data_2G4C
# 
_entry.id   2G4C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2G4C         
RCSB  RCSB036671   
WWPDB D_1000036671 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2G4C 
_pdbx_database_status.recvd_initial_deposition_date   2006-02-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fan, L.'      1 
'Farr, C.L.'   2 
'Kaguni, L.S.' 3 
'Tainer, J.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
;A novel processive mechanism for DNA synthesis revealed by structure, modeling and mutagenesis of the accessory subunit of human mitochondrial DNA polymerase
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            358 
_citation.page_first                1229 
_citation.page_last                 1243 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16574152 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2006.02.073 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fan, L.'        1 
primary 'Kim, S.'        2 
primary 'Farr, C.L.'     3 
primary 'Schaefer, K.T.' 4 
primary 'Randolph, K.M.' 5 
primary 'Tainer, J.A.'   6 
primary 'Kaguni, L.S.'   7 
# 
_cell.entry_id           2G4C 
_cell.length_a           101.790 
_cell.length_b           101.790 
_cell.length_c           170.277 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2G4C 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                145 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA polymerase gamma subunit 2' 53907.449 4  2.7.7.7 ? ? ? 
2 water   nat water                            18.015    31 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Mitochondrial DNA polymerase accessory subunit, PolG-beta, MtPolB, DNA polymerase gamma accessory 55 kDa subunit, p55' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRGSHHHHHHGSTMDAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSL
LSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFL
ENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQW
LDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNV
VPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGI
SVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRGSHHHHHHGSTMDAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSL
LSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFL
ENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQW
LDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNV
VPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGI
SVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  GLY n 
1 12  SER n 
1 13  THR n 
1 14  MET n 
1 15  ASP n 
1 16  ALA n 
1 17  GLY n 
1 18  GLN n 
1 19  PRO n 
1 20  GLU n 
1 21  LEU n 
1 22  LEU n 
1 23  THR n 
1 24  GLU n 
1 25  ARG n 
1 26  SER n 
1 27  SER n 
1 28  PRO n 
1 29  LYS n 
1 30  GLY n 
1 31  GLY n 
1 32  HIS n 
1 33  VAL n 
1 34  LYS n 
1 35  SER n 
1 36  HIS n 
1 37  ALA n 
1 38  GLU n 
1 39  LEU n 
1 40  GLU n 
1 41  GLY n 
1 42  ASN n 
1 43  GLY n 
1 44  GLU n 
1 45  HIS n 
1 46  PRO n 
1 47  GLU n 
1 48  ALA n 
1 49  PRO n 
1 50  GLY n 
1 51  SER n 
1 52  GLY n 
1 53  GLU n 
1 54  GLY n 
1 55  SER n 
1 56  GLU n 
1 57  ALA n 
1 58  LEU n 
1 59  LEU n 
1 60  GLU n 
1 61  ILE n 
1 62  CYS n 
1 63  GLN n 
1 64  ARG n 
1 65  ARG n 
1 66  HIS n 
1 67  PHE n 
1 68  LEU n 
1 69  SER n 
1 70  GLY n 
1 71  SER n 
1 72  LYS n 
1 73  GLN n 
1 74  GLN n 
1 75  LEU n 
1 76  SER n 
1 77  ARG n 
1 78  ASP n 
1 79  SER n 
1 80  LEU n 
1 81  LEU n 
1 82  SER n 
1 83  GLY n 
1 84  CYS n 
1 85  HIS n 
1 86  PRO n 
1 87  GLY n 
1 88  PHE n 
1 89  GLY n 
1 90  PRO n 
1 91  LEU n 
1 92  GLY n 
1 93  VAL n 
1 94  GLU n 
1 95  LEU n 
1 96  ARG n 
1 97  LYS n 
1 98  ASN n 
1 99  LEU n 
1 100 ALA n 
1 101 ALA n 
1 102 GLU n 
1 103 TRP n 
1 104 TRP n 
1 105 THR n 
1 106 SER n 
1 107 VAL n 
1 108 VAL n 
1 109 VAL n 
1 110 PHE n 
1 111 ARG n 
1 112 GLU n 
1 113 GLN n 
1 114 VAL n 
1 115 PHE n 
1 116 PRO n 
1 117 VAL n 
1 118 ASP n 
1 119 ALA n 
1 120 LEU n 
1 121 HIS n 
1 122 HIS n 
1 123 LYS n 
1 124 PRO n 
1 125 GLY n 
1 126 PRO n 
1 127 LEU n 
1 128 LEU n 
1 129 PRO n 
1 130 GLY n 
1 131 ASP n 
1 132 SER n 
1 133 ALA n 
1 134 PHE n 
1 135 ARG n 
1 136 LEU n 
1 137 VAL n 
1 138 SER n 
1 139 ALA n 
1 140 GLU n 
1 141 THR n 
1 142 LEU n 
1 143 ARG n 
1 144 GLU n 
1 145 ILE n 
1 146 LEU n 
1 147 GLN n 
1 148 ASP n 
1 149 LYS n 
1 150 GLU n 
1 151 LEU n 
1 152 SER n 
1 153 LYS n 
1 154 GLU n 
1 155 GLN n 
1 156 LEU n 
1 157 VAL n 
1 158 THR n 
1 159 PHE n 
1 160 LEU n 
1 161 GLU n 
1 162 ASN n 
1 163 VAL n 
1 164 LEU n 
1 165 LYS n 
1 166 THR n 
1 167 SER n 
1 168 GLY n 
1 169 LYS n 
1 170 LEU n 
1 171 ARG n 
1 172 GLU n 
1 173 ASN n 
1 174 LEU n 
1 175 LEU n 
1 176 HIS n 
1 177 GLY n 
1 178 ALA n 
1 179 LEU n 
1 180 GLU n 
1 181 HIS n 
1 182 TYR n 
1 183 VAL n 
1 184 ASN n 
1 185 CYS n 
1 186 LEU n 
1 187 ASP n 
1 188 LEU n 
1 189 VAL n 
1 190 ASN n 
1 191 LYS n 
1 192 ARG n 
1 193 LEU n 
1 194 PRO n 
1 195 TYR n 
1 196 GLY n 
1 197 LEU n 
1 198 ALA n 
1 199 GLN n 
1 200 ILE n 
1 201 GLY n 
1 202 VAL n 
1 203 CYS n 
1 204 PHE n 
1 205 HIS n 
1 206 PRO n 
1 207 VAL n 
1 208 PHE n 
1 209 ASP n 
1 210 THR n 
1 211 LYS n 
1 212 GLN n 
1 213 ILE n 
1 214 ARG n 
1 215 ASN n 
1 216 GLY n 
1 217 VAL n 
1 218 LYS n 
1 219 SER n 
1 220 ILE n 
1 221 GLY n 
1 222 GLU n 
1 223 LYS n 
1 224 THR n 
1 225 GLU n 
1 226 ALA n 
1 227 SER n 
1 228 LEU n 
1 229 VAL n 
1 230 TRP n 
1 231 PHE n 
1 232 THR n 
1 233 PRO n 
1 234 PRO n 
1 235 ARG n 
1 236 THR n 
1 237 SER n 
1 238 ASN n 
1 239 GLN n 
1 240 TRP n 
1 241 LEU n 
1 242 ASP n 
1 243 PHE n 
1 244 TRP n 
1 245 LEU n 
1 246 ARG n 
1 247 HIS n 
1 248 ARG n 
1 249 LEU n 
1 250 GLN n 
1 251 TRP n 
1 252 TRP n 
1 253 ARG n 
1 254 LYS n 
1 255 PHE n 
1 256 ALA n 
1 257 MET n 
1 258 SER n 
1 259 PRO n 
1 260 SER n 
1 261 ASN n 
1 262 PHE n 
1 263 SER n 
1 264 SER n 
1 265 SER n 
1 266 ASP n 
1 267 CYS n 
1 268 GLN n 
1 269 ASP n 
1 270 GLU n 
1 271 GLU n 
1 272 GLY n 
1 273 ARG n 
1 274 LYS n 
1 275 GLY n 
1 276 ASN n 
1 277 LYS n 
1 278 LEU n 
1 279 TYR n 
1 280 TYR n 
1 281 ASN n 
1 282 PHE n 
1 283 PRO n 
1 284 TRP n 
1 285 GLY n 
1 286 LYS n 
1 287 GLU n 
1 288 LEU n 
1 289 ILE n 
1 290 GLU n 
1 291 THR n 
1 292 LEU n 
1 293 TRP n 
1 294 ASN n 
1 295 LEU n 
1 296 GLY n 
1 297 ASP n 
1 298 HIS n 
1 299 GLU n 
1 300 LEU n 
1 301 LEU n 
1 302 HIS n 
1 303 MET n 
1 304 TYR n 
1 305 PRO n 
1 306 GLY n 
1 307 ASN n 
1 308 VAL n 
1 309 SER n 
1 310 LYS n 
1 311 LEU n 
1 312 HIS n 
1 313 GLY n 
1 314 ARG n 
1 315 ASP n 
1 316 GLY n 
1 317 ARG n 
1 318 LYS n 
1 319 ASN n 
1 320 VAL n 
1 321 VAL n 
1 322 PRO n 
1 323 CYS n 
1 324 VAL n 
1 325 LEU n 
1 326 SER n 
1 327 VAL n 
1 328 ASN n 
1 329 GLY n 
1 330 ASP n 
1 331 LEU n 
1 332 ASP n 
1 333 ARG n 
1 334 GLY n 
1 335 MET n 
1 336 LEU n 
1 337 ALA n 
1 338 TYR n 
1 339 LEU n 
1 340 TYR n 
1 341 ASP n 
1 342 SER n 
1 343 PHE n 
1 344 GLN n 
1 345 LEU n 
1 346 THR n 
1 347 GLU n 
1 348 ASN n 
1 349 SER n 
1 350 PHE n 
1 351 THR n 
1 352 ARG n 
1 353 LYS n 
1 354 LYS n 
1 355 ASN n 
1 356 LEU n 
1 357 HIS n 
1 358 ARG n 
1 359 LYS n 
1 360 VAL n 
1 361 LEU n 
1 362 LYS n 
1 363 LEU n 
1 364 HIS n 
1 365 PRO n 
1 366 CYS n 
1 367 LEU n 
1 368 ALA n 
1 369 PRO n 
1 370 ILE n 
1 371 LYS n 
1 372 VAL n 
1 373 ALA n 
1 374 LEU n 
1 375 ASP n 
1 376 VAL n 
1 377 GLY n 
1 378 ARG n 
1 379 GLY n 
1 380 PRO n 
1 381 THR n 
1 382 LEU n 
1 383 GLU n 
1 384 LEU n 
1 385 ARG n 
1 386 GLN n 
1 387 VAL n 
1 388 CYS n 
1 389 GLN n 
1 390 GLY n 
1 391 LEU n 
1 392 PHE n 
1 393 ASN n 
1 394 GLU n 
1 395 LEU n 
1 396 LEU n 
1 397 GLU n 
1 398 ASN n 
1 399 GLY n 
1 400 ILE n 
1 401 SER n 
1 402 VAL n 
1 403 TRP n 
1 404 PRO n 
1 405 GLY n 
1 406 TYR n 
1 407 LEU n 
1 408 GLU n 
1 409 THR n 
1 410 MET n 
1 411 GLN n 
1 412 SER n 
1 413 SER n 
1 414 LEU n 
1 415 GLU n 
1 416 GLN n 
1 417 LEU n 
1 418 TYR n 
1 419 SER n 
1 420 LYS n 
1 421 TYR n 
1 422 ASP n 
1 423 GLU n 
1 424 MET n 
1 425 SER n 
1 426 ILE n 
1 427 LEU n 
1 428 PHE n 
1 429 THR n 
1 430 VAL n 
1 431 LEU n 
1 432 VAL n 
1 433 THR n 
1 434 GLU n 
1 435 THR n 
1 436 THR n 
1 437 LEU n 
1 438 GLU n 
1 439 ASN n 
1 440 GLY n 
1 441 LEU n 
1 442 ILE n 
1 443 HIS n 
1 444 LEU n 
1 445 ARG n 
1 446 SER n 
1 447 ARG n 
1 448 ASP n 
1 449 THR n 
1 450 THR n 
1 451 MET n 
1 452 LYS n 
1 453 GLU n 
1 454 MET n 
1 455 MET n 
1 456 HIS n 
1 457 ILE n 
1 458 SER n 
1 459 LYS n 
1 460 LEU n 
1 461 LYS n 
1 462 ASP n 
1 463 PHE n 
1 464 LEU n 
1 465 ILE n 
1 466 LYS n 
1 467 TYR n 
1 468 ILE n 
1 469 SER n 
1 470 SER n 
1 471 ALA n 
1 472 LYS n 
1 473 ASN n 
1 474 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'POLG2, MTPOLB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pQESL-Hp55 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DPOG2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UHN1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVE
LRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENL
LHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRK
FAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRG
MLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSL
EQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
;
_struct_ref.pdbx_align_begin           26 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2G4C A 15 ? 474 ? Q9UHN1 26 ? 485 ? 26 485 
2 1 2G4C B 15 ? 474 ? Q9UHN1 26 ? 485 ? 26 485 
3 1 2G4C C 15 ? 474 ? Q9UHN1 26 ? 485 ? 26 485 
4 1 2G4C D 15 ? 474 ? Q9UHN1 26 ? 485 ? 26 485 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2G4C MET A 1   ? UNP Q9UHN1 ?   ?   'INITIATING METHIONINE' 12  1  
1 2G4C ARG A 2   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      13  2  
1 2G4C GLY A 3   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      14  3  
1 2G4C SER A 4   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      15  4  
1 2G4C HIS A 5   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        16  5  
1 2G4C HIS A 6   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        17  6  
1 2G4C HIS A 7   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        18  7  
1 2G4C HIS A 8   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        19  8  
1 2G4C HIS A 9   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        20  9  
1 2G4C HIS A 10  ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        21  10 
1 2G4C GLY A 11  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      22  11 
1 2G4C SER A 12  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      23  12 
1 2G4C THR A 13  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      24  13 
1 2G4C MET A 14  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      25  14 
1 2G4C THR A 158 ? UNP Q9UHN1 ALA 169 'SEE REMARK 999'        169 15 
2 2G4C MET B 1   ? UNP Q9UHN1 ?   ?   'INITIATING METHIONINE' 12  16 
2 2G4C ARG B 2   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      13  17 
2 2G4C GLY B 3   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      14  18 
2 2G4C SER B 4   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      15  19 
2 2G4C HIS B 5   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        16  20 
2 2G4C HIS B 6   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        17  21 
2 2G4C HIS B 7   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        18  22 
2 2G4C HIS B 8   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        19  23 
2 2G4C HIS B 9   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        20  24 
2 2G4C HIS B 10  ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        21  25 
2 2G4C GLY B 11  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      22  26 
2 2G4C SER B 12  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      23  27 
2 2G4C THR B 13  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      24  28 
2 2G4C MET B 14  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      25  29 
2 2G4C THR B 158 ? UNP Q9UHN1 ALA 169 'SEE REMARK 999'        169 30 
3 2G4C MET C 1   ? UNP Q9UHN1 ?   ?   'INITIATING METHIONINE' 12  31 
3 2G4C ARG C 2   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      13  32 
3 2G4C GLY C 3   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      14  33 
3 2G4C SER C 4   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      15  34 
3 2G4C HIS C 5   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        16  35 
3 2G4C HIS C 6   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        17  36 
3 2G4C HIS C 7   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        18  37 
3 2G4C HIS C 8   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        19  38 
3 2G4C HIS C 9   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        20  39 
3 2G4C HIS C 10  ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        21  40 
3 2G4C GLY C 11  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      22  41 
3 2G4C SER C 12  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      23  42 
3 2G4C THR C 13  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      24  43 
3 2G4C MET C 14  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      25  44 
3 2G4C THR C 158 ? UNP Q9UHN1 ALA 169 'SEE REMARK 999'        169 45 
4 2G4C MET D 1   ? UNP Q9UHN1 ?   ?   'INITIATING METHIONINE' 12  46 
4 2G4C ARG D 2   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      13  47 
4 2G4C GLY D 3   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      14  48 
4 2G4C SER D 4   ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      15  49 
4 2G4C HIS D 5   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        16  50 
4 2G4C HIS D 6   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        17  51 
4 2G4C HIS D 7   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        18  52 
4 2G4C HIS D 8   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        19  53 
4 2G4C HIS D 9   ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        20  54 
4 2G4C HIS D 10  ? UNP Q9UHN1 ?   ?   'EXPRESSION TAG'        21  55 
4 2G4C GLY D 11  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      22  56 
4 2G4C SER D 12  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      23  57 
4 2G4C THR D 13  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      24  58 
4 2G4C MET D 14  ? UNP Q9UHN1 ?   ?   'CLONING ARTIFACT'      25  59 
4 2G4C THR D 158 ? UNP Q9UHN1 ALA 169 'SEE REMARK 999'        169 60 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2G4C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.36 
_exptl_crystal.density_percent_sol   47.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '10%PEG 8000, 100 mM Tris-Cl, pH 8.0, VAPOR DIFFUSION, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2004-12-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(iii)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03320 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 12.3.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   12.3.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.03320 
# 
_reflns.entry_id                     2G4C 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.15 
_reflns.number_obs                   33633 
_reflns.number_all                   34088 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              0.11 
_reflns.pdbx_netI_over_sigmaI        16.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.15 
_reflns_shell.d_res_low              3.26 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.881 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.94 
_reflns_shell.pdbx_redundancy        4.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3386 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2G4C 
_refine.ls_number_reflns_obs                     32261 
_refine.ls_number_reflns_all                     34088 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            3.15 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.217 
_refine.ls_R_factor_all                          0.217 
_refine.ls_R_factor_R_work                       0.232 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1610 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1G5H' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12816 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             31 
_refine_hist.number_atoms_total               12847 
_refine_hist.d_res_high                       3.15 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.48   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.0078 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param ? 'X-RAY DIFFRACTION' 
2 ion.param         ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2G4C 
_struct.title                     'Crystal Structure of human DNA polymerase gamma accessory subunit' 
_struct.pdbx_descriptor           'DNA polymerase gamma subunit 2 (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2G4C 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'alpha and beta protein, anti-codon binding domain-like, aaRS class II-like, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The biological assembly is likely a homodimer.' ? 
2 ?                                                ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 57  ? ARG A 65  ? ALA A 68  ARG A 76  1 ? 9  
HELX_P HELX_P2  2  SER A 76  ? SER A 82  ? SER A 87  SER A 93  1 ? 7  
HELX_P HELX_P3  3  GLY A 89  ? VAL A 108 ? GLY A 100 VAL A 119 1 ? 20 
HELX_P HELX_P4  4  ALA A 139 ? ARG A 143 ? ALA A 150 ARG A 154 1 ? 5  
HELX_P HELX_P5  5  GLU A 144 ? LEU A 146 ? GLU A 155 LEU A 157 5 ? 3  
HELX_P HELX_P6  6  GLU A 154 ? THR A 158 ? GLU A 165 THR A 169 5 ? 5  
HELX_P HELX_P7  7  PHE A 159 ? SER A 167 ? PHE A 170 SER A 178 1 ? 9  
HELX_P HELX_P8  8  LEU A 174 ? GLU A 180 ? LEU A 185 GLU A 191 1 ? 7  
HELX_P HELX_P9  9  HIS A 181 ? LEU A 188 ? HIS A 192 LEU A 199 1 ? 8  
HELX_P HELX_P10 10 PRO A 233 ? LYS A 254 ? PRO A 244 LYS A 265 1 ? 22 
HELX_P HELX_P11 11 SER A 258 ? SER A 260 ? SER A 269 SER A 271 5 ? 3  
HELX_P HELX_P12 12 ASP A 297 ? TYR A 304 ? ASP A 308 TYR A 315 1 ? 8  
HELX_P HELX_P13 13 ASN A 307 ? LEU A 311 ? ASN A 318 LEU A 322 5 ? 5  
HELX_P HELX_P14 14 LEU A 331 ? SER A 342 ? LEU A 342 SER A 353 1 ? 12 
HELX_P HELX_P15 15 GLU A 383 ? ARG A 385 ? GLU A 394 ARG A 396 5 ? 3  
HELX_P HELX_P16 16 GLN A 386 ? GLU A 397 ? GLN A 397 GLU A 408 1 ? 12 
HELX_P HELX_P17 17 LEU A 414 ? MET A 424 ? LEU A 425 MET A 435 1 ? 11 
HELX_P HELX_P18 18 THR A 433 ? GLU A 438 ? THR A 444 GLU A 449 1 ? 6  
HELX_P HELX_P19 19 LEU A 460 ? VAL A 474 ? LEU A 471 VAL A 485 1 ? 15 
HELX_P HELX_P20 20 ALA B 57  ? ARG B 65  ? ALA B 68  ARG B 76  1 ? 9  
HELX_P HELX_P21 21 SER B 76  ? SER B 82  ? SER B 87  SER B 93  1 ? 7  
HELX_P HELX_P22 22 GLY B 89  ? VAL B 108 ? GLY B 100 VAL B 119 1 ? 20 
HELX_P HELX_P23 23 ALA B 139 ? ARG B 143 ? ALA B 150 ARG B 154 1 ? 5  
HELX_P HELX_P24 24 GLU B 144 ? LEU B 146 ? GLU B 155 LEU B 157 5 ? 3  
HELX_P HELX_P25 25 GLU B 154 ? THR B 158 ? GLU B 165 THR B 169 5 ? 5  
HELX_P HELX_P26 26 PHE B 159 ? SER B 167 ? PHE B 170 SER B 178 1 ? 9  
HELX_P HELX_P27 27 LEU B 174 ? GLU B 180 ? LEU B 185 GLU B 191 1 ? 7  
HELX_P HELX_P28 28 HIS B 181 ? LEU B 188 ? HIS B 192 LEU B 199 1 ? 8  
HELX_P HELX_P29 29 PRO B 233 ? LYS B 254 ? PRO B 244 LYS B 265 1 ? 22 
HELX_P HELX_P30 30 SER B 258 ? SER B 260 ? SER B 269 SER B 271 5 ? 3  
HELX_P HELX_P31 31 ASP B 297 ? TYR B 304 ? ASP B 308 TYR B 315 1 ? 8  
HELX_P HELX_P32 32 ASN B 307 ? LEU B 311 ? ASN B 318 LEU B 322 5 ? 5  
HELX_P HELX_P33 33 LEU B 331 ? SER B 342 ? LEU B 342 SER B 353 1 ? 12 
HELX_P HELX_P34 34 GLU B 383 ? ARG B 385 ? GLU B 394 ARG B 396 5 ? 3  
HELX_P HELX_P35 35 GLN B 386 ? GLU B 397 ? GLN B 397 GLU B 408 1 ? 12 
HELX_P HELX_P36 36 LEU B 414 ? MET B 424 ? LEU B 425 MET B 435 1 ? 11 
HELX_P HELX_P37 37 THR B 433 ? GLU B 438 ? THR B 444 GLU B 449 1 ? 6  
HELX_P HELX_P38 38 LEU B 460 ? VAL B 474 ? LEU B 471 VAL B 485 1 ? 15 
HELX_P HELX_P39 39 GLU C 56  ? ARG C 65  ? GLU C 67  ARG C 76  1 ? 10 
HELX_P HELX_P40 40 SER C 76  ? GLY C 83  ? SER C 87  GLY C 94  1 ? 8  
HELX_P HELX_P41 41 GLY C 89  ? VAL C 108 ? GLY C 100 VAL C 119 1 ? 20 
HELX_P HELX_P42 42 THR C 158 ? SER C 167 ? THR C 169 SER C 178 1 ? 10 
HELX_P HELX_P43 43 LEU C 174 ? VAL C 183 ? LEU C 185 VAL C 194 1 ? 10 
HELX_P HELX_P44 44 PRO C 233 ? PHE C 255 ? PRO C 244 PHE C 266 1 ? 23 
HELX_P HELX_P45 45 SER C 258 ? SER C 260 ? SER C 269 SER C 271 5 ? 3  
HELX_P HELX_P46 46 ASP C 297 ? TYR C 304 ? ASP C 308 TYR C 315 1 ? 8  
HELX_P HELX_P47 47 VAL C 308 ? HIS C 312 ? VAL C 319 HIS C 323 5 ? 5  
HELX_P HELX_P48 48 LEU C 331 ? SER C 342 ? LEU C 342 SER C 353 1 ? 12 
HELX_P HELX_P49 49 HIS C 364 ? ALA C 368 ? HIS C 375 ALA C 379 5 ? 5  
HELX_P HELX_P50 50 LEU C 384 ? GLU C 397 ? LEU C 395 GLU C 408 1 ? 14 
HELX_P HELX_P51 51 LEU C 414 ? MET C 424 ? LEU C 425 MET C 435 1 ? 11 
HELX_P HELX_P52 52 THR C 433 ? GLU C 438 ? THR C 444 GLU C 449 1 ? 6  
HELX_P HELX_P53 53 LYS C 459 ? LYS C 472 ? LYS C 470 LYS C 483 1 ? 14 
HELX_P HELX_P54 54 GLU D 56  ? ARG D 65  ? GLU D 67  ARG D 76  1 ? 10 
HELX_P HELX_P55 55 SER D 76  ? GLY D 83  ? SER D 87  GLY D 94  1 ? 8  
HELX_P HELX_P56 56 GLY D 89  ? VAL D 108 ? GLY D 100 VAL D 119 1 ? 20 
HELX_P HELX_P57 57 THR D 158 ? SER D 167 ? THR D 169 SER D 178 1 ? 10 
HELX_P HELX_P58 58 LEU D 174 ? VAL D 183 ? LEU D 185 VAL D 194 1 ? 10 
HELX_P HELX_P59 59 PRO D 233 ? PHE D 255 ? PRO D 244 PHE D 266 1 ? 23 
HELX_P HELX_P60 60 SER D 258 ? SER D 260 ? SER D 269 SER D 271 5 ? 3  
HELX_P HELX_P61 61 ASP D 297 ? TYR D 304 ? ASP D 308 TYR D 315 1 ? 8  
HELX_P HELX_P62 62 VAL D 308 ? HIS D 312 ? VAL D 319 HIS D 323 5 ? 5  
HELX_P HELX_P63 63 LEU D 331 ? SER D 342 ? LEU D 342 SER D 353 1 ? 12 
HELX_P HELX_P64 64 HIS D 364 ? ALA D 368 ? HIS D 375 ALA D 379 5 ? 5  
HELX_P HELX_P65 65 LEU D 384 ? GLU D 397 ? LEU D 395 GLU D 408 1 ? 14 
HELX_P HELX_P66 66 LEU D 414 ? MET D 424 ? LEU D 425 MET D 435 1 ? 11 
HELX_P HELX_P67 67 THR D 433 ? GLU D 438 ? THR D 444 GLU D 449 1 ? 6  
HELX_P HELX_P68 68 LYS D 459 ? LYS D 472 ? LYS D 470 LYS D 483 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 193 A . ? LEU 204 A PRO 194 A ? PRO 205 A 1 0.47  
2 LEU 193 B . ? LEU 204 B PRO 194 B ? PRO 205 B 1 0.38  
3 LEU 193 C . ? LEU 204 C PRO 194 C ? PRO 205 C 1 -0.18 
4 LEU 193 D . ? LEU 204 D PRO 194 D ? PRO 205 D 1 -0.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 4 ? 
F ? 7 ? 
G ? 6 ? 
H ? 2 ? 
I ? 4 ? 
J ? 7 ? 
K ? 2 ? 
L ? 3 ? 
M ? 2 ? 
N ? 7 ? 
O ? 2 ? 
P ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
J 6 7 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
N 5 6 ? anti-parallel 
N 6 7 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? parallel      
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 114 ? PRO A 116 ? VAL A 125 PRO A 127 
A 2 GLY A 196 ? PRO A 206 ? GLY A 207 PRO A 217 
A 3 ILE A 220 ? THR A 232 ? ILE A 231 THR A 243 
A 4 CYS A 323 ? ASP A 330 ? CYS A 334 ASP A 341 
A 5 GLY A 285 ? ASN A 294 ? GLY A 296 ASN A 305 
A 6 LYS A 277 ? PHE A 282 ? LYS A 288 PHE A 293 
A 7 PHE A 262 ? SER A 265 ? PHE A 273 SER A 276 
B 1 HIS A 122 ? LYS A 123 ? HIS A 133 LYS A 134 
B 2 LYS A 169 ? LEU A 170 ? LYS A 180 LEU A 181 
C 1 ARG A 135 ? SER A 138 ? ARG A 146 SER A 149 
C 2 PHE C 134 ? VAL C 137 ? PHE C 145 VAL C 148 
C 3 GLY C 168 ? LEU C 170 ? GLY C 179 LEU C 181 
C 4 HIS C 122 ? LYS C 123 ? HIS C 133 LYS C 134 
D 1 GLY A 313 ? ARG A 314 ? GLY A 324 ARG A 325 
D 2 ASN A 319 ? VAL A 320 ? ASN A 330 VAL A 331 
E 1 VAL A 402 ? PRO A 404 ? VAL A 413 PRO A 415 
E 2 VAL A 372 ? VAL A 376 ? VAL A 383 VAL A 387 
E 3 PHE A 428 ? VAL A 432 ? PHE A 439 VAL A 443 
E 4 ARG A 445 ? SER A 446 ? ARG A 456 SER A 457 
F 1 VAL B 114 ? PRO B 116 ? VAL B 125 PRO B 127 
F 2 GLY B 196 ? PRO B 206 ? GLY B 207 PRO B 217 
F 3 ILE B 220 ? THR B 232 ? ILE B 231 THR B 243 
F 4 CYS B 323 ? ASP B 330 ? CYS B 334 ASP B 341 
F 5 GLY B 285 ? ASN B 294 ? GLY B 296 ASN B 305 
F 6 LYS B 277 ? PHE B 282 ? LYS B 288 PHE B 293 
F 7 PHE B 262 ? SER B 265 ? PHE B 273 SER B 276 
G 1 HIS B 122 ? LYS B 123 ? HIS B 133 LYS B 134 
G 2 GLY B 168 ? LEU B 170 ? GLY B 179 LEU B 181 
G 3 ARG B 135 ? SER B 138 ? ARG B 146 SER B 149 
G 4 PHE D 134 ? VAL D 137 ? PHE D 145 VAL D 148 
G 5 GLY D 168 ? LEU D 170 ? GLY D 179 LEU D 181 
G 6 HIS D 122 ? LYS D 123 ? HIS D 133 LYS D 134 
H 1 GLY B 313 ? ARG B 314 ? GLY B 324 ARG B 325 
H 2 ASN B 319 ? VAL B 320 ? ASN B 330 VAL B 331 
I 1 VAL B 402 ? PRO B 404 ? VAL B 413 PRO B 415 
I 2 VAL B 372 ? VAL B 376 ? VAL B 383 VAL B 387 
I 3 PHE B 428 ? VAL B 432 ? PHE B 439 VAL B 443 
I 4 ARG B 445 ? SER B 446 ? ARG B 456 SER B 457 
J 1 PHE C 115 ? PRO C 116 ? PHE C 126 PRO C 127 
J 2 TYR C 195 ? PHE C 204 ? TYR C 206 PHE C 215 
J 3 GLU C 222 ? THR C 232 ? GLU C 233 THR C 243 
J 4 CYS C 323 ? ASP C 330 ? CYS C 334 ASP C 341 
J 5 GLU C 287 ? GLY C 296 ? GLU C 298 GLY C 307 
J 6 LYS C 277 ? TYR C 280 ? LYS C 288 TYR C 291 
J 7 PHE C 262 ? SER C 263 ? PHE C 273 SER C 274 
K 1 GLY C 313 ? ASP C 315 ? GLY C 324 ASP C 326 
K 2 LYS C 318 ? VAL C 320 ? LYS C 329 VAL C 331 
L 1 VAL C 402 ? PRO C 404 ? VAL C 413 PRO C 415 
L 2 VAL C 372 ? VAL C 376 ? VAL C 383 VAL C 387 
L 3 PHE C 428 ? VAL C 432 ? PHE C 439 VAL C 443 
M 1 ILE C 442 ? LEU C 444 ? ILE C 453 LEU C 455 
M 2 GLU C 453 ? MET C 455 ? GLU C 464 MET C 466 
N 1 PHE D 115 ? PRO D 116 ? PHE D 126 PRO D 127 
N 2 TYR D 195 ? PHE D 204 ? TYR D 206 PHE D 215 
N 3 GLU D 222 ? THR D 232 ? GLU D 233 THR D 243 
N 4 CYS D 323 ? ASP D 330 ? CYS D 334 ASP D 341 
N 5 GLU D 287 ? GLY D 296 ? GLU D 298 GLY D 307 
N 6 LYS D 277 ? TYR D 280 ? LYS D 288 TYR D 291 
N 7 PHE D 262 ? SER D 263 ? PHE D 273 SER D 274 
O 1 GLY D 313 ? ASP D 315 ? GLY D 324 ASP D 326 
O 2 LYS D 318 ? VAL D 320 ? LYS D 329 VAL D 331 
P 1 VAL D 402 ? PRO D 404 ? VAL D 413 PRO D 415 
P 2 VAL D 372 ? VAL D 376 ? VAL D 383 VAL D 387 
P 3 PHE D 428 ? VAL D 432 ? PHE D 439 VAL D 443 
P 4 ILE D 442 ? LEU D 444 ? ILE D 453 LEU D 455 
P 5 GLU D 453 ? MET D 455 ? GLU D 464 MET D 466 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 115 ? N PHE A 126 O GLY A 196 ? O GLY A 207 
A 2 3 N GLN A 199 ? N GLN A 210 O SER A 227 ? O SER A 238 
A 3 4 N THR A 232 ? N THR A 243 O CYS A 323 ? O CYS A 334 
A 4 5 O ASP A 330 ? O ASP A 341 N ILE A 289 ? N ILE A 300 
A 5 6 O GLY A 285 ? O GLY A 296 N PHE A 282 ? N PHE A 293 
A 6 7 O TYR A 279 ? O TYR A 290 N SER A 263 ? N SER A 274 
B 1 2 N LYS A 123 ? N LYS A 134 O LYS A 169 ? O LYS A 180 
C 1 2 N VAL A 137 ? N VAL A 148 O ARG C 135 ? O ARG C 146 
C 2 3 N PHE C 134 ? N PHE C 145 O LEU C 170 ? O LEU C 181 
C 3 4 O LYS C 169 ? O LYS C 180 N LYS C 123 ? N LYS C 134 
D 1 2 N GLY A 313 ? N GLY A 324 O VAL A 320 ? O VAL A 331 
E 1 2 O TRP A 403 ? O TRP A 414 N VAL A 372 ? N VAL A 383 
E 2 3 N ASP A 375 ? N ASP A 386 O VAL A 432 ? O VAL A 443 
E 3 4 N THR A 429 ? N THR A 440 O ARG A 445 ? O ARG A 456 
F 1 2 N PHE B 115 ? N PHE B 126 O GLY B 196 ? O GLY B 207 
F 2 3 N GLN B 199 ? N GLN B 210 O SER B 227 ? O SER B 238 
F 3 4 N THR B 232 ? N THR B 243 O CYS B 323 ? O CYS B 334 
F 4 5 O ASP B 330 ? O ASP B 341 N ILE B 289 ? N ILE B 300 
F 5 6 O GLY B 285 ? O GLY B 296 N PHE B 282 ? N PHE B 293 
F 6 7 O TYR B 279 ? O TYR B 290 N SER B 263 ? N SER B 274 
G 1 2 N LYS B 123 ? N LYS B 134 O LYS B 169 ? O LYS B 180 
G 2 3 O GLY B 168 ? O GLY B 179 N LEU B 136 ? N LEU B 147 
G 3 4 N VAL B 137 ? N VAL B 148 O ARG D 135 ? O ARG D 146 
G 4 5 N PHE D 134 ? N PHE D 145 O LEU D 170 ? O LEU D 181 
G 5 6 O LYS D 169 ? O LYS D 180 N LYS D 123 ? N LYS D 134 
H 1 2 N GLY B 313 ? N GLY B 324 O VAL B 320 ? O VAL B 331 
I 1 2 O TRP B 403 ? O TRP B 414 N VAL B 372 ? N VAL B 383 
I 2 3 N ASP B 375 ? N ASP B 386 O VAL B 432 ? O VAL B 443 
I 3 4 N THR B 429 ? N THR B 440 O ARG B 445 ? O ARG B 456 
J 1 2 N PHE C 115 ? N PHE C 126 O GLY C 196 ? O GLY C 207 
J 2 3 N GLY C 201 ? N GLY C 212 O GLU C 225 ? O GLU C 236 
J 3 4 N LEU C 228 ? N LEU C 239 O VAL C 327 ? O VAL C 338 
J 4 5 O ASP C 330 ? O ASP C 341 N ILE C 289 ? N ILE C 300 
J 5 6 O GLU C 290 ? O GLU C 301 N LEU C 278 ? N LEU C 289 
J 6 7 O TYR C 279 ? O TYR C 290 N SER C 263 ? N SER C 274 
K 1 2 N GLY C 313 ? N GLY C 324 O VAL C 320 ? O VAL C 331 
L 1 2 O TRP C 403 ? O TRP C 414 N VAL C 372 ? N VAL C 383 
L 2 3 N ALA C 373 ? N ALA C 384 O PHE C 428 ? O PHE C 439 
M 1 2 N ILE C 442 ? N ILE C 453 O MET C 455 ? O MET C 466 
N 1 2 N PHE D 115 ? N PHE D 126 O GLY D 196 ? O GLY D 207 
N 2 3 N GLY D 201 ? N GLY D 212 O GLU D 225 ? O GLU D 236 
N 3 4 N LEU D 228 ? N LEU D 239 O VAL D 327 ? O VAL D 338 
N 4 5 O ASP D 330 ? O ASP D 341 N ILE D 289 ? N ILE D 300 
N 5 6 O GLU D 290 ? O GLU D 301 N LEU D 278 ? N LEU D 289 
N 6 7 O TYR D 279 ? O TYR D 290 N SER D 263 ? N SER D 274 
O 1 2 N GLY D 313 ? N GLY D 324 O VAL D 320 ? O VAL D 331 
P 1 2 O TRP D 403 ? O TRP D 414 N VAL D 372 ? N VAL D 383 
P 2 3 N ALA D 373 ? N ALA D 384 O PHE D 428 ? O PHE D 439 
P 3 4 N LEU D 431 ? N LEU D 442 O HIS D 443 ? O HIS D 454 
P 4 5 N ILE D 442 ? N ILE D 453 O MET D 455 ? O MET D 466 
# 
_database_PDB_matrix.entry_id          2G4C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2G4C 
_atom_sites.fract_transf_matrix[1][1]   0.009824 
_atom_sites.fract_transf_matrix[1][2]   0.005672 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011344 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005873 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A 1 55  ? -44.986 -13.369 9.081   1.00 108.37 ? 66   SER A N   1 
ATOM   2     C CA  . SER A 1 55  ? -43.512 -13.131 9.076   1.00 108.37 ? 66   SER A CA  1 
