 83.27  ? 9   PHE B CD1 1 
ATOM 2404 C CD2 . PHE C 1 9   ? 183.067 99.482  148.133 1.00 83.27  ? 9   PHE B CD2 1 
ATOM 2405 C CE1 . PHE C 1 9   ? 182.036 98.322  145.821 1.00 83.27  ? 9   PHE B CE1 1 
ATOM 2406 C CE2 . PHE C 1 9   ? 183.123 100.163 146.907 1.00 83.27  ? 9   PHE B CE2 1 
ATOM 2407 C CZ  . PHE C 1 9   ? 182.607 99.579  145.751 1.00 83.27  ? 9   PHE B CZ  1 
ATOM 2408 N N   . GLY C 1 10  ? 180.105 97.250  152.366 1.00 142.27 ? 10  GLY B N   1 
ATOM 2409 C CA  . GLY C 1 10  ? 180.057 96.718  153.722 1.00 142.27 ? 10  GLY B CA  1 
ATOM 2410 C C   . GLY C 1 10  ? 181.405 96.874  154.401 1.00 142.27 ? 10  GLY B C   1 
ATOM 2411 O O   . GLY C 1 10  ? 181.806 96.048  155.233 1.00 142.27 ? 10  GLY B O   1 
ATOM 2412 N N   . ALA C 1 11  ? 182.092 97.956  154.038 1.00 91.36  ? 11  ALA B N   1 
ATOM 2413 C CA  . ALA C 1 11  ? 183.421 98.265  154.549 1.00 91.36  ? 11  ALA B CA  1 
ATOM 2414 C C   . ALA C 1 11  ? 183.600 99.735  154.930 1.00 91.36  ? 11  ALA B C   1 
ATOM 2415 O O   . ALA C 1 11  ? 182.647 100.509 154.881 1.00 91.36  ? 11  ALA B O   1 
ATOM 2416 C CB  . ALA C 1 11  ? 184.434 97.888  153.514 1.00 53.82  ? 11  ALA B CB  1 
ATOM 2417 N N   . THR C 1 12  ? 184.833 100.112 155.287 1.00 69.17  ? 12  THR B N   1 
ATOM 2418 C CA  . THR C 1 12  ? 185.163 101.487 155.703 1.00 69.17  ? 12  THR B CA  1 
ATOM 2419 C C   . THR C 1 12  ? 186.665 101.894 155.734 1.00 69.17  ? 12  THR B C   1 
ATOM 2420 O O   . THR C 1 12  ? 187.561 101.045 155.775 1.00 69.17  ? 12  THR B O   1 
ATOM 2421 C CB  . THR C 1 12  ? 184.558 101.776 157.100 1.00 56.23  ? 12  THR B CB  1 
ATOM 2422 O OG1 . THR C 1 12  ? 185.315 102.815 157.746 1.00 56.23  ? 12  THR B OG1 1 
ATOM 2423 C CG2 . THR C 1 12  ? 184.536 100.490 157.959 1.00 56.23  ? 12  THR B CG2 1 
ATOM 2424 N N   . VAL C 1 13  ? 186.923 103.205 155.713 1.00 104.17 ? 13  VAL B N   1 
ATOM 2425 C CA  . VAL C 1 13  ? 188.292 103.746 155.753 1.00 104.17 ? 13  VAL B CA  1 
ATOM 2426 C C   . VAL C 1 13  ? 188.738 103.759 157.192 1.00 104.17 ? 13  VAL B C   1 
ATOM 2427 O O   . VAL C 1 13  ? 189.895 103.451 157.529 1.00 104.17 ? 13  VAL B O   1 
ATOM 2428 C CB  . VAL C 1 13  ? 188.375 105.219 155.234 1.00 60.81  ? 13  VAL B CB  1 
ATOM 2429 C CG1 . VAL C 1 13  ? 187.333 106.099 155.946 1.00 60.81  ? 13  VAL B CG1 1 
ATOM 2430 C CG2 . VAL C 1 13  ? 189.805 105.775 155.455 1.00 60.81  ? 13  VAL B CG2 1 
ATOM 2431 N N   . GLU C 1 14  ? 187.790 104.153 158.033 1.00 121.76 ? 14  GLU B N   1 
ATOM 2432 C CA  . GLU C 1 14  ? 188.007 104.215 159.453 1.00 121.76 ? 14  GLU B CA  1 
ATOM 2433 C C   . GLU C 1 14  ? 188.598 102.850 159.751 1.00 121.76 ? 14  GLU B C   1 
ATOM 2434 O O   . GLU C 1 14  ? 189.304 102.648 160.735 1.00 121.76 ? 14  GLU B O   1 
ATOM 2435 C CB  . GLU C 1 14  ? 186.660 104.461 160.141 1.00 114.55 ? 14  GLU B CB  1 
ATOM 2436 C CG  . GLU C 1 14  ? 186.160 105.896 159.925 1.00 114.55 ? 14  GLU B CG  1 
ATOM 2437 C CD  . GLU C 1 14  ? 184.670 106.076 160.171 1.00 114.55 ? 14  GLU B CD  1 
ATOM 2438 O OE1 . GLU C 1 14  ? 184.169 105.563 161.193 1.00 114.55 ? 14  GLU B OE1 1 
ATOM 2439 O OE2 . GLU C 1 14  ? 184.003 106.749 159.345 1.00 114.55 ? 14  GLU B OE2 1 
ATOM 2440 N N   . LEU C 1 15  ? 188.353 101.933 158.826 1.00 72.09  ? 15  LEU B N   1 
ATOM 2441 C CA  . LEU C 1 15  ? 188.837 100.577 158.926 1.00 72.09  ? 15  LEU B CA  1 
ATOM 2442 C C   . LEU C 1 15  ? 190.280 100.387 158.440 1.00 72.09  ? 15  LEU B C   1 
ATOM 2443 O O   . LEU C 1 15  ? 191.042 99.612  159.007 1.00 72.09  ? 15  LEU B O   1 
ATOM 2444 C CB  . LEU C 1 15  ? 187.902 99.679  158.130 1.00 35.84  ? 15  LEU B CB  1 
ATOM 2445 C CG  . LEU C 1 15  ? 188.028 98.171  158.263 1.00 35.84  ? 15  LEU B CG  1 
ATOM 2446 C CD1 . LEU C 1 15  ? 186.831 97.584  157.570 1.00 35.84  ? 15  LEU B CD1 1 
ATOM 2447 C CD2 . LEU C 1 15  ? 189.323 97.635  157.678 1.00 35.84  ? 15  LEU B CD2 1 
ATOM 2448 N N   . LEU C 1 16  ? 190.679 101.104 157.404 1.00 57.63  ? 16  LEU B N   1 
ATOM 2449 C CA  . LEU C 1 16  ? 192.016 100.897 156.873 1.00 57.63  ? 16  LEU B CA  1 
ATOM 2450 C C   . LEU C 1 16  ? 193.095 101.799 157.436 1.00 57.63  ? 16  LEU B C   1 
ATOM 2451 O O   . LEU C 1 16  ? 194.220 101.802 156.940 1.00 57.63  ? 16  LEU B O   1 
ATOM 2452 C CB  . LEU C 1 16  ? 191.965 101.015 155.352 1.00 52.23  ? 16  LEU B CB  1 
ATOM 2453 C CG  . LEU C 1 16  ? 190.711 100.386 154.721 1.00 52.23  ? 16  LEU B CG  1 
ATOM 2454 C CD1 . LEU C 1 16  ? 190.675 100.688 153.239 1.00 52.23  ? 16  LEU B CD1 1 
ATOM 2455 C CD2 . LEU C 1 16  ? 190.696 98.899  154.954 1.00 52.23  ? 16  LEU B CD2 1 
ATOM 2456 N N   . SER C 1 17  ? 192.762 102.563 158.467 1.00 123.11 ? 17  SER B N   1 
ATOM 2457 C CA  . SER C 1 17  ? 193.741 103.442 159.090 1.00 123.11 ? 17  SER B CA  1 
ATOM 2458 C C   . SER C 1 17  ? 194.937 102.569 159.475 1.00 123.11 ? 17  SER B C   1 
ATOM 2459 O O   . SER C 1 17  ? 196.104 103.009 159.499 1.00 123.11 ? 17  SER B O   1 
ATOM 2460 C CB  . SER C 1 17  ? 193.126 104.076 160.345 1.00 128.97 ? 17  SER B CB  1 
ATOM 2461 O OG  . SER C 1 17  ? 194.120 104.750 161.121 1.00 128.97 ? 17  SER B OG  1 
ATOM 2462 N N   . PHE C 1 18  ? 194.596 101.309 159.734 1.00 102.53 ? 18  PHE B N   1 
ATOM 2463 C CA  . PHE C 1 18  ? 195.516 100.277 160.163 1.00 102.53 ? 18  PHE B CA  1 
ATOM 2464 C C   . PHE C 1 18  ? 196.556 99.846  159.181 1.00 102.53 ? 18  PHE B C   1 
ATOM 2465 O O   . PHE C 1 18  ? 197.583 99.306  159.559 1.00 102.53 ? 18  PHE B O   1 
ATOM 2466 C CB  . PHE C 1 18  ? 194.731 99.057  160.567 1.00 127.36 ? 18  PHE B CB  1 
ATOM 2467 C CG  . PHE C 1 18  ? 193.657 99.353  161.534 1.00 127.36 ? 18  PHE B CG  1 
ATOM 2468 C CD1 . PHE C 1 18  ? 193.948 99.968  162.748 1.00 127.36 ? 18  PHE B CD1 1 
ATOM 2469 C CD2 . PHE C 1 18  ? 192.350 99.046  161.232 1.00 127.36 ? 18  PHE B CD2 1 
ATOM 2470 C CE1 . PHE C 1 18  ? 192.939 100.275 163.648 1.00 127.36 ? 18  PHE B CE1 1 
ATOM 2471 C CE2 . PHE C 1 18  ? 191.337 99.345  162.115 1.00 127.36 ? 18  PHE B CE2 1 
ATOM 2472 C CZ  . PHE C 1 18  ? 191.627 99.962  163.328 1.00 127.36 ? 18  PHE B CZ  1 
ATOM 2473 N N   . LEU C 1 19  ? 196.312 100.066 157.911 1.00 85.65  ? 19  LEU B N   1 
ATOM 2474 C CA  . LEU C 1 19  ? 197.301 99.637  156.963 1.00 85.65  ? 19  LEU B CA  1 
ATOM 2475 C C   . LEU C 1 19  ? 198.610 100.410 156.983 1.00 85.65  ? 19  LEU B C   1 
ATOM 2476 O O   . LEU C 1 19  ? 198.645 101.636 156.807 1.00 85.65  ? 19  LEU B O   1 
ATOM 2477 C CB  . LEU C 1 19  ? 196.669 99.618  155.586 1.00 72.95  ? 19  LEU B CB  1 
ATOM 2478 C CG  . LEU C 1 19  ? 195.662 98.468  155.526 1.00 72.95  ? 19  LEU B CG  1 
ATOM 2479 C CD1 . LEU C 1 19  ? 195.980 97.576  154.335 1.00 72.95  ? 19  LEU B CD1 1 
ATOM 2480 C CD2 . LEU C 1 19  ? 195.748 97.650  156.803 1.00 72.95  ? 19  LEU B CD2 1 
ATOM 2481 N N   . PRO C 1 20  ? 199.714 99.690  157.237 1.00 62.24  ? 20  PRO B N   1 
ATOM 2482 C CA  . PRO C 1 20  ? 201.021 100.337 157.277 1.00 62.24  ? 20  PRO B CA  1 
ATOM 2483 C C   . PRO C 1 20  ? 201.430 100.793 155.908 1.00 62.24  ? 20  PRO B C   1 
ATOM 2484 O O   . PRO C 1 20  ? 201.373 100.036 154.938 1.00 62.24  ? 20  PRO B O   1 
ATOM 2485 C CB  . PRO C 1 20  ? 201.934 99.250  157.816 1.00 78.82  ? 20  PRO B CB  1 
ATOM 2486 C CG  . PRO C 1 20  ? 201.019 98.509  158.717 1.00 78.82  ? 20  PRO B CG  1 
ATOM 2487 C CD  . PRO C 1 20  ? 199.781 98.371  157.879 1.00 78.82  ? 20  PRO B CD  1 
ATOM 2488 N N   . SER C 1 21  ? 201.834 102.052 155.855 1.00 82.92  ? 21  SER B N   1 
ATOM 2489 C CA  . SER C 1 21  ? 202.280 102.689 154.637 1.00 82.92  ? 21  SER B CA  1 
ATOM 2490 C C   . SER C 1 21  ? 203.277 101.760 153.915 1.00 82.92  ? 21  SER B C   1 
ATOM 2491 O O   . SER C 1 21  ? 203.332 101.711 152.684 1.00 82.92  ? 21  SER B O   1 
ATOM 2492 C CB  . SER C 1 21  ? 202.922 104.027 155.024 1.00 87.52  ? 21  SER B CB  1 
ATOM 2493 O OG  . SER C 1 21  ? 202.200 104.647 156.090 1.00 87.52  ? 21  SER B OG  1 
ATOM 2494 N N   . ASP C 1 22  ? 204.037 101.004 154.706 1.00 85.90  ? 22  ASP B N   1 
ATOM 2495 C CA  . ASP C 1 22  ? 205.047 100.072 154.203 1.00 85.90  ? 22  ASP B CA  1 
ATOM 2496 C C   . ASP C 1 22  ? 204.425 98.800  153.647 1.00 85.90  ? 22  ASP B C   1 
ATOM 2497 O O   . ASP C 1 22  ? 205.123 97.873  153.239 1.00 85.90  ? 22  ASP B O   1 
ATOM 2498 C CB  . ASP C 1 22  ? 206.037 99.720  155.337 1.00 94.29  ? 22  ASP B CB  1 
ATOM 2499 C CG  . ASP C 1 22  ? 205.371 98.993  156.528 1.00 94.29  ? 22  ASP B CG  1 
ATOM 2500 O OD1 . ASP C 1 22  ? 204.880 97.861  156.343 1.00 94.29  ? 22  ASP B OD1 1 
ATOM 2501 O OD2 . ASP C 1 22  ? 205.342 99.542  157.657 1.00 94.29  ? 22  ASP B OD2 1 
ATOM 2502 N N   . PHE C 1 23  ? 203.103 98.778  153.628 1.00 79.24  ? 23  PHE B N   1 
ATOM 2503 C CA  . PHE C 1 23  ? 202.368 97.617  153.167 1.00 79.24  ? 23  PHE B CA  1 
ATOM 2504 C C   . PHE C 1 23  ? 202.192 97.511  151.670 1.00 79.24  ? 23  PHE B C   1 
ATOM 2505 O O   . PHE C 1 23  ? 202.536 96.504  151.056 1.00 79.24  ? 23  PHE B O   1 
ATOM 2506 C CB  . PHE C 1 23  ? 200.992 97.589  153.859 1.00 91.20  ? 23  PHE B CB  1 
ATOM 2507 C CG  . PHE C 1 23  ? 200.036 96.514  153.352 1.00 91.20  ? 23  PHE B CG  1 
ATOM 2508 C CD1 . PHE C 1 23  ? 199.017 96.055  154.179 1.00 91.20  ? 23  PHE B CD1 1 
ATOM 2509 C CD2 . PHE C 1 23  ? 200.120 95.982  152.061 1.00 91.20  ? 23  PHE B CD2 1 
ATOM 2510 C CE1 . PHE C 1 23  ? 198.104 95.088  153.732 1.00 91.20  ? 23  PHE B CE1 1 
ATOM 2511 C CE2 . PHE C 1 23  ? 199.212 95.018  151.609 1.00 91.20  ? 23  PHE B CE2 1 
ATOM 2512 C CZ  . PHE C 1 23  ? 198.206 94.572  152.445 1.00 91.20  ? 23  PHE B CZ  1 
ATOM 2513 N N   . PHE C 1 24  ? 201.627 98.547  151.079 1.00 89.94  ? 24  PHE B N   1 
ATOM 2514 C CA  . PHE C 1 24  ? 201.331 98.563  149.643 1.00 89.94  ? 24  PHE B CA  1 
ATOM 2515 C C   . PHE C 1 24  ? 202.426 98.557  148.610 1.00 89.94  ? 24  PHE B C   1 
ATOM 2516 O O   . PHE C 1 24  ? 203.524 99.118  148.800 1.00 89.94  ? 24  PHE B O   1 
ATOM 2517 C CB  . PHE C 1 24  ? 200.441 99.743  149.365 1.00 104.61 ? 24  PHE B CB  1 
ATOM 2518 C CG  . PHE C 1 24  ? 199.328 99.837  150.320 1.00 104.61 ? 24  PHE B CG  1 
ATOM 2519 C CD1 . PHE C 1 24  ? 198.129 99.199  150.055 1.00 104.61 ? 24  PHE B CD1 1 
ATOM 2520 C CD2 . PHE C 1 24  ? 199.499 100.485 151.544 1.00 104.61 ? 24  PHE B CD2 1 
ATOM 2521 C CE1 . PHE C 1 24  ? 197.116 99.193  150.985 1.00 104.61 ? 24  PHE B CE1 1 
ATOM 2522 C CE2 . PHE C 1 24  ? 198.492 100.492 152.497 1.00 104.61 ? 24  PHE B CE2 1 
ATOM 2523 C CZ  . PHE C 1 24  ? 197.295 99.847  152.220 1.00 104.61 ? 24  PHE B CZ  1 
ATOM 2524 N N   . PRO C 1 25  ? 202.119 97.952  147.466 1.00 74.33  ? 25  PRO B N   1 
ATOM 2525 C CA  . PRO C 1 25  ? 202.976 97.798  146.286 1.00 74.33  ? 25  PRO B CA  1 
ATOM 2526 C C   . PRO C 1 25  ? 203.124 99.166  145.624 1.00 74.33  ? 25  PRO B C   1 
ATOM 2527 O O   . PRO C 1 25  ? 202.183 99.958  145.639 1.00 74.33  ? 25  PRO B O   1 
ATOM 2528 C CB  . PRO C 1 25  ? 202.183 96.828  145.414 1.00 75.29  ? 25  PRO B CB  1 
ATOM 2529 C CG  . PRO C 1 25  ? 201.327 96.072  146.423 1.00 75.29  ? 25  PRO B CG  1 
ATOM 2530 C CD  . PRO C 1 25  ? 200.885 97.166  147.331 1.00 75.29  ? 25  PRO B CD  1 
ATOM 2531 N N   . SER C 1 26  ? 204.288 99.462  145.056 1.00 79.74  ? 26  SER B N   1 
ATOM 2532 C CA  . SER C 1 26  ? 204.436 100.767 144.429 1.00 79.74  ? 26  SER B CA  1 
ATOM 2533 C C   . SER C 1 26  ? 203.231 100.948 143.520 1.00 79.74  ? 26  SER B C   1 
ATOM 2534 O O   . SER C 1 26  ? 202.783 100.013 142.853 1.00 79.74  ? 26  SER B O   1 
ATOM 2535 C CB  . SER C 1 26  ? 205.750 100.875 143.634 1.00 143.96 ? 26  SER B CB  1 
ATOM 2536 O OG  . SER C 1 26  ? 205.710 100.169 142.409 1.00 143.96 ? 26  SER B OG  1 
ATOM 2537 N N   . VAL C 1 27  ? 202.675 102.146 143.554 1.00 53.27  ? 27  VAL B N   1 
ATOM 2538 C CA  . VAL C 1 27  ? 201.520 102.489 142.734 1.00 53.27  ? 27  VAL B CA  1 
ATOM 2539 C C   . VAL C 1 27  ? 201.687 101.885 141.354 1.00 53.27  ? 27  VAL B C   1 
ATOM 2540 O O   . VAL C 1 27  ? 200.855 101.100 140.890 1.00 53.27  ? 27  VAL B O   1 
ATOM 2541 C CB  . VAL C 1 27  ? 201.449 103.997 142.536 1.00 90.03  ? 27  VAL B CB  1 
ATOM 2542 C CG1 . VAL C 1 27  ? 200.087 104.389 141.959 1.00 90.03  ? 27  VAL B CG1 1 
ATOM 2543 C CG2 . VAL C 1 27  ? 201.798 104.701 143.856 1.00 90.03  ? 27  VAL B CG2 1 
ATOM 2544 N N   . ARG C 1 28  ? 202.782 102.309 140.718 1.00 102.72 ? 28  ARG B N   1 
ATOM 2545 C CA  . ARG C 1 28  ? 203.201 101.896 139.382 1.00 102.72 ? 28  ARG B CA  1 
ATOM 2546 C C   . ARG C 1 28  ? 202.969 100.397 139.248 1.00 102.72 ? 28  ARG B C   1 
ATOM 2547 O O   . ARG C 1 28  ? 202.360 99.930  138.280 1.00 102.72 ? 28  ARG B O   1 
ATOM 2548 C CB  . ARG C 1 28  ? 204.697 102.233 139.192 1.00 118.94 ? 28  ARG B CB  1 
ATOM 2549 C CG  . ARG C 1 28  ? 205.206 102.135 137.762 1.00 118.94 ? 28  ARG B CG  1 
ATOM 2550 C CD  . ARG C 1 28  ? 204.448 103.102 136.872 1.00 118.94 ? 28  ARG B CD  1 
ATOM 2551 N NE  . ARG C 1 28  ? 204.260 102.554 135.535 1.00 118.94 ? 28  ARG B NE  1 
ATOM 2552 C CZ  . ARG C 1 28  ? 203.192 102.789 134.779 1.00 118.94 ? 28  ARG B CZ  1 
ATOM 2553 N NH1 . ARG C 1 28  ? 202.212 103.567 135.234 1.00 118.94 ? 28  ARG B NH1 1 
ATOM 2554 N NH2 . ARG C 1 28  ? 203.101 102.238 133.573 1.00 118.94 ? 28  ARG B NH2 1 
ATOM 2555 N N   . ASP C 1 29  ? 203.451 99.659  140.248 1.00 69.60  ? 29  ASP B N   1 
ATOM 2556 C CA  . ASP C 1 29  ? 203.308 98.218  140.276 1.00 69.60  ? 29  ASP B CA  1 
ATOM 2557 C C   . ASP C 1 29  ? 201.826 97.899  140.236 1.00 69.60  ? 29  ASP B C   1 
ATOM 2558 O O   . ASP C 1 29  ? 201.409 97.176  139.350 1.00 69.60  ? 29  ASP B O   1 
ATOM 2559 C CB  . ASP C 1 29  ? 203.987 97.601  141.518 1.00 85.33  ? 29  ASP B CB  1 
ATOM 2560 C CG  . ASP C 1 29  ? 205.533 97.553  141.403 1.00 85.33  ? 29  ASP B CG  1 
ATOM 2561 O OD1 . ASP C 1 29  ? 206.088 97.648  140.278 1.00 85.33  ? 29  ASP B OD1 1 
ATOM 2562 O OD2 . ASP C 1 29  ? 206.200 97.402  142.450 1.00 85.33  ? 29  ASP B OD2 1 
ATOM 2563 N N   . LEU C 1 30  ? 201.027 98.451  141.153 1.00 34.37  ? 30  LEU B N   1 
ATOM 2564 C CA  . LEU C 1 30  ? 199.568 98.207  141.162 1.00 34.37  ? 30  LEU B CA  1 
ATOM 2565 C C   . LEU C 1 30  ? 198.870 98.459  139.823 1.00 34.37  ? 30  LEU B C   1 
ATOM 2566 O O   . LEU C 1 30  ? 198.048 97.649  139.380 1.00 34.37  ? 30  LEU B O   1 
ATOM 2567 C CB  . LEU C 1 30  ? 198.869 99.075  142.192 1.00 73.57  ? 30  LEU B CB  1 
ATOM 2568 C CG  . LEU C 1 30  ? 198.902 98.592  143.626 1.00 73.57  ? 30  LEU B CG  1 
ATOM 2569 C CD1 . LEU C 1 30  ? 200.007 99.313  144.358 1.00 73.57  ? 30  LEU B CD1 1 
ATOM 2570 C CD2 . LEU C 1 30  ? 197.560 98.878  144.274 1.00 73.57  ? 30  LEU B CD2 1 
ATOM 2571 N N   . LEU C 1 31  ? 199.146 99.615  139.220 1.00 52.01  ? 31  LEU B N   1 
ATOM 2572 C CA  . LEU C 1 31  ? 198.597 99.952  137.912 1.00 52.01  ? 31  LEU B CA  1 
ATOM 2573 C C   . LEU C 1 31  ? 198.950 98.799  137.002 1.00 52.01  ? 31  LEU B C   1 
ATOM 2574 O O   . LEU C 1 31  ? 198.085 98.007  136.622 1.00 52.01  ? 31  LEU B O   1 
ATOM 2575 C CB  . LEU C 1 31  ? 199.274 101.194 137.373 1.00 103.60 ? 31  LEU B CB  1 
ATOM 2576 C CG  . LEU C 1 31  ? 198.934 102.447 138.148 1.00 103.60 ? 31  LEU B CG  1 
ATOM 2577 C CD1 . LEU C 1 31  ? 199.643 103.647 137.496 1.00 103.60 ? 31  LEU B CD1 1 
ATOM 2578 C CD2 . LEU C 1 31  ? 197.412 102.604 138.150 1.00 103.60 ? 31  LEU B CD2 1 
ATOM 2579 N N   . ASP C 1 32  ? 200.239 98.723  136.658 1.00 93.58  ? 32  ASP B N   1 
ATOM 2580 C CA  . ASP C 1 32  ? 200.763 97.655  135.813 1.00 93.58  ? 32  ASP B CA  1 
ATOM 2581 C C   . ASP C 1 32  ? 199.915 96.414  136.126 1.00 93.58  ? 32  ASP B C   1 
ATOM 2582 O O   . ASP C 1 32  ? 199.112 95.980  135.303 1.00 93.58  ? 32  ASP B O   1 
ATOM 2583 C CB  . ASP C 1 32  ? 202.250 97.377  136.138 1.00 85.15  ? 32  ASP B CB  1 
ATOM 2584 C CG  . ASP C 1 32  ? 203.174 98.572  135.845 1.00 85.15  ? 32  ASP B CG  1 
ATOM 2585 O OD1 . ASP C 1 32  ? 203.159 99.098  134.705 1.00 85.15  ? 32  ASP B OD1 1 
ATOM 2586 O OD2 . ASP C 1 32  ? 203.936 98.970  136.758 1.00 85.15  ? 32  ASP B OD2 1 
ATOM 2587 N N   . THR C 1 33  ? 200.080 95.892  137.343 1.00 83.91  ? 33  THR B N   1 
ATOM 2588 C CA  . THR C 1 33  ? 199.358 94.714  137.856 1.00 83.91  ? 33  THR B CA  1 
ATOM 2589 C C   . THR C 1 33  ? 197.963 94.593  137.309 1.00 83.91  ? 33  THR B C   1 
ATOM 2590 O O   . THR C 1 33  ? 197.641 93.726  136.496 1.00 83.91  ? 33  THR B O   1 
ATOM 2591 C CB  . THR C 1 33  ? 199.149 94.778  139.383 1.00 73.91  ? 33  THR B CB  1 
ATOM 2592 O OG1 . THR C 1 33  ? 200.408 94.876  140.055 1.00 73.91  ? 33  THR B OG1 1 
ATOM 2593 C CG2 . THR C 1 33  ? 198.420 93.545  139.861 1.00 73.91  ? 33  THR B CG2 1 
ATOM 2594 N N   . ALA C 1 34  ? 197.132 95.477  137.836 1.00 67.68  ? 34  ALA B N   1 
ATOM 2595 C CA  . ALA C 1 34  ? 195.735 95.562  137.494 1.00 67.68  ? 34  ALA B CA  1 
ATOM 2596 C C   . ALA C 1 34  ? 195.443 95.406  136.006 1.00 67.68  ? 34  ALA B C   1 
ATOM 2597 O O   . ALA C 1 34  ? 195.114 94.307  135.519 1.00 67.68  ? 34  ALA B O   1 
ATOM 2598 C CB  . ALA C 1 34  ? 195.195 96.886  137.986 1.00 50.22  ? 34  ALA B CB  1 
ATOM 2599 N N   . ALA C 1 35  ? 195.556 96.531  135.304 1.00 116.52 ? 35  ALA B N   1 
ATOM 2600 C CA  . ALA C 1 35  ? 195.296 96.612  133.876 1.00 116.52 ? 35  ALA B CA  1 
ATOM 2601 C C   . ALA C 1 35  ? 195.949 95.483  133.078 1.00 116.52 ? 35  ALA B C   1 
ATOM 2602 O O   . ALA C 1 35  ? 195.575 95.234  131.932 1.00 116.52 ? 35  ALA B O   1 
ATOM 2603 C CB  . ALA C 1 35  ? 195.746 97.980  133.338 1.00 41.33  ? 35  ALA B CB  1 
ATOM 2604 N N   . ALA C 1 36  ? 196.921 94.795  133.665 1.00 102.26 ? 36  ALA B N   1 
ATOM 2605 C CA  . ALA C 1 36  ? 197.565 93.699  132.949 1.00 102.26 ? 36  ALA B CA  1 
ATOM 2606 C C   . ALA C 1 36  ? 196.833 92.416  133.297 1.00 102.26 ? 36  ALA B C   1 
ATOM 2607 O O   . ALA C 1 36  ? 197.154 91.341  132.820 1.00 102.26 ? 36  ALA B O   1 
ATOM 2608 C CB  . ALA C 1 36  ? 199.046 93.598  133.354 1.00 97.28  ? 36  ALA B CB  1 
ATOM 2609 N N   . LEU C 1 37  ? 195.813 92.542  134.110 1.00 79.92  ? 37  LEU B N   1 
ATOM 2610 C CA  . LEU C 1 37  ? 195.120 91.369  134.523 1.00 79.92  ? 37  LEU B CA  1 
ATOM 2611 C C   . LEU C 1 37  ? 193.688 91.439  134.112 1.00 79.92  ? 37  LEU B C   1 
ATOM 2612 O O   . LEU C 1 37  ? 192.972 90.441  134.109 1.00 79.92  ? 37  LEU B O   1 
ATOM 2613 C CB  . LEU C 1 37  ? 195.236 91.275  136.020 1.00 67.71  ? 37  LEU B CB  1 
ATOM 2614 C CG  . LEU C 1 37  ? 194.326 90.235  136.634 1.00 67.71  ? 37  LEU B CG  1 
ATOM 2615 C CD1 . LEU C 1 37  ? 194.482 88.909  135.930 1.00 67.71  ? 37  LEU B CD1 1 
ATOM 2616 C CD2 . LEU C 1 37  ? 194.656 90.122  138.091 1.00 67.71  ? 37  LEU B CD2 1 
ATOM 2617 N N   . TYR C 1 38  ? 193.280 92.628  133.717 1.00 78.29  ? 38  TYR B N   1 
ATOM 2618 C CA  . TYR C 1 38  ? 191.901 92.818  133.355 1.00 78.29  ? 38  TYR B CA  1 
ATOM 2619 C C   . TYR C 1 38  ? 191.659 93.695  132.146 1.00 78.29  ? 38  TYR B C   1 
ATOM 2620 O O   . TYR C 1 38  ? 190.573 93.670  131.585 1.00 78.29  ? 38  TYR B O   1 
ATOM 2621 C CB  . TYR C 1 38  ? 191.179 93.405  134.551 1.00 61.61  ? 38  TYR B CB  1 
ATOM 2622 C CG  . TYR C 1 38  ? 191.251 92.550  135.815 1.00 61.61  ? 38  TYR B CG  1 
ATOM 2623 C CD1 . TYR C 1 38  ? 190.755 91.227  135.846 1.00 61.61  ? 38  TYR B CD1 1 
ATOM 2624 C CD2 . TYR C 1 38  ? 191.734 93.084  137.016 1.00 61.61  ? 38  TYR B CD2 1 
ATOM 2625 C CE1 . TYR C 1 38  ? 190.737 90.460  137.079 1.00 61.61  ? 38  TYR B CE1 1 
ATOM 2626 C CE2 . TYR C 1 38  ? 191.717 92.332  138.245 1.00 61.61  ? 38  TYR B CE2 1 
ATOM 2627 C CZ  . TYR C 1 38  ? 191.225 91.031  138.274 1.00 61.61  ? 38  TYR B CZ  1 
ATOM 2628 O OH  . TYR C 1 38  ? 191.252 90.316  139.470 1.00 61.61  ? 38  TYR B OH  1 
ATOM 2629 N N   . ARG C 1 39  ? 192.671 94.457  131.745 1.00 83.23  ? 39  ARG B N   1 
ATOM 2630 C CA  . ARG C 1 39  ? 192.566 95.380  130.608 1.00 83.23  ? 39  ARG B CA  1 
ATOM 2631 C C   . ARG C 1 39  ? 191.361 95.143  129.708 1.00 83.23  ? 39  ARG B C   1 
ATOM 2632 O O   . ARG C 1 39  ? 190.411 95.926  129.733 1.00 83.23  ? 39  ARG B O   1 
ATOM 2633 C CB  . ARG C 1 39  ? 193.850 95.369  129.749 1.00 104.78 ? 39  ARG B CB  1 
ATOM 2634 C CG  . ARG C 1 39  ? 194.012 96.611  128.824 1.00 104.78 ? 39  ARG B CG  1 
ATOM 2635 C CD  . ARG C 1 39  ? 195.485 96.935  128.504 1.00 104.78 ? 39  ARG B CD  1 
ATOM 2636 N NE  . ARG C 1 39  ? 195.661 98.302  128.004 1.00 104.78 ? 39  ARG B NE  1 
ATOM 2637 C CZ  . ARG C 1 39  ? 196.841 98.900  127.833 1.00 104.78 ? 39  ARG B CZ  1 
ATOM 2638 N NH1 . ARG C 1 39  ? 197.965 98.257  128.122 1.00 104.78 ? 39  ARG B NH1 1 
ATOM 2639 N NH2 . ARG C 1 39  ? 196.901 100.144 127.371 1.00 104.78 ? 39  ARG B NH2 1 
ATOM 2640 N N   . ASP C 1 40  ? 191.396 94.079  128.909 1.00 134.26 ? 40  ASP B N   1 
ATOM 2641 C CA  . ASP C 1 40  ? 190.287 93.779  128.008 1.00 134.26 ? 40  ASP B CA  1 
ATOM 2642 C C   . ASP C 1 40  ? 188.952 94.014  128.692 1.00 134.26 ? 40  ASP B C   1 
ATOM 2643 O O   . ASP C 1 40  ? 188.048 94.639  128.133 1.00 134.26 ? 40  ASP B O   1 
ATOM 2644 C CB  . ASP C 1 40  ? 190.355 92.329  127.535 1.00 109.75 ? 40  ASP B CB  1 
ATOM 2645 C CG  . ASP C 1 40  ? 191.392 92.120  126.453 1.00 109.75 ? 40  ASP B CG  1 
ATOM 2646 O OD1 . ASP C 1 40  ? 191.773 93.112  125.780 1.00 109.75 ? 40  ASP B OD1 1 
ATOM 2647 O OD2 . ASP C 1 40  ? 191.816 90.960  126.269 1.00 109.75 ? 40  ASP B OD2 1 
ATOM 2648 N N   . ALA C 1 41  ? 188.854 93.508  129.916 1.00 74.45  ? 41  ALA B N   1 
ATOM 2649 C CA  . ALA C 1 41  ? 187.651 93.618  130.731 1.00 74.45  ? 41  ALA B CA  1 
ATOM 2650 C C   . ALA C 1 41  ? 187.310 95.050  131.173 1.00 74.45  ? 41  ALA B C   1 
ATOM 2651 O O   . ALA C 1 41  ? 186.200 95.313  131.631 1.00 74.45  ? 41  ALA B O   1 
ATOM 2652 C CB  . ALA C 1 41  ? 187.789 92.706  131.962 1.00 49.60  ? 41  ALA B CB  1 
ATOM 2653 N N   . LEU C 1 42  ? 188.248 95.976  131.007 1.00 60.69  ? 42  LEU B N   1 
ATOM 2654 C CA  . LEU C 1 42  ? 188.046 97.360  131.426 1.00 60.69  ? 42  LEU B CA  1 
ATOM 2655 C C   . LEU C 1 42  ? 187.765 98.311  130.273 1.00 60.69  ? 42  LEU B C   1 
ATOM 2656 O O   . LEU C 1 42  ? 186.852 99.136  130.334 1.00 60.69  ? 42  LEU B O   1 
ATOM 2657 C CB  . LEU C 1 42  ? 189.275 97.797  132.201 1.00 53.44  ? 42  LEU B CB  1 
ATOM 2658 C CG  . LEU C 1 42  ? 189.578 96.646  133.161 1.00 53.44  ? 42  LEU B CG  1 
ATOM 2659 C CD1 . LEU C 1 42  ? 190.925 96.797  133.844 1.00 53.44  ? 42  LEU B CD1 1 
ATOM 2660 C CD2 . LEU C 1 42  ? 188.441 96.588  134.149 1.00 53.44  ? 42  LEU B CD2 1 
ATOM 2661 N N   . GLU C 1 43  ? 188.553 98.200  129.213 1.00 133.64 ? 43  GLU B N   1 
ATOM 2662 C CA  . GLU C 1 43  ? 188.332 99.033  128.047 1.00 133.64 ? 43  GLU B CA  1 
ATOM 2663 C C   . GLU C 1 43  ? 186.996 98.510  127.495 1.00 133.64 ? 43  GLU B C   1 
ATOM 2664 O O   . GLU C 1 43  ? 186.615 98.779  126.354 1.00 133.64 ? 43  GLU B O   1 
ATOM 2665 C CB  . GLU C 1 43  ? 189.493 98.845  127.055 1.00 121.82 ? 43  GLU B CB  1 
ATOM 2666 C CG  . GLU C 1 43  ? 190.873 98.954  127.730 1.00 121.82 ? 43  GLU B CG  1 
ATOM 2667 C CD  . GLU C 1 43  ? 192.051 98.856  126.768 1.00 121.82 ? 43  GLU B CD  1 
ATOM 2668 O OE1 . GLU C 1 43  ? 192.113 97.874  125.989 1.00 121.82 ? 43  GLU B OE1 1 
ATOM 2669 O OE2 . GLU C 1 43  ? 192.921 99.760  126.807 1.00 121.82 ? 43  GLU B OE2 1 
ATOM 2670 N N   . SER C 1 44  ? 186.301 97.759  128.354 1.00 92.26  ? 44  SER B N   1 
ATOM 2671 C CA  . SER C 1 44  ? 185.007 97.144  128.066 1.00 92.26  ? 44  SER B CA  1 
ATOM 2672 C C   . SER C 1 44  ? 183.817 98.008  128.481 1.00 92.26  ? 44  SER B C   1 
ATOM 2673 O O   . SER C 1 44  ? 183.916 98.815  129.407 1.00 92.26  ? 44  SER B O   1 
ATOM 2674 C CB  . SER C 1 44  ? 184.892 95.788  128.777 1.00 70.57  ? 44  SER B CB  1 
ATOM 2675 O OG  . SER C 1 44  ? 183.545 95.324  128.801 1.00 70.57  ? 44  SER B OG  1 
ATOM 2676 N N   . PRO C 1 45  ? 182.678 97.849  127.775 1.00 73.00  ? 45  PRO B N   1 
ATOM 2677 C CA  . PRO C 1 45  ? 181.405 98.556  127.985 1.00 73.00  ? 45  PRO B CA  1 
ATOM 2678 C C   . PRO C 1 45  ? 180.484 97.921  129.034 1.00 73.00  ? 45  PRO B C   1 
ATOM 2679 O O   . PRO C 1 45  ? 179.336 98.352  129.216 1.00 73.00  ? 45  PRO B O   1 
ATOM 2680 C CB  . PRO C 1 45  ? 180.763 98.537  126.588 1.00 89.70  ? 45  PRO B CB  1 
ATOM 2681 C CG  . PRO C 1 45  ? 181.948 98.378  125.642 1.00 89.70  ? 45  PRO B CG  1 
ATOM 2682 C CD  . PRO C 1 45  ? 182.741 97.340  126.391 1.00 89.70  ? 45  PRO B CD  1 
ATOM 2683 N N   . GLU C 1 46  ? 180.981 96.898  129.719 1.00 88.94  ? 46  GLU B N   1 
ATOM 2684 C CA  . GLU C 1 46  ? 180.171 96.214  130.723 1.00 88.94  ? 46  GLU B CA  1 
ATOM 2685 C C   . GLU C 1 46  ? 180.600 96.521  132.162 1.00 88.94  ? 46  GLU B C   1 
ATOM 2686 O O   . GLU C 1 46  ? 181.672 96.101  132.611 1.00 88.94  ? 46  GLU B O   1 
ATOM 2687 C CB  . GLU C 1 46  ? 180.197 94.698  130.461 1.00 129.29 ? 46  GLU B CB  1 
ATOM 2688 C CG  . GLU C 1 46  ? 179.512 94.282  129.154 1.00 129.29 ? 46  GLU B CG  1 
ATOM 2689 C CD  . GLU C 1 46  ? 178.074 94.804  129.054 1.00 129.29 ? 46  GLU B CD  1 
ATOM 2690 O OE1 . GLU C 1 46  ? 177.267 94.505  129.958 1.00 129.29 ? 46  GLU B OE1 1 
ATOM 2691 O OE2 . GLU C 1 46  ? 177.746 95.513  128.076 1.00 129.29 ? 46  GLU B OE2 1 
ATOM 2692 N N   . HIS C 1 47  ? 179.764 97.265  132.879 1.00 102.97 ? 47  HIS B N   1 
ATOM 2693 C CA  . HIS C 1 47  ? 180.081 97.608  134.257 1.00 102.97 ? 47  HIS B CA  1 
ATOM 2694 C C   . HIS C 1 47  ? 179.808 96.417  135.154 1.00 102.97 ? 47  HIS B C   1 
ATOM 2695 O O   . HIS C 1 47  ? 179.243 96.552  136.239 1.00 102.97 ? 47  HIS B O   1 
ATOM 2696 C CB  . HIS C 1 47  ? 179.270 98.833  134.721 1.00 123.99 ? 47  HIS B CB  1 
ATOM 2697 C CG  . HIS C 1 47  ? 177.913 98.971  134.086 1.00 123.99 ? 47  HIS B CG  1 
ATOM 2698 N ND1 . HIS C 1 47  ? 177.715 98.874  132.726 1.00 123.99 ? 47  HIS B ND1 1 
ATOM 2699 C CD2 . HIS C 1 47  ? 176.718 99.359  134.605 1.00 123.99 ? 47  HIS B CD2 1 
ATOM 2700 C CE1 . HIS C 1 47  ? 176.469 99.200  132.429 1.00 123.99 ? 47  HIS B CE1 1 
ATOM 2701 N NE2 . HIS C 1 47  ? 175.843 99.499  133.555 1.00 123.99 ? 47  HIS B NE2 1 
ATOM 2702 N N   . ALA C 1 48  ? 180.265 95.254  134.691 1.00 134.23 ? 48  ALA B N   1 
ATOM 2703 C CA  . ALA C 1 48  ? 180.071 93.965  135.374 1.00 134.23 ? 48  ALA B CA  1 
ATOM 2704 C C   . ALA C 1 48  ? 179.795 94.114  136.863 1.00 134.23 ? 48  ALA B C   1 
ATOM 2705 O O   . ALA C 1 48  ? 178.694 93.795  137.326 1.00 134.23 ? 48  ALA B O   1 
ATOM 2706 C CB  . ALA C 1 48  ? 181.270 93.040  135.151 1.00 37.60  ? 48  ALA B CB  1 
ATOM 2707 N N   . SER C 1 49  ? 180.772 94.605  137.619 1.00 88.28  ? 49  SER B N   1 
ATOM 2708 C CA  . SER C 1 49  ? 180.549 94.778  139.042 1.00 88.28  ? 49  SER B CA  1 
ATOM 2709 C C   . SER C 1 49  ? 180.753 96.226  139.358 1.00 88.28  ? 49  SER B C   1 
ATOM 2710 O O   . SER C 1 49  ? 181.388 96.954  138.600 1.00 88.28  ? 49  SER B O   1 
ATOM 2711 C CB  . SER C 1 49  ? 181.537 93.954  139.869 1.00 89.28  ? 49  SER B CB  1 
ATOM 2712 O OG  . SER C 1 49  ? 182.789 94.613  139.882 1.00 89.28  ? 49  SER B OG  1 
ATOM 2713 N N   . PRO C 1 50  ? 180.185 96.669  140.475 1.00 92.04  ? 50  PRO B N   1 
ATOM 2714 C CA  . PRO C 1 50  ? 180.355 98.062  140.849 1.00 92.04  ? 50  PRO B CA  1 
ATOM 2715 C C   . PRO C 1 50  ? 181.829 98.298  141.177 1.00 92.04  ? 50  PRO B C   1 
ATOM 2716 O O   . PRO C 1 50  ? 182.303 99.428  141.153 1.00 92.04  ? 50  PRO B O   1 
ATOM 2717 C CB  . PRO C 1 50  ? 179.440 98.189  142.051 1.00 121.84 ? 50  PRO B CB  1 
ATOM 2718 C CG  . PRO C 1 50  ? 178.301 97.319  141.638 1.00 121.84 ? 50  PRO B CG  1 
ATOM 2719 C CD  . PRO C 1 50  ? 179.037 96.084  141.185 1.00 121.84 ? 50  PRO B CD  1 
ATOM 2720 N N   . HIS C 1 51  ? 182.558 97.230  141.482 1.00 46.10  ? 51  HIS B N   1 
ATOM 2721 C CA  . HIS C 1 51  ? 183.987 97.366  141.763 1.00 46.10  ? 51  HIS B CA  1 
ATOM 2722 C C   . HIS C 1 51  ? 184.644 97.812  140.476 1.00 46.10  ? 51  HIS B C   1 
ATOM 2723 O O   . HIS C 1 51  ? 185.362 98.808  140.456 1.00 46.10  ? 51  HIS B O   1 
ATOM 2724 C CB  . HIS C 1 51  ? 184.608 96.043  142.171 1.00 94.23  ? 51  HIS B CB  1 
ATOM 2725 C CG  . HIS C 1 51  ? 184.315 95.635  143.578 1.00 94.23  ? 51  HIS B CG  1 
ATOM 2726 N ND1 . HIS C 1 51  ? 184.737 96.360  144.670 1.00 94.23  ? 51  HIS B ND1 1 
ATOM 2727 C CD2 . HIS C 1 51  ? 183.702 94.533  144.073 1.00 94.23  ? 51  HIS B CD2 1 
ATOM 2728 C CE1 . HIS C 1 51  ? 184.403 95.719  145.776 1.00 94.23  ? 51  HIS B CE1 1 
ATOM 2729 N NE2 . HIS C 1 51  ? 183.775 94.606  145.442 1.00 94.23  ? 51  HIS B NE2 1 
ATOM 2730 N N   . HIS C 1 52  ? 184.420 97.050  139.408 1.00 58.20  ? 52  HIS B N   1 
ATOM 2731 C CA  . HIS C 1 52  ? 184.952 97.409  138.099 1.00 58.20  ? 52  HIS B CA  1 
ATOM 2732 C C   . HIS C 1 52  ? 184.771 98.913  137.947 1.00 58.20  ? 52  HIS B C   1 
ATOM 2733 O O   . HIS C 1 52  ? 185.726 99.693  137.944 1.00 58.20  ? 52  HIS B O   1 
ATOM 2734 C CB  . HIS C 1 52  ? 184.147 96.743  136.985 1.00 106.61 ? 52  HIS B CB  1 
ATOM 2735 C CG  . HIS C 1 52  ? 184.372 95.277  136.876 1.00 106.61 ? 52  HIS B CG  1 
ATOM 2736 N ND1 . HIS C 1 52  ? 183.630 94.358  137.580 1.00 106.61 ? 52  HIS B ND1 1 
ATOM 2737 C CD2 . HIS C 1 52  ? 185.302 94.569  136.192 1.00 106.61 ? 52  HIS B CD2 1 
ATOM 2738 C CE1 . HIS C 1 52  ? 184.095 93.145  137.339 1.00 106.61 ? 52  HIS B CE1 1 
ATOM 2739 N NE2 . HIS C 1 52  ? 185.111 93.245  136.500 1.00 106.61 ? 52  HIS B NE2 1 
ATOM 2740 N N   . THR C 1 53  ? 183.503 99.282  137.791 1.00 90.30  ? 53  THR B N   1 
ATOM 2741 C CA  . THR C 1 53  ? 183.053 100.662 137.652 1.00 90.30  ? 53  THR B CA  1 
ATOM 2742 C C   . THR C 1 53  ? 183.949 101.556 138.499 1.00 90.30  ? 53  THR B C   1 
ATOM 2743 O O   . THR C 1 53  ? 184.907 102.161 138.007 1.00 90.30  ? 53  THR B O   1 
ATOM 2744 C CB  . THR C 1 53  ? 181.604 100.795 138.181 1.00 112.50 ? 53  THR B CB  1 
ATOM 2745 O OG1 . THR C 1 53  ? 180.774 99.781  137.592 1.00 112.50 ? 53  THR B OG1 1 
ATOM 2746 C CG2 . THR C 1 53  ? 181.048 102.170 137.880 1.00 112.50 ? 53  THR B CG2 1 
ATOM 2747 N N   . ALA C 1 54  ? 183.608 101.602 139.786 1.00 87.43  ? 54  ALA B N   1 
ATOM 2748 C CA  . ALA C 1 54  ? 184.305 102.377 140.815 1.00 87.43  ? 54  ALA B CA  1 