ATOM   3     C C   . SER A 1 55  ? -42.933 -13.199 7.662   1.00 108.37 ? 66   SER A C   1 
ATOM   4     O O   . SER A 1 55  ? -43.447 -13.913 6.801   1.00 108.37 ? 66   SER A O   1 
ATOM   5     C CB  . SER A 1 55  ? -42.813 -14.162 9.972   1.00 82.51  ? 66   SER A CB  1 
ATOM   6     O OG  . SER A 1 55  ? -41.402 -14.047 9.891   1.00 82.51  ? 66   SER A OG  1 
ATOM   7     N N   . GLU A 1 56  ? -41.861 -12.446 7.429   1.00 126.42 ? 67   GLU A N   1 
ATOM   8     C CA  . GLU A 1 56  ? -41.220 -12.433 6.122   1.00 126.42 ? 67   GLU A CA  1 
ATOM   9     C C   . GLU A 1 56  ? -39.696 -12.453 6.246   1.00 126.42 ? 67   GLU A C   1 
ATOM   10    O O   . GLU A 1 56  ? -39.130 -11.989 7.240   1.00 126.42 ? 67   GLU A O   1 
ATOM   11    C CB  . GLU A 1 56  ? -41.668 -11.201 5.319   1.00 68.68  ? 67   GLU A CB  1 
ATOM   12    C CG  . GLU A 1 56  ? -40.948 -9.911  5.657   1.00 68.68  ? 67   GLU A CG  1 
ATOM   13    C CD  . GLU A 1 56  ? -41.072 -9.530  7.119   1.00 68.68  ? 67   GLU A CD  1 
ATOM   14    O OE1 . GLU A 1 56  ? -42.203 -9.595  7.658   1.00 68.68  ? 67   GLU A OE1 1 
ATOM   15    O OE2 . GLU A 1 56  ? -40.040 -9.151  7.722   1.00 68.68  ? 67   GLU A OE2 1 
ATOM   16    N N   . ALA A 1 57  ? -39.039 -13.010 5.234   1.00 82.72  ? 68   ALA A N   1 
ATOM   17    C CA  . ALA A 1 57  ? -37.588 -13.092 5.216   1.00 82.72  ? 68   ALA A CA  1 
ATOM   18    C C   . ALA A 1 57  ? -37.035 -12.090 4.210   1.00 82.72  ? 68   ALA A C   1 
ATOM   19    O O   . ALA A 1 57  ? -36.341 -12.456 3.260   1.00 82.72  ? 68   ALA A O   1 
ATOM   20    C CB  . ALA A 1 57  ? -37.144 -14.499 4.857   1.00 124.04 ? 68   ALA A CB  1 
ATOM   21    N N   . LEU A 1 58  ? -37.378 -10.822 4.424   1.00 91.71  ? 69   LEU A N   1 
ATOM   22    C CA  . LEU A 1 58  ? -36.918 -9.713  3.593   1.00 91.71  ? 69   LEU A CA  1 
ATOM   23    C C   . LEU A 1 58  ? -35.730 -9.115  4.342   1.00 91.71  ? 69   LEU A C   1 
ATOM   24    O O   . LEU A 1 58  ? -34.683 -8.821  3.766   1.00 91.71  ? 69   LEU A O   1 
ATOM   25    C CB  . LEU A 1 58  ? -38.033 -8.676  3.455   1.00 51.43  ? 69   LEU A CB  1 
ATOM   26    C CG  . LEU A 1 58  ? -37.700 -7.262  2.963   1.00 51.43  ? 69   LEU A CG  1 
ATOM   27    C CD1 . LEU A 1 58  ? -37.243 -7.317  1.515   1.00 51.43  ? 69   LEU A CD1 1 
ATOM   28    C CD2 . LEU A 1 58  ? -38.938 -6.368  3.106   1.00 51.43  ? 69   LEU A CD2 1 
ATOM   29    N N   . LEU A 1 59  ? -35.908 -8.962  5.647   1.00 89.05  ? 70   LEU A N   1 
ATOM   30    C CA  . LEU A 1 59  ? -34.868 -8.424  6.503   1.00 89.05  ? 70   LEU A CA  1 
ATOM   31    C C   . LEU A 1 59  ? -33.685 -9.391  6.541   1.00 89.05  ? 70   LEU A C   1 
ATOM   32    O O   . LEU A 1 59  ? -32.682 -9.159  7.222   1.00 89.05  ? 70   LEU A O   1 
ATOM   33    C CB  . LEU A 1 59  ? -35.439 -8.183  7.904   1.00 54.06  ? 70   LEU A CB  1 
ATOM   34    C CG  . LEU A 1 59  ? -36.223 -6.877  8.104   1.00 54.06  ? 70   LEU A CG  1 
ATOM   35    C CD1 . LEU A 1 59  ? -36.763 -6.368  6.778   1.00 54.06  ? 70   LEU A CD1 1 
ATOM   36    C CD2 . LEU A 1 59  ? -37.354 -7.100  9.103   1.00 54.06  ? 70   LEU A CD2 1 
ATOM   37    N N   . GLU A 1 60  ? -33.814 -10.481 5.797   1.00 85.01  ? 71   GLU A N   1 
ATOM   38    C CA  . GLU A 1 60  ? -32.757 -11.475 5.714   1.00 85.01  ? 71   GLU A CA  1 
ATOM   39    C C   . GLU A 1 60  ? -31.936 -11.068 4.507   1.00 85.01  ? 71   GLU A C   1 
ATOM   40    O O   . GLU A 1 60  ? -30.729 -10.849 4.595   1.00 85.01  ? 71   GLU A O   1 
ATOM   41    C CB  . GLU A 1 60  ? -33.345 -12.870 5.475   1.00 201.99 ? 71   GLU A CB  1 
ATOM   42    C CG  . GLU A 1 60  ? -34.154 -13.452 6.628   1.00 201.99 ? 71   GLU A CG  1 
ATOM   43    C CD  . GLU A 1 60  ? -33.284 -13.930 7.776   1.00 201.99 ? 71   GLU A CD  1 
ATOM   44    O OE1 . GLU A 1 60  ? -33.822 -14.569 8.704   1.00 201.99 ? 71   GLU A OE1 1 
ATOM   45    O OE2 . GLU A 1 60  ? -32.064 -13.667 7.751   1.00 201.99 ? 71   GLU A OE2 1 
ATOM   46    N N   . ILE A 1 61  ? -32.621 -10.969 3.374   1.00 57.38  ? 72   ILE A N   1 
ATOM   47    C CA  . ILE A 1 61  ? -31.996 -10.585 2.122   1.00 57.38  ? 72   ILE A CA  1 
ATOM   48    C C   . ILE A 1 61  ? -31.354 -9.225  2.341   1.00 57.38  ? 72   ILE A C   1 
ATOM   49    O O   . ILE A 1 61  ? -30.189 -9.015  1.996   1.00 57.38  ? 72   ILE A O   1 
ATOM   50    C CB  . ILE A 1 61  ? -33.055 -10.504 0.999   1.00 56.70  ? 72   ILE A CB  1 
ATOM   51    C CG1 . ILE A 1 61  ? -33.650 -11.894 0.759   1.00 56.70  ? 72   ILE A CG1 1 
ATOM   52    C CG2 . ILE A 1 61  ? -32.449 -9.946  -0.277  1.00 56.70  ? 72   ILE A CG2 1 
ATOM   53    C CD1 . ILE A 1 61  ? -34.948 -11.867 -0.028  1.00 56.70  ? 72   ILE A CD1 1 
ATOM   54    N N   . CYS A 1 62  ? -32.116 -8.315  2.943   1.00 60.69  ? 73   CYS A N   1 
ATOM   55    C CA  . CYS A 1 62  ? -31.641 -6.961  3.223   1.00 60.69  ? 73   CYS A CA  1 
ATOM   56    C C   . CYS A 1 62  ? -30.333 -6.918  4.021   1.00 60.69  ? 73   CYS A C   1 
ATOM   57    O O   . CYS A 1 62  ? -29.603 -5.920  3.974   1.00 60.69  ? 73   CYS A O   1 
ATOM   58    C CB  . CYS A 1 62  ? -32.725 -6.167  3.958   1.00 88.70  ? 73   CYS A CB  1 
ATOM   59    S SG  . CYS A 1 62  ? -34.124 -5.681  2.912   1.00 88.70  ? 73   CYS A SG  1 
ATOM   60    N N   . GLN A 1 63  ? -30.052 -7.993  4.761   1.00 67.17  ? 74   GLN A N   1 
ATOM   61    C CA  . GLN A 1 63  ? -28.826 -8.097  5.545   1.00 67.17  ? 74   GLN A CA  1 
ATOM   62    C C   . GLN A 1 63  ? -27.733 -8.638  4.635   1.00 67.17  ? 74   GLN A C   1 
ATOM   63    O O   . GLN A 1 63  ? -26.671 -8.039  4.503   1.00 67.17  ? 74   GLN A O   1 
ATOM   64    C CB  . GLN A 1 63  ? -29.007 -9.052  6.722   1.00 172.84 ? 74   GLN A CB  1 
ATOM   65    C CG  . GLN A 1 63  ? -27.699 -9.386  7.420   1.00 172.84 ? 74   GLN A CG  1 
ATOM   66    C CD  . GLN A 1 63  ? -27.844 -10.480 8.458   1.00 172.84 ? 74   GLN A CD  1 
ATOM   67    O OE1 . GLN A 1 63  ? -28.489 -10.293 9.491   1.00 172.84 ? 74   GLN A OE1 1 
ATOM   68    N NE2 . GLN A 1 63  ? -27.245 -11.635 8.186   1.00 172.84 ? 74   GLN A NE2 1 
ATOM   69    N N   . ARG A 1 64  ? -28.009 -9.765  3.989   1.00 83.43  ? 75   ARG A N   1 
ATOM   70    C CA  . ARG A 1 64  ? -27.040 -10.392 3.095   1.00 83.43  ? 75   ARG A CA  1 
ATOM   71    C C   . ARG A 1 64  ? -26.623 -9.518  1.917   1.00 83.43  ? 75   ARG A C   1 
ATOM   72    O O   . ARG A 1 64  ? -25.523 -9.680  1.387   1.00 83.43  ? 75   ARG A O   1 
ATOM   73    C CB  . ARG A 1 64  ? -27.587 -11.733 2.583   1.00 115.52 ? 75   ARG A CB  1 
ATOM   74    C CG  . ARG A 1 64  ? -27.550 -12.856 3.620   1.00 115.52 ? 75   ARG A CG  1 
ATOM   75    C CD  . ARG A 1 64  ? -28.640 -13.892 3.376   1.00 115.52 ? 75   ARG A CD  1 
ATOM   76    N NE  . ARG A 1 64  ? -28.605 -14.965 4.367   1.00 115.52 ? 75   ARG A NE  1 
ATOM   77    C CZ  . ARG A 1 64  ? -29.597 -15.826 4.579   1.00 115.52 ? 75   ARG A CZ  1 
ATOM   78    N NH1 . ARG A 1 64  ? -30.719 -15.743 3.874   1.00 115.52 ? 75   ARG A NH1 1 
ATOM   79    N NH2 . ARG A 1 64  ? -29.463 -16.778 5.493   1.00 115.52 ? 75   ARG A NH2 1 
ATOM   80    N N   . ARG A 1 65  ? -27.485 -8.592  1.507   1.00 54.62  ? 76   ARG A N   1 
ATOM   81    C CA  . ARG A 1 65  ? -27.153 -7.720  0.383   1.00 54.62  ? 76   ARG A CA  1 
ATOM   82    C C   . ARG A 1 65  ? -26.808 -6.270  0.736   1.00 54.62  ? 76   ARG A C   1 
ATOM   83    O O   . ARG A 1 65  ? -26.829 -5.394  -0.132  1.00 54.62  ? 76   ARG A O   1 
ATOM   84    C CB  . ARG A 1 65  ? -28.272 -7.757  -0.663  1.00 96.38  ? 76   ARG A CB  1 
ATOM   85    C CG  . ARG A 1 65  ? -28.442 -9.128  -1.301  1.00 96.38  ? 76   ARG A CG  1 
ATOM   86    C CD  . ARG A 1 65  ? -27.089 -9.702  -1.684  1.00 96.38  ? 76   ARG A CD  1 
ATOM   87    N NE  . ARG A 1 65  ? -27.108 -11.156 -1.809  1.00 96.38  ? 76   ARG A NE  1 
ATOM   88    C CZ  . ARG A 1 65  ? -26.033 -11.928 -1.681  1.00 96.38  ? 76   ARG A CZ  1 
ATOM   89    N NH1 . ARG A 1 65  ? -24.847 -11.386 -1.422  1.00 96.38  ? 76   ARG A NH1 1 
ATOM   90    N NH2 . ARG A 1 65  ? -26.141 -13.243 -1.806  1.00 96.38  ? 76   ARG A NH2 1 
ATOM   91    N N   . HIS A 1 66  ? -26.472 -6.038  2.006   1.00 38.99  ? 77   HIS A N   1 
ATOM   92    C CA  . HIS A 1 66  ? -26.087 -4.721  2.505   1.00 38.99  ? 77   HIS A CA  1 
ATOM   93    C C   . HIS A 1 66  ? -27.084 -3.582  2.320   1.00 38.99  ? 77   HIS A C   1 
ATOM   94    O O   . HIS A 1 66  ? -26.709 -2.461  1.982   1.00 38.99  ? 77   HIS A O   1 
ATOM   95    C CB  . HIS A 1 66  ? -24.749 -4.326  1.902   1.00 71.47  ? 77   HIS A CB  1 
ATOM   96    C CG  . HIS A 1 66  ? -23.632 -5.229  2.308   1.00 71.47  ? 77   HIS A CG  1 
ATOM   97    N ND1 . HIS A 1 66  ? -23.732 -6.601  2.253   1.00 71.47  ? 77   HIS A ND1 1 
ATOM   98    C CD2 . HIS A 1 66  ? -22.394 -4.960  2.782   1.00 71.47  ? 77   HIS A CD2 1 
ATOM   99    C CE1 . HIS A 1 66  ? -22.603 -7.140  2.676   1.00 71.47  ? 77   HIS A CE1 1 
ATOM   100   N NE2 . HIS A 1 66  ? -21.774 -6.166  3.003   1.00 71.47  ? 77   HIS A NE2 1 
ATOM   101   N N   . PHE A 1 67  ? -28.363 -3.872  2.527   1.00 75.25  ? 78   PHE A N   1 
ATOM   102   C CA  . PHE A 1 67  ? -29.367 -2.829  2.439   1.00 75.25  ? 78   PHE A CA  1 
ATOM   103   C C   . PHE A 1 67  ? -29.405 -2.291  3.847   1.00 75.25  ? 78   PHE A C   1 
ATOM   104   O O   . PHE A 1 67  ? -29.028 -1.151  4.085   1.00 75.25  ? 78   PHE A O   1 
ATOM   105   C CB  . PHE A 1 67  ? -30.722 -3.397  2.035   1.00 54.75  ? 78   PHE A CB  1 
ATOM   106   C CG  . PHE A 1 67  ? -30.977 -3.332  0.561   1.00 54.75  ? 78   PHE A CG  1 
ATOM   107   C CD1 . PHE A 1 67  ? -31.194 -2.108  -0.060  1.00 54.75  ? 78   PHE A CD1 1 
ATOM   108   C CD2 . PHE A 1 67  ? -30.953 -4.487  -0.217  1.00 54.75  ? 78   PHE A CD2 1 
ATOM   109   C CE1 . PHE A 1 67  ? -31.379 -2.033  -1.428  1.00 54.75  ? 78   PHE A CE1 1 
ATOM   110   C CE2 . PHE A 1 67  ? -31.136 -4.419  -1.579  1.00 54.75  ? 78   PHE A CE2 1 
ATOM   111   C CZ  . PHE A 1 67  ? -31.349 -3.187  -2.189  1.00 54.75  ? 78   PHE A CZ  1 
ATOM   112   N N   . LEU A 1 68  ? -29.839 -3.128  4.784   1.00 58.47  ? 79   LEU A N   1 
ATOM   113   C CA  . LEU A 1 68  ? -29.882 -2.748  6.197   1.00 58.47  ? 79   LEU A CA  1 
ATOM   114   C C   . LEU A 1 68  ? -28.561 -3.210  6.799   1.00 58.47  ? 79   LEU A C   1 
ATOM   115   O O   . LEU A 1 68  ? -27.892 -4.077  6.243   1.00 58.47  ? 79   LEU A O   1 
ATOM   116   C CB  . LEU A 1 68  ? -31.038 -3.437  6.946   1.00 66.88  ? 79   LEU A CB  1 
ATOM   117   C CG  . LEU A 1 68  ? -32.487 -2.953  6.849   1.00 66.88  ? 79   LEU A CG  1 
ATOM   118   C CD1 . LEU A 1 68  ? -32.530 -1.479  7.182   1.00 66.88  ? 79   LEU A CD1 1 
ATOM   119   C CD2 . LEU A 1 68  ? -33.047 -3.203  5.465   1.00 66.88  ? 79   LEU A CD2 1 
ATOM   120   N N   . SER A 1 69  ? -28.192 -2.641  7.940   1.00 110.37 ? 80   SER A N   1 
ATOM   121   C CA  . SER A 1 69  ? -26.941 -3.004  8.586   1.00 110.37 ? 80   SER A CA  1 
ATOM   122   C C   . SER A 1 69  ? -27.178 -3.435  10.034  1.00 110.37 ? 80   SER A C   1 
ATOM   123   O O   . SER A 1 69  ? -28.225 -3.141  10.611  1.00 110.37 ? 80   SER A O   1 
ATOM   124   C CB  . SER A 1 69  ? -25.975 -1.815  8.527   1.00 94.19  ? 80   SER A CB  1 
ATOM   125   O OG  . SER A 1 69  ? -24.701 -2.152  9.039   1.00 94.19  ? 80   SER A OG  1 
ATOM   126   N N   . GLY A 1 70  ? -26.208 -4.145  10.605  1.00 128.07 ? 81   GLY A N   1 
ATOM   127   C CA  . GLY A 1 70  ? -26.323 -4.601  11.980  1.00 128.07 ? 81   GLY A CA  1 
ATOM   128   C C   . GLY A 1 70  ? -26.644 -6.077  12.139  1.00 128.07 ? 81   GLY A C   1 
ATOM   129   O O   . GLY A 1 70  ? -26.845 -6.790  11.157  1.00 128.07 ? 81   GLY A O   1 
ATOM   130   N N   . SER A 1 71  ? -26.698 -6.536  13.386  1.00 136.51 ? 82   SER A N   1 
ATOM   131   C CA  . SER A 1 71  ? -26.996 -7.932  13.678  1.00 136.51 ? 82   SER A CA  1 
ATOM   132   C C   . SER A 1 71  ? -28.450 -8.294  13.379  1.00 136.51 ? 82   SER A C   1 
ATOM   133   O O   . SER A 1 71  ? -29.155 -7.561  12.688  1.00 136.51 ? 82   SER A O   1 
ATOM   134   C CB  . SER A 1 71  ? -26.678 -8.239  15.143  1.00 110.51 ? 82   SER A CB  1 
ATOM   135   O OG  . SER A 1 71  ? -25.286 -8.144  15.385  1.00 110.51 ? 82   SER A OG  1 
ATOM   136   N N   . LYS A 1 72  ? -28.887 -9.434  13.903  1.00 101.33 ? 83   LYS A N   1 
ATOM   137   C CA  . LYS A 1 72  ? -30.247 -9.909  13.694  1.00 101.33 ? 83   LYS A CA  1 
ATOM   138   C C   . LYS A 1 72  ? -31.068 -9.683  14.961  1.00 101.33 ? 83   LYS A C   1 
ATOM   139   O O   . LYS A 1 72  ? -32.209 -10.143 15.069  1.00 101.33 ? 83   LYS A O   1 
ATOM   140   C CB  . LYS A 1 72  ? -30.215 -11.396 13.338  1.00 141.33 ? 83   LYS A CB  1 
ATOM   141   C CG  . LYS A 1 72  ? -29.321 -11.722 12.146  1.00 141.33 ? 83   LYS A CG  1 
ATOM   142   C CD  . LYS A 1 72  ? -29.120 -13.228 11.972  1.00 141.33 ? 83   LYS A CD  1 
ATOM   143   C CE  . LYS A 1 72  ? -30.435 -13.962 11.704  1.00 141.33 ? 83   LYS A CE  1 
ATOM   144   N NZ  . LYS A 1 72  ? -30.251 -15.438 11.555  1.00 141.33 ? 83   LYS A NZ  1 
ATOM   145   N N   . GLN A 1 73  ? -30.468 -8.969  15.915  1.00 168.61 ? 84   GLN A N   1 
ATOM   146   C CA  . GLN A 1 73  ? -31.102 -8.642  17.195  1.00 168.61 ? 84   GLN A CA  1 
ATOM   147   C C   . GLN A 1 73  ? -31.181 -7.119  17.367  1.00 168.61 ? 84   GLN A C   1 
ATOM   148   O O   . GLN A 1 73  ? -32.141 -6.601  17.942  1.00 168.61 ? 84   GLN A O   1 
ATOM   149   C CB  . GLN A 1 73  ? -30.302 -9.252  18.356  1.00 172.86 ? 84   GLN A CB  1 
ATOM   150   C CG  . GLN A 1 73  ? -30.881 -8.995  19.752  1.00 172.86 ? 84   GLN A CG  1 
ATOM   151   C CD  . GLN A 1 73  ? -31.911 -10.032 20.180  1.00 172.86 ? 84   GLN A CD  1 
ATOM   152   O OE1 . GLN A 1 73  ? -32.485 -9.940  21.267  1.00 172.86 ? 84   GLN A OE1 1 
ATOM   153   N NE2 . GLN A 1 73  ? -32.143 -11.027 19.331  1.00 172.86 ? 84   GLN A NE2 1 
ATOM   154   N N   . GLN A 1 74  ? -30.163 -6.410  16.876  1.00 109.56 ? 85   GLN A N   1 
ATOM   155   C CA  . GLN A 1 74  ? -30.136 -4.953  16.961  1.00 109.56 ? 85   GLN A CA  1 
ATOM   156   C C   . GLN A 1 74  ? -30.883 -4.318  15.775  1.00 109.56 ? 85   GLN A C   1 
ATOM   157   O O   . GLN A 1 74  ? -31.099 -3.102  15.732  1.00 109.56 ? 85   GLN A O   1 
ATOM   158   C CB  . GLN A 1 74  ? -28.684 -4.442  17.064  1.00 71.35  ? 85   GLN A CB  1 
ATOM   159   C CG  . GLN A 1 74  ? -27.664 -5.027  16.081  1.00 71.35  ? 85   GLN A CG  1 
ATOM   160   C CD  . GLN A 1 74  ? -26.237 -4.526  16.354  1.00 71.35  ? 85   GLN A CD  1 
ATOM   161   O OE1 . GLN A 1 74  ? -25.304 -4.818  15.609  1.00 71.35  ? 85   GLN A OE1 1 
ATOM   162   N NE2 . GLN A 1 74  ? -26.073 -3.773  17.431  1.00 71.35  ? 85   GLN A NE2 1 
ATOM   163   N N   . LEU A 1 75  ? -31.277 -5.165  14.823  1.00 149.23 ? 86   LEU A N   1 
ATOM   164   C CA  . LEU A 1 75  ? -32.049 -4.749  13.649  1.00 149.23 ? 86   LEU A CA  1 
ATOM   165   C C   . LEU A 1 75  ? -33.488 -5.188  13.916  1.00 149.23 ? 86   LEU A C   1 
ATOM   166   O O   . LEU A 1 75  ? -34.151 -5.771  13.055  1.00 149.23 ? 86   LEU A O   1 
ATOM   167   C CB  . LEU A 1 75  ? -31.537 -5.426  12.365  1.00 64.11  ? 86   LEU A CB  1 
ATOM   168   C CG  . LEU A 1 75  ? -30.474 -4.711  11.517  1.00 64.11  ? 86   LEU A CG  1 
ATOM   169   C CD1 . LEU A 1 75  ? -30.078 -5.585  10.346  1.00 64.11  ? 86   LEU A CD1 1 
ATOM   170   C CD2 . LEU A 1 75  ? -31.017 -3.398  11.009  1.00 64.11  ? 86   LEU A CD2 1 
ATOM   171   N N   . SER A 1 76  ? -33.950 -4.911  15.134  1.00 150.16 ? 87   SER A N   1 
ATOM   172   C CA  . SER A 1 76  ? -35.300 -5.259  15.560  1.00 150.16 ? 87   SER A CA  1 
ATOM   173   C C   . SER A 1 76  ? -36.332 -4.541  14.699  1.00 150.16 ? 87   SER A C   1 
ATOM   174   O O   . SER A 1 76  ? -36.015 -3.596  13.978  1.00 150.16 ? 87   SER A O   1 
ATOM   175   C CB  . SER A 1 76  ? -35.511 -4.880  17.034  1.00 161.28 ? 87   SER A CB  1 
ATOM   176   O OG  . SER A 1 76  ? -34.547 -5.488  17.878  1.00 161.28 ? 87   SER A OG  1 
ATOM   177   N N   . ARG A 1 77  ? -37.573 -4.999  14.784  1.00 93.08  ? 88   ARG A N   1 
ATOM   178   C CA  . ARG A 1 77  ? -38.662 -4.406  14.020  1.00 93.08  ? 88   ARG A CA  1 
ATOM   179   C C   . ARG A 1 77  ? -38.962 -3.054  14.652  1.00 93.08  ? 88   ARG A C   1 
ATOM   180   O O   . ARG A 1 77  ? -39.148 -2.054  13.958  1.00 93.08  ? 88   ARG A O   1 
ATOM   181   C CB  . ARG A 1 77  ? -39.917 -5.295  14.076  1.00 164.73 ? 88   ARG A CB  1 
ATOM   182   C CG  . ARG A 1 77  ? -39.674 -6.769  14.423  1.00 164.73 ? 88   ARG A CG  1 
ATOM   183   C CD  . ARG A 1 77  ? -39.154 -6.886  15.853  1.00 164.73 ? 88   ARG A CD  1 
ATOM   184   N NE  . ARG A 1 77  ? -39.346 -8.173  16.442  1.00 164.73 ? 88   ARG A NE  1 
ATOM   185   C CZ  . ARG A 1 77  ? -38.533 -9.008  17.082  1.00 164.73 ? 88   ARG A CZ  1 
ATOM   186   N NH1 . ARG A 1 77  ? -39.124 -10.109 17.489  1.00 164.73 ? 88   ARG A NH1 1 
ATOM   187   N NH2 . ARG A 1 77  ? -37.234 -8.837  17.313  1.00 164.73 ? 88   ARG A NH2 1 
ATOM   188   N N   . ASP A 1 78  ? -39.000 -3.045  15.982  1.00 103.74 ? 89   ASP A N   1 
ATOM   189   C CA  . ASP A 1 78  ? -39.270 -1.839  16.759  1.00 103.74 ? 89   ASP A CA  1 
ATOM   190   C C   . ASP A 1 78  ? -38.025 -0.945  16.741  1.00 103.74 ? 89   ASP A C   1 
ATOM   191   O O   . ASP A 1 78  ? -38.111 0.256   17.009  1.00 103.74 ? 89   ASP A O   1 
ATOM   192   C CB  . ASP A 1 78  ? -39.616 -2.205  18.214  1.00 130.19 ? 89   ASP A CB  1 
ATOM   193   C CG  . ASP A 1 78  ? -40.568 -3.398  18.325  1.00 130.19 ? 89   ASP A CG  1 
ATOM   194   O OD1 . ASP A 1 78  ? -40.184 -4.516  17.917  1.00 130.19 ? 89   ASP A OD1 1 
ATOM   195   O OD2 . ASP A 1 78  ? -41.699 -3.217  18.830  1.00 130.19 ? 89   ASP A OD2 1 
ATOM   196   N N   . SER A 1 79  ? -36.873 -1.547  16.435  1.00 62.41  ? 90   SER A N   1 
ATOM   197   C CA  . SER A 1 79  ? -35.604 -0.824  16.368  1.00 62.41  ? 90   SER A CA  1 
ATOM   198   C C   . SER A 1 79  ? -35.535 -0.138  14.999  1.00 62.41  ? 90   SER A C   1 
ATOM   199   O O   . SER A 1 79  ? -35.062 0.990   14.883  1.00 62.41  ? 90   SER A O   1 
ATOM   200   C CB  . SER A 1 79  ? -34.421 -1.797  16.555  1.00 85.59  ? 90   SER A CB  1 
ATOM   201   O OG  . SER A 1 79  ? -33.282 -1.179  17.148  1.00 85.59  ? 90   SER A OG  1 
ATOM   202   N N   . LEU A 1 80  ? -36.025 -0.818  13.966  1.00 59.68  ? 91   LEU A N   1 
ATOM   203   C CA  . LEU A 1 80  ? -36.038 -0.252  12.619  1.00 59.68  ? 91   LEU A CA  1 
ATOM   204   C C   . LEU A 1 80  ? -36.933 0.983   12.510  1.00 59.68  ? 91   LEU A C   1 
ATOM   205   O O   . LEU A 1 80  ? -36.577 1.966   11.863  1.00 59.68  ? 91   LEU A O   1 
ATOM   206   C CB  . LEU A 1 80  ? -36.503 -1.296  11.601  1.00 53.12  ? 91   LEU A CB  1 
ATOM   207   C CG  . LEU A 1 80  ? -35.427 -2.215  11.009  1.00 53.12  ? 91   LEU A CG  1 
ATOM   208   C CD1 . LEU A 1 80  ? -36.029 -3.029  9.877   1.00 53.12  ? 91   LEU A CD1 1 
ATOM   209   C CD2 . LEU A 1 80  ? -34.259 -1.384  10.478  1.00 53.12  ? 91   LEU A CD2 1 
ATOM   210   N N   . LEU A 1 81  ? -38.098 0.923   13.141  1.00 66.49  ? 92   LEU A N   1 
ATOM   211   C CA  . LEU A 1 81  ? -39.042 2.027   13.120  1.00 66.49  ? 92   LEU A CA  1 
ATOM   212   C C   . LEU A 1 81  ? -38.753 3.160   14.109  1.00 66.49  ? 92   LEU A C   1 
ATOM   213   O O   . LEU A 1 81  ? -39.160 4.296   13.878  1.00 66.49  ? 92   LEU A O   1 
ATOM   214   C CB  . LEU A 1 81  ? -40.453 1.510   13.382  1.00 54.75  ? 92   LEU A CB  1 
ATOM   215   C CG  . LEU A 1 81  ? -41.238 0.852   12.257  1.00 54.75  ? 92   LEU A CG  1 
ATOM   216   C CD1 . LEU A 1 81  ? -42.649 0.561   12.748  1.00 54.75  ? 92   LEU A CD1 1 
ATOM   217   C CD2 . LEU A 1 81  ? -41.286 1.778   11.056  1.00 54.75  ? 92   LEU A CD2 1 
ATOM   218   N N   . SER A 1 82  ? -38.072 2.869   15.210  1.00 62.39  ? 93   SER A N   1 
ATOM   219   C CA  . SER A 1 82  ? -37.791 3.911   16.195  1.00 62.39  ? 93   SER A CA  1 
ATOM   220   C C   . SER A 1 82  ? -36.521 4.693   15.882  1.00 62.39  ? 93   SER A C   1 
ATOM   221   O O   . SER A 1 82  ? -36.134 5.593   16.627  1.00 62.39  ? 93   SER A O   1 
ATOM   222   C CB  . SER A 1 82  ? -37.650 3.310   17.589  1.00 55.47  ? 93   SER A CB  1 
ATOM   223   O OG  . SER A 1 82  ? -36.307 2.926   17.836  1.00 55.47  ? 93   SER A OG  1 
ATOM   224   N N   . GLY A 1 83  ? -35.865 4.347   14.786  1.00 43.62  ? 94   GLY A N   1 
ATOM   225   C CA  . GLY A 1 83  ? -34.653 5.045   14.437  1.00 43.62  ? 94   GLY A CA  1 
ATOM   226   C C   . GLY A 1 83  ? -33.506 4.604   15.314  1.00 43.62  ? 94   GLY A C   1 
ATOM   227   O O   . GLY A 1 83  ? -32.508 5.302   15.400  1.00 43.62  ? 94   GLY A O   1 
ATOM   228   N N   . CYS A 1 84  ? -33.629 3.447   15.960  1.00 65.56  ? 95   CYS A N   1 
ATOM   229   C CA  . CYS A 1 84  ? -32.563 2.948   16.834  1.00 65.56  ? 95   CYS A CA  1 
ATOM   230   C C   . CYS A 1 84  ? -31.696 1.856   16.237  1.00 65.56  ? 95   CYS A C   1 
ATOM   231   O O   . CYS A 1 84  ? -30.920 1.210   16.940  1.00 65.56  ? 95   CYS A O   1 
ATOM   232   C CB  . CYS A 1 84  ? -33.148 2.457   18.142  1.00 76.55  ? 95   CYS A CB  1 
ATOM   233   S SG  . CYS A 1 84  ? -33.679 3.816   19.134  1.00 76.55  ? 95   CYS A SG  1 
ATOM   234   N N   . HIS A 1 85  ? -31.836 1.654   14.933  1.00 98.30  ? 96   HIS A N   1 
ATOM   235   C CA  . HIS A 1 85  ? -31.063 0.652   14.222  1.00 98.30  ? 96   HIS A CA  1 
ATOM   236   C C   . HIS A 1 85  ? -29.607 1.087   14.235  1.00 98.30  ? 96   HIS A C   1 
ATOM   237   O O   . HIS A 1 85  ? -29.286 2.216   14.596  1.00 98.30  ? 96   HIS A O   1 
ATOM   238   C CB  . HIS A 1 85  ? -31.570 0.543   12.785  1.00 75.30  ? 96   HIS A CB  1 
ATOM   239   C CG  . HIS A 1 85  ? -31.656 1.861   12.082  1.00 75.30  ? 96   HIS A CG  1 
ATOM   240   N ND1 . HIS A 1 85  ? -32.663 2.166   11.193  1.00 75.30  ? 96   HIS A ND1 1 
ATOM   241   C CD2 . HIS A 1 85  ? -30.869 2.961   12.149  1.00 75.30  ? 96   HIS A CD2 1 
ATOM   242   C CE1 . HIS A 1 85  ? -32.495 3.397   10.744  1.00 75.30  ? 96   HIS A CE1 1 
ATOM   243   N NE2 . HIS A 1 85  ? -31.413 3.902   11.309  1.00 75.30  ? 96   HIS A NE2 1 
ATOM   244   N N   . PRO A 1 86  ? -28.703 0.183   13.869  1.00 70.15  ? 97   PRO A N   1 
ATOM   245   C CA  . PRO A 1 86  ? -27.286 0.534   13.853  1.00 70.15  ? 97   PRO A CA  1 
ATOM   246   C C   . PRO A 1 86  ? -26.901 1.317   12.608  1.00 70.15  ? 97   PRO A C   1 
ATOM   247   O O   . PRO A 1 86  ? -25.735 1.654   12.419  1.00 70.15  ? 97   PRO A O   1 
ATOM   248   C CB  . PRO A 1 86  ? -26.600 -0.822  13.910  1.00 45.97  ? 97   PRO A CB  1 
ATOM   249   C CG  . PRO A 1 86  ? -27.572 -1.719  13.219  1.00 45.97  ? 97   PRO A CG  1 
ATOM   250   C CD  . PRO A 1 86  ? -28.884 -1.277  13.789  1.00 45.97  ? 97   PRO A CD  1 
ATOM   251   N N   . GLY A 1 87  ? -27.875 1.598   11.752  1.00 102.99 ? 98   GLY A N   1 
ATOM   252   C CA  . GLY A 1 87  ? -27.572 2.338   10.541  1.00 102.99 ? 98   GLY A CA  1 
ATOM   253   C C   . GLY A 1 87  ? -27.872 1.564   9.270   1.00 102.99 ? 98   GLY A C   1 
ATOM   254   O O   . GLY A 1 87  ? -28.502 0.504   9.312   1.00 102.99 ? 98   GLY A O   1 
ATOM   255   N N   . PHE A 1 88  ? -27.415 2.088   8.136   1.00 68.20  ? 99   PHE A N   1 
ATOM   256   C CA  . PHE A 1 88  ? -27.656 1.444   6.856   1.00 68.20  ? 99   PHE A CA  1 
ATOM   257   C C   . PHE A 1 88  ? -26.397 0.904   6.186   1.00 68.20  ? 99   PHE A C   1 
ATOM   258   O O   . PHE A 1 88  ? -25.273 1.229   6.583   1.00 68.20  ? 99   PHE A O   1 
ATOM   259   C CB  . PHE A 1 88  ? -28.356 2.422   5.909   1.00 78.05  ? 99   PHE A CB  1 
ATOM   260   C CG  . PHE A 1 88  ? -29.782 2.700   6.275   1.00 78.05  ? 99   PHE A CG  1 
ATOM   261   C CD1 . PHE A 1 88  ? -30.723 1.671   6.287   1.00 78.05  ? 99   PHE A CD1 1 
ATOM   262   C CD2 . PHE A 1 88  ? -30.186 3.976   6.634   1.00 78.05  ? 99   PHE A CD2 1 
ATOM   263   C CE1 . PHE A 1 88  ? -32.050 1.910   6.655   1.00 78.05  ? 99   PHE A CE1 1 
ATOM   264   C CE2 . PHE A 1 88  ? -31.511 4.225   7.003   1.00 78.05  ? 99   PHE A CE2 1 
ATOM   265   C CZ  . PHE A 1 88  ? -32.443 3.186   7.014   1.00 78.05  ? 99   PHE A CZ  1 
ATOM   266   N N   . GLY A 1 89  ? -26.614 0.058   5.177   1.00 68.67  ? 100  GLY A N   1 
ATOM   267   C CA  . GLY A 1 89  ? -25.530 -0.514  4.400   1.00 68.67  ? 100  GLY A CA  1 
ATOM   268   C C   . GLY A 1 89  ? -25.341 0.413   3.210   1.00 68.67  ? 100  GLY A C   1 
ATOM   269   O O   . GLY A 1 89  ? -26.177 1.296   3.004   1.00 68.67  ? 100  GLY A O   1 
ATOM   270   N N   . PRO A 1 90  ? -24.275 0.251   2.407   1.00 47.37  ? 101  PRO A N   1 
ATOM   271   C CA  . PRO A 1 90  ? -24.026 1.112   1.243   1.00 47.37  ? 101  PRO A CA  1 
ATOM   272   C C   . PRO A 1 90  ? -25.241 1.172   0.307   1.00 47.37  ? 101  PRO A C   1 
ATOM   273   O O   . PRO A 1 90  ? -25.519 2.195   -0.332  1.00 47.37  ? 101  PRO A O   1 
ATOM   274   C CB  . PRO A 1 90  ? -22.828 0.454   0.575   1.00 35.74  ? 101  PRO A CB  1 
ATOM   275   C CG  . PRO A 1 90  ? -22.185 -0.315  1.693   1.00 35.74  ? 101  PRO A CG  1 
ATOM   276   C CD  . PRO A 1 90  ? -23.333 -0.874  2.434   1.00 35.74  ? 101  PRO A CD  1 
ATOM   277   N N   . LEU A 1 91  ? -25.965 0.065   0.222   1.00 55.22  ? 102  LEU A N   1 
ATOM   278   C CA  . LEU A 1 91  ? -27.134 0.032   -0.621  1.00 55.22  ? 102  LEU A CA  1 
ATOM   279   C C   . LEU A 1 91  ? -28.244 0.862   0.006   1.00 55.22  ? 102  LEU A C   1 
ATOM   280   O O   . LEU A 1 91  ? -28.901 1.639   -0.680  1.00 55.22  ? 102  LEU A O   1 
ATOM   281   C CB  . LEU A 1 91  ? -27.567 -1.409  -0.842  1.00 38.24  ? 102  LEU A CB  1 
ATOM   282   C CG  . LEU A 1 91  ? -27.254 -1.869  -2.265  1.00 38.24  ? 102  LEU A CG  1 
ATOM   283   C CD1 . LEU A 1 91  ? -25.838 -1.447  -2.656  1.00 38.24  ? 102  LEU A CD1 1 
ATOM   284   C CD2 . LEU A 1 91  ? -27.408 -3.370  -2.357  1.00 38.24  ? 102  LEU A CD2 1 
ATOM   285   N N   . GLY A 1 92  ? -28.446 0.714   1.313   1.00 60.48  ? 103  GLY A N   1 
ATOM   286   C CA  . GLY A 1 92  ? -29.478 1.490   1.980   1.00 60.48  ? 103  GLY A CA  1 
ATOM   287   C C   . GLY A 1 92  ? -29.188 2.966   1.820   1.00 60.48  ? 103  GLY A C   1 
ATOM   288   O O   . GLY A 1 92  ? -30.085 3.779   1.588   1.00 60.48  ? 103  GLY A O   1 
ATOM   289   N N   . VAL A 1 93  ? -27.909 3.301   1.937   1.00 50.92  ? 104  VAL A N   1 
ATOM   290   C CA  . VAL A 1 93  ? -27.454 4.669   1.798   1.00 50.92  ? 104  VAL A CA  1 
ATOM   291   C C   . VAL A 1 93  ? -27.712 5.188   0.398   1.00 50.92  ? 104  VAL A C   1 
ATOM   292   O O   . VAL A 1 93  ? -28.173 6.319   0.223   1.00 50.92  ? 104  VAL A O   1 
ATOM   293   C CB  . VAL A 1 93  ? -25.981 4.777   2.071   1.00 37.77  ? 104  VAL A CB  1 
ATOM   294   C CG1 . VAL A 1 93  ? -25.528 6.188   1.766   1.00 37.77  ? 104  VAL A CG1 1 
ATOM   295   C CG2 . VAL A 1 93  ? -25.691 4.391   3.525   1.00 37.77  ? 104  VAL A CG2 1 
ATOM   296   N N   . GLU A 1 94  ? -27.383 4.375   -0.602  1.00 28.83  ? 105  GLU A N   1 
ATOM   297   C CA  . GLU A 1 94  ? -27.635 4.753   -1.991  1.00 28.83  ? 105  GLU A CA  1 
ATOM   298   C C   . GLU A 1 94  ? -29.143 4.856   -2.235  1.00 28.83  ? 105  GLU A C   1 
ATOM   299   O O   . GLU A 1 94  ? -29.602 5.819   -2.826  1.00 28.83  ? 105  GLU A O   1 
ATOM   300   C CB  . GLU A 1 94  ? -27.023 3.732   -2.945  1.00 72.04  ? 105  GLU A CB  1 
ATOM   301   C CG  . GLU A 1 94  ? -25.661 4.130   -3.457  1.00 72.04  ? 105  GLU A CG  1 
ATOM   302   C CD  . GLU A 1 94  ? -25.685 5.489   -4.121  1.00 72.04  ? 105  GLU A CD  1 
ATOM   303   O OE1 . GLU A 1 94  ? -26.631 5.739   -4.900  1.00 72.04  ? 105  GLU A OE1 1 
ATOM   304   O OE2 . GLU A 1 94  ? -24.764 6.302   -3.872  1.00 72.04  ? 105  GLU A OE2 1 
ATOM   305   N N   . LEU A 1 95  ? -29.910 3.872   -1.759  1.00 21.76  ? 106  LEU A N   1 
ATOM   306   C CA  . LEU A 1 95  ? -31.357 3.888   -1.930  1.00 21.76  ? 106  LEU A CA  1 
ATOM   307   C C   . LEU A 1 95  ? -31.981 5.129   -1.339  1.00 21.76  ? 106  LEU A C   1 
ATOM   308   O O   . LEU A 1 95  ? -32.788 5.780   -2.002  1.00 21.76  ? 106  LEU A O   1 
ATOM   309   C CB  . LEU A 1 95  ? -32.008 2.664   -1.300  1.00 23.68  ? 106  LEU A CB  1 
ATOM   310   C CG  . LEU A 1 95  ? -33.554 2.641   -1.262  1.00 23.68  ? 106  LEU A CG  1 
ATOM   311   C CD1 . LEU A 1 95  ? -34.164 3.180   -2.555  1.00 23.68  ? 106  LEU A CD1 1 
ATOM   312   C CD2 . LEU A 1 95  ? -34.017 1.211   -1.007  1.00 23.68  ? 106  LEU A CD2 1 
ATOM   313   N N   . ARG A 1 96  ? -31.623 5.455   -0.091  1.00 28.21  ? 107  ARG A N   1 
ATOM   314   C CA  . ARG A 1 96  ? -32.152 6.666   0.554   1.00 28.21  ? 107  ARG A CA  1 
ATOM   315   C C   . ARG A 1 96  ? -31.662 7.903   -0.180  1.00 28.21  ? 107  ARG A C   1 
ATOM   316   O O   . ARG A 1 96  ? -32.379 8.897   -0.283  1.00 28.21  ? 107  ARG A O   1 
ATOM   317   C CB  . ARG A 1 96  ? -31.720 6.772   2.017   1.00 69.20  ? 107  ARG A CB  1 
ATOM   318   C CG  . ARG A 1 96  ? -32.244 8.044   2.686   1.00 69.20  ? 107  ARG A CG  1 
ATOM   319   C CD  . ARG A 1 96  ? -31.918 8.088   4.156   1.00 69.20  ? 107  ARG A CD  1 
ATOM   320   N NE  . ARG A 1 96  ? -30.492 7.895   4.363   1.00 69.20  ? 107  ARG A NE  1 
ATOM   321   C CZ  . ARG A 1 96  ? -29.889 7.917   5.547   1.00 69.20  ? 107  ARG A CZ  1 
ATOM   322   N NH1 . ARG A 1 96  ? -30.585 8.128   6.658   1.00 69.20  ? 107  ARG A NH1 1 
ATOM   323   N NH2 . ARG A 1 96  ? -28.578 7.726   5.617   1.00 69.20  ? 107  ARG A NH2 1 
ATOM   324   N N   . LYS A 1 97  ? -30.439 7.816   -0.701  1.00 35.57  ? 108  LYS A N   1 
ATOM   325   C CA  . LYS A 1 97  ? -29.832 8.910   -1.436  1.00 35.57  ? 108  LYS A CA  1 
ATOM   326   C C   . LYS A 1 97  ? -30.653 9.282   -2.690  1.00 35.57  ? 108  LYS A C   1 
ATOM   327   O O   . LYS A 1 97  ? -30.880 10.464  -2.982  1.00 35.57  ? 108  LYS A O   1 
ATOM   328   C CB  . LYS A 1 97  ? -28.387 8.550   -1.803  1.00 61.50  ? 108  LYS A CB  1 
ATOM   329   C CG  . LYS A 1 97  ? -27.532 9.745   -2.188  1.00 61.50  ? 108  LYS A CG  1 
ATOM   330   C CD  . LYS A 1 97  ? -26.091 9.342   -2.443  1.00 61.50  ? 108  LYS A CD  1 
ATOM   331   C CE  . LYS A 1 97  ? -25.351 8.951   -1.155  1.00 61.50  ? 108  LYS A CE  1 
ATOM   332   N NZ  . LYS A 1 97  ? -24.990 10.092  -0.232  1.00 61.50  ? 108  LYS A NZ  1 
ATOM   333   N N   . ASN A 1 98  ? -31.103 8.285   -3.436  1.00 67.95  ? 109  ASN A N   1 
ATOM   334   C CA  . ASN A 1 98  ? -31.897 8.589   -4.610  1.00 67.95  ? 109  ASN A CA  1 
ATOM   335   C C   . ASN A 1 98  ? -33.209 9.170   -4.108  1.00 67.95  ? 109  ASN A C   1 
ATOM   336   O O   . ASN A 1 98  ? -33.606 10.264  -4.503  1.00 67.95  ? 109  ASN A O   1 
ATOM   337   C CB  . ASN A 1 98  ? -32.133 7.328   -5.445  1.00 91.89  ? 109  ASN A CB  1 
ATOM   338   C CG  . ASN A 1 98  ? -30.878 6.861   -6.159  1.00 91.89  ? 109  ASN A CG  1 
ATOM   339   O OD1 . ASN A 1 98  ? -30.264 7.612   -6.919  1.00 91.89  ? 109  ASN A OD1 1 
ATOM   340   N ND2 . ASN A 1 98  ? -30.492 5.618   -5.922  1.00 91.89  ? 109  ASN A ND2 1 
ATOM   341   N N   . LEU A 1 99  ? -33.861 8.438   -3.214  1.00 39.63  ? 110  LEU A N   1 
ATOM   342   C CA  . LEU A 1 99  ? -35.121 8.866   -2.628  1.00 39.63  ? 110  LEU A CA  1 
ATOM   343   C C   . LEU A 1 99  ? -35.019 10.333  -2.227  1.00 39.63  ? 110  LEU A C   1 
ATOM   344   O O   . LEU A 1 99  ? -35.883 11.150  -2.563  1.00 39.63  ? 110  LEU A O   1 
ATOM   345   C CB  . LEU A 1 99  ? -35.419 8.005   -1.406  1.00 37.75  ? 110  LEU A CB  1 
ATOM   346   C CG  . LEU A 1 99  ? -36.792 8.069   -0.747  1.00 37.75  ? 110  LEU A CG  1 
ATOM   347   C CD1 . LEU A 1 99  ? -37.896 8.107   -1.779  1.00 37.75  ? 110  LEU A CD1 1 
ATOM   348   C CD2 . LEU A 1 99  ? -36.918 6.840   0.137   1.00 37.75  ? 110  LEU A CD2 1 
ATOM   349   N N   . ALA A 1 100 ? -33.952 10.668  -1.509  1.00 35.32  ? 111  ALA A N   1 
ATOM   350   C CA  . ALA A 1 100 ? -33.732 12.046  -1.089  1.00 35.32  ? 111  ALA A CA  1 
ATOM   351   C C   . ALA A 1 100 ? -33.685 12.923  -2.341  1.00 35.32  ? 111  ALA A C   1 
ATOM   352   O O   . ALA A 1 100 ? -34.305 13.983  -2.408  1.00 35.32  ? 111  ALA A O   1 
ATOM   353   C CB  . ALA A 1 100 ? -32.424 12.149  -0.326  1.00 14.31  ? 111  ALA A CB  1 
ATOM   354   N N   . ALA A 1 101 ? -32.943 12.447  -3.337  1.00 51.71  ? 112  ALA A N   1 
ATOM   355   C CA  . ALA A 1 101 ? -32.772 13.143  -4.601  1.00 51.71  ? 112  ALA A CA  1 
ATOM   356   C C   . ALA A 1 101 ? -34.079 13.380  -5.312  1.00 51.71  ? 112  ALA A C   1 
ATOM   357   O O   . ALA A 1 101 ? -34.355 14.487  -5.767  1.00 51.71  ? 112  ALA A O   1 
ATOM   358   C CB  . ALA A 1 101 ? -31.895 12.361  -5.464  1.00 17.95  ? 112  ALA A CB  1 
ATOM   359   N N   . GLU A 1 102 ? -34.879 12.329  -5.425  1.00 34.53  ? 113  GLU A N   1 
ATOM   360   C CA  . GLU A 1 102 ? -36.168 12.442  -6.080  1.00 34.53  ? 113  GLU A CA  1 
ATOM   361   C C   . GLU A 1 102 ? -37.037 13.468  -5.346  1.00 34.53  ? 113  GLU A C   1 
ATOM   362   O O   . GLU A 1 102 ? -37.568 14.397  -5.958  1.00 34.53  ? 113  GLU A O   1 
ATOM   363   C CB  . GLU A 1 102 ? -36.866 11.093  -6.091  1.00 93.54  ? 113  GLU A CB  1 
ATOM   364   C CG  . GLU A 1 102 ? -37.652 10.850  -7.339  1.00 93.54  ? 113  GLU A CG  1 
ATOM   365   C CD  . GLU A 1 102 ? -36.768 10.768  -8.565  1.00 93.54  ? 113  GLU A CD  1 
ATOM   366   O OE1 . GLU A 1 102 ? -35.762 10.023  -8.521  1.00 93.54  ? 113  GLU A OE1 1 
ATOM   367   O OE2 . GLU A 1 102 ? -37.084 11.438  -9.575  1.00 93.54  ? 113  GLU A OE2 1 
ATOM   368   N N   . TRP A 1 103 ? -37.169 13.299  -4.029  1.00 37.37  ? 114  TRP A N   1 
ATOM   369   C CA  . TRP A 1 103 ? -37.976 14.203  -3.198  1.00 37.37  ? 114  TRP A CA  1 
ATOM   370   C C   . TRP A 1 103 ? -37.656 15.636  -3.560  1.00 37.37  ? 114  TRP A C   1 
ATOM   371   O O   . TRP A 1 103 ? -38.532 16.479  -3.743  1.00 37.37  ? 114  TRP A O   1 
ATOM   372   C CB  . TRP A 1 103 ? -37.651 14.002  -1.706  1.00 43.30  ? 114  TRP A CB  1 
ATOM   373   C CG  . TRP A 1 103 ? -38.480 14.855  -0.784  1.00 43.30  ? 114  TRP A CG  1 
ATOM   374   C CD1 . TRP A 1 103 ? -39.653 14.511  -0.206  1.00 43.30  ? 114  TRP A CD1 1 
ATOM   375   C CD2 . TRP A 1 103 ? -38.226 16.211  -0.398  1.00 43.30  ? 114  TRP A CD2 1 
ATOM   376   N NE1 . TRP A 1 103 ? -40.155 15.563  0.516   1.00 43.30  ? 114  TRP A NE1 1 
ATOM   377   C CE2 . TRP A 1 103 ? -39.297 16.621  0.412   1.00 43.30  ? 114  TRP A CE2 1 
ATOM   378   C CE3 . TRP A 1 103 ? -37.196 17.121  -0.661  1.00 43.30  ? 114  TRP A CE3 1 
ATOM   379   C CZ2 . TRP A 1 103 ? -39.375 17.900  0.965   1.00 43.30  ? 114  TRP A CZ2 1 
ATOM   380   C CZ3 . TRP A 1 103 ? -37.273 18.401  -0.107  1.00 43.30  ? 114  TRP A CZ3 1 
ATOM   381   C CH2 . TRP A 1 103 ? -38.356 18.773  0.695   1.00 43.30  ? 114  TRP A CH2 1 
ATOM   382   N N   . TRP A 1 104 ? -36.362 15.881  -3.658  1.00 40.07  ? 115  TRP A N   1 
ATOM   383   C CA  . TRP A 1 104 ? -35.858 17.194  -3.942  1.00 40.07  ? 115  TRP A CA  1 
ATOM   384   C C   . TRP A 1 104 ? -36.315 17.694  -5.289  1.00 40.07  ? 115  TRP A C   1 
ATOM   385   O O   . TRP A 1 104 ? -36.843 18.798  -5.406  1.00 40.07  ? 115  TRP A O   1 
ATOM   386   C CB  . TRP A 1 104 ? -34.332 17.189  -3.847  1.00 67.48  ? 115  TRP A CB  1 
ATOM   387   C CG  . TRP A 1 104 ? -33.794 18.553  -3.714  1.00 67.48  ? 115  TRP A CG  1 
ATOM   388   C CD1 . TRP A 1 104 ? -33.415 19.380  -4.723  1.00 67.48  ? 115  TRP A CD1 1 
ATOM   389   C CD2 . TRP A 1 104 ? -33.708 19.319  -2.511  1.00 67.48  ? 115  TRP A CD2 1 
ATOM   390   N NE1 . TRP A 1 104 ? -33.108 20.622  -4.229  1.00 67.48  ? 115  TRP A NE1 1 
ATOM   391   C CE2 . TRP A 1 104 ? -33.279 20.614  -2.870  1.00 67.48  ? 115  TRP A CE2 1 
ATOM   392   C CE3 . TRP A 1 104 ? -33.959 19.040  -1.164  1.00 67.48  ? 115  TRP A CE3 1 
ATOM   393   C CZ2 . TRP A 1 104 ? -33.094 21.635  -1.932  1.00 67.48  ? 115  TRP A CZ2 1 
ATOM   394   C CZ3 . TRP A 1 104 ? -33.777 20.054  -0.233  1.00 67.48  ? 115  TRP A CZ3 1 
ATOM   395   C CH2 . TRP A 1 104 ? -33.347 21.337  -0.623  1.00 67.48  ? 115  TRP A CH2 1 
ATOM   396   N N   . THR A 1 105 ? -36.123 16.884  -6.315  1.00 33.73  ? 116  THR A N   1 
ATOM   397   C CA  . THR A 1 105 ? -36.529 17.311  -7.636  1.00 33.73  ? 116  THR A CA  1 
ATOM   398   C C   . THR A 1 105 ? -38.017 17.618  -7.655  1.00 33.73  ? 116  THR A C   1 
ATOM   399   O O   . THR A 1 105 ? -38.462 18.522  -8.361  1.00 33.73  ? 116  THR A O   1 
ATOM   400   C CB  . THR A 1 105 ? -36.241 16.238  -8.681  1.00 50.40  ? 116  THR A CB  1 
ATOM   401   O OG1 . THR A 1 105 ? -35.364 15.255  -8.125  1.00 50.40  ? 116  THR A OG1 1 
ATOM   402   C CG2 . THR A 1 105 ? -35.572 16.856  -9.884  1.00 50.40  ? 116  THR A CG2 1 
ATOM   403   N N   . SER A 1 106 ? -38.778 16.875  -6.856  1.00 38.05  ? 117  SER A N   1 
ATOM   404   C CA  . SER A 1 106 ? -40.224 17.031  -6.808  1.00 38.05  ? 117  SER A CA  1 
ATOM   405   C C   . SER A 1 106 ? -40.737 18.362  -6.305  1.00 38.05  ? 117  SER A C   1 
ATOM   406   O O   . SER A 1 106 ? -41.564 18.983  -6.960  1.00 38.05  ? 117  SER A O   1 
ATOM   407   C CB  . SER A 1 106 ? -40.844 15.919  -5.986  1.00 64.38  ? 117  SER A CB  1 
ATOM   408   O OG  . SER A 1 106 ? -42.232 15.866  -6.239  1.00 64.38  ? 117  SER A OG  1 
ATOM   409   N N   . VAL A 1 107 ? -40.252 18.809  -5.155  1.00 55.96  ? 118  VAL A N   1 
ATOM   410   C CA  . VAL A 1 107 ? -40.698 20.084  -4.589  1.00 55.96  ? 118  VAL A CA  1 
ATOM   411   C C   . VAL A 1 107 ? -39.787 21.293  -4.866  1.00 55.96  ? 118  VAL A C   1 
ATOM   412   O O   . VAL A 1 107 ? -40.253 22.346  -5.312  1.00 55.96  ? 118  VAL A O   1 
ATOM   413   C CB  . VAL A 1 107 ? -40.908 19.947  -3.058  1.00 68.49  ? 118  VAL A CB  1 
ATOM   414   C CG1 . VAL A 1 107 ? -40.068 18.803  -2.520  1.00 68.49  ? 118  VAL A CG1 1 
ATOM   415   C CG2 . VAL A 1 107 ? -40.533 21.239  -2.350  1.00 68.49  ? 118  VAL A CG2 1 
ATOM   416   N N   . VAL A 1 108 ? -38.491 21.129  -4.613  1.00 84.50  ? 119  VAL A N   1 
ATOM   417   C CA  . VAL A 1 108 ? -37.515 22.199  -4.789  1.00 84.50  ? 119  VAL A CA  1 
ATOM   418   C C   . VAL A 1 108 ? -37.058 22.509  -6.213  1.00 84.50  ? 119  VAL A C   1 
ATOM   419   O O   . VAL A 1 108 ? -37.222 23.634  -6.659  1.00 84.50  ? 119  VAL A O   1 
ATOM   420   C CB  . VAL A 1 108 ? -36.265 21.938  -3.928  1.00 140.37 ? 119  VAL A CB  1 
ATOM   421   C CG1 . VAL A 1 108 ? -35.424 23.190  -3.848  1.00 140.37 ? 119  VAL A CG1 1 
ATOM   422   C CG2 . VAL A 1 108 ? -36.675 21.502  -2.541  1.00 140.37 ? 119  VAL A CG2 1 
ATOM   423   N N   . VAL A 1 109 ? -36.484 21.549  -6.932  1.00 64.47  ? 120  VAL A N   1 
ATOM   424   C CA  . VAL A 1 109 ? -36.023 21.858  -8.291  1.00 64.47  ? 120  VAL A CA  1 
ATOM   425   C C   . VAL A 1 109 ? -37.168 22.436  -9.128  1.00 64.47  ? 120  VAL A C   1 
ATOM   426   O O   . VAL A 1 109 ? -37.216 23.653  -9.357  1.00 64.47  ? 120  VAL A O   1 
ATOM   427   C CB  . VAL A 1 109 ? -35.433 20.619  -9.041  1.00 56.01  ? 120  VAL A CB  1 
ATOM   428   C CG1 . VAL A 1 109 ? -34.720 21.067  -10.301 1.00 56.01  ? 120  VAL A CG1 1 
ATOM   429   C CG2 . VAL A 1 109 ? -34.448 19.879  -8.163  1.00 56.01  ? 120  VAL A CG2 1 
ATOM   430   N N   . PHE A 1 110 ? -38.075 21.563  -9.578  1.00 105.79 ? 121  PHE A N   1 
ATOM   431   C CA  . PHE A 1 110 ? -39.244 21.942  -10.385 1.00 105.79 ? 121  PHE A CA  1 
ATOM   432   C C   . PHE A 1 110 ? -39.506 23.442  -10.389 1.00 105.79 ? 121  PHE A C   1 
ATOM   433   O O   . PHE A 1 110 ? -38.829 24.192  -11.084 1.00 105.79 ? 121  PHE A O   1 
ATOM   434   C CB  . PHE A 1 110 ? -40.504 21.230  -9.869  1.00 194.72 ? 121  PHE A CB  1 
ATOM   435   C CG  . PHE A 1 110 ? -40.738 19.865  -10.468 1.00 194.72 ? 121  PHE A CG  1 
ATOM   436   C CD1 . PHE A 1 110 ? -41.822 19.095  -10.052 1.00 194.72 ? 121  PHE A CD1 1 
ATOM   437   C CD2 . PHE A 1 110 ? -39.898 19.355  -11.455 1.00 194.72 ? 121  PHE A CD2 1 
ATOM   438   C CE1 . PHE A 1 110 ? -42.067 17.839  -10.609 1.00 194.72 ? 121  PHE A CE1 1 
ATOM   439   C CE2 . PHE A 1 110 ? -40.136 18.098  -12.018 1.00 194.72 ? 121  PHE A CE2 1 
ATOM   440   C CZ  . PHE A 1 110 ? -41.223 17.340  -11.594 1.00 194.72 ? 121  PHE A CZ  1 
ATOM   441   N N   . ARG A 1 111 ? -40.499 23.864  -9.608  1.00 81.36  ? 122  ARG A N   1 
ATOM   442   C CA  . ARG A 1 111 ? -40.870 25.275  -9.488  1.00 81.36  ? 122  ARG A CA  1 
ATOM   443   C C   . ARG A 1 111 ? -40.028 25.951  -8.382  1.00 81.36  ? 122  ARG A C   1 
ATOM   444   O O   . ARG A 1 111 ? -40.475 26.079  -7.240  1.00 81.36  ? 122  ARG A O   1 
ATOM   445   C CB  . ARG A 1 111 ? -42.372 25.387  -9.168  1.00 105.33 ? 122  ARG A CB  1 
ATOM   446   C CG  . ARG A 1 111 ? -42.791 24.645  -7.889  1.00 105.33 ? 122  ARG A CG  1 
ATOM   447   C CD  . ARG A 1 111 ? -44.279 24.807  -7.544  1.00 105.33 ? 122  ARG A CD  1 
ATOM   448   N NE  . ARG A 1 111 ? -45.174 23.939  -8.317  1.00 105.33 ? 122  ARG A NE  1 
ATOM   449   C CZ  . ARG A 1 111 ? -45.179 22.610  -8.258  1.00 105.33 ? 122  ARG A CZ  1 
ATOM   450   N NH1 . ARG A 1 111 ? -44.331 21.973  -7.462  1.00 105.33 ? 122  ARG A NH1 1 
ATOM   451   N NH2 . ARG A 1 111 ? -46.042 21.916  -8.990  1.00 105.33 ? 122  ARG A NH2 1 
ATOM   452   N N   . GLU A 1 112 ? -38.822 26.397  -8.745  1.00 195.47 ? 123  GLU A N   1 
ATOM   453   C CA  . GLU A 1 112 ? -37.883 27.024  -7.807  1.00 195.47 ? 123  GLU A CA  1 
ATOM   454   C C   . GLU A 1 112 ? -38.263 28.368  -7.167  1.00 195.47 ? 123  GLU A C   1 
ATOM   455   O O   . GLU A 1 112 ? -37.715 29.424  -7.496  1.00 195.47 ? 123  GLU A O   1 
ATOM   456   C CB  . GLU A 1 112 ? -36.485 27.125  -8.454  1.00 121.91 ? 123  GLU A CB  1 
ATOM   457   C CG  . GLU A 1 112 ? -35.404 27.767  -7.571  1.00 121.91 ? 123  GLU A CG  1 
ATOM   458   C CD  . GLU A 1 112 ? -33.987 27.437  -8.025  1.00 121.91 ? 123  GLU A CD  1 
ATOM   459   O OE1 . GLU A 1 112 ? -33.725 27.468  -9.246  1.00 121.91 ? 123  GLU A OE1 1 
ATOM   460   O OE2 . GLU A 1 112 ? -33.131 27.156  -7.155  1.00 121.91 ? 123  GLU A OE2 1 
ATOM   461   N N   . GLN A 1 113 ? -39.218 28.296  -6.245  1.00 70.66  ? 124  GLN A N   1 
ATOM   462   C CA  . GLN A 1 113 ? -39.688 29.432  -5.454  1.00 70.66  ? 124  GLN A CA  1 
ATOM   463   C C   . GLN A 1 113 ? -39.358 28.883  -4.063  1.00 70.66  ? 124  GLN A C   1 
ATOM   464   O O   . GLN A 1 113 ? -39.662 29.468  -3.031  1.00 70.66  ? 124  GLN A O   1 
ATOM   465   C CB  . GLN A 1 113 ? -41.209 29.610  -5.590  1.00 138.82 ? 124  GLN A CB  1 
ATOM   466   C CG  . GLN A 1 113 ? -41.852 28.840  -6.747  1.00 138.82 ? 124  GLN A CG  1 
ATOM   467   C CD  . GLN A 1 113 ? -43.375 28.803  -6.667  1.00 138.82 ? 124  GLN A CD  1 
ATOM   468   O OE1 . GLN A 1 113 ? -44.046 29.827  -6.806  1.00 138.82 ? 124  GLN A OE1 1 
ATOM   469   N NE2 . GLN A 1 113 ? -43.924 27.615  -6.436  1.00 138.82 ? 124  GLN A NE2 1 
ATOM   470   N N   . VAL A 1 114 ? -38.741 27.710  -4.083  1.00 59.52  ? 125  VAL A N   1 
ATOM   471   C CA  . VAL A 1 114 ? -38.332 26.978  -2.898  1.00 59.52  ? 125  VAL A CA  1 
ATOM   472   C C   . VAL A 1 114 ? -36.810 27.100  -2.781  1.00 59.52  ? 125  VAL A C   1 
ATOM   473   O O   . VAL A 1 114 ? -36.077 26.945  -3.761  1.00 59.52  ? 125  VAL A O   1 
ATOM   474   C CB  . VAL A 1 114 ? -38.731 25.472  -3.026  1.00 36.44  ? 125  VAL A CB  1 
ATOM   475   C CG1 . VAL A 1 114 ? -38.199 24.677  -1.855  1.00 36.44  ? 125  VAL A CG1 1 
ATOM   476   C CG2 . VAL A 1 114 ? -40.232 25.337  -3.097  1.00 36.44  ? 125  VAL A CG2 1 
ATOM   477   N N   . PHE A 1 115 ? -36.337 27.392  -1.581  1.00 59.39  ? 126  PHE A N   1 
ATOM   478   C CA  . PHE A 1 115 ? -34.911 27.530  -1.366  1.00 59.39  ? 126  PHE A CA  1 
ATOM   479   C C   . PHE A 1 115 ? -34.356 26.517  -0.345  1.00 59.39  ? 126  PHE A C   1 
ATOM   480   O O   . PHE A 1 115 ? -34.990 26.216  0.683   1.00 59.39  ? 126  PHE A O   1 
ATOM   481   C CB  . PHE A 1 115 ? -34.583 28.951  -0.878  1.00 42.08  ? 126  PHE A CB  1 
ATOM   482   C CG  . PHE A 1 115 ? -34.955 30.045  -1.845  1.00 42.08  ? 126  PHE A CG  1 
ATOM   483   C CD1 . PHE A 1 115 ? -36.184 30.686  -1.757  1.00 42.08  ? 126  PHE A CD1 1 
ATOM   484   C CD2 . PHE A 1 115 ? -34.066 30.444  -2.844  1.00 42.08  ? 126  PHE A CD2 1 
ATOM   485   C CE1 . PHE A 1 115 ? -36.525 31.710  -2.647  1.00 42.08  ? 126  PHE A CE1 1 
ATOM   486   C CE2 . PHE A 1 115 ? -34.394 31.461  -3.737  1.00 42.08  ? 126  PHE A CE2 1 
ATOM   487   C CZ  . PHE A 1 115 ? -35.629 32.092  -3.634  1.00 42.08  ? 126  PHE A CZ  1 
ATOM   488   N N   . PRO A 1 116 ? -33.171 25.956  -0.622  1.00 52.01  ? 127  PRO A N   1 
ATOM   489   C CA  . PRO A 1 116 ? -32.645 25.016  0.356   1.00 52.01  ? 127  PRO A CA  1 
ATOM   490   C C   . PRO A 1 116 ? -32.127 25.970  1.415   1.00 52.01  ? 127  PRO A C   1 
ATOM   491   O O   . PRO A 1 116 ? -31.624 27.053  1.088   1.00 52.01  ? 127  PRO A O   1 
ATOM   492   C CB  . PRO A 1 116 ? -31.522 24.346  -0.400  1.00 32.55  ? 127  PRO A CB  1 
ATOM   493   C CG  . PRO A 1 116 ? -30.965 25.484  -1.174  1.00 32.55  ? 127  PRO A CG  1 
ATOM   494   C CD  . PRO A 1 116 ? -32.199 26.174  -1.704  1.00 32.55  ? 127  PRO A CD  1 
ATOM   495   N N   . VAL A 1 117 ? -32.257 25.593  2.676   1.00 39.87  ? 128  VAL A N   1 
ATOM   496   C CA  . VAL A 1 117 ? -31.809 26.450  3.753   1.00 39.87  ? 128  VAL A CA  1 
ATOM   497   C C   . VAL A 1 117 ? -30.975 25.591  4.705   1.00 39.87  ? 128  VAL A C   1 
ATOM   498   O O   . VAL A 1 117 ? -31.057 24.367  4.660   1.00 39.87  ? 128  VAL A O   1 
ATOM   499   C CB  . VAL A 1 117 ? -33.044 27.068  4.425   1.00 31.70  ? 128  VAL A CB  1 
ATOM   500   C CG1 . VAL A 1 117 ? -33.689 26.082  5.370   1.00 31.70  ? 128  VAL A CG1 1 
ATOM   501   C CG2 . VAL A 1 117 ? -32.666 28.355  5.086   1.00 31.70  ? 128  VAL A CG2 1 
ATOM   502   N N   . ASP A 1 118 ? -30.154 26.199  5.554   1.00 85.83  ? 129  ASP A N   1 
ATOM   503   C CA  . ASP A 1 118 ? -29.334 25.378  6.443   1.00 85.83  ? 129  ASP A CA  1 
ATOM   504   C C   . ASP A 1 118 ? -29.386 25.736  7.915   1.00 85.83  ? 129  ASP A C   1 
ATOM   505   O O   . ASP A 1 118 ? -28.838 26.749  8.336   1.00 85.83  ? 129  ASP A O   1 
ATOM   506   C CB  . ASP A 1 118 ? -27.879 25.394  5.988   1.00 134.92 ? 129  ASP A CB  1 
ATOM   507   C CG  . ASP A 1 118 ? -27.034 24.366  6.710   1.00 134.92 ? 129  ASP A CG  1 
ATOM   508   O OD1 . ASP A 1 118 ? -27.330 23.156  6.583   1.00 134.92 ? 129  ASP A OD1 1 
ATOM   509   O OD2 . ASP A 1 118 ? -26.074 24.770  7.403   1.00 134.92 ? 129  ASP A OD2 1 
ATOM   510   N N   . ALA A 1 119 ? -30.027 24.869  8.690   1.00 51.84  ? 130  ALA A N   1 
ATOM   511   C CA  . ALA A 1 119 ? -30.182 25.041  10.129  1.00 51.84  ? 130  ALA A CA  1 
ATOM   512   C C   . ALA A 1 119 ? -29.199 24.163  10.897  1.00 51.84  ? 130  ALA A C   1 
ATOM   513   O O   . ALA A 1 119 ? -28.575 23.267  10.331  1.00 51.84  ? 130  ALA A O   1 
ATOM   514   C CB  . ALA A 1 119 ? -31.599 24.681  10.529  1.00 8.95   ? 130  ALA A CB  1 
ATOM   515   N N   . LEU A 1 120 ? -29.080 24.403  12.198  1.00 51.25  ? 131  LEU A N   1 
ATOM   516   C CA  . LEU A 1 120 ? -28.180 23.619  13.037  1.00 51.25  ? 131  LEU A CA  1 
ATOM   517   C C   . LEU A 1 120 ? -28.858 22.359  13.572  1.00 51.25  ? 131  LEU A C   1 
ATOM   518   O O   . LEU A 1 120 ? -30.075 22.204  13.463  1.00 51.25  ? 131  LEU A O   1 
ATOM   519   C CB  . LEU A 1 120 ? -27.666 24.472  14.199  1.00 53.57  ? 131  LEU A CB  1 
ATOM   520   C CG  . LEU A 1 120 ? -27.013 25.787  13.760  1.00 53.57  ? 131  LEU A CG  1 
ATOM   521   C CD1 . LEU A 1 120 ? -26.347 26.446  14.956  1.00 53.57  ? 131  LEU A CD1 1 
ATOM   522   C CD2 . LEU A 1 120 ? -25.987 25.523  12.662  1.00 53.57  ? 131  LEU A CD2 1 
ATOM   523   N N   . HIS A 1 121 ? -28.059 21.461  14.148  1.00 55.15  ? 132  HIS A N   1 
ATOM   524   C CA  . HIS A 1 121 ? -28.575 20.207  14.677  1.00 55.15  ? 132  HIS A CA  1 
ATOM   525   C C   . HIS A 1 121 ? -28.961 20.269  16.135  1.00 55.15  ? 132  HIS A C   1 
ATOM   526   O O   . HIS A 1 121 ? -29.542 19.317  16.653  1.00 55.15  ? 132  HIS A O   1 
ATOM   527   C CB  . HIS A 1 121 ? -27.561 19.082  14.486  1.00 49.53  ? 132  HIS A CB  1 
ATOM   528   C CG  . HIS A 1 121 ? -27.338 18.706  13.055  1.00 49.53  ? 132  HIS A CG  1 
ATOM   529   N ND1 . HIS A 1 121 ? -26.513 19.424  12.217  1.00 49.53  ? 132  HIS A ND1 1 
ATOM   530   C CD2 . HIS A 1 121 ? -27.854 17.702  12.305  1.00 49.53  ? 132  HIS A CD2 1 
ATOM   531   C CE1 . HIS A 1 121 ? -26.531 18.881  11.012  1.00 49.53  ? 132  HIS A CE1 1 
ATOM   532   N NE2 . HIS A 1 121 ? -27.337 17.834  11.038  1.00 49.53  ? 132  HIS A NE2 1 
ATOM   533   N N   . HIS A 1 122 ? -28.635 21.375  16.803  1.00 55.52  ? 133  HIS A N   1 
ATOM   534   C CA  . HIS A 1 122 ? -28.982 21.532  18.219  1.00 55.52  ? 133  HIS A CA  1 
ATOM   535   C C   . HIS A 1 122 ? -29.542 22.918  18.547  1.00 55.52  ? 133  HIS A C   1 
ATOM   536   O O   . HIS A 1 122 ? -29.093 23.929  18.006  1.00 55.52  ? 133  HIS A O   1 
ATOM   537   C CB  . HIS A 1 122 ? -27.765 21.270  19.107  1.00 65.68  ? 133  HIS A CB  1 
ATOM   538   C CG  . HIS A 1 122 ? -26.822 22.427  19.187  1.00 65.68  ? 133  HIS A CG  1 
ATOM   539   N ND1 . HIS A 1 122 ? -26.231 22.985  18.074  1.00 65.68  ? 133  HIS A ND1 1 
ATOM   540   C CD2 . HIS A 1 122 ? -26.365 23.132  20.249  1.00 65.68  ? 133  HIS A CD2 1 
ATOM   541   C CE1 . HIS A 1 122 ? -25.448 23.982  18.447  1.00 65.68  ? 133  HIS A CE1 1 
ATOM   542   N NE2 . HIS A 1 122 ? -25.512 24.091  19.762  1.00 65.68  ? 133  HIS A NE2 1 
ATOM   543   N N   . LYS A 1 123 ? -30.532 22.944  19.434  1.00 74.88  ? 134  LYS A N   1 
ATOM   544   C CA  . LYS A 1 123 ? -31.155 24.187  19.879  1.00 74.88  ? 134  LYS A CA  1 
ATOM   545   C C   . LYS A 1 123 ? -30.325 24.645  21.071  1.00 74.88  ? 134  LYS A C   1 
ATOM   546   O O   . LYS A 1 123 ? -30.505 24.158  22.185  1.00 74.88  ? 134  LYS A O   1 
ATOM   547   C CB  . LYS A 1 123 ? -32.607 23.925  20.309  1.00 81.02  ? 134  LYS A CB  1 
ATOM   548   C CG  . LYS A 1 123 ? -33.305 25.094  21.015  1.00 81.02  ? 134  LYS A CG  1 
ATOM   549   C CD  . LYS A 1 123 ? -33.676 26.242  20.081  1.00 81.02  ? 134  LYS A CD  1 
ATOM   550   C CE  . LYS A 1 123 ? -34.196 27.449  20.868  1.00 81.02  ? 134  LYS A CE  1 
ATOM   551   N NZ  . LYS A 1 123 ? -33.142 28.069  21.737  1.00 81.02  ? 134  LYS A NZ  1 
ATOM   552   N N   . PRO A 1 124 ? -29.400 25.588  20.853  1.00 56.04  ? 135  PRO A N   1 
ATOM   553   C CA  . PRO A 1 124 ? -28.531 26.105  21.912  1.00 56.04  ? 135  PRO A CA  1 
ATOM   554   C C   . PRO A 1 124 ? -29.234 26.822  23.051  1.00 56.04  ? 135  PRO A C   1 
ATOM   555   O O   . PRO A 1 124 ? -30.418 26.599  23.298  1.00 56.04  ? 135  PRO A O   1 
ATOM   556   C CB  . PRO A 1 124 ? -27.589 27.028  21.153  1.00 84.74  ? 135  PRO A CB  1 
ATOM   557   C CG  . PRO A 1 124 ? -28.470 27.567  20.099  1.00 84.74  ? 135  PRO A CG  1 
ATOM   558   C CD  . PRO A 1 124 ? -29.188 26.334  19.605  1.00 84.74  ? 135  PRO A CD  1 
ATOM   559   N N   . GLY A 1 125 ? -28.469 27.667  23.743  1.00 132.24 ? 136  GLY A N   1 
ATOM   560   C CA  . GLY A 1 125 ? -28.966 28.469  24.851  1.00 132.24 ? 136  GLY A CA  1 
ATOM   561   C C   . GLY A 1 125 ? -30.026 27.915  25.792  1.00 132.24 ? 136  GLY A C   1 
ATOM   562   O O   . GLY A 1 125 ? -30.391 26.740  25.729  1.00 132.24 ? 136  GLY A O   1 
ATOM   563   N N   . PRO A 1 126 ? -30.533 28.766  26.699  1.00 80.42  ? 137  PRO A N   1 
ATOM   564   C CA  . PRO A 1 126 ? -31.559 28.414  27.687  1.00 80.42  ? 137  PRO A CA  1 
ATOM   565   C C   . PRO A 1 126 ? -32.897 27.949  27.113  1.00 80.42  ? 137  PRO A C   1 
ATOM   566   O O   . PRO A 1 126 ? -33.476 28.605  26.249  1.00 80.42  ? 137  PRO A O   1 
ATOM   567   C CB  . PRO A 1 126 ? -31.698 29.696  28.506  1.00 139.04 ? 137  PRO A CB  1 
ATOM   568   C CG  . PRO A 1 126 ? -30.314 30.269  28.456  1.00 139.04 ? 137  PRO A CG  1 
ATOM   569   C CD  . PRO A 1 126 ? -29.960 30.091  26.999  1.00 139.04 ? 137  PRO A CD  1 
ATOM   570   N N   . LEU A 1 127 ? -33.381 26.816  27.619  1.00 79.29  ? 138  LEU A N   1 
ATOM   571   C CA  . LEU A 1 127 ? -34.655 26.229  27.197  1.00 79.29  ? 138  LEU A CA  1 
ATOM   572   C C   . LEU A 1 127 ? -35.767 26.542  28.206  1.00 79.29  ? 138  LEU A C   1 
ATOM   573   O O   . LEU A 1 127 ? -35.540 27.233  29.199  1.00 79.29  ? 138  LEU A O   1 
ATOM   574   C CB  . LEU A 1 127 ? -34.517 24.704  27.068  1.00 54.06  ? 138  LEU A CB  1 
ATOM   575   C CG  . LEU A 1 127 ? -34.186 23.981  25.755  1.00 54.06  ? 138  LEU A CG  1 
ATOM   576   C CD1 . LEU A 1 127 ? -32.923 24.546  25.101  1.00 54.06  ? 138  LEU A CD1 1 
ATOM   577   C CD2 . LEU A 1 127 ? -34.040 22.502  26.071  1.00 54.06  ? 138  LEU A CD2 1 
ATOM   578   N N   . LEU A 1 128 ? -36.965 26.022  27.949  1.00 144.87 ? 139  LEU A N   1 
ATOM   579   C CA  . LEU A 1 128 ? -38.108 26.231  28.835  1.00 144.87 ? 139  LEU A CA  1 
ATOM   580   C C   . LEU A 1 128 ? -38.112 25.175  29.955  1.00 144.87 ? 139  LEU A C   1 
ATOM   581   O O   . LEU A 1 128 ? -37.293 24.251  29.946  1.00 144.87 ? 139  LEU A O   1 
ATOM   582   C CB  . LEU A 1 128 ? -39.417 26.184  28.021  1.00 96.87  ? 139  LEU A CB  1 
ATOM   583   C CG  . LEU A 1 128 ? -39.876 24.913  27.286  1.00 96.87  ? 139  LEU A CG  1 
ATOM   584   C CD1 . LEU A 1 128 ? -40.482 23.918  28.269  1.00 96.87  ? 139  LEU A CD1 1 
ATOM   585   C CD2 . LEU A 1 128 ? -40.913 25.288  26.233  1.00 96.87  ? 139  LEU A CD2 1 
ATOM   586   N N   . PRO A 1 129 ? -39.026 25.301  30.939  1.00 164.78 ? 140  PRO A N   1 
ATOM   587   C CA  . PRO A 1 129 ? -39.111 24.348  32.055  1.00 164.78 ? 140  PRO A CA  1 
ATOM   588   C C   . PRO A 1 129 ? -39.603 22.944  31.699  1.00 164.78 ? 140  PRO A C   1 
ATOM   589   O O   . PRO A 1 129 ? -40.801 22.671  31.740  1.00 164.78 ? 140  PRO A O   1 
ATOM   590   C CB  . PRO A 1 129 ? -40.048 25.051  33.035  1.00 180.48 ? 140  PRO A CB  1 
ATOM   591   C CG  . PRO A 1 129 ? -40.960 25.807  32.127  1.00 180.48 ? 140  PRO A CG  1 
ATOM   592   C CD  . PRO A 1 129 ? -39.990 26.401  31.130  1.00 180.48 ? 140  PRO A CD  1 
ATOM   593   N N   . GLY A 1 130 ? -38.669 22.056  31.369  1.00 149.60 ? 141  GLY A N   1 
ATOM   594   C CA  . GLY A 1 130 ? -39.035 20.694  31.024  1.00 149.60 ? 141  GLY A CA  1 
ATOM   595   C C   . GLY A 1 130 ? -38.393 20.203  29.740  1.00 149.60 ? 141  GLY A C   1 
ATOM   596   O O   . GLY A 1 130 ? -37.210 19.862  29.721  1.00 149.60 ? 141  GLY A O   1 
ATOM   597   N N   . ASP A 1 131 ? -39.184 20.164  28.671  1.00 201.99 ? 142  ASP A N   1 
ATOM   598   C CA  . ASP A 1 131 ? -38.730 19.717  27.354  1.00 201.99 ? 142  ASP A CA  1 
ATOM   599   C C   . ASP A 1 131 ? -38.558 18.201  27.260  1.00 201.99 ? 142  ASP A C   1 
ATOM   600   O O   . ASP A 1 131 ? -38.737 17.619  26.189  1.00 201.99 ? 142  ASP A O   1 
ATOM   601   C CB  . ASP A 1 131 ? -37.420 20.412  26.973  1.00 132.78 ? 142  ASP A CB  1 
ATOM   602   C CG  . ASP A 1 131 ? -37.553 21.920  26.935  1.00 132.78 ? 142  ASP A CG  1 
ATOM   603   O OD1 . ASP A 1 131 ? -37.920 22.499  27.978  1.00 132.78 ? 142  ASP A OD1 1 
ATOM   604   O OD2 . ASP A 1 131 ? -37.293 22.524  25.872  1.00 132.78 ? 142  ASP A OD2 1 
ATOM   605   N N   . SER A 1 132 ? -38.203 17.569  28.377  1.00 151.41 ? 143  SER A N   1 
ATOM   606   C CA  . SER A 1 132 ? -38.026 16.116  28.433  1.00 151.41 ? 143  SER A CA  1 
ATOM   607   C C   . SER A 1 132 ? -36.931 15.570  27.513  1.00 151.41 ? 143  SER A C   1 
ATOM   608   O O   . SER A 1 132 ? -36.588 14.387  27.579  1.00 151.41 ? 143  SER A O   1 
ATOM   609   C CB  . SER A 1 132 ? -39.352 15.414  28.111  1.00 147.83 ? 143  SER A CB  1 
ATOM   610   O OG  . SER A 1 132 ? -40.370 15.791  29.023  1.00 147.83 ? 143  SER A OG  1 
ATOM   611   N N   . ALA A 1 133 ? -36.388 16.424  26.653  1.00 112.75 ? 144  ALA A N   1 
ATOM   612   C CA  . ALA A 1 133 ? -35.332 16.001  25.741  1.00 112.75 ? 144  ALA A CA  1 
ATOM   613   C C   . ALA A 1 133 ? -33.985 16.055  26.450  1.00 112.75 ? 144  ALA A C   1 
ATOM   614   O O   . ALA A 1 133 ? -33.794 16.815  27.401  1.00 112.75 ? 144  ALA A O   1 
ATOM   615   C CB  . ALA A 1 133 ? -35.311 16.892  24.499  1.00 135.67 ? 144  ALA A CB  1 
ATOM   616   N N   . PHE A 1 134 ? -33.052 15.240  25.982  1.00 56.65  ? 145  PHE A N   1 
ATOM   617   C CA  . PHE A 1 134 ? -31.725 15.189  26.572  1.00 56.65  ? 145  PHE A CA  1 
ATOM   618   C C   . PHE A 1 134 ? -30.975 16.494  26.355  1.00 56.65  ? 145  PHE A C   1 
ATOM   619   O O   . PHE A 1 134 ? -31.060 17.081  25.278  1.00 56.65  ? 145  PHE A O   1 
ATOM   620   C CB  . PHE A 1 134 ? -30.917 14.055  25.943  1.00 71.02  ? 145  PHE A CB  1 
ATOM   621   C CG  . PHE A 1 134 ? -31.612 12.729  25.956  1.00 71.02  ? 145  PHE A CG  1 
ATOM   622   C CD1 . PHE A 1 134 ? -31.976 12.133  27.153  1.00 71.02  ? 145  PHE A CD1 1 
ATOM   623   C CD2 . PHE A 1 134 ? -31.893 12.073  24.762  1.00 71.02  ? 145  PHE A CD2 1 
ATOM   624   C CE1 . PHE A 1 134 ? -32.612 10.901  27.166  1.00 71.02  ? 145  PHE A CE1 1 
ATOM   625   C CE2 . PHE A 1 134 ? -32.532 10.839  24.760  1.00 71.02  ? 145  PHE A CE2 1 
ATOM   626   C CZ  . PHE A 1 134 ? -32.894 10.249  25.969  1.00 71.02  ? 145  PHE A CZ  1 
ATOM   627   N N   . ARG A 1 135 ? -30.232 16.930  27.371  1.00 55.69  ? 146  ARG A N   1 
ATOM   628   C CA  . ARG A 1 135 ? -29.437 18.151  27.283  1.00 55.69  ? 146  ARG A CA  1 
ATOM   629   C C   . ARG A 1 135 ? -28.053 17.779  26.767  1.00 55.69  ? 146  ARG A C   1 
ATOM   630   O O   . ARG A 1 135 ? -27.601 16.654  26.967  1.00 55.69  ? 146  ARG A O   1 
ATOM   631   C CB  . ARG A 1 135 ? -29.272 18.785  28.664  1.00 79.56  ? 146  ARG A CB  1 
ATOM   632   C CG  . ARG A 1 135 ? -30.562 19.156  29.371  1.00 79.56  ? 146  ARG A CG  1 
ATOM   633   C CD  . ARG A 1 135 ? -31.240 20.368  28.734  1.00 79.56  ? 146  ARG A CD  1 
ATOM   634   N NE  . ARG A 1 135 ? -32.482 20.742  29.413  1.00 79.56  ? 146  ARG A NE  1 
ATOM   635   C CZ  . ARG A 1 135 ? -33.538 19.941  29.552  1.00 79.56  ? 146  ARG A CZ  1 
ATOM   636   N NH1 . ARG A 1 135 ? -33.522 18.705  29.063  1.00 79.56  ? 146  ARG A NH1 1 
ATOM   637   N NH2 . ARG A 1 135 ? -34.615 20.384  30.185  1.00 79.56  ? 146  ARG A NH2 1 
ATOM   638   N N   . LEU A 1 136 ? -27.380 18.710  26.100  1.00 53.03  ? 147  LEU A N   1 
ATOM   639   C CA  . LEU A 1 136 ? -26.021 18.460  25.609  1.00 53.03  ? 147  LEU A CA  1 
ATOM   640   C C   . LEU A 1 136 ? -25.060 19.093  26.612  1.00 53.03  ? 147  LEU A C   1 
ATOM   641   O O   . LEU A 1 136 ? -24.912 20.321  26.666  1.00 53.03  ? 147  LEU A O   1 
ATOM   642   C CB  . LEU A 1 136 ? -25.798 19.091  24.237  1.00 49.94  ? 147  LEU A CB  1 
ATOM   643   C CG  . LEU A 1 136 ? -26.779 18.652  23.165  1.00 49.94  ? 147  LEU A CG  1 
ATOM   644   C CD1 . LEU A 1 136 ? -26.402 19.302  21.859  1.00 49.94  ? 147  LEU A CD1 1 
ATOM   645   C CD2 . LEU A 1 136 ? -26.769 17.159  23.036  1.00 49.94  ? 147  LEU A CD2 1 
ATOM   646   N N   . VAL A 1 137 ? -24.413 18.244  27.406  1.00 66.10  ? 148  VAL A N   1 
ATOM   647   C CA  . VAL A 1 137 ? -23.485 18.705  28.430  1.00 66.10  ? 148  VAL A CA  1 
ATOM   648   C C   . VAL A 1 137 ? -22.031 18.511  27.992  1.00 66.10  ? 148  VAL A C   1 
ATOM   649   O O   . VAL A 1 137 ? -21.620 17.399  27.640  1.00 66.10  ? 148  VAL A O   1 