ATOM 2749 C C   . ALA C 1 54  ? 185.761 102.546 140.479 1.00 87.43  ? 54  ALA B C   1 
ATOM 2750 O O   . ALA C 1 54  ? 186.246 103.641 140.184 1.00 87.43  ? 54  ALA B O   1 
ATOM 2751 C CB  . ALA C 1 54  ? 184.178 101.672 142.171 1.00 138.46 ? 54  ALA B CB  1 
ATOM 2752 N N   . LEU C 1 55  ? 186.461 101.436 140.573 1.00 54.56  ? 55  LEU B N   1 
ATOM 2753 C CA  . LEU C 1 55  ? 187.858 101.407 140.251 1.00 54.56  ? 55  LEU B CA  1 
ATOM 2754 C C   . LEU C 1 55  ? 188.213 102.480 139.203 1.00 54.56  ? 55  LEU B C   1 
ATOM 2755 O O   . LEU C 1 55  ? 188.672 103.582 139.543 1.00 54.56  ? 55  LEU B O   1 
ATOM 2756 C CB  . LEU C 1 55  ? 188.175 100.017 139.728 1.00 39.21  ? 55  LEU B CB  1 
ATOM 2757 C CG  . LEU C 1 55  ? 189.577 99.894  139.176 1.00 39.21  ? 55  LEU B CG  1 
ATOM 2758 C CD1 . LEU C 1 55  ? 190.361 98.948  140.078 1.00 39.21  ? 55  LEU B CD1 1 
ATOM 2759 C CD2 . LEU C 1 55  ? 189.518 99.450  137.713 1.00 39.21  ? 55  LEU B CD2 1 
ATOM 2760 N N   . ARG C 1 56  ? 187.977 102.133 137.938 1.00 53.02  ? 56  ARG B N   1 
ATOM 2761 C CA  . ARG C 1 56  ? 188.236 102.986 136.788 1.00 53.02  ? 56  ARG B CA  1 
ATOM 2762 C C   . ARG C 1 56  ? 188.349 104.494 137.077 1.00 53.02  ? 56  ARG B C   1 
ATOM 2763 O O   . ARG C 1 56  ? 189.281 105.158 136.588 1.00 53.02  ? 56  ARG B O   1 
ATOM 2764 C CB  . ARG C 1 56  ? 187.153 102.734 135.749 1.00 109.37 ? 56  ARG B CB  1 
ATOM 2765 C CG  . ARG C 1 56  ? 187.033 101.276 135.318 1.00 109.37 ? 56  ARG B CG  1 
ATOM 2766 C CD  . ARG C 1 56  ? 185.999 101.174 134.204 1.00 109.37 ? 56  ARG B CD  1 
ATOM 2767 N NE  . ARG C 1 56  ? 185.978 99.891  133.500 1.00 109.37 ? 56  ARG B NE  1 
ATOM 2768 C CZ  . ARG C 1 56  ? 185.123 98.903  133.757 1.00 109.37 ? 56  ARG B CZ  1 
ATOM 2769 N NH1 . ARG C 1 56  ? 184.208 99.038  134.711 1.00 109.37 ? 56  ARG B NH1 1 
ATOM 2770 N NH2 . ARG C 1 56  ? 185.169 97.782  133.043 1.00 109.37 ? 56  ARG B NH2 1 
ATOM 2771 N N   . GLN C 1 57  ? 187.407 105.037 137.855 1.00 103.86 ? 57  GLN B N   1 
ATOM 2772 C CA  . GLN C 1 57  ? 187.430 106.465 138.199 1.00 103.86 ? 57  GLN B CA  1 
ATOM 2773 C C   . GLN C 1 57  ? 188.772 106.699 138.820 1.00 103.86 ? 57  GLN B C   1 
ATOM 2774 O O   . GLN C 1 57  ? 189.587 107.475 138.319 1.00 103.86 ? 57  GLN B O   1 
ATOM 2775 C CB  . GLN C 1 57  ? 186.355 106.805 139.226 1.00 85.99  ? 57  GLN B CB  1 
ATOM 2776 C CG  . GLN C 1 57  ? 185.028 106.160 138.924 1.00 85.99  ? 57  GLN B CG  1 
ATOM 2777 C CD  . GLN C 1 57  ? 184.569 106.401 137.503 1.00 85.99  ? 57  GLN B CD  1 
ATOM 2778 O OE1 . GLN C 1 57  ? 184.232 107.524 137.134 1.00 85.99  ? 57  GLN B OE1 1 
ATOM 2779 N NE2 . GLN C 1 57  ? 184.557 105.345 136.694 1.00 85.99  ? 57  GLN B NE2 1 
ATOM 2780 N N   . ALA C 1 58  ? 188.976 105.998 139.926 1.00 69.05  ? 58  ALA B N   1 
ATOM 2781 C CA  . ALA C 1 58  ? 190.215 106.049 140.656 1.00 69.05  ? 58  ALA B CA  1 
ATOM 2782 C C   . ALA C 1 58  ? 191.387 106.154 139.678 1.00 69.05  ? 58  ALA B C   1 
ATOM 2783 O O   . ALA C 1 58  ? 192.178 107.102 139.727 1.00 69.05  ? 58  ALA B O   1 
ATOM 2784 C CB  . ALA C 1 58  ? 190.342 104.807 141.490 1.00 78.60  ? 58  ALA B CB  1 
ATOM 2785 N N   . ILE C 1 59  ? 191.489 105.185 138.778 1.00 56.22  ? 59  ILE B N   1 
ATOM 2786 C CA  . ILE C 1 59  ? 192.566 105.178 137.793 1.00 56.22  ? 59  ILE B CA  1 
ATOM 2787 C C   . ILE C 1 59  ? 192.655 106.478 137.005 1.00 56.22  ? 59  ILE B C   1 
ATOM 2788 O O   . ILE C 1 59  ? 193.688 107.140 136.999 1.00 56.22  ? 59  ILE B O   1 
ATOM 2789 C CB  . ILE C 1 59  ? 192.411 104.026 136.767 1.00 29.77  ? 59  ILE B CB  1 
ATOM 2790 C CG1 . ILE C 1 59  ? 192.355 102.691 137.492 1.00 29.77  ? 59  ILE B CG1 1 
ATOM 2791 C CG2 . ILE C 1 59  ? 193.582 104.030 135.778 1.00 29.77  ? 59  ILE B CG2 1 
ATOM 2792 C CD1 . ILE C 1 59  ? 191.096 102.490 138.231 1.00 29.77  ? 59  ILE B CD1 1 
ATOM 2793 N N   . LEU C 1 60  ? 191.581 106.845 136.330 1.00 110.41 ? 60  LEU B N   1 
ATOM 2794 C CA  . LEU C 1 60  ? 191.646 108.055 135.561 1.00 110.41 ? 60  LEU B CA  1 
ATOM 2795 C C   . LEU C 1 60  ? 191.903 109.277 136.390 1.00 110.41 ? 60  LEU B C   1 
ATOM 2796 O O   . LEU C 1 60  ? 192.807 110.049 136.080 1.00 110.41 ? 60  LEU B O   1 
ATOM 2797 C CB  . LEU C 1 60  ? 190.395 108.214 134.735 1.00 138.94 ? 60  LEU B CB  1 
ATOM 2798 C CG  . LEU C 1 60  ? 190.733 107.435 133.466 1.00 138.94 ? 60  LEU B CG  1 
ATOM 2799 C CD1 . LEU C 1 60  ? 189.639 107.619 132.428 1.00 138.94 ? 60  LEU B CD1 1 
ATOM 2800 C CD2 . LEU C 1 60  ? 192.096 107.932 132.904 1.00 138.94 ? 60  LEU B CD2 1 
ATOM 2801 N N   . ALA C 1 61  ? 191.120 109.454 137.446 1.00 88.26  ? 61  ALA B N   1 
ATOM 2802 C CA  . ALA C 1 61  ? 191.306 110.601 138.330 1.00 88.26  ? 61  ALA B CA  1 
ATOM 2803 C C   . ALA C 1 61  ? 192.789 110.711 138.681 1.00 88.26  ? 61  ALA B C   1 
ATOM 2804 O O   . ALA C 1 61  ? 193.323 111.806 138.840 1.00 88.26  ? 61  ALA B O   1 
ATOM 2805 C CB  . ALA C 1 61  ? 190.478 110.430 139.589 1.00 94.41  ? 61  ALA B CB  1 
ATOM 2806 N N   . TRP C 1 62  ? 193.441 109.560 138.797 1.00 54.95  ? 62  TRP B N   1 
ATOM 2807 C CA  . TRP C 1 62  ? 194.863 109.504 139.083 1.00 54.95  ? 62  TRP B CA  1 
ATOM 2808 C C   . TRP C 1 62  ? 195.679 109.765 137.816 1.00 54.95  ? 62  TRP B C   1 
ATOM 2809 O O   . TRP C 1 62  ? 196.656 110.515 137.833 1.00 54.95  ? 62  TRP B O   1 
ATOM 2810 C CB  . TRP C 1 62  ? 195.249 108.141 139.624 1.00 108.11 ? 62  TRP B CB  1 
ATOM 2811 C CG  . TRP C 1 62  ? 196.716 107.927 139.538 1.00 108.11 ? 62  TRP B CG  1 
ATOM 2812 C CD1 . TRP C 1 62  ? 197.410 107.395 138.487 1.00 108.11 ? 62  TRP B CD1 1 
ATOM 2813 C CD2 . TRP C 1 62  ? 197.690 108.303 140.515 1.00 108.11 ? 62  TRP B CD2 1 
ATOM 2814 N NE1 . TRP C 1 62  ? 198.759 107.418 138.752 1.00 108.11 ? 62  TRP B NE1 1 
ATOM 2815 C CE2 . TRP C 1 62  ? 198.958 107.971 139.991 1.00 108.11 ? 62  TRP B CE2 1 
ATOM 2816 C CE3 . TRP C 1 62  ? 197.615 108.894 141.785 1.00 108.11 ? 62  TRP B CE3 1 
ATOM 2817 C CZ2 . TRP C 1 62  ? 200.142 108.205 140.694 1.00 108.11 ? 62  TRP B CZ2 1 
ATOM 2818 C CZ3 . TRP C 1 62  ? 198.792 109.128 142.485 1.00 108.11 ? 62  TRP B CZ3 1 
ATOM 2819 C CH2 . TRP C 1 62  ? 200.039 108.784 141.935 1.00 108.11 ? 62  TRP B CH2 1 
ATOM 2820 N N   . GLY C 1 63  ? 195.300 109.109 136.724 1.00 135.41 ? 63  GLY B N   1 
ATOM 2821 C CA  . GLY C 1 63  ? 195.999 109.313 135.471 1.00 135.41 ? 63  GLY B CA  1 
ATOM 2822 C C   . GLY C 1 63  ? 195.997 110.795 135.146 1.00 135.41 ? 63  GLY B C   1 
ATOM 2823 O O   . GLY C 1 63  ? 196.758 111.236 134.287 1.00 135.41 ? 63  GLY B O   1 
ATOM 2824 N N   . ASP C 1 64  ? 195.134 111.555 135.831 1.00 77.08  ? 64  ASP B N   1 
ATOM 2825 C CA  . ASP C 1 64  ? 195.020 113.009 135.658 1.00 77.08  ? 64  ASP B CA  1 
ATOM 2826 C C   . ASP C 1 64  ? 196.111 113.716 136.455 1.00 77.08  ? 64  ASP B C   1 
ATOM 2827 O O   . ASP C 1 64  ? 196.449 114.872 136.183 1.00 77.08  ? 64  ASP B O   1 
ATOM 2828 C CB  . ASP C 1 64  ? 193.653 113.520 136.139 1.00 104.98 ? 64  ASP B CB  1 
ATOM 2829 C CG  . ASP C 1 64  ? 192.554 113.337 135.104 1.00 104.98 ? 64  ASP B CG  1 
ATOM 2830 O OD1 . ASP C 1 64  ? 192.866 113.410 133.886 1.00 104.98 ? 64  ASP B OD1 1 
ATOM 2831 O OD2 . ASP C 1 64  ? 191.378 113.144 135.513 1.00 104.98 ? 64  ASP B OD2 1 
ATOM 2832 N N   . LEU C 1 65  ? 196.657 113.003 137.436 1.00 64.00  ? 65  LEU B N   1 
ATOM 2833 C CA  . LEU C 1 65  ? 197.711 113.526 138.294 1.00 64.00  ? 65  LEU B CA  1 
ATOM 2834 C C   . LEU C 1 65  ? 199.090 113.230 137.724 1.00 64.00  ? 65  LEU B C   1 
ATOM 2835 O O   . LEU C 1 65  ? 199.993 114.052 137.825 1.00 64.00  ? 65  LEU B O   1 
ATOM 2836 C CB  . LEU C 1 65  ? 197.579 112.936 139.693 1.00 49.97  ? 65  LEU B CB  1 
ATOM 2837 C CG  . LEU C 1 65  ? 196.122 112.851 140.174 1.00 49.97  ? 65  LEU B CG  1 
ATOM 2838 C CD1 . LEU C 1 65  ? 196.089 112.580 141.679 1.00 49.97  ? 65  LEU B CD1 1 
ATOM 2839 C CD2 . LEU C 1 65  ? 195.377 114.137 139.846 1.00 49.97  ? 65  LEU B CD2 1 
ATOM 2840 N N   . MET C 1 66  ? 199.272 112.055 137.139 1.00 123.90 ? 66  MET B N   1 
ATOM 2841 C CA  . MET C 1 66  ? 200.557 111.776 136.533 1.00 123.90 ? 66  MET B CA  1 
ATOM 2842 C C   . MET C 1 66  ? 200.563 112.449 135.153 1.00 123.90 ? 66  MET B C   1 
ATOM 2843 O O   . MET C 1 66  ? 201.594 112.483 134.476 1.00 123.90 ? 66  MET B O   1 
ATOM 2844 C CB  . MET C 1 66  ? 200.801 110.273 136.422 1.00 147.05 ? 66  MET B CB  1 
ATOM 2845 C CG  . MET C 1 66  ? 201.276 109.637 137.725 1.00 147.05 ? 66  MET B CG  1 
ATOM 2846 S SD  . MET C 1 66  ? 201.910 107.939 137.487 1.00 147.05 ? 66  MET B SD  1 
ATOM 2847 C CE  . MET C 1 66  ? 203.659 108.130 137.793 1.00 147.05 ? 66  MET B CE  1 
ATOM 2848 N N   . THR C 1 67  ? 199.399 112.978 134.750 1.00 116.85 ? 67  THR B N   1 
ATOM 2849 C CA  . THR C 1 67  ? 199.223 113.715 133.482 1.00 116.85 ? 67  THR B CA  1 
ATOM 2850 C C   . THR C 1 67  ? 199.038 115.180 133.902 1.00 116.85 ? 67  THR B C   1 
ATOM 2851 O O   . THR C 1 67  ? 198.504 116.021 133.175 1.00 116.85 ? 67  THR B O   1 
ATOM 2852 C CB  . THR C 1 67  ? 197.980 113.207 132.651 1.00 116.39 ? 67  THR B CB  1 
ATOM 2853 O OG1 . THR C 1 67  ? 198.230 111.871 132.185 1.00 116.39 ? 67  THR B OG1 1 
ATOM 2854 C CG2 . THR C 1 67  ? 197.721 114.098 131.430 1.00 116.39 ? 67  THR B CG2 1 
ATOM 2855 N N   . LEU C 1 68  ? 199.492 115.447 135.118 1.00 105.95 ? 68  LEU B N   1 
ATOM 2856 C CA  . LEU C 1 68  ? 199.462 116.771 135.721 1.00 105.95 ? 68  LEU B CA  1 
ATOM 2857 C C   . LEU C 1 68  ? 200.899 117.086 136.126 1.00 105.95 ? 68  LEU B C   1 
ATOM 2858 O O   . LEU C 1 68  ? 201.484 118.078 135.682 1.00 105.95 ? 68  LEU B O   1 
ATOM 2859 C CB  . LEU C 1 68  ? 198.601 116.787 136.991 1.00 59.36  ? 68  LEU B CB  1 
ATOM 2860 C CG  . LEU C 1 68  ? 199.156 117.738 138.083 1.00 59.36  ? 68  LEU B CG  1 
ATOM 2861 C CD1 . LEU C 1 68  ? 199.003 119.172 137.601 1.00 59.36  ? 68  LEU B CD1 1 
ATOM 2862 C CD2 . LEU C 1 68  ? 198.468 117.545 139.417 1.00 59.36  ? 68  LEU B CD2 1 
ATOM 2863 N N   . ALA C 1 69  ? 201.436 116.231 136.998 1.00 101.59 ? 69  ALA B N   1 
ATOM 2864 C CA  . ALA C 1 69  ? 202.794 116.343 137.515 1.00 101.59 ? 69  ALA B CA  1 
ATOM 2865 C C   . ALA C 1 69  ? 203.767 116.577 136.376 1.00 101.59 ? 69  ALA B C   1 
ATOM 2866 O O   . ALA C 1 69  ? 204.863 117.103 136.569 1.00 101.59 ? 69  ALA B O   1 
ATOM 2867 C CB  . ALA C 1 69  ? 203.161 115.077 138.244 1.00 70.99  ? 69  ALA B CB  1 
ATOM 2868 N N   . THR C 1 70  ? 203.366 116.170 135.181 1.00 168.17 ? 70  THR B N   1 
ATOM 2869 C CA  . THR C 1 70  ? 204.216 116.362 134.029 1.00 168.17 ? 70  THR B CA  1 
ATOM 2870 C C   . THR C 1 70  ? 203.813 117.644 133.266 1.00 168.17 ? 70  THR B C   1 
ATOM 2871 O O   . THR C 1 70  ? 204.066 117.778 132.072 1.00 168.17 ? 70  THR B O   1 
ATOM 2872 C CB  . THR C 1 70  ? 204.218 115.074 133.138 1.00 97.17  ? 70  THR B CB  1 
ATOM 2873 O OG1 . THR C 1 70  ? 202.876 114.709 132.790 1.00 97.17  ? 70  THR B OG1 1 
ATOM 2874 C CG2 . THR C 1 70  ? 204.876 113.904 133.904 1.00 97.17  ? 70  THR B CG2 1 
ATOM 2875 N N   . TRP C 1 71  ? 203.183 118.578 133.989 1.00 131.63 ? 71  TRP B N   1 
ATOM 2876 C CA  . TRP C 1 71  ? 202.770 119.903 133.481 1.00 131.63 ? 71  TRP B CA  1 
ATOM 2877 C C   . TRP C 1 71  ? 203.337 120.865 134.516 1.00 131.63 ? 71  TRP B C   1 
ATOM 2878 O O   . TRP C 1 71  ? 203.456 122.073 134.309 1.00 131.63 ? 71  TRP B O   1 
ATOM 2879 C CB  . TRP C 1 71  ? 201.248 120.091 133.461 1.00 136.33 ? 71  TRP B CB  1 
ATOM 2880 C CG  . TRP C 1 71  ? 200.830 121.493 132.981 1.00 136.33 ? 71  TRP B CG  1 
ATOM 2881 C CD1 . TRP C 1 71  ? 200.652 121.905 131.677 1.00 136.33 ? 71  TRP B CD1 1 
ATOM 2882 C CD2 . TRP C 1 71  ? 200.576 122.652 133.801 1.00 136.33 ? 71  TRP B CD2 1 
ATOM 2883 N NE1 . TRP C 1 71  ? 200.304 123.241 131.642 1.00 136.33 ? 71  TRP B NE1 1 
ATOM 2884 C CE2 . TRP C 1 71  ? 200.250 123.723 132.926 1.00 136.33 ? 71  TRP B CE2 1 
ATOM 2885 C CE3 . TRP C 1 71  ? 200.593 122.890 135.185 1.00 136.33 ? 71  TRP B CE3 1 
ATOM 2886 C CZ2 . TRP C 1 71  ? 199.941 125.009 133.395 1.00 136.33 ? 71  TRP B CZ2 1 
ATOM 2887 C CZ3 . TRP C 1 71  ? 200.286 124.171 135.649 1.00 136.33 ? 71  TRP B CZ3 1 
ATOM 2888 C CH2 . TRP C 1 71  ? 199.965 125.212 134.754 1.00 136.33 ? 71  TRP B CH2 1 
ATOM 2889 N N   . VAL C 1 72  ? 203.663 120.283 135.655 1.00 133.74 ? 72  VAL B N   1 
ATOM 2890 C CA  . VAL C 1 72  ? 204.238 120.997 136.769 1.00 133.74 ? 72  VAL B CA  1 
ATOM 2891 C C   . VAL C 1 72  ? 205.743 121.155 136.502 1.00 133.74 ? 72  VAL B C   1 
ATOM 2892 O O   . VAL C 1 72  ? 206.251 122.272 136.404 1.00 133.74 ? 72  VAL B O   1 
ATOM 2893 C CB  . VAL C 1 72  ? 203.995 120.190 138.053 1.00 87.13  ? 72  VAL B CB  1 
ATOM 2894 C CG1 . VAL C 1 72  ? 204.468 120.949 139.265 1.00 87.13  ? 72  VAL B CG1 1 
ATOM 2895 C CG2 . VAL C 1 72  ? 202.525 119.859 138.159 1.00 87.13  ? 72  VAL B CG2 1 
ATOM 2896 N N   . GLY C 1 73  ? 206.449 120.034 136.366 1.00 135.97 ? 73  GLY B N   1 
ATOM 2897 C CA  . GLY C 1 73  ? 207.876 120.096 136.106 1.00 135.97 ? 73  GLY B CA  1 
ATOM 2898 C C   . GLY C 1 73  ? 208.169 120.839 134.816 1.00 135.97 ? 73  GLY B C   1 
ATOM 2899 O O   . GLY C 1 73  ? 209.234 121.442 134.660 1.00 135.97 ? 73  GLY B O   1 
ATOM 2900 N N   . THR C 1 74  ? 207.209 120.796 133.893 1.00 181.96 ? 74  THR B N   1 
ATOM 2901 C CA  . THR C 1 74  ? 207.325 121.458 132.592 1.00 181.96 ? 74  THR B CA  1 
ATOM 2902 C C   . THR C 1 74  ? 207.093 122.973 132.687 1.00 181.96 ? 74  THR B C   1 
ATOM 2903 O O   . THR C 1 74  ? 207.954 123.770 132.297 1.00 181.96 ? 74  THR B O   1 
ATOM 2904 C CB  . THR C 1 74  ? 206.304 120.859 131.568 1.00 100.07 ? 74  THR B CB  1 
ATOM 2905 O OG1 . THR C 1 74  ? 206.600 119.473 131.350 1.00 100.07 ? 74  THR B OG1 1 
ATOM 2906 C CG2 . THR C 1 74  ? 206.352 121.613 130.227 1.00 100.07 ? 74  THR B CG2 1 
ATOM 2907 N N   . ASN C 1 75  ? 205.931 123.362 133.211 1.00 123.23 ? 75  ASN B N   1 
ATOM 2908 C CA  . ASN C 1 75  ? 205.570 124.774 133.334 1.00 123.23 ? 75  ASN B CA  1 
ATOM 2909 C C   . ASN C 1 75  ? 205.781 125.379 134.737 1.00 123.23 ? 75  ASN B C   1 
ATOM 2910 O O   . ASN C 1 75  ? 204.812 125.775 135.386 1.00 123.23 ? 75  ASN B O   1 
ATOM 2911 C CB  . ASN C 1 75  ? 204.101 124.973 132.894 1.00 115.21 ? 75  ASN B CB  1 
ATOM 2912 C CG  . ASN C 1 75  ? 203.928 125.026 131.363 1.00 115.21 ? 75  ASN B CG  1 
ATOM 2913 O OD1 . ASN C 1 75  ? 204.122 126.074 130.735 1.00 115.21 ? 75  ASN B OD1 1 
ATOM 2914 N ND2 . ASN C 1 75  ? 203.562 123.891 130.765 1.00 115.21 ? 75  ASN B ND2 1 
ATOM 2915 N N   . LEU C 1 76  ? 207.038 125.458 135.189 1.00 200.00 ? 76  LEU B N   1 
ATOM 2916 C CA  . LEU C 1 76  ? 207.384 126.035 136.503 1.00 200.00 ? 76  LEU B CA  1 
ATOM 2917 C C   . LEU C 1 76  ? 208.821 126.534 136.608 1.00 200.00 ? 76  LEU B C   1 
ATOM 2918 O O   . LEU C 1 76  ? 209.767 125.831 136.237 1.00 200.00 ? 76  LEU B O   1 
ATOM 2919 C CB  . LEU C 1 76  ? 207.156 125.034 137.630 1.00 133.61 ? 76  LEU B CB  1 
ATOM 2920 C CG  . LEU C 1 76  ? 205.725 124.920 138.139 1.00 133.61 ? 76  LEU B CG  1 
ATOM 2921 C CD1 . LEU C 1 76  ? 205.735 123.975 139.316 1.00 133.61 ? 76  LEU B CD1 1 
ATOM 2922 C CD2 . LEU C 1 76  ? 205.174 126.290 138.546 1.00 133.61 ? 76  LEU B CD2 1 
ATOM 2923 N N   . GLU C 1 77  ? 208.976 127.740 137.154 1.00 194.32 ? 77  GLU B N   1 
ATOM 2924 C CA  . GLU C 1 77  ? 210.290 128.358 137.291 1.00 194.32 ? 77  GLU B CA  1 
ATOM 2925 C C   . GLU C 1 77  ? 210.871 128.347 138.709 1.00 194.32 ? 77  GLU B C   1 
ATOM 2926 O O   . GLU C 1 77  ? 211.789 129.113 139.000 1.00 194.32 ? 77  GLU B O   1 
ATOM 2927 C CB  . GLU C 1 77  ? 210.249 129.805 136.762 1.00 148.28 ? 77  GLU B CB  1 
ATOM 2928 C CG  . GLU C 1 77  ? 209.774 129.961 135.302 1.00 148.28 ? 77  GLU B CG  1 
ATOM 2929 C CD  . GLU C 1 77  ? 210.678 129.267 134.280 1.00 148.28 ? 77  GLU B CD  1 
ATOM 2930 O OE1 . GLU C 1 77  ? 211.855 129.665 134.146 1.00 148.28 ? 77  GLU B OE1 1 
ATOM 2931 O OE2 . GLU C 1 77  ? 210.207 128.324 133.604 1.00 148.28 ? 77  GLU B OE2 1 
ATOM 2932 N N   . ASP C 1 78  ? 210.349 127.496 139.590 1.00 130.94 ? 78  ASP B N   1 
ATOM 2933 C CA  . ASP C 1 78  ? 210.886 127.423 140.949 1.00 130.94 ? 78  ASP B CA  1 
ATOM 2934 C C   . ASP C 1 78  ? 211.372 126.009 141.305 1.00 130.94 ? 78  ASP B C   1 
ATOM 2935 O O   . ASP C 1 78  ? 210.613 125.202 141.838 1.00 130.94 ? 78  ASP B O   1 
ATOM 2936 C CB  . ASP C 1 78  ? 209.841 127.903 141.974 1.00 109.92 ? 78  ASP B CB  1 
ATOM 2937 C CG  . ASP C 1 78  ? 210.397 127.952 143.409 1.00 109.92 ? 78  ASP B CG  1 
ATOM 2938 O OD1 . ASP C 1 78  ? 211.599 128.253 143.585 1.00 109.92 ? 78  ASP B OD1 1 
ATOM 2939 O OD2 . ASP C 1 78  ? 209.629 127.707 144.368 1.00 109.92 ? 78  ASP B OD2 1 
ATOM 2940 N N   . PRO C 1 79  ? 212.651 125.693 141.002 1.00 154.83 ? 79  PRO B N   1 
ATOM 2941 C CA  . PRO C 1 79  ? 213.285 124.391 141.270 1.00 154.83 ? 79  PRO B CA  1 
ATOM 2942 C C   . PRO C 1 79  ? 213.248 123.877 142.721 1.00 154.83 ? 79  PRO B C   1 
ATOM 2943 O O   . PRO C 1 79  ? 213.498 122.694 142.966 1.00 154.83 ? 79  PRO B O   1 
ATOM 2944 C CB  . PRO C 1 79  ? 214.720 124.603 140.777 1.00 126.32 ? 79  PRO B CB  1 
ATOM 2945 C CG  . PRO C 1 79  ? 214.532 125.515 139.613 1.00 126.32 ? 79  PRO B CG  1 
ATOM 2946 C CD  . PRO C 1 79  ? 213.533 126.526 140.157 1.00 126.32 ? 79  PRO B CD  1 
ATOM 2947 N N   . ALA C 1 80  ? 212.932 124.757 143.671 1.00 142.53 ? 80  ALA B N   1 
ATOM 2948 C CA  . ALA C 1 80  ? 212.891 124.395 145.095 1.00 142.53 ? 80  ALA B CA  1 
ATOM 2949 C C   . ALA C 1 80  ? 211.567 123.779 145.586 1.00 142.53 ? 80  ALA B C   1 
ATOM 2950 O O   . ALA C 1 80  ? 211.567 122.798 146.342 1.00 142.53 ? 80  ALA B O   1 
ATOM 2951 C CB  . ALA C 1 80  ? 213.252 125.635 145.955 1.00 83.06  ? 80  ALA B CB  1 
ATOM 2952 N N   . SER C 1 81  ? 210.445 124.356 145.156 1.00 137.29 ? 81  SER B N   1 
ATOM 2953 C CA  . SER C 1 81  ? 209.126 123.869 145.559 1.00 137.29 ? 81  SER B CA  1 
ATOM 2954 C C   . SER C 1 81  ? 208.441 122.976 144.519 1.00 137.29 ? 81  SER B C   1 
ATOM 2955 O O   . SER C 1 81  ? 207.535 122.218 144.863 1.00 137.29 ? 81  SER B O   1 
ATOM 2956 C CB  . SER C 1 81  ? 208.208 125.052 145.923 1.00 127.82 ? 81  SER B CB  1 
ATOM 2957 O OG  . SER C 1 81  ? 207.961 125.913 144.822 1.00 127.82 ? 81  SER B OG  1 
ATOM 2958 N N   . ARG C 1 82  ? 208.871 123.058 143.259 1.00 134.07 ? 82  ARG B N   1 
ATOM 2959 C CA  . ARG C 1 82  ? 208.282 122.235 142.201 1.00 134.07 ? 82  ARG B CA  1 
ATOM 2960 C C   . ARG C 1 82  ? 208.564 120.761 142.500 1.00 134.07 ? 82  ARG B C   1 
ATOM 2961 O O   . ARG C 1 82  ? 207.853 119.878 142.020 1.00 134.07 ? 82  ARG B O   1 
ATOM 2962 C CB  . ARG C 1 82  ? 208.859 122.604 140.817 1.00 152.06 ? 82  ARG B CB  1 
ATOM 2963 C CG  . ARG C 1 82  ? 210.179 121.903 140.456 1.00 152.06 ? 82  ARG B CG  1 
ATOM 2964 C CD  . ARG C 1 82  ? 210.663 122.227 139.031 1.00 152.06 ? 82  ARG B CD  1 
ATOM 2965 N NE  . ARG C 1 82  ? 211.870 121.471 138.676 1.00 152.06 ? 82  ARG B NE  1 
ATOM 2966 C CZ  . ARG C 1 82  ? 212.598 121.677 137.579 1.00 152.06 ? 82  ARG B CZ  1 
ATOM 2967 N NH1 . ARG C 1 82  ? 212.249 122.622 136.715 1.00 152.06 ? 82  ARG B NH1 1 
ATOM 2968 N NH2 . ARG C 1 82  ? 213.679 120.940 137.350 1.00 152.06 ? 82  ARG B NH2 1 
ATOM 2969 N N   . ASP C 1 83  ? 209.608 120.510 143.293 1.00 144.86 ? 83  ASP B N   1 
ATOM 2970 C CA  . ASP C 1 83  ? 210.009 119.152 143.679 1.00 144.86 ? 83  ASP B CA  1 
ATOM 2971 C C   . ASP C 1 83  ? 209.335 118.738 144.996 1.00 144.86 ? 83  ASP B C   1 
ATOM 2972 O O   . ASP C 1 83  ? 209.226 117.545 145.299 1.00 144.86 ? 83  ASP B O   1 
ATOM 2973 C CB  . ASP C 1 83  ? 211.545 119.060 143.840 1.00 132.16 ? 83  ASP B CB  1 
ATOM 2974 C CG  . ASP C 1 83  ? 212.296 119.066 142.499 1.00 132.16 ? 83  ASP B CG  1 
ATOM 2975 O OD1 . ASP C 1 83  ? 212.165 118.091 141.726 1.00 132.16 ? 83  ASP B OD1 1 
ATOM 2976 O OD2 . ASP C 1 83  ? 213.024 120.046 142.221 1.00 132.16 ? 83  ASP B OD2 1 
ATOM 2977 N N   . LEU C 1 84  ? 208.881 119.732 145.762 1.00 175.98 ? 84  LEU B N   1 
ATOM 2978 C CA  . LEU C 1 84  ? 208.224 119.516 147.058 1.00 175.98 ? 84  LEU B CA  1 
ATOM 2979 C C   . LEU C 1 84  ? 206.778 119.013 146.974 1.00 175.98 ? 84  LEU B C   1 
ATOM 2980 O O   . LEU C 1 84  ? 206.265 118.393 147.912 1.00 175.98 ? 84  LEU B O   1 
ATOM 2981 C CB  . LEU C 1 84  ? 208.252 120.812 147.875 1.00 145.19 ? 84  LEU B CB  1 
ATOM 2982 C CG  . LEU C 1 84  ? 207.374 120.846 149.131 1.00 145.19 ? 84  LEU B CG  1 
ATOM 2983 C CD1 . LEU C 1 84  ? 207.853 119.817 150.156 1.00 145.19 ? 84  LEU B CD1 1 
ATOM 2984 C CD2 . LEU C 1 84  ? 207.407 122.247 149.713 1.00 145.19 ? 84  LEU B CD2 1 
ATOM 2985 N N   . VAL C 1 85  ? 206.119 119.292 145.856 1.00 119.56 ? 85  VAL B N   1 
ATOM 2986 C CA  . VAL C 1 85  ? 204.737 118.864 145.652 1.00 119.56 ? 85  VAL B CA  1 
ATOM 2987 C C   . VAL C 1 85  ? 204.679 117.381 145.337 1.00 119.56 ? 85  VAL B C   1 
ATOM 2988 O O   . VAL C 1 85  ? 203.912 116.626 145.936 1.00 119.56 ? 85  VAL B O   1 
ATOM 2989 C CB  . VAL C 1 85  ? 204.088 119.635 144.479 1.00 66.53  ? 85  VAL B CB  1 
ATOM 2990 C CG1 . VAL C 1 85  ? 204.252 121.128 144.718 1.00 66.53  ? 85  VAL B CG1 1 
ATOM 2991 C CG2 . VAL C 1 85  ? 204.706 119.210 143.124 1.00 66.53  ? 85  VAL B CG2 1 
ATOM 2992 N N   . VAL C 1 86  ? 205.502 116.990 144.374 1.00 112.41 ? 86  VAL B N   1 
ATOM 2993 C CA  . VAL C 1 86  ? 205.602 115.621 143.927 1.00 112.41 ? 86  VAL B CA  1 
ATOM 2994 C C   . VAL C 1 86  ? 205.736 114.713 145.145 1.00 112.41 ? 86  VAL B C   1 
ATOM 2995 O O   . VAL C 1 86  ? 205.222 113.598 145.153 1.00 112.41 ? 86  VAL B O   1 
ATOM 2996 C CB  . VAL C 1 86  ? 206.818 115.469 142.998 1.00 92.72  ? 86  VAL B CB  1 
ATOM 2997 C CG1 . VAL C 1 86  ? 206.834 114.086 142.372 1.00 92.72  ? 86  VAL B CG1 1 
ATOM 2998 C CG2 . VAL C 1 86  ? 206.773 116.551 141.923 1.00 92.72  ? 86  VAL B CG2 1 
ATOM 2999 N N   . SER C 1 87  ? 206.421 115.198 146.177 1.00 189.82 ? 87  SER B N   1 
ATOM 3000 C CA  . SER C 1 87  ? 206.595 114.432 147.407 1.00 189.82 ? 87  SER B CA  1 
ATOM 3001 C C   . SER C 1 87  ? 205.229 114.187 148.061 1.00 189.82 ? 87  SER B C   1 
ATOM 3002 O O   . SER C 1 87  ? 204.886 113.049 148.378 1.00 189.82 ? 87  SER B O   1 
ATOM 3003 C CB  . SER C 1 87  ? 207.521 115.188 148.370 1.00 97.72  ? 87  SER B CB  1 
ATOM 3004 O OG  . SER C 1 87  ? 207.546 114.595 149.660 1.00 97.72  ? 87  SER B OG  1 
ATOM 3005 N N   . TYR C 1 88  ? 204.456 115.258 148.253 1.00 135.86 ? 88  TYR B N   1 
ATOM 3006 C CA  . TYR C 1 88  ? 203.116 115.174 148.854 1.00 135.86 ? 88  TYR B CA  1 
ATOM 3007 C C   . TYR C 1 88  ? 202.341 114.084 148.144 1.00 135.86 ? 88  TYR B C   1 
ATOM 3008 O O   . TYR C 1 88  ? 201.824 113.147 148.743 1.00 135.86 ? 88  TYR B O   1 
ATOM 3009 C CB  . TYR C 1 88  ? 202.367 116.498 148.669 1.00 135.87 ? 88  TYR B CB  1 
ATOM 3010 C CG  . TYR C 1 88  ? 200.951 116.497 149.216 1.00 135.87 ? 88  TYR B CG  1 
ATOM 3011 C CD1 . TYR C 1 88  ? 200.712 116.452 150.594 1.00 135.87 ? 88  TYR B CD1 1 
ATOM 3012 C CD2 . TYR C 1 88  ? 199.852 116.566 148.361 1.00 135.87 ? 88  TYR B CD2 1 
ATOM 3013 C CE1 . TYR C 1 88  ? 199.410 116.482 151.110 1.00 135.87 ? 88  TYR B CE1 1 
ATOM 3014 C CE2 . TYR C 1 88  ? 198.546 116.597 148.863 1.00 135.87 ? 88  TYR B CE2 1 
ATOM 3015 C CZ  . TYR C 1 88  ? 198.330 116.557 150.238 1.00 135.87 ? 88  TYR B CZ  1 
ATOM 3016 O OH  . TYR C 1 88  ? 197.040 116.609 150.736 1.00 135.87 ? 88  TYR B OH  1 
ATOM 3017 N N   . VAL C 1 89  ? 202.269 114.251 146.839 1.00 100.22 ? 89  VAL B N   1 
ATOM 3018 C CA  . VAL C 1 89  ? 201.598 113.328 145.958 1.00 100.22 ? 89  VAL B CA  1 
ATOM 3019 C C   . VAL C 1 89  ? 202.106 111.891 146.102 1.00 100.22 ? 89  VAL B C   1 
ATOM 3020 O O   . VAL C 1 89  ? 201.535 111.093 146.846 1.00 100.22 ? 89  VAL B O   1 
ATOM 3021 C CB  . VAL C 1 89  ? 201.808 113.789 144.532 1.00 50.45  ? 89  VAL B CB  1 
ATOM 3022 C CG1 . VAL C 1 89  ? 201.079 112.888 143.577 1.00 50.45  ? 89  VAL B CG1 1 
ATOM 3023 C CG2 . VAL C 1 89  ? 201.357 115.218 144.414 1.00 50.45  ? 89  VAL B CG2 1 
ATOM 3024 N N   . ASN C 1 90  ? 203.180 111.573 145.381 1.00 111.75 ? 90  ASN B N   1 
ATOM 3025 C CA  . ASN C 1 90  ? 203.774 110.237 145.396 1.00 111.75 ? 90  ASN B CA  1 
ATOM 3026 C C   . ASN C 1 90  ? 204.007 109.671 146.800 1.00 111.75 ? 90  ASN B C   1 
ATOM 3027 O O   . ASN C 1 90  ? 204.547 108.576 146.944 1.00 111.75 ? 90  ASN B O   1 
ATOM 3028 C CB  . ASN C 1 90  ? 205.103 110.236 144.619 1.00 97.37  ? 90  ASN B CB  1 
ATOM 3029 C CG  . ASN C 1 90  ? 204.925 110.535 143.127 1.00 97.37  ? 90  ASN B CG  1 
ATOM 3030 O OD1 . ASN C 1 90  ? 205.884 110.482 142.352 1.00 97.37  ? 90  ASN B OD1 1 
ATOM 3031 N ND2 . ASN C 1 90  ? 203.700 110.849 142.726 1.00 97.37  ? 90  ASN B ND2 1 
ATOM 3032 N N   . THR C 1 91  ? 203.605 110.410 147.830 1.00 159.33 ? 91  THR B N   1 
ATOM 3033 C CA  . THR C 1 91  ? 203.779 109.950 149.206 1.00 159.33 ? 91  THR B CA  1 
ATOM 3034 C C   . THR C 1 91  ? 202.506 110.103 150.053 1.00 159.33 ? 91  THR B C   1 
ATOM 3035 O O   . THR C 1 91  ? 201.900 109.104 150.445 1.00 159.33 ? 91  THR B O   1 
ATOM 3036 C CB  . THR C 1 91  ? 204.950 110.695 149.897 1.00 117.74 ? 91  THR B CB  1 
ATOM 3037 O OG1 . THR C 1 91  ? 206.093 110.680 149.031 1.00 117.74 ? 91  THR B OG1 1 
ATOM 3038 C CG2 . THR C 1 91  ? 205.317 110.023 151.230 1.00 117.74 ? 91  THR B CG2 1 
ATOM 3039 N N   . ASN C 1 92  ? 202.100 111.342 150.331 1.00 102.75 ? 92  ASN B N   1 
ATOM 3040 C CA  . ASN C 1 92  ? 200.905 111.602 151.143 1.00 102.75 ? 92  ASN B CA  1 
ATOM 3041 C C   . ASN C 1 92  ? 199.599 111.253 150.417 1.00 102.75 ? 92  ASN B C   1 
ATOM 3042 O O   . ASN C 1 92  ? 198.518 111.256 151.018 1.00 102.75 ? 92  ASN B O   1 
ATOM 3043 C CB  . ASN C 1 92  ? 200.874 113.076 151.576 1.00 140.32 ? 92  ASN B CB  1 
ATOM 3044 C CG  . ASN C 1 92  ? 202.031 113.448 152.498 1.00 140.32 ? 92  ASN B CG  1 
ATOM 3045 O OD1 . ASN C 1 92  ? 203.199 113.200 152.189 1.00 140.32 ? 92  ASN B OD1 1 
ATOM 3046 N ND2 . ASN C 1 92  ? 201.705 114.059 153.633 1.00 140.32 ? 92  ASN B ND2 1 
ATOM 3047 N N   . VAL C 1 93  ? 199.714 110.950 149.126 1.00 103.73 ? 93  VAL B N   1 
ATOM 3048 C CA  . VAL C 1 93  ? 198.568 110.597 148.285 1.00 103.73 ? 93  VAL B CA  1 
ATOM 3049 C C   . VAL C 1 93  ? 198.696 109.216 147.645 1.00 103.73 ? 93  VAL B C   1 
ATOM 3050 O O   . VAL C 1 93  ? 197.711 108.477 147.552 1.00 103.73 ? 93  VAL B O   1 
ATOM 3051 C CB  . VAL C 1 93  ? 198.359 111.651 147.175 1.00 37.54  ? 93  VAL B CB  1 
ATOM 3052 C CG1 . VAL C 1 93  ? 197.709 111.009 145.923 1.00 37.54  ? 93  VAL B CG1 1 
ATOM 3053 C CG2 . VAL C 1 93  ? 197.502 112.786 147.726 1.00 37.54  ? 93  VAL B CG2 1 
ATOM 3054 N N   . GLY C 1 94  ? 199.900 108.881 147.182 1.00 114.71 ? 94  GLY B N   1 
ATOM 3055 C CA  . GLY C 1 94  ? 200.111 107.572 146.598 1.00 114.71 ? 94  GLY B CA  1 
ATOM 3056 C C   . GLY C 1 94  ? 199.438 106.624 147.566 1.00 114.71 ? 94  GLY B C   1 
ATOM 3057 O O   . GLY C 1 94  ? 198.890 105.602 147.178 1.00 114.71 ? 94  GLY B O   1 
ATOM 3058 N N   . LEU C 1 95  ? 199.471 106.992 148.844 1.00 96.64  ? 95  LEU B N   1 
ATOM 3059 C CA  . LEU C 1 95  ? 198.839 106.212 149.893 1.00 96.64  ? 95  LEU B CA  1 
ATOM 3060 C C   . LEU C 1 95  ? 197.316 106.263 149.683 1.00 96.64  ? 95  LEU B C   1 
ATOM 3061 O O   . LEU C 1 95  ? 196.714 105.262 149.285 1.00 96.64  ? 95  LEU B O   1 
ATOM 3062 C CB  . LEU C 1 95  ? 199.233 106.775 151.272 1.00 110.38 ? 95  LEU B CB  1 
ATOM 3063 C CG  . LEU C 1 95  ? 198.653 106.151 152.555 1.00 110.38 ? 95  LEU B CG  1 
ATOM 3064 C CD1 . LEU C 1 95  ? 199.710 106.189 153.666 1.00 110.38 ? 95  LEU B CD1 1 
ATOM 3065 C CD2 . LEU C 1 95  ? 197.354 106.878 152.980 1.00 110.38 ? 95  LEU B CD2 1 
ATOM 3066 N N   . LYS C 1 96  ? 196.690 107.419 149.920 1.00 99.06  ? 96  LYS B N   1 
ATOM 3067 C CA  . LYS C 1 96  ? 195.242 107.522 149.741 1.00 99.06  ? 96  LYS B CA  1 
ATOM 3068 C C   . LYS C 1 96  ? 194.789 106.758 148.497 1.00 99.06  ? 96  LYS B C   1 
ATOM 3069 O O   . LYS C 1 96  ? 193.681 106.228 148.475 1.00 99.06  ? 96  LYS B O   1 
ATOM 3070 C CB  . LYS C 1 96  ? 194.783 108.992 149.660 1.00 106.92 ? 96  LYS B CB  1 
ATOM 3071 C CG  . LYS C 1 96  ? 194.652 109.713 151.022 1.00 106.92 ? 96  LYS B CG  1 
ATOM 3072 C CD  . LYS C 1 96  ? 194.023 111.121 150.884 1.00 106.92 ? 96  LYS B CD  1 
ATOM 3073 C CE  . LYS C 1 96  ? 193.912 111.874 152.227 1.00 106.92 ? 96  LYS B CE  1 
ATOM 3074 N NZ  . LYS C 1 96  ? 193.267 113.226 152.097 1.00 106.92 ? 96  LYS B NZ  1 
ATOM 3075 N N   . PHE C 1 97  ? 195.651 106.674 147.479 1.00 55.63  ? 97  PHE B N   1 
ATOM 3076 C CA  . PHE C 1 97  ? 195.316 105.964 146.241 1.00 55.63  ? 97  PHE B CA  1 
ATOM 3077 C C   . PHE C 1 97  ? 195.707 104.497 146.183 1.00 55.63  ? 97  PHE B C   1 
ATOM 3078 O O   . PHE C 1 97  ? 194.967 103.700 145.625 1.00 55.63  ? 97  PHE B O   1 
ATOM 3079 C CB  . PHE C 1 97  ? 195.889 106.693 145.027 1.00 113.30 ? 97  PHE B CB  1 
ATOM 3080 C CG  . PHE C 1 97  ? 194.909 107.631 144.373 1.00 113.30 ? 97  PHE B CG  1 
ATOM 3081 C CD1 . PHE C 1 97  ? 194.140 108.512 145.145 1.00 113.30 ? 97  PHE B CD1 1 
ATOM 3082 C CD2 . PHE C 1 97  ? 194.755 107.650 142.989 1.00 113.30 ? 97  PHE B CD2 1 
ATOM 3083 C CE1 . PHE C 1 97  ? 193.229 109.402 144.544 1.00 113.30 ? 97  PHE B CE1 1 
ATOM 3084 C CE2 . PHE C 1 97  ? 193.849 108.535 142.374 1.00 113.30 ? 97  PHE B CE2 1 
ATOM 3085 C CZ  . PHE C 1 97  ? 193.087 109.412 143.153 1.00 113.30 ? 97  PHE B CZ  1 
ATOM 3086 N N   . ARG C 1 98  ? 196.865 104.131 146.730 1.00 58.35  ? 98  ARG B N   1 
ATOM 3087 C CA  . ARG C 1 98  ? 197.265 102.718 146.734 1.00 58.35  ? 98  ARG B CA  1 
ATOM 3088 C C   . ARG C 1 98  ? 196.320 102.052 147.731 1.00 58.35  ? 98  ARG B C   1 
ATOM 3089 O O   . ARG C 1 98  ? 195.727 101.007 147.446 1.00 58.35  ? 98  ARG B O   1 
ATOM 3090 C CB  . ARG C 1 98  ? 198.728 102.505 147.210 1.00 80.97  ? 98  ARG B CB  1 
ATOM 3091 C CG  . ARG C 1 98  ? 199.839 103.018 146.280 1.00 80.97  ? 98  ARG B CG  1 
ATOM 3092 C CD  . ARG C 1 98  ? 201.252 102.446 146.581 1.00 80.97  ? 98  ARG B CD  1 
ATOM 3093 N NE  . ARG C 1 98  ? 201.712 102.594 147.969 1.00 80.97  ? 98  ARG B NE  1 
ATOM 3094 C CZ  . ARG C 1 98  ? 202.993 102.550 148.353 1.00 80.97  ? 98  ARG B CZ  1 