ATOM   650   C CB  . VAL A 1 137 ? -23.746 17.947  29.759  1.00 53.84  ? 148  VAL A CB  1 
ATOM   651   C CG1 . VAL A 1 137 ? -23.310 18.794  30.948  1.00 53.84  ? 148  VAL A CG1 1 
ATOM   652   C CG2 . VAL A 1 137 ? -25.222 17.604  29.872  1.00 53.84  ? 148  VAL A CG2 1 
ATOM   653   N N   . SER A 1 138 ? -21.257 19.593  28.008  1.00 93.96  ? 149  SER A N   1 
ATOM   654   C CA  . SER A 1 138 ? -19.856 19.517  27.607  1.00 93.96  ? 149  SER A CA  1 
ATOM   655   C C   . SER A 1 138 ? -19.081 18.592  28.535  1.00 93.96  ? 149  SER A C   1 
ATOM   656   O O   . SER A 1 138 ? -18.586 19.023  29.577  1.00 93.96  ? 149  SER A O   1 
ATOM   657   C CB  . SER A 1 138 ? -19.211 20.905  27.615  1.00 172.37 ? 149  SER A CB  1 
ATOM   658   O OG  . SER A 1 138 ? -17.849 20.831  27.223  1.00 172.37 ? 149  SER A OG  1 
ATOM   659   N N   . ALA A 1 139 ? -18.977 17.323  28.138  1.00 96.51  ? 150  ALA A N   1 
ATOM   660   C CA  . ALA A 1 139 ? -18.284 16.289  28.911  1.00 96.51  ? 150  ALA A CA  1 
ATOM   661   C C   . ALA A 1 139 ? -17.154 16.794  29.792  1.00 96.51  ? 150  ALA A C   1 
ATOM   662   O O   . ALA A 1 139 ? -17.118 16.504  30.984  1.00 96.51  ? 150  ALA A O   1 
ATOM   663   C CB  . ALA A 1 139 ? -17.755 15.214  27.977  1.00 127.78 ? 150  ALA A CB  1 
ATOM   664   N N   . GLU A 1 140 ? -16.236 17.557  29.209  1.00 88.58  ? 151  GLU A N   1 
ATOM   665   C CA  . GLU A 1 140 ? -15.103 18.064  29.968  1.00 88.58  ? 151  GLU A CA  1 
ATOM   666   C C   . GLU A 1 140 ? -15.471 19.121  31.006  1.00 88.58  ? 151  GLU A C   1 
ATOM   667   O O   . GLU A 1 140 ? -14.627 19.907  31.435  1.00 88.58  ? 151  GLU A O   1 
ATOM   668   C CB  . GLU A 1 140 ? -14.026 18.601  29.021  1.00 201.99 ? 151  GLU A CB  1 
ATOM   669   C CG  . GLU A 1 140 ? -12.629 18.661  29.646  1.00 201.99 ? 151  GLU A CG  1 
ATOM   670   C CD  . GLU A 1 140 ? -12.119 17.298  30.107  1.00 201.99 ? 151  GLU A CD  1 
ATOM   671   O OE1 . GLU A 1 140 ? -12.736 16.696  31.013  1.00 201.99 ? 151  GLU A OE1 1 
ATOM   672   O OE2 . GLU A 1 140 ? -11.098 16.828  29.562  1.00 201.99 ? 151  GLU A OE2 1 
ATOM   673   N N   . THR A 1 141 ? -16.739 19.145  31.399  1.00 100.24 ? 152  THR A N   1 
ATOM   674   C CA  . THR A 1 141 ? -17.202 20.073  32.424  1.00 100.24 ? 152  THR A CA  1 
ATOM   675   C C   . THR A 1 141 ? -17.553 19.173  33.592  1.00 100.24 ? 152  THR A C   1 
ATOM   676   O O   . THR A 1 141 ? -17.316 19.509  34.751  1.00 100.24 ? 152  THR A O   1 
ATOM   677   C CB  . THR A 1 141 ? -18.467 20.858  31.996  1.00 101.19 ? 152  THR A CB  1 
ATOM   678   O OG1 . THR A 1 141 ? -19.513 19.943  31.645  1.00 101.19 ? 152  THR A OG1 1 
ATOM   679   C CG2 . THR A 1 141 ? -18.158 21.757  30.821  1.00 101.19 ? 152  THR A CG2 1 
ATOM   680   N N   . LEU A 1 142 ? -18.119 18.017  33.264  1.00 88.85  ? 153  LEU A N   1 
ATOM   681   C CA  . LEU A 1 142 ? -18.491 17.044  34.273  1.00 88.85  ? 153  LEU A CA  1 
ATOM   682   C C   . LEU A 1 142 ? -17.220 16.737  35.053  1.00 88.85  ? 153  LEU A C   1 
ATOM   683   O O   . LEU A 1 142 ? -17.214 16.740  36.284  1.00 88.85  ? 153  LEU A O   1 
ATOM   684   C CB  . LEU A 1 142 ? -19.044 15.771  33.608  1.00 60.29  ? 153  LEU A CB  1 
ATOM   685   C CG  . LEU A 1 142 ? -20.345 15.904  32.799  1.00 60.29  ? 153  LEU A CG  1 
ATOM   686   C CD1 . LEU A 1 142 ? -20.719 14.549  32.204  1.00 60.29  ? 153  LEU A CD1 1 
ATOM   687   C CD2 . LEU A 1 142 ? -21.464 16.419  33.692  1.00 60.29  ? 153  LEU A CD2 1 
ATOM   688   N N   . ARG A 1 143 ? -16.139 16.489  34.323  1.00 120.41 ? 154  ARG A N   1 
ATOM   689   C CA  . ARG A 1 143 ? -14.850 16.200  34.936  1.00 120.41 ? 154  ARG A CA  1 
ATOM   690   C C   . ARG A 1 143 ? -14.487 17.282  35.968  1.00 120.41 ? 154  ARG A C   1 
ATOM   691   O O   . ARG A 1 143 ? -14.386 16.989  37.158  1.00 120.41 ? 154  ARG A O   1 
ATOM   692   C CB  . ARG A 1 143 ? -13.776 16.096  33.845  1.00 79.53  ? 154  ARG A CB  1 
ATOM   693   C CG  . ARG A 1 143 ? -13.297 14.675  33.565  1.00 79.53  ? 154  ARG A CG  1 
ATOM   694   C CD  . ARG A 1 143 ? -12.358 14.198  34.680  1.00 79.53  ? 154  ARG A CD  1 
ATOM   695   N NE  . ARG A 1 143 ? -11.746 12.892  34.425  1.00 79.53  ? 154  ARG A NE  1 
ATOM   696   C CZ  . ARG A 1 143 ? -12.247 11.726  34.837  1.00 79.53  ? 154  ARG A CZ  1 
ATOM   697   N NH1 . ARG A 1 143 ? -13.381 11.684  35.534  1.00 79.53  ? 154  ARG A NH1 1 
ATOM   698   N NH2 . ARG A 1 143 ? -11.604 10.594  34.562  1.00 79.53  ? 154  ARG A NH2 1 
ATOM   699   N N   . GLU A 1 144 ? -14.313 18.526  35.516  1.00 105.20 ? 155  GLU A N   1 
ATOM   700   C CA  . GLU A 1 144 ? -13.966 19.645  36.405  1.00 105.20 ? 155  GLU A CA  1 
ATOM   701   C C   . GLU A 1 144 ? -14.921 19.794  37.578  1.00 105.20 ? 155  GLU A C   1 
ATOM   702   O O   . GLU A 1 144 ? -14.773 20.699  38.397  1.00 105.20 ? 155  GLU A O   1 
ATOM   703   C CB  . GLU A 1 144 ? -13.946 20.976  35.644  1.00 138.39 ? 155  GLU A CB  1 
ATOM   704   C CG  . GLU A 1 144 ? -12.758 21.177  34.725  1.00 138.39 ? 155  GLU A CG  1 
ATOM   705   C CD  . GLU A 1 144 ? -12.651 22.606  34.228  1.00 138.39 ? 155  GLU A CD  1 
ATOM   706   O OE1 . GLU A 1 144 ? -11.762 22.881  33.392  1.00 138.39 ? 155  GLU A OE1 1 
ATOM   707   O OE2 . GLU A 1 144 ? -13.453 23.455  34.676  1.00 138.39 ? 155  GLU A OE2 1 
ATOM   708   N N   . ILE A 1 145 ? -15.912 18.917  37.643  1.00 129.48 ? 156  ILE A N   1 
ATOM   709   C CA  . ILE A 1 145 ? -16.882 18.951  38.718  1.00 129.48 ? 156  ILE A CA  1 
ATOM   710   C C   . ILE A 1 145 ? -16.572 17.806  39.672  1.00 129.48 ? 156  ILE A C   1 
ATOM   711   O O   . ILE A 1 145 ? -16.872 17.878  40.862  1.00 129.48 ? 156  ILE A O   1 
ATOM   712   C CB  . ILE A 1 145 ? -18.302 18.822  38.160  1.00 134.24 ? 156  ILE A CB  1 
ATOM   713   C CG1 . ILE A 1 145 ? -18.576 19.997  37.225  1.00 134.24 ? 156  ILE A CG1 1 
ATOM   714   C CG2 . ILE A 1 145 ? -19.317 18.808  39.284  1.00 134.24 ? 156  ILE A CG2 1 
ATOM   715   C CD1 . ILE A 1 145 ? -19.817 19.831  36.402  1.00 134.24 ? 156  ILE A CD1 1 
ATOM   716   N N   . LEU A 1 146 ? -15.965 16.749  39.146  1.00 124.06 ? 157  LEU A N   1 
ATOM   717   C CA  . LEU A 1 146 ? -15.592 15.612  39.975  1.00 124.06 ? 157  LEU A CA  1 
ATOM   718   C C   . LEU A 1 146 ? -14.208 15.922  40.541  1.00 124.06 ? 157  LEU A C   1 
ATOM   719   O O   . LEU A 1 146 ? -13.293 15.094  40.521  1.00 124.06 ? 157  LEU A O   1 
ATOM   720   C CB  . LEU A 1 146 ? -15.571 14.327  39.142  1.00 93.65  ? 157  LEU A CB  1 
ATOM   721   C CG  . LEU A 1 146 ? -16.907 13.961  38.488  1.00 93.65  ? 157  LEU A CG  1 
ATOM   722   C CD1 . LEU A 1 146 ? -16.804 12.575  37.890  1.00 93.65  ? 157  LEU A CD1 1 
ATOM   723   C CD2 . LEU A 1 146 ? -18.023 13.997  39.520  1.00 93.65  ? 157  LEU A CD2 1 
ATOM   724   N N   . GLN A 1 147 ? -14.087 17.149  41.038  1.00 120.36 ? 158  GLN A N   1 
ATOM   725   C CA  . GLN A 1 147 ? -12.864 17.685  41.624  1.00 120.36 ? 158  GLN A CA  1 
ATOM   726   C C   . GLN A 1 147 ? -13.317 18.965  42.330  1.00 120.36 ? 158  GLN A C   1 
ATOM   727   O O   . GLN A 1 147 ? -14.464 19.054  42.764  1.00 120.36 ? 158  GLN A O   1 
ATOM   728   C CB  . GLN A 1 147 ? -11.860 18.013  40.513  1.00 181.79 ? 158  GLN A CB  1 
ATOM   729   C CG  . GLN A 1 147 ? -10.485 18.459  40.984  1.00 181.79 ? 158  GLN A CG  1 
ATOM   730   C CD  . GLN A 1 147 ? -9.631  18.985  39.846  1.00 181.79 ? 158  GLN A CD  1 
ATOM   731   O OE1 . GLN A 1 147 ? -9.371  18.277  38.871  1.00 181.79 ? 158  GLN A OE1 1 
ATOM   732   N NE2 . GLN A 1 147 ? -9.193  20.235  39.962  1.00 181.79 ? 158  GLN A NE2 1 
ATOM   733   N N   . ASP A 1 148 ? -12.433 19.952  42.435  1.00 122.69 ? 159  ASP A N   1 
ATOM   734   C CA  . ASP A 1 148 ? -12.763 21.225  43.077  1.00 122.69 ? 159  ASP A CA  1 
ATOM   735   C C   . ASP A 1 148 ? -13.160 21.087  44.549  1.00 122.69 ? 159  ASP A C   1 
ATOM   736   O O   . ASP A 1 148 ? -12.794 21.923  45.378  1.00 122.69 ? 159  ASP A O   1 
ATOM   737   C CB  . ASP A 1 148 ? -13.900 21.931  42.316  1.00 125.99 ? 159  ASP A CB  1 
ATOM   738   C CG  . ASP A 1 148 ? -13.545 22.233  40.863  1.00 125.99 ? 159  ASP A CG  1 
ATOM   739   O OD1 . ASP A 1 148 ? -14.322 22.953  40.194  1.00 125.99 ? 159  ASP A OD1 1 
ATOM   740   O OD2 . ASP A 1 148 ? -12.495 21.747  40.389  1.00 125.99 ? 159  ASP A OD2 1 
ATOM   741   N N   . LYS A 1 149 ? -13.913 20.034  44.862  1.00 201.99 ? 160  LYS A N   1 
ATOM   742   C CA  . LYS A 1 149 ? -14.389 19.767  46.217  1.00 201.99 ? 160  LYS A CA  1 
ATOM   743   C C   . LYS A 1 149 ? -15.313 20.875  46.710  1.00 201.99 ? 160  LYS A C   1 
ATOM   744   O O   . LYS A 1 149 ? -15.951 20.738  47.755  1.00 201.99 ? 160  LYS A O   1 
ATOM   745   C CB  . LYS A 1 149 ? -13.211 19.607  47.184  1.00 157.43 ? 160  LYS A CB  1 
ATOM   746   C CG  . LYS A 1 149 ? -13.622 19.312  48.620  1.00 157.43 ? 160  LYS A CG  1 
ATOM   747   C CD  . LYS A 1 149 ? -12.411 19.050  49.495  1.00 157.43 ? 160  LYS A CD  1 
ATOM   748   C CE  . LYS A 1 149 ? -11.634 17.838  49.000  1.00 157.43 ? 160  LYS A CE  1 
ATOM   749   N NZ  . LYS A 1 149 ? -10.424 17.556  49.822  1.00 157.43 ? 160  LYS A NZ  1 
ATOM   750   N N   . GLU A 1 150 ? -15.382 21.967  45.950  1.00 181.23 ? 161  GLU A N   1 
ATOM   751   C CA  . GLU A 1 150 ? -16.230 23.101  46.300  1.00 181.23 ? 161  GLU A CA  1 
ATOM   752   C C   . GLU A 1 150 ? -17.580 22.571  46.752  1.00 181.23 ? 161  GLU A C   1 
ATOM   753   O O   . GLU A 1 150 ? -18.364 22.077  45.943  1.00 181.23 ? 161  GLU A O   1 
ATOM   754   C CB  . GLU A 1 150 ? -16.408 24.028  45.096  1.00 201.99 ? 161  GLU A CB  1 
ATOM   755   C CG  . GLU A 1 150 ? -17.277 25.243  45.381  1.00 201.99 ? 161  GLU A CG  1 
ATOM   756   C CD  . GLU A 1 150 ? -17.394 26.175  44.190  1.00 201.99 ? 161  GLU A CD  1 
ATOM   757   O OE1 . GLU A 1 150 ? -17.842 25.722  43.115  1.00 201.99 ? 161  GLU A OE1 1 
ATOM   758   O OE2 . GLU A 1 150 ? -17.039 27.364  44.330  1.00 201.99 ? 161  GLU A OE2 1 
ATOM   759   N N   . LEU A 1 151 ? -17.840 22.684  48.051  1.00 115.06 ? 162  LEU A N   1 
ATOM   760   C CA  . LEU A 1 151 ? -19.072 22.189  48.644  1.00 115.06 ? 162  LEU A CA  1 
ATOM   761   C C   . LEU A 1 151 ? -19.399 20.844  48.023  1.00 115.06 ? 162  LEU A C   1 
ATOM   762   O O   . LEU A 1 151 ? -20.385 20.703  47.305  1.00 115.06 ? 162  LEU A O   1 
ATOM   763   C CB  . LEU A 1 151 ? -20.227 23.176  48.430  1.00 83.78  ? 162  LEU A CB  1 
ATOM   764   C CG  . LEU A 1 151 ? -20.288 24.373  49.388  1.00 83.78  ? 162  LEU A CG  1 
ATOM   765   C CD1 . LEU A 1 151 ? -19.206 25.386  49.037  1.00 83.78  ? 162  LEU A CD1 1 
ATOM   766   C CD2 . LEU A 1 151 ? -21.670 25.021  49.314  1.00 83.78  ? 162  LEU A CD2 1 
ATOM   767   N N   . SER A 1 152 ? -18.546 19.861  48.299  1.00 201.99 ? 163  SER A N   1 
ATOM   768   C CA  . SER A 1 152 ? -18.713 18.509  47.779  1.00 201.99 ? 163  SER A CA  1 
ATOM   769   C C   . SER A 1 152 ? -20.024 17.885  48.271  1.00 201.99 ? 163  SER A C   1 
ATOM   770   O O   . SER A 1 152 ? -20.093 16.680  48.528  1.00 201.99 ? 163  SER A O   1 
ATOM   771   C CB  . SER A 1 152 ? -17.521 17.640  48.205  1.00 104.79 ? 163  SER A CB  1 
ATOM   772   O OG  . SER A 1 152 ? -16.299 18.170  47.716  1.00 104.79 ? 163  SER A OG  1 
ATOM   773   N N   . LYS A 1 153 ? -21.059 18.717  48.387  1.00 109.58 ? 164  LYS A N   1 
ATOM   774   C CA  . LYS A 1 153 ? -22.378 18.290  48.848  1.00 109.58 ? 164  LYS A CA  1 
ATOM   775   C C   . LYS A 1 153 ? -23.473 19.292  48.464  1.00 109.58 ? 164  LYS A C   1 
ATOM   776   O O   . LYS A 1 153 ? -24.593 18.899  48.148  1.00 109.58 ? 164  LYS A O   1 
ATOM   777   C CB  . LYS A 1 153 ? -22.368 18.105  50.372  1.00 163.96 ? 164  LYS A CB  1 
ATOM   778   C CG  . LYS A 1 153 ? -21.651 16.848  50.859  1.00 163.96 ? 164  LYS A CG  1 
ATOM   779   C CD  . LYS A 1 153 ? -21.367 16.904  52.356  1.00 163.96 ? 164  LYS A CD  1 
ATOM   780   C CE  . LYS A 1 153 ? -20.251 17.889  52.676  1.00 163.96 ? 164  LYS A CE  1 
ATOM   781   N NZ  . LYS A 1 153 ? -18.957 17.455  52.077  1.00 163.96 ? 164  LYS A NZ  1 
ATOM   782   N N   . GLU A 1 154 ? -23.156 20.584  48.487  1.00 116.51 ? 165  GLU A N   1 
ATOM   783   C CA  . GLU A 1 154 ? -24.152 21.595  48.151  1.00 116.51 ? 165  GLU A CA  1 
ATOM   784   C C   . GLU A 1 154 ? -23.947 22.354  46.844  1.00 116.51 ? 165  GLU A C   1 
ATOM   785   O O   . GLU A 1 154 ? -24.921 22.787  46.224  1.00 116.51 ? 165  GLU A O   1 
ATOM   786   C CB  . GLU A 1 154 ? -24.302 22.587  49.305  1.00 153.59 ? 165  GLU A CB  1 
ATOM   787   C CG  . GLU A 1 154 ? -25.251 22.100  50.382  1.00 153.59 ? 165  GLU A CG  1 
ATOM   788   C CD  . GLU A 1 154 ? -26.610 21.719  49.816  1.00 153.59 ? 165  GLU A CD  1 
ATOM   789   O OE1 . GLU A 1 154 ? -26.685 20.740  49.038  1.00 153.59 ? 165  GLU A OE1 1 
ATOM   790   O OE2 . GLU A 1 154 ? -27.604 22.403  50.144  1.00 153.59 ? 165  GLU A OE2 1 
ATOM   791   N N   . GLN A 1 155 ? -22.696 22.527  46.426  1.00 201.99 ? 166  GLN A N   1 
ATOM   792   C CA  . GLN A 1 155 ? -22.406 23.226  45.174  1.00 201.99 ? 166  GLN A CA  1 
ATOM   793   C C   . GLN A 1 155 ? -22.673 22.306  43.981  1.00 201.99 ? 166  GLN A C   1 
ATOM   794   O O   . GLN A 1 155 ? -23.087 22.759  42.912  1.00 201.99 ? 166  GLN A O   1 
ATOM   795   C CB  . GLN A 1 155 ? -20.949 23.698  45.150  1.00 163.71 ? 166  GLN A CB  1 
ATOM   796   C CG  . GLN A 1 155 ? -20.706 25.057  45.798  1.00 163.71 ? 166  GLN A CG  1 
ATOM   797   C CD  . GLN A 1 155 ? -21.185 26.221  44.941  1.00 163.71 ? 166  GLN A CD  1 
ATOM   798   O OE1 . GLN A 1 155 ? -20.960 27.385  45.276  1.00 163.71 ? 166  GLN A OE1 1 
ATOM   799   N NE2 . GLN A 1 155 ? -21.846 25.911  43.830  1.00 163.71 ? 166  GLN A NE2 1 
ATOM   800   N N   . LEU A 1 156 ? -22.424 21.014  44.178  1.00 87.06  ? 167  LEU A N   1 
ATOM   801   C CA  . LEU A 1 156 ? -22.645 20.001  43.153  1.00 87.06  ? 167  LEU A CA  1 
ATOM   802   C C   . LEU A 1 156 ? -24.090 19.532  43.209  1.00 87.06  ? 167  LEU A C   1 
ATOM   803   O O   . LEU A 1 156 ? -24.425 18.482  42.664  1.00 87.06  ? 167  LEU A O   1 
ATOM   804   C CB  . LEU A 1 156 ? -21.731 18.799  43.388  1.00 80.39  ? 167  LEU A CB  1 
ATOM   805   C CG  . LEU A 1 156 ? -20.641 18.544  42.350  1.00 80.39  ? 167  LEU A CG  1 
ATOM   806   C CD1 . LEU A 1 156 ? -19.674 19.731  42.310  1.00 80.39  ? 167  LEU A CD1 1 
ATOM   807   C CD2 . LEU A 1 156 ? -19.914 17.251  42.699  1.00 80.39  ? 167  LEU A CD2 1 
ATOM   808   N N   . VAL A 1 157 ? -24.937 20.302  43.887  1.00 85.29  ? 168  VAL A N   1 
ATOM   809   C CA  . VAL A 1 157 ? -26.351 19.964  44.015  1.00 85.29  ? 168  VAL A CA  1 
ATOM   810   C C   . VAL A 1 157 ? -27.225 21.151  43.603  1.00 85.29  ? 168  VAL A C   1 
ATOM   811   O O   . VAL A 1 157 ? -28.455 21.046  43.549  1.00 85.29  ? 168  VAL A O   1 
ATOM   812   C CB  . VAL A 1 157 ? -26.685 19.523  45.466  1.00 198.42 ? 168  VAL A CB  1 
ATOM   813   C CG1 . VAL A 1 157 ? -28.177 19.258  45.619  1.00 198.42 ? 168  VAL A CG1 1 
ATOM   814   C CG2 . VAL A 1 157 ? -25.910 18.259  45.799  1.00 198.42 ? 168  VAL A CG2 1 
ATOM   815   N N   . THR A 1 158 ? -26.569 22.273  43.309  1.00 149.59 ? 169  THR A N   1 
ATOM   816   C CA  . THR A 1 158 ? -27.232 23.499  42.860  1.00 149.59 ? 169  THR A CA  1 
ATOM   817   C C   . THR A 1 158 ? -26.815 23.687  41.404  1.00 149.59 ? 169  THR A C   1 
ATOM   818   O O   . THR A 1 158 ? -27.486 24.364  40.621  1.00 149.59 ? 169  THR A O   1 
ATOM   819   C CB  . THR A 1 158 ? -26.771 24.729  43.667  1.00 201.99 ? 169  THR A CB  1 
ATOM   820   O OG1 . THR A 1 158 ? -27.109 24.551  45.049  1.00 201.99 ? 169  THR A OG1 1 
ATOM   821   C CG2 . THR A 1 158 ? -27.440 25.996  43.138  1.00 201.99 ? 169  THR A CG2 1 
ATOM   822   N N   . PHE A 1 159 ? -25.684 23.075  41.070  1.00 117.28 ? 170  PHE A N   1 
ATOM   823   C CA  . PHE A 1 159 ? -25.131 23.106  39.724  1.00 117.28 ? 170  PHE A CA  1 
ATOM   824   C C   . PHE A 1 159 ? -26.136 22.475  38.776  1.00 117.28 ? 170  PHE A C   1 
ATOM   825   O O   . PHE A 1 159 ? -26.579 23.110  37.825  1.00 117.28 ? 170  PHE A O   1 
ATOM   826   C CB  . PHE A 1 159 ? -23.816 22.326  39.691  1.00 127.32 ? 170  PHE A CB  1 
ATOM   827   C CG  . PHE A 1 159 ? -23.494 21.735  38.353  1.00 127.32 ? 170  PHE A CG  1 
ATOM   828   C CD1 . PHE A 1 159 ? -23.328 22.547  37.240  1.00 127.32 ? 170  PHE A CD1 1 
ATOM   829   C CD2 . PHE A 1 159 ? -23.359 20.360  38.206  1.00 127.32 ? 170  PHE A CD2 1 
ATOM   830   C CE1 . PHE A 1 159 ? -23.031 21.996  35.994  1.00 127.32 ? 170  PHE A CE1 1 
ATOM   831   C CE2 . PHE A 1 159 ? -23.062 19.796  36.967  1.00 127.32 ? 170  PHE A CE2 1 
ATOM   832   C CZ  . PHE A 1 159 ? -22.898 20.615  35.859  1.00 127.32 ? 170  PHE A CZ  1 
ATOM   833   N N   . LEU A 1 160 ? -26.491 21.222  39.047  1.00 70.96  ? 171  LEU A N   1 
ATOM   834   C CA  . LEU A 1 160 ? -27.457 20.508  38.227  1.00 70.96  ? 171  LEU A CA  1 
ATOM   835   C C   . LEU A 1 160 ? -28.769 21.280  38.017  1.00 70.96  ? 171  LEU A C   1 
ATOM   836   O O   . LEU A 1 160 ? -29.659 20.805  37.309  1.00 70.96  ? 171  LEU A O   1 
ATOM   837   C CB  . LEU A 1 160 ? -27.775 19.136  38.833  1.00 84.71  ? 171  LEU A CB  1 
ATOM   838   C CG  . LEU A 1 160 ? -26.652 18.103  38.940  1.00 84.71  ? 171  LEU A CG  1 
ATOM   839   C CD1 . LEU A 1 160 ? -27.265 16.730  39.153  1.00 84.71  ? 171  LEU A CD1 1 
ATOM   840   C CD2 . LEU A 1 160 ? -25.823 18.086  37.678  1.00 84.71  ? 171  LEU A CD2 1 
ATOM   841   N N   . GLU A 1 161 ? -28.914 22.446  38.643  1.00 143.05 ? 172  GLU A N   1 
ATOM   842   C CA  . GLU A 1 161 ? -30.125 23.236  38.437  1.00 143.05 ? 172  GLU A CA  1 
ATOM   843   C C   . GLU A 1 161 ? -29.809 24.258  37.347  1.00 143.05 ? 172  GLU A C   1 
ATOM   844   O O   . GLU A 1 161 ? -30.708 24.890  36.787  1.00 143.05 ? 172  GLU A O   1 
ATOM   845   C CB  . GLU A 1 161 ? -30.568 23.969  39.711  1.00 166.92 ? 172  GLU A CB  1 
ATOM   846   C CG  . GLU A 1 161 ? -31.999 24.528  39.599  1.00 166.92 ? 172  GLU A CG  1 
ATOM   847   C CD  . GLU A 1 161 ? -32.329 25.610  40.621  1.00 166.92 ? 172  GLU A CD  1 
ATOM   848   O OE1 . GLU A 1 161 ? -32.173 25.362  41.835  1.00 166.92 ? 172  GLU A OE1 1 
ATOM   849   O OE2 . GLU A 1 161 ? -32.756 26.709  40.205  1.00 166.92 ? 172  GLU A OE2 1 
ATOM   850   N N   . ASN A 1 162 ? -28.519 24.416  37.058  1.00 169.77 ? 173  ASN A N   1 
ATOM   851   C CA  . ASN A 1 162 ? -28.053 25.336  36.023  1.00 169.77 ? 173  ASN A CA  1 
ATOM   852   C C   . ASN A 1 162 ? -28.116 24.582  34.693  1.00 169.77 ? 173  ASN A C   1 
ATOM   853   O O   . ASN A 1 162 ? -28.542 25.122  33.672  1.00 169.77 ? 173  ASN A O   1 
ATOM   854   C CB  . ASN A 1 162 ? -26.613 25.770  36.314  1.00 110.57 ? 173  ASN A CB  1 
ATOM   855   C CG  . ASN A 1 162 ? -26.164 26.943  35.451  1.00 110.57 ? 173  ASN A CG  1 
ATOM   856   O OD1 . ASN A 1 162 ? -26.714 28.042  35.546  1.00 110.57 ? 173  ASN A OD1 1 
ATOM   857   N ND2 . ASN A 1 162 ? -25.158 26.714  34.610  1.00 110.57 ? 173  ASN A ND2 1 
ATOM   858   N N   . VAL A 1 163 ? -27.686 23.323  34.728  1.00 84.08  ? 174  VAL A N   1 
ATOM   859   C CA  . VAL A 1 163 ? -27.700 22.448  33.565  1.00 84.08  ? 174  VAL A CA  1 
ATOM   860   C C   . VAL A 1 163 ? -29.102 22.443  32.942  1.00 84.08  ? 174  VAL A C   1 
ATOM   861   O O   . VAL A 1 163 ? -29.311 23.059  31.896  1.00 84.08  ? 174  VAL A O   1 
ATOM   862   C CB  . VAL A 1 163 ? -27.255 21.001  33.981  1.00 64.94  ? 174  VAL A CB  1 
ATOM   863   C CG1 . VAL A 1 163 ? -27.985 19.943  33.172  1.00 64.94  ? 174  VAL A CG1 1 
ATOM   864   C CG2 . VAL A 1 163 ? -25.747 20.846  33.783  1.00 64.94  ? 174  VAL A CG2 1 
ATOM   865   N N   . LEU A 1 164 ? -30.051 21.768  33.598  1.00 85.38  ? 175  LEU A N   1 
ATOM   866   C CA  . LEU A 1 164 ? -31.446 21.658  33.136  1.00 85.38  ? 175  LEU A CA  1 
ATOM   867   C C   . LEU A 1 164 ? -32.004 22.932  32.513  1.00 85.38  ? 175  LEU A C   1 
ATOM   868   O O   . LEU A 1 164 ? -32.821 22.874  31.590  1.00 85.38  ? 175  LEU A O   1 
ATOM   869   C CB  . LEU A 1 164 ? -32.362 21.255  34.299  1.00 69.84  ? 175  LEU A CB  1 
ATOM   870   C CG  . LEU A 1 164 ? -32.296 19.831  34.870  1.00 69.84  ? 175  LEU A CG  1 
ATOM   871   C CD1 . LEU A 1 164 ? -33.014 19.787  36.209  1.00 69.84  ? 175  LEU A CD1 1 
ATOM   872   C CD2 . LEU A 1 164 ? -32.922 18.836  33.897  1.00 69.84  ? 175  LEU A CD2 1 
ATOM   873   N N   . LYS A 1 165 ? -31.552 24.074  33.031  1.00 133.71 ? 176  LYS A N   1 
ATOM   874   C CA  . LYS A 1 165 ? -31.997 25.390  32.579  1.00 133.71 ? 176  LYS A CA  1 
ATOM   875   C C   . LYS A 1 165 ? -31.089 26.099  31.577  1.00 133.71 ? 176  LYS A C   1 
ATOM   876   O O   . LYS A 1 165 ? -31.540 27.012  30.887  1.00 133.71 ? 176  LYS A O   1 
ATOM   877   C CB  . LYS A 1 165 ? -32.180 26.320  33.781  1.00 130.80 ? 176  LYS A CB  1 
ATOM   878   C CG  . LYS A 1 165 ? -33.266 25.917  34.758  1.00 130.80 ? 176  LYS A CG  1 
ATOM   879   C CD  . LYS A 1 165 ? -33.270 26.847  35.970  1.00 130.80 ? 176  LYS A CD  1 
ATOM   880   C CE  . LYS A 1 165 ? -33.434 28.309  35.556  1.00 130.80 ? 176  LYS A CE  1 
ATOM   881   N NZ  . LYS A 1 165 ? -33.415 29.249  36.716  1.00 130.80 ? 176  LYS A NZ  1 
ATOM   882   N N   . THR A 1 166 ? -29.822 25.702  31.492  1.00 81.53  ? 177  THR A N   1 
ATOM   883   C CA  . THR A 1 166 ? -28.907 26.376  30.571  1.00 81.53  ? 177  THR A CA  1 
ATOM   884   C C   . THR A 1 166 ? -28.234 25.542  29.471  1.00 81.53  ? 177  THR A C   1 
ATOM   885   O O   . THR A 1 166 ? -27.449 26.081  28.682  1.00 81.53  ? 177  THR A O   1 
ATOM   886   C CB  . THR A 1 166 ? -27.795 27.097  31.347  1.00 126.23 ? 177  THR A CB  1 
ATOM   887   O OG1 . THR A 1 166 ? -26.905 26.131  31.924  1.00 126.23 ? 177  THR A OG1 1 
ATOM   888   C CG2 . THR A 1 166 ? -28.399 27.951  32.449  1.00 126.23 ? 177  THR A CG2 1 
ATOM   889   N N   . SER A 1 167 ? -28.521 24.244  29.408  1.00 106.08 ? 178  SER A N   1 
ATOM   890   C CA  . SER A 1 167 ? -27.911 23.403  28.379  1.00 106.08 ? 178  SER A CA  1 
ATOM   891   C C   . SER A 1 167 ? -28.767 23.301  27.125  1.00 106.08 ? 178  SER A C   1 
ATOM   892   O O   . SER A 1 167 ? -29.987 23.470  27.179  1.00 106.08 ? 178  SER A O   1 
ATOM   893   C CB  . SER A 1 167 ? -27.624 22.000  28.928  1.00 87.76  ? 178  SER A CB  1 
ATOM   894   O OG  . SER A 1 167 ? -26.386 21.975  29.620  1.00 87.76  ? 178  SER A OG  1 
ATOM   895   N N   . GLY A 1 168 ? -28.121 23.027  25.996  1.00 57.56  ? 179  GLY A N   1 
ATOM   896   C CA  . GLY A 1 168 ? -28.849 22.909  24.747  1.00 57.56  ? 179  GLY A CA  1 
ATOM   897   C C   . GLY A 1 168 ? -29.542 21.572  24.561  1.00 57.56  ? 179  GLY A C   1 
ATOM   898   O O   . GLY A 1 168 ? -29.668 20.792  25.503  1.00 57.56  ? 179  GLY A O   1 
ATOM   899   N N   . LYS A 1 169 ? -30.002 21.313  23.340  1.00 60.16  ? 180  LYS A N   1 
ATOM   900   C CA  . LYS A 1 169 ? -30.668 20.057  23.005  1.00 60.16  ? 180  LYS A CA  1 
ATOM   901   C C   . LYS A 1 169 ? -30.515 19.793  21.515  1.00 60.16  ? 180  LYS A C   1 
ATOM   902   O O   . LYS A 1 169 ? -29.996 20.633  20.779  1.00 60.16  ? 180  LYS A O   1 
ATOM   903   C CB  . LYS A 1 169 ? -32.152 20.125  23.354  1.00 53.12  ? 180  LYS A CB  1 
ATOM   904   C CG  . LYS A 1 169 ? -32.878 21.269  22.685  1.00 53.12  ? 180  LYS A CG  1 
ATOM   905   C CD  . LYS A 1 169 ? -34.368 21.144  22.911  1.00 53.12  ? 180  LYS A CD  1 
ATOM   906   C CE  . LYS A 1 169 ? -35.119 22.378  22.431  1.00 53.12  ? 180  LYS A CE  1 
ATOM   907   N NZ  . LYS A 1 169 ? -36.576 22.259  22.724  1.00 53.12  ? 180  LYS A NZ  1 
ATOM   908   N N   . LEU A 1 170 ? -30.961 18.621  21.079  1.00 40.96  ? 181  LEU A N   1 
ATOM   909   C CA  . LEU A 1 170 ? -30.894 18.246  19.665  1.00 40.96  ? 181  LEU A CA  1 
ATOM   910   C C   . LEU A 1 170 ? -32.276 18.476  19.029  1.00 40.96  ? 181  LEU A C   1 
ATOM   911   O O   . LEU A 1 170 ? -33.309 18.205  19.642  1.00 40.96  ? 181  LEU A O   1 
ATOM   912   C CB  . LEU A 1 170 ? -30.472 16.776  19.538  1.00 49.46  ? 181  LEU A CB  1 
ATOM   913   C CG  . LEU A 1 170 ? -29.129 16.353  20.150  1.00 49.46  ? 181  LEU A CG  1 
ATOM   914   C CD1 . LEU A 1 170 ? -29.079 14.840  20.306  1.00 49.46  ? 181  LEU A CD1 1 
ATOM   915   C CD2 . LEU A 1 170 ? -27.990 16.849  19.280  1.00 49.46  ? 181  LEU A CD2 1 
ATOM   916   N N   . ARG A 1 171 ? -32.286 18.974  17.797  1.00 39.87  ? 182  ARG A N   1 
ATOM   917   C CA  . ARG A 1 171 ? -33.529 19.284  17.087  1.00 39.87  ? 182  ARG A CA  1 
ATOM   918   C C   . ARG A 1 171 ? -34.501 18.148  16.974  1.00 39.87  ? 182  ARG A C   1 
ATOM   919   O O   . ARG A 1 171 ? -34.110 17.037  16.665  1.00 39.87  ? 182  ARG A O   1 
ATOM   920   C CB  . ARG A 1 171 ? -33.241 19.812  15.679  1.00 36.18  ? 182  ARG A CB  1 
ATOM   921   C CG  . ARG A 1 171 ? -32.014 19.227  15.055  1.00 36.18  ? 182  ARG A CG  1 
ATOM   922   C CD  . ARG A 1 171 ? -32.231 18.895  13.619  1.00 36.18  ? 182  ARG A CD  1 
ATOM   923   N NE  . ARG A 1 171 ? -31.647 19.862  12.710  1.00 36.18  ? 182  ARG A NE  1 
ATOM   924   C CZ  . ARG A 1 171 ? -31.170 19.534  11.517  1.00 36.18  ? 182  ARG A CZ  1 
ATOM   925   N NH1 . ARG A 1 171 ? -31.204 18.272  11.116  1.00 36.18  ? 182  ARG A NH1 1 
ATOM   926   N NH2 . ARG A 1 171 ? -30.679 20.461  10.710  1.00 36.18  ? 182  ARG A NH2 1 
ATOM   927   N N   . GLU A 1 172 ? -35.773 18.456  17.223  1.00 42.36  ? 183  GLU A N   1 
ATOM   928   C CA  . GLU A 1 172 ? -36.866 17.498  17.147  1.00 42.36  ? 183  GLU A CA  1 
ATOM   929   C C   . GLU A 1 172 ? -37.411 17.560  15.741  1.00 42.36  ? 183  GLU A C   1 
ATOM   930   O O   . GLU A 1 172 ? -37.984 16.587  15.259  1.00 42.36  ? 183  GLU A O   1 
ATOM   931   C CB  . GLU A 1 172 ? -37.970 17.859  18.149  1.00 187.24 ? 183  GLU A CB  1 
ATOM   932   C CG  . GLU A 1 172 ? -39.396 17.408  17.764  1.00 187.24 ? 183  GLU A CG  1 
ATOM   933   C CD  . GLU A 1 172 ? -39.629 15.906  17.880  1.00 187.24 ? 183  GLU A CD  1 
ATOM   934   O OE1 . GLU A 1 172 ? -40.761 15.453  17.595  1.00 187.24 ? 183  GLU A OE1 1 
ATOM   935   O OE2 . GLU A 1 172 ? -38.688 15.179  18.258  1.00 187.24 ? 183  GLU A OE2 1 
ATOM   936   N N   . ASN A 1 173 ? -37.238 18.705  15.080  1.00 92.83  ? 184  ASN A N   1 
ATOM   937   C CA  . ASN A 1 173 ? -37.710 18.871  13.706  1.00 92.83  ? 184  ASN A CA  1 
ATOM   938   C C   . ASN A 1 173 ? -36.935 19.914  12.903  1.00 92.83  ? 184  ASN A C   1 
ATOM   939   O O   . ASN A 1 173 ? -36.039 20.588  13.423  1.00 92.83  ? 184  ASN A O   1 
ATOM   940   C CB  . ASN A 1 173 ? -39.206 19.212  13.673  1.00 61.31  ? 184  ASN A CB  1 
ATOM   941   C CG  . ASN A 1 173 ? -39.594 20.272  14.687  1.00 61.31  ? 184  ASN A CG  1 
ATOM   942   O OD1 . ASN A 1 173 ? -38.935 21.305  14.823  1.00 61.31  ? 184  ASN A OD1 1 
ATOM   943   N ND2 . ASN A 1 173 ? -40.686 20.022  15.400  1.00 61.31  ? 184  ASN A ND2 1 
ATOM   944   N N   . LEU A 1 174 ? -37.295 20.041  11.627  1.00 41.99  ? 185  LEU A N   1 
ATOM   945   C CA  . LEU A 1 174 ? -36.632 20.974  10.733  1.00 41.99  ? 185  LEU A CA  1 
ATOM   946   C C   . LEU A 1 174 ? -37.385 22.281  10.570  1.00 41.99  ? 185  LEU A C   1 
ATOM   947   O O   . LEU A 1 174 ? -36.909 23.201  9.891   1.00 41.99  ? 185  LEU A O   1 
ATOM   948   C CB  . LEU A 1 174 ? -36.454 20.313  9.371   1.00 28.28  ? 185  LEU A CB  1 
ATOM   949   C CG  . LEU A 1 174 ? -35.419 19.190  9.281   1.00 28.28  ? 185  LEU A CG  1 
ATOM   950   C CD1 . LEU A 1 174 ? -35.247 18.834  7.823   1.00 28.28  ? 185  LEU A CD1 1 
ATOM   951   C CD2 . LEU A 1 174 ? -34.071 19.625  9.872   1.00 28.28  ? 185  LEU A CD2 1 
ATOM   952   N N   . LEU A 1 175 ? -38.551 22.350  11.213  1.00 40.92  ? 186  LEU A N   1 
ATOM   953   C CA  . LEU A 1 175 ? -39.449 23.504  11.148  1.00 40.92  ? 186  LEU A CA  1 
ATOM   954   C C   . LEU A 1 175 ? -38.966 24.741  11.884  1.00 40.92  ? 186  LEU A C   1 
ATOM   955   O O   . LEU A 1 175 ? -39.156 25.860  11.412  1.00 40.92  ? 186  LEU A O   1 
ATOM   956   C CB  . LEU A 1 175 ? -40.830 23.107  11.673  1.00 47.79  ? 186  LEU A CB  1 
ATOM   957   C CG  . LEU A 1 175 ? -42.069 23.975  11.428  1.00 47.79  ? 186  LEU A CG  1 
ATOM   958   C CD1 . LEU A 1 175 ? -43.296 23.203  11.913  1.00 47.79  ? 186  LEU A CD1 1 
ATOM   959   C CD2 . LEU A 1 175 ? -41.958 25.306  12.145  1.00 47.79  ? 186  LEU A CD2 1 
ATOM   960   N N   . HIS A 1 176 ? -38.357 24.560  13.048  1.00 44.40  ? 187  HIS A N   1 
ATOM   961   C CA  . HIS A 1 176 ? -37.865 25.711  13.794  1.00 44.40  ? 187  HIS A CA  1 
ATOM   962   C C   . HIS A 1 176 ? -36.804 26.397  12.936  1.00 44.40  ? 187  HIS A C   1 
ATOM   963   O O   . HIS A 1 176 ? -36.931 27.563  12.607  1.00 44.40  ? 187  HIS A O   1 
ATOM   964   C CB  . HIS A 1 176 ? -37.270 25.273  15.138  1.00 61.91  ? 187  HIS A CB  1 
ATOM   965   C CG  . HIS A 1 176 ? -37.001 26.407  16.079  1.00 61.91  ? 187  HIS A CG  1 
ATOM   966   N ND1 . HIS A 1 176 ? -38.008 27.111  16.706  1.00 61.91  ? 187  HIS A ND1 1 
ATOM   967   C CD2 . HIS A 1 176 ? -35.840 26.980  16.475  1.00 61.91  ? 187  HIS A CD2 1 
ATOM   968   C CE1 . HIS A 1 176 ? -37.478 28.070  17.444  1.00 61.91  ? 187  HIS A CE1 1 
ATOM   969   N NE2 . HIS A 1 176 ? -36.164 28.014  17.320  1.00 61.91  ? 187  HIS A NE2 1 
ATOM   970   N N   . GLY A 1 177 ? -35.775 25.653  12.552  1.00 46.94  ? 188  GLY A N   1 
ATOM   971   C CA  . GLY A 1 177 ? -34.717 26.216  11.743  1.00 46.94  ? 188  GLY A CA  1 
ATOM   972   C C   . GLY A 1 177 ? -35.269 26.851  10.491  1.00 46.94  ? 188  GLY A C   1 
ATOM   973   O O   . GLY A 1 177 ? -34.667 27.763  9.936   1.00 46.94  ? 188  GLY A O   1 
ATOM   974   N N   . ALA A 1 178 ? -36.417 26.374  10.032  1.00 41.75  ? 189  ALA A N   1 
ATOM   975   C CA  . ALA A 1 178 ? -37.019 26.945  8.836   1.00 41.75  ? 189  ALA A CA  1 
ATOM   976   C C   . ALA A 1 178 ? -37.505 28.344  9.168   1.00 41.75  ? 189  ALA A C   1 
ATOM   977   O O   . ALA A 1 178 ? -37.085 29.325  8.557   1.00 41.75  ? 189  ALA A O   1 
ATOM   978   C CB  . ALA A 1 178 ? -38.176 26.093  8.376   1.00 36.07  ? 189  ALA A CB  1 
ATOM   979   N N   . LEU A 1 179 ? -38.393 28.419  10.151  1.00 32.38  ? 190  LEU A N   1 
ATOM   980   C CA  . LEU A 1 179 ? -38.948 29.676  10.594  1.00 32.38  ? 190  LEU A CA  1 
ATOM   981   C C   . LEU A 1 179 ? -37.863 30.690  10.933  1.00 32.38  ? 190  LEU A C   1 
ATOM   982   O O   . LEU A 1 179 ? -37.965 31.847  10.563  1.00 32.38  ? 190  LEU A O   1 
ATOM   983   C CB  . LEU A 1 179 ? -39.825 29.447  11.821  1.00 39.87  ? 190  LEU A CB  1 
ATOM   984   C CG  . LEU A 1 179 ? -40.975 28.466  11.639  1.00 39.87  ? 190  LEU A CG  1 
ATOM   985   C CD1 . LEU A 1 179 ? -41.925 28.573  12.813  1.00 39.87  ? 190  LEU A CD1 1 
ATOM   986   C CD2 . LEU A 1 179 ? -41.693 28.786  10.331  1.00 39.87  ? 190  LEU A CD2 1 
ATOM   987   N N   . GLU A 1 180 ? -36.833 30.261  11.649  1.00 43.19  ? 191  GLU A N   1 
ATOM   988   C CA  . GLU A 1 180 ? -35.749 31.155  12.027  1.00 43.19  ? 191  GLU A CA  1 
ATOM   989   C C   . GLU A 1 180 ? -35.181 31.883  10.822  1.00 43.19  ? 191  GLU A C   1 
ATOM   990   O O   . GLU A 1 180 ? -34.535 32.911  10.979  1.00 43.19  ? 191  GLU A O   1 
ATOM   991   C CB  . GLU A 1 180 ? -34.617 30.388  12.736  1.00 84.24  ? 191  GLU A CB  1 
ATOM   992   C CG  . GLU A 1 180 ? -34.835 30.141  14.233  1.00 84.24  ? 191  GLU A CG  1 
ATOM   993   C CD  . GLU A 1 180 ? -33.587 29.630  14.952  1.00 84.24  ? 191  GLU A CD  1 
ATOM   994   O OE1 . GLU A 1 180 ? -32.534 30.298  14.899  1.00 84.24  ? 191  GLU A OE1 1 
ATOM   995   O OE2 . GLU A 1 180 ? -33.656 28.560  15.585  1.00 84.24  ? 191  GLU A OE2 1 
ATOM   996   N N   . HIS A 1 181 ? -35.429 31.361  9.622   1.00 54.87  ? 192  HIS A N   1 
ATOM   997   C CA  . HIS A 1 181 ? -34.935 31.977  8.382   1.00 54.87  ? 192  HIS A CA  1 
ATOM   998   C C   . HIS A 1 181 ? -35.910 32.908  7.652   1.00 54.87  ? 192  HIS A C   1 
ATOM   999   O O   . HIS A 1 181 ? -35.488 33.814  6.938   1.00 54.87  ? 192  HIS A O   1 
ATOM   1000  C CB  . HIS A 1 181 ? -34.466 30.892  7.413   1.00 63.92  ? 192  HIS A CB  1 
ATOM   1001  C CG  . HIS A 1 181 ? -33.135 30.313  7.767   1.00 63.92  ? 192  HIS A CG  1 
ATOM   1002  N ND1 . HIS A 1 181 ? -31.954 30.989  7.557   1.00 63.92  ? 192  HIS A ND1 1 
ATOM   1003  C CD2 . HIS A 1 181 ? -32.800 29.153  8.377   1.00 63.92  ? 192  HIS A CD2 1 
ATOM   1004  C CE1 . HIS A 1 181 ? -30.950 30.272  8.027   1.00 63.92  ? 192  HIS A CE1 1 
ATOM   1005  N NE2 . HIS A 1 181 ? -31.436 29.153  8.530   1.00 63.92  ? 192  HIS A NE2 1 
ATOM   1006  N N   . TYR A 1 182 ? -37.207 32.686  7.831   1.00 38.24  ? 193  TYR A N   1 
ATOM   1007  C CA  . TYR A 1 182 ? -38.236 33.494  7.181   1.00 38.24  ? 193  TYR A CA  1 
ATOM   1008  C C   . TYR A 1 182 ? -37.903 34.965  6.893   1.00 38.24  ? 193  TYR A C   1 
ATOM   1009  O O   . TYR A 1 182 ? -37.974 35.403  5.752   1.00 38.24  ? 193  TYR A O   1 
ATOM   1010  C CB  . TYR A 1 182 ? -39.538 33.442  7.983   1.00 50.53  ? 193  TYR A CB  1 
ATOM   1011  C CG  . TYR A 1 182 ? -40.625 34.285  7.356   1.00 50.53  ? 193  TYR A CG  1 
ATOM   1012  C CD1 . TYR A 1 182 ? -41.199 33.926  6.142   1.00 50.53  ? 193  TYR A CD1 1 
ATOM   1013  C CD2 . TYR A 1 182 ? -41.041 35.469  7.953   1.00 50.53  ? 193  TYR A CD2 1 
ATOM   1014  C CE1 . TYR A 1 182 ? -42.157 34.725  5.540   1.00 50.53  ? 193  TYR A CE1 1 
ATOM   1015  C CE2 . TYR A 1 182 ? -41.999 36.277  7.355   1.00 50.53  ? 193  TYR A CE2 1 
ATOM   1016  C CZ  . TYR A 1 182 ? -42.558 35.903  6.148   1.00 50.53  ? 193  TYR A CZ  1 
ATOM   1017  O OH  . TYR A 1 182 ? -43.528 36.706  5.568   1.00 50.53  ? 193  TYR A OH  1 
ATOM   1018  N N   . VAL A 1 183 ? -37.570 35.736  7.918   1.00 62.08  ? 194  VAL A N   1 
ATOM   1019  C CA  . VAL A 1 183 ? -37.264 37.137  7.683   1.00 62.08  ? 194  VAL A CA  1 
ATOM   1020  C C   . VAL A 1 183 ? -36.132 37.254  6.683   1.00 62.08  ? 194  VAL A C   1 
ATOM   1021  O O   . VAL A 1 183 ? -36.329 37.765  5.586   1.00 62.08  ? 194  VAL A O   1 
ATOM   1022  C CB  . VAL A 1 183 ? -36.883 37.880  8.988   1.00 43.73  ? 194  VAL A CB  1 
ATOM   1023  C CG1 . VAL A 1 183 ? -36.274 39.256  8.662   1.00 43.73  ? 194  VAL A CG1 1 
ATOM   1024  C CG2 . VAL A 1 183 ? -38.129 38.054  9.858   1.00 43.73  ? 194  VAL A CG2 1 
ATOM   1025  N N   . ASN A 1 184 ? -34.953 36.767  7.054   1.00 89.81  ? 195  ASN A N   1 
ATOM   1026  C CA  . ASN A 1 184 ? -33.795 36.829  6.173   1.00 89.81  ? 195  ASN A CA  1 
ATOM   1027  C C   . ASN A 1 184 ? -34.119 36.362  4.753   1.00 89.81  ? 195  ASN A C   1 
ATOM   1028  O O   . ASN A 1 184 ? -33.643 36.947  3.781   1.00 89.81  ? 195  ASN A O   1 
ATOM   1029  C CB  . ASN A 1 184 ? -32.653 35.988  6.748   1.00 156.93 ? 195  ASN A CB  1 
ATOM   1030  C CG  . ASN A 1 184 ? -32.287 36.395  8.164   1.00 156.93 ? 195  ASN A CG  1 
ATOM   1031  O OD1 . ASN A 1 184 ? -31.928 37.544  8.419   1.00 156.93 ? 195  ASN A OD1 1 
ATOM   1032  N ND2 . ASN A 1 184 ? -32.378 35.451  9.093   1.00 156.93 ? 195  ASN A ND2 1 
ATOM   1033  N N   . CYS A 1 185 ? -34.942 35.322  4.628   1.00 61.29  ? 196  CYS A N   1 
ATOM   1034  C CA  . CYS A 1 185 ? -35.293 34.795  3.312   1.00 61.29  ? 196  CYS A CA  1 
ATOM   1035  C C   . CYS A 1 185 ? -36.488 35.454  2.652   1.00 61.29  ? 196  CYS A C   1 
ATOM   1036  O O   . CYS A 1 185 ? -36.724 35.255  1.463   1.00 61.29  ? 196  CYS A O   1 
ATOM   1037  C CB  . CYS A 1 185 ? -35.510 33.282  3.388   1.00 81.18  ? 196  CYS A CB  1 
ATOM   1038  S SG  . CYS A 1 185 ? -33.958 32.322  3.447   1.00 81.18  ? 196  CYS A SG  1 
ATOM   1039  N N   . LEU A 1 186 ? -37.240 36.238  3.417   1.00 91.48  ? 197  LEU A N   1 
ATOM   1040  C CA  . LEU A 1 186 ? -38.406 36.931  2.879   1.00 91.48  ? 197  LEU A CA  1 
ATOM   1041  C C   . LEU A 1 186 ? -37.917 38.037  1.969   1.00 91.48  ? 197  LEU A C   1 
ATOM   1042  O O   . LEU A 1 186 ? -38.670 38.592  1.181   1.00 91.48  ? 197  LEU A O   1 
ATOM   1043  C CB  . LEU A 1 186 ? -39.243 37.535  4.001   1.00 54.94  ? 197  LEU A CB  1 
ATOM   1044  C CG  . LEU A 1 186 ? -40.557 38.139  3.532   1.00 54.94  ? 197  LEU A CG  1 
ATOM   1045  C CD1 . LEU A 1 186 ? -41.379 37.085  2.799   1.00 54.94  ? 197  LEU A CD1 1 
ATOM   1046  C CD2 . LEU A 1 186 ? -41.310 38.663  4.728   1.00 54.94  ? 197  LEU A CD2 1 
ATOM   1047  N N   . ASP A 1 187 ? -36.641 38.362  2.103   1.00 68.87  ? 198  ASP A N   1 
ATOM   1048  C CA  . ASP A 1 187 ? -36.031 39.387  1.282   1.00 68.87  ? 198  ASP A CA  1 
ATOM   1049  C C   . ASP A 1 187 ? -35.917 38.774  -0.101  1.00 68.87  ? 198  ASP A C   1 
ATOM   1050  O O   . ASP A 1 187 ? -36.611 39.168  -1.030  1.00 68.87  ? 198  ASP A O   1 
ATOM   1051  C CB  . ASP A 1 187 ? -34.639 39.718  1.817   1.00 78.73  ? 198  ASP A CB  1 
ATOM   1052  C CG  . ASP A 1 187 ? -33.901 40.713  0.950   1.00 78.73  ? 198  ASP A CG  1 
ATOM   1053  O OD1 . ASP A 1 187 ? -34.292 41.902  0.962   1.00 78.73  ? 198  ASP A OD1 1 
ATOM   1054  O OD2 . ASP A 1 187 ? -32.939 40.300  0.258   1.00 78.73  ? 198  ASP A OD2 1 
ATOM   1055  N N   . LEU A 1 188 ? -35.034 37.787  -0.197  1.00 84.88  ? 199  LEU A N   1 
ATOM   1056  C CA  . LEU A 1 188 ? -34.729 37.022  -1.405  1.00 84.88  ? 199  LEU A CA  1 
ATOM   1057  C C   . LEU A 1 188 ? -35.800 36.917  -2.502  1.00 84.88  ? 199  LEU A C   1 
ATOM   1058  O O   . LEU A 1 188 ? -35.485 36.656  -3.661  1.00 84.88  ? 199  LEU A O   1 
ATOM   1059  C CB  . LEU A 1 188 ? -34.313 35.624  -0.977  1.00 53.30  ? 199  LEU A CB  1 
ATOM   1060  C CG  . LEU A 1 188 ? -33.639 34.748  -2.007  1.00 53.30  ? 199  LEU A CG  1 
ATOM   1061  C CD1 . LEU A 1 188 ? -32.320 35.354  -2.419  1.00 53.30  ? 199  LEU A CD1 1 
ATOM   1062  C CD2 . LEU A 1 188 ? -33.440 33.384  -1.393  1.00 53.30  ? 199  LEU A CD2 1 
ATOM   1063  N N   . VAL A 1 189 ? -37.063 37.082  -2.143  1.00 102.62 ? 200  VAL A N   1 
ATOM   1064  C CA  . VAL A 1 189 ? -38.125 37.023  -3.134  1.00 102.62 ? 200  VAL A CA  1 
ATOM   1065  C C   . VAL A 1 189 ? -38.853 38.359  -3.138  1.00 102.62 ? 200  VAL A C   1 
ATOM   1066  O O   . VAL A 1 189 ? -40.082 38.397  -3.113  1.00 102.62 ? 200  VAL A O   1 
ATOM   1067  C CB  . VAL A 1 189 ? -39.130 35.909  -2.811  1.00 57.55  ? 200  VAL A CB  1 
ATOM   1068  C CG1 . VAL A 1 189 ? -38.449 34.566  -2.921  1.00 57.55  ? 200  VAL A CG1 1 
ATOM   1069  C CG2 . VAL A 1 189 ? -39.696 36.099  -1.414  1.00 57.55  ? 200  VAL A CG2 1 
ATOM   1070  N N   . ASN A 1 190 ? -38.082 39.448  -3.190  1.00 129.25 ? 201  ASN A N   1 
ATOM   1071  C CA  . ASN A 1 190 ? -38.623 40.807  -3.164  1.00 129.25 ? 201  ASN A CA  1 
ATOM   1072  C C   . ASN A 1 190 ? -39.404 40.958  -1.869  1.00 129.25 ? 201  ASN A C   1 
ATOM   1073  O O   . ASN A 1 190 ? -39.081 41.798  -1.032  1.00 129.25 ? 201  ASN A O   1 
ATOM   1074  C CB  . ASN A 1 190 ? -39.531 41.061  -4.371  1.00 131.95 ? 201  ASN A CB  1 
ATOM   1075  C CG  . ASN A 1 190 ? -38.750 41.415  -5.624  1.00 131.95 ? 201  ASN A CG  1 
ATOM   1076  O OD1 . ASN A 1 190 ? -38.090 42.452  -5.682  1.00 131.95 ? 201  ASN A OD1 1 
ATOM   1077  N ND2 . ASN A 1 190 ? -38.820 40.553  -6.633  1.00 131.95 ? 201  ASN A ND2 1 
ATOM   1078  N N   . LYS A 1 191 ? -40.425 40.122  -1.720  1.00 54.47  ? 202  LYS A N   1 
ATOM   1079  C CA  . LYS A 1 191 ? -41.281 40.080  -0.541  1.00 54.47  ? 202  LYS A CA  1 
ATOM   1080  C C   . LYS A 1 191 ? -42.598 39.392  -0.917  1.00 54.47  ? 202  LYS A C   1 
ATOM   1081  O O   . LYS A 1 191 ? -43.544 39.328  -0.118  1.00 54.47  ? 202  LYS A O   1 
ATOM   1082  C CB  . LYS A 1 191 ? -41.543 41.487  -0.013  1.00 73.68  ? 202  LYS A CB  1 
ATOM   1083  C CG  . LYS A 1 191 ? -41.849 41.531  1.464   1.00 73.68  ? 202  LYS A CG  1 
ATOM   1084  C CD  . LYS A 1 191 ? -40.925 42.493  2.193   1.00 73.68  ? 202  LYS A CD  1 
ATOM   1085  C CE  . LYS A 1 191 ? -41.273 42.520  3.674   1.00 73.68  ? 202  LYS A CE  1 
ATOM   1086  N NZ  . LYS A 1 191 ? -40.407 43.447  4.439   1.00 73.68  ? 202  LYS A NZ  1 
ATOM   1087  N N   . ARG A 1 192 ? -42.637 38.862  -2.142  1.00 84.16  ? 203  ARG A N   1 
ATOM   1088  C CA  . ARG A 1 192 ? -43.814 38.173  -2.662  1.00 84.16  ? 203  ARG A CA  1 
ATOM   1089  C C   . ARG A 1 192 ? -43.956 36.781  -2.070  1.00 84.16  ? 203  ARG A C   1 
ATOM   1090  O O   . ARG A 1 192 ? -42.963 36.090  -1.842  1.00 84.16  ? 203  ARG A O   1 
ATOM   1091  C CB  . ARG A 1 192 ? -43.737 38.040  -4.187  1.00 133.26 ? 203  ARG A CB  1 
ATOM   1092  C CG  . ARG A 1 192 ? -43.548 39.335  -4.948  1.00 133.26 ? 203  ARG A CG  1 
ATOM   1093  C CD  . ARG A 1 192 ? -43.659 39.079  -6.439  1.00 133.26 ? 203  ARG A CD  1 
ATOM   1094  N NE  . ARG A 1 192 ? -42.852 37.933  -6.855  1.00 133.26 ? 203  ARG A NE  1 
ATOM   1095  C CZ  . ARG A 1 192 ? -41.524 37.874  -6.775  1.00 133.26 ? 203  ARG A CZ  1 
ATOM   1096  N NH1 . ARG A 1 192 ? -40.880 36.785  -7.177  1.00 133.26 ? 203  ARG A NH1 1 
ATOM   1097  N NH2 . ARG A 1 192 ? -40.836 38.904  -6.300  1.00 133.26 ? 203  ARG A NH2 1 
ATOM   1098  N N   . LEU A 1 193 ? -45.200 36.379  -1.826  1.00 51.62  ? 204  LEU A N   1 
ATOM   1099  C CA  . LEU A 1 193 ? -45.500 35.058  -1.293  1.00 51.62  ? 204  LEU A CA  1 
ATOM   1100  C C   . LEU A 1 193 ? -46.340 34.356  -2.339  1.00 51.62  ? 204  LEU A C   1 
ATOM   1101  O O   . LEU A 1 193 ? -46.939 34.998  -3.185  1.00 51.62  ? 204  LEU A O   1 
ATOM   1102  C CB  . LEU A 1 193 ? -46.276 35.176  0.007   1.00 45.64  ? 204  LEU A CB  1 
ATOM   1103  C CG  . LEU A 1 193 ? -45.550 35.998  1.066   1.00 45.64  ? 204  LEU A CG  1 
ATOM   1104  C CD1 . LEU A 1 193 ? -46.407 36.021  2.313   1.00 45.64  ? 204  LEU A CD1 1 
ATOM   1105  C CD2 . LEU A 1 193 ? -44.171 35.412  1.365   1.00 45.64  ? 204  LEU A CD2 1 
ATOM   1106  N N   . PRO A 1 194 ? -46.402 33.031  -2.304  1.00 79.55  ? 205  PRO A N   1 
ATOM   1107  C CA  . PRO A 1 194 ? -45.763 32.125  -1.366  1.00 79.55  ? 205  PRO A CA  1 
ATOM   1108  C C   . PRO A 1 194 ? -44.424 31.619  -1.904  1.00 79.55  ? 205  PRO A C   1 
ATOM   1109  O O   . PRO A 1 194 ? -44.159 31.677  -3.116  1.00 79.55  ? 205  PRO A O   1 
ATOM   1110  C CB  . PRO A 1 194 ? -46.782 31.012  -1.269  1.00 38.80  ? 205  PRO A CB  1 
ATOM   1111  C CG  . PRO A 1 194 ? -47.161 30.855  -2.724  1.00 38.80  ? 205  PRO A CG  1 
ATOM   1112  C CD  . PRO A 1 194 ? -47.259 32.283  -3.239  1.00 38.80  ? 205  PRO A CD  1 
ATOM   1113  N N   . TYR A 1 195 ? -43.594 31.121  -0.988  1.00 41.18  ? 206  TYR A N   1 
ATOM   1114  C CA  . TYR A 1 195 ? -42.295 30.557  -1.311  1.00 41.18  ? 206  TYR A CA  1 
ATOM   1115  C C   . TYR A 1 195 ? -41.953 29.606  -0.183  1.00 41.18  ? 206  TYR A C   1 
ATOM   1116  O O   . TYR A 1 195 ? -42.323 29.832  0.963   1.00 41.18  ? 206  TYR A O   1 
ATOM   1117  C CB  . TYR A 1 195 ? -41.248 31.656  -1.398  1.00 39.44  ? 206  TYR A CB  1 
ATOM   1118  C CG  . TYR A 1 195 ? -40.773 32.164  -0.067  1.00 39.44  ? 206  TYR A CG  1 
ATOM   1119  C CD1 . TYR A 1 195 ? -39.718 31.549  0.596   1.00 39.44  ? 206  TYR A CD1 1 
ATOM   1120  C CD2 . TYR A 1 195 ? -41.374 33.265  0.528   1.00 39.44  ? 206  TYR A CD2 1 
ATOM   1121  C CE1 . TYR A 1 195 ? -39.280 32.020  1.812   1.00 39.44  ? 206  TYR A CE1 1 
ATOM   1122  C CE2 . TYR A 1 195 ? -40.943 33.745  1.737   1.00 39.44  ? 206  TYR A CE2 1 
ATOM   1123  C CZ  . TYR A 1 195 ? -39.899 33.121  2.374   1.00 39.44  ? 206  TYR A CZ  1 
ATOM   1124  O OH  . TYR A 1 195 ? -39.470 33.601  3.583   1.00 39.44  ? 206  TYR A OH  1 
ATOM   1125  N N   . GLY A 1 196 ? -41.243 28.538  -0.496  1.00 42.00  ? 207  GLY A N   1 
ATOM   1126  C CA  . GLY A 1 196 ? -40.887 27.607  0.553   1.00 42.00  ? 207  GLY A CA  1 
ATOM   1127  C C   . GLY A 1 196 ? -39.405 27.567  0.874   1.00 42.00  ? 207  GLY A C   1 
ATOM   1128  O O   . GLY A 1 196 ? -38.568 28.150  0.172   1.00 42.00  ? 207  GLY A O   1 
ATOM   1129  N N   . LEU A 1 197 ? -39.106 26.878  1.972   1.00 36.44  ? 208  LEU A N   1 
ATOM   1130  C CA  . LEU A 1 197 ? -37.750 26.659  2.456   1.00 36.44  ? 208  LEU A CA  1 
ATOM   1131  C C   . LEU A 1 197 ? -37.644 25.150  2.716   1.00 36.44  ? 208  LEU A C   1 
ATOM   1132  O O   . LEU A 1 197 ? -38.194 24.629  3.693   1.00 36.44  ? 208  LEU A O   1 
ATOM   1133  C CB  . LEU A 1 197 ? -37.512 27.460  3.740   1.00 43.56  ? 208  LEU A CB  1 
ATOM   1134  C CG  . LEU A 1 197 ? -37.432 28.980  3.577   1.00 43.56  ? 208  LEU A CG  1 
ATOM   1135  C CD1 . LEU A 1 197 ? -37.033 29.614  4.888   1.00 43.56  ? 208  LEU A CD1 1 
ATOM   1136  C CD2 . LEU A 1 197 ? -36.407 29.321  2.525   1.00 43.56  ? 208  LEU A CD2 1 
ATOM   1137  N N   . ALA A 1 198 ? -36.956 24.449  1.819   1.00 52.85  ? 209  ALA A N   1 
ATOM   1138  C CA  . ALA A 1 198 ? -36.819 22.999  1.923   1.00 52.85  ? 209  ALA A CA  1 
ATOM   1139  C C   . ALA A 1 198 ? -35.567 22.589  2.668   1.00 52.85  ? 209  ALA A C   1 
ATOM   1140  O O   . ALA A 1 198 ? -34.541 23.270  2.586   1.00 52.85  ? 209  ALA A O   1 
ATOM   1141  C CB  . ALA A 1 198 ? -36.816 22.380  0.539   1.00 57.07  ? 209  ALA A CB  1 
ATOM   1142  N N   . GLN A 1 199 ? -35.650 21.457  3.366   1.00 27.99  ? 210  GLN A N   1 
ATOM   1143  C CA  . GLN A 1 199 ? -34.526 20.963  4.148   1.00 27.99  ? 210  GLN A CA  1 
ATOM   1144  C C   . GLN A 1 199 ? -34.628 19.457  4.332   1.00 27.99  ? 210  GLN A C   1 
ATOM   1145  O O   . GLN A 1 199 ? -35.700 18.950  4.590   1.00 27.99  ? 210  GLN A O   1 
ATOM   1146  C CB  . GLN A 1 199 ? -34.552 21.663  5.501   1.00 73.47  ? 210  GLN A CB  1 
ATOM   1147  C CG  . GLN A 1 199 ? -33.285 21.582  6.303   1.00 73.47  ? 210  GLN A CG  1 
ATOM   1148  C CD  . GLN A 1 199 ? -33.347 22.460  7.536   1.00 73.47  ? 210  GLN A CD  1 
ATOM   1149  O OE1 . GLN A 1 199 ? -32.377 22.565  8.287   1.00 73.47  ? 210  GLN A OE1 1 
ATOM   1150  N NE2 . GLN A 1 199 ? -34.498 23.096  7.753   1.00 73.47  ? 210  GLN A NE2 1 
ATOM   1151  N N   . ILE A 1 200 ? -33.533 18.729  4.173   1.00 39.26  ? 211  ILE A N   1 
ATOM   1152  C CA  . ILE A 1 200 ? -33.559 17.271  4.371   1.00 39.26  ? 211  ILE A CA  1 
ATOM   1153  C C   . ILE A 1 200 ? -32.472 16.947  5.383   1.00 39.26  ? 211  ILE A C   1 
ATOM   1154  O O   . ILE A 1 200 ? -31.298 17.159  5.125   1.00 39.26  ? 211  ILE A O   1 
ATOM   1155  C CB  . ILE A 1 200 ? -33.271 16.493  3.054   1.00 33.48  ? 211  ILE A CB  1 
ATOM   1156  C CG1 . ILE A 1 200 ? -34.533 16.439  2.193   1.00 33.48  ? 211  ILE A CG1 1 
ATOM   1157  C CG2 . ILE A 1 200 ? -32.773 15.082  3.360   1.00 33.48  ? 211  ILE A CG2 1 
ATOM   1158  C CD1 . ILE A 1 200 ? -34.341 15.715  0.886   1.00 33.48  ? 211  ILE A CD1 1 
ATOM   1159  N N   . GLY A 1 201 ? -32.848 16.445  6.544   1.00 58.43  ? 212  GLY A N   1 
ATOM   1160  C CA  . GLY A 1 201 ? -31.822 16.169  7.518   1.00 58.43  ? 212  GLY A CA  1 
ATOM   1161  C C   . GLY A 1 201 ? -32.220 15.244  8.634   1.00 58.43  ? 212  GLY A C   1 
ATOM   1162  O O   . GLY A 1 201 ? -33.376 14.835  8.760   1.00 58.43  ? 212  GLY A O   1 
ATOM   1163  N N   . VAL A 1 202 ? -31.234 14.925  9.459   1.00 26.66  ? 213  VAL A N   1 
ATOM   1164  C CA  . VAL A 1 202 ? -31.421 14.028  10.584  1.00 26.66  ? 213  VAL A CA  1 
ATOM   1165  C C   . VAL A 1 202 ? -32.039 14.743  11.764  1.00 26.66  ? 213  VAL A C   1 
ATOM   1166  O O   . VAL A 1 202 ? -31.745 15.907  12.033  1.00 26.66  ? 213  VAL A O   1 
ATOM   1167  C CB  . VAL A 1 202 ? -30.077 13.428  11.003  1.00 37.67  ? 213  VAL A CB  1 
ATOM   1168  C CG1 . VAL A 1 202 ? -30.266 12.472  12.160  1.00 37.67  ? 213  VAL A CG1 1 
ATOM   1169  C CG2 . VAL A 1 202 ? -29.448 12.737  9.813   1.00 37.67  ? 213  VAL A CG2 1 
ATOM   1170  N N   . CYS A 1 203 ? -32.900 14.028  12.465  1.00 42.12  ? 214  CYS A N   1 
ATOM   1171  C CA  . CYS A 1 203 ? -33.557 14.580  13.625  1.00 42.12  ? 214  CYS A CA  1 
ATOM   1172  C C   . CYS A 1 203 ? -33.564 13.546  14.722  1.00 42.12  ? 214  CYS A C   1 
ATOM   1173  O O   . CYS A 1 203 ? -33.757 12.354  14.467  1.00 42.12  ? 214  CYS A O   1 
ATOM   1174  C CB  . CYS A 1 203 ? -34.977 14.999  13.272  1.00 49.27  ? 214  CYS A CB  1 
ATOM   1175  S SG  . CYS A 1 203 ? -35.018 16.424  12.176  1.00 49.27  ? 214  CYS A SG  1 
ATOM   1176  N N   . PHE A 1 204 ? -33.350 14.007  15.947  1.00 30.80  ? 215  PHE A N   1 
ATOM   1177  C CA  . PHE A 1 204 ? -33.327 13.113  17.080  1.00 30.80  ? 215  PHE A CA  1 
ATOM   1178  C C   . PHE A 1 204 ? -34.610 13.125  17.896  1.00 30.80  ? 215  PHE A C   1 
ATOM   1179  O O   . PHE A 1 204 ? -35.018 14.150  18.436  1.00 30.80  ? 215  PHE A O   1 
ATOM   1180  C CB  . PHE A 1 204 ? -32.128 13.447  17.930  1.00 30.26  ? 215  PHE A CB  1 
ATOM   1181  C CG  . PHE A 1 204 ? -30.906 13.721  17.122  1.00 30.26  ? 215  PHE A CG  1 
ATOM   1182  C CD1 . PHE A 1 204 ? -30.720 14.958  16.532  1.00 30.26  ? 215  PHE A CD1 1 
ATOM   1183  C CD2 . PHE A 1 204 ? -29.950 12.737  16.921  1.00 30.26  ? 215  PHE A CD2 1 
ATOM   1184  C CE1 . PHE A 1 204 ? -29.600 15.214  15.760  1.00 30.26  ? 215  PHE A CE1 1 
ATOM   1185  C CE2 . PHE A 1 204 ? -28.829 12.988  16.144  1.00 30.26  ? 215  PHE A CE2 1 
ATOM   1186  C CZ  . PHE A 1 204 ? -28.655 14.229  15.566  1.00 30.26  ? 215  PHE A CZ  1 
ATOM   1187  N N   . HIS A 1 205 ? -35.239 11.954  17.954  1.00 69.91  ? 216  HIS A N   1 
ATOM   1188  C CA  . HIS A 1 205 ? -36.485 11.728  18.670  1.00 69.91  ? 216  HIS A CA  1 
ATOM   1189  C C   . HIS A 1 205 ? -36.258 10.630  19.690  1.00 69.91  ? 216  HIS A C   1 
ATOM   1190  O O   . HIS A 1 205 ? -35.698 9.581   19.363  1.00 69.91  ? 216  HIS A O   1 
ATOM   1191  C CB  . HIS A 1 205 ? -37.560 11.238  17.714  1.00 83.22  ? 216  HIS A CB  1 
ATOM   1192  C CG  . HIS A 1 205 ? -37.778 12.126  16.535  1.00 83.22  ? 216  HIS A CG  1 
ATOM   1193  N ND1 . HIS A 1 205 ? -38.473 11.713  15.419  1.00 83.22  ? 216  HIS A ND1 1 
ATOM   1194  C CD2 . HIS A 1 205 ? -37.435 13.415  16.311  1.00 83.22  ? 216  HIS A CD2 1 
ATOM   1195  C CE1 . HIS A 1 205 ? -38.552 12.713  14.561  1.00 83.22  ? 216  HIS A CE1 1 
ATOM   1196  N NE2 . HIS A 1 205 ? -37.931 13.758  15.078  1.00 83.22  ? 216  HIS A NE2 1 
ATOM   1197  N N   . PRO A 1 206 ? -36.700 10.849  20.937  1.00 64.01  ? 217  PRO A N   1 
ATOM   1198  C CA  . PRO A 1 206 ? -36.552 9.869   22.019  1.00 64.01  ? 217  PRO A CA  1 
ATOM   1199  C C   . PRO A 1 206 ? -37.615 8.761   21.975  1.00 64.01  ? 217  PRO A C   1 
ATOM   1200  O O   . PRO A 1 206 ? -38.772 9.005   21.621  1.00 64.01  ? 217  PRO A O   1 
ATOM   1201  C CB  . PRO A 1 206 ? -36.660 10.732  23.270  1.00 102.09 ? 217  PRO A CB  1 
ATOM   1202  C CG  . PRO A 1 206 ? -37.631 11.778  22.849  1.00 102.09 ? 217  PRO A CG  1 
ATOM   1203  C CD  . PRO A 1 206 ? -37.144 12.149  21.468  1.00 102.09 ? 217  PRO A CD  1 
ATOM   1204  N N   . VAL A 1 207 ? -37.222 7.542   22.332  1.00 75.36  ? 218  VAL A N   1 
ATOM   1205  C CA  . VAL A 1 207 ? -38.162 6.428   22.322  1.00 75.36  ? 218  VAL A CA  1 
ATOM   1206  C C   . VAL A 1 207 ? -38.555 6.045   23.738  1.00 75.36  ? 218  VAL A C   1 
ATOM   1207  O O   . VAL A 1 207 ? -37.736 5.514   24.482  1.00 75.36  ? 218  VAL A O   1 
ATOM   1208  C CB  . VAL A 1 207 ? -37.564 5.187   21.650  1.00 80.72  ? 218  VAL A CB  1 
ATOM   1209  C CG1 . VAL A 1 207 ? -38.689 4.319   21.099  1.00 80.72  ? 218  VAL A CG1 1 
ATOM   1210  C CG2 . VAL A 1 207 ? -36.602 5.598   20.557  1.00 80.72  ? 218  VAL A CG2 1 
ATOM   1211  N N   . LYS A 1 218 ? -33.587 5.424   28.783  1.00 100.70 ? 229  LYS A N   1 
ATOM   1212  C CA  . LYS A 1 218 ? -34.268 5.778   27.543  1.00 100.70 ? 229  LYS A CA  1 
ATOM   1213  C C   . LYS A 1 218 ? -33.235 5.991   26.434  1.00 100.70 ? 229  LYS A C   1 
ATOM   1214  O O   . LYS A 1 218 ? -32.171 6.563   26.666  1.00 100.70 ? 229  LYS A O   1 
ATOM   1215  C CB  . LYS A 1 218 ? -35.092 7.052   27.746  1.00 77.05  ? 229  LYS A CB  1 
ATOM   1216  C CG  . LYS A 1 218 ? -36.136 7.298   26.669  1.00 77.05  ? 229  LYS A CG  1 
ATOM   1217  C CD  . LYS A 1 218 ? -36.713 8.709   26.726  1.00 77.05  ? 229  LYS A CD  1 
ATOM   1218  C CE  . LYS A 1 218 ? -37.345 9.026   28.069  1.00 77.05  ? 229  LYS A CE  1 
ATOM   1219  N NZ  . LYS A 1 218 ? -36.339 9.164   29.160  1.00 77.05  ? 229  LYS A NZ  1 
ATOM   1220  N N   . SER A 1 219 ? -33.556 5.529   25.230  1.00 111.58 ? 230  SER A N   1 
ATOM   1221  C CA  . SER A 1 219 ? -32.648 5.648   24.092  1.00 111.58 ? 230  SER A CA  1 
ATOM   1222  C C   . SER A 1 219 ? -33.022 6.782   23.137  1.00 111.58 ? 230  SER A C   1 
ATOM   1223  O O   . SER A 1 219 ? -34.127 7.323   23.211  1.00 111.58 ? 230  SER A O   1 
ATOM   1224  C CB  . SER A 1 219 ? -32.615 4.324   23.329  1.00 201.99 ? 230  SER A CB  1 
ATOM   1225  O OG  . SER A 1 219 ? -33.928 3.878   23.035  1.00 201.99 ? 230  SER A OG  1 
ATOM   1226  N N   . ILE A 1 220 ? -32.099 7.130   22.239  1.00 75.74  ? 231  ILE A N   1 
ATOM   1227  C CA  . ILE A 1 220 ? -32.330 8.206   21.268  1.00 75.74  ? 231  ILE A CA  1 
ATOM   1228  C C   . ILE A 1 220 ? -32.399 7.681   19.846  1.00 75.74  ? 231  ILE A C   1 
ATOM   1229  O O   . ILE A 1 220 ? -31.570 6.879   19.423  1.00 75.74  ? 231  ILE A O   1 
ATOM   1230  C CB  . ILE A 1 220 ? -31.223 9.284   21.290  1.00 50.19  ? 231  ILE A CB  1 
ATOM   1231  C CG1 . ILE A 1 220 ? -30.433 9.224   22.605  1.00 50.19  ? 231  ILE A CG1 1 
ATOM   1232  C CG2 . ILE A 1 220 ? -31.862 10.666  21.109  1.00 50.19  ? 231  ILE A CG2 1 
ATOM   1233  C CD1 . ILE A 1 220 ? -29.582 7.959   22.804  1.00 50.19  ? 231  ILE A CD1 1 
ATOM   1234  N N   . GLY A 1 221 ? -33.386 8.155   19.103  1.00 51.43  ? 232  GLY A N   1 
ATOM   1235  C CA  . GLY A 1 221 ? -33.543 7.704   17.742  1.00 51.43  ? 232  GLY A CA  1 
ATOM   1236  C C   . GLY A 1 221 ? -33.163 8.760   16.741  1.00 51.43  ? 232  GLY A C   1 
ATOM   1237  O O   . GLY A 1 221 ? -33.388 9.941   16.960  1.00 51.43  ? 232  GLY A O   1 
ATOM   1238  N N   . GLU A 1 222 ? -32.574 8.320   15.639  1.00 37.21  ? 233  GLU A N   1 
ATOM   1239  C CA  . GLU A 1 222 ? -32.173 9.206   14.570  1.00 37.21  ? 233  GLU A CA  1 
ATOM   1240  C C   . GLU A 1 222 ? -33.007 8.932   13.318  1.00 37.21  ? 233  GLU A C   1 
ATOM   1241  O O   . GLU A 1 222 ? -33.191 7.786   12.923  1.00 37.21  ? 233  GLU A O   1 
ATOM   1242  C CB  . GLU A 1 222 ? -30.688 9.022   14.290  1.00 35.25  ? 233  GLU A CB  1 
ATOM   1243  C CG  . GLU A 1 222 ? -29.817 9.634   15.372  1.00 35.25  ? 233  GLU A CG  1 
ATOM   1244  C CD  . GLU A 1 222 ? -28.344 9.677   15.001  1.00 35.25  ? 233  GLU A CD  1 
ATOM   1245  O OE1 . GLU A 1 222 ? -28.022 9.683   13.783  1.00 35.25  ? 233  GLU A OE1 1 
ATOM   1246  O OE2 . GLU A 1 222 ? -27.513 9.724   15.935  1.00 35.25  ? 233  GLU A OE2 1 
ATOM   1247  N N   . LYS A 1 223 ? -33.532 9.996   12.720  1.00 43.48  ? 234  LYS A N   1 
ATOM   1248  C CA  . LYS A 1 223 ? -34.344 9.889   11.522  1.00 43.48  ? 234  LYS A CA  1 
ATOM   1249  C C   . LYS A 1 223 ? -33.985 10.974  10.530  1.00 43.48  ? 234  LYS A C   1 
ATOM   1250  O O   . LYS A 1 223 ? -33.711 12.110  10.918  1.00 43.48  ? 234  LYS A O   1 
ATOM   1251  C CB  . LYS A 1 223 ? -35.818 10.017  11.873  1.00 48.09  ? 234  LYS A CB  1 
ATOM   1252  C CG  . LYS A 1 223 ? -36.419 8.768   12.472  1.00 48.09  ? 234  LYS A CG  1 
ATOM   1253  C CD  . LYS A 1 223 ? -37.776 9.083   13.086  1.00 48.09  ? 234  LYS A CD  1 
ATOM   1254  C CE  . LYS A 1 223 ? -38.468 7.850   13.633  1.00 48.09  ? 234  LYS A CE  1 
ATOM   1255  N NZ  . LYS A 1 223 ? -38.798 6.906   12.531  1.00 48.09  ? 234  LYS A NZ  1 
ATOM   1256  N N   . THR A 1 224 ? -33.970 10.619  9.247   1.00 43.23  ? 235  THR A N   1 
ATOM   1257  C CA  . THR A 1 224 ? -33.677 11.585  8.196   1.00 43.23  ? 235  THR A CA  1 
ATOM   1258  C C   . THR A 1 224 ? -34.999 12.090  7.680   1.00 43.23  ? 235  THR A C   1 
ATOM   1259  O O   . THR A 1 224 ? -35.715 11.374  6.979   1.00 43.23  ? 235  THR A O   1 
ATOM   1260  C CB  . THR A 1 224 ? -32.928 10.963  7.023   1.00 44.39  ? 235  THR A CB  1 
ATOM   1261  O OG1 . THR A 1 224 ? -31.538 10.865  7.336   1.00 44.39  ? 235  THR A OG1 1 
ATOM   1262  C CG2 . THR A 1 224 ? -33.081 11.814  5.801   1.00 44.39  ? 235  THR A CG2 1 
ATOM   1263  N N   . GLU A 1 225 ? -35.327 13.324  8.039   1.00 39.17  ? 236  GLU A N   1 
ATOM   1264  C CA  . GLU A 1 225 ? -36.570 13.907  7.600   1.00 39.17  ? 236  GLU A CA  1 
ATOM   1265  C C   . GLU A 1 225 ? -36.358 14.892  6.453   1.00 39.17  ? 236  GLU A C   1 
ATOM   1266  O O   . GLU A 1 225 ? -35.307 15.526  6.328   1.00 39.17  ? 236  GLU A O   1 
ATOM   1267  C CB  . GLU A 1 225 ? -37.267 14.603  8.772   1.00 82.94  ? 236  GLU A CB  1 
ATOM   1268  C CG  . GLU A 1 225 ? -37.227 13.816  10.085  1.00 82.94  ? 236  GLU A CG  1 
ATOM   1269  C CD  . GLU A 1 225 ? -38.310 14.238  11.076  1.00 82.94  ? 236  GLU A CD  1 
ATOM   1270  O OE1 . GLU A 1 225 ? -39.468 13.795  10.901  1.00 82.94  ? 236  GLU A OE1 1 
ATOM   1271  O OE2 . GLU A 1 225 ? -38.013 15.011  12.020  1.00 82.94  ? 236  GLU A OE2 1 
ATOM   1272  N N   . ALA A 1 226 ? -37.369 14.975  5.593   1.00 42.35  ? 237  ALA A N   1 
ATOM   1273  C CA  . ALA A 1 226 ? -37.398 15.905  4.471   1.00 42.35  ? 237  ALA A CA  1 
ATOM   1274  C C   . ALA A 1 226 ? -38.491 16.904  4.866   1.00 42.35  ? 237  ALA A C   1 
ATOM   1275  O O   . ALA A 1 226 ? -39.630 16.523  5.136   1.00 42.35  ? 237  ALA A O   1 
ATOM   1276  C CB  . ALA A 1 226 ? -37.772 15.179  3.196   1.00 44.27  ? 237  ALA A CB  1 
ATOM   1277  N N   . SER A 1 227 ? -38.128 18.176  4.932   1.00 33.19  ? 238  SER A N   1 
ATOM   1278  C CA  . SER A 1 227 ? -39.072 19.216  5.319   1.00 33.19  ? 238  SER A CA  1 
ATOM   1279  C C   . SER A 1 227 ? -39.198 20.429  4.398   1.00 33.19  ? 238  SER A C   1 
ATOM   1280  O O   . SER A 1 227 ? -38.202 21.085  4.057   1.00 33.19  ? 238  SER A O   1 
ATOM   1281  C CB  . SER A 1 227 ? -38.748 19.733  6.725   1.00 57.76  ? 238  SER A CB  1 
ATOM   1282  O OG  . SER A 1 227 ? -39.611 20.812  7.084   1.00 57.76  ? 238  SER A OG  1 
ATOM   1283  N N   . LEU A 1 228 ? -40.443 20.718  4.018   1.00 36.90  ? 239  LEU A N   1 
ATOM   1284  C CA  . LEU A 1 228 ? -40.781 21.874  3.195   1.00 36.90  ? 239  LEU A CA  1 
ATOM   1285  C C   . LEU A 1 228 ? -41.722 22.766  3.991   1.00 36.90  ? 239  LEU A C   1 
ATOM   1286  O O   . LEU A 1 228 ? -42.789 22.329  4.425   1.00 36.90  ? 239  LEU A O   1 
ATOM   1287  C CB  . LEU A 1 228 ? -41.492 21.455  1.915   1.00 41.64  ? 239  LEU A CB  1 
ATOM   1288  C CG  . LEU A 1 228 ? -42.199 22.590  1.163   1.00 41.64  ? 239  LEU A CG  1 
ATOM   1289  C CD1 . LEU A 1 228 ? -41.199 23.604  0.651   1.00 41.64  ? 239  LEU A CD1 1 
ATOM   1290  C CD2 . LEU A 1 228 ? -42.980 21.994  0.013   1.00 41.64  ? 239  LEU A CD2 1 
ATOM   1291  N N   . VAL A 1 229 ? -41.322 24.006  4.208   1.00 45.02  ? 240  VAL A N   1 
ATOM   1292  C CA  . VAL A 1 229 ? -42.187 24.906  4.929   1.00 45.02  ? 240  VAL A CA  1 
ATOM   1293  C C   . VAL A 1 229 ? -42.668 25.939  3.921   1.00 45.02  ? 240  VAL A C   1 
ATOM   1294  O O   . VAL A 1 229 ? -41.879 26.704  3.372   1.00 45.02  ? 240  VAL A O   1 
ATOM   1295  C CB  . VAL A 1 229 ? -41.461 25.567  6.104   1.00 51.39  ? 240  VAL A CB  1 
ATOM   1296  C CG1 . VAL A 1 229 ? -42.405 26.518  6.813   1.00 51.39  ? 240  VAL A CG1 1 