ATOM 3095 N NH1 . ARG C 1 98  ? 203.953 102.375 147.454 1.00 80.97  ? 98  ARG B NH1 1 
ATOM 3096 N NH2 . ARG C 1 98  ? 203.319 102.646 149.640 1.00 80.97  ? 98  ARG B NH2 1 
ATOM 3097 N N   . GLN C 1 99  ? 196.194 102.676 148.904 1.00 107.32 ? 99  GLN B N   1 
ATOM 3098 C CA  . GLN C 1 99  ? 195.326 102.174 149.964 1.00 107.32 ? 99  GLN B CA  1 
ATOM 3099 C C   . GLN C 1 99  ? 194.133 101.651 149.230 1.00 107.32 ? 99  GLN B C   1 
ATOM 3100 O O   . GLN C 1 99  ? 193.905 100.446 149.123 1.00 107.32 ? 99  GLN B O   1 
ATOM 3101 C CB  . GLN C 1 99  ? 194.881 103.312 150.888 1.00 128.72 ? 99  GLN B CB  1 
ATOM 3102 C CG  . GLN C 1 99  ? 193.848 102.898 151.932 1.00 128.72 ? 99  GLN B CG  1 
ATOM 3103 C CD  . GLN C 1 99  ? 193.439 104.033 152.854 1.00 128.72 ? 99  GLN B CD  1 
ATOM 3104 O OE1 . GLN C 1 99  ? 192.901 105.044 152.407 1.00 128.72 ? 99  GLN B OE1 1 
ATOM 3105 N NE2 . GLN C 1 99  ? 193.692 103.867 154.151 1.00 128.72 ? 99  GLN B NE2 1 
ATOM 3106 N N   . LEU C 1 100 ? 193.393 102.600 148.693 1.00 83.69  ? 100 LEU B N   1 
ATOM 3107 C CA  . LEU C 1 100 ? 192.216 102.302 147.920 1.00 83.69  ? 100 LEU B CA  1 
ATOM 3108 C C   . LEU C 1 100 ? 192.491 101.165 146.935 1.00 83.69  ? 100 LEU B C   1 
ATOM 3109 O O   . LEU C 1 100 ? 192.201 100.005 147.199 1.00 83.69  ? 100 LEU B O   1 
ATOM 3110 C CB  . LEU C 1 100 ? 191.805 103.556 147.160 1.00 52.80  ? 100 LEU B CB  1 
ATOM 3111 C CG  . LEU C 1 100 ? 190.547 103.486 146.299 1.00 52.80  ? 100 LEU B CG  1 
ATOM 3112 C CD1 . LEU C 1 100 ? 190.257 104.866 145.749 1.00 52.80  ? 100 LEU B CD1 1 
ATOM 3113 C CD2 . LEU C 1 100 ? 190.718 102.506 145.165 1.00 52.80  ? 100 LEU B CD2 1 
ATOM 3114 N N   . LEU C 1 101 ? 193.055 101.522 145.791 1.00 47.67  ? 101 LEU B N   1 
ATOM 3115 C CA  . LEU C 1 101 ? 193.356 100.568 144.743 1.00 47.67  ? 101 LEU B CA  1 
ATOM 3116 C C   . LEU C 1 101 ? 193.419 99.114  145.186 1.00 47.67  ? 101 LEU B C   1 
ATOM 3117 O O   . LEU C 1 101 ? 192.450 98.360  145.029 1.00 47.67  ? 101 LEU B O   1 
ATOM 3118 C CB  . LEU C 1 101 ? 194.672 100.939 144.094 1.00 84.72  ? 101 LEU B CB  1 
ATOM 3119 C CG  . LEU C 1 101 ? 194.491 101.254 142.619 1.00 84.72  ? 101 LEU B CG  1 
ATOM 3120 C CD1 . LEU C 1 101 ? 194.127 102.727 142.428 1.00 84.72  ? 101 LEU B CD1 1 
ATOM 3121 C CD2 . LEU C 1 101 ? 195.785 100.899 141.892 1.00 84.72  ? 101 LEU B CD2 1 
ATOM 3122 N N   . TRP C 1 102 ? 194.574 98.733  145.729 1.00 77.29  ? 102 TRP B N   1 
ATOM 3123 C CA  . TRP C 1 102 ? 194.815 97.371  146.201 1.00 77.29  ? 102 TRP B CA  1 
ATOM 3124 C C   . TRP C 1 102 ? 193.555 96.699  146.667 1.00 77.29  ? 102 TRP B C   1 
ATOM 3125 O O   . TRP C 1 102 ? 193.304 95.519  146.410 1.00 77.29  ? 102 TRP B O   1 
ATOM 3126 C CB  . TRP C 1 102 ? 195.780 97.379  147.369 1.00 84.48  ? 102 TRP B CB  1 
ATOM 3127 C CG  . TRP C 1 102 ? 195.699 96.118  148.219 1.00 84.48  ? 102 TRP B CG  1 
ATOM 3128 C CD1 . TRP C 1 102 ? 196.386 94.931  148.053 1.00 84.48  ? 102 TRP B CD1 1 
ATOM 3129 C CD2 . TRP C 1 102 ? 194.893 95.947  149.367 1.00 84.48  ? 102 TRP B CD2 1 
ATOM 3130 N NE1 . TRP C 1 102 ? 196.051 94.044  149.046 1.00 84.48  ? 102 TRP B NE1 1 
ATOM 3131 C CE2 . TRP C 1 102 ? 195.134 94.646  149.866 1.00 84.48  ? 102 TRP B CE2 1 
ATOM 3132 C CE3 . TRP C 1 102 ? 193.985 96.771  150.031 1.00 84.48  ? 102 TRP B CE3 1 
ATOM 3133 C CZ2 . TRP C 1 102 ? 194.497 94.160  150.999 1.00 84.48  ? 102 TRP B CZ2 1 
ATOM 3134 C CZ3 . TRP C 1 102 ? 193.351 96.290  151.153 1.00 84.48  ? 102 TRP B CZ3 1 
ATOM 3135 C CH2 . TRP C 1 102 ? 193.608 94.996  151.631 1.00 84.48  ? 102 TRP B CH2 1 
ATOM 3136 N N   . PHE C 1 103 ? 192.803 97.461  147.431 1.00 72.27  ? 103 PHE B N   1 
ATOM 3137 C CA  . PHE C 1 103 ? 191.555 96.990  147.945 1.00 72.27  ? 103 PHE B CA  1 
ATOM 3138 C C   . PHE C 1 103 ? 190.812 96.325  146.793 1.00 72.27  ? 103 PHE B C   1 
ATOM 3139 O O   . PHE C 1 103 ? 190.890 95.102  146.614 1.00 72.27  ? 103 PHE B O   1 
ATOM 3140 C CB  . PHE C 1 103 ? 190.800 98.189  148.472 1.00 83.83  ? 103 PHE B CB  1 
ATOM 3141 C CG  . PHE C 1 103 ? 189.358 97.951  148.664 1.00 83.83  ? 103 PHE B CG  1 
ATOM 3142 C CD1 . PHE C 1 103 ? 188.905 97.304  149.793 1.00 83.83  ? 103 PHE B CD1 1 
ATOM 3143 C CD2 . PHE C 1 103 ? 188.440 98.392  147.720 1.00 83.83  ? 103 PHE B CD2 1 
ATOM 3144 C CE1 . PHE C 1 103 ? 187.549 97.099  149.990 1.00 83.83  ? 103 PHE B CE1 1 
ATOM 3145 C CE2 . PHE C 1 103 ? 187.076 98.193  147.903 1.00 83.83  ? 103 PHE B CE2 1 
ATOM 3146 C CZ  . PHE C 1 103 ? 186.626 97.545  149.044 1.00 83.83  ? 103 PHE B CZ  1 
ATOM 3147 N N   . HIS C 1 104 ? 190.121 97.143  146.002 1.00 72.41  ? 104 HIS B N   1 
ATOM 3148 C CA  . HIS C 1 104 ? 189.355 96.667  144.860 1.00 72.41  ? 104 HIS B CA  1 
ATOM 3149 C C   . HIS C 1 104 ? 190.095 95.556  144.161 1.00 72.41  ? 104 HIS B C   1 
ATOM 3150 O O   . HIS C 1 104 ? 189.691 94.396  144.217 1.00 72.41  ? 104 HIS B O   1 
ATOM 3151 C CB  . HIS C 1 104 ? 189.119 97.806  143.879 1.00 100.83 ? 104 HIS B CB  1 
ATOM 3152 C CG  . HIS C 1 104 ? 188.135 98.819  144.366 1.00 100.83 ? 104 HIS B CG  1 
ATOM 3153 N ND1 . HIS C 1 104 ? 186.774 98.600  144.356 1.00 100.83 ? 104 HIS B ND1 1 
ATOM 3154 C CD2 . HIS C 1 104 ? 188.314 100.041 144.918 1.00 100.83 ? 104 HIS B CD2 1 
ATOM 3155 C CE1 . HIS C 1 104 ? 186.157 99.643  144.882 1.00 100.83 ? 104 HIS B CE1 1 
ATOM 3156 N NE2 . HIS C 1 104 ? 187.069 100.532 145.232 1.00 100.83 ? 104 HIS B NE2 1 
ATOM 3157 N N   . ILE C 1 105 ? 191.183 95.937  143.501 1.00 58.42  ? 105 ILE B N   1 
ATOM 3158 C CA  . ILE C 1 105 ? 192.063 95.025  142.771 1.00 58.42  ? 105 ILE B CA  1 
ATOM 3159 C C   . ILE C 1 105 ? 192.111 93.593  143.301 1.00 58.42  ? 105 ILE B C   1 
ATOM 3160 O O   . ILE C 1 105 ? 191.541 92.662  142.715 1.00 58.42  ? 105 ILE B O   1 
ATOM 3161 C CB  . ILE C 1 105 ? 193.506 95.550  142.798 1.00 107.31 ? 105 ILE B CB  1 
ATOM 3162 C CG1 . ILE C 1 105 ? 193.574 96.908  142.100 1.00 107.31 ? 105 ILE B CG1 1 
ATOM 3163 C CG2 . ILE C 1 105 ? 194.452 94.524  142.183 1.00 107.31 ? 105 ILE B CG2 1 
ATOM 3164 C CD1 . ILE C 1 105 ? 194.975 97.495  142.040 1.00 107.31 ? 105 ILE B CD1 1 
ATOM 3165 N N   . SER C 1 106 ? 192.840 93.432  144.400 1.00 115.51 ? 106 SER B N   1 
ATOM 3166 C CA  . SER C 1 106 ? 193.001 92.144  145.040 1.00 115.51 ? 106 SER B CA  1 
ATOM 3167 C C   . SER C 1 106 ? 191.603 91.566  145.306 1.00 115.51 ? 106 SER B C   1 
ATOM 3168 O O   . SER C 1 106 ? 191.310 90.422  144.961 1.00 115.51 ? 106 SER B O   1 
ATOM 3169 C CB  . SER C 1 106 ? 193.843 92.337  146.312 1.00 44.81  ? 106 SER B CB  1 
ATOM 3170 O OG  . SER C 1 106 ? 195.185 92.706  145.963 1.00 44.81  ? 106 SER B OG  1 
ATOM 3171 N N   . ALA C 1 107 ? 190.726 92.385  145.870 1.00 61.80  ? 107 ALA B N   1 
ATOM 3172 C CA  . ALA C 1 107 ? 189.353 91.970  146.143 1.00 61.80  ? 107 ALA B CA  1 
ATOM 3173 C C   . ALA C 1 107 ? 188.626 91.413  144.913 1.00 61.80  ? 107 ALA B C   1 
ATOM 3174 O O   . ALA C 1 107 ? 187.877 90.442  145.010 1.00 61.80  ? 107 ALA B O   1 
ATOM 3175 C CB  . ALA C 1 107 ? 188.573 93.137  146.685 1.00 97.13  ? 107 ALA B CB  1 
ATOM 3176 N N   . LEU C 1 108 ? 188.832 92.045  143.763 1.00 53.31  ? 108 LEU B N   1 
ATOM 3177 C CA  . LEU C 1 108 ? 188.196 91.619  142.520 1.00 53.31  ? 108 LEU B CA  1 
ATOM 3178 C C   . LEU C 1 108 ? 188.850 90.329  142.098 1.00 53.31  ? 108 LEU B C   1 
ATOM 3179 O O   . LEU C 1 108 ? 188.976 90.043  140.909 1.00 53.31  ? 108 LEU B O   1 
ATOM 3180 C CB  . LEU C 1 108 ? 188.424 92.648  141.418 1.00 83.91  ? 108 LEU B CB  1 
ATOM 3181 C CG  . LEU C 1 108 ? 187.252 92.782  140.455 1.00 83.91  ? 108 LEU B CG  1 
ATOM 3182 C CD1 . LEU C 1 108 ? 186.363 93.871  140.980 1.00 83.91  ? 108 LEU B CD1 1 
ATOM 3183 C CD2 . LEU C 1 108 ? 187.704 93.132  139.062 1.00 83.91  ? 108 LEU B CD2 1 
ATOM 3184 N N   . THR C 1 109 ? 189.270 89.551  143.082 1.00 89.10  ? 109 THR B N   1 
ATOM 3185 C CA  . THR C 1 109 ? 189.949 88.307  142.811 1.00 89.10  ? 109 THR B CA  1 
ATOM 3186 C C   . THR C 1 109 ? 189.583 87.282  143.874 1.00 89.10  ? 109 THR B C   1 
ATOM 3187 O O   . THR C 1 109 ? 189.614 86.070  143.647 1.00 89.10  ? 109 THR B O   1 
ATOM 3188 C CB  . THR C 1 109 ? 191.459 88.529  142.846 1.00 27.84  ? 109 THR B CB  1 
ATOM 3189 O OG1 . THR C 1 109 ? 191.783 89.793  142.238 1.00 27.84  ? 109 THR B OG1 1 
ATOM 3190 C CG2 . THR C 1 109 ? 192.145 87.407  142.100 1.00 27.84  ? 109 THR B CG2 1 
ATOM 3191 N N   . PHE C 1 110 ? 189.234 87.796  145.043 1.00 75.29  ? 110 PHE B N   1 
ATOM 3192 C CA  . PHE C 1 110 ? 188.868 86.967  146.175 1.00 75.29  ? 110 PHE B CA  1 
ATOM 3193 C C   . PHE C 1 110 ? 187.502 87.433  146.722 1.00 75.29  ? 110 PHE B C   1 
ATOM 3194 O O   . PHE C 1 110 ? 187.293 87.521  147.934 1.00 75.29  ? 110 PHE B O   1 
ATOM 3195 C CB  . PHE C 1 110 ? 189.952 87.111  147.241 1.00 84.12  ? 110 PHE B CB  1 
ATOM 3196 C CG  . PHE C 1 110 ? 191.380 87.105  146.691 1.00 84.12  ? 110 PHE B CG  1 
ATOM 3197 C CD1 . PHE C 1 110 ? 192.161 85.945  146.735 1.00 84.12  ? 110 PHE B CD1 1 
ATOM 3198 C CD2 . PHE C 1 110 ? 191.967 88.270  146.199 1.00 84.12  ? 110 PHE B CD2 1 
ATOM 3199 C CE1 . PHE C 1 110 ? 193.512 85.955  146.302 1.00 84.12  ? 110 PHE B CE1 1 
ATOM 3200 C CE2 . PHE C 1 110 ? 193.309 88.287  145.767 1.00 84.12  ? 110 PHE B CE2 1 
ATOM 3201 C CZ  . PHE C 1 110 ? 194.078 87.129  145.822 1.00 84.12  ? 110 PHE B CZ  1 
ATOM 3202 N N   . GLY C 1 111 ? 186.573 87.736  145.819 1.00 95.21  ? 111 GLY B N   1 
ATOM 3203 C CA  . GLY C 1 111 ? 185.267 88.205  146.244 1.00 95.21  ? 111 GLY B CA  1 
ATOM 3204 C C   . GLY C 1 111 ? 185.472 89.321  147.249 1.00 95.21  ? 111 GLY B C   1 
ATOM 3205 O O   . GLY C 1 111 ? 186.572 89.839  147.383 1.00 95.21  ? 111 GLY B O   1 
ATOM 3206 N N   . ARG C 1 112 ? 184.419 89.724  147.939 1.00 40.70  ? 112 ARG B N   1 
ATOM 3207 C CA  . ARG C 1 112 ? 184.562 90.760  148.952 1.00 40.70  ? 112 ARG B CA  1 
ATOM 3208 C C   . ARG C 1 112 ? 184.720 89.950  150.213 1.00 40.70  ? 112 ARG B C   1 
ATOM 3209 O O   . ARG C 1 112 ? 185.722 90.012  150.901 1.00 40.70  ? 112 ARG B O   1 
ATOM 3210 C CB  . ARG C 1 112 ? 183.284 91.590  149.150 1.00 88.09  ? 112 ARG B CB  1 
ATOM 3211 C CG  . ARG C 1 112 ? 182.848 92.612  148.114 1.00 88.09  ? 112 ARG B CG  1 
ATOM 3212 C CD  . ARG C 1 112 ? 181.685 93.391  148.749 1.00 88.09  ? 112 ARG B CD  1 
ATOM 3213 N NE  . ARG C 1 112 ? 180.917 94.266  147.855 1.00 88.09  ? 112 ARG B NE  1 
ATOM 3214 C CZ  . ARG C 1 112 ? 180.225 93.866  146.781 1.00 88.09  ? 112 ARG B CZ  1 
ATOM 3215 N NH1 . ARG C 1 112 ? 180.203 92.579  146.436 1.00 88.09  ? 112 ARG B NH1 1 
ATOM 3216 N NH2 . ARG C 1 112 ? 179.524 94.751  146.059 1.00 88.09  ? 112 ARG B NH2 1 
ATOM 3217 N N   . GLU C 1 113 ? 183.669 89.189  150.488 1.00 80.21  ? 113 GLU B N   1 
ATOM 3218 C CA  . GLU C 1 113 ? 183.574 88.358  151.667 1.00 80.21  ? 113 GLU B CA  1 
ATOM 3219 C C   . GLU C 1 113 ? 184.912 87.729  152.016 1.00 80.21  ? 113 GLU B C   1 
ATOM 3220 O O   . GLU C 1 113 ? 185.389 87.863  153.150 1.00 80.21  ? 113 GLU B O   1 
ATOM 3221 C CB  . GLU C 1 113 ? 182.480 87.297  151.456 1.00 121.40 ? 113 GLU B CB  1 
ATOM 3222 C CG  . GLU C 1 113 ? 181.087 87.900  151.151 1.00 121.40 ? 113 GLU B CG  1 
ATOM 3223 C CD  . GLU C 1 113 ? 180.631 88.949  152.186 1.00 121.40 ? 113 GLU B CD  1 
ATOM 3224 O OE1 . GLU C 1 113 ? 180.546 88.616  153.392 1.00 121.40 ? 113 GLU B OE1 1 
ATOM 3225 O OE2 . GLU C 1 113 ? 180.352 90.107  151.793 1.00 121.40 ? 113 GLU B OE2 1 
ATOM 3226 N N   . THR C 1 114 ? 185.528 87.081  151.029 1.00 80.26  ? 114 THR B N   1 
ATOM 3227 C CA  . THR C 1 114 ? 186.822 86.408  151.206 1.00 80.26  ? 114 THR B CA  1 
ATOM 3228 C C   . THR C 1 114 ? 187.901 87.396  151.650 1.00 80.26  ? 114 THR B C   1 
ATOM 3229 O O   . THR C 1 114 ? 188.920 87.028  152.234 1.00 80.26  ? 114 THR B O   1 
ATOM 3230 C CB  . THR C 1 114 ? 187.250 85.716  149.873 1.00 105.44 ? 114 THR B CB  1 
ATOM 3231 O OG1 . THR C 1 114 ? 186.267 84.735  149.511 1.00 105.44 ? 114 THR B OG1 1 
ATOM 3232 C CG2 . THR C 1 114 ? 188.603 85.032  150.004 1.00 105.44 ? 114 THR B CG2 1 
ATOM 3233 N N   . VAL C 1 115 ? 187.626 88.663  151.384 1.00 53.54  ? 115 VAL B N   1 
ATOM 3234 C CA  . VAL C 1 115 ? 188.522 89.765  151.687 1.00 53.54  ? 115 VAL B CA  1 
ATOM 3235 C C   . VAL C 1 115 ? 188.317 90.361  153.042 1.00 53.54  ? 115 VAL B C   1 
ATOM 3236 O O   . VAL C 1 115 ? 189.194 90.323  153.880 1.00 53.54  ? 115 VAL B O   1 
ATOM 3237 C CB  . VAL C 1 115 ? 188.308 90.921  150.738 1.00 38.87  ? 115 VAL B CB  1 
ATOM 3238 C CG1 . VAL C 1 115 ? 189.184 92.100  151.181 1.00 38.87  ? 115 VAL B CG1 1 
ATOM 3239 C CG2 . VAL C 1 115 ? 188.545 90.461  149.293 1.00 38.87  ? 115 VAL B CG2 1 
ATOM 3240 N N   . LEU C 1 116 ? 187.168 90.999  153.203 1.00 59.31  ? 116 LEU B N   1 
ATOM 3241 C CA  . LEU C 1 116 ? 186.814 91.621  154.458 1.00 59.31  ? 116 LEU B CA  1 
ATOM 3242 C C   . LEU C 1 116 ? 187.217 90.673  155.564 1.00 59.31  ? 116 LEU B C   1 
ATOM 3243 O O   . LEU C 1 116 ? 187.825 91.091  156.537 1.00 59.31  ? 116 LEU B O   1 
ATOM 3244 C CB  . LEU C 1 116 ? 185.307 91.844  154.528 1.00 66.99  ? 116 LEU B CB  1 
ATOM 3245 C CG  . LEU C 1 116 ? 184.574 92.136  153.219 1.00 66.99  ? 116 LEU B CG  1 
ATOM 3246 C CD1 . LEU C 1 116 ? 183.147 92.622  153.508 1.00 66.99  ? 116 LEU B CD1 1 
ATOM 3247 C CD2 . LEU C 1 116 ? 185.356 93.172  152.457 1.00 66.99  ? 116 LEU B CD2 1 
ATOM 3248 N N   . GLU C 1 117 ? 186.873 89.396  155.401 1.00 112.03 ? 117 GLU B N   1 
ATOM 3249 C CA  . GLU C 1 117 ? 187.195 88.379  156.393 1.00 112.03 ? 117 GLU B CA  1 
ATOM 3250 C C   . GLU C 1 117 ? 188.705 88.336  156.627 1.00 112.03 ? 117 GLU B C   1 
ATOM 3251 O O   . GLU C 1 117 ? 189.177 87.688  157.564 1.00 112.03 ? 117 GLU B O   1 
ATOM 3252 C CB  . GLU C 1 117 ? 186.673 87.014  155.937 1.00 119.72 ? 117 GLU B CB  1 
ATOM 3253 C CG  . GLU C 1 117 ? 186.577 85.984  157.052 1.00 119.72 ? 117 GLU B CG  1 
ATOM 3254 C CD  . GLU C 1 117 ? 185.790 84.748  156.642 1.00 119.72 ? 117 GLU B CD  1 
ATOM 3255 O OE1 . GLU C 1 117 ? 186.210 84.053  155.688 1.00 119.72 ? 117 GLU B OE1 1 
ATOM 3256 O OE2 . GLU C 1 117 ? 184.748 84.472  157.276 1.00 119.72 ? 117 GLU B OE2 1 
ATOM 3257 N N   . TYR C 1 118 ? 189.449 89.031  155.761 1.00 63.80  ? 118 TYR B N   1 
ATOM 3258 C CA  . TYR C 1 118 ? 190.911 89.146  155.860 1.00 63.80  ? 118 TYR B CA  1 
ATOM 3259 C C   . TYR C 1 118 ? 191.196 90.299  156.810 1.00 63.80  ? 118 TYR B C   1 
ATOM 3260 O O   . TYR C 1 118 ? 191.564 90.087  157.963 1.00 63.80  ? 118 TYR B O   1 
ATOM 3261 C CB  . TYR C 1 118 ? 191.540 89.459  154.490 1.00 88.12  ? 118 TYR B CB  1 
ATOM 3262 C CG  . TYR C 1 118 ? 193.068 89.605  154.475 1.00 88.12  ? 118 TYR B CG  1 
ATOM 3263 C CD1 . TYR C 1 118 ? 193.867 88.738  153.715 1.00 88.12  ? 118 TYR B CD1 1 
ATOM 3264 C CD2 . TYR C 1 118 ? 193.715 90.634  155.173 1.00 88.12  ? 118 TYR B CD2 1 
ATOM 3265 C CE1 . TYR C 1 118 ? 195.276 88.895  153.644 1.00 88.12  ? 118 TYR B CE1 1 
ATOM 3266 C CE2 . TYR C 1 118 ? 195.129 90.797  155.103 1.00 88.12  ? 118 TYR B CE2 1 
ATOM 3267 C CZ  . TYR C 1 118 ? 195.895 89.924  154.332 1.00 88.12  ? 118 TYR B CZ  1 
ATOM 3268 O OH  . TYR C 1 118 ? 197.260 90.073  154.211 1.00 88.12  ? 118 TYR B OH  1 
ATOM 3269 N N   . LEU C 1 119 ? 191.024 91.515  156.298 1.00 69.97  ? 119 LEU B N   1 
ATOM 3270 C CA  . LEU C 1 119 ? 191.218 92.741  157.064 1.00 69.97  ? 119 LEU B CA  1 
ATOM 3271 C C   . LEU C 1 119 ? 190.927 92.490  158.507 1.00 69.97  ? 119 LEU B C   1 
ATOM 3272 O O   . LEU C 1 119 ? 191.758 92.720  159.380 1.00 69.97  ? 119 LEU B O   1 
ATOM 3273 C CB  . LEU C 1 119 ? 190.252 93.801  156.605 1.00 65.46  ? 119 LEU B CB  1 
ATOM 3274 C CG  . LEU C 1 119 ? 190.514 94.212  155.179 1.00 65.46  ? 119 LEU B CG  1 
ATOM 3275 C CD1 . LEU C 1 119 ? 190.121 93.119  154.188 1.00 65.46  ? 119 LEU B CD1 1 
ATOM 3276 C CD2 . LEU C 1 119 ? 189.727 95.464  154.970 1.00 65.46  ? 119 LEU B CD2 1 
ATOM 3277 N N   . VAL C 1 120 ? 189.698 92.048  158.732 1.00 74.39  ? 120 VAL B N   1 
ATOM 3278 C CA  . VAL C 1 120 ? 189.205 91.705  160.048 1.00 74.39  ? 120 VAL B CA  1 
ATOM 3279 C C   . VAL C 1 120 ? 190.365 91.235  160.909 1.00 74.39  ? 120 VAL B C   1 
ATOM 3280 O O   . VAL C 1 120 ? 190.896 92.004  161.728 1.00 74.39  ? 120 VAL B O   1 
ATOM 3281 C CB  . VAL C 1 120 ? 188.178 90.563  159.942 1.00 99.99  ? 120 VAL B CB  1 
ATOM 3282 C CG1 . VAL C 1 120 ? 187.699 90.170  161.304 1.00 99.99  ? 120 VAL B CG1 1 
ATOM 3283 C CG2 . VAL C 1 120 ? 187.008 90.992  159.094 1.00 99.99  ? 120 VAL B CG2 1 
ATOM 3284 N N   . SER C 1 121 ? 190.754 89.972  160.692 1.00 142.90 ? 121 SER B N   1 
ATOM 3285 C CA  . SER C 1 121 ? 191.851 89.322  161.421 1.00 142.90 ? 121 SER B CA  1 
ATOM 3286 C C   . SER C 1 121 ? 193.084 90.239  161.457 1.00 142.90 ? 121 SER B C   1 
ATOM 3287 O O   . SER C 1 121 ? 193.535 90.651  162.534 1.00 142.90 ? 121 SER B O   1 
ATOM 3288 C CB  . SER C 1 121 ? 192.204 87.949  160.780 1.00 109.08 ? 121 SER B CB  1 
ATOM 3289 O OG  . SER C 1 121 ? 191.297 86.885  161.117 1.00 109.08 ? 121 SER B OG  1 
ATOM 3290 N N   . PHE C 1 122 ? 193.617 90.561  160.281 1.00 81.64  ? 122 PHE B N   1 
ATOM 3291 C CA  . PHE C 1 122 ? 194.774 91.448  160.181 1.00 81.64  ? 122 PHE B CA  1 
ATOM 3292 C C   . PHE C 1 122 ? 194.630 92.658  161.114 1.00 81.64  ? 122 PHE B C   1 
ATOM 3293 O O   . PHE C 1 122 ? 195.578 93.035  161.810 1.00 81.64  ? 122 PHE B O   1 
ATOM 3294 C CB  . PHE C 1 122 ? 194.936 91.932  158.739 1.00 143.84 ? 122 PHE B CB  1 
ATOM 3295 C CG  . PHE C 1 122 ? 196.138 92.823  158.519 1.00 143.84 ? 122 PHE B CG  1 
ATOM 3296 C CD1 . PHE C 1 122 ? 197.182 92.406  157.699 1.00 143.84 ? 122 PHE B CD1 1 
ATOM 3297 C CD2 . PHE C 1 122 ? 196.217 94.089  159.103 1.00 143.84 ? 122 PHE B CD2 1 
ATOM 3298 C CE1 . PHE C 1 122 ? 198.288 93.239  157.459 1.00 143.84 ? 122 PHE B CE1 1 
ATOM 3299 C CE2 . PHE C 1 122 ? 197.319 94.928  158.869 1.00 143.84 ? 122 PHE B CE2 1 
ATOM 3300 C CZ  . PHE C 1 122 ? 198.351 94.501  158.047 1.00 143.84 ? 122 PHE B CZ  1 
ATOM 3301 N N   . GLY C 1 123 ? 193.450 93.274  161.113 1.00 99.24  ? 123 GLY B N   1 
ATOM 3302 C CA  . GLY C 1 123 ? 193.229 94.424  161.966 1.00 99.24  ? 123 GLY B CA  1 
ATOM 3303 C C   . GLY C 1 123 ? 193.998 94.218  163.249 1.00 99.24  ? 123 GLY B C   1 
ATOM 3304 O O   . GLY C 1 123 ? 194.895 94.987  163.597 1.00 99.24  ? 123 GLY B O   1 
ATOM 3305 N N   . VAL C 1 124 ? 193.675 93.128  163.926 1.00 84.83  ? 124 VAL B N   1 
ATOM 3306 C CA  . VAL C 1 124 ? 194.318 92.800  165.179 1.00 84.83  ? 124 VAL B CA  1 
ATOM 3307 C C   . VAL C 1 124 ? 195.822 92.624  165.110 1.00 84.83  ? 124 VAL B C   1 
ATOM 3308 O O   . VAL C 1 124 ? 196.538 93.140  165.966 1.00 84.83  ? 124 VAL B O   1 
ATOM 3309 C CB  . VAL C 1 124 ? 193.720 91.542  165.763 1.00 83.47  ? 124 VAL B CB  1 
ATOM 3310 C CG1 . VAL C 1 124 ? 194.489 91.133  167.015 1.00 83.47  ? 124 VAL B CG1 1 
ATOM 3311 C CG2 . VAL C 1 124 ? 192.262 91.798  166.099 1.00 83.47  ? 124 VAL B CG2 1 
ATOM 3312 N N   . TRP C 1 125 ? 196.300 91.892  164.108 1.00 71.25  ? 125 TRP B N   1 
ATOM 3313 C CA  . TRP C 1 125 ? 197.738 91.659  163.964 1.00 71.25  ? 125 TRP B CA  1 
ATOM 3314 C C   . TRP C 1 125 ? 198.542 92.921  164.275 1.00 71.25  ? 125 TRP B C   1 
ATOM 3315 O O   . TRP C 1 125 ? 199.233 92.978  165.294 1.00 71.25  ? 125 TRP B O   1 
ATOM 3316 C CB  . TRP C 1 125 ? 198.092 91.177  162.549 1.00 114.87 ? 125 TRP B CB  1 
ATOM 3317 C CG  . TRP C 1 125 ? 199.465 90.521  162.459 1.00 114.87 ? 125 TRP B CG  1 
ATOM 3318 C CD1 . TRP C 1 125 ? 199.784 89.220  162.758 1.00 114.87 ? 125 TRP B CD1 1 
ATOM 3319 C CD2 . TRP C 1 125 ? 200.697 91.159  162.115 1.00 114.87 ? 125 TRP B CD2 1 
ATOM 3320 N NE1 . TRP C 1 125 ? 201.137 89.014  162.626 1.00 114.87 ? 125 TRP B NE1 1 
ATOM 3321 C CE2 . TRP C 1 125 ? 201.723 90.188  162.234 1.00 114.87 ? 125 TRP B CE2 1 
ATOM 3322 C CE3 . TRP C 1 125 ? 201.037 92.459  161.724 1.00 114.87 ? 125 TRP B CE3 1 
ATOM 3323 C CZ2 . TRP C 1 125 ? 203.065 90.480  161.974 1.00 114.87 ? 125 TRP B CZ2 1 
ATOM 3324 C CZ3 . TRP C 1 125 ? 202.368 92.748  161.468 1.00 114.87 ? 125 TRP B CZ3 1 
ATOM 3325 C CH2 . TRP C 1 125 ? 203.368 91.761  161.595 1.00 114.87 ? 125 TRP B CH2 1 
ATOM 3326 N N   . ILE C 1 126 ? 198.455 93.925  163.405 1.00 93.28  ? 126 ILE B N   1 
ATOM 3327 C CA  . ILE C 1 126 ? 199.182 95.175  163.611 1.00 93.28  ? 126 ILE B CA  1 
ATOM 3328 C C   . ILE C 1 126 ? 198.844 95.814  164.957 1.00 93.28  ? 126 ILE B C   1 
ATOM 3329 O O   . ILE C 1 126 ? 199.716 96.342  165.657 1.00 93.28  ? 126 ILE B O   1 
ATOM 3330 C CB  . ILE C 1 126 ? 198.842 96.197  162.527 1.00 109.86 ? 126 ILE B CB  1 
ATOM 3331 C CG1 . ILE C 1 126 ? 199.418 97.568  162.925 1.00 109.86 ? 126 ILE B CG1 1 
ATOM 3332 C CG2 . ILE C 1 126 ? 197.333 96.238  162.325 1.00 109.86 ? 126 ILE B CG2 1 
ATOM 3333 C CD1 . ILE C 1 126 ? 199.258 98.674  161.893 1.00 109.86 ? 126 ILE B CD1 1 
ATOM 3334 N N   . ARG C 1 127 ? 197.559 95.766  165.292 1.00 82.61  ? 127 ARG B N   1 
ATOM 3335 C CA  . ARG C 1 127 ? 197.013 96.324  166.527 1.00 82.61  ? 127 ARG B CA  1 
ATOM 3336 C C   . ARG C 1 127 ? 197.696 95.737  167.762 1.00 82.61  ? 127 ARG B C   1 
ATOM 3337 O O   . ARG C 1 127 ? 197.410 96.118  168.889 1.00 82.61  ? 127 ARG B O   1 
ATOM 3338 C CB  . ARG C 1 127 ? 195.514 96.009  166.570 1.00 82.26  ? 127 ARG B CB  1 
ATOM 3339 C CG  . ARG C 1 127 ? 194.613 97.144  167.021 1.00 82.26  ? 127 ARG B CG  1 
ATOM 3340 C CD  . ARG C 1 127 ? 193.385 97.250  166.113 1.00 82.26  ? 127 ARG B CD  1 
ATOM 3341 N NE  . ARG C 1 127 ? 192.619 96.004  166.026 1.00 82.26  ? 127 ARG B NE  1 
ATOM 3342 C CZ  . ARG C 1 127 ? 191.657 95.777  165.133 1.00 82.26  ? 127 ARG B CZ  1 
ATOM 3343 N NH1 . ARG C 1 127 ? 191.335 96.706  164.244 1.00 82.26  ? 127 ARG B NH1 1 
ATOM 3344 N NH2 . ARG C 1 127 ? 191.018 94.620  165.123 1.00 82.26  ? 127 ARG B NH2 1 
ATOM 3345 N N   . THR C 1 128 ? 198.636 94.835  167.547 1.00 85.68  ? 128 THR B N   1 
ATOM 3346 C CA  . THR C 1 128 ? 199.271 94.171  168.663 1.00 85.68  ? 128 THR B CA  1 
ATOM 3347 C C   . THR C 1 128 ? 200.759 94.363  168.912 1.00 85.68  ? 128 THR B C   1 
ATOM 3348 O O   . THR C 1 128 ? 201.596 93.882  168.139 1.00 85.68  ? 128 THR B O   1 
ATOM 3349 C CB  . THR C 1 128 ? 198.972 92.682  168.555 1.00 64.17  ? 128 THR B CB  1 
ATOM 3350 O OG1 . THR C 1 128 ? 197.612 92.459  168.950 1.00 64.17  ? 128 THR B OG1 1 
ATOM 3351 C CG2 . THR C 1 128 ? 199.943 91.858  169.406 1.00 64.17  ? 128 THR B CG2 1 
ATOM 3352 N N   . PRO C 1 129 ? 201.102 95.028  170.033 1.00 64.62  ? 129 PRO B N   1 
ATOM 3353 C CA  . PRO C 1 129 ? 202.472 95.328  170.485 1.00 64.62  ? 129 PRO B CA  1 
ATOM 3354 C C   . PRO C 1 129 ? 203.562 94.401  169.911 1.00 64.62  ? 129 PRO B C   1 
ATOM 3355 O O   . PRO C 1 129 ? 203.629 93.204  170.229 1.00 64.62  ? 129 PRO B O   1 
ATOM 3356 C CB  . PRO C 1 129 ? 202.363 95.249  172.014 1.00 88.02  ? 129 PRO B CB  1 
ATOM 3357 C CG  . PRO C 1 129 ? 200.830 95.017  172.302 1.00 88.02  ? 129 PRO B CG  1 
ATOM 3358 C CD  . PRO C 1 129 ? 200.128 95.434  171.056 1.00 88.02  ? 129 PRO B CD  1 
ATOM 3359 N N   . PRO C 1 130 ? 204.444 94.971  169.068 1.00 87.19  ? 130 PRO B N   1 
ATOM 3360 C CA  . PRO C 1 130 ? 205.557 94.293  168.383 1.00 87.19  ? 130 PRO B CA  1 
ATOM 3361 C C   . PRO C 1 130 ? 206.083 93.030  169.059 1.00 87.19  ? 130 PRO B C   1 
ATOM 3362 O O   . PRO C 1 130 ? 206.290 91.987  168.419 1.00 87.19  ? 130 PRO B O   1 
ATOM 3363 C CB  . PRO C 1 130 ? 206.611 95.395  168.283 1.00 124.11 ? 130 PRO B CB  1 
ATOM 3364 C CG  . PRO C 1 130 ? 205.758 96.624  168.032 1.00 124.11 ? 130 PRO B CG  1 
ATOM 3365 C CD  . PRO C 1 130 ? 204.611 96.442  169.016 1.00 124.11 ? 130 PRO B CD  1 
ATOM 3366 N N   . ALA C 1 131 ? 206.289 93.145  170.363 1.00 102.82 ? 131 ALA B N   1 
ATOM 3367 C CA  . ALA C 1 131 ? 206.803 92.054  171.161 1.00 102.82 ? 131 ALA B CA  1 
ATOM 3368 C C   . ALA C 1 131 ? 205.842 90.857  171.237 1.00 102.82 ? 131 ALA B C   1 
ATOM 3369 O O   . ALA C 1 131 ? 206.227 89.792  171.733 1.00 102.82 ? 131 ALA B O   1 
ATOM 3370 C CB  . ALA C 1 131 ? 207.121 92.576  172.566 1.00 61.15  ? 131 ALA B CB  1 
ATOM 3371 N N   . TYR C 1 132 ? 204.614 91.016  170.726 1.00 101.84 ? 132 TYR B N   1 
ATOM 3372 C CA  . TYR C 1 132 ? 203.604 89.947  170.806 1.00 101.84 ? 132 TYR B CA  1 
ATOM 3373 C C   . TYR C 1 132 ? 203.088 89.265  169.539 1.00 101.84 ? 132 TYR B C   1 
ATOM 3374 O O   . TYR C 1 132 ? 202.520 88.175  169.612 1.00 101.84 ? 132 TYR B O   1 
ATOM 3375 C CB  . TYR C 1 132 ? 202.389 90.439  171.576 1.00 75.38  ? 132 TYR B CB  1 
ATOM 3376 C CG  . TYR C 1 132 ? 202.676 90.796  173.004 1.00 75.38  ? 132 TYR B CG  1 
ATOM 3377 C CD1 . TYR C 1 132 ? 201.680 91.327  173.816 1.00 75.38  ? 132 TYR B CD1 1 
ATOM 3378 C CD2 . TYR C 1 132 ? 203.950 90.658  173.535 1.00 75.38  ? 132 TYR B CD2 1 
ATOM 3379 C CE1 . TYR C 1 132 ? 201.947 91.724  175.127 1.00 75.38  ? 132 TYR B CE1 1 
ATOM 3380 C CE2 . TYR C 1 132 ? 204.231 91.052  174.838 1.00 75.38  ? 132 TYR B CE2 1 
ATOM 3381 C CZ  . TYR C 1 132 ? 203.226 91.591  175.636 1.00 75.38  ? 132 TYR B CZ  1 
ATOM 3382 O OH  . TYR C 1 132 ? 203.510 92.028  176.924 1.00 75.38  ? 132 TYR B OH  1 
ATOM 3383 N N   . ARG C 1 133 ? 203.240 89.885  168.383 1.00 102.19 ? 133 ARG B N   1 
ATOM 3384 C CA  . ARG C 1 133 ? 202.770 89.236  167.167 1.00 102.19 ? 133 ARG B CA  1 
ATOM 3385 C C   . ARG C 1 133 ? 203.912 88.503  166.438 1.00 102.19 ? 133 ARG B C   1 
ATOM 3386 O O   . ARG C 1 133 ? 205.080 88.900  166.544 1.00 102.19 ? 133 ARG B O   1 
ATOM 3387 C CB  . ARG C 1 133 ? 202.160 90.288  166.270 1.00 90.84  ? 133 ARG B CB  1 
ATOM 3388 C CG  . ARG C 1 133 ? 202.955 91.571  166.266 1.00 90.84  ? 133 ARG B CG  1 
ATOM 3389 C CD  . ARG C 1 133 ? 202.471 92.439  165.148 1.00 90.84  ? 133 ARG B CD  1 
ATOM 3390 N NE  . ARG C 1 133 ? 203.406 93.501  164.789 1.00 90.84  ? 133 ARG B NE  1 
ATOM 3391 C CZ  . ARG C 1 133 ? 203.421 94.714  165.338 1.00 90.84  ? 133 ARG B CZ  1 
ATOM 3392 N NH1 . ARG C 1 133 ? 202.551 95.033  166.289 1.00 90.84  ? 133 ARG B NH1 1 
ATOM 3393 N NH2 . ARG C 1 133 ? 204.293 95.624  164.914 1.00 90.84  ? 133 ARG B NH2 1 
ATOM 3394 N N   . PRO C 1 134 ? 203.590 87.424  165.695 1.00 93.72  ? 134 PRO B N   1 
ATOM 3395 C CA  . PRO C 1 134 ? 204.563 86.611  164.935 1.00 93.72  ? 134 PRO B CA  1 
ATOM 3396 C C   . PRO C 1 134 ? 205.092 87.351  163.704 1.00 93.72  ? 134 PRO B C   1 
ATOM 3397 O O   . PRO C 1 134 ? 204.308 87.859  162.906 1.00 93.72  ? 134 PRO B O   1 
ATOM 3398 C CB  . PRO C 1 134 ? 203.757 85.380  164.532 1.00 91.55  ? 134 PRO B CB  1 
ATOM 3399 C CG  . PRO C 1 134 ? 202.642 85.344  165.554 1.00 91.55  ? 134 PRO B CG  1 
ATOM 3400 C CD  . PRO C 1 134 ? 202.269 86.782  165.698 1.00 91.55  ? 134 PRO B CD  1 
ATOM 3401 N N   . PRO C 1 135 ? 206.426 87.397  163.522 1.00 135.26 ? 135 PRO B N   1 
ATOM 3402 C CA  . PRO C 1 135 ? 207.059 88.084  162.380 1.00 135.26 ? 135 PRO B CA  1 
ATOM 3403 C C   . PRO C 1 135 ? 206.356 87.778  161.061 1.00 135.26 ? 135 PRO B C   1 
ATOM 3404 O O   . PRO C 1 135 ? 206.527 88.477  160.045 1.00 135.26 ? 135 PRO B O   1 
ATOM 3405 C CB  . PRO C 1 135 ? 208.495 87.552  162.408 1.00 153.67 ? 135 PRO B CB  1 
ATOM 3406 C CG  . PRO C 1 135 ? 208.731 87.308  163.872 1.00 153.67 ? 135 PRO B CG  1 
ATOM 3407 C CD  . PRO C 1 135 ? 207.429 86.646  164.299 1.00 153.67 ? 135 PRO B CD  1 
ATOM 3408 N N   . ASN C 1 136 ? 205.560 86.716  161.109 1.00 118.62 ? 136 ASN B N   1 
ATOM 3409 C CA  . ASN C 1 136 ? 204.813 86.251  159.964 1.00 118.62 ? 136 ASN B CA  1 
ATOM 3410 C C   . ASN C 1 136 ? 203.370 86.720  160.008 1.00 118.62 ? 136 ASN B C   1 
ATOM 3411 O O   . ASN C 1 136 ? 202.526 86.118  160.673 1.00 118.62 ? 136 ASN B O   1 
ATOM 3412 C CB  . ASN C 1 136 ? 204.875 84.724  159.904 1.00 113.93 ? 136 ASN B CB  1 
ATOM 3413 C CG  . ASN C 1 136 ? 206.301 84.206  159.777 1.00 113.93 ? 136 ASN B CG  1 
ATOM 3414 O OD1 . ASN C 1 136 ? 207.236 84.972  159.507 1.00 113.93 ? 136 ASN B OD1 1 
ATOM 3415 N ND2 . ASN C 1 136 ? 206.475 82.901  159.958 1.00 113.93 ? 136 ASN B ND2 1 
ATOM 3416 N N   . ALA C 1 137 ? 203.106 87.809  159.294 1.00 123.53 ? 137 ALA B N   1 
ATOM 3417 C CA  . ALA C 1 137 ? 201.771 88.382  159.215 1.00 123.53 ? 137 ALA B CA  1 
ATOM 3418 C C   . ALA C 1 137 ? 200.840 87.414  158.478 1.00 123.53 ? 137 ALA B C   1 
ATOM 3419 O O   . ALA C 1 137 ? 201.292 86.394  157.958 1.00 123.53 ? 137 ALA B O   1 
ATOM 3420 C CB  . ALA C 1 137 ? 201.841 89.703  158.478 1.00 63.29  ? 137 ALA B CB  1 
ATOM 3421 N N   . PRO C 1 138 ? 199.524 87.710  158.443 1.00 88.32  ? 138 PRO B N   1 
ATOM 3422 C CA  . PRO C 1 138 ? 198.499 86.888  157.771 1.00 88.32  ? 138 PRO B CA  1 
ATOM 3423 C C   . PRO C 1 138 ? 198.324 87.319  156.301 1.00 88.32  ? 138 PRO B C   1 
ATOM 3424 O O   . PRO C 1 138 ? 198.114 88.505  156.014 1.00 88.32  ? 138 PRO B O   1 
ATOM 3425 C CB  . PRO C 1 138 ? 197.262 87.157  158.607 1.00 77.93  ? 138 PRO B CB  1 
ATOM 3426 C CG  . PRO C 1 138 ? 197.426 88.624  158.923 1.00 77.93  ? 138 PRO B CG  1 
ATOM 3427 C CD  . PRO C 1 138 ? 198.888 88.705  159.327 1.00 77.93  ? 138 PRO B CD  1 
ATOM 3428 N N   . ILE C 1 139 ? 198.370 86.364  155.372 1.00 72.62  ? 139 ILE B N   1 
ATOM 3429 C CA  . ILE C 1 139 ? 198.293 86.737  153.963 1.00 72.62  ? 139 ILE B CA  1 
ATOM 3430 C C   . ILE C 1 139 ? 197.076 86.348  153.128 1.00 72.62  ? 139 ILE B C   1 
ATOM 3431 O O   . ILE C 1 139 ? 196.267 85.477  153.488 1.00 72.62  ? 139 ILE B O   1 
ATOM 3432 C CB  . ILE C 1 139 ? 199.560 86.249  153.207 1.00 111.56 ? 139 ILE B CB  1 
ATOM 3433 C CG1 . ILE C 1 139 ? 200.762 86.232  154.162 1.00 111.56 ? 139 ILE B CG1 1 
ATOM 3434 C CG2 . ILE C 1 139 ? 199.850 87.181  152.020 1.00 111.56 ? 139 ILE B CG2 1 
ATOM 3435 C CD1 . ILE C 1 139 ? 202.055 85.704  153.560 1.00 111.56 ? 139 ILE B CD1 1 
ATOM 3436 N N   . LEU C 1 140 ? 196.985 87.031  151.989 1.00 95.71  ? 140 LEU B N   1 
ATOM 3437 C CA  . LEU C 1 140 ? 195.930 86.845  151.009 1.00 95.71  ? 140 LEU B CA  1 
ATOM 3438 C C   . LEU C 1 140 ? 196.010 85.512  150.325 1.00 95.71  ? 140 LEU B C   1 
ATOM 3439 O O   . LEU C 1 140 ? 196.845 85.293  149.449 1.00 95.71  ? 140 LEU B O   1 
ATOM 3440 C CB  . LEU C 1 140 ? 196.020 87.904  149.934 1.00 77.53  ? 140 LEU B CB  1 