ATOM   1297  C CG2 . VAL A 1 229 ? -40.997 24.501  7.091   1.00 51.39  ? 240  VAL A CG2 1 
ATOM   1298  N N   . TRP A 1 230 ? -43.975 25.927  3.672   1.00 42.45  ? 241  TRP A N   1 
ATOM   1299  C CA  . TRP A 1 230 ? -44.621 26.807  2.714   1.00 42.45  ? 241  TRP A CA  1 
ATOM   1300  C C   . TRP A 1 230 ? -45.165 28.074  3.362   1.00 42.45  ? 241  TRP A C   1 
ATOM   1301  O O   . TRP A 1 230 ? -45.990 28.005  4.258   1.00 42.45  ? 241  TRP A O   1 
ATOM   1302  C CB  . TRP A 1 230 ? -45.762 26.032  2.045   1.00 83.22  ? 241  TRP A CB  1 
ATOM   1303  C CG  . TRP A 1 230 ? -46.148 26.530  0.697   1.00 83.22  ? 241  TRP A CG  1 
ATOM   1304  C CD1 . TRP A 1 230 ? -47.389 26.914  0.295   1.00 83.22  ? 241  TRP A CD1 1 
ATOM   1305  C CD2 . TRP A 1 230 ? -45.291 26.679  -0.442  1.00 83.22  ? 241  TRP A CD2 1 
ATOM   1306  N NE1 . TRP A 1 230 ? -47.363 27.293  -1.022  1.00 83.22  ? 241  TRP A NE1 1 
ATOM   1307  C CE2 . TRP A 1 230 ? -46.086 27.159  -1.499  1.00 83.22  ? 241  TRP A CE2 1 
ATOM   1308  C CE3 . TRP A 1 230 ? -43.927 26.454  -0.671  1.00 83.22  ? 241  TRP A CE3 1 
ATOM   1309  C CZ2 . TRP A 1 230 ? -45.561 27.421  -2.774  1.00 83.22  ? 241  TRP A CZ2 1 
ATOM   1310  C CZ3 . TRP A 1 230 ? -43.405 26.714  -1.937  1.00 83.22  ? 241  TRP A CZ3 1 
ATOM   1311  C CH2 . TRP A 1 230 ? -44.222 27.192  -2.971  1.00 83.22  ? 241  TRP A CH2 1 
ATOM   1312  N N   . PHE A 1 231 ? -44.716 29.231  2.910   1.00 57.61  ? 242  PHE A N   1 
ATOM   1313  C CA  . PHE A 1 231 ? -45.208 30.485  3.468   1.00 57.61  ? 242  PHE A CA  1 
ATOM   1314  C C   . PHE A 1 231 ? -46.303 31.075  2.584   1.00 57.61  ? 242  PHE A C   1 
ATOM   1315  O O   . PHE A 1 231 ? -46.036 31.959  1.767   1.00 57.61  ? 242  PHE A O   1 
ATOM   1316  C CB  . PHE A 1 231 ? -44.083 31.502  3.567   1.00 79.67  ? 242  PHE A CB  1 
ATOM   1317  C CG  . PHE A 1 231 ? -42.946 31.056  4.407   1.00 79.67  ? 242  PHE A CG  1 
ATOM   1318  C CD1 . PHE A 1 231 ? -43.044 31.068  5.784   1.00 79.67  ? 242  PHE A CD1 1 
ATOM   1319  C CD2 . PHE A 1 231 ? -41.765 30.635  3.822   1.00 79.67  ? 242  PHE A CD2 1 
ATOM   1320  C CE1 . PHE A 1 231 ? -41.980 30.668  6.566   1.00 79.67  ? 242  PHE A CE1 1 
ATOM   1321  C CE2 . PHE A 1 231 ? -40.694 30.233  4.594   1.00 79.67  ? 242  PHE A CE2 1 
ATOM   1322  C CZ  . PHE A 1 231 ? -40.800 30.250  5.968   1.00 79.67  ? 242  PHE A CZ  1 
ATOM   1323  N N   . THR A 1 232 ? -47.533 30.608  2.755   1.00 68.17  ? 243  THR A N   1 
ATOM   1324  C CA  . THR A 1 232 ? -48.638 31.108  1.954   1.00 68.17  ? 243  THR A CA  1 
ATOM   1325  C C   . THR A 1 232 ? -49.647 31.950  2.729   1.00 68.17  ? 243  THR A C   1 
ATOM   1326  O O   . THR A 1 232 ? -49.828 31.758  3.930   1.00 68.17  ? 243  THR A O   1 
ATOM   1327  C CB  . THR A 1 232 ? -49.397 29.958  1.317   1.00 67.17  ? 243  THR A CB  1 
ATOM   1328  O OG1 . THR A 1 232 ? -50.612 30.458  0.756   1.00 67.17  ? 243  THR A OG1 1 
ATOM   1329  C CG2 . THR A 1 232 ? -49.711 28.895  2.351   1.00 67.17  ? 243  THR A CG2 1 
ATOM   1330  N N   . PRO A 1 233 ? -50.315 32.902  2.044   1.00 75.19  ? 244  PRO A N   1 
ATOM   1331  C CA  . PRO A 1 233 ? -51.323 33.781  2.656   1.00 75.19  ? 244  PRO A CA  1 
ATOM   1332  C C   . PRO A 1 233 ? -52.630 33.042  2.962   1.00 75.19  ? 244  PRO A C   1 
ATOM   1333  O O   . PRO A 1 233 ? -53.089 32.221  2.167   1.00 75.19  ? 244  PRO A O   1 
ATOM   1334  C CB  . PRO A 1 233 ? -51.513 34.877  1.610   1.00 44.43  ? 244  PRO A CB  1 
ATOM   1335  C CG  . PRO A 1 233 ? -51.259 34.159  0.335   1.00 44.43  ? 244  PRO A CG  1 
ATOM   1336  C CD  . PRO A 1 233 ? -50.041 33.322  0.658   1.00 44.43  ? 244  PRO A CD  1 
ATOM   1337  N N   . PRO A 1 234 ? -53.249 33.348  4.117   1.00 70.92  ? 245  PRO A N   1 
ATOM   1338  C CA  . PRO A 1 234 ? -54.496 32.792  4.654   1.00 70.92  ? 245  PRO A CA  1 
ATOM   1339  C C   . PRO A 1 234 ? -55.558 32.387  3.634   1.00 70.92  ? 245  PRO A C   1 
ATOM   1340  O O   . PRO A 1 234 ? -56.219 31.348  3.785   1.00 70.92  ? 245  PRO A O   1 
ATOM   1341  C CB  . PRO A 1 234 ? -54.984 33.896  5.575   1.00 76.30  ? 245  PRO A CB  1 
ATOM   1342  C CG  . PRO A 1 234 ? -53.719 34.419  6.132   1.00 76.30  ? 245  PRO A CG  1 
ATOM   1343  C CD  . PRO A 1 234 ? -52.826 34.512  4.918   1.00 76.30  ? 245  PRO A CD  1 
ATOM   1344  N N   . ARG A 1 235 ? -55.727 33.212  2.605   1.00 56.65  ? 246  ARG A N   1 
ATOM   1345  C CA  . ARG A 1 235 ? -56.717 32.958  1.558   1.00 56.65  ? 246  ARG A CA  1 
ATOM   1346  C C   . ARG A 1 235 ? -56.433 31.629  0.847   1.00 56.65  ? 246  ARG A C   1 
ATOM   1347  O O   . ARG A 1 235 ? -57.276 30.713  0.841   1.00 56.65  ? 246  ARG A O   1 
ATOM   1348  C CB  . ARG A 1 235 ? -56.699 34.130  0.562   1.00 102.85 ? 246  ARG A CB  1 
ATOM   1349  C CG  . ARG A 1 235 ? -57.737 34.066  -0.553  1.00 102.85 ? 246  ARG A CG  1 
ATOM   1350  C CD  . ARG A 1 235 ? -57.883 35.423  -1.249  1.00 102.85 ? 246  ARG A CD  1 
ATOM   1351  N NE  . ARG A 1 235 ? -56.723 35.793  -2.056  1.00 102.85 ? 246  ARG A NE  1 
ATOM   1352  C CZ  . ARG A 1 235 ? -56.343 35.150  -3.154  1.00 102.85 ? 246  ARG A CZ  1 
ATOM   1353  N NH1 . ARG A 1 235 ? -57.029 34.098  -3.580  1.00 102.85 ? 246  ARG A NH1 1 
ATOM   1354  N NH2 . ARG A 1 235 ? -55.283 35.567  -3.832  1.00 102.85 ? 246  ARG A NH2 1 
ATOM   1355  N N   . THR A 1 236 ? -55.232 31.535  0.268   1.00 47.30  ? 247  THR A N   1 
ATOM   1356  C CA  . THR A 1 236 ? -54.796 30.346  -0.452  1.00 47.30  ? 247  THR A CA  1 
ATOM   1357  C C   . THR A 1 236 ? -54.358 29.273  0.541   1.00 47.30  ? 247  THR A C   1 
ATOM   1358  O O   . THR A 1 236 ? -54.340 28.088  0.211   1.00 47.30  ? 247  THR A O   1 
ATOM   1359  C CB  . THR A 1 236 ? -53.606 30.654  -1.401  1.00 78.50  ? 247  THR A CB  1 
ATOM   1360  O OG1 . THR A 1 236 ? -53.570 32.051  -1.696  1.00 78.50  ? 247  THR A OG1 1 
ATOM   1361  C CG2 . THR A 1 236 ? -53.757 29.888  -2.715  1.00 78.50  ? 247  THR A CG2 1 
ATOM   1362  N N   . SER A 1 237 ? -54.010 29.709  1.751   1.00 56.52  ? 248  SER A N   1 
ATOM   1363  C CA  . SER A 1 237 ? -53.562 28.835  2.841   1.00 56.52  ? 248  SER A CA  1 
ATOM   1364  C C   . SER A 1 237 ? -54.171 27.444  2.822   1.00 56.52  ? 248  SER A C   1 
ATOM   1365  O O   . SER A 1 237 ? -53.524 26.485  2.409   1.00 56.52  ? 248  SER A O   1 
ATOM   1366  C CB  . SER A 1 237 ? -53.868 29.483  4.193   1.00 59.51  ? 248  SER A CB  1 
ATOM   1367  O OG  . SER A 1 237 ? -53.582 28.607  5.266   1.00 59.51  ? 248  SER A OG  1 
ATOM   1368  N N   . ASN A 1 238 ? -55.415 27.341  3.284   1.00 125.53 ? 249  ASN A N   1 
ATOM   1369  C CA  . ASN A 1 238 ? -56.119 26.063  3.332   1.00 125.53 ? 249  ASN A CA  1 
ATOM   1370  C C   . ASN A 1 238 ? -56.193 25.408  1.953   1.00 125.53 ? 249  ASN A C   1 
ATOM   1371  O O   . ASN A 1 238 ? -56.411 24.202  1.836   1.00 125.53 ? 249  ASN A O   1 
ATOM   1372  C CB  . ASN A 1 238 ? -57.528 26.267  3.905   1.00 114.00 ? 249  ASN A CB  1 
ATOM   1373  C CG  . ASN A 1 238 ? -58.315 24.971  4.008   1.00 114.00 ? 249  ASN A CG  1 
ATOM   1374  O OD1 . ASN A 1 238 ? -59.020 24.576  3.076   1.00 114.00 ? 249  ASN A OD1 1 
ATOM   1375  N ND2 . ASN A 1 238 ? -58.189 24.297  5.146   1.00 114.00 ? 249  ASN A ND2 1 
ATOM   1376  N N   . GLN A 1 239 ? -55.999 26.205  0.909   1.00 89.03  ? 250  GLN A N   1 
ATOM   1377  C CA  . GLN A 1 239 ? -56.051 25.692  -0.450  1.00 89.03  ? 250  GLN A CA  1 
ATOM   1378  C C   . GLN A 1 239 ? -54.748 24.969  -0.790  1.00 89.03  ? 250  GLN A C   1 
ATOM   1379  O O   . GLN A 1 239 ? -54.777 23.827  -1.250  1.00 89.03  ? 250  GLN A O   1 
ATOM   1380  C CB  . GLN A 1 239 ? -56.314 26.845  -1.424  1.00 87.22  ? 250  GLN A CB  1 
ATOM   1381  C CG  . GLN A 1 239 ? -56.724 26.421  -2.834  1.00 87.22  ? 250  GLN A CG  1 
ATOM   1382  C CD  . GLN A 1 239 ? -57.901 25.464  -2.841  1.00 87.22  ? 250  GLN A CD  1 
ATOM   1383  O OE1 . GLN A 1 239 ? -58.714 25.472  -1.919  1.00 87.22  ? 250  GLN A OE1 1 
ATOM   1384  N NE2 . GLN A 1 239 ? -58.004 24.644  -3.888  1.00 87.22  ? 250  GLN A NE2 1 
ATOM   1385  N N   . TRP A 1 240 ? -53.612 25.628  -0.555  1.00 101.96 ? 251  TRP A N   1 
ATOM   1386  C CA  . TRP A 1 240 ? -52.296 25.037  -0.831  1.00 101.96 ? 251  TRP A CA  1 
ATOM   1387  C C   . TRP A 1 240 ? -52.136 23.709  -0.112  1.00 101.96 ? 251  TRP A C   1 
ATOM   1388  O O   . TRP A 1 240 ? -51.568 22.756  -0.651  1.00 101.96 ? 251  TRP A O   1 
ATOM   1389  C CB  . TRP A 1 240 ? -51.163 25.971  -0.388  1.00 49.58  ? 251  TRP A CB  1 
ATOM   1390  C CG  . TRP A 1 240 ? -50.832 27.050  -1.378  1.00 49.58  ? 251  TRP A CG  1 
ATOM   1391  C CD1 . TRP A 1 240 ? -51.155 28.379  -1.295  1.00 49.58  ? 251  TRP A CD1 1 
ATOM   1392  C CD2 . TRP A 1 240 ? -50.132 26.888  -2.615  1.00 49.58  ? 251  TRP A CD2 1 
ATOM   1393  N NE1 . TRP A 1 240 ? -50.701 29.055  -2.404  1.00 49.58  ? 251  TRP A NE1 1 
ATOM   1394  C CE2 . TRP A 1 240 ? -50.070 28.165  -3.232  1.00 49.58  ? 251  TRP A CE2 1 
ATOM   1395  C CE3 . TRP A 1 240 ? -49.552 25.792  -3.262  1.00 49.58  ? 251  TRP A CE3 1 
ATOM   1396  C CZ2 . TRP A 1 240 ? -49.452 28.370  -4.464  1.00 49.58  ? 251  TRP A CZ2 1 
ATOM   1397  C CZ3 . TRP A 1 240 ? -48.938 25.997  -4.487  1.00 49.58  ? 251  TRP A CZ3 1 
ATOM   1398  C CH2 . TRP A 1 240 ? -48.893 27.279  -5.075  1.00 49.58  ? 251  TRP A CH2 1 
ATOM   1399  N N   . LEU A 1 241 ? -52.631 23.659  1.118   1.00 55.13  ? 252  LEU A N   1 
ATOM   1400  C CA  . LEU A 1 241 ? -52.556 22.447  1.910   1.00 55.13  ? 252  LEU A CA  1 
ATOM   1401  C C   . LEU A 1 241 ? -53.104 21.302  1.081   1.00 55.13  ? 252  LEU A C   1 
ATOM   1402  O O   . LEU A 1 241 ? -52.573 20.200  1.112   1.00 55.13  ? 252  LEU A O   1 
ATOM   1403  C CB  . LEU A 1 241 ? -53.368 22.607  3.192   1.00 42.26  ? 252  LEU A CB  1 
ATOM   1404  C CG  . LEU A 1 241 ? -53.357 21.452  4.192   1.00 42.26  ? 252  LEU A CG  1 
ATOM   1405  C CD1 . LEU A 1 241 ? -54.300 20.371  3.728   1.00 42.26  ? 252  LEU A CD1 1 
ATOM   1406  C CD2 . LEU A 1 241 ? -51.943 20.911  4.351   1.00 42.26  ? 252  LEU A CD2 1 
ATOM   1407  N N   . ASP A 1 242 ? -54.171 21.574  0.337   1.00 81.15  ? 253  ASP A N   1 
ATOM   1408  C CA  . ASP A 1 242 ? -54.783 20.564  -0.516  1.00 81.15  ? 253  ASP A CA  1 
ATOM   1409  C C   . ASP A 1 242 ? -53.747 20.154  -1.540  1.00 81.15  ? 253  ASP A C   1 
ATOM   1410  O O   . ASP A 1 242 ? -53.415 18.978  -1.669  1.00 81.15  ? 253  ASP A O   1 
ATOM   1411  C CB  . ASP A 1 242 ? -56.002 21.135  -1.246  1.00 201.99 ? 253  ASP A CB  1 
ATOM   1412  C CG  . ASP A 1 242 ? -57.010 21.762  -0.304  1.00 201.99 ? 253  ASP A CG  1 
ATOM   1413  O OD1 . ASP A 1 242 ? -57.500 21.057  0.604   1.00 201.99 ? 253  ASP A OD1 1 
ATOM   1414  O OD2 . ASP A 1 242 ? -57.315 22.961  -0.475  1.00 201.99 ? 253  ASP A OD2 1 
ATOM   1415  N N   . PHE A 1 243 ? -53.235 21.145  -2.262  1.00 68.51  ? 254  PHE A N   1 
ATOM   1416  C CA  . PHE A 1 243 ? -52.235 20.915  -3.292  1.00 68.51  ? 254  PHE A CA  1 
ATOM   1417  C C   . PHE A 1 243 ? -51.161 19.964  -2.831  1.00 68.51  ? 254  PHE A C   1 
ATOM   1418  O O   . PHE A 1 243 ? -50.921 18.940  -3.465  1.00 68.51  ? 254  PHE A O   1 
ATOM   1419  C CB  . PHE A 1 243 ? -51.571 22.221  -3.704  1.00 74.39  ? 254  PHE A CB  1 
ATOM   1420  C CG  . PHE A 1 243 ? -50.533 22.055  -4.776  1.00 74.39  ? 254  PHE A CG  1 
ATOM   1421  C CD1 . PHE A 1 243 ? -50.860 21.464  -5.993  1.00 74.39  ? 254  PHE A CD1 1 
ATOM   1422  C CD2 . PHE A 1 243 ? -49.235 22.515  -4.584  1.00 74.39  ? 254  PHE A CD2 1 
ATOM   1423  C CE1 . PHE A 1 243 ? -49.916 21.338  -7.001  1.00 74.39  ? 254  PHE A CE1 1 
ATOM   1424  C CE2 . PHE A 1 243 ? -48.281 22.392  -5.590  1.00 74.39  ? 254  PHE A CE2 1 
ATOM   1425  C CZ  . PHE A 1 243 ? -48.625 21.802  -6.802  1.00 74.39  ? 254  PHE A CZ  1 
ATOM   1426  N N   . TRP A 1 244 ? -50.522 20.303  -1.716  1.00 61.69  ? 255  TRP A N   1 
ATOM   1427  C CA  . TRP A 1 244 ? -49.444 19.487  -1.171  1.00 61.69  ? 255  TRP A CA  1 
ATOM   1428  C C   . TRP A 1 244 ? -49.781 18.058  -0.718  1.00 61.69  ? 255  TRP A C   1 
ATOM   1429  O O   . TRP A 1 244 ? -48.964 17.157  -0.892  1.00 61.69  ? 255  TRP A O   1 
ATOM   1430  C CB  . TRP A 1 244 ? -48.747 20.268  -0.061  1.00 40.13  ? 255  TRP A CB  1 
ATOM   1431  C CG  . TRP A 1 244 ? -47.987 21.429  -0.619  1.00 40.13  ? 255  TRP A CG  1 
ATOM   1432  C CD1 . TRP A 1 244 ? -48.277 22.754  -0.481  1.00 40.13  ? 255  TRP A CD1 1 
ATOM   1433  C CD2 . TRP A 1 244 ? -46.848 21.358  -1.468  1.00 40.13  ? 255  TRP A CD2 1 
ATOM   1434  N NE1 . TRP A 1 244 ? -47.387 23.518  -1.200  1.00 40.13  ? 255  TRP A NE1 1 
ATOM   1435  C CE2 . TRP A 1 244 ? -46.498 22.681  -1.815  1.00 40.13  ? 255  TRP A CE2 1 
ATOM   1436  C CE3 . TRP A 1 244 ? -46.085 20.300  -1.973  1.00 40.13  ? 255  TRP A CE3 1 
ATOM   1437  C CZ2 . TRP A 1 244 ? -45.420 22.976  -2.644  1.00 40.13  ? 255  TRP A CZ2 1 
ATOM   1438  C CZ3 . TRP A 1 244 ? -45.008 20.587  -2.798  1.00 40.13  ? 255  TRP A CZ3 1 
ATOM   1439  C CH2 . TRP A 1 244 ? -44.685 21.919  -3.127  1.00 40.13  ? 255  TRP A CH2 1 
ATOM   1440  N N   . LEU A 1 245 ? -50.962 17.832  -0.148  1.00 50.39  ? 256  LEU A N   1 
ATOM   1441  C CA  . LEU A 1 245 ? -51.317 16.479  0.255   1.00 50.39  ? 256  LEU A CA  1 
ATOM   1442  C C   . LEU A 1 245 ? -51.363 15.702  -1.026  1.00 50.39  ? 256  LEU A C   1 
ATOM   1443  O O   . LEU A 1 245 ? -50.873 14.577  -1.100  1.00 50.39  ? 256  LEU A O   1 
ATOM   1444  C CB  . LEU A 1 245 ? -52.696 16.407  0.919   1.00 70.02  ? 256  LEU A CB  1 
ATOM   1445  C CG  . LEU A 1 245 ? -53.220 14.984  1.208   1.00 70.02  ? 256  LEU A CG  1 
ATOM   1446  C CD1 . LEU A 1 245 ? -52.256 14.221  2.107   1.00 70.02  ? 256  LEU A CD1 1 
ATOM   1447  C CD2 . LEU A 1 245 ? -54.574 15.059  1.877   1.00 70.02  ? 256  LEU A CD2 1 
ATOM   1448  N N   . ARG A 1 246 ? -51.956 16.311  -2.046  1.00 90.18  ? 257  ARG A N   1 
ATOM   1449  C CA  . ARG A 1 246 ? -52.056 15.660  -3.335  1.00 90.18  ? 257  ARG A CA  1 
ATOM   1450  C C   . ARG A 1 246 ? -50.641 15.376  -3.847  1.00 90.18  ? 257  ARG A C   1 
ATOM   1451  O O   . ARG A 1 246 ? -50.267 14.220  -4.051  1.00 90.18  ? 257  ARG A O   1 
ATOM   1452  C CB  . ARG A 1 246 ? -52.825 16.546  -4.312  1.00 82.15  ? 257  ARG A CB  1 
ATOM   1453  C CG  . ARG A 1 246 ? -53.746 15.757  -5.232  1.00 82.15  ? 257  ARG A CG  1 
ATOM   1454  C CD  . ARG A 1 246 ? -54.472 16.642  -6.242  1.00 82.15  ? 257  ARG A CD  1 
ATOM   1455  N NE  . ARG A 1 246 ? -55.046 17.808  -5.588  1.00 82.15  ? 257  ARG A NE  1 
ATOM   1456  C CZ  . ARG A 1 246 ? -55.898 17.747  -4.571  1.00 82.15  ? 257  ARG A CZ  1 
ATOM   1457  N NH1 . ARG A 1 246 ? -56.363 18.873  -4.036  1.00 82.15  ? 257  ARG A NH1 1 
ATOM   1458  N NH2 . ARG A 1 246 ? -56.291 16.566  -4.095  1.00 82.15  ? 257  ARG A NH2 1 
ATOM   1459  N N   . HIS A 1 247 ? -49.850 16.430  -4.020  1.00 41.47  ? 258  HIS A N   1 
ATOM   1460  C CA  . HIS A 1 247 ? -48.478 16.310  -4.500  1.00 41.47  ? 258  HIS A CA  1 
ATOM   1461  C C   . HIS A 1 247 ? -47.739 15.194  -3.777  1.00 41.47  ? 258  HIS A C   1 
ATOM   1462  O O   . HIS A 1 247 ? -47.240 14.254  -4.397  1.00 41.47  ? 258  HIS A O   1 
ATOM   1463  C CB  . HIS A 1 247 ? -47.754 17.644  -4.287  1.00 73.46  ? 258  HIS A CB  1 
ATOM   1464  C CG  . HIS A 1 247 ? -46.348 17.671  -4.804  1.00 73.46  ? 258  HIS A CG  1 
ATOM   1465  N ND1 . HIS A 1 247 ? -45.332 16.932  -4.239  1.00 73.46  ? 258  HIS A ND1 1 
ATOM   1466  C CD2 . HIS A 1 247 ? -45.787 18.367  -5.822  1.00 73.46  ? 258  HIS A CD2 1 
ATOM   1467  C CE1 . HIS A 1 247 ? -44.205 17.172  -4.884  1.00 73.46  ? 258  HIS A CE1 1 
ATOM   1468  N NE2 . HIS A 1 247 ? -44.455 18.039  -5.849  1.00 73.46  ? 258  HIS A NE2 1 
ATOM   1469  N N   . ARG A 1 248 ? -47.672 15.307  -2.457  1.00 51.89  ? 259  ARG A N   1 
ATOM   1470  C CA  . ARG A 1 248 ? -46.981 14.319  -1.638  1.00 51.89  ? 259  ARG A CA  1 
ATOM   1471  C C   . ARG A 1 248 ? -47.533 12.913  -1.844  1.00 51.89  ? 259  ARG A C   1 
ATOM   1472  O O   . ARG A 1 248 ? -46.809 11.989  -2.220  1.00 51.89  ? 259  ARG A O   1 
ATOM   1473  C CB  . ARG A 1 248 ? -47.077 14.702  -0.155  1.00 52.44  ? 259  ARG A CB  1 
ATOM   1474  C CG  . ARG A 1 248 ? -46.393 16.010  0.199   1.00 52.44  ? 259  ARG A CG  1 
ATOM   1475  C CD  . ARG A 1 248 ? -44.983 15.980  -0.309  1.00 52.44  ? 259  ARG A CD  1 
ATOM   1476  N NE  . ARG A 1 248 ? -44.322 14.784  0.172   1.00 52.44  ? 259  ARG A NE  1 
ATOM   1477  C CZ  . ARG A 1 248 ? -43.445 14.086  -0.532  1.00 52.44  ? 259  ARG A CZ  1 
ATOM   1478  N NH1 . ARG A 1 248 ? -43.131 14.476  -1.759  1.00 52.44  ? 259  ARG A NH1 1 
ATOM   1479  N NH2 . ARG A 1 248 ? -42.883 13.002  -0.007  1.00 52.44  ? 259  ARG A NH2 1 
ATOM   1480  N N   . LEU A 1 249 ? -48.823 12.748  -1.595  1.00 75.01  ? 260  LEU A N   1 
ATOM   1481  C CA  . LEU A 1 249 ? -49.437 11.447  -1.756  1.00 75.01  ? 260  LEU A CA  1 
ATOM   1482  C C   . LEU A 1 249 ? -49.138 10.904  -3.154  1.00 75.01  ? 260  LEU A C   1 
ATOM   1483  O O   . LEU A 1 249 ? -48.713 9.759   -3.310  1.00 75.01  ? 260  LEU A O   1 
ATOM   1484  C CB  . LEU A 1 249 ? -50.946 11.551  -1.514  1.00 53.08  ? 260  LEU A CB  1 
ATOM   1485  C CG  . LEU A 1 249 ? -51.750 10.245  -1.556  1.00 53.08  ? 260  LEU A CG  1 
ATOM   1486  C CD1 . LEU A 1 249 ? -51.139 9.154   -0.662  1.00 53.08  ? 260  LEU A CD1 1 
ATOM   1487  C CD2 . LEU A 1 249 ? -53.160 10.564  -1.126  1.00 53.08  ? 260  LEU A CD2 1 
ATOM   1488  N N   . GLN A 1 250 ? -49.331 11.733  -4.173  1.00 51.91  ? 261  GLN A N   1 
ATOM   1489  C CA  . GLN A 1 250 ? -49.080 11.295  -5.537  1.00 51.91  ? 261  GLN A CA  1 
ATOM   1490  C C   . GLN A 1 250 ? -47.630 10.858  -5.719  1.00 51.91  ? 261  GLN A C   1 
ATOM   1491  O O   . GLN A 1 250 ? -47.358 9.898   -6.431  1.00 51.91  ? 261  GLN A O   1 
ATOM   1492  C CB  . GLN A 1 250 ? -49.452 12.408  -6.524  1.00 99.44  ? 261  GLN A CB  1 
ATOM   1493  C CG  . GLN A 1 250 ? -50.874 12.933  -6.307  1.00 99.44  ? 261  GLN A CG  1 
ATOM   1494  C CD  . GLN A 1 250 ? -51.475 13.610  -7.525  1.00 99.44  ? 261  GLN A CD  1 
ATOM   1495  O OE1 . GLN A 1 250 ? -50.885 14.517  -8.113  1.00 99.44  ? 261  GLN A OE1 1 
ATOM   1496  N NE2 . GLN A 1 250 ? -52.670 13.174  -7.904  1.00 99.44  ? 261  GLN A NE2 1 
ATOM   1497  N N   . TRP A 1 251 ? -46.715 11.551  -5.041  1.00 48.24  ? 262  TRP A N   1 
ATOM   1498  C CA  . TRP A 1 251 ? -45.275 11.269  -5.100  1.00 48.24  ? 262  TRP A CA  1 
ATOM   1499  C C   . TRP A 1 251 ? -44.894 9.865   -4.587  1.00 48.24  ? 262  TRP A C   1 
ATOM   1500  O O   . TRP A 1 251 ? -44.164 9.127   -5.247  1.00 48.24  ? 262  TRP A O   1 
ATOM   1501  C CB  . TRP A 1 251 ? -44.521 12.331  -4.288  1.00 46.22  ? 262  TRP A CB  1 
ATOM   1502  C CG  . TRP A 1 251 ? -43.028 12.275  -4.398  1.00 46.22  ? 262  TRP A CG  1 
ATOM   1503  C CD1 . TRP A 1 251 ? -42.276 12.790  -5.392  1.00 46.22  ? 262  TRP A CD1 1 
ATOM   1504  C CD2 . TRP A 1 251 ? -42.107 11.656  -3.479  1.00 46.22  ? 262  TRP A CD2 1 
ATOM   1505  N NE1 . TRP A 1 251 ? -40.945 12.540  -5.167  1.00 46.22  ? 262  TRP A NE1 1 
ATOM   1506  C CE2 . TRP A 1 251 ? -40.812 11.844  -3.999  1.00 46.22  ? 262  TRP A CE2 1 
ATOM   1507  C CE3 . TRP A 1 251 ? -42.253 10.957  -2.266  1.00 46.22  ? 262  TRP A CE3 1 
ATOM   1508  C CZ2 . TRP A 1 251 ? -39.665 11.361  -3.360  1.00 46.22  ? 262  TRP A CZ2 1 
ATOM   1509  C CZ3 . TRP A 1 251 ? -41.104 10.473  -1.626  1.00 46.22  ? 262  TRP A CZ3 1 
ATOM   1510  C CH2 . TRP A 1 251 ? -39.830 10.680  -2.179  1.00 46.22  ? 262  TRP A CH2 1 
ATOM   1511  N N   . TRP A 1 252 ? -45.386 9.502   -3.404  1.00 50.27  ? 263  TRP A N   1 
ATOM   1512  C CA  . TRP A 1 252 ? -45.070 8.202   -2.819  1.00 50.27  ? 263  TRP A CA  1 
ATOM   1513  C C   . TRP A 1 252 ? -45.526 7.018   -3.655  1.00 50.27  ? 263  TRP A C   1 
ATOM   1514  O O   . TRP A 1 252 ? -44.851 5.996   -3.713  1.00 50.27  ? 263  TRP A O   1 
ATOM   1515  C CB  . TRP A 1 252 ? -45.695 8.063   -1.434  1.00 40.87  ? 263  TRP A CB  1 
ATOM   1516  C CG  . TRP A 1 252 ? -45.068 8.874   -0.359  1.00 40.87  ? 263  TRP A CG  1 
ATOM   1517  C CD1 . TRP A 1 252 ? -45.490 10.073  0.106   1.00 40.87  ? 263  TRP A CD1 1 
ATOM   1518  C CD2 . TRP A 1 252 ? -43.929 8.520   0.417   1.00 40.87  ? 263  TRP A CD2 1 
ATOM   1519  N NE1 . TRP A 1 252 ? -44.688 10.495  1.134   1.00 40.87  ? 263  TRP A NE1 1 
ATOM   1520  C CE2 . TRP A 1 252 ? -43.717 9.556   1.343   1.00 40.87  ? 263  TRP A CE2 1 
ATOM   1521  C CE3 . TRP A 1 252 ? -43.062 7.427   0.419   1.00 40.87  ? 263  TRP A CE3 1 
ATOM   1522  C CZ2 . TRP A 1 252 ? -42.670 9.535   2.267   1.00 40.87  ? 263  TRP A CZ2 1 
ATOM   1523  C CZ3 . TRP A 1 252 ? -42.016 7.401   1.334   1.00 40.87  ? 263  TRP A CZ3 1 
ATOM   1524  C CH2 . TRP A 1 252 ? -41.830 8.449   2.247   1.00 40.87  ? 263  TRP A CH2 1 
ATOM   1525  N N   . ARG A 1 253 ? -46.691 7.152   -4.279  1.00 75.81  ? 264  ARG A N   1 
ATOM   1526  C CA  . ARG A 1 253 ? -47.256 6.084   -5.099  1.00 75.81  ? 264  ARG A CA  1 
ATOM   1527  C C   . ARG A 1 253 ? -46.468 5.917   -6.400  1.00 75.81  ? 264  ARG A C   1 
ATOM   1528  O O   . ARG A 1 253 ? -46.322 4.808   -6.917  1.00 75.81  ? 264  ARG A O   1 
ATOM   1529  C CB  . ARG A 1 253 ? -48.738 6.394   -5.380  1.00 67.83  ? 264  ARG A CB  1 
ATOM   1530  C CG  . ARG A 1 253 ? -49.629 6.309   -4.128  1.00 67.83  ? 264  ARG A CG  1 
ATOM   1531  C CD  . ARG A 1 253 ? -51.067 6.796   -4.339  1.00 67.83  ? 264  ARG A CD  1 
ATOM   1532  N NE  . ARG A 1 253 ? -51.866 6.632   -3.117  1.00 67.83  ? 264  ARG A NE  1 
ATOM   1533  C CZ  . ARG A 1 253 ? -53.068 7.172   -2.904  1.00 67.83  ? 264  ARG A CZ  1 
ATOM   1534  N NH1 . ARG A 1 253 ? -53.642 7.929   -3.827  1.00 67.83  ? 264  ARG A NH1 1 
ATOM   1535  N NH2 . ARG A 1 253 ? -53.702 6.961   -1.762  1.00 67.83  ? 264  ARG A NH2 1 
ATOM   1536  N N   . LYS A 1 254 ? -45.947 7.036   -6.895  1.00 36.66  ? 265  LYS A N   1 
ATOM   1537  C CA  . LYS A 1 254 ? -45.159 7.126   -8.126  1.00 36.66  ? 265  LYS A CA  1 
ATOM   1538  C C   . LYS A 1 254 ? -44.081 6.062   -8.281  1.00 36.66  ? 265  LYS A C   1 
ATOM   1539  O O   . LYS A 1 254 ? -43.744 5.687   -9.395  1.00 36.66  ? 265  LYS A O   1 
ATOM   1540  C CB  . LYS A 1 254 ? -44.504 8.507   -8.183  1.00 95.42  ? 265  LYS A CB  1 
ATOM   1541  C CG  . LYS A 1 254 ? -43.822 8.865   -9.491  1.00 95.42  ? 265  LYS A CG  1 
ATOM   1542  C CD  . LYS A 1 254 ? -42.946 10.121  -9.337  1.00 95.42  ? 265  LYS A CD  1 
ATOM   1543  C CE  . LYS A 1 254 ? -43.727 11.331  -8.832  1.00 95.42  ? 265  LYS A CE  1 
ATOM   1544  N NZ  . LYS A 1 254 ? -42.836 12.497  -8.571  1.00 95.42  ? 265  LYS A NZ  1 
ATOM   1545  N N   . PHE A 1 255 ? -43.541 5.581   -7.170  1.00 42.24  ? 266  PHE A N   1 
ATOM   1546  C CA  . PHE A 1 255 ? -42.482 4.579   -7.209  1.00 42.24  ? 266  PHE A CA  1 
ATOM   1547  C C   . PHE A 1 255 ? -42.894 3.278   -6.552  1.00 42.24  ? 266  PHE A C   1 
ATOM   1548  O O   . PHE A 1 255 ? -42.056 2.387   -6.365  1.00 42.24  ? 266  PHE A O   1 
ATOM   1549  C CB  . PHE A 1 255 ? -41.235 5.082   -6.474  1.00 59.29  ? 266  PHE A CB  1 
ATOM   1550  C CG  . PHE A 1 255 ? -40.799 6.451   -6.879  1.00 59.29  ? 266  PHE A CG  1 
ATOM   1551  C CD1 . PHE A 1 255 ? -40.089 6.648   -8.042  1.00 59.29  ? 266  PHE A CD1 1 
ATOM   1552  C CD2 . PHE A 1 255 ? -41.126 7.545   -6.100  1.00 59.29  ? 266  PHE A CD2 1 
ATOM   1553  C CE1 . PHE A 1 255 ? -39.718 7.904   -8.419  1.00 59.29  ? 266  PHE A CE1 1 
ATOM   1554  C CE2 . PHE A 1 255 ? -40.754 8.810   -6.476  1.00 59.29  ? 266  PHE A CE2 1 
ATOM   1555  C CZ  . PHE A 1 255 ? -40.053 8.989   -7.634  1.00 59.29  ? 266  PHE A CZ  1 
ATOM   1556  N N   . ALA A 1 256 ? -44.169 3.180   -6.183  1.00 71.73  ? 267  ALA A N   1 
ATOM   1557  C CA  . ALA A 1 256 ? -44.701 1.990   -5.524  1.00 71.73  ? 267  ALA A CA  1 
ATOM   1558  C C   . ALA A 1 256 ? -45.210 0.954   -6.511  1.00 71.73  ? 267  ALA A C   1 
ATOM   1559  O O   . ALA A 1 256 ? -45.598 1.283   -7.628  1.00 71.73  ? 267  ALA A O   1 
ATOM   1560  C CB  . ALA A 1 256 ? -45.827 2.383   -4.579  1.00 24.76  ? 267  ALA A CB  1 
ATOM   1561  N N   . MET A 1 257 ? -45.195 -0.302  -6.078  1.00 81.15  ? 268  MET A N   1 
ATOM   1562  C CA  . MET A 1 257 ? -45.684 -1.418  -6.876  1.00 81.15  ? 268  MET A CA  1 
ATOM   1563  C C   . MET A 1 257 ? -47.149 -1.644  -6.518  1.00 81.15  ? 268  MET A C   1 
ATOM   1564  O O   . MET A 1 257 ? -47.950 -2.076  -7.347  1.00 81.15  ? 268  MET A O   1 
ATOM   1565  C CB  . MET A 1 257 ? -44.902 -2.690  -6.558  1.00 82.36  ? 268  MET A CB  1 
ATOM   1566  C CG  . MET A 1 257 ? -43.517 -2.743  -7.146  1.00 82.36  ? 268  MET A CG  1 
ATOM   1567  S SD  . MET A 1 257 ? -43.263 -4.305  -8.022  1.00 82.36  ? 268  MET A SD  1 
ATOM   1568  C CE  . MET A 1 257 ? -43.637 -3.790  -9.730  1.00 82.36  ? 268  MET A CE  1 
ATOM   1569  N N   . SER A 1 258 ? -47.476 -1.346  -5.265  1.00 61.09  ? 269  SER A N   1 
ATOM   1570  C CA  . SER A 1 258 ? -48.817 -1.500  -4.716  1.00 61.09  ? 269  SER A CA  1 
ATOM   1571  C C   . SER A 1 258 ? -49.233 -0.142  -4.164  1.00 61.09  ? 269  SER A C   1 
ATOM   1572  O O   . SER A 1 258 ? -49.430 0.013   -2.963  1.00 61.09  ? 269  SER A O   1 
ATOM   1573  C CB  . SER A 1 258 ? -48.789 -2.527  -3.581  1.00 63.99  ? 269  SER A CB  1 
ATOM   1574  O OG  . SER A 1 258 ? -47.926 -3.618  -3.883  1.00 63.99  ? 269  SER A OG  1 
ATOM   1575  N N   . PRO A 1 259 ? -49.369 0.863   -5.041  1.00 47.83  ? 270  PRO A N   1 
ATOM   1576  C CA  . PRO A 1 259 ? -49.756 2.214   -4.639  1.00 47.83  ? 270  PRO A CA  1 
ATOM   1577  C C   . PRO A 1 259 ? -51.010 2.199   -3.809  1.00 47.83  ? 270  PRO A C   1 
ATOM   1578  O O   . PRO A 1 259 ? -51.460 3.237   -3.322  1.00 47.83  ? 270  PRO A O   1 
ATOM   1579  C CB  . PRO A 1 259 ? -49.964 2.925   -5.968  1.00 71.48  ? 270  PRO A CB  1 
ATOM   1580  C CG  . PRO A 1 259 ? -50.378 1.830   -6.872  1.00 71.48  ? 270  PRO A CG  1 
ATOM   1581  C CD  . PRO A 1 259 ? -49.413 0.735   -6.503  1.00 71.48  ? 270  PRO A CD  1 
ATOM   1582  N N   . SER A 1 260 ? -51.576 1.010   -3.654  1.00 69.95  ? 271  SER A N   1 
ATOM   1583  C CA  . SER A 1 260 ? -52.789 0.842   -2.877  1.00 69.95  ? 271  SER A CA  1 
ATOM   1584  C C   . SER A 1 260 ? -52.482 0.930   -1.384  1.00 69.95  ? 271  SER A C   1 
ATOM   1585  O O   . SER A 1 260 ? -53.333 1.347   -0.605  1.00 69.95  ? 271  SER A O   1 
ATOM   1586  C CB  . SER A 1 260 ? -53.427 -0.508  -3.207  1.00 114.26 ? 271  SER A CB  1 
ATOM   1587  O OG  . SER A 1 260 ? -53.594 -0.658  -4.608  1.00 114.26 ? 271  SER A OG  1 
ATOM   1588  N N   . ASN A 1 261 ? -51.260 0.559   -0.997  1.00 52.51  ? 272  ASN A N   1 
ATOM   1589  C CA  . ASN A 1 261 ? -50.857 0.577   0.410   1.00 52.51  ? 272  ASN A CA  1 
ATOM   1590  C C   . ASN A 1 261 ? -50.303 1.903   0.949   1.00 52.51  ? 272  ASN A C   1 
ATOM   1591  O O   . ASN A 1 261 ? -49.720 1.951   2.039   1.00 52.51  ? 272  ASN A O   1 
ATOM   1592  C CB  . ASN A 1 261 ? -49.857 -0.547  0.679   1.00 77.36  ? 272  ASN A CB  1 
ATOM   1593  C CG  . ASN A 1 261 ? -50.431 -1.911  0.383   1.00 77.36  ? 272  ASN A CG  1 
ATOM   1594  O OD1 . ASN A 1 261 ? -51.599 -2.166  0.657   1.00 77.36  ? 272  ASN A OD1 1 
ATOM   1595  N ND2 . ASN A 1 261 ? -49.611 -2.801  -0.167  1.00 77.36  ? 272  ASN A ND2 1 
ATOM   1596  N N   . PHE A 1 262 ? -50.479 2.973   0.185   1.00 66.50  ? 273  PHE A N   1 
ATOM   1597  C CA  . PHE A 1 262 ? -50.035 4.291   0.610   1.00 66.50  ? 273  PHE A CA  1 
ATOM   1598  C C   . PHE A 1 262 ? -51.322 5.086   0.680   1.00 66.50  ? 273  PHE A C   1 
ATOM   1599  O O   . PHE A 1 262 ? -51.903 5.397   -0.355  1.00 66.50  ? 273  PHE A O   1 
ATOM   1600  C CB  . PHE A 1 262 ? -49.073 4.915   -0.420  1.00 64.25  ? 273  PHE A CB  1 
ATOM   1601  C CG  . PHE A 1 262 ? -47.623 4.482   -0.261  1.00 64.25  ? 273  PHE A CG  1 
ATOM   1602  C CD1 . PHE A 1 262 ? -46.778 5.141   0.618   1.00 64.25  ? 273  PHE A CD1 1 
ATOM   1603  C CD2 . PHE A 1 262 ? -47.111 3.408   -0.985  1.00 64.25  ? 273  PHE A CD2 1 
ATOM   1604  C CE1 . PHE A 1 262 ? -45.447 4.736   0.771   1.00 64.25  ? 273  PHE A CE1 1 
ATOM   1605  C CE2 . PHE A 1 262 ? -45.784 3.001   -0.835  1.00 64.25  ? 273  PHE A CE2 1 
ATOM   1606  C CZ  . PHE A 1 262 ? -44.953 3.661   0.039   1.00 64.25  ? 273  PHE A CZ  1 
ATOM   1607  N N   . SER A 1 263 ? -51.781 5.387   1.893   1.00 47.72  ? 274  SER A N   1 
ATOM   1608  C CA  . SER A 1 263 ? -53.021 6.143   2.069   1.00 47.72  ? 274  SER A CA  1 
ATOM   1609  C C   . SER A 1 263 ? -52.860 7.460   2.833   1.00 47.72  ? 274  SER A C   1 
ATOM   1610  O O   . SER A 1 263 ? -51.827 7.695   3.470   1.00 47.72  ? 274  SER A O   1 
ATOM   1611  C CB  . SER A 1 263 ? -54.070 5.275   2.770   1.00 71.35  ? 274  SER A CB  1 
ATOM   1612  O OG  . SER A 1 263 ? -53.623 4.843   4.041   1.00 71.35  ? 274  SER A OG  1 
ATOM   1613  N N   . SER A 1 264 ? -53.899 8.303   2.762   1.00 53.96  ? 275  SER A N   1 
ATOM   1614  C CA  . SER A 1 264 ? -53.935 9.616   3.431   1.00 53.96  ? 275  SER A CA  1 
ATOM   1615  C C   . SER A 1 264 ? -55.064 9.745   4.473   1.00 53.96  ? 275  SER A C   1 
ATOM   1616  O O   . SER A 1 264 ? -55.970 8.925   4.536   1.00 53.96  ? 275  SER A O   1 
ATOM   1617  C CB  . SER A 1 264 ? -54.094 10.741  2.396   1.00 92.57  ? 275  SER A CB  1 
ATOM   1618  O OG  . SER A 1 264 ? -55.423 10.816  1.902   1.00 92.57  ? 275  SER A OG  1 
ATOM   1619  N N   . SER A 1 265 ? -55.015 10.790  5.286   1.00 91.92  ? 276  SER A N   1 
ATOM   1620  C CA  . SER A 1 265 ? -56.037 10.957  6.302   1.00 91.92  ? 276  SER A CA  1 
ATOM   1621  C C   . SER A 1 265 ? -56.200 12.398  6.757   1.00 91.92  ? 276  SER A C   1 
ATOM   1622  O O   . SER A 1 265 ? -55.357 13.247  6.476   1.00 91.92  ? 276  SER A O   1 
ATOM   1623  C CB  . SER A 1 265 ? -55.709 10.085  7.509   1.00 58.89  ? 276  SER A CB  1 
ATOM   1624  O OG  . SER A 1 265 ? -54.529 10.546  8.138   1.00 58.89  ? 276  SER A OG  1 
ATOM   1625  N N   . ASP A 1 266 ? -57.290 12.650  7.479   1.00 83.27  ? 277  ASP A N   1 
ATOM   1626  C CA  . ASP A 1 266 ? -57.618 13.972  7.996   1.00 83.27  ? 277  ASP A CA  1 
ATOM   1627  C C   . ASP A 1 266 ? -57.231 14.046  9.475   1.00 83.27  ? 277  ASP A C   1 
ATOM   1628  O O   . ASP A 1 266 ? -56.706 13.076  10.022  1.00 83.27  ? 277  ASP A O   1 
ATOM   1629  C CB  . ASP A 1 266 ? -59.119 14.217  7.821   1.00 179.71 ? 277  ASP A CB  1 
ATOM   1630  C CG  . ASP A 1 266 ? -59.595 13.934  6.398   1.00 179.71 ? 277  ASP A CG  1 
ATOM   1631  O OD1 . ASP A 1 266 ? -60.817 14.022  6.147   1.00 179.71 ? 277  ASP A OD1 1 
ATOM   1632  O OD2 . ASP A 1 266 ? -58.752 13.625  5.526   1.00 179.71 ? 277  ASP A OD2 1 
ATOM   1633  N N   . CYS A 1 267 ? -57.472 15.198  10.104  1.00 58.15  ? 278  CYS A N   1 
ATOM   1634  C CA  . CYS A 1 267 ? -57.173 15.424  11.528  1.00 58.15  ? 278  CYS A CA  1 
ATOM   1635  C C   . CYS A 1 267 ? -56.910 16.903  11.786  1.00 58.15  ? 278  CYS A C   1 
ATOM   1636  O O   . CYS A 1 267 ? -56.698 17.659  10.839  1.00 58.15  ? 278  CYS A O   1 
ATOM   1637  C CB  . CYS A 1 267 ? -55.955 14.612  11.982  1.00 94.35  ? 278  CYS A CB  1 
ATOM   1638  S SG  . CYS A 1 267 ? -54.396 15.139  11.266  1.00 94.35  ? 278  CYS A SG  1 
ATOM   1639  N N   . GLN A 1 268 ? -56.898 17.307  13.061  1.00 149.64 ? 279  GLN A N   1 
ATOM   1640  C CA  . GLN A 1 268 ? -56.683 18.717  13.407  1.00 149.64 ? 279  GLN A CA  1 
ATOM   1641  C C   . GLN A 1 268 ? -56.361 19.072  14.872  1.00 149.64 ? 279  GLN A C   1 
ATOM   1642  O O   . GLN A 1 268 ? -56.579 18.276  15.788  1.00 149.64 ? 279  GLN A O   1 
ATOM   1643  C CB  . GLN A 1 268 ? -57.910 19.514  12.965  1.00 119.32 ? 279  GLN A CB  1 
ATOM   1644  C CG  . GLN A 1 268 ? -59.217 18.956  13.501  1.00 119.32 ? 279  GLN A CG  1 
ATOM   1645  C CD  . GLN A 1 268 ? -60.401 19.408  12.686  1.00 119.32 ? 279  GLN A CD  1 
ATOM   1646  O OE1 . GLN A 1 268 ? -60.616 20.603  12.505  1.00 119.32 ? 279  GLN A OE1 1 
ATOM   1647  N NE2 . GLN A 1 268 ? -61.178 18.454  12.184  1.00 119.32 ? 279  GLN A NE2 1 
ATOM   1648  N N   . ASP A 1 269 ? -55.846 20.291  15.057  1.00 97.17  ? 280  ASP A N   1 
ATOM   1649  C CA  . ASP A 1 269 ? -55.480 20.865  16.358  1.00 97.17  ? 280  ASP A CA  1 
ATOM   1650  C C   . ASP A 1 269 ? -54.281 20.214  17.045  1.00 97.17  ? 280  ASP A C   1 
ATOM   1651  O O   . ASP A 1 269 ? -54.436 19.373  17.932  1.00 97.17  ? 280  ASP A O   1 
ATOM   1652  C CB  . ASP A 1 269 ? -56.693 20.860  17.301  1.00 132.44 ? 280  ASP A CB  1 
ATOM   1653  C CG  . ASP A 1 269 ? -56.545 21.847  18.457  1.00 132.44 ? 280  ASP A CG  1 
ATOM   1654  O OD1 . ASP A 1 269 ? -55.719 21.603  19.361  1.00 132.44 ? 280  ASP A OD1 1 
ATOM   1655  O OD2 . ASP A 1 269 ? -57.254 22.876  18.455  1.00 132.44 ? 280  ASP A OD2 1 
ATOM   1656  N N   . GLU A 1 270 ? -53.084 20.628  16.634  1.00 122.70 ? 281  GLU A N   1 
ATOM   1657  C CA  . GLU A 1 270 ? -51.824 20.112  17.180  1.00 122.70 ? 281  GLU A CA  1 
ATOM   1658  C C   . GLU A 1 270 ? -50.793 21.241  17.269  1.00 122.70 ? 281  GLU A C   1 
ATOM   1659  O O   . GLU A 1 270 ? -49.736 21.100  17.890  1.00 122.70 ? 281  GLU A O   1 
ATOM   1660  C CB  . GLU A 1 270 ? -51.314 18.961  16.295  1.00 120.39 ? 281  GLU A CB  1 
ATOM   1661  C CG  . GLU A 1 270 ? -49.837 18.606  16.418  1.00 120.39 ? 281  GLU A CG  1 
ATOM   1662  C CD  . GLU A 1 270 ? -48.975 19.400  15.457  1.00 120.39 ? 281  GLU A CD  1 
ATOM   1663  O OE1 . GLU A 1 270 ? -47.814 19.006  15.224  1.00 120.39 ? 281  GLU A OE1 1 
ATOM   1664  O OE2 . GLU A 1 270 ? -49.460 20.423  14.934  1.00 120.39 ? 281  GLU A OE2 1 
ATOM   1665  N N   . GLU A 1 271 ? -51.145 22.362  16.644  1.00 97.90  ? 282  GLU A N   1 
ATOM   1666  C CA  . GLU A 1 271 ? -50.340 23.580  16.598  1.00 97.90  ? 282  GLU A CA  1 
ATOM   1667  C C   . GLU A 1 271 ? -51.065 24.526  15.638  1.00 97.90  ? 282  GLU A C   1 
ATOM   1668  O O   . GLU A 1 271 ? -50.495 25.479  15.107  1.00 97.90  ? 282  GLU A O   1 
ATOM   1669  C CB  . GLU A 1 271 ? -48.921 23.270  16.105  1.00 132.29 ? 282  GLU A CB  1 
ATOM   1670  C CG  . GLU A 1 271 ? -47.904 23.084  17.233  1.00 132.29 ? 282  GLU A CG  1 
ATOM   1671  C CD  . GLU A 1 271 ? -46.618 22.412  16.779  1.00 132.29 ? 282  GLU A CD  1 
ATOM   1672  O OE1 . GLU A 1 271 ? -46.007 22.872  15.791  1.00 132.29 ? 282  GLU A OE1 1 
ATOM   1673  O OE2 . GLU A 1 271 ? -46.214 21.421  17.420  1.00 132.29 ? 282  GLU A OE2 1 
ATOM   1674  N N   . GLY A 1 272 ? -52.349 24.235  15.450  1.00 69.62  ? 283  GLY A N   1 
ATOM   1675  C CA  . GLY A 1 272 ? -53.221 24.994  14.572  1.00 69.62  ? 283  GLY A CA  1 
ATOM   1676  C C   . GLY A 1 272 ? -54.373 24.062  14.231  1.00 69.62  ? 283  GLY A C   1 
ATOM   1677  O O   . GLY A 1 272 ? -54.555 23.032  14.879  1.00 69.62  ? 283  GLY A O   1 
ATOM   1678  N N   . ARG A 1 273 ? -55.165 24.392  13.225  1.00 101.92 ? 284  ARG A N   1 
ATOM   1679  C CA  . ARG A 1 273 ? -56.266 23.511  12.867  1.00 101.92 ? 284  ARG A CA  1 
ATOM   1680  C C   . ARG A 1 273 ? -56.206 23.159  11.387  1.00 101.92 ? 284  ARG A C   1 
ATOM   1681  O O   . ARG A 1 273 ? -56.083 24.046  10.539  1.00 101.92 ? 284  ARG A O   1 
ATOM   1682  C CB  . ARG A 1 273 ? -57.610 24.176  13.195  1.00 186.81 ? 284  ARG A CB  1 
ATOM   1683  C CG  . ARG A 1 273 ? -57.768 25.582  12.623  1.00 186.81 ? 284  ARG A CG  1 
ATOM   1684  C CD  . ARG A 1 273 ? -59.157 26.164  12.882  1.00 186.81 ? 284  ARG A CD  1 
ATOM   1685  N NE  . ARG A 1 273 ? -60.200 25.478  12.122  1.00 186.81 ? 284  ARG A NE  1 
ATOM   1686  C CZ  . ARG A 1 273 ? -61.484 25.823  12.135  1.00 186.81 ? 284  ARG A CZ  1 
ATOM   1687  N NH1 . ARG A 1 273 ? -61.889 26.849  12.871  1.00 186.81 ? 284  ARG A NH1 1 
ATOM   1688  N NH2 . ARG A 1 273 ? -62.365 25.143  11.413  1.00 186.81 ? 284  ARG A NH2 1 
ATOM   1689  N N   . LYS A 1 274 ? -56.267 21.862  11.095  1.00 78.98  ? 285  LYS A N   1 
ATOM   1690  C CA  . LYS A 1 274 ? -56.257 21.342  9.724   1.00 78.98  ? 285  LYS A CA  1 
ATOM   1691  C C   . LYS A 1 274 ? -54.936 20.676  9.343   1.00 78.98  ? 285  LYS A C   1 
ATOM   1692  O O   . LYS A 1 274 ? -53.912 21.343  9.165   1.00 78.98  ? 285  LYS A O   1 
ATOM   1693  C CB  . LYS A 1 274 ? -56.583 22.451  8.708   1.00 163.66 ? 285  LYS A CB  1 
ATOM   1694  C CG  . LYS A 1 274 ? -57.383 22.008  7.481   1.00 163.66 ? 285  LYS A CG  1 
ATOM   1695  C CD  . LYS A 1 274 ? -58.861 21.789  7.803   1.00 163.66 ? 285  LYS A CD  1 
ATOM   1696  C CE  . LYS A 1 274 ? -59.663 21.459  6.545   1.00 163.66 ? 285  LYS A CE  1 
ATOM   1697  N NZ  . LYS A 1 274 ? -61.120 21.276  6.815   1.00 163.66 ? 285  LYS A NZ  1 
ATOM   1698  N N   . GLY A 1 275 ? -54.977 19.351  9.212   1.00 101.62 ? 286  GLY A N   1 
ATOM   1699  C CA  . GLY A 1 275 ? -53.790 18.604  8.844   1.00 101.62 ? 286  GLY A CA  1 
ATOM   1700  C C   . GLY A 1 275 ? -54.067 17.168  8.441   1.00 101.62 ? 286  GLY A C   1 
ATOM   1701  O O   . GLY A 1 275 ? -55.026 16.565  8.918   1.00 101.62 ? 286  GLY A O   1 
ATOM   1702  N N   . ASN A 1 276 ? -53.219 16.629  7.563   1.00 63.42  ? 287  ASN A N   1 
ATOM   1703  C CA  . ASN A 1 276 ? -53.333 15.252  7.078   1.00 63.42  ? 287  ASN A CA  1 
ATOM   1704  C C   . ASN A 1 276 ? -52.118 14.396  7.466   1.00 63.42  ? 287  ASN A C   1 
ATOM   1705  O O   . ASN A 1 276 ? -51.135 14.888  8.019   1.00 63.42  ? 287  ASN A O   1 
ATOM   1706  C CB  . ASN A 1 276 ? -53.456 15.240  5.557   1.00 77.93  ? 287  ASN A CB  1 
ATOM   1707  C CG  . ASN A 1 276 ? -54.379 16.307  5.045   1.00 77.93  ? 287  ASN A CG  1 
ATOM   1708  O OD1 . ASN A 1 276 ? -55.583 16.264  5.276   1.00 77.93  ? 287  ASN A OD1 1 
ATOM   1709  N ND2 . ASN A 1 276 ? -53.818 17.283  4.347   1.00 77.93  ? 287  ASN A ND2 1 
ATOM   1710  N N   . LYS A 1 277 ? -52.191 13.109  7.151   1.00 49.21  ? 288  LYS A N   1 
ATOM   1711  C CA  . LYS A 1 277 ? -51.105 12.186  7.443   1.00 49.21  ? 288  LYS A CA  1 
ATOM   1712  C C   . LYS A 1 277 ? -51.022 11.138  6.330   1.00 49.21  ? 288  LYS A C   1 
ATOM   1713  O O   . LYS A 1 277 ? -52.043 10.672  5.822   1.00 49.21  ? 288  LYS A O   1 
ATOM   1714  C CB  . LYS A 1 277 ? -51.339 11.496  8.791   1.00 80.74  ? 288  LYS A CB  1 
ATOM   1715  C CG  . LYS A 1 277 ? -51.192 12.384  10.015  1.00 80.74  ? 288  LYS A CG  1 
ATOM   1716  C CD  . LYS A 1 277 ? -51.420 11.575  11.287  1.00 80.74  ? 288  LYS A CD  1 
ATOM   1717  C CE  . LYS A 1 277 ? -50.934 12.307  12.541  1.00 80.74  ? 288  LYS A CE  1 
ATOM   1718  N NZ  . LYS A 1 277 ? -51.669 13.572  12.850  1.00 80.74  ? 288  LYS A NZ  1 
ATOM   1719  N N   . LEU A 1 278 ? -49.806 10.781  5.938   1.00 46.80  ? 289  LEU A N   1 
ATOM   1720  C CA  . LEU A 1 278 ? -49.621 9.778   4.900   1.00 46.80  ? 289  LEU A CA  1 
ATOM   1721  C C   . LEU A 1 278 ? -49.199 8.494   5.584   1.00 46.80  ? 289  LEU A C   1 
ATOM   1722  O O   . LEU A 1 278 ? -48.325 8.499   6.446   1.00 46.80  ? 289  LEU A O   1 
ATOM   1723  C CB  . LEU A 1 278 ? -48.559 10.218  3.885   1.00 35.29  ? 289  LEU A CB  1 
ATOM   1724  C CG  . LEU A 1 278 ? -49.014 11.217  2.821   1.00 35.29  ? 289  LEU A CG  1 
ATOM   1725  C CD1 . LEU A 1 278 ? -50.198 10.645  2.116   1.00 35.29  ? 289  LEU A CD1 1 
ATOM   1726  C CD2 . LEU A 1 278 ? -49.377 12.554  3.443   1.00 35.29  ? 289  LEU A CD2 1 
ATOM   1727  N N   . TYR A 1 279 ? -49.825 7.393   5.200   1.00 63.12  ? 290  TYR A N   1 
ATOM   1728  C CA  . TYR A 1 279 ? -49.524 6.118   5.818   1.00 63.12  ? 290  TYR A CA  1 
ATOM   1729  C C   . TYR A 1 279 ? -49.059 5.072   4.820   1.00 63.12  ? 290  TYR A C   1 
ATOM   1730  O O   . TYR A 1 279 ? -49.364 5.157   3.629   1.00 63.12  ? 290  TYR A O   1 
ATOM   1731  C CB  . TYR A 1 279 ? -50.784 5.594   6.527   1.00 51.88  ? 290  TYR A CB  1 
ATOM   1732  C CG  . TYR A 1 279 ? -51.223 6.397   7.741   1.00 51.88  ? 290  TYR A CG  1 
ATOM   1733  C CD1 . TYR A 1 279 ? -50.822 6.026   9.021   1.00 51.88  ? 290  TYR A CD1 1 
ATOM   1734  C CD2 . TYR A 1 279 ? -51.977 7.563   7.600   1.00 51.88  ? 290  TYR A CD2 1 
ATOM   1735  C CE1 . TYR A 1 279 ? -51.143 6.791   10.125  1.00 51.88  ? 290  TYR A CE1 1 
ATOM   1736  C CE2 . TYR A 1 279 ? -52.302 8.337   8.705   1.00 51.88  ? 290  TYR A CE2 1 
ATOM   1737  C CZ  . TYR A 1 279 ? -51.874 7.946   9.964   1.00 51.88  ? 290  TYR A CZ  1 
ATOM   1738  O OH  . TYR A 1 279 ? -52.113 8.731   11.067  1.00 51.88  ? 290  TYR A OH  1 
ATOM   1739  N N   . TYR A 1 280 ? -48.301 4.094   5.304   1.00 54.34  ? 291  TYR A N   1 
ATOM   1740  C CA  . TYR A 1 280 ? -47.882 2.992   4.450   1.00 54.34  ? 291  TYR A CA  1 
ATOM   1741  C C   . TYR A 1 280 ? -48.208 1.658   5.140   1.00 54.34  ? 291  TYR A C   1 
ATOM   1742  O O   . TYR A 1 280 ? -47.804 1.420   6.289   1.00 54.34  ? 291  TYR A O   1 
ATOM   1743  C CB  . TYR A 1 280 ? -46.395 3.023   4.112   1.00 64.20  ? 291  TYR A CB  1 
ATOM   1744  C CG  . TYR A 1 280 ? -46.040 1.786   3.336   1.00 64.20  ? 291  TYR A CG  1 
ATOM   1745  C CD1 . TYR A 1 280 ? -46.705 1.490   2.153   1.00 64.20  ? 291  TYR A CD1 1 
ATOM   1746  C CD2 . TYR A 1 280 ? -45.159 0.842   3.846   1.00 64.20  ? 291  TYR A CD2 1 
ATOM   1747  C CE1 . TYR A 1 280 ? -46.519 0.284   1.505   1.00 64.20  ? 291  TYR A CE1 1 
ATOM   1748  C CE2 . TYR A 1 280 ? -44.965 -0.376  3.200   1.00 64.20  ? 291  TYR A CE2 1 
ATOM   1749  C CZ  . TYR A 1 280 ? -45.656 -0.647  2.030   1.00 64.20  ? 291  TYR A CZ  1 
ATOM   1750  O OH  . TYR A 1 280 ? -45.519 -1.861  1.396   1.00 64.20  ? 291  TYR A OH  1 
ATOM   1751  N N   . ASN A 1 281 ? -48.920 0.794   4.410   1.00 64.04  ? 292  ASN A N   1 
ATOM   1752  C CA  . ASN A 1 281 ? -49.355 -0.510  4.912   1.00 64.04  ? 292  ASN A CA  1 
ATOM   1753  C C   . ASN A 1 281 ? -48.270 -1.581  5.001   1.00 64.04  ? 292  ASN A C   1 
ATOM   1754  O O   . ASN A 1 281 ? -48.035 -2.340  4.056   1.00 64.04  ? 292  ASN A O   1 
ATOM   1755  C CB  . ASN A 1 281 ? -50.520 -1.033  4.059   1.00 132.85 ? 292  ASN A CB  1 
ATOM   1756  C CG  . ASN A 1 281 ? -51.607 -1.704  4.892   1.00 132.85 ? 292  ASN A CG  1 
ATOM   1757  O OD1 . ASN A 1 281 ? -51.355 -2.684  5.597   1.00 132.85 ? 292  ASN A OD1 1 
ATOM   1758  N ND2 . ASN A 1 281 ? -52.825 -1.174  4.811   1.00 132.85 ? 292  ASN A ND2 1 
ATOM   1759  N N   . PHE A 1 282 ? -47.605 -1.627  6.150   1.00 84.88  ? 293  PHE A N   1 
ATOM   1760  C CA  . PHE A 1 282 ? -46.576 -2.621  6.393   1.00 84.88  ? 293  PHE A CA  1 
ATOM   1761  C C   . PHE A 1 282 ? -47.357 -3.908  6.575   1.00 84.88  ? 293  PHE A C   1 
ATOM   1762  O O   . PHE A 1 282 ? -48.461 -3.884  7.113   1.00 84.88  ? 293  PHE A O   1 
ATOM   1763  C CB  . PHE A 1 282 ? -45.794 -2.280  7.670   1.00 81.33  ? 293  PHE A CB  1 
ATOM   1764  C CG  . PHE A 1 282 ? -44.735 -1.214  7.476   1.00 81.33  ? 293  PHE A CG  1 
ATOM   1765  C CD1 . PHE A 1 282 ? -43.491 -1.536  6.946   1.00 81.33  ? 293  PHE A CD1 1 
ATOM   1766  C CD2 . PHE A 1 282 ? -44.986 0.108   7.818   1.00 81.33  ? 293  PHE A CD2 1 
ATOM   1767  C CE1 . PHE A 1 282 ? -42.520 -0.560  6.761   1.00 81.33  ? 293  PHE A CE1 1 
ATOM   1768  C CE2 . PHE A 1 282 ? -44.017 1.089   7.635   1.00 81.33  ? 293  PHE A CE2 1 
ATOM   1769  C CZ  . PHE A 1 282 ? -42.785 0.753   7.108   1.00 81.33  ? 293  PHE A CZ  1 
ATOM   1770  N N   . PRO A 1 283 ? -46.813 -5.045  6.113   1.00 141.01 ? 294  PRO A N   1 
ATOM   1771  C CA  . PRO A 1 283 ? -47.478 -6.347  6.232   1.00 141.01 ? 294  PRO A CA  1 
ATOM   1772  C C   . PRO A 1 283 ? -48.109 -6.628  7.596   1.00 141.01 ? 294  PRO A C   1 
ATOM   1773  O O   . PRO A 1 283 ? -48.667 -7.701  7.816   1.00 141.01 ? 294  PRO A O   1 
ATOM   1774  C CB  . PRO A 1 283 ? -46.362 -7.325  5.892   1.00 141.99 ? 294  PRO A CB  1 
ATOM   1775  C CG  . PRO A 1 283 ? -45.623 -6.587  4.822   1.00 141.99 ? 294  PRO A CG  1 
ATOM   1776  C CD  . PRO A 1 283 ? -45.533 -5.182  5.393   1.00 141.99 ? 294  PRO A CD  1 
ATOM   1777  N N   . TRP A 1 284 ? -48.023 -5.659  8.502   1.00 78.92  ? 295  TRP A N   1 
ATOM   1778  C CA  . TRP A 1 284 ? -48.583 -5.799  9.839   1.00 78.92  ? 295  TRP A CA  1 
ATOM   1779  C C   . TRP A 1 284 ? -49.476 -4.609  10.229  1.00 78.92  ? 295  TRP A C   1 
ATOM   1780  O O   . TRP A 1 284 ? -49.859 -4.472  11.398  1.00 78.92  ? 295  TRP A O   1 
ATOM   1781  C CB  . TRP A 1 284 ? -47.446 -5.967  10.859  1.00 61.51  ? 295  TRP A CB  1 
ATOM   1782  C CG  . TRP A 1 284 ? -46.642 -4.716  11.091  1.00 61.51  ? 295  TRP A CG  1 
ATOM   1783  C CD1 . TRP A 1 284 ? -46.996 -3.655  11.858  1.00 61.51  ? 295  TRP A CD1 1 
ATOM   1784  C CD2 . TRP A 1 284 ? -45.355 -4.400  10.541  1.00 61.51  ? 295  TRP A CD2 1 
ATOM   1785  N NE1 . TRP A 1 284 ? -46.016 -2.697  11.826  1.00 61.51  ? 295  TRP A NE1 1 
ATOM   1786  C CE2 . TRP A 1 284 ? -44.996 -3.130  11.025  1.00 61.51  ? 295  TRP A CE2 1 
ATOM   1787  C CE3 . TRP A 1 284 ? -44.471 -5.070  9.687   1.00 61.51  ? 295  TRP A CE3 1 
ATOM   1788  C CZ2 . TRP A 1 284 ? -43.791 -2.512  10.689  1.00 61.51  ? 295  TRP A CZ2 1 
ATOM   1789  C CZ3 . TRP A 1 284 ? -43.273 -4.455  9.355   1.00 61.51  ? 295  TRP A CZ3 1 
ATOM   1790  C CH2 . TRP A 1 284 ? -42.946 -3.187  9.857   1.00 61.51  ? 295  TRP A CH2 1 
ATOM   1791  N N   . GLY A 1 285 ? -49.800 -3.752  9.258   1.00 68.44  ? 296  GLY A N   1 
ATOM   1792  C CA  . GLY A 1 285 ? -50.651 -2.604  9.537   1.00 68.44  ? 296  GLY A CA  1 
ATOM   1793  C C   . GLY A 1 285 ? -50.045 -1.214  9.375   1.00 68.44  ? 296  GLY A C   1 
ATOM   1794  O O   . GLY A 1 285 ? -48.893 -0.969  9.732   1.00 68.44  ? 296  GLY A O   1 
ATOM   1795  N N   . LYS A 1 286 ? -50.856 -0.297  8.850   1.00 67.14  ? 297  LYS A N   1 
ATOM   1796  C CA  . LYS A 1 286 ? -50.476 1.094   8.605   1.00 67.14  ? 297  LYS A CA  1 
ATOM   1797  C C   . LYS A 1 286 ? -49.516 1.712   9.618   1.00 67.14  ? 297  LYS A C   1 
ATOM   1798  O O   . LYS A 1 286 ? -49.638 1.516   10.824  1.00 67.14  ? 297  LYS A O   1 
ATOM   1799  C CB  . LYS A 1 286 ? -51.729 1.965   8.508   1.00 100.48 ? 297  LYS A CB  1 
ATOM   1800  C CG  . LYS A 1 286 ? -52.650 1.575   7.373   1.00 100.48 ? 297  LYS A CG  1 
ATOM   1801  C CD  . LYS A 1 286 ? -53.990 2.287   7.472   1.00 100.48 ? 297  LYS A CD  1 
ATOM   1802  C CE  . LYS A 1 286 ? -54.956 1.779   6.404   1.00 100.48 ? 297  LYS A CE  1 
ATOM   1803  N NZ  . LYS A 1 286 ? -56.322 2.362   6.532   1.00 100.48 ? 297  LYS A NZ  1 
ATOM   1804  N N   . GLU A 1 287 ? -48.559 2.470   9.088   1.00 69.00  ? 298  GLU A N   1 
ATOM   1805  C CA  . GLU A 1 287 ? -47.545 3.158   9.871   1.00 69.00  ? 298  GLU A CA  1 
ATOM   1806  C C   . GLU A 1 287 ? -47.312 4.514   9.200   1.00 69.00  ? 298  GLU A C   1 
ATOM   1807  O O   . GLU A 1 287 ? -47.239 4.612   7.975   1.00 69.00  ? 298  GLU A O   1 
ATOM   1808  C CB  . GLU A 1 287 ? -46.253 2.343   9.878   1.00 53.11  ? 298  GLU A CB  1 
ATOM   1809  C CG  . GLU A 1 287 ? -45.419 2.545   11.115  1.00 53.11  ? 298  GLU A CG  1 
ATOM   1810  C CD  . GLU A 1 287 ? -45.990 1.816   12.304  1.00 53.11  ? 298  GLU A CD  1 
ATOM   1811  O OE1 . GLU A 1 287 ? -45.828 2.297   13.449  1.00 53.11  ? 298  GLU A OE1 1 
ATOM   1812  O OE2 . GLU A 1 287 ? -46.595 0.752   12.077  1.00 53.11  ? 298  GLU A OE2 1 
ATOM   1813  N N   . LEU A 1 288 ? -47.197 5.554   10.011  1.00 60.70  ? 299  LEU A N   1 
ATOM   1814  C CA  . LEU A 1 288 ? -47.012 6.914   9.520   1.00 60.70  ? 299  LEU A CA  1 
ATOM   1815  C C   . LEU A 1 288 ? -45.690 7.133   8.782   1.00 60.70  ? 299  LEU A C   1 
ATOM   1816  O O   . LEU A 1 288 ? -44.667 6.582   9.187   1.00 60.70  ? 299  LEU A O   1 
ATOM   1817  C CB  . LEU A 1 288 ? -47.068 7.864   10.708  1.00 36.94  ? 299  LEU A CB  1 
ATOM   1818  C CG  . LEU A 1 288 ? -47.891 9.150   10.647  1.00 36.94  ? 299  LEU A CG  1 
ATOM   1819  C CD1 . LEU A 1 288 ? -47.208 10.233  11.498  1.00 36.94  ? 299  LEU A CD1 1 
ATOM   1820  C CD2 . LEU A 1 288 ? -48.013 9.614   9.205   1.00 36.94  ? 299  LEU A CD2 1 
ATOM   1821  N N   . ILE A 1 289 ? -45.701 7.929   7.707   1.00 61.50  ? 300  ILE A N   1 
ATOM   1822  C CA  . ILE A 1 289 ? -44.468 8.234   6.974   1.00 61.50  ? 300  ILE A CA  1 
ATOM   1823  C C   . ILE A 1 289 ? -44.338 9.713   6.663   1.00 61.50  ? 300  ILE A C   1 
ATOM   1824  O O   . ILE A 1 289 ? -43.230 10.231  6.580   1.00 61.50  ? 300  ILE A O   1 
ATOM   1825  C CB  . ILE A 1 289 ? -44.321 7.461   5.634   1.00 28.32  ? 300  ILE A CB  1 
ATOM   1826  C CG1 . ILE A 1 289 ? -45.507 7.757   4.706   1.00 28.32  ? 300  ILE A CG1 1 
ATOM   1827  C CG2 . ILE A 1 289 ? -44.136 5.994   5.905   1.00 28.32  ? 300  ILE A CG2 1 
ATOM   1828  C CD1 . ILE A 1 289 ? -45.415 7.070   3.334   1.00 28.32  ? 300  ILE A CD1 1 
ATOM   1829  N N   . GLU A 1 290 ? -45.457 10.400  6.474   1.00 47.12  ? 301  GLU A N   1 
ATOM   1830  C CA  . GLU A 1 290 ? -45.401 11.833  6.192   1.00 47.12  ? 301  GLU A CA  1 
ATOM   1831  C C   . GLU A 1 290 ? -46.608 12.567  6.762   1.00 47.12  ? 301  GLU A C   1 
ATOM   1832  O O   . GLU A 1 290 ? -47.732 12.094  6.671   1.00 47.12  ? 301  GLU A O   1 
ATOM   1833  C CB  . GLU A 1 290 ? -45.288 12.076  4.684   1.00 87.69  ? 301  GLU A CB  1 
ATOM   1834  C CG  . GLU A 1 290 ? -45.080 13.538  4.296   1.00 87.69  ? 301  GLU A CG  1 
ATOM   1835  C CD  . GLU A 1 290 ? -44.491 13.701  2.903   1.00 87.69  ? 301  GLU A CD  1 
ATOM   1836  O OE1 . GLU A 1 290 ? -44.954 13.002  1.978   1.00 87.69  ? 301  GLU A OE1 1 
ATOM   1837  O OE2 . GLU A 1 290 ? -43.571 14.532  2.732   1.00 87.69  ? 301  GLU A OE2 1 
ATOM   1838  N N   . THR A 1 291 ? -46.367 13.728  7.352   1.00 31.76  ? 302  THR A N   1 
ATOM   1839  C CA  . THR A 1 291 ? -47.431 14.510  7.958   1.00 31.76  ? 302  THR A CA  1 
ATOM   1840  C C   . THR A 1 291 ? -47.532 15.910  7.370   1.00 31.76  ? 302  THR A C   1 
ATOM   1841  O O   . THR A 1 291 ? -46.517 16.497  7.029   1.00 31.76  ? 302  THR A O   1 
ATOM   1842  C CB  . THR A 1 291 ? -47.182 14.649  9.477   1.00 44.32  ? 302  THR A CB  1 
ATOM   1843  O OG1 . THR A 1 291 ? -46.082 15.540  9.715   1.00 44.32  ? 302  THR A OG1 1 
ATOM   1844  C CG2 . THR A 1 291 ? -46.835 13.300  10.066  1.00 44.32  ? 302  THR A CG2 1 
ATOM   1845  N N   . LEU A 1 292 ? -48.749 16.448  7.255   1.00 60.25  ? 303  LEU A N   1 
ATOM   1846  C CA  . LEU A 1 292 ? -48.950 17.815  6.751   1.00 60.25  ? 303  LEU A CA  1 
ATOM   1847  C C   . LEU A 1 292 ? -49.712 18.632  7.797   1.00 60.25  ? 303  LEU A C   1 
ATOM   1848  O O   . LEU A 1 292 ? -50.464 18.074  8.580   1.00 60.25  ? 303  LEU A O   1 
ATOM   1849  C CB  . LEU A 1 292 ? -49.709 17.804  5.428   1.00 54.62  ? 303  LEU A CB  1 
ATOM   1850  C CG  . LEU A 1 292 ? -48.919 17.118  4.311   1.00 54.62  ? 303  LEU A CG  1 
ATOM   1851  C CD1 . LEU A 1 292 ? -49.301 15.640  4.247   1.00 54.62  ? 303  LEU A CD1 1 
ATOM   1852  C CD2 . LEU A 1 292 ? -49.198 17.801  2.979   1.00 54.62  ? 303  LEU A CD2 1 
ATOM   1853  N N   . TRP A 1 293 ? -49.507 19.945  7.827   1.00 40.25  ? 304  TRP A N   1 
ATOM   1854  C CA  . TRP A 1 293 ? -50.169 20.796  8.815   1.00 40.25  ? 304  TRP A CA  1 
ATOM   1855  C C   . TRP A 1 293 ? -50.229 22.244  8.391   1.00 40.25  ? 304  TRP A C   1 
ATOM   1856  O O   . TRP A 1 293 ? -49.284 22.761  7.803   1.00 40.25  ? 304  TRP A O   1 
ATOM   1857  C CB  . TRP A 1 293 ? -49.418 20.779  10.149  1.00 48.69  ? 304  TRP A CB  1 
ATOM   1858  C CG  . TRP A 1 293 ? -49.645 19.598  10.988  1.00 48.69  ? 304  TRP A CG  1 
ATOM   1859  C CD1 . TRP A 1 293 ? -48.730 18.650  11.337  1.00 48.69  ? 304  TRP A CD1 1 
ATOM   1860  C CD2 . TRP A 1 293 ? -50.868 19.223  11.606  1.00 48.69  ? 304  TRP A CD2 1 
ATOM   1861  N NE1 . TRP A 1 293 ? -49.308 17.698  12.137  1.00 48.69  ? 304  TRP A NE1 1 
ATOM   1862  C CE2 . TRP A 1 293 ? -50.625 18.025  12.320  1.00 48.69  ? 304  TRP A CE2 1 
ATOM   1863  C CE3 . TRP A 1 293 ? -52.152 19.781  11.629  1.00 48.69  ? 304  TRP A CE3 1 
ATOM   1864  C CZ2 . TRP A 1 293 ? -51.619 17.374  13.049  1.00 48.69  ? 304  TRP A CZ2 1 
ATOM   1865  C CZ3 . TRP A 1 293 ? -53.144 19.137  12.354  1.00 48.69  ? 304  TRP A CZ3 1 
ATOM   1866  C CH2 . TRP A 1 293 ? -52.869 17.943  13.055  1.00 48.69  ? 304  TRP A CH2 1 
ATOM   1867  N N   . ASN A 1 294 ? -51.332 22.907  8.732   1.00 80.13  ? 305  ASN A N   1 
ATOM   1868  C CA  . ASN A 1 294 ? -51.487 24.333  8.451   1.00 80.13  ? 305  ASN A CA  1 
ATOM   1869  C C   . ASN A 1 294 ? -51.441 25.030  9.808   1.00 80.13  ? 305  ASN A C   1 
ATOM   1870  O O   . ASN A 1 294 ? -52.465 25.240  10.441  1.00 80.13  ? 305  ASN A O   1 
ATOM   1871  C CB  . ASN A 1 294 ? -52.823 24.634  7.779   1.00 61.57  ? 305  ASN A CB  1 
ATOM   1872  C CG  . ASN A 1 294 ? -52.891 26.053  7.249   1.00 61.57  ? 305  ASN A CG  1 
ATOM   1873  O OD1 . ASN A 1 294 ? -52.502 27.007  7.928   1.00 61.57  ? 305  ASN A OD1 1 
ATOM   1874  N ND2 . ASN A 1 294 ? -53.384 26.198  6.033   1.00 61.57  ? 305  ASN A ND2 1 
ATOM   1875  N N   . LEU A 1 295 ? -50.246 25.383  10.251  1.00 61.34  ? 306  LEU A N   1 
ATOM   1876  C CA  . LEU A 1 295 ? -50.075 26.017  11.548  1.00 61.34  ? 306  LEU A CA  1 
ATOM   1877  C C   . LEU A 1 295 ? -50.678 27.409  11.639  1.00 61.34  ? 306  LEU A C   1 
ATOM   1878  O O   . LEU A 1 295 ? -50.998 27.868  12.731  1.00 61.34  ? 306  LEU A O   1 
ATOM   1879  C CB  . LEU A 1 295 ? -48.584 26.108  11.898  1.00 35.08  ? 306  LEU A CB  1 
ATOM   1880  C CG  . LEU A 1 295 ? -47.696 24.884  11.661  1.00 35.08  ? 306  LEU A CG  1 
ATOM   1881  C CD1 . LEU A 1 295 ? -46.218 25.289  11.803  1.00 35.08  ? 306  LEU A CD1 1 
ATOM   1882  C CD2 . LEU A 1 295 ? -48.080 23.779  12.628  1.00 35.08  ? 306  LEU A CD2 1 
ATOM   1883  N N   . GLY A 1 296 ? -50.833 28.081  10.504  1.00 69.15  ? 307  GLY A N   1 
ATOM   1884  C CA  . GLY A 1 296 ? -51.356 29.434  10.532  1.00 69.15  ? 307  GLY A CA  1 
ATOM   1885  C C   . GLY A 1 296 ? -50.225 30.425  10.803  1.00 69.15  ? 307  GLY A C   1 
ATOM   1886  O O   . GLY A 1 296 ? -49.054 30.132  10.560  1.00 69.15  ? 307  GLY A O   1 
ATOM   1887  N N   . ASP A 1 297 ? -50.559 31.605  11.312  1.00 79.65  ? 308  ASP A N   1 
ATOM   1888  C CA  . ASP A 1 297 ? -49.541 32.607  11.593  1.00 79.65  ? 308  ASP A CA  1 
ATOM   1889  C C   . ASP A 1 297 ? -48.953 32.445  12.986  1.00 79.65  ? 308  ASP A C   1 
ATOM   1890  O O   . ASP A 1 297 ? -47.970 33.094  13.334  1.00 79.65  ? 308  ASP A O   1 
ATOM   1891  C CB  . ASP A 1 297 ? -50.127 34.014  11.424  1.00 137.99 ? 308  ASP A CB  1 
ATOM   1892  C CG  . ASP A 1 297 ? -51.457 34.189  12.135  1.00 137.99 ? 308  ASP A CG  1 
ATOM   1893  O OD1 . ASP A 1 297 ? -52.067 35.268  11.980  1.00 137.99 ? 308  ASP A OD1 1 
ATOM   1894  O OD2 . ASP A 1 297 ? -51.893 33.255  12.843  1.00 137.99 ? 308  ASP A OD2 1 
ATOM   1895  N N   . HIS A 1 298 ? -49.541 31.549  13.768  1.00 103.33 ? 309  HIS A N   1 
ATOM   1896  C CA  . HIS A 1 298 ? -49.105 31.306  15.138  1.00 103.33 ? 309  HIS A CA  1 
ATOM   1897  C C   . HIS A 1 298 ? -47.601 31.390  15.433  1.00 103.33 ? 309  HIS A C   1 
ATOM   1898  O O   . HIS A 1 298 ? -47.113 32.444  15.835  1.00 103.33 ? 309  HIS A O   1 
ATOM   1899  C CB  . HIS A 1 298 ? -49.671 29.967  15.618  1.00 164.01 ? 309  HIS A CB  1 
ATOM   1900  C CG  . HIS A 1 298 ? -51.165 29.958  15.728  1.00 164.01 ? 309  HIS A CG  1 
ATOM   1901  N ND1 . HIS A 1 298 ? -51.884 28.829  16.057  1.00 164.01 ? 309  HIS A ND1 1 
ATOM   1902  C CD2 . HIS A 1 298 ? -52.076 30.945  15.549  1.00 164.01 ? 309  HIS A CD2 1 
ATOM   1903  C CE1 . HIS A 1 298 ? -53.173 29.121  16.075  1.00 164.01 ? 309  HIS A CE1 1 
ATOM   1904  N NE2 . HIS A 1 298 ? -53.316 30.398  15.770  1.00 164.01 ? 309  HIS A NE2 1 
ATOM   1905  N N   . GLU A 1 299 ? -46.865 30.300  15.232  1.00 81.93  ? 310  GLU A N   1 
ATOM   1906  C CA  . GLU A 1 299 ? -45.434 30.302  15.531  1.00 81.93  ? 310  GLU A CA  1 
ATOM   1907  C C   . GLU A 1 299 ? -44.643 31.388  14.839  1.00 81.93  ? 310  GLU A C   1 
ATOM   1908  O O   . GLU A 1 299 ? -43.576 31.784  15.316  1.00 81.93  ? 310  GLU A O   1 
ATOM   1909  C CB  . GLU A 1 299 ? -44.803 28.957  15.196  1.00 69.20  ? 310  GLU A CB  1 
ATOM   1910  C CG  . GLU A 1 299 ? -45.466 27.800  15.877  1.00 69.20  ? 310  GLU A CG  1 
ATOM   1911  C CD  . GLU A 1 299 ? -46.366 27.055  14.938  1.00 69.20  ? 310  GLU A CD  1 
ATOM   1912  O OE1 . GLU A 1 299 ? -47.170 27.705  14.231  1.00 69.20  ? 310  GLU A OE1 1 
ATOM   1913  O OE2 . GLU A 1 299 ? -46.262 25.815  14.907  1.00 69.20  ? 310  GLU A OE2 1 
ATOM   1914  N N   . LEU A 1 300 ? -45.146 31.879  13.714  1.00 45.34  ? 311  LEU A N   1 
ATOM   1915  C CA  . LEU A 1 300 ? -44.413 32.914  13.021  1.00 45.34  ? 311  LEU A CA  1 
ATOM   1916  C C   . LEU A 1 300 ? -44.370 34.135  13.912  1.00 45.34  ? 311  LEU A C   1 
ATOM   1917  O O   . LEU A 1 300 ? -43.310 34.717  14.146  1.00 45.34  ? 311  LEU A O   1 
ATOM   1918  C CB  . LEU A 1 300 ? -45.064 33.239  11.685  1.00 41.75  ? 311  LEU A CB  1 
ATOM   1919  C CG  . LEU A 1 300 ? -44.083 33.825  10.669  1.00 41.75  ? 311  LEU A CG  1 
ATOM   1920  C CD1 . LEU A 1 300 ? -42.714 33.186  10.853  1.00 41.75  ? 311  LEU A CD1 1 
ATOM   1921  C CD2 . LEU A 1 300 ? -44.582 33.573  9.251   1.00 41.75  ? 311  LEU A CD2 1 
ATOM   1922  N N   . LEU A 1 301 ? -45.531 34.501  14.440  1.00 65.80  ? 312  LEU A N   1 
ATOM   1923  C CA  . LEU A 1 301 ? -45.634 35.659  15.315  1.00 65.80  ? 312  LEU A CA  1 
ATOM   1924  C C   . LEU A 1 301 ? -44.900 35.430  16.634  1.00 65.80  ? 312  LEU A C   1 
ATOM   1925  O O   . LEU A 1 301 ? -44.141 36.287  17.077  1.00 65.80  ? 312  LEU A O   1 
ATOM   1926  C CB  . LEU A 1 301 ? -47.111 35.995  15.575  1.00 42.48  ? 312  LEU A CB  1 
ATOM   1927  C CG  . LEU A 1 301 ? -47.926 36.379  14.329  1.00 42.48  ? 312  LEU A CG  1 
ATOM   1928  C CD1 . LEU A 1 301 ? -49.374 36.635  14.694  1.00 42.48  ? 312  LEU A CD1 1 
ATOM   1929  C CD2 . LEU A 1 301 ? -47.317 37.608  13.676  1.00 42.48  ? 312  LEU A CD2 1 
ATOM   1930  N N   . HIS A 1 302 ? -45.120 34.270  17.246  1.00 61.07  ? 313  HIS A N   1 
ATOM   1931  C CA  . HIS A 1 302 ? -44.493 33.927  18.513  1.00 61.07  ? 313  HIS A CA  1 
ATOM   1932  C C   . HIS A 1 302 ? -42.980 33.891  18.397  1.00 61.07  ? 313  HIS A C   1 
ATOM   1933  O O   . HIS A 1 302 ? -42.275 34.159  19.373  1.00 61.07  ? 313  HIS A O   1 
ATOM   1934  C CB  . HIS A 1 302 ? -45.006 32.579  19.006  1.00 73.72  ? 313  HIS A CB  1 
ATOM   1935  C CG  . HIS A 1 302 ? -44.400 32.134  20.299  1.00 73.72  ? 313  HIS A CG  1 
ATOM   1936  N ND1 . HIS A 1 302 ? -45.157 31.655  21.346  1.00 73.72  ? 313  HIS A ND1 1 
ATOM   1937  C CD2 . HIS A 1 302 ? -43.111 32.066  20.706  1.00 73.72  ? 313  HIS A CD2 1 
ATOM   1938  C CE1 . HIS A 1 302 ? -44.359 31.311  22.342  1.00 73.72  ? 313  HIS A CE1 1 
ATOM   1939  N NE2 . HIS A 1 302 ? -43.112 31.550  21.979  1.00 73.72  ? 313  HIS A NE2 1 
ATOM   1940  N N   . MET A 1 303 ? -42.463 33.557  17.220  1.00 43.27  ? 314  MET A N   1 
ATOM   1941  C CA  . MET A 1 303 ? -41.018 33.529  17.074  1.00 43.27  ? 314  MET A CA  1 
ATOM   1942  C C   . MET A 1 303 ? -40.511 34.925  16.795  1.00 43.27  ? 314  MET A C   1 
ATOM   1943  O O   . MET A 1 303 ? -39.456 35.318  17.285  1.00 43.27  ? 314  MET A O   1 