ATOM 3441 C CG  . LEU C 1 140 ? 194.981 88.988  150.107 1.00 77.53  ? 140 LEU B CG  1 
ATOM 3442 C CD1 . LEU C 1 140 ? 194.951 89.859  148.863 1.00 77.53  ? 140 LEU B CD1 1 
ATOM 3443 C CD2 . LEU C 1 140 ? 193.630 88.329  150.348 1.00 77.53  ? 140 LEU B CD2 1 
ATOM 3444 N N   . SER C 1 141 ? 195.119 84.615  150.687 1.00 101.33 ? 141 SER B N   1 
ATOM 3445 C CA  . SER C 1 141 ? 195.172 83.320  150.054 1.00 101.33 ? 141 SER B CA  1 
ATOM 3446 C C   . SER C 1 141 ? 193.828 82.948  149.483 1.00 101.33 ? 141 SER B C   1 
ATOM 3447 O O   . SER C 1 141 ? 192.821 83.016  150.180 1.00 101.33 ? 141 SER B O   1 
ATOM 3448 C CB  . SER C 1 141 ? 195.633 82.258  151.069 1.00 124.80 ? 141 SER B CB  1 
ATOM 3449 O OG  . SER C 1 141 ? 195.890 81.004  150.450 1.00 124.80 ? 141 SER B OG  1 
ATOM 3450 N N   . THR C 1 142 ? 193.816 82.549  148.217 1.00 168.58 ? 142 THR B N   1 
ATOM 3451 C CA  . THR C 1 142 ? 192.572 82.140  147.603 1.00 168.58 ? 142 THR B CA  1 
ATOM 3452 C C   . THR C 1 142 ? 192.191 81.019  148.556 1.00 168.58 ? 142 THR B C   1 
ATOM 3453 O O   . THR C 1 142 ? 193.018 80.142  148.817 1.00 168.58 ? 142 THR B O   1 
ATOM 3454 C CB  . THR C 1 142 ? 192.806 81.553  146.190 1.00 103.65 ? 142 THR B CB  1 
ATOM 3455 O OG1 . THR C 1 142 ? 193.545 82.482  145.383 1.00 103.65 ? 142 THR B OG1 1 
ATOM 3456 C CG2 . THR C 1 142 ? 191.491 81.231  145.544 1.00 103.65 ? 142 THR B CG2 1 
ATOM 3457 N N   . LEU C 1 143 ? 190.980 81.061  149.107 1.00 199.23 ? 143 LEU B N   1 
ATOM 3458 C CA  . LEU C 1 143 ? 190.553 80.012  150.034 1.00 199.23 ? 143 LEU B CA  1 
ATOM 3459 C C   . LEU C 1 143 ? 190.856 78.646  149.410 1.00 199.23 ? 143 LEU B C   1 
ATOM 3460 O O   . LEU C 1 143 ? 190.864 78.518  148.182 1.00 199.23 ? 143 LEU B O   1 
ATOM 3461 C CB  . LEU C 1 143 ? 189.055 80.151  150.328 1.00 120.53 ? 143 LEU B CB  1 
ATOM 3462 C CG  . LEU C 1 143 ? 188.596 81.455  150.993 1.00 120.53 ? 143 LEU B CG  1 
ATOM 3463 C CD1 . LEU C 1 143 ? 187.085 81.436  151.223 1.00 120.53 ? 143 LEU B CD1 1 
ATOM 3464 C CD2 . LEU C 1 143 ? 189.336 81.627  152.306 1.00 120.53 ? 143 LEU B CD2 1 
ATOM 3465 N N   . PRO C 1 144 ? 191.128 77.616  150.247 1.00 200.00 ? 144 PRO B N   1 
ATOM 3466 C CA  . PRO C 1 144 ? 191.442 76.240  149.816 1.00 200.00 ? 144 PRO B CA  1 
ATOM 3467 C C   . PRO C 1 144 ? 190.446 75.663  148.796 1.00 200.00 ? 144 PRO B C   1 
ATOM 3468 O O   . PRO C 1 144 ? 189.326 76.180  148.661 1.00 200.00 ? 144 PRO B O   1 
ATOM 3469 C CB  . PRO C 1 144 ? 191.456 75.464  151.137 1.00 124.97 ? 144 PRO B CB  1 
ATOM 3470 C CG  . PRO C 1 144 ? 192.033 76.485  152.086 1.00 124.97 ? 144 PRO B CG  1 
ATOM 3471 C CD  . PRO C 1 144 ? 191.250 77.737  151.713 1.00 124.97 ? 144 PRO B CD  1 
ATOM 3472 N N   . GLU C 1 145 ? 190.837 74.605  148.074 1.00 200.00 ? 145 GLU B N   1 
ATOM 3473 C CA  . GLU C 1 145 ? 189.924 74.016  147.077 1.00 200.00 ? 145 GLU B CA  1 
ATOM 3474 C C   . GLU C 1 145 ? 188.971 72.882  147.528 1.00 200.00 ? 145 GLU B C   1 
ATOM 3475 O O   . GLU C 1 145 ? 188.903 71.818  146.902 1.00 200.00 ? 145 GLU B O   1 
ATOM 3476 C CB  . GLU C 1 145 ? 190.680 73.572  145.810 1.00 188.51 ? 145 GLU B CB  1 
ATOM 3477 C CG  . GLU C 1 145 ? 190.108 74.219  144.509 1.00 188.51 ? 145 GLU B CG  1 
ATOM 3478 C CD  . GLU C 1 145 ? 188.724 73.693  144.080 1.00 188.51 ? 145 GLU B CD  1 
ATOM 3479 O OE1 . GLU C 1 145 ? 188.617 72.478  143.817 1.00 188.51 ? 145 GLU B OE1 1 
ATOM 3480 O OE2 . GLU C 1 145 ? 187.753 74.486  143.996 1.00 188.51 ? 145 GLU B OE2 1 
ATOM 3481 N N   . THR C 1 146 ? 188.233 73.106  148.615 1.00 200.00 ? 146 THR B N   1 
ATOM 3482 C CA  . THR C 1 146 ? 187.216 72.145  149.055 1.00 200.00 ? 146 THR B CA  1 
ATOM 3483 C C   . THR C 1 146 ? 186.034 73.075  149.312 1.00 200.00 ? 146 THR B C   1 
ATOM 3484 O O   . THR C 1 146 ? 185.656 73.400  150.456 1.00 200.00 ? 146 THR B O   1 
ATOM 3485 C CB  . THR C 1 146 ? 187.663 71.309  150.303 1.00 164.99 ? 146 THR B CB  1 
ATOM 3486 O OG1 . THR C 1 146 ? 188.861 70.575  149.990 1.00 164.99 ? 146 THR B OG1 1 
ATOM 3487 C CG2 . THR C 1 146 ? 186.610 70.247  150.651 1.00 164.99 ? 146 THR B CG2 1 
ATOM 3488 N N   . THR C 1 147 ? 185.557 73.540  148.149 1.00 199.29 ? 147 THR B N   1 
ATOM 3489 C CA  . THR C 1 147 ? 184.469 74.494  147.946 1.00 199.29 ? 147 THR B CA  1 
ATOM 3490 C C   . THR C 1 147 ? 184.812 75.949  148.400 1.00 199.29 ? 147 THR B C   1 
ATOM 3491 O O   . THR C 1 147 ? 184.860 76.825  147.490 1.00 199.29 ? 147 THR B O   1 
ATOM 3492 C CB  . THR C 1 147 ? 183.115 73.971  148.602 1.00 200.00 ? 147 THR B CB  1 
ATOM 3493 O OG1 . THR C 1 147 ? 183.235 73.817  150.031 1.00 200.00 ? 147 THR B OG1 1 
ATOM 3494 C CG2 . THR C 1 147 ? 182.752 72.567  148.030 1.00 200.00 ? 147 THR B CG2 1 
ATOM 3495 N N   . MET D 1 1   ? 196.924 104.492 129.287 1.00 114.87 ? 1   MET A N   1 
ATOM 3496 C CA  . MET D 1 1   ? 196.227 103.558 128.357 1.00 114.87 ? 1   MET A CA  1 
ATOM 3497 C C   . MET D 1 1   ? 194.839 104.078 127.982 1.00 114.87 ? 1   MET A C   1 
ATOM 3498 O O   . MET D 1 1   ? 194.207 104.802 128.757 1.00 114.87 ? 1   MET A O   1 
ATOM 3499 C CB  . MET D 1 1   ? 196.072 102.198 129.016 1.00 116.24 ? 1   MET A CB  1 
ATOM 3500 C CG  . MET D 1 1   ? 195.029 102.196 130.105 1.00 116.24 ? 1   MET A CG  1 
ATOM 3501 S SD  . MET D 1 1   ? 194.966 100.626 130.937 1.00 116.24 ? 1   MET A SD  1 
ATOM 3502 C CE  . MET D 1 1   ? 196.356 100.851 132.060 1.00 116.24 ? 1   MET A CE  1 
ATOM 3503 N N   . ASP D 1 2   ? 194.371 103.691 126.795 1.00 153.94 ? 2   ASP A N   1 
ATOM 3504 C CA  . ASP D 1 2   ? 193.055 104.102 126.298 1.00 153.94 ? 2   ASP A CA  1 
ATOM 3505 C C   . ASP D 1 2   ? 191.943 103.419 127.098 1.00 153.94 ? 2   ASP A C   1 
ATOM 3506 O O   . ASP D 1 2   ? 191.750 102.206 126.992 1.00 153.94 ? 2   ASP A O   1 
ATOM 3507 C CB  . ASP D 1 2   ? 192.916 103.750 124.797 1.00 139.57 ? 2   ASP A CB  1 
ATOM 3508 C CG  . ASP D 1 2   ? 191.631 104.321 124.149 1.00 139.57 ? 2   ASP A CG  1 
ATOM 3509 O OD1 . ASP D 1 2   ? 190.508 103.924 124.540 1.00 139.57 ? 2   ASP A OD1 1 
ATOM 3510 O OD2 . ASP D 1 2   ? 191.750 105.166 123.232 1.00 139.57 ? 2   ASP A OD2 1 
ATOM 3511 N N   . ILE D 1 3   ? 191.229 104.205 127.906 1.00 111.89 ? 3   ILE A N   1 
ATOM 3512 C CA  . ILE D 1 3   ? 190.116 103.699 128.719 1.00 111.89 ? 3   ILE A CA  1 
ATOM 3513 C C   . ILE D 1 3   ? 189.117 104.825 129.039 1.00 111.89 ? 3   ILE A C   1 
ATOM 3514 O O   . ILE D 1 3   ? 189.326 105.628 129.947 1.00 111.89 ? 3   ILE A O   1 
ATOM 3515 C CB  . ILE D 1 3   ? 190.636 103.049 130.033 1.00 92.60  ? 3   ILE A CB  1 
ATOM 3516 C CG1 . ILE D 1 3   ? 191.230 104.099 130.964 1.00 92.60  ? 3   ILE A CG1 1 
ATOM 3517 C CG2 . ILE D 1 3   ? 191.710 102.017 129.716 1.00 92.60  ? 3   ILE A CG2 1 
ATOM 3518 C CD1 . ILE D 1 3   ? 190.391 104.300 132.198 1.00 92.60  ? 3   ILE A CD1 1 
ATOM 3519 N N   . ASP D 1 4   ? 188.029 104.882 128.277 1.00 99.23  ? 4   ASP A N   1 
ATOM 3520 C CA  . ASP D 1 4   ? 187.027 105.935 128.458 1.00 99.23  ? 4   ASP A CA  1 
ATOM 3521 C C   . ASP D 1 4   ? 186.117 105.661 129.652 1.00 99.23  ? 4   ASP A C   1 
ATOM 3522 O O   . ASP D 1 4   ? 185.597 104.554 129.806 1.00 99.23  ? 4   ASP A O   1 
ATOM 3523 C CB  . ASP D 1 4   ? 186.183 106.086 127.178 1.00 81.71  ? 4   ASP A CB  1 
ATOM 3524 C CG  . ASP D 1 4   ? 185.545 107.471 127.040 1.00 81.71  ? 4   ASP A CG  1 
ATOM 3525 O OD1 . ASP D 1 4   ? 184.715 107.859 127.890 1.00 81.71  ? 4   ASP A OD1 1 
ATOM 3526 O OD2 . ASP D 1 4   ? 185.881 108.171 126.061 1.00 81.71  ? 4   ASP A OD2 1 
ATOM 3527 N N   . PRO D 1 5   ? 185.918 106.676 130.514 1.00 73.28  ? 5   PRO A N   1 
ATOM 3528 C CA  . PRO D 1 5   ? 185.082 106.633 131.728 1.00 73.28  ? 5   PRO A CA  1 
ATOM 3529 C C   . PRO D 1 5   ? 183.595 106.511 131.438 1.00 73.28  ? 5   PRO A C   1 
ATOM 3530 O O   . PRO D 1 5   ? 182.781 106.395 132.362 1.00 73.28  ? 5   PRO A O   1 
ATOM 3531 C CB  . PRO D 1 5   ? 185.377 107.972 132.414 1.00 59.59  ? 5   PRO A CB  1 
ATOM 3532 C CG  . PRO D 1 5   ? 186.710 108.366 131.878 1.00 59.59  ? 5   PRO A CG  1 
ATOM 3533 C CD  . PRO D 1 5   ? 186.649 107.952 130.434 1.00 59.59  ? 5   PRO A CD  1 
ATOM 3534 N N   . TYR D 1 6   ? 183.261 106.539 130.151 1.00 82.11  ? 6   TYR A N   1 
ATOM 3535 C CA  . TYR D 1 6   ? 181.881 106.502 129.701 1.00 82.11  ? 6   TYR A CA  1 
ATOM 3536 C C   . TYR D 1 6   ? 181.431 105.249 128.971 1.00 82.11  ? 6   TYR A C   1 
ATOM 3537 O O   . TYR D 1 6   ? 180.262 104.885 129.081 1.00 82.11  ? 6   TYR A O   1 
ATOM 3538 C CB  . TYR D 1 6   ? 181.622 107.720 128.820 1.00 96.39  ? 6   TYR A CB  1 
ATOM 3539 C CG  . TYR D 1 6   ? 182.022 109.018 129.480 1.00 96.39  ? 6   TYR A CG  1 
ATOM 3540 C CD1 . TYR D 1 6   ? 183.358 109.309 129.752 1.00 96.39  ? 6   TYR A CD1 1 
ATOM 3541 C CD2 . TYR D 1 6   ? 181.062 109.946 129.866 1.00 96.39  ? 6   TYR A CD2 1 
ATOM 3542 C CE1 . TYR D 1 6   ? 183.724 110.501 130.397 1.00 96.39  ? 6   TYR A CE1 1 
ATOM 3543 C CE2 . TYR D 1 6   ? 181.414 111.138 130.509 1.00 96.39  ? 6   TYR A CE2 1 
ATOM 3544 C CZ  . TYR D 1 6   ? 182.739 111.413 130.770 1.00 96.39  ? 6   TYR A CZ  1 
ATOM 3545 O OH  . TYR D 1 6   ? 183.053 112.613 131.375 1.00 96.39  ? 6   TYR A OH  1 
ATOM 3546 N N   . LYS D 1 7   ? 182.344 104.613 128.224 1.00 127.06 ? 7   LYS A N   1 
ATOM 3547 C CA  . LYS D 1 7   ? 182.057 103.386 127.456 1.00 127.06 ? 7   LYS A CA  1 
ATOM 3548 C C   . LYS D 1 7   ? 181.032 102.546 128.218 1.00 127.06 ? 7   LYS A C   1 
ATOM 3549 O O   . LYS D 1 7   ? 180.107 101.967 127.639 1.00 127.06 ? 7   LYS A O   1 
ATOM 3550 C CB  . LYS D 1 7   ? 183.357 102.564 127.233 1.00 119.27 ? 7   LYS A CB  1 
ATOM 3551 C CG  . LYS D 1 7   ? 183.944 102.583 125.787 1.00 119.27 ? 7   LYS A CG  1 
ATOM 3552 C CD  . LYS D 1 7   ? 185.299 101.832 125.657 1.00 119.27 ? 7   LYS A CD  1 
ATOM 3553 C CE  . LYS D 1 7   ? 185.917 101.964 124.243 1.00 119.27 ? 7   LYS A CE  1 
ATOM 3554 N NZ  . LYS D 1 7   ? 187.333 101.475 124.127 1.00 119.27 ? 7   LYS A NZ  1 
ATOM 3555 N N   . GLU D 1 8   ? 181.216 102.522 129.533 1.00 79.09  ? 8   GLU A N   1 
ATOM 3556 C CA  . GLU D 1 8   ? 180.385 101.800 130.491 1.00 79.09  ? 8   GLU A CA  1 
ATOM 3557 C C   . GLU D 1 8   ? 178.893 102.170 130.444 1.00 79.09  ? 8   GLU A C   1 
ATOM 3558 O O   . GLU D 1 8   ? 178.000 101.304 130.523 1.00 79.09  ? 8   GLU A O   1 
ATOM 3559 C CB  . GLU D 1 8   ? 180.977 102.080 131.861 1.00 106.39 ? 8   GLU A CB  1 
ATOM 3560 C CG  . GLU D 1 8   ? 180.307 101.440 133.014 1.00 106.39 ? 8   GLU A CG  1 
ATOM 3561 C CD  . GLU D 1 8   ? 181.201 101.493 134.221 1.00 106.39 ? 8   GLU A CD  1 
ATOM 3562 O OE1 . GLU D 1 8   ? 180.730 101.157 135.323 1.00 106.39 ? 8   GLU A OE1 1 
ATOM 3563 O OE2 . GLU D 1 8   ? 182.384 101.871 134.056 1.00 106.39 ? 8   GLU A OE2 1 
ATOM 3564 N N   . PHE D 1 9   ? 178.645 103.470 130.324 1.00 83.43  ? 9   PHE A N   1 
ATOM 3565 C CA  . PHE D 1 9   ? 177.302 104.017 130.238 1.00 83.43  ? 9   PHE A CA  1 
ATOM 3566 C C   . PHE D 1 9   ? 177.066 104.411 128.789 1.00 83.43  ? 9   PHE A C   1 
ATOM 3567 O O   . PHE D 1 9   ? 176.693 105.549 128.498 1.00 83.43  ? 9   PHE A O   1 
ATOM 3568 C CB  . PHE D 1 9   ? 177.199 105.228 131.139 1.00 97.12  ? 9   PHE A CB  1 
ATOM 3569 C CG  . PHE D 1 9   ? 177.870 105.031 132.443 1.00 97.12  ? 9   PHE A CG  1 
ATOM 3570 C CD1 . PHE D 1 9   ? 179.189 105.403 132.615 1.00 97.12  ? 9   PHE A CD1 1 
ATOM 3571 C CD2 . PHE D 1 9   ? 177.206 104.409 133.493 1.00 97.12  ? 9   PHE A CD2 1 
ATOM 3572 C CE1 . PHE D 1 9   ? 179.844 105.157 133.824 1.00 97.12  ? 9   PHE A CE1 1 
ATOM 3573 C CE2 . PHE D 1 9   ? 177.849 104.157 134.708 1.00 97.12  ? 9   PHE A CE2 1 
ATOM 3574 C CZ  . PHE D 1 9   ? 179.168 104.531 134.873 1.00 97.12  ? 9   PHE A CZ  1 
ATOM 3575 N N   . GLY D 1 10  ? 177.311 103.450 127.891 1.00 124.91 ? 10  GLY A N   1 
ATOM 3576 C CA  . GLY D 1 10  ? 177.148 103.645 126.456 1.00 124.91 ? 10  GLY A CA  1 
ATOM 3577 C C   . GLY D 1 10  ? 177.438 105.053 125.975 1.00 124.91 ? 10  GLY A C   1 
ATOM 3578 O O   . GLY D 1 10  ? 176.571 105.678 125.373 1.00 124.91 ? 10  GLY A O   1 
ATOM 3579 N N   . ALA D 1 11  ? 178.654 105.543 126.226 1.00 94.47  ? 11  ALA A N   1 
ATOM 3580 C CA  . ALA D 1 11  ? 179.041 106.899 125.833 1.00 94.47  ? 11  ALA A CA  1 
ATOM 3581 C C   . ALA D 1 11  ? 180.562 107.153 125.728 1.00 94.47  ? 11  ALA A C   1 
ATOM 3582 O O   . ALA D 1 11  ? 181.366 106.365 126.225 1.00 94.47  ? 11  ALA A O   1 
ATOM 3583 C CB  . ALA D 1 11  ? 178.425 107.872 126.793 1.00 24.06  ? 11  ALA A CB  1 
ATOM 3584 N N   . THR D 1 12  ? 180.944 108.265 125.094 1.00 68.76  ? 12  THR A N   1 
ATOM 3585 C CA  . THR D 1 12  ? 182.357 108.612 124.896 1.00 68.76  ? 12  THR A CA  1 
ATOM 3586 C C   . THR D 1 12  ? 182.728 110.087 125.128 1.00 68.76  ? 12  THR A C   1 
ATOM 3587 O O   . THR D 1 12  ? 181.894 110.991 125.048 1.00 68.76  ? 12  THR A O   1 
ATOM 3588 C CB  . THR D 1 12  ? 182.828 108.222 123.442 1.00 97.31  ? 12  THR A CB  1 
ATOM 3589 O OG1 . THR D 1 12  ? 184.226 108.499 123.285 1.00 97.31  ? 12  THR A OG1 1 
ATOM 3590 C CG2 . THR D 1 12  ? 182.070 109.015 122.389 1.00 97.31  ? 12  THR A CG2 1 
ATOM 3591 N N   . VAL D 1 13  ? 184.000 110.315 125.434 1.00 87.27  ? 13  VAL A N   1 
ATOM 3592 C CA  . VAL D 1 13  ? 184.499 111.670 125.614 1.00 87.27  ? 13  VAL A CA  1 
ATOM 3593 C C   . VAL D 1 13  ? 184.536 112.219 124.202 1.00 87.27  ? 13  VAL A C   1 
ATOM 3594 O O   . VAL D 1 13  ? 184.116 113.356 123.948 1.00 87.27  ? 13  VAL A O   1 
ATOM 3595 C CB  . VAL D 1 13  ? 185.944 111.694 126.171 1.00 98.61  ? 13  VAL A CB  1 
ATOM 3596 C CG1 . VAL D 1 13  ? 186.850 110.758 125.354 1.00 98.61  ? 13  VAL A CG1 1 
ATOM 3597 C CG2 . VAL D 1 13  ? 186.490 113.129 126.117 1.00 98.61  ? 13  VAL A CG2 1 
ATOM 3598 N N   . GLU D 1 14  ? 185.046 111.373 123.297 1.00 142.50 ? 14  GLU A N   1 
ATOM 3599 C CA  . GLU D 1 14  ? 185.175 111.668 121.873 1.00 142.50 ? 14  GLU A CA  1 
ATOM 3600 C C   . GLU D 1 14  ? 183.897 112.370 121.495 1.00 142.50 ? 14  GLU A C   1 
ATOM 3601 O O   . GLU D 1 14  ? 183.814 113.070 120.489 1.00 142.50 ? 14  GLU A O   1 
ATOM 3602 C CB  . GLU D 1 14  ? 185.322 110.366 121.069 1.00 147.04 ? 14  GLU A CB  1 
ATOM 3603 C CG  . GLU D 1 14  ? 185.660 110.574 119.592 1.00 147.04 ? 14  GLU A CG  1 
ATOM 3604 C CD  . GLU D 1 14  ? 185.830 109.266 118.828 1.00 147.04 ? 14  GLU A CD  1 
ATOM 3605 O OE1 . GLU D 1 14  ? 185.696 108.188 119.447 1.00 147.04 ? 14  GLU A OE1 1 
ATOM 3606 O OE2 . GLU D 1 14  ? 186.098 109.316 117.607 1.00 147.04 ? 14  GLU A OE2 1 
ATOM 3607 N N   . LEU D 1 15  ? 182.906 112.163 122.348 1.00 93.66  ? 15  LEU A N   1 
ATOM 3608 C CA  . LEU D 1 15  ? 181.593 112.736 122.209 1.00 93.66  ? 15  LEU A CA  1 
ATOM 3609 C C   . LEU D 1 15  ? 181.498 114.132 122.815 1.00 93.66  ? 15  LEU A C   1 
ATOM 3610 O O   . LEU D 1 15  ? 181.557 115.150 122.128 1.00 93.66  ? 15  LEU A O   1 
ATOM 3611 C CB  . LEU D 1 15  ? 180.612 111.830 122.910 1.00 34.33  ? 15  LEU A CB  1 
ATOM 3612 C CG  . LEU D 1 15  ? 179.146 112.181 122.862 1.00 34.33  ? 15  LEU A CG  1 
ATOM 3613 C CD1 . LEU D 1 15  ? 178.463 111.049 123.566 1.00 34.33  ? 15  LEU A CD1 1 
ATOM 3614 C CD2 . LEU D 1 15  ? 178.831 113.537 123.502 1.00 34.33  ? 15  LEU A CD2 1 
ATOM 3615 N N   . LEU D 1 16  ? 181.321 114.158 124.121 1.00 64.29  ? 16  LEU A N   1 
ATOM 3616 C CA  . LEU D 1 16  ? 181.187 115.393 124.864 1.00 64.29  ? 16  LEU A CA  1 
ATOM 3617 C C   . LEU D 1 16  ? 181.874 116.606 124.241 1.00 64.29  ? 16  LEU A C   1 
ATOM 3618 O O   . LEU D 1 16  ? 181.331 117.709 124.307 1.00 64.29  ? 16  LEU A O   1 
ATOM 3619 C CB  . LEU D 1 16  ? 181.688 115.125 126.271 1.00 64.51  ? 16  LEU A CB  1 
ATOM 3620 C CG  . LEU D 1 16  ? 181.133 113.731 126.590 1.00 64.51  ? 16  LEU A CG  1 
ATOM 3621 C CD1 . LEU D 1 16  ? 181.700 113.207 127.867 1.00 64.51  ? 16  LEU A CD1 1 
ATOM 3622 C CD2 . LEU D 1 16  ? 179.633 113.803 126.668 1.00 64.51  ? 16  LEU A CD2 1 
ATOM 3623 N N   . SER D 1 17  ? 183.049 116.393 123.634 1.00 162.29 ? 17  SER A N   1 
ATOM 3624 C CA  . SER D 1 17  ? 183.821 117.452 122.962 1.00 162.29 ? 17  SER A CA  1 
ATOM 3625 C C   . SER D 1 17  ? 182.884 118.455 122.295 1.00 162.29 ? 17  SER A C   1 
ATOM 3626 O O   . SER D 1 17  ? 183.255 119.611 122.047 1.00 162.29 ? 17  SER A O   1 
ATOM 3627 C CB  . SER D 1 17  ? 184.754 116.846 121.903 1.00 100.19 ? 17  SER A CB  1 
ATOM 3628 O OG  . SER D 1 17  ? 185.383 117.856 121.123 1.00 100.19 ? 17  SER A OG  1 
ATOM 3629 N N   . PHE D 1 18  ? 181.679 117.976 121.984 1.00 165.05 ? 18  PHE A N   1 
ATOM 3630 C CA  . PHE D 1 18  ? 180.621 118.782 121.395 1.00 165.05 ? 18  PHE A CA  1 
ATOM 3631 C C   . PHE D 1 18  ? 180.588 120.041 122.221 1.00 165.05 ? 18  PHE A C   1 
ATOM 3632 O O   . PHE D 1 18  ? 181.176 121.075 121.889 1.00 165.05 ? 18  PHE A O   1 
ATOM 3633 C CB  . PHE D 1 18  ? 179.265 118.104 121.593 1.00 127.66 ? 18  PHE A CB  1 
ATOM 3634 C CG  . PHE D 1 18  ? 179.001 116.959 120.671 1.00 127.66 ? 18  PHE A CG  1 
ATOM 3635 C CD1 . PHE D 1 18  ? 177.717 116.414 120.588 1.00 127.66 ? 18  PHE A CD1 1 
ATOM 3636 C CD2 . PHE D 1 18  ? 180.003 116.441 119.861 1.00 127.66 ? 18  PHE A CD2 1 
ATOM 3637 C CE1 . PHE D 1 18  ? 177.427 115.372 119.709 1.00 127.66 ? 18  PHE A CE1 1 
ATOM 3638 C CE2 . PHE D 1 18  ? 179.725 115.396 118.977 1.00 127.66 ? 18  PHE A CE2 1 
ATOM 3639 C CZ  . PHE D 1 18  ? 178.430 114.862 118.902 1.00 127.66 ? 18  PHE A CZ  1 
ATOM 3640 N N   . LEU D 1 19  ? 179.867 119.890 123.323 1.00 81.41  ? 19  LEU A N   1 
ATOM 3641 C CA  . LEU D 1 19  ? 179.648 120.903 124.335 1.00 81.41  ? 19  LEU A CA  1 
ATOM 3642 C C   . LEU D 1 19  ? 180.752 121.923 124.573 1.00 81.41  ? 19  LEU A C   1 
ATOM 3643 O O   . LEU D 1 19  ? 181.939 121.590 124.691 1.00 81.41  ? 19  LEU A O   1 
ATOM 3644 C CB  . LEU D 1 19  ? 179.361 120.199 125.641 1.00 77.87  ? 19  LEU A CB  1 
ATOM 3645 C CG  . LEU D 1 19  ? 178.322 119.109 125.438 1.00 77.87  ? 19  LEU A CG  1 
ATOM 3646 C CD1 . LEU D 1 19  ? 178.699 117.877 126.237 1.00 77.87  ? 19  LEU A CD1 1 
ATOM 3647 C CD2 . LEU D 1 19  ? 176.966 119.651 125.836 1.00 77.87  ? 19  LEU A CD2 1 
ATOM 3648 N N   . PRO D 1 20  ? 180.361 123.194 124.672 1.00 89.70  ? 20  PRO A N   1 
ATOM 3649 C CA  . PRO D 1 20  ? 181.324 124.258 124.907 1.00 89.70  ? 20  PRO A CA  1 
ATOM 3650 C C   . PRO D 1 20  ? 181.978 123.896 126.207 1.00 89.70  ? 20  PRO A C   1 
ATOM 3651 O O   . PRO D 1 20  ? 181.300 123.693 127.216 1.00 89.70  ? 20  PRO A O   1 
ATOM 3652 C CB  . PRO D 1 20  ? 180.448 125.490 125.051 1.00 96.16  ? 20  PRO A CB  1 
ATOM 3653 C CG  . PRO D 1 20  ? 179.251 125.149 124.233 1.00 96.16  ? 20  PRO A CG  1 
ATOM 3654 C CD  . PRO D 1 20  ? 178.997 123.731 124.627 1.00 96.16  ? 20  PRO A CD  1 
ATOM 3655 N N   . SER D 1 21  ? 183.294 123.794 126.177 1.00 98.26  ? 21  SER A N   1 
ATOM 3656 C CA  . SER D 1 21  ? 184.035 123.463 127.370 1.00 98.26  ? 21  SER A CA  1 
ATOM 3657 C C   . SER D 1 21  ? 183.626 124.438 128.490 1.00 98.26  ? 21  SER A C   1 
ATOM 3658 O O   . SER D 1 21  ? 184.045 124.307 129.638 1.00 98.26  ? 21  SER A O   1 
ATOM 3659 C CB  . SER D 1 21  ? 185.534 123.553 127.062 1.00 84.94  ? 21  SER A CB  1 
ATOM 3660 O OG  . SER D 1 21  ? 185.865 122.718 125.963 1.00 84.94  ? 21  SER A OG  1 
ATOM 3661 N N   . ASP D 1 22  ? 182.775 125.401 128.156 1.00 82.98  ? 22  ASP A N   1 
ATOM 3662 C CA  . ASP D 1 22  ? 182.328 126.400 129.126 1.00 82.98  ? 22  ASP A CA  1 
ATOM 3663 C C   . ASP D 1 22  ? 180.836 126.312 129.439 1.00 82.98  ? 22  ASP A C   1 
ATOM 3664 O O   . ASP D 1 22  ? 180.263 127.257 129.983 1.00 82.98  ? 22  ASP A O   1 
ATOM 3665 C CB  . ASP D 1 22  ? 182.661 127.806 128.598 1.00 91.86  ? 22  ASP A CB  1 
ATOM 3666 C CG  . ASP D 1 22  ? 182.029 128.093 127.226 1.00 91.86  ? 22  ASP A CG  1 
ATOM 3667 O OD1 . ASP D 1 22  ? 182.763 128.447 126.271 1.00 91.86  ? 22  ASP A OD1 1 
ATOM 3668 O OD2 . ASP D 1 22  ? 180.792 127.967 127.107 1.00 91.86  ? 22  ASP A OD2 1 
ATOM 3669 N N   . PHE D 1 23  ? 180.217 125.182 129.101 1.00 72.88  ? 23  PHE A N   1 
ATOM 3670 C CA  . PHE D 1 23  ? 178.781 124.970 129.328 1.00 72.88  ? 23  PHE A CA  1 
ATOM 3671 C C   . PHE D 1 23  ? 178.446 124.556 130.773 1.00 72.88  ? 23  PHE A C   1 
ATOM 3672 O O   . PHE D 1 23  ? 177.654 125.213 131.473 1.00 72.88  ? 23  PHE A O   1 
ATOM 3673 C CB  . PHE D 1 23  ? 178.272 123.913 128.321 1.00 88.21  ? 23  PHE A CB  1 
ATOM 3674 C CG  . PHE D 1 23  ? 176.939 123.243 128.687 1.00 88.21  ? 23  PHE A CG  1 
ATOM 3675 C CD1 . PHE D 1 23  ? 176.463 122.187 127.915 1.00 88.21  ? 23  PHE A CD1 1 
ATOM 3676 C CD2 . PHE D 1 23  ? 176.179 123.631 129.790 1.00 88.21  ? 23  PHE A CD2 1 
ATOM 3677 C CE1 . PHE D 1 23  ? 175.267 121.535 128.234 1.00 88.21  ? 23  PHE A CE1 1 
ATOM 3678 C CE2 . PHE D 1 23  ? 174.983 122.980 130.113 1.00 88.21  ? 23  PHE A CE2 1 
ATOM 3679 C CZ  . PHE D 1 23  ? 174.530 121.934 129.333 1.00 88.21  ? 23  PHE A CZ  1 
ATOM 3680 N N   . PHE D 1 24  ? 179.036 123.449 131.198 1.00 71.82  ? 24  PHE A N   1 
ATOM 3681 C CA  . PHE D 1 24  ? 178.816 122.897 132.524 1.00 71.82  ? 24  PHE A CA  1 
ATOM 3682 C C   . PHE D 1 24  ? 178.983 123.914 133.637 1.00 71.82  ? 24  PHE A C   1 
ATOM 3683 O O   . PHE D 1 24  ? 179.973 124.643 133.687 1.00 71.82  ? 24  PHE A O   1 
ATOM 3684 C CB  . PHE D 1 24  ? 179.777 121.744 132.736 1.00 114.00 ? 24  PHE A CB  1 
ATOM 3685 C CG  . PHE D 1 24  ? 180.080 120.993 131.479 1.00 114.00 ? 24  PHE A CG  1 
ATOM 3686 C CD1 . PHE D 1 24  ? 180.797 121.602 130.447 1.00 114.00 ? 24  PHE A CD1 1 
ATOM 3687 C CD2 . PHE D 1 24  ? 179.607 119.702 131.297 1.00 114.00 ? 24  PHE A CD2 1 
ATOM 3688 C CE1 . PHE D 1 24  ? 181.034 120.936 129.252 1.00 114.00 ? 24  PHE A CE1 1 
ATOM 3689 C CE2 . PHE D 1 24  ? 179.838 119.027 130.107 1.00 114.00 ? 24  PHE A CE2 1 
ATOM 3690 C CZ  . PHE D 1 24  ? 180.552 119.643 129.080 1.00 114.00 ? 24  PHE A CZ  1 
ATOM 3691 N N   . PRO D 1 25  ? 178.015 123.962 134.559 1.00 76.05  ? 25  PRO A N   1 
ATOM 3692 C CA  . PRO D 1 25  ? 177.964 124.870 135.722 1.00 76.05  ? 25  PRO A CA  1 
ATOM 3693 C C   . PRO D 1 25  ? 179.101 124.759 136.756 1.00 76.05  ? 25  PRO A C   1 
ATOM 3694 O O   . PRO D 1 25  ? 179.608 123.666 137.039 1.00 76.05  ? 25  PRO A O   1 
ATOM 3695 C CB  . PRO D 1 25  ? 176.600 124.562 136.330 1.00 84.74  ? 25  PRO A CB  1 
ATOM 3696 C CG  . PRO D 1 25  ? 175.787 124.114 135.110 1.00 84.74  ? 25  PRO A CG  1 
ATOM 3697 C CD  . PRO D 1 25  ? 176.753 123.219 134.408 1.00 84.74  ? 25  PRO A CD  1 
ATOM 3698 N N   . SER D 1 26  ? 179.493 125.899 137.324 1.00 98.56  ? 26  SER A N   1 
ATOM 3699 C CA  . SER D 1 26  ? 180.566 125.898 138.311 1.00 98.56  ? 26  SER A CA  1 
ATOM 3700 C C   . SER D 1 26  ? 180.249 124.810 139.318 1.00 98.56  ? 26  SER A C   1 
ATOM 3701 O O   . SER D 1 26  ? 179.096 124.615 139.710 1.00 98.56  ? 26  SER A O   1 
ATOM 3702 C CB  . SER D 1 26  ? 180.690 127.258 139.022 1.00 124.83 ? 26  SER A CB  1 
ATOM 3703 O OG  . SER D 1 26  ? 179.755 127.405 140.078 1.00 124.83 ? 26  SER A OG  1 
ATOM 3704 N N   . VAL D 1 27  ? 181.283 124.084 139.705 1.00 49.17  ? 27  VAL A N   1 
ATOM 3705 C CA  . VAL D 1 27  ? 181.147 122.998 140.659 1.00 49.17  ? 27  VAL A CA  1 
ATOM 3706 C C   . VAL D 1 27  ? 180.331 123.381 141.888 1.00 49.17  ? 27  VAL A C   1 
ATOM 3707 O O   . VAL D 1 27  ? 179.395 122.680 142.264 1.00 49.17  ? 27  VAL A O   1 
ATOM 3708 C CB  . VAL D 1 27  ? 182.513 122.550 141.140 1.00 53.81  ? 27  VAL A CB  1 
ATOM 3709 C CG1 . VAL D 1 27  ? 182.390 121.236 141.876 1.00 53.81  ? 27  VAL A CG1 1 
ATOM 3710 C CG2 . VAL D 1 27  ? 183.464 122.473 139.963 1.00 53.81  ? 27  VAL A CG2 1 
ATOM 3711 N N   . ARG D 1 28  ? 180.710 124.489 142.521 1.00 99.13  ? 28  ARG A N   1 
ATOM 3712 C CA  . ARG D 1 28  ? 180.017 124.957 143.717 1.00 99.13  ? 28  ARG A CA  1 
ATOM 3713 C C   . ARG D 1 28  ? 178.524 124.763 143.458 1.00 99.13  ? 28  ARG A C   1 
ATOM 3714 O O   . ARG D 1 28  ? 177.789 124.300 144.333 1.00 99.13  ? 28  ARG A O   1 
ATOM 3715 C CB  . ARG D 1 28  ? 180.354 126.441 143.988 1.00 120.61 ? 28  ARG A CB  1 
ATOM 3716 C CG  . ARG D 1 28  ? 180.246 126.886 145.459 1.00 120.61 ? 28  ARG A CG  1 
ATOM 3717 C CD  . ARG D 1 28  ? 181.044 125.953 146.386 1.00 120.61 ? 28  ARG A CD  1 
ATOM 3718 N NE  . ARG D 1 28  ? 180.187 124.976 147.068 1.00 120.61 ? 28  ARG A NE  1 
ATOM 3719 C CZ  . ARG D 1 28  ? 180.623 123.910 147.744 1.00 120.61 ? 28  ARG A CZ  1 
ATOM 3720 N NH1 . ARG D 1 28  ? 181.925 123.654 147.837 1.00 120.61 ? 28  ARG A NH1 1 
ATOM 3721 N NH2 . ARG D 1 28  ? 179.748 123.102 148.341 1.00 120.61 ? 28  ARG A NH2 1 
ATOM 3722 N N   . ASP D 1 29  ? 178.098 125.080 142.233 1.00 99.30  ? 29  ASP A N   1 
ATOM 3723 C CA  . ASP D 1 29  ? 176.701 124.938 141.850 1.00 99.30  ? 29  ASP A CA  1 
ATOM 3724 C C   . ASP D 1 29  ? 176.292 123.477 141.893 1.00 99.30  ? 29  ASP A C   1 
ATOM 3725 O O   . ASP D 1 29  ? 175.278 123.149 142.494 1.00 99.30  ? 29  ASP A O   1 
ATOM 3726 C CB  . ASP D 1 29  ? 176.442 125.514 140.449 1.00 93.45  ? 29  ASP A CB  1 
ATOM 3727 C CG  . ASP D 1 29  ? 176.306 127.034 140.454 1.00 93.45  ? 29  ASP A CG  1 
ATOM 3728 O OD1 . ASP D 1 29  ? 175.502 127.571 141.252 1.00 93.45  ? 29  ASP A OD1 1 
ATOM 3729 O OD2 . ASP D 1 29  ? 177.000 127.692 139.651 1.00 93.45  ? 29  ASP A OD2 1 
ATOM 3730 N N   . LEU D 1 30  ? 177.092 122.603 141.283 1.00 45.43  ? 30  LEU A N   1 
ATOM 3731 C CA  . LEU D 1 30  ? 176.797 121.158 141.247 1.00 45.43  ? 30  LEU A CA  1 
ATOM 3732 C C   . LEU D 1 30  ? 176.718 120.442 142.579 1.00 45.43  ? 30  LEU A C   1 
ATOM 3733 O O   . LEU D 1 30  ? 175.785 119.690 142.826 1.00 45.43  ? 30  LEU A O   1 
ATOM 3734 C CB  . LEU D 1 30  ? 177.817 120.420 140.394 1.00 70.86  ? 30  LEU A CB  1 
ATOM 3735 C CG  . LEU D 1 30  ? 177.678 120.625 138.889 1.00 70.86  ? 30  LEU A CG  1 
ATOM 3736 C CD1 . LEU D 1 30  ? 178.123 122.034 138.523 1.00 70.86  ? 30  LEU A CD1 1 
ATOM 3737 C CD2 . LEU D 1 30  ? 178.511 119.595 138.150 1.00 70.86  ? 30  LEU A CD2 1 
ATOM 3738 N N   . LEU D 1 31  ? 177.726 120.644 143.415 1.00 65.51  ? 31  LEU A N   1 
ATOM 3739 C CA  . LEU D 1 31  ? 177.763 120.040 144.737 1.00 65.51  ? 31  LEU A CA  1 
ATOM 3740 C C   . LEU D 1 31  ? 176.625 120.609 145.575 1.00 65.51  ? 31  LEU A C   1 
ATOM 3741 O O   . LEU D 1 31  ? 175.747 119.862 146.014 1.00 65.51  ? 31  LEU A O   1 
ATOM 3742 C CB  . LEU D 1 31  ? 179.098 120.356 145.394 1.00 89.53  ? 31  LEU A CB  1 
ATOM 3743 C CG  . LEU D 1 31  ? 180.258 119.914 144.508 1.00 89.53  ? 31  LEU A CG  1 
ATOM 3744 C CD1 . LEU D 1 31  ? 181.589 120.399 145.094 1.00 89.53  ? 31  LEU A CD1 1 
ATOM 3745 C CD2 . LEU D 1 31  ? 180.213 118.402 144.380 1.00 89.53  ? 31  LEU A CD2 1 
ATOM 3746 N N   . ASP D 1 32  ? 176.645 121.932 145.783 1.00 120.57 ? 32  ASP A N   1 
ATOM 3747 C CA  . ASP D 1 32  ? 175.609 122.614 146.563 1.00 120.57 ? 32  ASP A CA  1 
ATOM 3748 C C   . ASP D 1 32  ? 174.273 121.965 146.235 1.00 120.57 ? 32  ASP A C   1 
ATOM 3749 O O   . ASP D 1 32  ? 173.390 121.857 147.083 1.00 120.57 ? 32  ASP A O   1 
ATOM 3750 C CB  . ASP D 1 32  ? 175.521 124.111 146.216 1.00 123.66 ? 32  ASP A CB  1 
ATOM 3751 C CG  . ASP D 1 32  ? 176.540 124.968 146.963 1.00 123.66 ? 32  ASP A CG  1 
ATOM 3752 O OD1 . ASP D 1 32  ? 176.978 124.593 148.078 1.00 123.66 ? 32  ASP A OD1 1 
ATOM 3753 O OD2 . ASP D 1 32  ? 176.879 126.048 146.430 1.00 123.66 ? 32  ASP A OD2 1 
ATOM 3754 N N   . THR D 1 33  ? 174.152 121.518 144.991 1.00 99.69  ? 33  THR A N   1 
ATOM 3755 C CA  . THR D 1 33  ? 172.941 120.875 144.484 1.00 99.69  ? 33  THR A CA  1 
ATOM 3756 C C   . THR D 1 33  ? 172.821 119.417 144.867 1.00 99.69  ? 33  THR A C   1 
ATOM 3757 O O   . THR D 1 33  ? 172.192 119.028 145.849 1.00 99.69  ? 33  THR A O   1 
ATOM 3758 C CB  . THR D 1 33  ? 172.918 120.887 142.948 1.00 89.65  ? 33  THR A CB  1 
ATOM 3759 O OG1 . THR D 1 33  ? 172.872 122.243 142.468 1.00 89.65  ? 33  THR A OG1 1 
ATOM 3760 C CG2 . THR D 1 33  ? 171.729 120.055 142.435 1.00 89.65  ? 33  THR A CG2 1 
ATOM 3761 N N   . ALA D 1 34  ? 173.414 118.624 143.997 1.00 65.42  ? 34  ALA A N   1 
ATOM 3762 C CA  . ALA D 1 34  ? 173.463 117.195 144.125 1.00 65.42  ? 34  ALA A CA  1 
ATOM 3763 C C   . ALA D 1 34  ? 173.300 116.723 145.559 1.00 65.42  ? 34  ALA A C   1 
ATOM 3764 O O   . ALA D 1 34  ? 172.193 116.399 146.000 1.00 65.42  ? 34  ALA A O   1 
ATOM 3765 C CB  . ALA D 1 34  ? 174.773 116.714 143.591 1.00 20.00  ? 34  ALA A CB  1 
ATOM 3766 N N   . ALA D 1 35  ? 174.424 116.706 146.269 1.00 141.88 ? 35  ALA A N   1 
ATOM 3767 C CA  . ALA D 1 35  ? 174.501 116.254 147.648 1.00 141.88 ? 35  ALA A CA  1 
ATOM 3768 C C   . ALA D 1 35  ? 173.358 116.769 148.530 1.00 141.88 ? 35  ALA A C   1 
ATOM 3769 O O   . ALA D 1 35  ? 173.028 116.152 149.543 1.00 141.88 ? 35  ALA A O   1 
ATOM 3770 C CB  . ALA D 1 35  ? 175.886 116.631 148.239 1.00 28.84  ? 35  ALA A CB  1 
ATOM 3771 N N   . ALA D 1 36  ? 172.740 117.882 148.143 1.00 103.40 ? 36  ALA A N   1 
ATOM 3772 C CA  . ALA D 1 36  ? 171.630 118.434 148.917 1.00 103.40 ? 36  ALA A CA  1 
ATOM 3773 C C   . ALA D 1 36  ? 170.344 117.876 148.322 1.00 103.40 ? 36  ALA A C   1 
ATOM 3774 O O   . ALA D 1 36  ? 169.274 118.475 148.403 1.00 103.40 ? 36  ALA A O   1 
ATOM 3775 C CB  . ALA D 1 36  ? 171.644 119.952 148.826 1.00 109.27 ? 36  ALA A CB  1 
ATOM 3776 N N   . LEU D 1 37  ? 170.461 116.690 147.753 1.00 90.03  ? 37  LEU A N   1 
ATOM 3777 C CA  . LEU D 1 37  ? 169.341 116.074 147.093 1.00 90.03  ? 37  LEU A CA  1 
ATOM 3778 C C   . LEU D 1 37  ? 169.442 114.534 147.124 1.00 90.03  ? 37  LEU A C   1 
ATOM 3779 O O   . LEU D 1 37  ? 168.439 113.812 146.991 1.00 90.03  ? 37  LEU A O   1 
ATOM 3780 C CB  . LEU D 1 37  ? 169.327 116.636 145.669 1.00 21.22  ? 37  LEU A CB  1 
ATOM 3781 C CG  . LEU D 1 37  ? 168.660 115.811 144.574 1.00 21.22  ? 37  LEU A CG  1 
ATOM 3782 C CD1 . LEU D 1 37  ? 167.192 115.556 144.898 1.00 21.22  ? 37  LEU A CD1 1 
ATOM 3783 C CD2 . LEU D 1 37  ? 168.816 116.522 143.255 1.00 21.22  ? 37  LEU A CD2 1 
ATOM 3784 N N   . TYR D 1 38  ? 170.658 114.043 147.355 1.00 65.67  ? 38  TYR A N   1 
ATOM 3785 C CA  . TYR D 1 38  ? 170.918 112.613 147.379 1.00 65.67  ? 38  TYR A CA  1 
ATOM 3786 C C   . TYR D 1 38  ? 171.730 112.139 148.577 1.00 65.67  ? 38  TYR A C   1 
ATOM 3787 O O   . TYR D 1 38  ? 171.803 110.947 148.838 1.00 65.67  ? 38  TYR A O   1 
ATOM 3788 C CB  . TYR D 1 38  ? 171.650 112.238 146.104 1.00 56.26  ? 38  TYR A CB  1 
ATOM 3789 C CG  . TYR D 1 38  ? 170.872 112.542 144.842 1.00 56.26  ? 38  TYR A CG  1 
ATOM 3790 C CD1 . TYR D 1 38  ? 169.536 112.152 144.706 1.00 56.26  ? 38  TYR A CD1 1 
ATOM 3791 C CD2 . TYR D 1 38  ? 171.484 113.161 143.758 1.00 56.26  ? 38  TYR A CD2 1 
ATOM 3792 C CE1 . TYR D 1 38  ? 168.836 112.374 143.503 1.00 56.26  ? 38  TYR A CE1 1 
ATOM 3793 C CE2 . TYR D 1 38  ? 170.800 113.381 142.560 1.00 56.26  ? 38  TYR A CE2 1 
ATOM 3794 C CZ  . TYR D 1 38  ? 169.485 112.989 142.432 1.00 56.26  ? 38  TYR A CZ  1 
ATOM 3795 O OH  . TYR D 1 38  ? 168.827 113.209 141.236 1.00 56.26  ? 38  TYR A OH  1 
ATOM 3796 N N   . ARG D 1 39  ? 172.328 113.078 149.303 1.00 107.11 ? 39  ARG A N   1 
ATOM 3797 C CA  . ARG D 1 39  ? 173.153 112.757 150.463 1.00 107.11 ? 39  ARG A CA  1 
ATOM 3798 C C   . ARG D 1 39  ? 172.756 111.493 151.235 1.00 107.11 ? 39  ARG A C   1 
ATOM 3799 O O   . ARG D 1 39  ? 173.402 110.457 151.077 1.00 107.11 ? 39  ARG A O   1 
ATOM 3800 C CB  . ARG D 1 39  ? 173.245 113.973 151.413 1.00 116.56 ? 39  ARG A CB  1 
ATOM 3801 C CG  . ARG D 1 39  ? 171.938 114.594 151.946 1.00 116.56 ? 39  ARG A CG  1 
ATOM 3802 C CD  . ARG D 1 39  ? 172.282 115.918 152.641 1.00 116.56 ? 39  ARG A CD  1 
ATOM 3803 N NE  . ARG D 1 39  ? 173.574 115.811 153.332 1.00 116.56 ? 39  ARG A NE  1 
ATOM 3804 C CZ  . ARG D 1 39  ? 174.409 116.824 153.575 1.00 116.56 ? 39  ARG A CZ  1 
ATOM 3805 N NH1 . ARG D 1 39  ? 174.103 118.060 153.188 1.00 116.56 ? 39  ARG A NH1 1 
ATOM 3806 N NH2 . ARG D 1 39  ? 175.568 116.595 154.194 1.00 116.56 ? 39  ARG A NH2 1 
ATOM 3807 N N   . ASP D 1 40  ? 171.711 111.573 152.061 1.00 147.87 ? 40  ASP A N   1 
ATOM 3808 C CA  . ASP D 1 40  ? 171.242 110.424 152.852 1.00 147.87 ? 40  ASP A CA  1 
ATOM 3809 C C   . ASP D 1 40  ? 171.184 109.140 152.008 1.00 147.87 ? 40  ASP A C   1 
ATOM 3810 O O   . ASP D 1 40  ? 171.332 108.025 152.524 1.00 147.87 ? 40  ASP A O   1 
ATOM 3811 C CB  . ASP D 1 40  ? 169.861 110.738 153.443 1.00 92.21  ? 40  ASP A CB  1 
ATOM 3812 C CG  . ASP D 1 40  ? 168.894 111.273 152.399 1.00 92.21  ? 40  ASP A CG  1 
ATOM 3813 O OD1 . ASP D 1 40  ? 169.056 112.435 151.957 1.00 92.21  ? 40  ASP A OD1 1 
ATOM 3814 O OD2 . ASP D 1 40  ? 167.978 110.521 152.006 1.00 92.21  ? 40  ASP A OD2 1 
ATOM 3815 N N   . ALA D 1 41  ? 170.976 109.325 150.706 1.00 80.07  ? 41  ALA A N   1 
ATOM 3816 C CA  . ALA D 1 41  ? 170.905 108.235 149.739 1.00 80.07  ? 41  ALA A CA  1 
ATOM 3817 C C   . ALA D 1 41  ? 172.317 107.783 149.296 1.00 80.07  ? 41  ALA A C   1 
ATOM 3818 O O   . ALA D 1 41  ? 172.477 106.802 148.571 1.00 80.07  ? 41  ALA A O   1 
ATOM 3819 C CB  . ALA D 1 41  ? 170.071 108.693 148.513 1.00 26.27  ? 41  ALA A CB  1 
ATOM 3820 N N   . LEU D 1 42  ? 173.341 108.495 149.749 1.00 55.64  ? 42  LEU A N   1 
ATOM 3821 C CA  . LEU D 1 42  ? 174.716 108.175 149.386 1.00 55.64  ? 42  LEU A CA  1 
ATOM 3822 C C   . LEU D 1 42  ? 175.545 107.805 150.606 1.00 55.64  ? 42  LEU A C   1 
ATOM 3823 O O   . LEU D 1 42  ? 176.442 106.988 150.514 1.00 55.64  ? 42  LEU A O   1 
ATOM 3824 C CB  . LEU D 1 42  ? 175.336 109.357 148.640 1.00 33.31  ? 42  LEU A CB  1 
ATOM 3825 C CG  . LEU D 1 42  ? 174.522 109.719 147.396 1.00 33.31  ? 42  LEU A CG  1 
ATOM 3826 C CD1 . LEU D 1 42  ? 175.179 110.821 146.593 1.00 33.31  ? 42  LEU A CD1 1 
ATOM 3827 C CD2 . LEU D 1 42  ? 174.373 108.459 146.569 1.00 33.31  ? 42  LEU A CD2 1 
ATOM 3828 N N   . GLU D 1 43  ? 175.250 108.397 151.753 1.00 145.35 ? 43  GLU A N   1 
ATOM 3829 C CA  . GLU D 1 43  ? 175.976 108.033 152.959 1.00 145.35 ? 43  GLU A CA  1 
ATOM 3830 C C   . GLU D 1 43  ? 175.277 106.712 153.308 1.00 145.35 ? 43  GLU A C   1 
ATOM 3831 O O   . GLU D 1 43  ? 174.953 106.445 154.469 1.00 145.35 ? 43  GLU A O   1 
ATOM 3832 C CB  . GLU D 1 43  ? 175.761 109.111 154.050 1.00 115.04 ? 43  GLU A CB  1 
ATOM 3833 C CG  . GLU D 1 43  ? 175.925 110.584 153.567 1.00 115.04 ? 43  GLU A CG  1 
ATOM 3834 C CD  . GLU D 1 43  ? 175.794 111.654 154.677 1.00 115.04 ? 43  GLU A CD  1 
ATOM 3835 O OE1 . GLU D 1 43  ? 174.972 111.465 155.606 1.00 115.04 ? 43  GLU A OE1 1 
ATOM 3836 O OE2 . GLU D 1 43  ? 176.513 112.686 154.588 1.00 115.04 ? 43  GLU A OE2 1 
ATOM 3837 N N   . SER D 1 44  ? 175.023 105.926 152.252 1.00 77.07  ? 44  SER A N   1 
ATOM 3838 C CA  . SER D 1 44  ? 174.307 104.638 152.303 1.00 77.07  ? 44  SER A CA  1 
ATOM 3839 C C   . SER D 1 44  ? 175.032 103.385 151.755 1.00 77.07  ? 44  SER A C   1 
ATOM 3840 O O   . SER D 1 44  ? 175.664 103.428 150.702 1.00 77.07  ? 44  SER A O   1 
ATOM 3841 C CB  . SER D 1 44  ? 172.964 104.792 151.566 1.00 70.20  ? 44  SER A CB  1 
ATOM 3842 O OG  . SER D 1 44  ? 172.507 103.548 151.061 1.00 70.20  ? 44  SER A OG  1 
ATOM 3843 N N   . PRO D 1 45  ? 174.923 102.249 152.474 1.00 96.03  ? 45  PRO A N   1 
ATOM 3844 C CA  . PRO D 1 45  ? 175.505 100.923 152.183 1.00 96.03  ? 45  PRO A CA  1 
ATOM 3845 C C   . PRO D 1 45  ? 175.049 100.213 150.891 1.00 96.03  ? 45  PRO A C   1 
ATOM 3846 O O   . PRO D 1 45  ? 175.623 99.192  150.477 1.00 96.03  ? 45  PRO A O   1 
ATOM 3847 C CB  . PRO D 1 45  ? 175.134 100.116 153.428 1.00 120.61 ? 45  PRO A CB  1 
ATOM 3848 C CG  . PRO D 1 45  ? 175.153 101.173 154.534 1.00 120.61 ? 45  PRO A CG  1 
ATOM 3849 C CD  . PRO D 1 45  ? 174.420 102.308 153.864 1.00 120.61 ? 45  PRO A CD  1 
ATOM 3850 N N   . GLU D 1 46  ? 174.006 100.749 150.273 1.00 105.05 ? 46  GLU A N   1 
ATOM 3851 C CA  . GLU D 1 46  ? 173.449 100.175 149.050 1.00 105.05 ? 46  GLU A CA  1 
ATOM 3852 C C   . GLU D 1 46  ? 173.934 101.007 147.868 1.00 105.05 ? 46  GLU A C   1 
ATOM 3853 O O   . GLU D 1 46  ? 173.950 102.236 147.945 1.00 105.05 ? 46  GLU A O   1 
ATOM 3854 C CB  . GLU D 1 46  ? 171.911 100.231 149.085 1.00 136.11 ? 46  GLU A CB  1 
ATOM 3855 C CG  . GLU D 1 46  ? 171.223 99.527  150.260 1.00 136.11 ? 46  GLU A CG  1 
ATOM 3856 C CD  . GLU D 1 46  ? 171.330 98.021  150.168 1.00 136.11 ? 46  GLU A CD  1 
ATOM 3857 O OE1 . GLU D 1 46  ? 171.136 97.502  149.051 1.00 136.11 ? 46  GLU A OE1 1 
ATOM 3858 O OE2 . GLU D 1 46  ? 171.599 97.360  151.198 1.00 136.11 ? 46  GLU A OE2 1 
ATOM 3859 N N   . HIS D 1 47  ? 174.326 100.358 146.777 1.00 79.95  ? 47  HIS A N   1 
ATOM 3860 C CA  . HIS D 1 47  ? 174.784 101.103 145.608 1.00 79.95  ? 47  HIS A CA  1 
ATOM 3861 C C   . HIS D 1 47  ? 173.780 101.018 144.479 1.00 79.95  ? 47  HIS A C   1 
ATOM 3862 O O   . HIS D 1 47  ? 174.135 100.630 143.371 1.00 79.95  ? 47  HIS A O   1 
ATOM 3863 C CB  . HIS D 1 47  ? 176.155 100.592 145.136 1.00 132.34 ? 47  HIS A CB  1 
ATOM 3864 C CG  . HIS D 1 47  ? 176.413 99.136  145.412 1.00 132.34 ? 47  HIS A CG  1 
ATOM 3865 N ND1 . HIS D 1 47  ? 176.416 98.597  146.684 1.00 132.34 ? 47  HIS A ND1 1 
ATOM 3866 C CD2 . HIS D 1 47  ? 176.774 98.127  144.582 1.00 132.34 ? 47  HIS A CD2 1 
ATOM 3867 C CE1 . HIS D 1 47  ? 176.773 97.325  146.626 1.00 132.34 ? 47  HIS A CE1 1 
ATOM 3868 N NE2 . HIS D 1 47  ? 176.997 97.015  145.362 1.00 132.34 ? 47  HIS A NE2 1 
ATOM 3869 N N   . ALA D 1 48  ? 172.538 101.409 144.782 1.00 125.54 ? 48  ALA A N   1 
ATOM 3870 C CA  . ALA D 1 48  ? 171.390 101.372 143.856 1.00 125.54 ? 48  ALA A CA  1 
ATOM 3871 C C   . ALA D 1 48  ? 171.713 101.376 142.365 1.00 125.54 ? 48  ALA A C   1 
ATOM 3872 O O   . ALA D 1 48  ? 170.886 100.954 141.545 1.00 125.54 ? 48  ALA A O   1 
ATOM 3873 C CB  . ALA D 1 48  ? 170.390 102.509 144.181 1.00 47.71  ? 48  ALA A CB  1 
ATOM 3874 N N   . SER D 1 49  ? 172.901 101.858 142.013 1.00 88.49  ? 49  SER A N   1 
ATOM 3875 C CA  . SER D 1 49  ? 173.318 101.869 140.628 1.00 88.49  ? 49  SER A CA  1 
ATOM 3876 C C   . SER D 1 49  ? 174.760 102.268 140.509 1.00 88.49  ? 49  SER A C   1 
ATOM 3877 O O   . SER D 1 49  ? 175.331 102.874 141.413 1.00 88.49  ? 49  SER A O   1 
ATOM 3878 C CB  . SER D 1 49  ? 172.464 102.830 139.796 1.00 60.27  ? 49  SER A CB  1 
ATOM 3879 O OG  . SER D 1 49  ? 173.219 103.969 139.444 1.00 60.27  ? 49  SER A OG  1 
ATOM 3880 N N   . PRO D 1 50  ? 175.371 101.902 139.381 1.00 83.22  ? 50  PRO A N   1 
ATOM 3881 C CA  . PRO D 1 50  ? 176.762 102.219 139.095 1.00 83.22  ? 50  PRO A CA  1 
ATOM 3882 C C   . PRO D 1 50  ? 176.927 103.734 139.085 1.00 83.22  ? 50  PRO A C   1 
ATOM 3883 O O   . PRO D 1 50  ? 177.883 104.262 139.647 1.00 83.22  ? 50  PRO A O   1 
ATOM 3884 C CB  . PRO D 1 50  ? 176.970 101.598 137.716 1.00 98.11  ? 50  PRO A CB  1 
ATOM 3885 C CG  . PRO D 1 50  ? 176.142 100.363 137.803 1.00 98.11  ? 50  PRO A CG  1 
ATOM 3886 C CD  . PRO D 1 50  ? 174.862 100.922 138.402 1.00 98.11  ? 50  PRO A CD  1 
ATOM 3887 N N   . HIS D 1 51  ? 175.995 104.433 138.450 1.00 42.31  ? 51  HIS A N   1 
ATOM 3888 C CA  . HIS D 1 51  ? 176.071 105.885 138.403 1.00 42.31  ? 51  HIS A CA  1 
ATOM 3889 C C   . HIS D 1 51  ? 176.379 106.425 139.787 1.00 42.31  ? 51  HIS A C   1 
ATOM 3890 O O   . HIS D 1 51  ? 177.304 107.218 139.969 1.00 42.31  ? 51  HIS A O   1 
ATOM 3891 C CB  . HIS D 1 51  ? 174.757 106.464 137.899 1.00 99.48  ? 51  HIS A CB  1 
ATOM 3892 C CG  . HIS D 1 51  ? 174.565 106.321 136.420 1.00 99.48  ? 51  HIS A CG  1 
ATOM 3893 N ND1 . HIS D 1 51  ? 175.352 106.984 135.503 1.00 99.48  ? 51  HIS A ND1 1 
ATOM 3894 C CD2 . HIS D 1 51  ? 173.678 105.594 135.698 1.00 99.48  ? 51  HIS A CD2 1 
ATOM 3895 C CE1 . HIS D 1 51  ? 174.956 106.674 134.281 1.00 99.48  ? 51  HIS A CE1 1 
ATOM 3896 N NE2 . HIS D 1 51  ? 173.941 105.832 134.370 1.00 99.48  ? 51  HIS A NE2 1 
ATOM 3897 N N   . HIS D 1 52  ? 175.611 105.974 140.773 1.00 77.49  ? 52  HIS A N   1 
ATOM 3898 C CA  . HIS D 1 52  ? 175.834 106.406 142.157 1.00 77.49  ? 52  HIS A CA  1 
ATOM 3899 C C   . HIS D 1 52  ? 177.303 106.314 142.474 1.00 77.49  ? 52  HIS A C   1 
ATOM 3900 O O   . HIS D 1 52  ? 178.001 107.302 142.714 1.00 77.49  ? 52  HIS A O   1 
ATOM 3901 C CB  . HIS D 1 52  ? 175.078 105.500 143.116 1.00 83.15  ? 52  HIS A CB  1 
ATOM 3902 C CG  . HIS D 1 52  ? 173.602 105.585 142.950 1.00 83.15  ? 52  HIS A CG  1 
ATOM 3903 N ND1 . HIS D 1 52  ? 172.925 104.937 141.939 1.00 83.15  ? 52  HIS A ND1 1 
ATOM 3904 C CD2 . HIS D 1 52  ? 172.682 106.352 143.579 1.00 83.15  ? 52  HIS A CD2 1 
ATOM 3905 C CE1 . HIS D 1 52  ? 171.657 105.301 141.950 1.00 83.15  ? 52  HIS A CE1 1 
ATOM 3906 N NE2 . HIS D 1 52  ? 171.481 106.165 142.938 1.00 83.15  ? 52  HIS A NE2 1 
ATOM 3907 N N   . THR D 1 53  ? 177.739 105.069 142.501 1.00 72.45  ? 53  THR A N   1 
ATOM 3908 C CA  . THR D 1 53  ? 179.115 104.688 142.763 1.00 72.45  ? 53  THR A CA  1 
ATOM 3909 C C   . THR D 1 53  ? 180.086 105.631 142.058 1.00 72.45  ? 53  THR A C   1 
ATOM 3910 O O   . THR D 1 53  ? 180.986 106.211 142.670 1.00 72.45  ? 53  THR A O   1 
ATOM 3911 C CB  . THR D 1 53  ? 179.331 103.276 142.240 1.00 88.09  ? 53  THR A CB  1 
ATOM 3912 O OG1 . THR D 1 53  ? 178.277 102.427 142.727 1.00 88.09  ? 53  THR A OG1 1 
ATOM 3913 C CG2 . THR D 1 53  ? 180.672 102.760 142.667 1.00 88.09  ? 53  THR A CG2 1 
ATOM 3914 N N   . ALA D 1 54  ? 179.880 105.775 140.756 1.00 62.82  ? 54  ALA A N   1 
ATOM 3915 C CA  . ALA D 1 54  ? 180.710 106.627 139.922 1.00 62.82  ? 54  ALA A CA  1 
ATOM 3916 C C   . ALA D 1 54  ? 181.021 107.946 140.596 1.00 62.82  ? 54  ALA A C   1 
ATOM 3917 O O   . ALA D 1 54  ? 182.187 108.351 140.700 1.00 62.82  ? 54  ALA A O   1 
ATOM 3918 C CB  . ALA D 1 54  ? 180.020 106.874 138.599 1.00 49.46  ? 54  ALA A CB  1 
ATOM 3919 N N   . LEU D 1 55  ? 179.975 108.617 141.053 1.00 53.92  ? 55  LEU A N   1 
ATOM 3920 C CA  . LEU D 1 55  ? 180.158 109.894 141.711 1.00 53.92  ? 55  LEU A CA  1 
ATOM 3921 C C   . LEU D 1 55  ? 181.168 109.795 142.816 1.00 53.92  ? 55  LEU A C   1 
ATOM 3922 O O   . LEU D 1 55  ? 182.311 110.234 142.665 1.00 53.92  ? 55  LEU A O   1 
ATOM 3923 C CB  . LEU D 1 55  ? 178.844 110.398 142.275 1.00 50.86  ? 55  LEU A CB  1 
ATOM 3924 C CG  . LEU D 1 55  ? 178.188 111.272 141.214 1.00 50.86  ? 55  LEU A CG  1 
ATOM 3925 C CD1 . LEU D 1 55  ? 177.717 110.393 140.067 1.00 50.86  ? 55  LEU A CD1 1 
ATOM 3926 C CD2 . LEU D 1 55  ? 177.048 112.045 141.808 1.00 50.86  ? 55  LEU A CD2 1 
ATOM 3927 N N   . ARG D 1 56  ? 180.718 109.225 143.926 1.00 70.02  ? 56  ARG A N   1 
ATOM 3928 C CA  . ARG D 1 56  ? 181.543 109.022 145.098 1.00 70.02  ? 56  ARG A CA  1 
ATOM 3929 C C   . ARG D 1 56  ? 183.038 109.380 144.849 1.00 70.02  ? 56  ARG A C   1 
ATOM 3930 O O   . ARG D 1 56  ? 183.544 110.364 145.409 1.00 70.02  ? 56  ARG A O   1 
ATOM 3931 C CB  . ARG D 1 56  ? 181.384 107.563 145.543 1.00 99.28  ? 56  ARG A CB  1 
ATOM 3932 C CG  . ARG D 1 56  ? 180.021 106.919 145.173 1.00 99.28  ? 56  ARG A CG  1 
ATOM 3933 C CD  . ARG D 1 56  ? 178.993 106.810 146.324 1.00 99.28  ? 56  ARG A CD  1 
ATOM 3934 N NE  . ARG D 1 56  ? 178.021 105.736 146.067 1.00 99.28  ? 56  ARG A NE  1 
ATOM 3935 C CZ  . ARG D 1 56  ? 176.963 105.452 146.825 1.00 99.28  ? 56  ARG A CZ  1 
ATOM 3936 N NH1 . ARG D 1 56  ? 176.701 106.158 147.917 1.00 99.28  ? 56  ARG A NH1 1 
ATOM 3937 N NH2 . ARG D 1 56  ? 176.157 104.456 146.481 1.00 99.28  ? 56  ARG A NH2 1 
ATOM 3938 N N   . GLN D 1 57  ? 183.729 108.599 144.006 1.00 139.21 ? 57  GLN A N   1 
ATOM 3939 C CA  . GLN D 1 57  ? 185.153 108.832 143.679 1.00 139.21 ? 57  GLN A CA  1 
ATOM 3940 C C   . GLN D 1 57  ? 185.299 110.285 143.387 1.00 139.21 ? 57  GLN A C   1 
ATOM 3941 O O   . GLN D 1 57  ? 185.821 111.066 144.180 1.00 139.21 ? 57  GLN A O   1 
ATOM 3942 C CB  . GLN D 1 57  ? 185.553 108.093 142.408 1.00 71.07  ? 57  GLN A CB  1 
ATOM 3943 C CG  . GLN D 1 57  ? 184.756 106.855 142.211 1.00 71.07  ? 57  GLN A CG  1 
ATOM 3944 C CD  . GLN D 1 57  ? 184.786 105.979 143.440 1.00 71.07  ? 57  GLN A CD  1 
ATOM 3945 O OE1 . GLN D 1 57  ? 185.839 105.442 143.801 1.00 71.07  ? 57  GLN A OE1 1 
ATOM 3946 N NE2 . GLN D 1 57  ? 183.636 105.838 144.103 1.00 71.07  ? 57  GLN A NE2 1 
ATOM 3947 N N   . ALA D 1 58  ? 184.839 110.604 142.189 1.00 86.01  ? 58  ALA A N   1 
ATOM 3948 C CA  . ALA D 1 58  ? 184.818 111.950 141.677 1.00 86.01  ? 58  ALA A CA  1 
ATOM 3949 C C   . ALA D 1 58  ? 184.891 112.955 142.824 1.00 86.01  ? 58  ALA A C   1 
ATOM 3950 O O   . ALA D 1 58  ? 185.894 113.646 143.048 1.00 86.01  ? 58  ALA A O   1 
ATOM 3951 C CB  . ALA D 1 58  ? 183.528 112.141 140.912 1.00 20.00  ? 58  ALA A CB  1 
ATOM 3952 N N   . ILE D 1 59  ? 183.792 113.011 143.549 1.00 69.63  ? 59  ILE A N   1 
ATOM 3953 C CA  . ILE D 1 59  ? 183.642 113.897 144.676 1.00 69.63  ? 59  ILE A CA  1 
ATOM 3954 C C   . ILE D 1 59  ? 184.822 113.782 145.642 1.00 69.63  ? 59  ILE A C   1 
ATOM 3955 O O   . ILE D 1 59  ? 185.456 114.783 145.978 1.00 69.63  ? 59  ILE A O   1 
ATOM 3956 C CB  . ILE D 1 59  ? 182.309 113.571 145.373 1.00 33.97  ? 59  ILE A CB  1 
ATOM 3957 C CG1 . ILE D 1 59  ? 181.196 113.584 144.327 1.00 33.97  ? 59  ILE A CG1 1 
ATOM 3958 C CG2 . ILE D 1 59  ? 181.989 114.586 146.448 1.00 33.97  ? 59  ILE A CG2 1 
ATOM 3959 C CD1 . ILE D 1 59  ? 180.400 112.321 144.290 1.00 33.97  ? 59  ILE A CD1 1 
ATOM 3960 N N   . LEU D 1 60  ? 185.129 112.566 146.073 1.00 121.19 ? 60  LEU A N   1 
ATOM 3961 C CA  . LEU D 1 60  ? 186.229 112.374 146.998 1.00 121.19 ? 60  LEU A CA  1 
ATOM 3962 C C   . LEU D 1 60  ? 187.572 112.760 146.418 1.00 121.19 ? 60  LEU A C   1 
ATOM 3963 O O   . LEU D 1 60  ? 188.386 113.367 147.109 1.00 121.19 ? 60  LEU A O   1 
ATOM 3964 C CB  . LEU D 1 60  ? 186.269 110.934 147.485 1.00 125.28 ? 60  LEU A CB  1 
ATOM 3965 C CG  . LEU D 1 60  ? 185.110 110.660 148.437 1.00 125.28 ? 60  LEU A CG  1 
ATOM 3966 C CD1 . LEU D 1 60  ? 185.237 109.265 148.996 1.00 125.28 ? 60  LEU A CD1 1 
ATOM 3967 C CD2 . LEU D 1 60  ? 185.118 111.692 149.566 1.00 125.28 ? 60  LEU A CD2 1 
ATOM 3968 N N   . ALA D 1 61  ? 187.812 112.410 145.157 1.00 86.57  ? 61  ALA A N   1 
ATOM 3969 C CA  . ALA D 1 61  ? 189.074 112.757 144.511 1.00 86.57  ? 61  ALA A CA  1 
ATOM 3970 C C   . ALA D 1 61  ? 189.192 114.276 144.493 1.00 86.57  ? 61  ALA A C   1 
ATOM 3971 O O   . ALA D 1 61  ? 190.254 114.829 144.783 1.00 86.57  ? 61  ALA A O   1 
ATOM 3972 C CB  . ALA D 1 61  ? 189.106 112.215 143.101 1.00 86.45  ? 61  ALA A CB  1 
ATOM 3973 N N   . TRP D 1 62  ? 188.087 114.939 144.157 1.00 61.64  ? 62  TRP A N   1 
ATOM 3974 C CA  . TRP D 1 62  ? 188.029 116.396 144.119 1.00 61.64  ? 62  TRP A CA  1 
ATOM 3975 C C   . TRP D 1 62  ? 188.103 117.014 145.530 1.00 61.64  ? 62  TRP A C   1 
ATOM 3976 O O   . TRP D 1 62  ? 188.762 118.043 145.752 1.00 61.64  ? 62  TRP A O   1 
ATOM 3977 C CB  . TRP D 1 62  ? 186.744 116.832 143.426 1.00 101.79 ? 62  TRP A CB  1 
ATOM 3978 C CG  . TRP D 1 62  ? 186.449 118.274 143.628 1.00 101.79 ? 62  TRP A CG  1 
ATOM 3979 C CD1 . TRP D 1 62  ? 185.826 118.850 144.710 1.00 101.79 ? 62  TRP A CD1 1 
ATOM 3980 C CD2 . TRP D 1 62  ? 186.809 119.347 142.753 1.00 101.79 ? 62  TRP A CD2 1 
ATOM 3981 N NE1 . TRP D 1 62  ? 185.778 120.217 144.557 1.00 101.79 ? 62  TRP A NE1 1 
ATOM 3982 C CE2 . TRP D 1 62  ? 186.374 120.551 143.365 1.00 101.79 ? 62  TRP A CE2 1 
ATOM 3983 C CE3 . TRP D 1 62  ? 187.457 119.412 141.508 1.00 101.79 ? 62  TRP A CE3 1 
ATOM 3984 C CZ2 . TRP D 1 62  ? 186.572 121.807 142.773 1.00 101.79 ? 62  TRP A CZ2 1 
ATOM 3985 C CZ3 . TRP D 1 62  ? 187.655 120.659 140.919 1.00 101.79 ? 62  TRP A CZ3 1 
ATOM 3986 C CH2 . TRP D 1 62  ? 187.211 121.841 141.554 1.00 101.79 ? 62  TRP A CH2 1 
ATOM 3987 N N   . GLY D 1 63  ? 187.396 116.390 146.471 1.00 123.70 ? 63  GLY A N   1 
ATOM 3988 C CA  . GLY D 1 63  ? 187.411 116.843 147.849 1.00 123.70 ? 63  GLY A CA  1 
ATOM 3989 C C   . GLY D 1 63  ? 188.700 116.338 148.481 1.00 123.70 ? 63  GLY A C   1 
ATOM 3990 O O   . GLY D 1 63  ? 188.850 116.358 149.702 1.00 123.70 ? 63  GLY A O   1 
ATOM 3991 N N   . ASP D 1 64  ? 189.606 115.846 147.627 1.00 64.44  ? 64  ASP A N   1 
ATOM 3992 C CA  . ASP D 1 64  ? 190.942 115.350 148.002 1.00 64.44  ? 64  ASP A CA  1 
ATOM 3993 C C   . ASP D 1 64  ? 191.834 116.433 147.420 1.00 64.44  ? 64  ASP A C   1 
ATOM 3994 O O   . ASP D 1 64  ? 192.948 116.676 147.885 1.00 64.44  ? 64  ASP A O   1 
ATOM 3995 C CB  . ASP D 1 64  ? 191.267 114.009 147.314 1.00 104.50 ? 64  ASP A CB  1 
ATOM 3996 C CG  . ASP D 1 64  ? 191.183 112.810 148.261 1.00 104.50 ? 64  ASP A CG  1 
ATOM 3997 O OD1 . ASP D 1 64  ? 191.360 111.664 147.774 1.00 104.50 ? 64  ASP A OD1 1 
ATOM 3998 O OD2 . ASP D 1 64  ? 190.949 113.010 149.477 1.00 104.50 ? 64  ASP A OD2 1 
ATOM 3999 N N   . LEU D 1 65  ? 191.296 117.071 146.382 1.00 62.54  ? 65  LEU A N   1 
ATOM 4000 C CA  . LEU D 1 65  ? 191.939 118.176 145.686 1.00 62.54  ? 65  LEU A CA  1 
ATOM 4001 C C   . LEU D 1 65  ? 191.731 119.454 146.463 1.00 62.54  ? 65  LEU A C   1 
ATOM 4002 O O   . LEU D 1 65  ? 192.689 120.133 146.785 1.00 62.54  ? 65  LEU A O   1 
ATOM 4003 C CB  . LEU D 1 65  ? 191.355 118.363 144.293 1.00 55.71  ? 65  LEU A CB  1 
ATOM 4004 C CG  . LEU D 1 65  ? 191.503 117.148 143.389 1.00 55.71  ? 65  LEU A CG  1 
ATOM 4005 C CD1 . LEU D 1 65  ? 191.257 117.583 141.953 1.00 55.71  ? 65  LEU A CD1 1 
ATOM 4006 C CD2 . LEU D 1 65  ? 192.891 116.543 143.545 1.00 55.71  ? 65  LEU A CD2 1 
ATOM 4007 N N   . MET D 1 66  ? 190.489 119.809 146.757 1.00 124.20 ? 66  MET A N   1 
ATOM 4008 C CA  . MET D 1 66  ? 190.299 121.012 147.534 1.00 124.20 ? 66  MET A CA  1 
ATOM 4009 C C   . MET D 1 66  ? 190.873 120.803 148.942 1.00 124.20 ? 66  MET A C   1 
ATOM 4010 O O   . MET D 1 66  ? 191.181 121.773 149.641 1.00 124.20 ? 66  MET A O   1 
ATOM 4011 C CB  . MET D 1 66  ? 188.830 121.406 147.548 1.00 131.63 ? 66  MET A CB  1 
ATOM 4012 C CG  . MET D 1 66  ? 188.475 122.205 146.303 1.00 131.63 ? 66  MET A CG  1 
ATOM 4013 S SD  . MET D 1 66  ? 186.820 122.955 146.350 1.00 131.63 ? 66  MET A SD  1 
ATOM 4014 C CE  . MET D 1 66  ? 187.137 124.581 146.999 1.00 131.63 ? 66  MET A CE  1 
ATOM 4015 N N   . THR D 1 67  ? 191.037 119.537 149.346 1.00 127.68 ? 67  THR A N   1 
ATOM 4016 C CA  . THR D 1 67  ? 191.641 119.203 150.653 1.00 127.68 ? 67  THR A CA  1 
ATOM 4017 C C   . THR D 1 67  ? 193.139 119.471 150.470 1.00 127.68 ? 67  THR A C   1 
ATOM 4018 O O   . THR D 1 67  ? 193.870 119.751 151.421 1.00 127.68 ? 67  THR A O   1 
ATOM 4019 C CB  . THR D 1 67  ? 191.410 117.686 151.071 1.00 110.78 ? 67  THR A CB  1 
ATOM 4020 O OG1 . THR D 1 67  ? 190.172 117.557 151.792 1.00 110.78 ? 67  THR A OG1 1 
ATOM 4021 C CG2 . THR D 1 67  ? 192.548 117.166 151.960 1.00 110.78 ? 67  THR A CG2 1 
ATOM 4022 N N   . LEU D 1 68  ? 193.572 119.389 149.217 1.00 102.16 ? 68  LEU A N   1 
ATOM 4023 C CA  . LEU D 1 68  ? 194.952 119.649 148.831 1.00 102.16 ? 68  LEU A CA  1 
ATOM 4024 C C   . LEU D 1 68  ? 195.162 121.164 148.702 1.00 102.16 ? 68  LEU A C   1 
ATOM 4025 O O   . LEU D 1 68  ? 195.965 121.765 149.422 1.00 102.16 ? 68  LEU A O   1 
ATOM 4026 C CB  . LEU D 1 68  ? 195.243 118.996 147.476 1.00 38.68  ? 68  LEU A CB  1 
ATOM 4027 C CG  . LEU D 1 68  ? 196.298 119.745 146.642 1.00 38.68  ? 68  LEU A CG  1 
ATOM 4028 C CD1 . LEU D 1 68  ? 197.665 119.351 147.143 1.00 38.68  ? 68  LEU A CD1 1 
ATOM 4029 C CD2 . LEU D 1 68  ? 196.170 119.441 145.172 1.00 38.68  ? 68  LEU A CD2 1 
ATOM 4030 N N   . ALA D 1 69  ? 194.422 121.753 147.761 1.00 97.92  ? 69  ALA A N   1 
ATOM 4031 C CA  . ALA D 1 69  ? 194.459 123.179 147.447 1.00 97.92  ? 69  ALA A CA  1 
ATOM 4032 C C   . ALA D 1 69  ? 194.705 124.079 148.639 1.00 97.92  ? 69  ALA A C   1 
ATOM 4033 O O   . ALA D 1 69  ? 195.643 124.870 148.633 1.00 97.92  ? 69  ALA A O   1 
ATOM 4034 C CB  . ALA D 1 69  ? 193.161 123.589 146.770 1.00 122.34 ? 69  ALA A CB  1 
ATOM 4035 N N   . THR D 1 70  ? 193.854 123.964 149.656 1.00 185.68 ? 70  THR A N   1 
ATOM 4036 C CA  . THR D 1 70  ? 193.980 124.784 150.852 1.00 185.68 ? 70  THR A CA  1 
ATOM 4037 C C   . THR D 1 70  ? 195.264 124.461 151.646 1.00 185.68 ? 70  THR A C   1 
ATOM 4038 O O   . THR D 1 70  ? 195.736 125.296 152.420 1.00 185.68 ? 70  THR A O   1 
ATOM 4039 C CB  . THR D 1 70  ? 192.698 124.656 151.750 1.00 99.12  ? 70  THR A CB  1 
ATOM 4040 O OG1 . THR D 1 70  ? 192.476 123.280 152.090 1.00 99.12  ? 70  THR A OG1 1 
ATOM 4041 C CG2 . THR D 1 70  ? 191.452 125.209 151.006 1.00 99.12  ? 70  THR A CG2 1 
ATOM 4042 N N   . TRP D 1 71  ? 195.834 123.269 151.435 1.00 143.70 ? 71  TRP A N   1 
ATOM 4043 C CA  . TRP D 1 71  ? 197.086 122.848 152.098 1.00 143.70 ? 71  TRP A CA  1 
ATOM 4044 C C   . TRP D 1 71  ? 198.276 123.564 151.445 1.00 143.70 ? 71  TRP A C   1 
ATOM 4045 O O   . TRP D 1 71  ? 199.171 124.079 152.123 1.00 143.70 ? 71  TRP A O   1 
ATOM 4046 C CB  . TRP D 1 71  ? 197.291 121.331 151.961 1.00 121.71 ? 71  TRP A CB  1 
ATOM 4047 C CG  . TRP D 1 71  ? 198.660 120.798 152.446 1.00 121.71 ? 71  TRP A CG  1 
ATOM 4048 C CD1 . TRP D 1 71  ? 198.969 120.313 153.702 1.00 121.71 ? 71  TRP A CD1 1 
ATOM 4049 C CD2 . TRP D 1 71  ? 199.861 120.647 151.658 1.00 121.71 ? 71  TRP A CD2 1 
ATOM 4050 N NE1 . TRP D 1 71  ? 200.278 119.868 153.734 1.00 121.71 ? 71  TRP A NE1 1 
ATOM 4051 C CE2 . TRP D 1 71  ? 200.849 120.065 152.501 1.00 121.71 ? 71  TRP A CE2 1 
ATOM 4052 C CE3 . TRP D 1 71  ? 200.201 120.953 150.329 1.00 121.71 ? 71  TRP A CE3 1 
ATOM 4053 C CZ2 . TRP D 1 71  ? 202.145 119.770 152.046 1.00 121.71 ? 71  TRP A CZ2 1 
ATOM 4054 C CZ3 . TRP D 1 71  ? 201.489 120.660 149.883 1.00 121.71 ? 71  TRP A CZ3 1 
ATOM 4055 C CH2 . TRP D 1 71  ? 202.445 120.079 150.742 1.00 121.71 ? 71  TRP A CH2 1 
ATOM 4056 N N   . VAL D 1 72  ? 198.279 123.567 150.118 1.00 126.62 ? 72  VAL A N   1 
ATOM 4057 C CA  . VAL D 1 72  ? 199.317 124.217 149.331 1.00 126.62 ? 72  VAL A CA  1 
ATOM 4058 C C   . VAL D 1 72  ? 199.593 125.646 149.836 1.00 126.62 ? 72  VAL A C   1 
ATOM 4059 O O   . VAL D 1 72  ? 200.748 126.066 149.932 1.00 126.62 ? 72  VAL A O   1 
ATOM 4060 C CB  . VAL D 1 72  ? 198.883 124.260 147.846 1.00 78.16  ? 72  VAL A CB  1 
ATOM 4061 C CG1 . VAL D 1 72  ? 199.996 124.841 146.973 1.00 78.16  ? 72  VAL A CG1 1 
ATOM 4062 C CG2 . VAL D 1 72  ? 198.477 122.862 147.397 1.00 78.16  ? 72  VAL A CG2 1 
ATOM 4063 N N   . GLY D 1 73  ? 198.528 126.381 150.156 1.00 122.90 ? 73  GLY A N   1 
ATOM 4064 C CA  . GLY D 1 73  ? 198.671 127.741 150.649 1.00 122.90 ? 73  GLY A CA  1 
ATOM 4065 C C   . GLY D 1 73  ? 199.372 127.791 151.995 1.00 122.90 ? 73  GLY A C   1 
ATOM 4066 O O   . GLY D 1 73  ? 200.119 128.727 152.280 1.00 122.90 ? 73  GLY A O   1 
ATOM 4067 N N   . THR D 1 74  ? 199.132 126.779 152.825 1.00 195.01 ? 74  THR A N   1 
ATOM 4068 C CA  . THR D 1 74  ? 199.745 126.694 154.151 1.00 195.01 ? 74  THR A CA  1 
ATOM 4069 C C   . THR D 1 74  ? 201.242 126.376 154.047 1.00 195.01 ? 74  THR A C   1 
ATOM 4070 O O   . THR D 1 74  ? 202.073 127.023 154.698 1.00 195.01 ? 74  THR A O   1 
ATOM 4071 C CB  . THR D 1 74  ? 199.066 125.581 155.026 1.00 105.81 ? 74  THR A CB  1 
ATOM 4072 O OG1 . THR D 1 74  ? 197.661 125.842 155.139 1.00 105.81 ? 74  THR A OG1 1 
ATOM 4073 C CG2 . THR D 1 74  ? 199.684 125.532 156.433 1.00 105.81 ? 74  THR A CG2 1 
ATOM 4074 N N   . ASN D 1 75  ? 201.576 125.392 153.210 1.00 107.93 ? 75  ASN A N   1 
ATOM 4075 C CA  . ASN D 1 75  ? 202.958 124.947 153.042 1.00 107.93 ? 75  ASN A CA  1 
ATOM 4076 C C   . ASN D 1 75  ? 203.707 125.384 151.768 1.00 107.93 ? 75  ASN A C   1 
ATOM 4077 O O   . ASN D 1 75  ? 204.303 124.546 151.095 1.00 107.93 ? 75  ASN A O   1 
ATOM 4078 C CB  . ASN D 1 75  ? 203.025 123.407 153.148 1.00 108.87 ? 75  ASN A CB  1 
ATOM 4079 C CG  . ASN D 1 75  ? 202.759 122.880 154.568 1.00 108.87 ? 75  ASN A CG  1 
ATOM 4080 O OD1 . ASN D 1 75  ? 201.673 123.072 155.136 1.00 108.87 ? 75  ASN A OD1 1 
ATOM 4081 N ND2 . ASN D 1 75  ? 203.754 122.197 155.136 1.00 108.87 ? 75  ASN A ND2 1 
ATOM 4082 N N   . LEU D 1 76  ? 203.697 126.674 151.434 1.00 185.24 ? 76  LEU A N   1 
ATOM 4083 C CA  . LEU D 1 76  ? 204.435 127.148 150.254 1.00 185.24 ? 76  LEU A CA  1 
ATOM 4084 C C   . LEU D 1 76  ? 204.730 128.651 150.270 1.00 185.24 ? 76  LEU A C   1 
ATOM 4085 O O   . LEU D 1 76  ? 203.903 129.475 149.868 1.00 185.24 ? 76  LEU A O   1 
ATOM 4086 C CB  . LEU D 1 76  ? 203.710 126.765 148.959 1.00 132.13 ? 76  LEU A CB  1 
ATOM 4087 C CG  . LEU D 1 76  ? 204.497 125.744 148.129 1.00 132.13 ? 76  LEU A CG  1 
ATOM 4088 C CD1 . LEU D 1 76  ? 203.776 125.491 146.822 1.00 132.13 ? 76  LEU A CD1 1 
ATOM 4089 C CD2 . LEU D 1 76  ? 205.916 126.263 147.869 1.00 132.13 ? 76  LEU A CD2 1 
ATOM 4090 N N   . GLU D 1 77  ? 205.936 128.985 150.727 1.00 184.57 ? 77  GLU A N   1 
ATOM 4091 C CA  . GLU D 1 77  ? 206.386 130.367 150.849 1.00 184.57 ? 77  GLU A CA  1 
ATOM 4092 C C   . GLU D 1 77  ? 206.805 131.020 149.528 1.00 184.57 ? 77  GLU A C   1 
ATOM 4093 O O   . GLU D 1 77  ? 207.830 131.702 149.459 1.00 184.57 ? 77  GLU A O   1 
ATOM 4094 C CB  . GLU D 1 77  ? 207.539 130.450 151.866 1.00 139.60 ? 77  GLU A CB  1 
ATOM 4095 C CG  . GLU D 1 77  ? 207.215 129.891 153.263 1.00 139.60 ? 77  GLU A CG  1 
ATOM 4096 C CD  . GLU D 1 77  ? 206.057 130.611 153.953 1.00 139.60 ? 77  GLU A CD  1 
ATOM 4097 O OE1 . GLU D 1 77  ? 206.122 131.849 154.091 1.00 139.60 ? 77  GLU A OE1 1 
ATOM 4098 O OE2 . GLU D 1 77  ? 205.083 129.939 154.363 1.00 139.60 ? 77  GLU A OE2 1 
ATOM 4099 N N   . ASP D 1 78  ? 206.010 130.806 148.484 1.00 135.11 ? 78  ASP A N   1 
ATOM 4100 C CA  . ASP D 1 78  ? 206.279 131.402 147.176 1.00 135.11 ? 78  ASP A CA  1 
ATOM 4101 C C   . ASP D 1 78  ? 204.961 131.837 146.526 1.00 135.11 ? 78  ASP A C   1 
ATOM 4102 O O   . ASP D 1 78  ? 204.451 131.164 145.630 1.00 135.11 ? 78  ASP A O   1 
ATOM 4103 C CB  . ASP D 1 78  ? 207.020 130.412 146.262 1.00 113.83 ? 78  ASP A CB  1 
ATOM 4104 C CG  . ASP D 1 78  ? 207.320 131.000 144.876 1.00 113.83 ? 78  ASP A CG  1 
ATOM 4105 O OD1 . ASP D 1 78  ? 207.733 132.183 144.793 1.00 113.83 ? 78  ASP A OD1 1 
ATOM 4106 O OD2 . ASP D 1 78  ? 207.153 130.276 143.865 1.00 113.83 ? 78  ASP A OD2 1 
ATOM 4107 N N   . PRO D 1 79  ? 204.395 132.976 146.975 1.00 161.78 ? 79  PRO A N   1 
ATOM 4108 C CA  . PRO D 1 79  ? 203.129 133.532 146.464 1.00 161.78 ? 79  PRO A CA  1 
ATOM 4109 C C   . PRO D 1 79  ? 202.993 133.671 144.936 1.00 161.78 ? 79  PRO A C   1 
ATOM 4110 O O   . PRO D 1 79  ? 201.881 133.831 144.419 1.00 161.78 ? 79  PRO A O   1 
ATOM 4111 C CB  . PRO D 1 79  ? 203.034 134.879 147.184 1.00 140.12 ? 79  PRO A CB  1 
ATOM 4112 C CG  . PRO D 1 79  ? 203.702 134.592 148.511 1.00 140.12 ? 79  PRO A CG  1 
ATOM 4113 C CD  . PRO D 1 79  ? 204.922 133.802 148.082 1.00 140.12 ? 79  PRO A CD  1 
ATOM 4114 N N   . ALA D 1 80  ? 204.121 133.602 144.227 1.00 134.39 ? 80  ALA A N   1 
ATOM 4115 C CA  . ALA D 1 80  ? 204.151 133.724 142.765 1.00 134.39 ? 80  ALA A CA  1 
ATOM 4116 C C   . ALA D 1 80  ? 203.522 132.522 142.038 1.00 134.39 ? 80  ALA A C   1 
ATOM 4117 O O   . ALA D 1 80  ? 202.504 132.662 141.350 1.00 134.39 ? 80  ALA A O   1 
ATOM 4118 C CB  . ALA D 1 80  ? 205.614 133.937 142.288 1.00 51.27  ? 80  ALA A CB  1 
ATOM 4119 N N   . SER D 1 81  ? 204.140 131.350 142.195 1.00 137.68 ? 81  SER A N   1 
ATOM 4120 C CA  . SER D 1 81  ? 203.666 130.110 141.571 1.00 137.68 ? 81  SER A CA  1 
ATOM 4121 C C   . SER D 1 81  ? 202.530 129.470 142.381 1.00 137.68 ? 81  SER A C   1 
ATOM 4122 O O   . SER D 1 81  ? 201.644 128.824 141.822 1.00 137.68 ? 81  SER A O   1 
ATOM 4123 C CB  . SER D 1 81  ? 204.828 129.108 141.427 1.00 126.28 ? 81  SER A CB  1 
ATOM 4124 O OG  . SER D 1 81  ? 205.329 128.688 142.690 1.00 126.28 ? 81  SER A OG  1 
ATOM 4125 N N   . ARG D 1 82  ? 202.558 129.664 143.697 1.00 139.03 ? 82  ARG A N   1 
ATOM 4126 C CA  . ARG D 1 82  ? 201.540 129.117 144.593 1.00 139.03 ? 82  ARG A CA  1 
ATOM 4127 C C   . ARG D 1 82  ? 200.129 129.475 144.127 1.00 139.03 ? 82  ARG A C   1 
ATOM 4128 O O   . ARG D 1 82  ? 199.271 128.600 143.984 1.00 139.03 ? 82  ARG A O   1 
ATOM 4129 C CB  . ARG D 1 82  ? 201.786 129.638 146.021 1.00 165.96 ? 82  ARG A CB  1 
ATOM 4130 C CG  . ARG D 1 82  ? 200.783 129.191 147.094 1.00 165.96 ? 82  ARG A CG  1 
ATOM 4131 C CD  . ARG D 1 82  ? 199.623 130.180 147.281 1.00 165.96 ? 82  ARG A CD  1 
ATOM 4132 N NE  . ARG D 1 82  ? 200.045 131.504 147.753 1.00 165.96 ? 82  ARG A NE  1 
ATOM 4133 C CZ  . ARG D 1 82  ? 200.599 131.745 148.940 1.00 165.96 ? 82  ARG A CZ  1 
ATOM 4134 N NH1 . ARG D 1 82  ? 200.808 130.752 149.795 1.00 165.96 ? 82  ARG A NH1 1 
ATOM 4135 N NH2 . ARG D 1 82  ? 200.949 132.983 149.273 1.00 165.96 ? 82  ARG A NH2 1 
ATOM 4136 N N   . ASP D 1 83  ? 199.897 130.764 143.888 1.00 148.18 ? 83  ASP A N   1 
ATOM 4137 C CA  . ASP D 1 83  ? 198.589 131.238 143.444 1.00 148.18 ? 83  ASP A CA  1 
ATOM 4138 C C   . ASP D 1 83  ? 198.302 130.854 142.003 1.00 148.18 ? 83  ASP A C   1 
ATOM 4139 O O   . ASP D 1 83  ? 197.170 130.967 141.547 1.00 148.18 ? 83  ASP A O   1 
ATOM 4140 C CB  . ASP D 1 83  ? 198.481 132.764 143.605 1.00 150.35 ? 83  ASP A CB  1 
ATOM 4141 C CG  . ASP D 1 83  ? 197.649 133.171 144.821 1.00 150.35 ? 83  ASP A CG  1 
ATOM 4142 O OD1 . ASP D 1 83  ? 197.356 132.303 145.671 1.00 150.35 ? 83  ASP A OD1 1 
ATOM 4143 O OD2 . ASP D 1 83  ? 197.292 134.364 144.930 1.00 150.35 ? 83  ASP A OD2 1 
ATOM 4144 N N   . LEU D 1 84  ? 199.328 130.400 141.291 1.00 187.50 ? 84  LEU A N   1 
ATOM 4145 C CA  . LEU D 1 84  ? 199.173 129.998 139.899 1.00 187.50 ? 84  LEU A CA  1 
ATOM 4146 C C   . LEU D 1 84  ? 198.413 128.675 139.783 1.00 187.50 ? 84  LEU A C   1 
ATOM 4147 O O   . LEU D 1 84  ? 197.306 128.638 139.257 1.00 187.50 ? 84  LEU A O   1 
ATOM 4148 C CB  . LEU D 1 84  ? 200.545 129.863 139.233 1.00 140.33 ? 84  LEU A CB  1 
ATOM 4149 C CG  . LEU D 1 84  ? 200.559 129.526 137.738 1.00 140.33 ? 84  LEU A CG  1 
ATOM 4150 C CD1 . LEU D 1 84  ? 199.819 130.602 136.932 1.00 140.33 ? 84  LEU A CD1 1 
ATOM 4151 C CD2 . LEU D 1 84  ? 202.009 129.407 137.285 1.00 140.33 ? 84  LEU A CD2 1 
ATOM 4152 N N   . VAL D 1 85  ? 199.016 127.601 140.288 1.00 129.91 ? 85  VAL A N   1 
ATOM 4153 C CA  . VAL D 1 85  ? 198.440 126.245 140.252 1.00 129.91 ? 85  VAL A CA  1 
ATOM 4154 C C   . VAL D 1 85  ? 196.908 126.126 140.224 1.00 129.91 ? 85  VAL A C   1 
ATOM 4155 O O   . VAL D 1 85  ? 196.339 125.395 139.405 1.00 129.91 ? 85  VAL A O   1 
ATOM 4156 C CB  . VAL D 1 85  ? 198.972 125.388 141.453 1.00 59.47  ? 85  VAL A CB  1 
ATOM 4157 C CG1 . VAL D 1 85  ? 200.454 125.643 141.630 1.00 59.47  ? 85  VAL A CG1 1 
ATOM 4158 C CG2 . VAL D 1 85  ? 198.211 125.700 142.754 1.00 59.47  ? 85  VAL A CG2 1 
ATOM 4159 N N   . VAL D 1 86  ? 196.254 126.846 141.127 1.00 101.69 ? 86  VAL A N   1 
ATOM 4160 C CA  . VAL D 1 86  ? 194.808 126.820 141.239 1.00 101.69 ? 86  VAL A CA  1 
ATOM 4161 C C   . VAL D 1 86  ? 194.157 127.387 139.962 1.00 101.69 ? 86  VAL A C   1 
ATOM 4162 O O   . VAL D 1 86  ? 192.948 127.288 139.766 1.00 101.69 ? 86  VAL A O   1 
ATOM 4163 C CB  . VAL D 1 86  ? 194.372 127.596 142.523 1.00 64.13  ? 86  VAL A CB  1 
ATOM 4164 C CG1 . VAL D 1 86  ? 192.948 127.193 142.927 1.00 64.13  ? 86  VAL A CG1 1 
ATOM 4165 C CG2 . VAL D 1 86  ? 195.364 127.309 143.680 1.00 64.13  ? 86  VAL A CG2 1 
ATOM 4166 N N   . SER D 1 87  ? 194.972 127.967 139.088 1.00 189.47 ? 87  SER A N   1 
ATOM 4167 C CA  . SER D 1 87  ? 194.484 128.503 137.820 1.00 189.47 ? 87  SER A CA  1 
ATOM 4168 C C   . SER D 1 87  ? 194.302 127.309 136.890 1.00 189.47 ? 87  SER A C   1 
ATOM 4169 O O   . SER D 1 87  ? 193.480 127.329 135.974 1.00 189.47 ? 87  SER A O   1 
ATOM 4170 C CB  . SER D 1 87  ? 195.508 129.474 137.217 1.00 131.17 ? 87  SER A CB  1 
ATOM 4171 O OG  . SER D 1 87  ? 195.219 129.775 135.860 1.00 131.17 ? 87  SER A OG  1 
ATOM 4172 N N   . TYR D 1 88  ? 195.090 126.269 137.147 1.00 134.97 ? 88  TYR A N   1 
ATOM 4173 C CA  . TYR D 1 88  ? 195.061 125.035 136.365 1.00 134.97 ? 88  TYR A CA  1 
ATOM 4174 C C   . TYR D 1 88  ? 194.068 124.080 136.991 1.00 134.97 ? 88  TYR A C   1 
ATOM 4175 O O   . TYR D 1 88  ? 193.889 122.955 136.542 1.00 134.97 ? 88  TYR A O   1 
ATOM 4176 C CB  . TYR D 1 88  ? 196.445 124.382 136.371 1.00 139.57 ? 88  TYR A CB  1 
ATOM 4177 C CG  . TYR D 1 88  ? 196.478 122.991 135.778 1.00 139.57 ? 88  TYR A CG  1 
ATOM 4178 C CD1 . TYR D 1 88  ? 196.452 122.794 134.393 1.00 139.57 ? 88  TYR A CD1 1 
ATOM 4179 C CD2 . TYR D 1 88  ? 196.529 121.869 136.600 1.00 139.57 ? 88  TYR A CD2 1 
ATOM 4180 C CE1 . TYR D 1 88  ? 196.479 121.507 133.845 1.00 139.57 ? 88  TYR A CE1 1 
ATOM 4181 C CE2 . TYR D 1 88  ? 196.557 120.582 136.064 1.00 139.57 ? 88  TYR A CE2 1 
ATOM 4182 C CZ  . TYR D 1 88  ? 196.535 120.406 134.691 1.00 139.57 ? 88  TYR A CZ  1 
ATOM 4183 O OH  . TYR D 1 88  ? 196.595 119.127 134.180 1.00 139.57 ? 88  TYR A OH  1 
ATOM 4184 N N   . VAL D 1 89  ? 193.414 124.543 138.039 1.00 91.43  ? 89  VAL A N   1 
ATOM 4185 C CA  . VAL D 1 89  ? 192.469 123.707 138.735 1.00 91.43  ? 89  VAL A CA  1 
ATOM 4186 C C   . VAL D 1 89  ? 191.069 124.287 138.699 1.00 91.43  ? 89  VAL A C   1 
ATOM 4187 O O   . VAL D 1 89  ? 190.201 123.758 138.013 1.00 91.43  ? 89  VAL A O   1 
ATOM 4188 C CB  . VAL D 1 89  ? 192.944 123.502 140.170 1.00 33.19  ? 89  VAL A CB  1 
ATOM 4189 C CG1 . VAL D 1 89  ? 191.923 122.701 140.952 1.00 33.19  ? 89  VAL A CG1 1 
ATOM 4190 C CG2 . VAL D 1 89  ? 194.305 122.812 140.143 1.00 33.19  ? 89  VAL A CG2 1 
ATOM 4191 N N   . ASN D 1 90  ? 190.838 125.370 139.428 1.00 143.46 ? 90  ASN A N   1 
ATOM 4192 C CA  . ASN D 1 90  ? 189.522 125.986 139.416 1.00 143.46 ? 90  ASN A CA  1 
ATOM 4193 C C   . ASN D 1 90  ? 189.206 126.386 137.969 1.00 143.46 ? 90  ASN A C   1 
ATOM 4194 O O   . ASN D 1 90  ? 188.239 127.105 137.714 1.00 143.46 ? 90  ASN A O   1 
ATOM 4195 C CB  . ASN D 1 90  ? 189.495 127.215 140.340 1.00 119.65 ? 90  ASN A CB  1 
ATOM 4196 C CG  . ASN D 1 90  ? 189.376 126.845 141.826 1.00 119.65 ? 90  ASN A CG  1 
ATOM 4197 O OD1 . ASN D 1 90  ? 190.015 125.898 142.306 1.00 119.65 ? 90  ASN A OD1 1 
ATOM 4198 N ND2 . ASN D 1 90  ? 188.564 127.607 142.560 1.00 119.65 ? 90  ASN A ND2 1 
ATOM 4199 N N   . THR D 1 91  ? 190.031 125.910 137.031 1.00 138.95 ? 91  THR A N   1 
ATOM 4200 C CA  . THR D 1 91  ? 189.859 126.195 135.603 1.00 138.95 ? 91  THR A CA  1 
ATOM 4201 C C   . THR D 1 91  ? 190.219 125.061 134.624 1.00 138.95 ? 91  THR A C   1 
ATOM 4202 O O   . THR D 1 91  ? 189.423 124.753 133.730 1.00 138.95 ? 91  THR A O   1 
ATOM 4203 C CB  . THR D 1 91  ? 190.645 127.478 135.185 1.00 123.68 ? 91  THR A CB  1 
ATOM 4204 O OG1 . THR D 1 91  ? 189.871 128.636 135.524 1.00 123.68 ? 91  THR A OG1 1 
ATOM 4205 C CG2 . THR D 1 91  ? 190.945 127.491 133.671 1.00 123.68 ? 91  THR A CG2 1 
ATOM 4206 N N   . ASN D 1 92  ? 191.393 124.444 134.777 1.00 92.99  ? 92  ASN A N   1 
ATOM 4207 C CA  . ASN D 1 92  ? 191.812 123.371 133.858 1.00 92.99  ? 92  ASN A CA  1 
ATOM 4208 C C   . ASN D 1 92  ? 191.349 121.959 134.252 1.00 92.99  ? 92  ASN A C   1 
ATOM 4209 O O   . ASN D 1 92  ? 191.330 121.031 133.433 1.00 92.99  ? 92  ASN A O   1 
ATOM 4210 C CB  . ASN D 1 92  ? 193.338 123.406 133.682 1.00 125.71 ? 92  ASN A CB  1 
ATOM 4211 C CG  . ASN D 1 92  ? 193.790 124.384 132.589 1.00 125.71 ? 92  ASN A CG  1 
ATOM 4212 O OD1 . ASN D 1 92  ? 194.152 123.967 131.485 1.00 125.71 ? 92  ASN A OD1 1 
ATOM 4213 N ND2 . ASN D 1 92  ? 193.765 125.686 132.894 1.00 125.71 ? 92  ASN A ND2 1 
ATOM 4214 N N   . VAL D 1 93  ? 190.973 121.813 135.515 1.00 96.43  ? 93  VAL A N   1 
ATOM 4215 C CA  . VAL D 1 93  ? 190.484 120.551 136.053 1.00 96.43  ? 93  VAL A CA  1 
ATOM 4216 C C   . VAL D 1 93  ? 188.993 120.725 136.292 1.00 96.43  ? 93  VAL A C   1 
ATOM 4217 O O   . VAL D 1 93  ? 188.230 119.760 136.331 1.00 96.43  ? 93  VAL A O   1 
ATOM 4218 C CB  . VAL D 1 93  ? 191.201 120.215 137.371 1.00 40.83  ? 93  VAL A CB  1 
ATOM 4219 C CG1 . VAL D 1 93  ? 190.324 119.347 138.260 1.00 40.83  ? 93  VAL A CG1 1 
ATOM 4220 C CG2 . VAL D 1 93  ? 192.511 119.517 137.057 1.00 40.83  ? 93  VAL A CG2 1 
ATOM 4221 N N   . GLY D 1 94  ? 188.594 121.979 136.466 1.00 117.78 ? 94  GLY A N   1 
ATOM 4222 C CA  . GLY D 1 94  ? 187.194 122.277 136.656 1.00 117.78 ? 94  GLY A CA  1 
ATOM 4223 C C   . GLY D 1 94  ? 186.532 121.660 135.449 1.00 117.78 ? 94  GLY A C   1 
ATOM 4224 O O   . GLY D 1 94  ? 185.523 120.987 135.576 1.00 117.78 ? 94  GLY A O   1 
ATOM 4225 N N   . LEU D 1 95  ? 187.111 121.882 134.271 1.00 78.69  ? 95  LEU A N   1 
ATOM 4226 C CA  . LEU D 1 95  ? 186.576 121.297 133.048 1.00 78.69  ? 95  LEU A CA  1 
ATOM 4227 C C   . LEU D 1 95  ? 186.500 119.772 133.225 1.00 78.69  ? 95  LEU A C   1 
ATOM 4228 O O   . LEU D 1 95  ? 185.418 119.223 133.419 1.00 78.69  ? 95  LEU A O   1 
ATOM 4229 C CB  . LEU D 1 95  ? 187.472 121.637 131.842 1.00 138.56 ? 95  LEU A CB  1 
ATOM 4230 C CG  . LEU D 1 95  ? 187.246 120.862 130.525 1.00 138.56 ? 95  LEU A CG  1 
ATOM 4231 C CD1 . LEU D 1 95  ? 185.847 121.144 129.999 1.00 138.56 ? 95  LEU A CD1 1 
ATOM 4232 C CD2 . LEU D 1 95  ? 188.298 121.244 129.475 1.00 138.56 ? 95  LEU A CD2 1 
ATOM 4233 N N   . LYS D 1 96  ? 187.653 119.099 133.179 1.00 100.96 ? 96  LYS A N   1 
ATOM 4234 C CA  . LYS D 1 96  ? 187.715 117.640 133.313 1.00 100.96 ? 96  LYS A CA  1 
ATOM 4235 C C   . LYS D 1 96  ? 186.769 117.080 134.373 1.00 100.96 ? 96  LYS A C   1 
ATOM 4236 O O   . LYS D 1 96  ? 186.276 115.962 134.228 1.00 100.96 ? 96  LYS A O   1 
ATOM 4237 C CB  . LYS D 1 96  ? 189.158 117.191 133.601 1.00 105.16 ? 96  LYS A CB  1 
ATOM 4238 C CG  . LYS D 1 96  ? 189.952 116.691 132.372 1.00 105.16 ? 96  LYS A CG  1 
ATOM 4239 C CD  . LYS D 1 96  ? 189.700 115.200 132.078 1.00 105.16 ? 96  LYS A CD  1 
ATOM 4240 C CE  . LYS D 1 96  ? 190.703 114.629 131.063 1.00 105.16 ? 96  LYS A CE  1 
ATOM 4241 N NZ  . LYS D 1 96  ? 190.678 113.135 131.006 1.00 105.16 ? 96  LYS A NZ  1 
ATOM 4242 N N   . PHE D 1 97  ? 186.505 117.859 135.424 1.00 53.74  ? 97  PHE A N   1 
ATOM 4243 C CA  . PHE D 1 97  ? 185.608 117.420 136.498 1.00 53.74  ? 97  PHE A CA  1 
ATOM 4244 C C   . PHE D 1 97  ? 184.162 117.904 136.403 1.00 53.74  ? 97  PHE A C   1 
ATOM 4245 O O   . PHE D 1 97  ? 183.253 117.084 136.483 1.00 53.74  ? 97  PHE A O   1 
ATOM 4246 C CB  . PHE D 1 97  ? 186.192 117.772 137.873 1.00 112.80 ? 97  PHE A CB  1 
ATOM 4247 C CG  . PHE D 1 97  ? 186.927 116.625 138.524 1.00 112.80 ? 97  PHE A CG  1 
ATOM 4248 C CD1 . PHE D 1 97  ? 187.785 115.807 137.770 1.00 112.80 ? 97  PHE A CD1 1 
ATOM 4249 C CD2 . PHE D 1 97  ? 186.774 116.360 139.884 1.00 112.80 ? 97  PHE A CD2 1 
ATOM 4250 C CE1 . PHE D 1 97  ? 188.481 114.740 138.358 1.00 112.80 ? 97  PHE A CE1 1 
ATOM 4251 C CE2 . PHE D 1 97  ? 187.465 115.297 140.485 1.00 112.80 ? 97  PHE A CE2 1 
ATOM 4252 C CZ  . PHE D 1 97  ? 188.320 114.486 139.717 1.00 112.80 ? 97  PHE A CZ  1 
ATOM 4253 N N   . ARG D 1 98  ? 183.932 119.212 136.250 1.00 90.82  ? 98  ARG A N   1 
ATOM 4254 C CA  . ARG D 1 98  ? 182.552 119.713 136.116 1.00 90.82  ? 98  ARG A CA  1 
ATOM 4255 C C   . ARG D 1 98  ? 181.969 118.871 134.984 1.00 90.82  ? 98  ARG A C   1 
ATOM 4256 O O   . ARG D 1 98  ? 180.882 118.312 135.106 1.00 90.82  ? 98  ARG A O   1 
ATOM 4257 C CB  . ARG D 1 98  ? 182.483 121.205 135.695 1.00 90.10  ? 98  ARG A CB  1 
ATOM 4258 C CG  . ARG D 1 98  ? 182.947 122.270 136.706 1.00 90.10  ? 98  ARG A CG  1 
ATOM 4259 C CD  . ARG D 1 98  ? 182.751 123.696 136.148 1.00 90.10  ? 98  ARG A CD  1 
ATOM 4260 N NE  . ARG D 1 98  ? 183.131 123.801 134.733 1.00 90.10  ? 98  ARG A NE  1 
ATOM 4261 C CZ  . ARG D 1 98  ? 183.031 124.909 133.997 1.00 90.10  ? 98  ARG A CZ  1 
ATOM 4262 N NH1 . ARG D 1 98  ? 182.566 126.030 134.541 1.00 90.10  ? 98  ARG A NH1 1 
ATOM 4263 N NH2 . ARG D 1 98  ? 183.376 124.895 132.710 1.00 90.10  ? 98  ARG A NH2 1 
ATOM 4264 N N   . GLN D 1 99  ? 182.726 118.783 133.888 1.00 98.50  ? 99  GLN A N   1 
ATOM 4265 C CA  . GLN D 1 99  ? 182.326 118.021 132.710 1.00 98.50  ? 99  GLN A CA  1 
ATOM 4266 C C   . GLN D 1 99  ? 181.665 116.762 133.180 1.00 98.50  ? 99  GLN A C   1 
ATOM 4267 O O   . GLN D 1 99  ? 180.447 116.701 133.301 1.00 98.50  ? 99  GLN A O   1 
ATOM 4268 C CB  . GLN D 1 99  ? 183.538 117.653 131.846 1.00 138.12 ? 99  GLN A CB  1 
ATOM 4269 C CG  . GLN D 1 99  ? 183.191 116.785 130.631 1.00 138.12 ? 99  GLN A CG  1 
ATOM 4270 C CD  . GLN D 1 99  ? 184.339 116.650 129.642 1.00 138.12 ? 99  GLN A CD  1 
ATOM 4271 O OE1 . GLN D 1 99  ? 185.407 116.124 129.975 1.00 138.12 ? 99  GLN A OE1 1 
ATOM 4272 N NE2 . GLN D 1 99  ? 184.121 117.127 128.414 1.00 138.12 ? 99  GLN A NE2 1 
ATOM 4273 N N   . LEU D 1 100 ? 182.484 115.757 133.448 1.00 82.68  ? 100 LEU A N   1 
ATOM 4274 C CA  . LEU D 1 100 ? 181.978 114.484 133.926 1.00 82.68  ? 100 LEU A CA  1 
ATOM 4275 C C   . LEU D 1 100 ? 180.850 114.686 134.930 1.00 82.68  ? 100 LEU A C   1 
ATOM 4276 O O   . LEU D 1 100 ? 179.676 114.562 134.605 1.00 82.68  ? 100 LEU A O   1 
ATOM 4277 C CB  . LEU D 1 100 ? 183.103 113.683 134.593 1.00 81.09  ? 100 LEU A CB  1 
ATOM 4278 C CG  . LEU D 1 100 ? 182.696 112.353 135.263 1.00 81.09  ? 100 LEU A CG  1 
ATOM 4279 C CD1 . LEU D 1 100 ? 183.864 111.375 135.269 1.00 81.09  ? 100 LEU A CD1 1 
ATOM 4280 C CD2 . LEU D 1 100 ? 182.215 112.591 136.674 1.00 81.09  ? 100 LEU A CD2 1 
ATOM 4281 N N   . LEU D 1 101 ? 181.233 115.005 136.158 1.00 63.80  ? 101 LEU A N   1 
ATOM 4282 C CA  . LEU D 1 101 ? 180.293 115.205 137.243 1.00 63.80  ? 101 LEU A CA  1 
ATOM 4283 C C   . LEU D 1 101 ? 178.880 115.455 136.736 1.00 63.80  ? 101 LEU A C   1 
ATOM 4284 O O   . LEU D 1 101 ? 178.053 114.533 136.723 1.00 63.80  ? 101 LEU A O   1 
ATOM 4285 C CB  . LEU D 1 101 ? 180.764 116.362 138.111 1.00 99.65  ? 101 LEU A CB  1 
ATOM 4286 C CG  . LEU D 1 101 ? 180.565 116.074 139.596 1.00 99.65  ? 101 LEU A CG  1 
ATOM 4287 C CD1 . LEU D 1 101 ? 181.904 116.039 140.312 1.00 99.65  ? 101 LEU A CD1 1 
ATOM 4288 C CD2 . LEU D 1 101 ? 179.657 117.132 140.191 1.00 99.65  ? 101 LEU A CD2 1 
ATOM 4289 N N   . TRP D 1 102 ? 178.611 116.687 136.304 1.00 72.06  ? 102 TRP A N   1 
ATOM 4290 C CA  . TRP D 1 102 ? 177.292 117.043 135.782 1.00 72.06  ? 102 TRP A CA  1 
ATOM 4291 C C   . TRP D 1 102 ? 176.653 115.816 135.222 1.00 72.06  ? 102 TRP A C   1 
ATOM 4292 O O   . TRP D 1 102 ? 175.723 115.248 135.785 1.00 72.06  ? 102 TRP A O   1 
ATOM 4293 C CB  . TRP D 1 102 ? 177.403 118.033 134.635 1.00 73.78  ? 102 TRP A CB  1 
ATOM 4294 C CG  . TRP D 1 102 ? 176.130 118.123 133.792 1.00 73.78  ? 102 TRP A CG  1 
ATOM 4295 C CD1 . TRP D 1 102 ? 174.953 118.748 134.126 1.00 73.78  ? 102 TRP A CD1 1 
ATOM 4296 C CD2 . TRP D 1 102 ? 175.947 117.629 132.468 1.00 73.78  ? 102 TRP A CD2 1 
ATOM 4297 N NE1 . TRP D 1 102 ? 174.055 118.684 133.083 1.00 73.78  ? 102 TRP A NE1 1 
ATOM 4298 C CE2 . TRP D 1 102 ? 174.644 118.004 132.052 1.00 73.78  ? 102 TRP A CE2 1 
ATOM 4299 C CE3 . TRP D 1 102 ? 176.756 116.911 131.589 1.00 73.78  ? 102 TRP A CE3 1 
ATOM 4300 C CZ2 . TRP D 1 102 ? 174.144 117.689 130.799 1.00 73.78  ? 102 TRP A CZ2 1 
ATOM 4301 C CZ3 . TRP D 1 102 ? 176.257 116.595 130.346 1.00 73.78  ? 102 TRP A CZ3 1 
ATOM 4302 C CH2 . TRP D 1 102 ? 174.962 116.985 129.958 1.00 73.78  ? 102 TRP A CH2 1 
ATOM 4303 N N   . PHE D 1 103 ? 177.172 115.452 134.063 1.00 78.31  ? 103 PHE A N   1 
ATOM 4304 C CA  . PHE D 1 103 ? 176.742 114.285 133.352 1.00 78.31  ? 103 PHE A CA  1 
ATOM 4305 C C   . PHE D 1 103 ? 175.933 113.407 134.282 1.00 78.31  ? 103 PHE A C   1 
ATOM 4306 O O   . PHE D 1 103 ? 174.711 113.571 134.403 1.00 78.31  ? 103 PHE A O   1 
ATOM 4307 C CB  . PHE D 1 103 ? 177.979 113.546 132.873 1.00 94.98  ? 103 PHE A CB  1 
ATOM 4308 C CG  . PHE D 1 103 ? 177.723 112.147 132.437 1.00 94.98  ? 103 PHE A CG  1 
ATOM 4309 C CD1 . PHE D 1 103 ? 177.048 111.893 131.262 1.00 94.98  ? 103 PHE A CD1 1 
ATOM 4310 C CD2 . PHE D 1 103 ? 178.187 111.077 133.191 1.00 94.98  ? 103 PHE A CD2 1 
ATOM 4311 C CE1 . PHE D 1 103 ? 176.841 110.593 130.835 1.00 94.98  ? 103 PHE A CE1 1 
ATOM 4312 C CE2 . PHE D 1 103 ? 177.982 109.770 132.771 1.00 94.98  ? 103 PHE A CE2 1 
ATOM 4313 C CZ  . PHE D 1 103 ? 177.308 109.528 131.587 1.00 94.98  ? 103 PHE A CZ  1 
ATOM 4314 N N   . HIS D 1 104 ? 176.638 112.511 134.970 1.00 71.01  ? 104 HIS A N   1 
ATOM 4315 C CA  . HIS D 1 104 ? 176.030 111.566 135.888 1.00 71.01  ? 104 HIS A CA  1 
ATOM 4316 C C   . HIS D 1 104 ? 174.724 112.046 136.449 1.00 71.01  ? 104 HIS A C   1 
ATOM 4317 O O   . HIS D 1 104 ? 173.641 111.649 136.005 1.00 71.01  ? 104 HIS A O   1 
ATOM 4318 C CB  . HIS D 1 104 ? 176.992 111.264 137.013 1.00 88.06  ? 104 HIS A CB  1 
ATOM 4319 C CG  . HIS D 1 104 ? 177.951 110.177 136.672 1.00 88.06  ? 104 HIS A CG  1 
ATOM 4320 N ND1 . HIS D 1 104 ? 177.535 108.922 136.282 1.00 88.06  ? 104 HIS A ND1 1 
ATOM 4321 C CD2 . HIS D 1 104 ? 179.302 110.156 136.628 1.00 88.06  ? 104 HIS A CD2 1 
ATOM 4322 C CE1 . HIS D 1 104 ? 178.589 108.174 136.011 1.00 88.06  ? 104 HIS A CE1 1 
ATOM 4323 N NE2 . HIS D 1 104 ? 179.674 108.898 136.213 1.00 88.06  ? 104 HIS A NE2 1 
ATOM 4324 N N   . ILE D 1 105 ? 174.850 112.901 137.443 1.00 86.41  ? 105 ILE A N   1 
ATOM 4325 C CA  . ILE D 1 105 ? 173.720 113.518 138.105 1.00 86.41  ? 105 ILE A CA  1 
ATOM 4326 C C   . ILE D 1 105 ? 172.419 113.530 137.306 1.00 86.41  ? 105 ILE A C   1 
ATOM 4327 O O   . ILE D 1 105 ? 171.367 113.060 137.749 1.00 86.41  ? 105 ILE A O   1 
ATOM 4328 C CB  . ILE D 1 105 ? 174.103 114.928 138.420 1.00 42.13  ? 105 ILE A CB  1 
ATOM 4329 C CG1 . ILE D 1 105 ? 175.301 114.891 139.375 1.00 42.13  ? 105 ILE A CG1 1 
ATOM 4330 C CG2 . ILE D 1 105 ? 172.895 115.685 138.922 1.00 42.13  ? 105 ILE A CG2 1 
ATOM 4331 C CD1 . ILE D 1 105 ? 176.271 116.026 139.204 1.00 42.13  ? 105 ILE A CD1 1 
ATOM 4332 N N   . SER D 1 106 ? 172.511 114.102 136.124 1.00 85.60  ? 106 SER A N   1 
ATOM 4333 C CA  . SER D 1 106 ? 171.388 114.204 135.229 1.00 85.60  ? 106 SER A CA  1 
ATOM 4334 C C   . SER D 1 106 ? 170.656 112.869 135.080 1.00 85.60  ? 106 SER A C   1 
ATOM 4335 O O   . SER D 1 106 ? 169.477 112.746 135.435 1.00 85.60  ? 106 SER A O   1 
ATOM 4336 C CB  . SER D 1 106 ? 171.932 114.692 133.907 1.00 53.44  ? 106 SER A CB  1 
ATOM 4337 O OG  . SER D 1 106 ? 172.954 115.639 134.185 1.00 53.44  ? 106 SER A OG  1 
ATOM 4338 N N   . ALA D 1 107 ? 171.362 111.871 134.558 1.00 101.21 ? 107 ALA A N   1 
ATOM 4339 C CA  . ALA D 1 107 ? 170.780 110.554 134.372 1.00 101.21 ? 107 ALA A CA  1 
ATOM 4340 C C   . ALA D 1 107 ? 169.990 110.205 135.622 1.00 101.21 ? 107 ALA A C   1 
ATOM 4341 O O   . ALA D 1 107 ? 168.834 109.786 135.535 1.00 101.21 ? 107 ALA A O   1 
ATOM 4342 C CB  . ALA D 1 107 ? 171.874 109.528 134.140 1.00 20.00  ? 107 ALA A CB  1 
ATOM 4343 N N   . LEU D 1 108 ? 170.612 110.407 136.785 1.00 76.02  ? 108 LEU A N   1 
ATOM 4344 C CA  . LEU D 1 108 ? 169.973 110.110 138.070 1.00 76.02  ? 108 LEU A CA  1 
ATOM 4345 C C   . LEU D 1 108 ? 168.783 111.005 138.294 1.00 76.02  ? 108 LEU A C   1 
ATOM 4346 O O   . LEU D 1 108 ? 168.464 111.376 139.428 1.00 76.02  ? 108 LEU A O   1 
ATOM 4347 C CB  . LEU D 1 108 ? 170.941 110.302 139.235 1.00 101.55 ? 108 LEU A CB  1 
ATOM 4348 C CG  . LEU D 1 108 ? 172.009 109.229 139.392 1.00 101.55 ? 108 LEU A CG  1 
ATOM 4349 C CD1 . LEU D 1 108 ? 173.134 109.494 138.408 1.00 101.55 ? 108 LEU A CD1 1 
ATOM 4350 C CD2 . LEU D 1 108 ? 172.524 109.230 140.810 1.00 101.55 ? 108 LEU A CD2 1 
ATOM 4351 N N   . THR D 1 109 ? 168.110 111.339 137.207 1.00 111.21 ? 109 THR A N   1 
ATOM 4352 C CA  . THR D 1 109 ? 166.980 112.212 137.304 1.00 111.21 ? 109 THR A CA  1 
ATOM 4353 C C   . THR D 1 109 ? 166.070 111.997 136.107 1.00 111.21 ? 109 THR A C   1 
ATOM 4354 O O   . THR D 1 109 ? 164.845 112.057 136.226 1.00 111.21 ? 109 THR A O   1 
ATOM 4355 C CB  . THR D 1 109 ? 167.456 113.675 137.313 1.00 39.25  ? 109 THR A CB  1 
ATOM 4356 O OG1 . THR D 1 109 ? 168.663 113.817 138.078 1.00 39.25  ? 109 THR A OG1 1 
ATOM 4357 C CG2 . THR D 1 109 ? 166.418 114.522 137.932 1.00 39.25  ? 109 THR A CG2 1 
ATOM 4358 N N   . PHE D 1 110 ? 166.689 111.713 134.963 1.00 109.42 ? 110 PHE A N   1 
ATOM 4359 C CA  . PHE D 1 110 ? 165.977 111.546 133.698 1.00 109.42 ? 110 PHE A CA  1 
ATOM 4360 C C   . PHE D 1 110 ? 166.141 110.181 133.074 1.00 109.42 ? 110 PHE A C   1 
ATOM 4361 O O   . PHE D 1 110 ? 165.177 109.579 132.575 1.00 109.42 ? 110 PHE A O   1 
ATOM 4362 C CB  . PHE D 1 110 ? 166.480 112.608 132.748 1.00 81.14  ? 110 PHE A CB  1 
ATOM 4363 C CG  . PHE D 1 110 ? 166.526 113.976 133.376 1.00 81.14  ? 110 PHE A CG  1 
ATOM 4364 C CD1 . PHE D 1 110 ? 165.473 114.890 133.196 1.00 81.14  ? 110 PHE A CD1 1 
ATOM 4365 C CD2 . PHE D 1 110 ? 167.609 114.347 134.175 1.00 81.14  ? 110 PHE A CD2 1 
ATOM 4366 C CE1 . PHE D 1 110 ? 165.510 116.155 133.806 1.00 81.14  ? 110 PHE A CE1 1 
ATOM 4367 C CE2 . PHE D 1 110 ? 167.653 115.602 134.784 1.00 81.14  ? 110 PHE A CE2 1 
ATOM 4368 C CZ  . PHE D 1 110 ? 166.607 116.506 134.600 1.00 81.14  ? 110 PHE A CZ  1 
ATOM 4369 N N   . GLY D 1 111 ? 167.382 109.712 133.073 1.00 60.84  ? 111 GLY A N   1 
ATOM 4370 C CA  . GLY D 1 111 ? 167.647 108.394 132.549 1.00 60.84  ? 111 GLY A CA  1 
ATOM 4371 C C   . GLY D 1 111 ? 168.830 108.337 131.634 1.00 60.84  ? 111 GLY A C   1 
ATOM 4372 O O   . GLY D 1 111 ? 169.033 109.239 130.828 1.00 60.84  ? 111 GLY A O   1 
ATOM 4373 N N   . ARG D 1 112 ? 169.611 107.273 131.777 1.00 50.05  ? 112 ARG A N   1 
ATOM 4374 C CA  . ARG D 1 112 ? 170.780 107.054 130.933 1.00 50.05  ? 112 ARG A CA  1 
ATOM 4375 C C   . ARG D 1 112 ? 170.301 107.298 129.488 1.00 50.05  ? 112 ARG A C   1 
ATOM 4376 O O   . ARG D 1 112 ? 170.673 108.292 128.851 1.00 50.05  ? 112 ARG A O   1 
ATOM 4377 C CB  . ARG D 1 112 ? 171.276 105.602 131.107 1.00 109.30 ? 112 ARG A CB  1 
ATOM 4378 C CG  . ARG D 1 112 ? 172.611 105.267 130.433 1.00 109.30 ? 112 ARG A CG  1 
ATOM 4379 C CD  . ARG D 1 112 ? 172.989 103.789 130.586 1.00 109.30 ? 112 ARG A CD  1 
ATOM 4380 N NE  . ARG D 1 112 ? 172.974 103.343 131.983 1.00 109.30 ? 112 ARG A NE  1 
ATOM 4381 C CZ  . ARG D 1 112 ? 173.540 102.219 132.429 1.00 109.30 ? 112 ARG A CZ  1 
ATOM 4382 N NH1 . ARG D 1 112 ? 174.179 101.410 131.586 1.00 109.30 ? 112 ARG A NH1 1 
ATOM 4383 N NH2 . ARG D 1 112 ? 173.472 101.901 133.724 1.00 109.30 ? 112 ARG A NH2 1 
ATOM 4384 N N   . GLU D 1 113 ? 169.449 106.399 128.989 1.00 116.20 ? 113 GLU A N   1 
ATOM 4385 C CA  . GLU D 1 113 ? 168.928 106.527 127.631 1.00 116.20 ? 113 GLU A CA  1 
ATOM 4386 C C   . GLU D 1 113 ? 168.349 107.920 127.387 1.00 116.20 ? 113 GLU A C   1 
ATOM 4387 O O   . GLU D 1 113 ? 168.597 108.514 126.342 1.00 116.20 ? 113 GLU A O   1 
ATOM 4388 C CB  . GLU D 1 113 ? 167.868 105.451 127.349 1.00 115.44 ? 113 GLU A CB  1 
ATOM 4389 C CG  . GLU D 1 113 ? 168.440 104.067 126.972 1.00 115.44 ? 113 GLU A CG  1 
ATOM 4390 C CD  . GLU D 1 113 ? 169.349 104.082 125.722 1.00 115.44 ? 113 GLU A CD  1 
ATOM 4391 O OE1 . GLU D 1 113 ? 168.944 104.640 124.670 1.00 115.44 ? 113 GLU A OE1 1 
ATOM 4392 O OE2 . GLU D 1 113 ? 170.468 103.516 125.795 1.00 115.44 ? 113 GLU A OE2 1 
ATOM 4393 N N   . THR D 1 114 ? 167.596 108.442 128.357 1.00 55.90  ? 114 THR A N   1 
ATOM 4394 C CA  . THR D 1 114 ? 166.978 109.776 128.248 1.00 55.90  ? 114 THR A CA  1 
ATOM 4395 C C   . THR D 1 114 ? 168.040 110.849 128.107 1.00 55.90  ? 114 THR A C   1 
ATOM 4396 O O   . THR D 1 114 ? 167.773 111.922 127.575 1.00 55.90  ? 114 THR A O   1 
ATOM 4397 C CB  . THR D 1 114 ? 166.075 110.119 129.497 1.00 82.75  ? 114 THR A CB  1 
ATOM 4398 O OG1 . THR D 1 114 ? 164.851 109.363 129.445 1.00 82.75  ? 114 THR A OG1 1 
ATOM 4399 C CG2 . THR D 1 114 ? 165.740 111.607 129.539 1.00 82.75  ? 114 THR A CG2 1 
ATOM 4400 N N   . VAL D 1 115 ? 169.248 110.553 128.578 1.00 56.83  ? 115 VAL A N   1 
ATOM 4401 C CA  . VAL D 1 115 ? 170.344 111.521 128.497 1.00 56.83  ? 115 VAL A CA  1 
ATOM 4402 C C   . VAL D 1 115 ? 171.093 111.470 127.195 1.00 56.83  ? 115 VAL A C   1 
ATOM 4403 O O   . VAL D 1 115 ? 171.225 112.489 126.529 1.00 56.83  ? 115 VAL A O   1 
ATOM 4404 C CB  . VAL D 1 115 ? 171.403 111.327 129.569 1.00 46.17  ? 115 VAL A CB  1 
ATOM 4405 C CG1 . VAL D 1 115 ? 172.545 112.304 129.308 1.00 46.17  ? 115 VAL A CG1 1 
ATOM 4406 C CG2 . VAL D 1 115 ? 170.799 111.536 130.960 1.00 46.17  ? 115 VAL A CG2 1 
ATOM 4407 N N   . LEU D 1 116 ? 171.639 110.298 126.874 1.00 44.21  ? 116 LEU A N   1 
ATOM 4408 C CA  . LEU D 1 116 ? 172.347 110.121 125.613 1.00 44.21  ? 116 LEU A CA  1 
ATOM 4409 C C   . LEU D 1 116 ? 171.469 110.838 124.580 1.00 44.21  ? 116 LEU A C   1 
ATOM 4410 O O   . LEU D 1 116 ? 171.957 111.641 123.784 1.00 44.21  ? 116 LEU A O   1 
ATOM 4411 C CB  . LEU D 1 116 ? 172.424 108.636 125.245 1.00 115.67 ? 116 LEU A CB  1 
ATOM 4412 C CG  . LEU D 1 116 ? 172.876 107.616 126.290 1.00 115.67 ? 116 LEU A CG  1 
ATOM 4413 C CD1 . LEU D 1 116 ? 172.921 106.214 125.662 1.00 115.67 ? 116 LEU A CD1 1 
ATOM 4414 C CD2 . LEU D 1 116 ? 174.239 108.004 126.816 1.00 115.67 ? 116 LEU A CD2 1 
ATOM 4415 N N   . GLU D 1 117 ? 170.165 110.541 124.645 1.00 114.14 ? 117 GLU A N   1 
ATOM 4416 C CA  . GLU D 1 117 ? 169.153 111.111 123.759 1.00 114.14 ? 117 GLU A CA  1 
ATOM 4417 C C   . GLU D 1 117 ? 169.123 112.634 123.847 1.00 114.14 ? 117 GLU A C   1 
ATOM 4418 O O   . GLU D 1 117 ? 168.354 113.278 123.134 1.00 114.14 ? 117 GLU A O   1 
ATOM 4419 C CB  . GLU D 1 117 ? 167.763 110.508 124.066 1.00 114.26 ? 117 GLU A CB  1 
ATOM 4420 C CG  . GLU D 1 117 ? 167.299 109.440 123.046 1.00 114.26 ? 117 GLU A CG  1 
ATOM 4421 C CD  . GLU D 1 117 ? 166.113 108.580 123.516 1.00 114.26 ? 117 GLU A CD  1 
ATOM 4422 O OE1 . GLU D 1 117 ? 165.095 109.139 123.997 1.00 114.26 ? 117 GLU A OE1 1 
ATOM 4423 O OE2 . GLU D 1 117 ? 166.203 107.334 123.382 1.00 114.26 ? 117 GLU A OE2 1 
ATOM 4424 N N   . TYR D 1 118 ? 169.954 113.198 124.729 1.00 50.54  ? 118 TYR A N   1 
ATOM 4425 C CA  . TYR D 1 118 ? 170.100 114.655 124.879 1.00 50.54  ? 118 TYR A CA  1 
ATOM 4426 C C   . TYR D 1 118 ? 171.258 115.075 123.963 1.00 50.54  ? 118 TYR A C   1 
ATOM 4427 O O   . TYR D 1 118 ? 171.055 115.389 122.783 1.00 50.54  ? 118 TYR A O   1 
ATOM 4428 C CB  . TYR D 1 118 ? 170.456 115.057 126.323 1.00 79.66  ? 118 TYR A CB  1 
ATOM 4429 C CG  . TYR D 1 118 ? 170.560 116.581 126.586 1.00 79.66  ? 118 TYR A CG  1 
ATOM 4430 C CD1 . TYR D 1 118 ? 171.646 117.351 126.145 1.00 79.66  ? 118 TYR A CD1 1 
ATOM 4431 C CD2 . TYR D 1 118 ? 169.568 117.248 127.305 1.00 79.66  ? 118 TYR A CD2 1 
ATOM 4432 C CE1 . TYR D 1 118 ? 171.723 118.764 126.432 1.00 79.66  ? 118 TYR A CE1 1 
ATOM 4433 C CE2 . TYR D 1 118 ? 169.639 118.648 127.591 1.00 79.66  ? 118 TYR A CE2 1 
ATOM 4434 C CZ  . TYR D 1 118 ? 170.709 119.397 127.159 1.00 79.66  ? 118 TYR A CZ  1 
ATOM 4435 O OH  . TYR D 1 118 ? 170.742 120.752 127.478 1.00 79.66  ? 118 TYR A OH  1 
ATOM 4436 N N   . LEU D 1 119 ? 172.462 115.085 124.533 1.00 74.04  ? 119 LEU A N   1 
ATOM 4437 C CA  . LEU D 1 119 ? 173.689 115.429 123.822 1.00 74.04  ? 119 LEU A CA  1 
ATOM 4438 C C   . LEU D 1 119 ? 173.357 115.598 122.386 1.00 74.04  ? 119 LEU A C   1 
ATOM 4439 O O   . LEU D 1 119 ? 173.058 116.689 121.907 1.00 74.04  ? 119 LEU A O   1 
ATOM 4440 C CB  . LEU D 1 119 ? 174.661 114.289 123.937 1.00 57.15  ? 119 LEU A CB  1 
ATOM 4441 C CG  . LEU D 1 119 ? 174.871 114.021 125.410 1.00 57.15  ? 119 LEU A CG  1 
ATOM 4442 C CD1 . LEU D 1 119 ? 173.700 113.266 126.015 1.00 57.15  ? 119 LEU A CD1 1 
ATOM 4443 C CD2 . LEU D 1 119 ? 176.125 113.225 125.539 1.00 57.15  ? 119 LEU A CD2 1 
ATOM 4444 N N   . VAL D 1 120 ? 173.444 114.475 121.706 1.00 86.99  ? 120 VAL A N   1 
ATOM 4445 C CA  . VAL D 1 120 ? 173.072 114.369 120.321 1.00 86.99  ? 120 VAL A CA  1 
ATOM 4446 C C   . VAL D 1 120 ? 172.489 115.666 119.780 1.00 86.99  ? 120 VAL A C   1 
ATOM 4447 O O   . VAL D 1 120 ? 173.163 116.487 119.143 1.00 86.99  ? 120 VAL A O   1 
ATOM 4448 C CB  . VAL D 1 120 ? 171.969 113.356 120.237 1.00 28.25  ? 120 VAL A CB  1 
ATOM 4449 C CG1 . VAL D 1 120 ? 171.948 112.728 118.889 1.00 28.25  ? 120 VAL A CG1 1 
ATOM 4450 C CG2 . VAL D 1 120 ? 172.122 112.366 121.364 1.00 28.25  ? 120 VAL A CG2 1 
ATOM 4451 N N   . SER D 1 121 ? 171.190 115.782 120.051 1.00 153.69 ? 121 SER A N   1 
ATOM 4452 C CA  . SER D 1 121 ? 170.331 116.892 119.676 1.00 153.69 ? 121 SER A CA  1 
ATOM 4453 C C   . SER D 1 121 ? 171.092 118.195 119.807 1.00 153.69 ? 121 SER A C   1 
ATOM 4454 O O   . SER D 1 121 ? 171.364 118.887 118.823 1.00 153.69 ? 121 SER A O   1 
ATOM 4455 C CB  . SER D 1 121 ? 169.114 116.898 120.606 1.00 54.97  ? 121 SER A CB  1 
ATOM 4456 O OG  . SER D 1 121 ? 168.620 115.578 120.821 1.00 54.97  ? 121 SER A OG  1 
ATOM 4457 N N   . PHE D 1 122 ? 171.420 118.515 121.050 1.00 95.60  ? 122 PHE A N   1 
ATOM 4458 C CA  . PHE D 1 122 ? 172.173 119.708 121.381 1.00 95.60  ? 122 PHE A CA  1 
ATOM 4459 C C   . PHE D 1 122 ? 173.349 119.827 120.419 1.00 95.60  ? 122 PHE A C   1 
ATOM 4460 O O   . PHE D 1 122 ? 173.643 120.908 119.901 1.00 95.60  ? 122 PHE A O   1 
ATOM 4461 C CB  . PHE D 1 122 ? 172.662 119.593 122.824 1.00 145.33 ? 122 PHE A CB  1 
ATOM 4462 C CG  . PHE D 1 122 ? 173.536 120.719 123.261 1.00 145.33 ? 122 PHE A CG  1 
ATOM 4463 C CD1 . PHE D 1 122 ? 174.853 120.807 122.824 1.00 145.33 ? 122 PHE A CD1 1 
ATOM 4464 C CD2 . PHE D 1 122 ? 173.038 121.704 124.103 1.00 145.33 ? 122 PHE A CD2 1 
ATOM 4465 C CE1 . PHE D 1 122 ? 175.663 121.861 123.219 1.00 145.33 ? 122 PHE A CE1 1 
ATOM 4466 C CE2 . PHE D 1 122 ? 173.835 122.763 124.505 1.00 145.33 ? 122 PHE A CE2 1 
ATOM 4467 C CZ  . PHE D 1 122 ? 175.152 122.845 124.063 1.00 145.33 ? 122 PHE A CZ  1 
ATOM 4468 N N   . GLY D 1 123 ? 174.014 118.700 120.187 1.00 131.69 ? 123 GLY A N   1 
ATOM 4469 C CA  . GLY D 1 123 ? 175.148 118.675 119.285 1.00 131.69 ? 123 GLY A CA  1 
ATOM 4470 C C   . GLY D 1 123 ? 174.817 119.430 118.020 1.00 131.69 ? 123 GLY A C   1 
ATOM 4471 O O   . GLY D 1 123 ? 175.623 120.206 117.510 1.00 131.69 ? 123 GLY A O   1 
ATOM 4472 N N   . VAL D 1 124 ? 173.612 119.209 117.517 1.00 96.81  ? 124 VAL A N   1 
ATOM 4473 C CA  . VAL D 1 124 ? 173.182 119.891 116.319 1.00 96.81  ? 124 VAL A CA  1 
ATOM 4474 C C   . VAL D 1 124 ? 173.040 121.378 116.585 1.00 96.81  ? 124 VAL A C   1 
ATOM 4475 O O   . VAL D 1 124 ? 173.706 122.198 115.948 1.00 96.81  ? 124 VAL A O   1 
ATOM 4476 C CB  . VAL D 1 124 ? 171.855 119.340 115.851 1.00 102.54 ? 124 VAL A CB  1 
ATOM 4477 C CG1 . VAL D 1 124 ? 171.386 120.100 114.614 1.00 102.54 ? 124 VAL A CG1 1 
ATOM 4478 C CG2 . VAL D 1 124 ? 172.014 117.866 115.559 1.00 102.54 ? 124 VAL A CG2 1 
ATOM 4479 N N   . TRP D 1 125 ? 172.176 121.703 117.542 1.00 93.47  ? 125 TRP A N   1 
ATOM 4480 C CA  . TRP D 1 125 ? 171.901 123.082 117.931 1.00 93.47  ? 125 TRP A CA  1 
ATOM 4481 C C   . TRP D 1 125 ? 173.142 123.964 117.857 1.00 93.47  ? 125 TRP A C   1 
ATOM 4482 O O   . TRP D 1 125 ? 173.137 125.008 117.195 1.00 93.47  ? 125 TRP A O   1 
ATOM 4483 C CB  . TRP D 1 125 ? 171.331 123.134 119.355 1.00 114.28 ? 125 TRP A CB  1 
ATOM 4484 C CG  . TRP D 1 125 ? 170.810 124.489 119.745 1.00 114.28 ? 125 TRP A CG  1 
ATOM 4485 C CD1 . TRP D 1 125 ? 169.557 124.992 119.519 1.00 114.28 ? 125 TRP A CD1 1 
ATOM 4486 C CD2 . TRP D 1 125 ? 171.549 125.526 120.379 1.00 114.28 ? 125 TRP A CD2 1 
ATOM 4487 N NE1 . TRP D 1 125 ? 169.475 126.283 119.972 1.00 114.28 ? 125 TRP A NE1 1 
ATOM 4488 C CE2 . TRP D 1 125 ? 170.687 126.637 120.504 1.00 114.28 ? 125 TRP A CE2 1 
ATOM 4489 C CE3 . TRP D 1 125 ? 172.861 125.626 120.851 1.00 114.28 ? 125 TRP A CE3 1 
ATOM 4490 C CZ2 . TRP D 1 125 ? 171.097 127.837 121.083 1.00 114.28 ? 125 TRP A CZ2 1 
ATOM 4491 C CZ3 . TRP D 1 125 ? 173.269 126.813 121.424 1.00 114.28 ? 125 TRP A CZ3 1 
ATOM 4492 C CH2 . TRP D 1 125 ? 172.389 127.907 121.535 1.00 114.28 ? 125 TRP A CH2 1 
ATOM 4493 N N   . ILE D 1 126 ? 174.206 123.545 118.535 1.00 109.73 ? 126 ILE A N   1 
ATOM 4494 C CA  . ILE D 1 126 ? 175.445 124.314 118.539 1.00 109.73 ? 126 ILE A CA  1 
ATOM 4495 C C   . ILE D 1 126 ? 176.058 124.495 117.142 1.00 109.73 ? 126 ILE A C   1 
ATOM 4496 O O   . ILE D 1 126 ? 176.180 125.618 116.648 1.00 109.73 ? 126 ILE A O   1 
ATOM 4497 C CB  . ILE D 1 126 ? 176.486 123.666 119.478 1.00 104.03 ? 126 ILE A CB  1 
ATOM 4498 C CG1 . ILE D 1 126 ? 177.808 124.449 119.423 1.00 104.03 ? 126 ILE A CG1 1 
ATOM 4499 C CG2 . ILE D 1 126 ? 176.697 122.225 119.085 1.00 104.03 ? 126 ILE A CG2 1 
ATOM 4500 C CD1 . ILE D 1 126 ? 178.900 123.982 120.411 1.00 104.03 ? 126 ILE A CD1 1 
ATOM 4501 N N   . ARG D 1 127 ? 176.447 123.393 116.512 1.00 79.87  ? 127 ARG A N   1 
ATOM 4502 C CA  . ARG D 1 127 ? 177.047 123.432 115.180 1.00 79.87  ? 127 ARG A CA  1 
ATOM 4503 C C   . ARG D 1 127 ? 175.972 123.621 114.121 1.00 79.87  ? 127 ARG A C   1 
ATOM 4504 O O   . ARG D 1 127 ? 175.764 122.770 113.259 1.00 79.87  ? 127 ARG A O   1 
ATOM 4505 C CB  . ARG D 1 127 ? 177.782 122.134 114.941 1.00 115.77 ? 127 ARG A CB  1 
ATOM 4506 C CG  . ARG D 1 127 ? 176.856 120.985 115.186 1.00 115.77 ? 127 ARG A CG  1 
ATOM 4507 C CD  . ARG D 1 127 ? 177.527 119.636 115.221 1.00 115.77 ? 127 ARG A CD  1 
ATOM 4508 N NE  . ARG D 1 127 ? 176.519 118.650 115.598 1.00 115.77 ? 127 ARG A NE  1 
ATOM 4509 C CZ  . ARG D 1 127 ? 176.466 117.398 115.153 1.00 115.77 ? 127 ARG A CZ  1 
ATOM 4510 N NH1 . ARG D 1 127 ? 177.375 116.935 114.301 1.00 115.77 ? 127 ARG A NH1 1 
ATOM 4511 N NH2 . ARG D 1 127 ? 175.469 116.614 115.535 1.00 115.77 ? 127 ARG A NH2 1 
ATOM 4512 N N   . THR D 1 128 ? 175.277 124.749 114.213 1.00 92.85  ? 128 THR A N   1 
ATOM 4513 C CA  . THR D 1 128 ? 174.199 125.112 113.281 1.00 92.85  ? 128 THR A CA  1 
ATOM 4514 C C   . THR D 1 128 ? 174.310 126.631 113.105 1.00 92.85  ? 128 THR A C   1 
ATOM 4515 O O   . THR D 1 128 ? 174.078 127.393 114.059 1.00 92.85  ? 128 THR A O   1 
ATOM 4516 C CB  . THR D 1 128 ? 172.803 124.746 113.860 1.00 51.40  ? 128 THR A CB  1 
ATOM 4517 O OG1 . THR D 1 128 ? 172.578 123.335 113.714 1.00 51.40  ? 128 THR A OG1 1 
ATOM 4518 C CG2 . THR D 1 128 ? 171.703 125.535 113.183 1.00 51.40  ? 128 THR A CG2 1 
ATOM 4519 N N   . PRO D 1 129 ? 174.720 127.085 111.896 1.00 76.65  ? 129 PRO A N   1 
ATOM 4520 C CA  . PRO D 1 129 ? 174.823 128.531 111.694 1.00 76.65  ? 129 PRO A CA  1 
ATOM 4521 C C   . PRO D 1 129 ? 174.019 129.443 112.631 1.00 76.65  ? 129 PRO A C   1 
ATOM 4522 O O   . PRO D 1 129 ? 172.775 129.326 112.805 1.00 76.65  ? 129 PRO A O   1 
ATOM 4523 C CB  . PRO D 1 129 ? 174.425 128.662 110.255 1.00 117.77 ? 129 PRO A CB  1 
ATOM 4524 C CG  . PRO D 1 129 ? 175.406 127.517 109.644 1.00 117.77 ? 129 PRO A CG  1 
ATOM 4525 C CD  . PRO D 1 129 ? 175.178 126.359 110.681 1.00 117.77 ? 129 PRO A CD  1 
ATOM 4526 N N   . PRO D 1 130 ? 174.735 130.405 113.217 1.00 77.38  ? 130 PRO A N   1 
ATOM 4527 C CA  . PRO D 1 130 ? 174.227 131.396 114.157 1.00 77.38  ? 130 PRO A CA  1 
ATOM 4528 C C   . PRO D 1 130 ? 172.886 131.948 113.718 1.00 77.38  ? 130 PRO A C   1 
ATOM 4529 O O   . PRO D 1 130 ? 171.996 132.174 114.549 1.00 77.38  ? 130 PRO A O   1 
ATOM 4530 C CB  . PRO D 1 130 ? 175.339 132.444 114.180 1.00 92.36  ? 130 PRO A CB  1 
ATOM 4531 C CG  . PRO D 1 130 ? 176.597 131.634 113.925 1.00 92.36  ? 130 PRO A CG  1 
ATOM 4532 C CD  . PRO D 1 130 ? 176.123 130.708 112.817 1.00 92.36  ? 130 PRO A CD  1 
ATOM 4533 N N   . ALA D 1 131 ? 172.754 132.142 112.409 1.00 99.43  ? 131 ALA A N   1 
ATOM 4534 C CA  . ALA D 1 131 ? 171.548 132.689 111.824 1.00 99.43  ? 131 ALA A CA  1 
ATOM 4535 C C   . ALA D 1 131 ? 170.361 131.745 112.021 1.00 99.43  ? 131 ALA A C   1 
ATOM 4536 O O   . ALA D 1 131 ? 169.203 132.179 111.962 1.00 99.43  ? 131 ALA A O   1 
ATOM 4537 C CB  . ALA D 1 131 ? 171.786 132.955 110.347 1.00 21.33  ? 131 ALA A CB  1 
ATOM 4538 N N   . TYR D 1 132 ? 170.651 130.466 112.279 1.00 61.65  ? 132 TYR A N   1 
ATOM 4539 C CA  . TYR D 1 132 ? 169.604 129.457 112.466 1.00 61.65  ? 132 TYR A CA  1 
ATOM 4540 C C   . TYR D 1 132 ? 169.536 128.729 113.828 1.00 61.65  ? 132 TYR A C   1 
ATOM 4541 O O   . TYR D 1 132 ? 168.704 127.843 114.009 1.00 61.65  ? 132 TYR A O   1 
ATOM 4542 C CB  . TYR D 1 132 ? 169.690 128.431 111.335 1.00 82.41  ? 132 TYR A CB  1 
ATOM 4543 C CG  . TYR D 1 132 ? 169.742 129.048 109.950 1.00 82.41  ? 132 TYR A CG  1 
ATOM 4544 C CD1 . TYR D 1 132 ? 168.892 130.097 109.599 1.00 82.41  ? 132 TYR A CD1 1 
ATOM 4545 C CD2 . TYR D 1 132 ? 170.649 128.587 108.989 1.00 82.41  ? 132 TYR A CD2 1 
ATOM 4546 C CE1 . TYR D 1 132 ? 168.944 130.683 108.322 1.00 82.41  ? 132 TYR A CE1 1 
ATOM 4547 C CE2 . TYR D 1 132 ? 170.711 129.160 107.705 1.00 82.41  ? 132 TYR A CE2 1 
ATOM 4548 C CZ  . TYR D 1 132 ? 169.858 130.213 107.379 1.00 82.41  ? 132 TYR A CZ  1 
ATOM 4549 O OH  . TYR D 1 132 ? 169.945 130.820 106.136 1.00 82.41  ? 132 TYR A OH  1 
ATOM 4550 N N   . ARG D 1 133 ? 170.406 129.081 114.775 1.00 100.50 ? 133 ARG A N   1 
ATOM 4551 C CA  . ARG D 1 133 ? 170.348 128.466 116.102 1.00 100.50 ? 133 ARG A CA  1 
ATOM 4552 C C   . ARG D 1 133 ? 169.218 129.198 116.805 1.00 100.50 ? 133 ARG A C   1 
ATOM 4553 O O   . ARG D 1 133 ? 169.349 130.389 117.104 1.00 100.50 ? 133 ARG A O   1 
ATOM 4554 C CB  . ARG D 1 133 ? 171.602 128.734 116.937 1.00 93.33  ? 133 ARG A CB  1 
ATOM 4555 C CG  . ARG D 1 133 ? 172.924 128.265 116.404 1.00 93.33  ? 133 ARG A CG  1 
ATOM 4556 C CD  . ARG D 1 133 ? 174.011 128.766 117.352 1.00 93.33  ? 133 ARG A CD  1 
ATOM 4557 N NE  . ARG D 1 133 ? 175.360 128.635 116.807 1.00 93.33  ? 133 ARG A NE  1 
ATOM 4558 C CZ  . ARG D 1 133 ? 176.443 129.217 117.327 1.00 93.33  ? 133 ARG A CZ  1 
ATOM 4559 N NH1 . ARG D 1 133 ? 176.336 129.976 118.415 1.00 93.33  ? 133 ARG A NH1 1 
ATOM 4560 N NH2 . ARG D 1 133 ? 177.636 129.047 116.757 1.00 93.33  ? 133 ARG A NH2 1 
ATOM 4561 N N   . PRO D 1 134 ? 168.089 128.521 117.061 1.00 80.11  ? 134 PRO A N   1 
ATOM 4562 C CA  . PRO D 1 134 ? 166.971 129.177 117.744 1.00 80.11  ? 134 PRO A CA  1 
ATOM 4563 C C   . PRO D 1 134 ? 167.477 129.630 119.099 1.00 80.11  ? 134 PRO A C   1 
ATOM 4564 O O   . PRO D 1 134 ? 167.948 128.813 119.886 1.00 80.11  ? 134 PRO A O   1 
ATOM 4565 C CB  . PRO D 1 134 ? 165.944 128.064 117.865 1.00 94.13  ? 134 PRO A CB  1 
ATOM 4566 C CG  . PRO D 1 134 ? 166.177 127.295 116.625 1.00 94.13  ? 134 PRO A CG  1 
ATOM 4567 C CD  . PRO D 1 134 ? 167.687 127.197 116.576 1.00 94.13  ? 134 PRO A CD  1 
ATOM 4568 N N   . PRO D 1 135 ? 167.382 130.937 119.392 1.00 122.13 ? 135 PRO A N   1 
ATOM 4569 C CA  . PRO D 1 135 ? 167.850 131.485 120.674 1.00 122.13 ? 135 PRO A CA  1 
ATOM 4570 C C   . PRO D 1 135 ? 167.548 130.591 121.875 1.00 122.13 ? 135 PRO A C   1 
ATOM 4571 O O   . PRO D 1 135 ? 168.224 130.671 122.914 1.00 122.13 ? 135 PRO A O   1 
ATOM 4572 C CB  . PRO D 1 135 ? 167.158 132.853 120.745 1.00 113.91 ? 135 PRO A CB  1 
ATOM 4573 C CG  . PRO D 1 135 ? 165.955 132.694 119.840 1.00 113.91 ? 135 PRO A CG  1 
ATOM 4574 C CD  . PRO D 1 135 ? 166.522 131.907 118.692 1.00 113.91 ? 135 PRO A CD  1 
ATOM 4575 N N   . ASN D 1 136 ? 166.533 129.740 121.715 1.00 93.14  ? 136 ASN A N   1 
ATOM 4576 C CA  . ASN D 1 136 ? 166.130 128.801 122.757 1.00 93.14  ? 136 ASN A CA  1 
ATOM 4577 C C   . ASN D 1 136 ? 166.867 127.484 122.638 1.00 93.14  ? 136 ASN A C   1 
ATOM 4578 O O   . ASN D 1 136 ? 166.419 126.566 121.942 1.00 93.14  ? 136 ASN A O   1 
ATOM 4579 C CB  . ASN D 1 136 ? 164.627 128.513 122.712 1.00 133.80 ? 136 ASN A CB  1 
ATOM 4580 C CG  . ASN D 1 136 ? 163.823 129.483 123.551 1.00 133.80 ? 136 ASN A CG  1 
ATOM 4581 O OD1 . ASN D 1 136 ? 164.240 129.888 124.641 1.00 133.80 ? 136 ASN A OD1 1 
ATOM 4582 N ND2 . ASN D 1 136 ? 162.650 129.847 123.055 1.00 133.80 ? 136 ASN A ND2 1 
ATOM 4583 N N   . ALA D 1 137 ? 168.000 127.407 123.328 1.00 115.12 ? 137 ALA A N   1 
ATOM 4584 C CA  . ALA D 1 137 ? 168.817 126.206 123.349 1.00 115.12 ? 137 ALA A CA  1 
ATOM 4585 C C   . ALA D 1 137 ? 167.947 125.056 123.855 1.00 115.12 ? 137 ALA A C   1 
ATOM 4586 O O   . ALA D 1 137 ? 166.804 125.266 124.269 1.00 115.12 ? 137 ALA A O   1 
ATOM 4587 C CB  . ALA D 1 137 ? 169.999 126.409 124.267 1.00 38.00  ? 137 ALA A CB  1 
ATOM 4588 N N   . PRO D 1 138 ? 168.475 123.822 123.833 1.00 59.51  ? 138 PRO A N   1 
ATOM 4589 C CA  . PRO D 1 138 ? 167.692 122.673 124.299 1.00 59.51  ? 138 PRO A CA  1 
ATOM 4590 C C   . PRO D 1 138 ? 168.020 122.313 125.729 1.00 59.51  ? 138 PRO A C   1 
ATOM 4591 O O   . PRO D 1 138 ? 169.192 122.350 126.127 1.00 59.51  ? 138 PRO A O   1 
ATOM 4592 C CB  . PRO D 1 138 ? 168.109 121.585 123.335 1.00 73.50  ? 138 PRO A CB  1 
ATOM 4593 C CG  . PRO D 1 138 ? 169.581 121.856 123.223 1.00 73.50  ? 138 PRO A CG  1 
ATOM 4594 C CD  . PRO D 1 138 ? 169.665 123.372 123.091 1.00 73.50  ? 138 PRO A CD  1 
ATOM 4595 N N   . ILE D 1 139 ? 167.002 121.958 126.507 1.00 76.97  ? 139 ILE A N   1 
ATOM 4596 C CA  . ILE D 1 139 ? 167.284 121.604 127.885 1.00 76.97  ? 139 ILE A CA  1 
ATOM 4597 C C   . ILE D 1 139 ? 166.597 120.384 128.408 1.00 76.97  ? 139 ILE A C   1 
ATOM 4598 O O   . ILE D 1 139 ? 165.923 119.669 127.673 1.00 76.97  ? 139 ILE A O   1 
ATOM 4599 C CB  . ILE D 1 139 ? 167.003 122.734 128.838 1.00 112.64 ? 139 ILE A CB  1 
ATOM 4600 C CG1 . ILE D 1 139 ? 167.680 123.985 128.309 1.00 112.64 ? 139 ILE A CG1 1 
ATOM 4601 C CG2 . ILE D 1 139 ? 167.613 122.426 130.238 1.00 112.64 ? 139 ILE A CG2 1 
ATOM 4602 C CD1 . ILE D 1 139 ? 167.714 125.117 129.311 1.00 112.64 ? 139 ILE A CD1 1 
ATOM 4603 N N   . LEU D 1 140 ? 166.746 120.189 129.710 1.00 74.76  ? 140 LEU A N   1 
ATOM 4604 C CA  . LEU D 1 140 ? 166.277 119.017 130.399 1.00 74.76  ? 140 LEU A CA  1 
ATOM 4605 C C   . LEU D 1 140 ? 165.026 119.008 131.247 1.00 74.76  ? 140 LEU A C   1 
ATOM 4606 O O   . LEU D 1 140 ? 165.020 118.358 132.281 1.00 74.76  ? 140 LEU A O   1 
ATOM 4607 C CB  . LEU D 1 140 ? 167.413 118.531 131.274 1.00 61.97  ? 140 LEU A CB  1 
ATOM 4608 C CG  . LEU D 1 140 ? 168.603 117.960 130.535 1.00 61.97  ? 140 LEU A CG  1 
ATOM 4609 C CD1 . LEU D 1 140 ? 169.770 117.758 131.477 1.00 61.97  ? 140 LEU A CD1 1 
ATOM 4610 C CD2 . LEU D 1 140 ? 168.183 116.639 129.939 1.00 61.97  ? 140 LEU A CD2 1 
ATOM 4611 N N   . SER D 1 141 ? 163.939 119.637 130.837 1.00 117.60 ? 141 SER A N   1 
ATOM 4612 C CA  . SER D 1 141 ? 162.781 119.579 131.729 1.00 117.60 ? 141 SER A CA  1 
ATOM 4613 C C   . SER D 1 141 ? 162.329 118.133 131.986 1.00 117.60 ? 141 SER A C   1 
ATOM 4614 O O   . SER D 1 141 ? 162.501 117.262 131.137 1.00 117.60 ? 141 SER A O   1 
ATOM 4615 C CB  . SER D 1 141 ? 161.613 120.393 131.160 1.00 123.69 ? 141 SER A CB  1 
ATOM 4616 O OG  . SER D 1 141 ? 160.474 120.280 131.994 1.00 123.69 ? 141 SER A OG  1 
ATOM 4617 N N   . THR D 1 142 ? 161.787 117.866 133.173 1.00 132.63 ? 142 THR A N   1 
ATOM 4618 C CA  . THR D 1 142 ? 161.271 116.539 133.468 1.00 132.63 ? 142 THR A CA  1 
ATOM 4619 C C   . THR D 1 142 ? 160.058 116.583 132.569 1.00 132.63 ? 142 THR A C   1 
ATOM 4620 O O   . THR D 1 142 ? 159.669 117.660 132.122 1.00 132.63 ? 142 THR A O   1 
ATOM 4621 C CB  . THR D 1 142 ? 160.773 116.409 134.914 1.00 107.29 ? 142 THR A CB  1 
ATOM 4622 O OG1 . THR D 1 142 ? 161.888 116.310 135.797 1.00 107.29 ? 142 THR A OG1 1 
ATOM 4623 C CG2 . THR D 1 142 ? 159.906 115.188 135.082 1.00 107.29 ? 142 THR A CG2 1 
ATOM 4624 N N   . LEU D 1 143 ? 159.458 115.428 132.313 1.00 200.00 ? 143 LEU A N   1 
ATOM 4625 C CA  . LEU D 1 143 ? 158.285 115.329 131.440 1.00 200.00 ? 143 LEU A CA  1 
ATOM 4626 C C   . LEU D 1 143 ? 157.117 116.355 131.520 1.00 200.00 ? 143 LEU A C   1 
ATOM 4627 O O   . LEU D 1 143 ? 156.106 116.140 132.250 1.00 200.00 ? 143 LEU A O   1 
ATOM 4628 C CB  . LEU D 1 143 ? 157.699 113.918 131.569 1.00 134.09 ? 143 LEU A CB  1 
ATOM 4629 C CG  . LEU D 1 143 ? 158.556 112.692 131.236 1.00 134.09 ? 143 LEU A CG  1 
ATOM 4630 C CD1 . LEU D 1 143 ? 157.762 111.408 131.528 1.00 134.09 ? 143 LEU A CD1 1 
ATOM 4631 C CD2 . LEU D 1 143 ? 158.974 112.774 129.775 1.00 134.09 ? 143 LEU A CD2 1 
ATOM 4632 N N   . PRO D 1 144 ? 157.227 117.480 130.751 1.00 200.00 ? 144 PRO A N   1 
ATOM 4633 C CA  . PRO D 1 144 ? 156.080 118.383 130.856 1.00 200.00 ? 144 PRO A CA  1 
ATOM 4634 C C   . PRO D 1 144 ? 154.956 117.565 130.224 1.00 200.00 ? 144 PRO A C   1 
ATOM 4635 O O   . PRO D 1 144 ? 153.775 117.931 130.245 1.00 200.00 ? 144 PRO A O   1 
ATOM 4636 C CB  . PRO D 1 144 ? 156.473 119.566 129.958 1.00 130.63 ? 144 PRO A CB  1 
ATOM 4637 C CG  . PRO D 1 144 ? 157.908 119.633 130.084 1.00 130.63 ? 144 PRO A CG  1 
ATOM 4638 C CD  . PRO D 1 144 ? 158.285 118.137 129.952 1.00 130.63 ? 144 PRO A CD  1 
ATOM 4639 N N   . GLU D 1 145 ? 155.401 116.432 129.678 1.00 200.00 ? 145 GLU A N   1 
ATOM 4640 C CA  . GLU D 1 145 ? 154.614 115.413 128.996 1.00 200.00 ? 145 GLU A CA  1 
ATOM 4641 C C   . GLU D 1 145 ? 153.275 115.094 129.667 1.00 200.00 ? 145 GLU A C   1 
ATOM 4642 O O   . GLU D 1 145 ? 153.167 115.000 130.895 1.00 200.00 ? 145 GLU A O   1 
ATOM 4643 C CB  . GLU D 1 145 ? 155.452 114.143 128.877 1.00 179.45 ? 145 GLU A CB  1 
ATOM 4644 N N   . THR D 1 146 ? 152.264 114.911 128.823 1.00 200.00 ? 146 THR A N   1 
ATOM 4645 C CA  . THR D 1 146 ? 150.886 114.613 129.217 1.00 200.00 ? 146 THR A CA  1 
ATOM 4646 C C   . THR D 1 146 ? 150.632 113.440 130.172 1.00 200.00 ? 146 THR A C   1 
ATOM 4647 O O   . THR D 1 146 ? 151.517 112.623 130.473 1.00 200.00 ? 146 THR A O   1 
ATOM 4648 C CB  . THR D 1 146 ? 150.030 114.411 127.947 1.00 133.41 ? 146 THR A CB  1 
ATOM 4649 N N   . THR D 1 147 ? 149.381 113.387 130.630 1.00 200.00 ? 147 THR A N   1 
ATOM 4650 C CA  . THR D 1 147 ? 148.887 112.344 131.520 1.00 200.00 ? 147 THR A CA  1 
ATOM 4651 C C   . THR D 1 147 ? 148.050 111.416 130.629 1.00 200.00 ? 147 THR A C   1 
ATOM 4652 O O   . THR D 1 147 ? 148.460 110.288 130.341 1.00 200.00 ? 147 THR A O   1 
ATOM 4653 C CB  . THR D 1 147 ? 148.017 112.965 132.639 1.00 116.09 ? 147 THR A CB  1 
ATOM 4654 N N   . VAL D 1 148 ? 146.900 111.926 130.179 1.00 200.00 ? 148 VAL A N   1 
ATOM 4655 C CA  . VAL D 1 148 ? 145.953 111.215 129.304 1.00 200.00 ? 148 VAL A CA  1 
ATOM 4656 C C   . VAL D 1 148 ? 145.785 109.705 129.567 1.00 200.00 ? 148 VAL A C   1 
ATOM 4657 O O   . VAL D 1 148 ? 146.441 109.171 130.488 1.00 200.00 ? 148 VAL A O   1 
ATOM 4658 C CB  . VAL D 1 148 ? 146.320 111.466 127.824 1.00 101.66 ? 148 VAL A CB  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET C . n 
A 1 2   ASP 2   2   2   ASP ASP C . n 
A 1 3   ILE 3   3   3   ILE ILE C . n 
A 1 4   ASP 4   4   4   ASP ASP C . n 
A 1 5   PRO 5   5   5   PRO PRO C . n 
A 1 6   TYR 6   6   6   TYR TYR C . n 
A 1 7   LYS 7   7   7   LYS LYS C . n 
A 1 8   GLU 8   8   8   GLU GLU C . n 
A 1 9   PHE 9   9   9   PHE PHE C . n 
A 1 10  GLY 10  10  10  GLY GLY C . n 
A 1 11  ALA 11  11  11  ALA ALA C . n 
A 1 12  THR 12  12  12  THR THR C . n 
A 1 13  VAL 13  13  13  VAL VAL C . n 
A 1 14  GLU 14  14  14  GLU GLU C . n 
A 1 15  LEU 15  15  15  LEU LEU C . n 
A 1 16  LEU 16  16  16  LEU LEU C . n 
A 1 17  SER 17  17  17  SER SER C . n 
A 1 18  PHE 18  18  18  PHE PHE C . n 
A 1 19  LEU 19  19  19  LEU LEU C . n 
A 1 20  PRO 20  20  20  PRO PRO C . n 
A 1 21  SER 21  21  21  SER SER C . n 
A 1 22  ASP 22  22  22  ASP ASP C . n 
A 1 23  PHE 23  23  23  PHE PHE C . n 
A 1 24  PHE 24  24  24  PHE PHE C . n 
A 1 25  PRO 25  25  25  PRO PRO C . n 
A 1 26  SER 26  26  26  SER SER C . n 
A 1 27  VAL 27  27  27  VAL VAL C . n 
A 1 28  ARG 28  28  28  ARG ARG C . n 
A 1 29  ASP 29  29  29  ASP ASP C . n 
A 1 30  LEU 30  30  30  LEU LEU C . n 
A 1 31  LEU 31  31  31  LEU LEU C . n 
A 1 32  ASP 32  32  32  ASP ASP C . n 
A 1 33  THR 33  33  33  THR THR C . n 
A 1 34  ALA 34  34  34  ALA ALA C . n 
A 1 35  ALA 35  35  35  ALA ALA C . n 
A 1 36  ALA 36  36  36  ALA ALA C . n 
A 1 37  LEU 37  37  37  LEU LEU C . n 
A 1 38  TYR 38  38  38  TYR TYR C . n 
A 1 39  ARG 39  39  39  ARG ARG C . n 
A 1 40  ASP 40  40  40  ASP ASP C . n 
A 1 41  ALA 41  41  41  ALA ALA C . n 
A 1 42  LEU 42  42  42  LEU LEU C . n 
A 1 43  GLU 43  43  43  GLU GLU C . n 
A 1 44  SER 44  44  44  SER SER C . n 
A 1 45  PRO 45  45  45  PRO PRO C . n 
A 1 46  GLU 46  46  46  GLU GLU C . n 
A 1 47  HIS 47  47  47  HIS HIS C . n 
A 1 48  ALA 48  48  48  ALA ALA C . n 
A 1 49  SER 49  49  49  SER SER C . n 
A 1 50  PRO 50  50  50  PRO PRO C . n 
A 1 51  HIS 51  51  51  HIS HIS C . n 
A 1 52  HIS 52  52  52  HIS HIS C . n 
A 1 53  THR 53  53  53  THR THR C . n 
A 1 54  ALA 54  54  54  ALA ALA C . n 
A 1 55  LEU 55  55  55  LEU LEU C . n 
A 1 56  ARG 56  56  56  ARG ARG C . n 
A 1 57  GLN 57  57  57  GLN GLN C . n 
A 1 58  ALA 58  58  58  ALA ALA C . n 
A 1 59  ILE 59  59  59  ILE ILE C . n 
A 1 60  LEU 60  60  60  LEU LEU C . n 
A 1 61  ALA 61  61  61  ALA ALA C . n 
A 1 62  TRP 62  62  62  TRP TRP C . n 
A 1 63  GLY 63  63  63  GLY GLY C . n 
A 1 64  ASP 64  64  64  ASP ASP C . n 
A 1 65  LEU 65  65  65  LEU LEU C . n 
A 1 66  MET 66  66  66  MET MET C . n 
A 1 67  THR 67  67  67  THR THR C . n 
A 1 68  LEU 68  68  68  LEU LEU C . n 
A 1 69  ALA 69  69  69  ALA ALA C . n 
A 1 70  THR 70  70  70  THR THR C . n 
A 1 71  TRP 71  71  71  TRP TRP C . n 
A 1 72  VAL 72  72  72  VAL VAL C . n 
A 1 73  GLY 73  73  73  GLY GLY C . n 
A 1 74  THR 74  74  74  THR THR C . n 
A 1 75  ASN 75  75  75  ASN ASN C . n 
A 1 76  LEU 76  76  76  LEU LEU C . n 
A 1 77  GLU 77  77  77  GLU GLU C . n 
A 1 78  ASP 78  78  78  ASP ASP C . n 
A 1 79  PRO 79  79  79  PRO PRO C . n 
A 1 80  ALA 80  80  80  ALA ALA C . n 
A 1 81  SER 81  81  81  SER SER C . n 
A 1 82  ARG 82  82  82  ARG ARG C . n 
A 1 83  ASP 83  83  83  ASP ASP C . n 
A 1 84  LEU 84  84  84  LEU LEU C . n 
A 1 85  VAL 85  85  85  VAL VAL C . n 
A 1 86  VAL 86  86  86  VAL VAL C . n 
A 1 87  SER 87  87  87  SER SER C . n 
A 1 88  TYR 88  88  88  TYR TYR C . n 
A 1 89  VAL 89  89  89  VAL VAL C . n 
A 1 90  ASN 90  90  90  ASN ASN C . n 
A 1 91  THR 91  91  91  THR THR C . n 
A 1 92  ASN 92  92  92  ASN ASN C . n 
A 1 93  VAL 93  93  93  VAL VAL C . n 
A 1 94  GLY 94  94  94  GLY GLY C . n 
A 1 95  LEU 95  95  95  LEU LEU C . n 
A 1 96  LYS 96  96  96  LYS LYS C . n 
A 1 97  PHE 97  97  97  PHE PHE C . n 
A 1 98  ARG 98  98  98  ARG ARG C . n 
A 1 99  GLN 99  99  99  GLN GLN C . n 
A 1 100 LEU 100 100 100 LEU LEU C . n 
A 1 101 LEU 101 101 101 LEU LEU C . n 
A 1 102 TRP 102 102 102 TRP TRP C . n 
A 1 103 PHE 103 103 103 PHE PHE C . n 
A 1 104 HIS 104 104 104 HIS HIS C . n 
A 1 105 ILE 105 105 105 ILE ILE C . n 
A 1 106 SER 106 106 106 SER SER C . n 
A 1 107 ALA 107 107 107 ALA ALA C . n 
A 1 108 LEU 108 108 108 LEU LEU C . n 
A 1 109 THR 109 109 109 THR THR C . n 
A 1 110 PHE 110 110 110 PHE PHE C . n 
A 1 111 GLY 111 111 111 GLY GLY C . n 
A 1 112 ARG 112 112 112 ARG ARG C . n 
A 1 113 GLU 113 113 113 GLU GLU C . n 
A 1 114 THR 114 114 114 THR THR C . n 
A 1 115 VAL 115 115 115 VAL VAL C . n 
A 1 116 LEU 116 116 116 LEU LEU C . n 
A 1 117 GLU 117 117 117 GLU GLU C . n 
A 1 118 TYR 118 118 118 TYR TYR C . n 
A 1 119 LEU 119 119 119 LEU LEU C . n 
A 1 120 VAL 120 120 120 VAL VAL C . n 
A 1 121 SER 121 121 121 SER SER C . n 
A 1 122 PHE 122 122 122 PHE PHE C . n 
A 1 123 GLY 123 123 123 GLY GLY C . n 
A 1 124 VAL 124 124 124 VAL VAL C . n 
A 1 125 TRP 125 125 125 TRP TRP C . n 
A 1 126 ILE 126 126 126 ILE ILE C . n 
A 1 127 ARG 127 127 127 ARG ARG C . n 
A 1 128 THR 128 128 128 THR THR C . n 
A 1 129 PRO 129 129 129 PRO PRO C . n 
A 1 130 PRO 130 130 130 PRO PRO C . n 
A 1 131 ALA 131 131 131 ALA ALA C . n 
A 1 132 TYR 132 132 132 TYR TYR C . n 
A 1 133 ARG 133 133 133 ARG ARG C . n 
A 1 134 PRO 134 134 134 PRO PRO C . n 
A 1 135 PRO 135 135 135 PRO PRO C . n 
A 1 136 ASN 136 136 136 ASN ASN C . n 
A 1 137 ALA 137 137 137 ALA ALA C . n 
A 1 138 PRO 138 138 138 PRO PRO C . n 
A 1 139 ILE 139 139 139 ILE ILE C . n 
A 1 140 LEU 140 140 140 LEU LEU C . n 
A 1 141 SER 141 141 141 SER SER C . n 
A 1 142 THR 142 142 142 THR THR C . n 
A 1 143 LEU 143 143 143 LEU LEU C . n 
A 1 144 PRO 144 144 144 PRO PRO C . n 
A 1 145 GLU 145 145 145 GLU GLU C . n 
A 1 146 THR 146 146 146 THR THR C . n 
A 1 147 THR 147 147 147 THR THR C . n 
A 1 148 VAL 148 148 ?   ?   ?   C . n 
A 1 149 VAL 149 149 ?   ?   ?   C . n 
A 1 150 CYS 150 150 ?   ?   ?   C . n 
B 1 1   MET 1   1   1   MET MET D . n 
B 1 2   ASP 2   2   2   ASP ASP D . n 
B 1 3   ILE 3   3   3   ILE ILE D . n 
B 1 4   ASP 4   4   4   ASP ASP D . n 
B 1 5   PRO 5   5   5   PRO PRO D . n 
B 1 6   TYR 6   6   6   TYR TYR D . n 
B 1 7   LYS 7   7   7   LYS LYS D . n 
B 1 8   GLU 8   8   8   GLU GLU D . n 
B 1 9   PHE 9   9   9   PHE PHE D . n 
B 1 10  GLY 10  10  10  GLY GLY D . n 
B 1 11  ALA 11  11  11  ALA ALA D . n 
B 1 12  THR 12  12  12  THR THR D . n 
B 1 13  VAL 13  13  13  VAL VAL D . n 
B 1 14  GLU 14  14  14  GLU GLU D . n 
B 1 15  LEU 15  15  15  LEU LEU D . n 
B 1 16  LEU 16  16  16  LEU LEU D . n 
B 1 17  SER 17  17  17  SER SER D . n 
B 1 18  PHE 18  18  18  PHE PHE D . n 
B 1 19  LEU 19  19  19  LEU LEU D . n 
B 1 20  PRO 20  20  20  PRO PRO D . n 
B 1 21  SER 21  21  21  SER SER D . n 
B 1 22  ASP 22  22  22  ASP ASP D . n 
B 1 23  PHE 23  23  23  PHE PHE D . n 
B 1 24  PHE 24  24  24  PHE PHE D . n 
B 1 25  PRO 25  25  25  PRO PRO D . n 
B 1 26  SER 26  26  26  SER SER D . n 
B 1 27  VAL 27  27  27  VAL VAL D . n 
B 1 28  ARG 28  28  28  ARG ARG D . n 
B 1 29  ASP 29  29  29  ASP ASP D . n 
B 1 30  LEU 30  30  30  LEU LEU D . n 
B 1 31  LEU 31  31  31  LEU LEU D . n 
B 1 32  ASP 32  32  32  ASP ASP D . n 
B 1 33  THR 33  33  33  THR THR D . n 
B 1 34  ALA 34  34  34  ALA ALA D . n 
B 1 35  ALA 35  35  35  ALA ALA D . n 
B 1 36  ALA 36  36  36  ALA ALA D . n 
B 1 37  LEU 37  37  37  LEU LEU D . n 
B 1 38  TYR 38  38  38  TYR TYR D . n 
B 1 39  ARG 39  39  39  ARG ARG D . n 
B 1 40  ASP 40  40  40  ASP ASP D . n 
B 1 41  ALA 41  41  41  ALA ALA D . n 
B 1 42  LEU 42  42  42  LEU LEU D . n 
B 1 43  GLU 43  43  43  GLU GLU D . n 
B 1 44  SER 44  44  44  SER SER D . n 
B 1 45  PRO 45  45  45  PRO PRO D . n 
B 1 46  GLU 46  46  46  GLU GLU D . n 
B 1 47  HIS 47  47  47  HIS HIS D . n 
B 1 48  ALA 48  48  48  ALA ALA D . n 
B 1 49  SER 49  49  49  SER SER D . n 
B 1 50  PRO 50  50  50  PRO PRO D . n 
B 1 51  HIS 51  51  51  HIS HIS D . n 
B 1 52  HIS 52  52  52  HIS HIS D . n 
B 1 53  THR 53  53  53  THR THR D . n 
B 1 54  ALA 54  54  54  ALA ALA D . n 
B 1 55  LEU 55  55  55  LEU LEU D . n 
B 1 56  ARG 56  56  56  ARG ARG D . n 
B 1 57  GLN 57  57  57  GLN GLN D . n 
B 1 58  ALA 58  58  58  ALA ALA D . n 
B 1 59  ILE 59  59  59  ILE ILE D . n 
B 1 60  LEU 60  60  60  LEU LEU D . n 
B 1 61  ALA 61  61  61  ALA ALA D . n 
B 1 62  TRP 62  62  62  TRP TRP D . n 
B 1 63  GLY 63  63  63  GLY GLY D . n 
B 1 64  ASP 64  64  64  ASP ASP D . n 
B 1 65  LEU 65  65  65  LEU LEU D . n 
B 1 66  MET 66  66  66  MET MET D . n 
B 1 67  THR 67  67  67  THR THR D . n 
B 1 68  LEU 68  68  68  LEU LEU D . n 
B 1 69  ALA 69  69  69  ALA ALA D . n 
B 1 70  THR 70  70  70  THR THR D . n 
B 1 71  TRP 71  71  71  TRP TRP D . n 
B 1 72  VAL 72  72  72  VAL VAL D . n 
B 1 73  GLY 73  73  73  GLY GLY D . n 
B 1 74  THR 74  74  74  THR THR D . n 
B 1 75  ASN 75  75  75  ASN ASN D . n 
B 1 76  LEU 76  76  76  LEU LEU D . n 
B 1 77  GLU 77  77  77  GLU GLU D . n 
B 1 78  ASP 78  78  78  ASP ASP D . n 
B 1 79  PRO 79  79  79  PRO PRO D . n 
B 1 80  ALA 80  80  80  ALA ALA D . n 
B 1 81  SER 81  81  81  SER SER D . n 
B 1 82  ARG 82  82  82  ARG ARG D . n 
B 1 83  ASP 83  83  83  ASP ASP D . n 
B 1 84  LEU 84  84  84  LEU LEU D . n 
B 1 85  VAL 85  85  85  VAL VAL D . n 
B 1 86  VAL 86  86  86  VAL VAL D . n 
B 1 87  SER 87  87  87  SER SER D . n 
B 1 88  TYR 88  88  88  TYR TYR D . n 
B 1 89  VAL 89  89  89  VAL VAL D . n 
B 1 90  ASN 90  90  90  ASN ASN D . n 
B 1 91  THR 91  91  91  THR THR D . n 
B 1 92  ASN 92  92  92  ASN ASN D . n 
B 1 93  VAL 93  93  93  VAL VAL D . n 
B 1 94  GLY 94  94  94  GLY GLY D . n 
B 1 95  LEU 95  95  95  LEU LEU D . n 
B 1 96  LYS 96  96  96  LYS LYS D . n 
B 1 97  PHE 97  97  97  PHE PHE D . n 
B 1 98  ARG 98  98  98  ARG ARG D . n 
B 1 99  GLN 99  99  99  GLN GLN D . n 
B 1 100 LEU 100 100 100 LEU LEU D . n 
B 1 101 LEU 101 101 101 LEU LEU D . n 
B 1 102 TRP 102 102 102 TRP TRP D . n 
B 1 103 PHE 103 103 103 PHE PHE D . n 
B 1 104 HIS 104 104 104 HIS HIS D . n 
B 1 105 ILE 105 105 105 ILE ILE D . n 
B 1 106 SER 106 106 106 SER SER D . n 
B 1 107 ALA 107 107 107 ALA ALA D . n 
B 1 108 LEU 108 108 108 LEU LEU D . n 
B 1 109 THR 109 109 109 THR THR D . n 
B 1 110 PHE 110 110 110 PHE PHE D . n 
B 1 111 GLY 111 111 111 GLY GLY D . n 
B 1 112 ARG 112 112 112 ARG ARG D . n 
B 1 113 GLU 113 113 113 GLU GLU D . n 
B 1 114 THR 114 114 114 THR THR D . n 
B 1 115 VAL 115 115 115 VAL VAL D . n 
B 1 116 LEU 116 116 116 LEU LEU D . n 
B 1 117 GLU 117 117 117 GLU GLU D . n 
B 1 118 TYR 118 118 118 TYR TYR D . n 
B 1 119 LEU 119 119 119 LEU LEU D . n 
B 1 120 VAL 120 120 120 VAL VAL D . n 
B 1 121 SER 121 121 121 SER SER D . n 
B 1 122 PHE 122 122 122 PHE PHE D . n 
B 1 123 GLY 123 123 123 GLY GLY D . n 
B 1 124 VAL 124 124 124 VAL VAL D . n 
B 1 125 TRP 125 125 125 TRP TRP D . n 
B 1 126 ILE 126 126 126 ILE ILE D . n 
B 1 127 ARG 127 127 127 ARG ARG D . n 
B 1 128 THR 128 128 128 THR THR D . n 
B 1 129 PRO 129 129 129 PRO PRO D . n 
B 1 130 PRO 130 130 130 PRO PRO D . n 
B 1 131 ALA 131 131 131 ALA ALA D . n 
B 1 132 TYR 132 132 132 TYR TYR D . n 
B 1 133 ARG 133 133 133 ARG ARG D . n 
B 1 134 PRO 134 134 134 PRO PRO D . n 
B 1 135 PRO 135 135 135 PRO PRO D . n 
B 1 136 ASN 136 136 136 ASN ASN D . n 
B 1 137 ALA 137 137 137 ALA ALA D . n 
B 1 138 PRO 138 138 138 PRO PRO D . n 
B 1 139 ILE 139 139 139 ILE ILE D . n 
B 1 140 LEU 140 140 140 LEU LEU D . n 
B 1 141 SER 141 141 141 SER SER D . n 
B 1 142 THR 142 142 142 THR THR D . n 
B 1 143 LEU 143 143 143 LEU LEU D . n 
B 1 144 PRO 144 144 144 PRO PRO D . n 
B 1 145 GLU 145 145 145 GLU GLU D . n 
B 1 146 THR 146 146 146 THR THR D . n 
B 1 147 THR 147 147 ?   ?   ?   D . n 
B 1 148 VAL 148 148 ?   ?   ?   D . n 
B 1 149 VAL 149 149 ?   ?   ?   D . n 
B 1 150 CYS 150 150 ?   ?   ?   D . n 
C 1 1   MET 1   1   1   MET MET B . n 
C 1 2   ASP 2   2   2   ASP ASP B . n 
C 1 3   ILE 3   3   3   ILE ILE B . n 
C 1 4   ASP 4   4   4   ASP ASP B . n 
C 1 5   PRO 5   5   5   PRO PRO B . n 
C 1 6   TYR 6   6   6   TYR TYR B . n 
C 1 7   LYS 7   7   7   LYS LYS B . n 
C 1 8   GLU 8   8   8   GLU GLU B . n 
C 1 9   PHE 9   9   9   PHE PHE B . n 
C 1 10  GLY 10  10  10  GLY GLY B . n 
C 1 11  ALA 11  11  11  ALA ALA B . n 
C 1 12  THR 12  12  12  THR THR B . n 
C 1 13  VAL 13  13  13  VAL VAL B . n 
C 1 14  GLU 14  14  14  GLU GLU B . n 
C 1 15  LEU 15  15  15  LEU LEU B . n 
C 1 16  LEU 16  16  16  LEU LEU B . n 
C 1 17  SER 17  17  17  SER SER B . n 
C 1 18  PHE 18  18  18  PHE PHE B . n 
C 1 19  LEU 19  19  19  LEU LEU B . n 
C 1 20  PRO 20  20  20  PRO PRO B . n 
C 1 21  SER 21  21  21  SER SER B . n 
C 1 22  ASP 22  22  22  ASP ASP B . n 
C 1 23  PHE 23  23  23  PHE PHE B . n 
C 1 24  PHE 24  24  24  PHE PHE B . n 
C 1 25  PRO 25  25  25  PRO PRO B . n 
C 1 26  SER 26  26  26  SER SER B . n 
C 1 27  VAL 27  27  27  VAL VAL B . n 
C 1 28  ARG 28  28  28  ARG ARG B . n 
C 1 29  ASP 29  29  29  ASP ASP B . n 
C 1 30  LEU 30  30  30  LEU LEU B . n 
C 1 31  LEU 31  31  31  LEU LEU B . n 
C 1 32  ASP 32  32  32  ASP ASP B . n 
C 1 33  THR 33  33  33  THR THR B . n 
C 1 34  ALA 34  34  34  ALA ALA B . n 
C 1 35  ALA 35  35  35  ALA ALA B . n 
C 1 36  ALA 36  36  36  ALA ALA B . n 
C 1 37  LEU 37  37  37  LEU LEU B . n 
C 1 38  TYR 38  38  38  TYR TYR B . n 
C 1 39  ARG 39  39  39  ARG ARG B . n 
C 1 40  ASP 40  40  40  ASP ASP B . n 
C 1 41  ALA 41  41  41  ALA ALA B . n 
C 1 42  LEU 42  42  42  LEU LEU B . n 
C 1 43  GLU 43  43  43  GLU GLU B . n 
C 1 44  SER 44  44  44  SER SER B . n 
C 1 45  PRO 45  45  45  PRO PRO B . n 
C 1 46  GLU 46  46  46  GLU GLU B . n 
C 1 47  HIS 47  47  47  HIS HIS B . n 
C 1 48  ALA 48  48  48  ALA ALA B . n 
C 1 49  SER 49  49  49  SER SER B . n 
C 1 50  PRO 50  50  50  PRO PRO B . n 
C 1 51  HIS 51  51  51  HIS HIS B . n 
C 1 52  HIS 52  52  52  HIS HIS B . n 
C 1 53  THR 53  53  53  THR THR B . n 
C 1 54  ALA 54  54  54  ALA ALA B . n 
C 1 55  LEU 55  55  55  LEU LEU B . n 
C 1 56  ARG 56  56  56  ARG ARG B . n 
C 1 57  GLN 57  57  57  GLN GLN B . n 
C 1 58  ALA 58  58  58  ALA ALA B . n 
C 1 59  ILE 59  59  59  ILE ILE B . n 
C 1 60  LEU 60  60  60  LEU LEU B . n 
C 1 61  ALA 61  61  61  ALA ALA B . n 
C 1 62  TRP 62  62  62  TRP TRP B . n 
C 1 63  GLY 63  63  63  GLY GLY B . n 
C 1 64  ASP 64  64  64  ASP ASP B . n 
C 1 65  LEU 65  65  65  LEU LEU B . n 
C 1 66  MET 66  66  66  MET MET B . n 
C 1 67  THR 67  67  67  THR THR B . n 
C 1 68  LEU 68  68  68  LEU LEU B . n 
C 1 69  ALA 69  69  69  ALA ALA B . n 
C 1 70  THR 70  70  70  THR THR B . n 
C 1 71  TRP 71  71  71  TRP TRP B . n 
C 1 72  VAL 72  72  72  VAL VAL B . n 
C 1 73  GLY 73  73  73  GLY GLY B . n 
C 1 74  THR 74  74  74  THR THR B . n 
C 1 75  ASN 75  75  75  ASN ASN B . n 
C 1 76  LEU 76  76  76  LEU LEU B . n 
C 1 77  GLU 77  77  77  GLU GLU B . n 
C 1 78  ASP 78  78  78  ASP ASP B . n 
C 1 79  PRO 79  79  79  PRO PRO B . n 
C 1 80  ALA 80  80  80  ALA ALA B . n 
C 1 81  SER 81  81  81  SER SER B . n 
C 1 82  ARG 82  82  82  ARG ARG B . n 
C 1 83  ASP 83  83  83  ASP ASP B . n 
C 1 84  LEU 84  84  84  LEU LEU B . n 
C 1 85  VAL 85  85  85  VAL VAL B . n 
C 1 86  VAL 86  86  86  VAL VAL B . n 
C 1 87  SER 87  87  87  SER SER B . n 
C 1 88  TYR 88  88  88  TYR TYR B . n 
C 1 89  VAL 89  89  89  VAL VAL B . n 
C 1 90  ASN 90  90  90  ASN ASN B . n 
C 1 91  THR 91  91  91  THR THR B . n 
C 1 92  ASN 92  92  92  ASN ASN B . n 
C 1 93  VAL 93  93  93  VAL VAL B . n 
C 1 94  GLY 94  94  94  GLY GLY B . n 
C 1 95  LEU 95  95  95  LEU LEU B . n 
C 1 96  LYS 96  96  96  LYS LYS B . n 
C 1 97  PHE 97  97  97  PHE PHE B . n 
C 1 98  ARG 98  98  98  ARG ARG B . n 
C 1 99  GLN 99  99  99  GLN GLN B . n 
C 1 100 LEU 100 100 100 LEU LEU B . n 
C 1 101 LEU 101 101 101 LEU LEU B . n 
C 1 102 TRP 102 102 102 TRP TRP B . n 
C 1 103 PHE 103 103 103 PHE PHE B . n 
C 1 104 HIS 104 104 104 HIS HIS B . n 
C 1 105 ILE 105 105 105 ILE ILE B . n 
C 1 106 SER 106 106 106 SER SER B . n 
C 1 107 ALA 107 107 107 ALA ALA B . n 
C 1 108 LEU 108 108 108 LEU LEU B . n 
C 1 109 THR 109 109 109 THR THR B . n 
C 1 110 PHE 110 110 110 PHE PHE B . n 
C 1 111 GLY 111 111 111 GLY GLY B . n 
C 1 112 ARG 112 112 112 ARG ARG B . n 
C 1 113 GLU 113 113 113 GLU GLU B . n 
C 1 114 THR 114 114 114 THR THR B . n 
C 1 115 VAL 115 115 115 VAL VAL B . n 
C 1 116 LEU 116 116 116 LEU LEU B . n 
C 1 117 GLU 117 117 117 GLU GLU B . n 
C 1 118 TYR 118 118 118 TYR TYR B . n 
C 1 119 LEU 119 119 119 LEU LEU B . n 
C 1 120 VAL 120 120 120 VAL VAL B . n 
C 1 121 SER 121 121 121 SER SER B . n 
C 1 122 PHE 122 122 122 PHE PHE B . n 
C 1 123 GLY 123 123 123 GLY GLY B . n 
C 1 124 VAL 124 124 124 VAL VAL B . n 
C 1 125 TRP 125 125 125 TRP TRP B . n 
C 1 126 ILE 126 126 126 ILE ILE B . n 
C 1 127 ARG 127 127 127 ARG ARG B . n 
C 1 128 THR 128 128 128 THR THR B . n 
C 1 129 PRO 129 129 129 PRO PRO B . n 
C 1 130 PRO 130 130 130 PRO PRO B . n 
C 1 131 ALA 131 131 131 ALA ALA B . n 
C 1 132 TYR 132 132 132 TYR TYR B . n 
C 1 133 ARG 133 133 133 ARG ARG B . n 
C 1 134 PRO 134 134 134 PRO PRO B . n 
C 1 135 PRO 135 135 135 PRO PRO B . n 
C 1 136 ASN 136 136 136 ASN ASN B . n 
C 1 137 ALA 137 137 137 ALA ALA B . n 
C 1 138 PRO 138 138 138 PRO PRO B . n 
C 1 139 ILE 139 139 139 ILE ILE B . n 
C 1 140 LEU 140 140 140 LEU LEU B . n 
C 1 141 SER 141 141 141 SER SER B . n 
C 1 142 THR 142 142 142 THR THR B . n 
C 1 143 LEU 143 143 143 LEU LEU B . n 
C 1 144 PRO 144 144 144 PRO PRO B . n 
C 1 145 GLU 145 145 145 GLU GLU B . n 
C 1 146 THR 146 146 146 THR THR B . n 
C 1 147 THR 147 147 147 THR THR B . n 
C 1 148 VAL 148 148 ?   ?   ?   B . n 
C 1 149 VAL 149 149 ?   ?   ?   B . n 
C 1 150 CYS 150 150 ?   ?   ?   B . n 
D 1 1   MET 1   1   1   MET MET A . n 
D 1 2   ASP 2   2   2   ASP ASP A . n 
D 1 3   ILE 3   3   3   ILE ILE A . n 
D 1 4   ASP 4   4   4   ASP ASP A . n 
D 1 5   PRO 5   5   5   PRO PRO A . n 
D 1 6   TYR 6   6   6   TYR TYR A . n 
D 1 7   LYS 7   7   7   LYS LYS A . n 
D 1 8   GLU 8   8   8   GLU GLU A . n 
D 1 9   PHE 9   9   9   PHE PHE A . n 
D 1 10  GLY 10  10  10  GLY GLY A . n 
D 1 11  ALA 11  11  11  ALA ALA A . n 
D 1 12  THR 12  12  12  THR THR A . n 
D 1 13  VAL 13  13  13  VAL VAL A . n 
D 1 14  GLU 14  14  14  GLU GLU A . n 
D 1 15  LEU 15  15  15  LEU LEU A . n 
D 1 16  LEU 16  16  16  LEU LEU A . n 
D 1 17  SER 17  17  17  SER SER A . n 
D 1 18  PHE 18  18  18  PHE PHE A . n 
D 1 19  LEU 19  19  19  LEU LEU A . n 
D 1 20  PRO 20  20  20  PRO PRO A . n 
D 1 21  SER 21  21  21  SER SER A . n 
D 1 22  ASP 22  22  22  ASP ASP A . n 
D 1 23  PHE 23  23  23  PHE PHE A . n 
D 1 24  PHE 24  24  24  PHE PHE A . n 
D 1 25  PRO 25  25  25  PRO PRO A . n 
D 1 26  SER 26  26  26  SER SER A . n 
D 1 27  VAL 27  27  27  VAL VAL A . n 
D 1 28  ARG 28  28  28  ARG ARG A . n 
D 1 29  ASP 29  29  29  ASP ASP A . n 
D 1 30  LEU 30  30  30  LEU LEU A . n 
D 1 31  LEU 31  31  31  LEU LEU A . n 
D 1 32  ASP 32  32  32  ASP ASP A . n 
D 1 33  THR 33  33  33  THR THR A . n 
D 1 34  ALA 34  34  34  ALA ALA A . n 
D 1 35  ALA 35  35  35  ALA ALA A . n 
D 1 36  ALA 36  36  36  ALA ALA A . n 
D 1 37  LEU 37  37  37  LEU LEU A . n 
D 1 38  TYR 38  38  38  TYR TYR A . n 
D 1 39  ARG 39  39  39  ARG ARG A . n 
D 1 40  ASP 40  40  40  ASP ASP A . n 
D 1 41  ALA 41  41  41  ALA ALA A . n 
D 1 42  LEU 42  42  42  LEU LEU A . n 
D 1 43  GLU 43  43  43  GLU GLU A . n 
D 1 44  SER 44  44  44  SER SER A . n 
D 1 45  PRO 45  45  45  PRO PRO A . n 
D 1 46  GLU 46  46  46  GLU GLU A . n 
D 1 47  HIS 47  47  47  HIS HIS A . n 
D 1 48  ALA 48  48  48  ALA ALA A . n 
D 1 49  SER 49  49  49  SER SER A . n 
D 1 50  PRO 50  50  50  PRO PRO A . n 
D 1 51  HIS 51  51  51  HIS HIS A . n 
D 1 52  HIS 52  52  52  HIS HIS A . n 
D 1 53  THR 53  53  53  THR THR A . n 
D 1 54  ALA 54  54  54  ALA ALA A . n 
D 1 55  LEU 55  55  55  LEU LEU A . n 
D 1 56  ARG 56  56  56  ARG ARG A . n 
D 1 57  GLN 57  57  57  GLN GLN A . n 
D 1 58  ALA 58  58  58  ALA ALA A . n 
D 1 59  ILE 59  59  59  ILE ILE A . n 
D 1 60  LEU 60  60  60  LEU LEU A . n 
D 1 61  ALA 61  61  61  ALA ALA A . n 
D 1 62  TRP 62  62  62  TRP TRP A . n 
D 1 63  GLY 63  63  63  GLY GLY A . n 
D 1 64  ASP 64  64  64  ASP ASP A . n 
D 1 65  LEU 65  65  65  LEU LEU A . n 
D 1 66  MET 66  66  66  MET MET A . n 
D 1 67  THR 67  67  67  THR THR A . n 
D 1 68  LEU 68  68  68  LEU LEU A . n 
D 1 69  ALA 69  69  69  ALA ALA A . n 
D 1 70  THR 70  70  70  THR THR A . n 
D 1 71  TRP 71  71  71  TRP TRP A . n 
D 1 72  VAL 72  72  72  VAL VAL A . n 
D 1 73  GLY 73  73  73  GLY GLY A . n 
D 1 74  THR 74  74  74  THR THR A . n 
D 1 75  ASN 75  75  75  ASN ASN A . n 
D 1 76  LEU 76  76  76  LEU LEU A . n 
D 1 77  GLU 77  77  77  GLU GLU A . n 
D 1 78  ASP 78  78  78  ASP ASP A . n 
D 1 79  PRO 79  79  79  PRO PRO A . n 
D 1 80  ALA 80  80  80  ALA ALA A . n 
D 1 81  SER 81  81  81  SER SER A . n 
D 1 82  ARG 82  82  82  ARG ARG A . n 
D 1 83  ASP 83  83  83  ASP ASP A . n 
D 1 84  LEU 84  84  84  LEU LEU A . n 
D 1 85  VAL 85  85  85  VAL VAL A . n 
D 1 86  VAL 86  86  86  VAL VAL A . n 
D 1 87  SER 87  87  87  SER SER A . n 
D 1 88  TYR 88  88  88  TYR TYR A . n 
D 1 89  VAL 89  89  89  VAL VAL A . n 
D 1 90  ASN 90  90  90  ASN ASN A . n 
D 1 91  THR 91  91  91  THR THR A . n 
D 1 92  ASN 92  92  92  ASN ASN A . n 
D 1 93  VAL 93  93  93  VAL VAL A . n 
D 1 94  GLY 94  94  94  GLY GLY A . n 
D 1 95  LEU 95  95  95  LEU LEU A . n 
D 1 96  LYS 96  96  96  LYS LYS A . n 
D 1 97  PHE 97  97  97  PHE PHE A . n 
D 1 98  ARG 98  98  98  ARG ARG A . n 
D 1 99  GLN 99  99  99  GLN GLN A . n 
D 1 100 LEU 100 100 100 LEU LEU A . n 
D 1 101 LEU 101 101 101 LEU LEU A . n 
D 1 102 TRP 102 102 102 TRP TRP A . n 
D 1 103 PHE 103 103 103 PHE PHE A . n 
D 1 104 HIS 104 104 104 HIS HIS A . n 
D 1 105 ILE 105 105 105 ILE ILE A . n 
D 1 106 SER 106 106 106 SER SER A . n 
D 1 107 ALA 107 107 107 ALA ALA A . n 
D 1 108 LEU 108 108 108 LEU LEU A . n 
D 1 109 THR 109 109 109 THR THR A . n 
D 1 110 PHE 110 110 110 PHE PHE A . n 
D 1 111 GLY 111 111 111 GLY GLY A . n 
D 1 112 ARG 112 112 112 ARG ARG A . n 
D 1 113 GLU 113 113 113 GLU GLU A . n 
D 1 114 THR 114 114 114 THR THR A . n 
D 1 115 VAL 115 115 115 VAL VAL A . n 
D 1 116 LEU 116 116 116 LEU LEU A . n 
D 1 117 GLU 117 117 117 GLU GLU A . n 
D 1 118 TYR 118 118 118 TYR TYR A . n 
D 1 119 LEU 119 119 119 LEU LEU A . n 
D 1 120 VAL 120 120 120 VAL VAL A . n 
D 1 121 SER 121 121 121 SER SER A . n 
D 1 122 PHE 122 122 122 PHE PHE A . n 
D 1 123 GLY 123 123 123 GLY GLY A . n 
D 1 124 VAL 124 124 124 VAL VAL A . n 
D 1 125 TRP 125 125 125 TRP TRP A . n 
D 1 126 ILE 126 126 126 ILE ILE A . n 
D 1 127 ARG 127 127 127 ARG ARG A . n 
D 1 128 THR 128 128 128 THR THR A . n 
D 1 129 PRO 129 129 129 PRO PRO A . n 
D 1 130 PRO 130 130 130 PRO PRO A . n 
D 1 131 ALA 131 131 131 ALA ALA A . n 
D 1 132 TYR 132 132 132 TYR TYR A . n 
D 1 133 ARG 133 133 133 ARG ARG A . n 
D 1 134 PRO 134 134 134 PRO PRO A . n 
D 1 135 PRO 135 135 135 PRO PRO A . n 
D 1 136 ASN 136 136 136 ASN ASN A . n 
D 1 137 ALA 137 137 137 ALA ALA A . n 
D 1 138 PRO 138 138 138 PRO PRO A . n 
D 1 139 ILE 139 139 139 ILE ILE A . n 
D 1 140 LEU 140 140 140 LEU LEU A . n 
D 1 141 SER 141 141 141 SER SER A . n 
D 1 142 THR 142 142 142 THR THR A . n 
D 1 143 LEU 143 143 143 LEU LEU A . n 
D 1 144 PRO 144 144 144 PRO PRO A . n 
D 1 145 GLU 145 145 145 GLU ALA A . n 
D 1 146 THR 146 146 146 THR ALA A . n 
D 1 147 THR 147 147 147 THR ALA A . n 
D 1 148 VAL 148 148 148 VAL ALA A . n 
D 1 149 VAL 149 149 ?   ?   ?   A . n 
D 1 150 CYS 150 150 ?   ?   ?   A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'complete icosahedral assembly'                ? 'complete icosahedral assembly' 240 
2 'icosahedral asymmetric unit'                  ? tetrameric                      4   
3 'icosahedral pentamer'                         ? eicosameric                     20  
4 'icosahedral 23 hexamer'                       ? 24-meric                        24  
5 'icosahedral asymmetric unit, std point frame' ? tetrameric                      4   
6 'crystal asymmetric unit, crystal frame'       ? 240-meric                       240 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-60)'           A,B,C,D 
2 1                  A,B,C,D 
3 '(1-5)'            A,B,C,D 
4 '(1,2,6,10,23,24)' A,B,C,D 
5 P                  A,B,C,D 
6 '(X0)(1-60)'       A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
P  'transform to point frame'   ? ? 0.37556758  -0.26350136 -0.88854715 82.90701  -0.45538532 0.78254927  -0.42454782 100.77143  
0.80720085  0.56407772  0.17390549  -98.29921 
X0 'transform to crystal frame' ? ? 1.00000000  0.00000000  0.00000000  0.00000   0.00000000  1.00000000  0.00000000  0.00000    
0.00000000  0.00000000  1.00000000  0.00000   
1  'point symmetry operation'   ? ? 1.00000000  0.00000000  0.00000000  0.00000   0.00000000  1.00000000  0.00000000  0.00000    
0.00000000  0.00000000  1.00000000  0.00000   
2  'point symmetry operation'   ? ? 0.44722733  0.34700455  0.82436373  -57.53013 0.20384172  0.85787535  -0.47169740 43.58851   
-0.87088247 0.37899568  0.31293131  174.29650 
3  'point symmetry operation'   ? ? -0.44717763 0.76530686  0.46296607  75.54995  0.67682737  0.62791283  -0.38422674 -12.96022  
-0.58475370 0.14153049  -0.79876919 295.46117 
4  'point symmetry operation'   ? ? -0.44717763 0.67682736  -0.58475370 215.32809 0.76530686  0.62791284  0.14153050  -91.49777  
0.46296606  -0.38422675 -0.79876920 196.04855 
5  'point symmetry operation'   ? ? 0.44722733  0.20384171  -0.87088246 168.63565 0.34700454  0.85787535  0.37899569  -83.48792  
0.82436373  -0.47169741 0.31293130  13.44351  
6  'point symmetry operation'   ? ? 0.30314641  0.91064802  0.28075332  29.50529  0.91064803  -0.36363265 0.19619242  -114.02500 
0.28075331  0.19619242  -0.93951376 232.89816 
7  'point symmetry operation'   ? ? 0.07670028  0.99281997  -0.09179090 100.69335 0.16228265  0.07840360  0.98362454  -148.06925 
0.98375882  -0.09034035 -0.15510388 61.54416  
8  'point symmetry operation'   ? ? 0.31661967  0.84354277  -0.43380592 123.55749 -0.76806220 0.49636279  0.40460406  17.45441   
0.55662595  0.20508432  0.80505153  -26.02348 
9  'point symmetry operation'   ? ? 0.69134414  0.66911244  -0.27263861 66.50024  -0.59468155 0.31263951  -0.74068238 153.79792  
-0.41036219 0.67419958  0.61405033  91.21074  
10 'point symmetry operation'   ? ? 0.68301721  0.71058577  0.16898328  8.37279   0.44281843  -0.21886690 -0.86948786 72.53917   
-0.58086086 0.66870408  -0.46415032 251.23311 
11 'point symmetry operation'   ? ? -0.58524843 -0.71272289 0.38666568  96.42004  -0.71272290 0.22476672  -0.66445917 154.58901  
0.38666569  -0.66445918 -0.63951830 181.52312 
12 'point symmetry operation'   ? ? -0.74376211 -0.66796664 -0.02526824 166.41740 0.30573352  -0.30632342 -0.90149487 89.57639   
0.59442824  -0.67822307 0.43205154  18.84960  
13 'point symmetry operation'   ? ? -0.44678454 -0.84069750 -0.30595961 175.68629 0.85938697  -0.49835905 0.11442161  -98.49208  
-0.24867171 -0.21181588 0.94514359  30.39440  
14 'point symmetry operation'   ? ? -0.10472862 -0.99220730 -0.06750249 111.41742 0.18310720  -0.08595346 0.97932822  -149.71217 
-0.97749868 0.09020351  0.19068208  200.20300 
15 'point symmetry operation'   ? ? -0.19030401 -0.91311464 0.36056349  62.42818  -0.78851013 0.36096285  0.49795342  6.70055    
-0.58483857 -0.18954543 -0.78869283 293.60568 
16 'point symmetry operation'   ? ? -0.71789799 -0.19792513 -0.66741900 250.47407 -0.19792513 -0.86113407 0.46826675  -46.82043  
-0.66741900 0.46826676  0.57903206  119.75413 
17 'point symmetry operation'   ? ? 0.21983450  -0.67185788 -0.70730459 166.81878 -0.67185788 -0.62995553 0.38956773  8.64793    
-0.70730459 0.38956773  -0.58987897 279.48514 
18 'point symmetry operation'   ? ? 0.57734250  -0.76815213 0.27679946  1.60567   -0.76815213 -0.62591657 -0.13479894 87.74146   
0.27679946  -0.13479894 -0.95142593 234.34330 
19 'point symmetry operation'   ? ? -0.13943789 -0.35373250 0.92489480  -16.84635 -0.35373251 -0.85459889 -0.38017634 81.15560   
0.92489480  -0.38017634 -0.00596322 46.71310  
20 'point symmetry operation'   ? ? -0.93994054 -0.00131284 0.34133570  136.96278 -0.00131284 -0.99997130 -0.00746125 -2.00822   
0.34133570  -0.00746124 0.93991184  -24.10690 
21 'point symmetry operation'   ? ? -0.23545691 0.96351838  0.12724923  100.77000 -0.17567109 0.08658057  -0.98063422 146.05961  
-0.95587641 -0.25325111 0.14887634  203.21405 
22 'point symmetry operation'   ? ? -0.01971665 0.79310096  -0.60877099 178.49330 0.79310097  -0.35833947 -0.49252786 -10.98120  
-0.60877099 -0.49252785 -0.62194389 273.11552 
23 'point symmetry operation'   ? ? 0.68301721  0.44281842  -0.58086085 108.09104 0.71058577  -0.21886688 0.66870408  -158.07377 
0.16898327  -0.86948785 -0.46415033 178.26700 
24 'point symmetry operation'   ? ? 0.90159036  0.39674933  0.17240878  -13.14324 -0.30918348 0.31225195  0.89827852  -91.94116  
0.30255643  -0.86318520 0.40419167  49.74591  
25 'point symmetry operation'   ? ? 0.33394214  0.71855960  0.61004487  -17.66789 -0.85692035 0.50102886  -0.12106861 96.02360   
-0.39264509 -0.48232995 0.78306299  65.16403  
26 'point symmetry operation'   ? ? 0.84177384  -0.53981978 0.00337730  13.59370  -0.24972594 -0.38385105 0.88898556  -97.38387  
-0.47859561 -0.74916818 -0.45792279 238.56062 
27 'point symmetry operation'   ? ? 0.26348525  -0.16971875 0.94961627  -57.77494 -0.96413106 -0.07903070 0.25338795  55.19847   
0.03204416  -0.98231853 -0.18445455 153.62482 
28 'point symmetry operation'   ? ? -0.74376212 0.30573352  0.59442824  85.18372  -0.66796664 -0.30632341 -0.67822308 151.38485  
-0.02526823 -0.90149485 0.43205154  76.81373  
29 'point symmetry operation'   ? ? -0.78798663 0.22947815  -0.57132901 244.90568 0.22947816  -0.75161838 -0.61839275 58.24897   
-0.57132901 -0.61839273 0.53960502  114.27766 
30 'point symmetry operation'   ? ? 0.19192848  -0.29310253 -0.93661858 200.66062 0.48796513  -0.79953310 0.35019546  -95.49855  
-0.85150074 -0.52424967 -0.01042937 214.24274 
31 'point symmetry operation'   ? ? -0.49971792 0.29983048  -0.81263994 250.11526 -0.33807433 0.79625665  0.50167829  -35.50198  
0.79748840  0.52543033  -0.29653873 98.92306  
32 'point symmetry operation'   ? ? 0.54534432  -0.22417425 -0.80767907 150.29297 -0.42578859 0.75590952  -0.49729757 106.09589  
0.72201361  0.61509893  0.31678014  24.26052  
33 'point symmetry operation'   ? ? 0.90159037  -0.30918348 0.30255642  -31.62781 0.39674933  0.31225193  -0.86318521 76.86331   
0.17240877  0.89827852  0.40419169  64.74790  
34 'point symmetry operation'   ? ? 0.07670028  0.16228265  0.98375882  -44.23875 0.99281998  0.07840359  -0.09034034 -82.80129  
-0.09179091 0.98362453  -0.15510387 164.43302 
35 'point symmetry operation'   ? ? -0.78935587 0.53867398  0.29452956  129.88805 0.53867398  0.37753495  0.75319169  -152.24686 
0.29452955  0.75319167  -0.58817909 185.55443 
36 'point symmetry operation'   ? ? -0.10659901 -0.72352908 0.68201342  11.92043  0.76347136  -0.49898616 -0.41002963 -19.43018  
0.63698361  0.47698897  0.60558518  -6.52233  
37 'point symmetry operation'   ? ? -0.78911293 -0.39920797 0.46683378  105.38807 0.59681868  -0.31853935 0.73643747  -156.56958 
-0.14528678 0.85974745  0.48961829  83.17454  
38 'point symmetry operation'   ? ? -0.84084546 -0.43936846 -0.31612381 214.75245 -0.43936846 0.21293836  0.87270420  -76.43082  
-0.31612381 0.87270419  -0.37209290 214.34677 
39 'point symmetry operation'   ? ? -0.19030401 -0.78851013 -0.58483858 188.87571 -0.91311465 0.36096284  -0.18954543 110.23706  
0.36056349  0.49795341  -0.78869282 205.71881 
40 'point symmetry operation'   ? ? 0.26348525  -0.96413105 0.03204415  63.51862  -0.16971876 -0.07903071 -0.98231853 145.46539  
0.94961627  0.25338795  -0.18445454 69.21420  
41 'point symmetry operation'   ? ? -0.23545691 -0.17567110 -0.95587641 243.63296 0.96351839  0.08658057  -0.25325111 -58.27549  
0.12724922  -0.98063421 0.14887633  100.15438 
42 'point symmetry operation'   ? ? 0.69134415  -0.59468155 -0.41036219 82.91567  0.66911245  0.31263952  0.67419958  -154.07369 
-0.27263862 -0.74068237 0.61405032  76.03795  
43 'point symmetry operation'   ? ? 0.54534433  -0.42578858 0.72201361  -54.30342 -0.22417424 0.75590953  0.61509894  -61.42970  
-0.80767907 -0.49729756 0.31678013  166.46446 
44 'point symmetry operation'   ? ? -0.47168957 0.09760348  0.87634611  21.60780  -0.48184983 0.80380651  -0.34887796 91.62564   
-0.73846441 -0.58682933 -0.33211694 246.46755 
45 'point symmetry operation'   ? ? -0.95425127 0.25218458  -0.16064695 205.74261 0.25218458  0.39013847  -0.88554781 93.57504   
-0.16064695 -0.88554780 -0.43588719 205.48567 
46 'point symmetry operation'   ? ? -0.49971792 -0.33807432 0.79748840  34.09478  0.29983049  0.79625665  0.52543034  -98.70067  
-0.81263995 0.50167828  -0.29653873 250.39875 
47 'point symmetry operation'   ? ? -0.98691983 -0.16118536 -0.00292146 187.10689 -0.16118536 0.98626732  0.03600079  10.33835   
-0.00292146 0.03600077  -0.99934749 267.33178 
48 'point symmetry operation'   ? ? -0.47168958 -0.48184983 -0.73846441 236.34948 0.09760347  0.80380651  -0.58682932 68.87611   
0.87634611  -0.34887797 -0.33211693 94.88630  
49 'point symmetry operation'   ? ? 0.33394214  -0.85692034 -0.39264510 113.77097 0.71855960  0.50102885  -0.48232995 -3.98460   
0.61004487  -0.12106861 0.78306299  -28.62389 
50 'point symmetry operation'   ? ? 0.31661967  -0.76806219 0.55662594  -11.22932 0.84354278  0.49636278  0.20508432  -107.55274 
-0.43380593 0.40460406  0.80505154  67.48808  
51 'point symmetry operation'   ? ? -0.10659902 0.76347136  0.63698362  20.25971  -0.72352909 -0.49898615 0.47698896  2.04046    
0.68201343  -0.41002962 0.60558517  -12.14702 
52 'point symmetry operation'   ? ? -0.44678455 0.85938696  -0.24867170 170.69496 -0.84069750 -0.49835905 -0.21181589 105.05263  
-0.30595960 0.11442162  0.94514360  36.29546  
53 'point symmetry operation'   ? ? 0.19192848  0.48796511  -0.85150073 190.51532 -0.29310252 -0.79953311 -0.52424969 94.77656   
-0.93661858 0.35019546  -0.01042936 223.62004 
54 'point symmetry operation'   ? ? 0.92686037  0.16249819  -0.33841424 52.32973  0.16249820  -0.98629602 -0.02853954 -14.58655  
-0.33841424 -0.02853954 -0.94056435 290.95052 
55 'point symmetry operation'   ? ? 0.74236023  0.33277042  0.58151968  -52.89403 -0.10352005 -0.80054778 0.59025998  -71.90062  
0.66195535  -0.49838447 -0.55984643 145.23847 
56 'point symmetry operation'   ? ? 0.84177384  -0.24972594 -0.47859561 78.41196  -0.53981978 -0.38385107 -0.74916819 148.67927  
0.00337730  0.88898555  -0.45792278 195.76928 
57 'point symmetry operation'   ? ? 0.74236023  -0.10352005 0.66195535  -64.31812 0.33277042  -0.80054779 -0.49838448 32.42629   
0.58151968  0.59025997  -0.55984642 154.51021 
58 'point symmetry operation'   ? ? -0.26558323 0.41967330  0.86795154  3.83802   0.41967330  -0.76018293 0.49598007  -108.47939 
0.86795154  0.49598007  0.02576616  49.20459  
59 'point symmetry operation'   ? ? -0.78911293 0.59681868  -0.14528677 188.69090 -0.39920797 -0.31853935 0.85974745  -79.31091  
0.46683378  0.73643747  0.48961829  25.38122  
60 'point symmetry operation'   ? ? -0.10472863 0.18310719  -0.97749868 234.78013 -0.99220731 -0.08595346 0.09020350  79.62189   
-0.06750248 0.97932821  0.19068209  115.96318 
# 
_pdbx_point_symmetry.entry_id             2G33 
_pdbx_point_symmetry.Schoenflies_symbol   I 
_pdbx_point_symmetry.H-M_notation         532 
_pdbx_point_symmetry.circular_symmetry    ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-11-14 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_phasing_MR.entry_id                     2G33 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     0.672 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   0.148 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.000 
_pdbx_phasing_MR.d_res_low_rotation           40.000 
_pdbx_phasing_MR.d_res_high_translation       3.000 
_pdbx_phasing_MR.d_res_low_translation        40.000 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
MOLREP      .     ?              ?       'A. Vagin'           alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html      Fortran    ? 3 
CNS         .     ?              package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 4 
PDB_EXTRACT 1.701 'Nov. 1, 2005' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C C ASP 4   ? ? N  C PRO 5   ? ? CA C PRO 5   ? ? 128.41 119.30 9.11   1.50 Y 
2 1 N C ARG 82  ? ? CA C ARG 82  ? ? C  C ARG 82  ? ? 93.37  111.00 -17.63 2.70 N 
3 1 N C PRO 144 ? ? CA C PRO 144 ? ? C  C PRO 144 ? ? 131.85 112.10 19.75  2.60 N 
4 1 N C GLU 145 ? ? CA C GLU 145 ? ? C  C GLU 145 ? ? 136.58 111.00 25.58  2.70 N 
5 1 C D ASP 4   ? ? N  D PRO 5   ? ? CA D PRO 5   ? ? 128.40 119.30 9.10   1.50 Y 
6 1 C D PRO 129 ? ? N  D PRO 130 ? ? CA D PRO 130 ? ? 129.51 119.30 10.21  1.50 Y 
7 1 N D LEU 143 ? ? CA D LEU 143 ? ? C  D LEU 143 ? ? 130.09 111.00 19.09  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 LYS C 7   ? ? -39.25  -24.96  
2   1 PHE C 9   ? ? -100.25 53.20   
3   1 GLU C 14  ? ? -38.54  -30.11  
4   1 SER C 17  ? ? -57.50  -9.42   
5   1 ALA C 34  ? ? -55.23  -94.53  
6   1 ALA C 35  ? ? -47.68  -9.53   
7   1 LEU C 37  ? ? -146.51 -25.52  
8   1 ARG C 39  ? ? -4.06   -79.46  
9   1 GLU C 43  ? ? -75.77  32.03   
10  1 HIS C 47  ? ? -82.08  44.45   
11  1 ALA C 48  ? ? -20.27  -30.01  
12  1 HIS C 52  ? ? -52.24  -81.79  
13  1 THR C 53  ? ? -20.71  -73.46  
14  1 ALA C 54  ? ? -42.82  -85.07  
15  1 LEU C 55  ? ? -17.78  -64.56  
16  1 ALA C 58  ? ? -25.98  -59.81  
17  1 GLU C 77  ? ? -89.38  47.75   
18  1 ASP C 78  ? ? -82.49  -134.01 
19  1 PRO C 79  ? ? -51.96  -126.16 
20  1 ARG C 82  ? ? -153.71 -8.25   
21  1 ASP C 83  ? ? -108.79 -69.70  
22  1 LEU C 84  ? ? -69.37  26.61   
23  1 SER C 87  ? ? -63.32  -79.16  
24  1 TYR C 88  ? ? -25.08  -48.93  
25  1 VAL C 89  ? ? -55.78  -82.36  
26  1 ASN C 90  ? ? -51.61  -7.73   
27  1 GLN C 99  ? ? -58.49  -84.47  
28  1 TRP C 102 ? ? -37.05  -71.07  
29  1 PHE C 103 ? ? -16.89  -77.59  
30  1 HIS C 104 ? ? -39.33  -77.64  
31  1 ILE C 105 ? ? -20.69  -50.97  
32  1 LEU C 108 ? ? -66.27  27.66   
33  1 THR C 109 ? ? -159.51 -25.83  
34  1 ARG C 112 ? ? -29.85  -65.07  
35  1 THR C 114 ? ? -39.81  -35.78  
36  1 TYR C 118 ? ? -58.08  -86.56  
37  1 LEU C 119 ? ? -23.50  -70.90  
38  1 VAL C 120 ? ? -32.64  -89.60  
39  1 PHE C 122 ? ? -91.27  -61.60  
40  1 PRO C 129 ? ? -41.57  156.38  
41  1 PRO C 130 ? ? -44.88  -92.08  
42  1 ALA C 131 ? ? -63.99  4.25    
43  1 PRO C 134 ? ? -40.56  164.27  
44  1 LEU C 140 ? ? -35.11  121.98  
45  1 THR C 142 ? ? -51.04  -79.73  
46  1 LEU C 143 ? ? -32.41  -71.36  
47  1 PRO C 144 ? ? -53.62  -8.09   
48  1 THR C 146 ? ? 178.28  125.02  
49  1 ASP D 2   ? ? -57.42  106.18  
50  1 LYS D 7   ? ? -48.21  -17.99  
51  1 GLU D 14  ? ? -47.67  -18.26  
52  1 PHE D 18  ? ? -46.56  -78.24  
53  1 PHE D 23  ? ? -145.25 -57.71  
54  1 THR D 33  ? ? -39.45  -70.64  
55  1 ALA D 34  ? ? -39.48  -75.70  
56  1 ALA D 36  ? ? -98.99  34.05   
57  1 LEU D 37  ? ? -168.22 -18.10  
58  1 TYR D 38  ? ? -143.01 17.79   
59  1 ALA D 48  ? ? -23.03  -27.98  
60  1 ALA D 54  ? ? -48.12  -78.84  
61  1 LEU D 55  ? ? -22.36  -77.65  
62  1 ARG D 56  ? ? -22.48  -61.03  
63  1 LEU D 68  ? ? -97.62  -61.45  
64  1 ALA D 69  ? ? -36.52  -32.21  
65  1 THR D 70  ? ? -101.41 51.90   
66  1 TRP D 71  ? ? -156.73 -7.16   
67  1 ASN D 75  ? ? -95.85  40.70   
68  1 LEU D 76  ? ? -170.21 119.44  
69  1 GLU D 77  ? ? -145.29 45.38   
70  1 ASP D 78  ? ? -76.56  -107.82 
71  1 PRO D 79  ? ? -80.26  -158.50 
72  1 ALA D 80  ? ? -84.55  32.77   
73  1 VAL D 89  ? ? -61.12  -83.67  
74  1 ASN D 90  ? ? -59.34  13.47   
75  1 GLN D 99  ? ? -50.53  -93.43  
76  1 LEU D 100 ? ? -25.72  -70.60  
77  1 LEU D 101 ? ? -26.63  -65.46  
78  1 PHE D 103 ? ? -10.41  -86.48  
79  1 HIS D 104 ? ? -33.77  -79.86  
80  1 ILE D 105 ? ? -19.03  -55.32  
81  1 SER D 106 ? ? -53.47  -72.15  
82  1 THR D 109 ? ? -145.34 -9.31   
83  1 GLU D 117 ? ? -52.11  -2.52   
84  1 TYR D 118 ? ? -88.36  -73.52  
85  1 VAL D 124 ? ? -142.31 -46.23  
86  1 ARG D 127 ? ? -52.88  6.99    
87  1 PRO D 130 ? ? -23.29  -70.33  
88  1 THR D 142 ? ? -90.67  49.95   
89  1 ASP B 2   ? ? -50.70  91.71   
90  1 LYS B 7   ? ? -39.89  -33.15  
91  1 LEU B 31  ? ? -53.36  -72.46  
92  1 THR B 33  ? ? -32.38  -73.69  
93  1 ALA B 34  ? ? -41.89  -84.69  
94  1 ALA B 35  ? ? -46.31  -17.06  
95  1 ARG B 39  ? ? -15.23  -73.43  
96  1 GLU B 43  ? ? -68.02  15.82   
97  1 HIS B 47  ? ? -77.40  45.40   
98  1 ALA B 48  ? ? -22.24  -65.67  
99  1 HIS B 52  ? ? -41.26  -70.71  
100 1 THR B 53  ? ? -34.07  -82.63  
101 1 ALA B 54  ? ? -28.67  -70.11  
102 1 LEU B 55  ? ? -28.17  -82.67  
103 1 ARG B 56  ? ? -20.33  -46.85  
104 1 LEU B 68  ? ? -124.58 -59.86  
105 1 VAL B 89  ? ? -54.76  -85.62  
106 1 ASN B 90  ? ? -48.78  2.64    
107 1 THR B 91  ? ? -132.38 -67.63  
108 1 LEU B 95  ? ? -66.90  -70.49  
109 1 GLN B 99  ? ? -38.02  -70.05  
110 1 LEU B 100 ? ? -45.10  -83.69  
111 1 LEU B 101 ? ? -19.31  -82.31  
112 1 TRP B 102 ? ? -29.40  -45.12  
113 1 PHE B 103 ? ? -46.04  -83.85  
114 1 HIS B 104 ? ? -38.44  -70.70  
115 1 ILE B 105 ? ? -28.32  -76.83  
116 1 LEU B 108 ? ? -71.51  31.97   
117 1 THR B 109 ? ? -145.66 -26.46  
118 1 ARG B 112 ? ? -95.70  -61.66  
119 1 VAL B 115 ? ? -90.12  -67.57  
120 1 TYR B 118 ? ? -85.36  -76.21  
121 1 LEU B 119 ? ? -29.06  -58.44  
122 1 VAL B 120 ? ? -29.11  -79.13  
123 1 ARG B 127 ? ? -56.78  -0.63   
124 1 PRO B 129 ? ? -22.46  112.94  
125 1 PRO B 130 ? ? -24.69  -46.58  
126 1 PRO B 135 ? ? -44.60  -16.67  
127 1 LEU B 143 ? ? -48.62  150.26  
128 1 PRO B 144 ? ? -49.60  161.54  
129 1 GLU B 145 ? ? -90.29  50.99   
130 1 LYS A 7   ? ? -33.75  -39.79  
131 1 PHE A 9   ? ? -104.93 52.45   
132 1 GLU A 14  ? ? -41.41  -19.72  
133 1 LEU A 15  ? ? -85.94  -81.34  
134 1 LEU A 16  ? ? -27.15  -37.12  
135 1 SER A 17  ? ? -35.17  -24.56  
136 1 PHE A 18  ? ? -46.89  -83.60  
137 1 LEU A 19  ? ? -31.15  134.60  
138 1 SER A 21  ? ? -52.72  -3.66   
139 1 ASP A 32  ? ? -38.38  -32.98  
140 1 THR A 33  ? ? -80.53  -87.92  
141 1 ALA A 34  ? ? -23.70  -84.95  
142 1 LEU A 37  ? ? -151.97 -19.55  
143 1 ARG A 39  ? ? -30.55  -77.96  
144 1 GLU A 43  ? ? -78.26  41.29   
145 1 HIS A 47  ? ? -109.07 55.31   
146 1 ALA A 48  ? ? -22.89  -22.17  
147 1 LEU A 55  ? ? -52.24  -76.90  
148 1 ARG A 56  ? ? -7.07   -67.64  
149 1 GLN A 57  ? ? -46.51  -76.48  
150 1 ALA A 58  ? ? -20.83  -70.75  
151 1 ASN A 75  ? ? -104.04 50.19   
152 1 LEU A 76  ? ? -160.05 96.13   
153 1 GLU A 77  ? ? -77.24  43.79   
154 1 VAL A 85  ? ? -27.77  -48.90  
155 1 VAL A 89  ? ? -118.75 -71.20  
156 1 ASN A 90  ? ? -59.23  10.97   
157 1 THR A 91  ? ? -144.18 -49.02  
158 1 LEU A 95  ? ? -56.00  -74.15  
159 1 GLN A 99  ? ? -39.33  -85.46  
160 1 LEU A 100 ? ? -40.13  -79.02  
161 1 LEU A 101 ? ? -18.54  -79.43  
162 1 TRP A 102 ? ? -27.10  -74.58  
163 1 PHE A 103 ? ? -14.92  -89.56  
164 1 HIS A 104 ? ? -25.56  -80.05  
165 1 ILE A 105 ? ? -20.95  -56.19  
166 1 LEU A 108 ? ? -64.86  33.59   
167 1 THR A 109 ? ? -156.91 -34.93  
168 1 GLU A 117 ? ? -58.31  -2.69   
169 1 TYR A 118 ? ? -92.50  -91.23  
170 1 LEU A 119 ? ? -6.20   -89.07  
171 1 VAL A 120 ? ? -3.83   -83.82  
172 1 PRO A 129 ? ? -21.23  128.02  
173 1 PRO A 135 ? ? -39.46  -23.40  
174 1 ALA A 137 ? ? -57.34  173.88  
175 1 LEU A 140 ? ? -103.07 41.56   
176 1 LEU A 143 ? ? -42.94  88.26   
177 1 THR A 147 ? ? -103.71 -69.72  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 145 ? CG  ? D GLU 145 CG  
2  1 Y 1 A GLU 145 ? CD  ? D GLU 145 CD  
3  1 Y 1 A GLU 145 ? OE1 ? D GLU 145 OE1 
4  1 Y 1 A GLU 145 ? OE2 ? D GLU 145 OE2 
5  1 Y 1 A THR 146 ? OG1 ? D THR 146 OG1 
6  1 Y 1 A THR 146 ? CG2 ? D THR 146 CG2 
7  1 Y 1 A THR 147 ? OG1 ? D THR 147 OG1 
8  1 Y 1 A THR 147 ? CG2 ? D THR 147 CG2 
9  1 Y 1 A VAL 148 ? CG1 ? D VAL 148 CG1 
10 1 Y 1 A VAL 148 ? CG2 ? D VAL 148 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C VAL 148 ? A VAL 148 
2  1 Y 1 C VAL 149 ? A VAL 149 
3  1 Y 1 C CYS 150 ? A CYS 150 
4  1 Y 1 D THR 147 ? B THR 147 
5  1 Y 1 D VAL 148 ? B VAL 148 
6  1 Y 1 D VAL 149 ? B VAL 149 
7  1 Y 1 D CYS 150 ? B CYS 150 
8  1 Y 1 B VAL 148 ? C VAL 148 
9  1 Y 1 B VAL 149 ? C VAL 149 
10 1 Y 1 B CYS 150 ? C CYS 150 
11 1 Y 1 A VAL 149 ? D VAL 149 
12 1 Y 1 A CYS 150 ? D CYS 150 
#