ATOM   1944  C CB  . MET A 1 303 ? -40.585 32.621  15.931  1.00 92.98  ? 314  MET A CB  1 
ATOM   1945  C CG  . MET A 1 303 ? -39.091 32.727  15.636  1.00 92.98  ? 314  MET A CG  1 
ATOM   1946  S SD  . MET A 1 303 ? -38.559 31.629  14.322  1.00 92.98  ? 314  MET A SD  1 
ATOM   1947  C CE  . MET A 1 303 ? -39.121 30.065  14.997  1.00 92.98  ? 314  MET A CE  1 
ATOM   1948  N N   . TYR A 1 304 ? -41.283 35.661  15.996  1.00 65.24  ? 315  TYR A N   1 
ATOM   1949  C CA  . TYR A 1 304 ? -40.941 37.021  15.588  1.00 65.24  ? 315  TYR A CA  1 
ATOM   1950  C C   . TYR A 1 304 ? -41.781 38.097  16.264  1.00 65.24  ? 315  TYR A C   1 
ATOM   1951  O O   . TYR A 1 304 ? -42.627 38.736  15.639  1.00 65.24  ? 315  TYR A O   1 
ATOM   1952  C CB  . TYR A 1 304 ? -41.067 37.146  14.065  1.00 52.48  ? 315  TYR A CB  1 
ATOM   1953  C CG  . TYR A 1 304 ? -40.063 36.324  13.291  1.00 52.48  ? 315  TYR A CG  1 
ATOM   1954  C CD1 . TYR A 1 304 ? -38.712 36.653  13.311  1.00 52.48  ? 315  TYR A CD1 1 
ATOM   1955  C CD2 . TYR A 1 304 ? -40.464 35.221  12.536  1.00 52.48  ? 315  TYR A CD2 1 
ATOM   1956  C CE1 . TYR A 1 304 ? -37.777 35.907  12.595  1.00 52.48  ? 315  TYR A CE1 1 
ATOM   1957  C CE2 . TYR A 1 304 ? -39.538 34.468  11.814  1.00 52.48  ? 315  TYR A CE2 1 
ATOM   1958  C CZ  . TYR A 1 304 ? -38.193 34.821  11.849  1.00 52.48  ? 315  TYR A CZ  1 
ATOM   1959  O OH  . TYR A 1 304 ? -37.255 34.118  11.132  1.00 52.48  ? 315  TYR A OH  1 
ATOM   1960  N N   . PRO A 1 305 ? -41.554 38.311  17.562  1.00 71.91  ? 316  PRO A N   1 
ATOM   1961  C CA  . PRO A 1 305 ? -42.327 39.336  18.251  1.00 71.91  ? 316  PRO A CA  1 
ATOM   1962  C C   . PRO A 1 305 ? -41.904 40.687  17.693  1.00 71.91  ? 316  PRO A C   1 
ATOM   1963  O O   . PRO A 1 305 ? -40.979 40.777  16.878  1.00 71.91  ? 316  PRO A O   1 
ATOM   1964  C CB  . PRO A 1 305 ? -41.908 39.154  19.705  1.00 73.92  ? 316  PRO A CB  1 
ATOM   1965  C CG  . PRO A 1 305 ? -40.479 38.749  19.577  1.00 73.92  ? 316  PRO A CG  1 
ATOM   1966  C CD  . PRO A 1 305 ? -40.539 37.730  18.458  1.00 73.92  ? 316  PRO A CD  1 
ATOM   1967  N N   . GLY A 1 306 ? -42.576 41.734  18.143  1.00 111.56 ? 317  GLY A N   1 
ATOM   1968  C CA  . GLY A 1 306 ? -42.243 43.061  17.675  1.00 111.56 ? 317  GLY A CA  1 
ATOM   1969  C C   . GLY A 1 306 ? -43.012 43.432  16.427  1.00 111.56 ? 317  GLY A C   1 
ATOM   1970  O O   . GLY A 1 306 ? -44.116 42.943  16.193  1.00 111.56 ? 317  GLY A O   1 
ATOM   1971  N N   . ASN A 1 307 ? -42.416 44.299  15.622  1.00 135.35 ? 318  ASN A N   1 
ATOM   1972  C CA  . ASN A 1 307 ? -43.038 44.758  14.393  1.00 135.35 ? 318  ASN A CA  1 
ATOM   1973  C C   . ASN A 1 307 ? -43.559 43.603  13.540  1.00 135.35 ? 318  ASN A C   1 
ATOM   1974  O O   . ASN A 1 307 ? -42.788 42.767  13.059  1.00 135.35 ? 318  ASN A O   1 
ATOM   1975  C CB  . ASN A 1 307 ? -42.036 45.575  13.586  1.00 98.81  ? 318  ASN A CB  1 
ATOM   1976  C CG  . ASN A 1 307 ? -42.697 46.404  12.527  1.00 98.81  ? 318  ASN A CG  1 
ATOM   1977  O OD1 . ASN A 1 307 ? -42.041 46.885  11.608  1.00 98.81  ? 318  ASN A OD1 1 
ATOM   1978  N ND2 . ASN A 1 307 ? -44.008 46.588  12.651  1.00 98.81  ? 318  ASN A ND2 1 
ATOM   1979  N N   . VAL A 1 308 ? -44.874 43.561  13.360  1.00 96.37  ? 319  VAL A N   1 
ATOM   1980  C CA  . VAL A 1 308 ? -45.494 42.519  12.556  1.00 96.37  ? 319  VAL A CA  1 
ATOM   1981  C C   . VAL A 1 308 ? -45.234 42.902  11.117  1.00 96.37  ? 319  VAL A C   1 
ATOM   1982  O O   . VAL A 1 308 ? -45.144 42.048  10.240  1.00 96.37  ? 319  VAL A O   1 
ATOM   1983  C CB  . VAL A 1 308 ? -47.019 42.443  12.794  1.00 158.49 ? 319  VAL A CB  1 
ATOM   1984  C CG1 . VAL A 1 308 ? -47.688 43.736  12.349  1.00 158.49 ? 319  VAL A CG1 1 
ATOM   1985  C CG2 . VAL A 1 308 ? -47.601 41.254  12.052  1.00 158.49 ? 319  VAL A CG2 1 
ATOM   1986  N N   . SER A 1 309 ? -45.101 44.207  10.897  1.00 64.25  ? 320  SER A N   1 
ATOM   1987  C CA  . SER A 1 309 ? -44.836 44.761  9.569   1.00 64.25  ? 320  SER A CA  1 
ATOM   1988  C C   . SER A 1 309 ? -43.413 44.449  9.123   1.00 64.25  ? 320  SER A C   1 
ATOM   1989  O O   . SER A 1 309 ? -42.941 44.994  8.132   1.00 64.25  ? 320  SER A O   1 
ATOM   1990  C CB  . SER A 1 309 ? -45.040 46.283  9.575   1.00 191.99 ? 320  SER A CB  1 
ATOM   1991  O OG  . SER A 1 309 ? -46.372 46.641  9.906   1.00 191.99 ? 320  SER A OG  1 
ATOM   1992  N N   . LYS A 1 310 ? -42.743 43.578  9.876   1.00 63.38  ? 321  LYS A N   1 
ATOM   1993  C CA  . LYS A 1 310 ? -41.366 43.162  9.602   1.00 63.38  ? 321  LYS A CA  1 
ATOM   1994  C C   . LYS A 1 310 ? -41.462 41.802  8.956   1.00 63.38  ? 321  LYS A C   1 
ATOM   1995  O O   . LYS A 1 310 ? -40.530 41.323  8.309   1.00 63.38  ? 321  LYS A O   1 
ATOM   1996  C CB  . LYS A 1 310 ? -40.574 43.057  10.914  1.00 108.68 ? 321  LYS A CB  1 
ATOM   1997  C CG  . LYS A 1 310 ? -39.124 42.614  10.752  1.00 108.68 ? 321  LYS A CG  1 
ATOM   1998  C CD  . LYS A 1 310 ? -38.482 42.302  12.099  1.00 108.68 ? 321  LYS A CD  1 
ATOM   1999  C CE  . LYS A 1 310 ? -37.111 41.661  11.913  1.00 108.68 ? 321  LYS A CE  1 
ATOM   2000  N NZ  . LYS A 1 310 ? -36.546 41.125  13.185  1.00 108.68 ? 321  LYS A NZ  1 
ATOM   2001  N N   . LEU A 1 311 ? -42.617 41.186  9.161   1.00 90.05  ? 322  LEU A N   1 
ATOM   2002  C CA  . LEU A 1 311 ? -42.908 39.879  8.617   1.00 90.05  ? 322  LEU A CA  1 
ATOM   2003  C C   . LEU A 1 311 ? -43.606 40.061  7.277   1.00 90.05  ? 322  LEU A C   1 
ATOM   2004  O O   . LEU A 1 311 ? -43.062 40.676  6.360   1.00 90.05  ? 322  LEU A O   1 
ATOM   2005  C CB  . LEU A 1 311 ? -43.809 39.106  9.585   1.00 55.95  ? 322  LEU A CB  1 
ATOM   2006  C CG  . LEU A 1 311 ? -43.190 38.794  10.953  1.00 55.95  ? 322  LEU A CG  1 
ATOM   2007  C CD1 . LEU A 1 311 ? -44.248 38.233  11.900  1.00 55.95  ? 322  LEU A CD1 1 
ATOM   2008  C CD2 . LEU A 1 311 ? -42.032 37.815  10.768  1.00 55.95  ? 322  LEU A CD2 1 
ATOM   2009  N N   . HIS A 1 312 ? -44.820 39.534  7.192   1.00 65.26  ? 323  HIS A N   1 
ATOM   2010  C CA  . HIS A 1 312 ? -45.660 39.586  5.994   1.00 65.26  ? 323  HIS A CA  1 
ATOM   2011  C C   . HIS A 1 312 ? -45.107 40.072  4.655   1.00 65.26  ? 323  HIS A C   1 
ATOM   2012  O O   . HIS A 1 312 ? -44.509 41.145  4.535   1.00 65.26  ? 323  HIS A O   1 
ATOM   2013  C CB  . HIS A 1 312 ? -46.978 40.333  6.297   1.00 80.81  ? 323  HIS A CB  1 
ATOM   2014  C CG  . HIS A 1 312 ? -46.826 41.787  6.630   1.00 80.81  ? 323  HIS A CG  1 
ATOM   2015  N ND1 . HIS A 1 312 ? -47.820 42.499  7.269   1.00 80.81  ? 323  HIS A ND1 1 
ATOM   2016  C CD2 . HIS A 1 312 ? -45.820 42.663  6.403   1.00 80.81  ? 323  HIS A CD2 1 
ATOM   2017  C CE1 . HIS A 1 312 ? -47.430 43.750  7.424   1.00 80.81  ? 323  HIS A CE1 1 
ATOM   2018  N NE2 . HIS A 1 312 ? -46.221 43.876  6.907   1.00 80.81  ? 323  HIS A NE2 1 
ATOM   2019  N N   . GLY A 1 313 ? -45.337 39.243  3.645   1.00 99.82  ? 324  GLY A N   1 
ATOM   2020  C CA  . GLY A 1 313 ? -44.908 39.558  2.302   1.00 99.82  ? 324  GLY A CA  1 
ATOM   2021  C C   . GLY A 1 313 ? -46.074 40.218  1.606   1.00 99.82  ? 324  GLY A C   1 
ATOM   2022  O O   . GLY A 1 313 ? -46.665 41.153  2.141   1.00 99.82  ? 324  GLY A O   1 
ATOM   2023  N N   . ARG A 1 314 ? -46.429 39.730  0.427   1.00 87.47  ? 325  ARG A N   1 
ATOM   2024  C CA  . ARG A 1 314 ? -47.540 40.327  -0.295  1.00 87.47  ? 325  ARG A CA  1 
ATOM   2025  C C   . ARG A 1 314 ? -48.428 39.289  -0.969  1.00 87.47  ? 325  ARG A C   1 
ATOM   2026  O O   . ARG A 1 314 ? -47.942 38.322  -1.552  1.00 87.47  ? 325  ARG A O   1 
ATOM   2027  C CB  . ARG A 1 314 ? -47.012 41.302  -1.351  1.00 158.69 ? 325  ARG A CB  1 
ATOM   2028  C CG  . ARG A 1 314 ? -46.029 42.327  -0.817  1.00 158.69 ? 325  ARG A CG  1 
ATOM   2029  C CD  . ARG A 1 314 ? -45.423 43.151  -1.943  1.00 158.69 ? 325  ARG A CD  1 
ATOM   2030  N NE  . ARG A 1 314 ? -44.323 43.999  -1.481  1.00 158.69 ? 325  ARG A NE  1 
ATOM   2031  C CZ  . ARG A 1 314 ? -44.459 45.033  -0.654  1.00 158.69 ? 325  ARG A CZ  1 
ATOM   2032  N NH1 . ARG A 1 314 ? -45.656 45.358  -0.188  1.00 158.69 ? 325  ARG A NH1 1 
ATOM   2033  N NH2 . ARG A 1 314 ? -43.397 45.741  -0.289  1.00 158.69 ? 325  ARG A NH2 1 
ATOM   2034  N N   . ASP A 1 315 ? -49.736 39.495  -0.877  1.00 70.87  ? 326  ASP A N   1 
ATOM   2035  C CA  . ASP A 1 315 ? -50.695 38.605  -1.512  1.00 70.87  ? 326  ASP A CA  1 
ATOM   2036  C C   . ASP A 1 315 ? -50.974 39.225  -2.881  1.00 70.87  ? 326  ASP A C   1 
ATOM   2037  O O   . ASP A 1 315 ? -51.114 38.534  -3.899  1.00 70.87  ? 326  ASP A O   1 
ATOM   2038  C CB  . ASP A 1 315 ? -51.988 38.557  -0.705  1.00 88.20  ? 326  ASP A CB  1 
ATOM   2039  C CG  . ASP A 1 315 ? -52.930 37.481  -1.191  1.00 88.20  ? 326  ASP A CG  1 
ATOM   2040  O OD1 . ASP A 1 315 ? -53.168 37.390  -2.416  1.00 88.20  ? 326  ASP A OD1 1 
ATOM   2041  O OD2 . ASP A 1 315 ? -53.435 36.723  -0.341  1.00 88.20  ? 326  ASP A OD2 1 
ATOM   2042  N N   . GLY A 1 316 ? -51.050 40.554  -2.873  1.00 86.20  ? 327  GLY A N   1 
ATOM   2043  C CA  . GLY A 1 316 ? -51.292 41.328  -4.072  1.00 86.20  ? 327  GLY A CA  1 
ATOM   2044  C C   . GLY A 1 316 ? -50.901 42.761  -3.771  1.00 86.20  ? 327  GLY A C   1 
ATOM   2045  O O   . GLY A 1 316 ? -49.771 43.036  -3.359  1.00 86.20  ? 327  GLY A O   1 
ATOM   2046  N N   . ARG A 1 317 ? -51.842 43.677  -3.962  1.00 164.22 ? 328  ARG A N   1 
ATOM   2047  C CA  . ARG A 1 317 ? -51.592 45.086  -3.699  1.00 164.22 ? 328  ARG A CA  1 
ATOM   2048  C C   . ARG A 1 317 ? -51.625 45.335  -2.194  1.00 164.22 ? 328  ARG A C   1 
ATOM   2049  O O   . ARG A 1 317 ? -51.503 46.476  -1.744  1.00 164.22 ? 328  ARG A O   1 
ATOM   2050  C CB  . ARG A 1 317 ? -52.654 45.952  -4.394  1.00 131.31 ? 328  ARG A CB  1 
ATOM   2051  C CG  . ARG A 1 317 ? -52.702 45.787  -5.913  1.00 131.31 ? 328  ARG A CG  1 
ATOM   2052  C CD  . ARG A 1 317 ? -53.703 46.736  -6.574  1.00 131.31 ? 328  ARG A CD  1 
ATOM   2053  N NE  . ARG A 1 317 ? -53.654 46.641  -8.033  1.00 131.31 ? 328  ARG A NE  1 
ATOM   2054  C CZ  . ARG A 1 317 ? -54.326 47.435  -8.862  1.00 131.31 ? 328  ARG A CZ  1 
ATOM   2055  N NH1 . ARG A 1 317 ? -55.108 48.391  -8.382  1.00 131.31 ? 328  ARG A NH1 1 
ATOM   2056  N NH2 . ARG A 1 317 ? -54.209 47.278  -10.173 1.00 131.31 ? 328  ARG A NH2 1 
ATOM   2057  N N   . LYS A 1 318 ? -51.780 44.263  -1.418  1.00 134.59 ? 329  LYS A N   1 
ATOM   2058  C CA  . LYS A 1 318 ? -51.850 44.379  0.036   1.00 134.59 ? 329  LYS A CA  1 
ATOM   2059  C C   . LYS A 1 318 ? -50.974 43.369  0.786   1.00 134.59 ? 329  LYS A C   1 
ATOM   2060  O O   . LYS A 1 318 ? -51.016 42.168  0.520   1.00 134.59 ? 329  LYS A O   1 
ATOM   2061  C CB  . LYS A 1 318 ? -53.314 44.252  0.478   1.00 164.30 ? 329  LYS A CB  1 
ATOM   2062  C CG  . LYS A 1 318 ? -54.230 45.286  -0.187  1.00 164.30 ? 329  LYS A CG  1 
ATOM   2063  C CD  . LYS A 1 318 ? -55.694 45.123  0.205   1.00 164.30 ? 329  LYS A CD  1 
ATOM   2064  C CE  . LYS A 1 318 ? -56.573 46.198  -0.440  1.00 164.30 ? 329  LYS A CE  1 
ATOM   2065  N NZ  . LYS A 1 318 ? -56.561 46.139  -1.930  1.00 164.30 ? 329  LYS A NZ  1 
ATOM   2066  N N   . ASN A 1 319 ? -50.178 43.880  1.723   1.00 61.22  ? 330  ASN A N   1 
ATOM   2067  C CA  . ASN A 1 319 ? -49.278 43.062  2.526   1.00 61.22  ? 330  ASN A CA  1 
ATOM   2068  C C   . ASN A 1 319 ? -50.050 42.309  3.602   1.00 61.22  ? 330  ASN A C   1 
ATOM   2069  O O   . ASN A 1 319 ? -50.959 42.860  4.212   1.00 61.22  ? 330  ASN A O   1 
ATOM   2070  C CB  . ASN A 1 319 ? -48.235 43.950  3.193   1.00 136.61 ? 330  ASN A CB  1 
ATOM   2071  C CG  . ASN A 1 319 ? -47.420 44.724  2.195   1.00 136.61 ? 330  ASN A CG  1 
ATOM   2072  O OD1 . ASN A 1 319 ? -47.965 45.343  1.283   1.00 136.61 ? 330  ASN A OD1 1 
ATOM   2073  N ND2 . ASN A 1 319 ? -46.103 44.701  2.360   1.00 136.61 ? 330  ASN A ND2 1 
ATOM   2074  N N   . VAL A 1 320 ? -49.664 41.060  3.851   1.00 69.56  ? 331  VAL A N   1 
ATOM   2075  C CA  . VAL A 1 320 ? -50.338 40.232  4.847   1.00 69.56  ? 331  VAL A CA  1 
ATOM   2076  C C   . VAL A 1 320 ? -49.387 39.201  5.445   1.00 69.56  ? 331  VAL A C   1 
ATOM   2077  O O   . VAL A 1 320 ? -48.544 38.663  4.731   1.00 69.56  ? 331  VAL A O   1 
ATOM   2078  C CB  . VAL A 1 320 ? -51.531 39.479  4.202   1.00 49.41  ? 331  VAL A CB  1 
ATOM   2079  C CG1 . VAL A 1 320 ? -51.052 38.714  3.000   1.00 49.41  ? 331  VAL A CG1 1 
ATOM   2080  C CG2 . VAL A 1 320 ? -52.152 38.515  5.186   1.00 49.41  ? 331  VAL A CG2 1 
ATOM   2081  N N   . VAL A 1 321 ? -49.505 38.954  6.754   1.00 46.20  ? 332  VAL A N   1 
ATOM   2082  C CA  . VAL A 1 321 ? -48.683 37.950  7.449   1.00 46.20  ? 332  VAL A CA  1 
ATOM   2083  C C   . VAL A 1 321 ? -49.080 36.585  6.882   1.00 46.20  ? 332  VAL A C   1 
ATOM   2084  O O   . VAL A 1 321 ? -50.253 36.197  6.892   1.00 46.20  ? 332  VAL A O   1 
ATOM   2085  C CB  . VAL A 1 321 ? -48.924 37.943  8.984   1.00 92.59  ? 332  VAL A CB  1 
ATOM   2086  C CG1 . VAL A 1 321 ? -48.168 36.788  9.631   1.00 92.59  ? 332  VAL A CG1 1 
ATOM   2087  C CG2 . VAL A 1 321 ? -48.469 39.258  9.589   1.00 92.59  ? 332  VAL A CG2 1 
ATOM   2088  N N   . PRO A 1 322 ? -48.095 35.837  6.384   1.00 53.32  ? 333  PRO A N   1 
ATOM   2089  C CA  . PRO A 1 322 ? -48.343 34.525  5.797   1.00 53.32  ? 333  PRO A CA  1 
ATOM   2090  C C   . PRO A 1 322 ? -48.718 33.470  6.807   1.00 53.32  ? 333  PRO A C   1 
ATOM   2091  O O   . PRO A 1 322 ? -48.437 33.626  7.989   1.00 53.32  ? 333  PRO A O   1 
ATOM   2092  C CB  . PRO A 1 322 ? -47.017 34.218  5.126   1.00 55.21  ? 333  PRO A CB  1 
ATOM   2093  C CG  . PRO A 1 322 ? -46.045 34.778  6.119   1.00 55.21  ? 333  PRO A CG  1 
ATOM   2094  C CD  . PRO A 1 322 ? -46.649 36.121  6.442   1.00 55.21  ? 333  PRO A CD  1 
ATOM   2095  N N   . CYS A 1 323 ? -49.365 32.406  6.333   1.00 66.69  ? 334  CYS A N   1 
ATOM   2096  C CA  . CYS A 1 323 ? -49.730 31.278  7.183   1.00 66.69  ? 334  CYS A CA  1 
ATOM   2097  C C   . CYS A 1 323 ? -48.642 30.246  6.931   1.00 66.69  ? 334  CYS A C   1 
ATOM   2098  O O   . CYS A 1 323 ? -48.169 30.121  5.799   1.00 66.69  ? 334  CYS A O   1 
ATOM   2099  C CB  . CYS A 1 323 ? -51.093 30.710  6.795   1.00 81.63  ? 334  CYS A CB  1 
ATOM   2100  S SG  . CYS A 1 323 ? -52.469 31.525  7.616   1.00 81.63  ? 334  CYS A SG  1 
ATOM   2101  N N   . VAL A 1 324 ? -48.236 29.521  7.972   1.00 45.53  ? 335  VAL A N   1 
ATOM   2102  C CA  . VAL A 1 324 ? -47.175 28.527  7.832   1.00 45.53  ? 335  VAL A CA  1 
ATOM   2103  C C   . VAL A 1 324 ? -47.627 27.087  7.643   1.00 45.53  ? 335  VAL A C   1 
ATOM   2104  O O   . VAL A 1 324 ? -47.957 26.391  8.601   1.00 45.53  ? 335  VAL A O   1 
ATOM   2105  C CB  . VAL A 1 324 ? -46.208 28.568  9.030   1.00 31.22  ? 335  VAL A CB  1 
ATOM   2106  C CG1 . VAL A 1 324 ? -45.200 27.441  8.917   1.00 31.22  ? 335  VAL A CG1 1 
ATOM   2107  C CG2 . VAL A 1 324 ? -45.482 29.910  9.073   1.00 31.22  ? 335  VAL A CG2 1 
ATOM   2108  N N   . LEU A 1 325 ? -47.618 26.646  6.393   1.00 51.29  ? 336  LEU A N   1 
ATOM   2109  C CA  . LEU A 1 325 ? -47.984 25.283  6.042   1.00 51.29  ? 336  LEU A CA  1 
ATOM   2110  C C   . LEU A 1 325 ? -46.692 24.468  6.287   1.00 51.29  ? 336  LEU A C   1 
ATOM   2111  O O   . LEU A 1 325 ? -45.594 24.995  6.117   1.00 51.29  ? 336  LEU A O   1 
ATOM   2112  C CB  . LEU A 1 325 ? -48.412 25.270  4.571   1.00 60.99  ? 336  LEU A CB  1 
ATOM   2113  C CG  . LEU A 1 325 ? -49.438 24.258  4.067   1.00 60.99  ? 336  LEU A CG  1 
ATOM   2114  C CD1 . LEU A 1 325 ? -49.998 24.769  2.758   1.00 60.99  ? 336  LEU A CD1 1 
ATOM   2115  C CD2 . LEU A 1 325 ? -48.808 22.885  3.895   1.00 60.99  ? 336  LEU A CD2 1 
ATOM   2116  N N   . SER A 1 326 ? -46.800 23.203  6.690   1.00 44.00  ? 337  SER A N   1 
ATOM   2117  C CA  . SER A 1 326 ? -45.597 22.410  6.991   1.00 44.00  ? 337  SER A CA  1 
ATOM   2118  C C   . SER A 1 326 ? -45.667 20.947  6.542   1.00 44.00  ? 337  SER A C   1 
ATOM   2119  O O   . SER A 1 326 ? -46.477 20.164  7.041   1.00 44.00  ? 337  SER A O   1 
ATOM   2120  C CB  . SER A 1 326 ? -45.319 22.480  8.511   1.00 35.70  ? 337  SER A CB  1 
ATOM   2121  O OG  . SER A 1 326 ? -44.162 21.766  8.907   1.00 35.70  ? 337  SER A OG  1 
ATOM   2122  N N   . VAL A 1 327 ? -44.798 20.586  5.604   1.00 48.55  ? 338  VAL A N   1 
ATOM   2123  C CA  . VAL A 1 327 ? -44.751 19.222  5.095   1.00 48.55  ? 338  VAL A CA  1 
ATOM   2124  C C   . VAL A 1 327 ? -43.559 18.489  5.715   1.00 48.55  ? 338  VAL A C   1 
ATOM   2125  O O   . VAL A 1 327 ? -42.465 19.028  5.755   1.00 48.55  ? 338  VAL A O   1 
ATOM   2126  C CB  . VAL A 1 327 ? -44.628 19.216  3.553   1.00 37.70  ? 338  VAL A CB  1 
ATOM   2127  C CG1 . VAL A 1 327 ? -44.610 17.785  3.043   1.00 37.70  ? 338  VAL A CG1 1 
ATOM   2128  C CG2 . VAL A 1 327 ? -45.793 19.972  2.934   1.00 37.70  ? 338  VAL A CG2 1 
ATOM   2129  N N   . ASN A 1 328 ? -43.764 17.266  6.199   1.00 29.48  ? 339  ASN A N   1 
ATOM   2130  C CA  . ASN A 1 328 ? -42.677 16.509  6.834   1.00 29.48  ? 339  ASN A CA  1 
ATOM   2131  C C   . ASN A 1 328 ? -42.732 14.983  6.572   1.00 29.48  ? 339  ASN A C   1 
ATOM   2132  O O   . ASN A 1 328 ? -43.676 14.290  6.959   1.00 29.48  ? 339  ASN A O   1 
ATOM   2133  C CB  . ASN A 1 328 ? -42.691 16.779  8.339   1.00 58.37  ? 339  ASN A CB  1 
ATOM   2134  C CG  . ASN A 1 328 ? -41.311 16.999  8.903   1.00 58.37  ? 339  ASN A CG  1 
ATOM   2135  O OD1 . ASN A 1 328 ? -40.486 16.093  8.913   1.00 58.37  ? 339  ASN A OD1 1 
ATOM   2136  N ND2 . ASN A 1 328 ? -41.048 18.214  9.378   1.00 58.37  ? 339  ASN A ND2 1 
ATOM   2137  N N   . GLY A 1 329 ? -41.704 14.456  5.923   1.00 54.02  ? 340  GLY A N   1 
ATOM   2138  C CA  . GLY A 1 329 ? -41.709 13.038  5.643   1.00 54.02  ? 340  GLY A CA  1 
ATOM   2139  C C   . GLY A 1 329 ? -40.528 12.310  6.236   1.00 54.02  ? 340  GLY A C   1 
ATOM   2140  O O   . GLY A 1 329 ? -39.436 12.861  6.338   1.00 54.02  ? 340  GLY A O   1 
ATOM   2141  N N   . ASP A 1 330 ? -40.750 11.060  6.618   1.00 58.21  ? 341  ASP A N   1 
ATOM   2142  C CA  . ASP A 1 330 ? -39.709 10.233  7.204   1.00 58.21  ? 341  ASP A CA  1 
ATOM   2143  C C   . ASP A 1 330 ? -39.046 9.445   6.072   1.00 58.21  ? 341  ASP A C   1 
ATOM   2144  O O   . ASP A 1 330 ? -39.631 8.497   5.556   1.00 58.21  ? 341  ASP A O   1 
ATOM   2145  C CB  . ASP A 1 330 ? -40.345 9.284   8.214   1.00 82.64  ? 341  ASP A CB  1 
ATOM   2146  C CG  . ASP A 1 330 ? -39.397 8.877   9.311   1.00 82.64  ? 341  ASP A CG  1 
ATOM   2147  O OD1 . ASP A 1 330 ? -38.829 9.778   9.964   1.00 82.64  ? 341  ASP A OD1 1 
ATOM   2148  O OD2 . ASP A 1 330 ? -39.229 7.659   9.529   1.00 82.64  ? 341  ASP A OD2 1 
ATOM   2149  N N   . LEU A 1 331 ? -37.834 9.831   5.677   1.00 58.12  ? 342  LEU A N   1 
ATOM   2150  C CA  . LEU A 1 331 ? -37.153 9.135   4.586   1.00 58.12  ? 342  LEU A CA  1 
ATOM   2151  C C   . LEU A 1 331 ? -36.691 7.730   4.918   1.00 58.12  ? 342  LEU A C   1 
ATOM   2152  O O   . LEU A 1 331 ? -36.786 6.835   4.076   1.00 58.12  ? 342  LEU A O   1 
ATOM   2153  C CB  . LEU A 1 331 ? -35.949 9.936   4.091   1.00 54.73  ? 342  LEU A CB  1 
ATOM   2154  C CG  . LEU A 1 331 ? -36.209 11.206  3.284   1.00 54.73  ? 342  LEU A CG  1 
ATOM   2155  C CD1 . LEU A 1 331 ? -34.889 11.660  2.649   1.00 54.73  ? 342  LEU A CD1 1 
ATOM   2156  C CD2 . LEU A 1 331 ? -37.260 10.940  2.212   1.00 54.73  ? 342  LEU A CD2 1 
ATOM   2157  N N   . ASP A 1 332 ? -36.184 7.534   6.136   1.00 59.40  ? 343  ASP A N   1 
ATOM   2158  C CA  . ASP A 1 332 ? -35.692 6.220   6.557   1.00 59.40  ? 343  ASP A CA  1 
ATOM   2159  C C   . ASP A 1 332 ? -36.792 5.170   6.663   1.00 59.40  ? 343  ASP A C   1 
ATOM   2160  O O   . ASP A 1 332 ? -36.550 3.981   6.468   1.00 59.40  ? 343  ASP A O   1 
ATOM   2161  C CB  . ASP A 1 332 ? -34.941 6.346   7.881   1.00 84.20  ? 343  ASP A CB  1 
ATOM   2162  C CG  . ASP A 1 332 ? -33.664 7.144   7.736   1.00 84.20  ? 343  ASP A CG  1 
ATOM   2163  O OD1 . ASP A 1 332 ? -32.922 6.875   6.773   1.00 84.20  ? 343  ASP A OD1 1 
ATOM   2164  O OD2 . ASP A 1 332 ? -33.393 8.032   8.570   1.00 84.20  ? 343  ASP A OD2 1 
ATOM   2165  N N   . ARG A 1 333 ? -38.003 5.618   6.973   1.00 36.20  ? 344  ARG A N   1 
ATOM   2166  C CA  . ARG A 1 333 ? -39.143 4.725   7.074   1.00 36.20  ? 344  ARG A CA  1 
ATOM   2167  C C   . ARG A 1 333 ? -39.732 4.613   5.680   1.00 36.20  ? 344  ARG A C   1 
ATOM   2168  O O   . ARG A 1 333 ? -40.350 3.610   5.348   1.00 36.20  ? 344  ARG A O   1 
ATOM   2169  C CB  . ARG A 1 333 ? -40.175 5.283   8.052   1.00 67.55  ? 344  ARG A CB  1 
ATOM   2170  C CG  . ARG A 1 333 ? -41.366 4.372   8.275   1.00 67.55  ? 344  ARG A CG  1 
ATOM   2171  C CD  . ARG A 1 333 ? -42.232 4.879   9.411   1.00 67.55  ? 344  ARG A CD  1 
ATOM   2172  N NE  . ARG A 1 333 ? -41.529 4.858   10.692  1.00 67.55  ? 344  ARG A NE  1 
ATOM   2173  C CZ  . ARG A 1 333 ? -42.062 5.268   11.839  1.00 67.55  ? 344  ARG A CZ  1 
ATOM   2174  N NH1 . ARG A 1 333 ? -43.300 5.739   11.868  1.00 67.55  ? 344  ARG A NH1 1 
ATOM   2175  N NH2 . ARG A 1 333 ? -41.367 5.192   12.961  1.00 67.55  ? 344  ARG A NH2 1 
ATOM   2176  N N   . GLY A 1 334 ? -39.536 5.663   4.879   1.00 41.34  ? 345  GLY A N   1 
ATOM   2177  C CA  . GLY A 1 334 ? -39.996 5.677   3.499   1.00 41.34  ? 345  GLY A CA  1 
ATOM   2178  C C   . GLY A 1 334 ? -39.108 4.674   2.787   1.00 41.34  ? 345  GLY A C   1 
ATOM   2179  O O   . GLY A 1 334 ? -39.510 3.997   1.849   1.00 41.34  ? 345  GLY A O   1 
ATOM   2180  N N   . MET A 1 335 ? -37.871 4.591   3.257   1.00 42.07  ? 346  MET A N   1 
ATOM   2181  C CA  . MET A 1 335 ? -36.902 3.645   2.737   1.00 42.07  ? 346  MET A CA  1 
ATOM   2182  C C   . MET A 1 335 ? -37.549 2.272   2.871   1.00 42.07  ? 346  MET A C   1 
ATOM   2183  O O   . MET A 1 335 ? -37.927 1.653   1.884   1.00 42.07  ? 346  MET A O   1 
ATOM   2184  C CB  . MET A 1 335 ? -35.648 3.699   3.593   1.00 83.88  ? 346  MET A CB  1 
ATOM   2185  C CG  . MET A 1 335 ? -34.516 4.444   2.974   1.00 83.88  ? 346  MET A CG  1 
ATOM   2186  S SD  . MET A 1 335 ? -33.582 3.302   1.999   1.00 83.88  ? 346  MET A SD  1 
ATOM   2187  C CE  . MET A 1 335 ? -32.624 2.470   3.308   1.00 83.88  ? 346  MET A CE  1 
ATOM   2188  N N   . LEU A 1 336 ? -37.678 1.824   4.119   1.00 78.47  ? 347  LEU A N   1 
ATOM   2189  C CA  . LEU A 1 336 ? -38.291 0.542   4.474   1.00 78.47  ? 347  LEU A CA  1 
ATOM   2190  C C   . LEU A 1 336 ? -39.545 0.274   3.643   1.00 78.47  ? 347  LEU A C   1 
ATOM   2191  O O   . LEU A 1 336 ? -39.642 -0.738  2.945   1.00 78.47  ? 347  LEU A O   1 
ATOM   2192  C CB  . LEU A 1 336 ? -38.669 0.557   5.955   1.00 89.24  ? 347  LEU A CB  1 
ATOM   2193  C CG  . LEU A 1 336 ? -37.573 0.966   6.942   1.00 89.24  ? 347  LEU A CG  1 
ATOM   2194  C CD1 . LEU A 1 336 ? -38.208 1.412   8.239   1.00 89.24  ? 347  LEU A CD1 1 
ATOM   2195  C CD2 . LEU A 1 336 ? -36.618 -0.191  7.181   1.00 89.24  ? 347  LEU A CD2 1 
ATOM   2196  N N   . ALA A 1 337 ? -40.508 1.186   3.744   1.00 52.87  ? 348  ALA A N   1 
ATOM   2197  C CA  . ALA A 1 337 ? -41.750 1.083   2.995   1.00 52.87  ? 348  ALA A CA  1 
ATOM   2198  C C   . ALA A 1 337 ? -41.452 0.560   1.599   1.00 52.87  ? 348  ALA A C   1 
ATOM   2199  O O   . ALA A 1 337 ? -42.129 -0.328  1.098   1.00 52.87  ? 348  ALA A O   1 
ATOM   2200  C CB  . ALA A 1 337 ? -42.424 2.454   2.894   1.00 8.77   ? 348  ALA A CB  1 
ATOM   2201  N N   . TYR A 1 338 ? -40.426 1.105   0.968   1.00 73.60  ? 349  TYR A N   1 
ATOM   2202  C CA  . TYR A 1 338 ? -40.099 0.661   -0.368  1.00 73.60  ? 349  TYR A CA  1 
ATOM   2203  C C   . TYR A 1 338 ? -39.477 -0.713  -0.422  1.00 73.60  ? 349  TYR A C   1 
ATOM   2204  O O   . TYR A 1 338 ? -39.743 -1.467  -1.355  1.00 73.60  ? 349  TYR A O   1 
ATOM   2205  C CB  . TYR A 1 338 ? -39.218 1.696   -1.073  1.00 43.14  ? 349  TYR A CB  1 
ATOM   2206  C CG  . TYR A 1 338 ? -40.062 2.802   -1.656  1.00 43.14  ? 349  TYR A CG  1 
ATOM   2207  C CD1 . TYR A 1 338 ? -41.146 2.488   -2.479  1.00 43.14  ? 349  TYR A CD1 1 
ATOM   2208  C CD2 . TYR A 1 338 ? -39.853 4.140   -1.322  1.00 43.14  ? 349  TYR A CD2 1 
ATOM   2209  C CE1 . TYR A 1 338 ? -42.008 3.464   -2.944  1.00 43.14  ? 349  TYR A CE1 1 
ATOM   2210  C CE2 . TYR A 1 338 ? -40.708 5.127   -1.785  1.00 43.14  ? 349  TYR A CE2 1 
ATOM   2211  C CZ  . TYR A 1 338 ? -41.787 4.775   -2.591  1.00 43.14  ? 349  TYR A CZ  1 
ATOM   2212  O OH  . TYR A 1 338 ? -42.679 5.711   -3.040  1.00 43.14  ? 349  TYR A OH  1 
ATOM   2213  N N   . LEU A 1 339 ? -38.671 -1.061  0.573   1.00 50.56  ? 350  LEU A N   1 
ATOM   2214  C CA  . LEU A 1 339 ? -38.052 -2.366  0.559   1.00 50.56  ? 350  LEU A CA  1 
ATOM   2215  C C   . LEU A 1 339 ? -39.075 -3.442  0.820   1.00 50.56  ? 350  LEU A C   1 
ATOM   2216  O O   . LEU A 1 339 ? -38.911 -4.567  0.362   1.00 50.56  ? 350  LEU A O   1 
ATOM   2217  C CB  . LEU A 1 339 ? -36.916 -2.453  1.567   1.00 54.07  ? 350  LEU A CB  1 
ATOM   2218  C CG  . LEU A 1 339 ? -35.595 -1.854  1.086   1.00 54.07  ? 350  LEU A CG  1 
ATOM   2219  C CD1 . LEU A 1 339 ? -34.470 -2.207  2.046   1.00 54.07  ? 350  LEU A CD1 1 
ATOM   2220  C CD2 . LEU A 1 339 ? -35.281 -2.395  -0.290  1.00 54.07  ? 350  LEU A CD2 1 
ATOM   2221  N N   . TYR A 1 340 ? -40.138 -3.116  1.549   1.00 78.65  ? 351  TYR A N   1 
ATOM   2222  C CA  . TYR A 1 340 ? -41.192 -4.098  1.806   1.00 78.65  ? 351  TYR A CA  1 
ATOM   2223  C C   . TYR A 1 340 ? -42.055 -4.227  0.554   1.00 78.65  ? 351  TYR A C   1 
ATOM   2224  O O   . TYR A 1 340 ? -42.352 -5.320  0.085   1.00 78.65  ? 351  TYR A O   1 
ATOM   2225  C CB  . TYR A 1 340 ? -42.052 -3.651  2.974   1.00 61.03  ? 351  TYR A CB  1 
ATOM   2226  C CG  . TYR A 1 340 ? -41.633 -4.267  4.270   1.00 61.03  ? 351  TYR A CG  1 
ATOM   2227  C CD1 . TYR A 1 340 ? -41.957 -5.577  4.560   1.00 61.03  ? 351  TYR A CD1 1 
ATOM   2228  C CD2 . TYR A 1 340 ? -40.883 -3.546  5.202   1.00 61.03  ? 351  TYR A CD2 1 
ATOM   2229  C CE1 . TYR A 1 340 ? -41.553 -6.164  5.740   1.00 61.03  ? 351  TYR A CE1 1 
ATOM   2230  C CE2 . TYR A 1 340 ? -40.465 -4.125  6.395   1.00 61.03  ? 351  TYR A CE2 1 
ATOM   2231  C CZ  . TYR A 1 340 ? -40.805 -5.442  6.657   1.00 61.03  ? 351  TYR A CZ  1 
ATOM   2232  O OH  . TYR A 1 340 ? -40.384 -6.059  7.819   1.00 61.03  ? 351  TYR A OH  1 
ATOM   2233  N N   . ASP A 1 341 ? -42.445 -3.082  0.020   1.00 49.00  ? 352  ASP A N   1 
ATOM   2234  C CA  . ASP A 1 341 ? -43.256 -2.980  -1.178  1.00 49.00  ? 352  ASP A CA  1 
ATOM   2235  C C   . ASP A 1 341 ? -42.671 -3.688  -2.415  1.00 49.00  ? 352  ASP A C   1 
ATOM   2236  O O   . ASP A 1 341 ? -43.388 -3.933  -3.393  1.00 49.00  ? 352  ASP A O   1 
ATOM   2237  C CB  . ASP A 1 341 ? -43.446 -1.501  -1.483  1.00 54.34  ? 352  ASP A CB  1 
ATOM   2238  C CG  . ASP A 1 341 ? -44.369 -1.258  -2.636  1.00 54.34  ? 352  ASP A CG  1 
ATOM   2239  O OD1 . ASP A 1 341 ? -45.575 -1.575  -2.486  1.00 54.34  ? 352  ASP A OD1 1 
ATOM   2240  O OD2 . ASP A 1 341 ? -43.887 -0.748  -3.676  1.00 54.34  ? 352  ASP A OD2 1 
ATOM   2241  N N   . SER A 1 342 ? -41.382 -4.018  -2.388  1.00 67.18  ? 353  SER A N   1 
ATOM   2242  C CA  . SER A 1 342 ? -40.762 -4.666  -3.541  1.00 67.18  ? 353  SER A CA  1 
ATOM   2243  C C   . SER A 1 342 ? -40.554 -6.174  -3.384  1.00 67.18  ? 353  SER A C   1 
ATOM   2244  O O   . SER A 1 342 ? -40.071 -6.848  -4.298  1.00 67.18  ? 353  SER A O   1 
ATOM   2245  C CB  . SER A 1 342 ? -39.427 -3.992  -3.855  1.00 63.09  ? 353  SER A CB  1 
ATOM   2246  O OG  . SER A 1 342 ? -38.528 -4.123  -2.771  1.00 63.09  ? 353  SER A OG  1 
ATOM   2247  N N   . PHE A 1 343 ? -40.929 -6.701  -2.226  1.00 90.15  ? 354  PHE A N   1 
ATOM   2248  C CA  . PHE A 1 343 ? -40.788 -8.123  -1.948  1.00 90.15  ? 354  PHE A CA  1 
ATOM   2249  C C   . PHE A 1 343 ? -42.189 -8.723  -1.771  1.00 90.15  ? 354  PHE A C   1 
ATOM   2250  O O   . PHE A 1 343 ? -43.159 -8.226  -2.356  1.00 90.15  ? 354  PHE A O   1 
ATOM   2251  C CB  . PHE A 1 343 ? -39.963 -8.293  -0.678  1.00 71.94  ? 354  PHE A CB  1 
ATOM   2252  C CG  . PHE A 1 343 ? -39.486 -9.688  -0.435  1.00 71.94  ? 354  PHE A CG  1 
ATOM   2253  C CD1 . PHE A 1 343 ? -38.704 -10.341 -1.372  1.00 71.94  ? 354  PHE A CD1 1 
ATOM   2254  C CD2 . PHE A 1 343 ? -39.766 -10.329 0.763   1.00 71.94  ? 354  PHE A CD2 1 
ATOM   2255  C CE1 . PHE A 1 343 ? -38.200 -11.620 -1.117  1.00 71.94  ? 354  PHE A CE1 1 
ATOM   2256  C CE2 . PHE A 1 343 ? -39.272 -11.598 1.031   1.00 71.94  ? 354  PHE A CE2 1 
ATOM   2257  C CZ  . PHE A 1 343 ? -38.486 -12.248 0.092   1.00 71.94  ? 354  PHE A CZ  1 
ATOM   2258  N N   . GLN A 1 344 ? -42.290 -9.784  -0.969  1.00 132.25 ? 355  GLN A N   1 
ATOM   2259  C CA  . GLN A 1 344 ? -43.565 -10.457 -0.700  1.00 132.25 ? 355  GLN A CA  1 
ATOM   2260  C C   . GLN A 1 344 ? -43.800 -10.657 0.797   1.00 132.25 ? 355  GLN A C   1 
ATOM   2261  O O   . GLN A 1 344 ? -44.756 -11.318 1.202   1.00 132.25 ? 355  GLN A O   1 
ATOM   2262  C CB  . GLN A 1 344 ? -43.610 -11.819 -1.405  1.00 189.55 ? 355  GLN A CB  1 
ATOM   2263  C CG  . GLN A 1 344 ? -44.144 -11.780 -2.833  1.00 189.55 ? 355  GLN A CG  1 
ATOM   2264  C CD  . GLN A 1 344 ? -45.627 -11.450 -2.898  1.00 189.55 ? 355  GLN A CD  1 
ATOM   2265  O OE1 . GLN A 1 344 ? -46.447 -12.112 -2.262  1.00 189.55 ? 355  GLN A OE1 1 
ATOM   2266  N NE2 . GLN A 1 344 ? -45.976 -10.428 -3.673  1.00 189.55 ? 355  GLN A NE2 1 
ATOM   2267  N N   . ARG A 1 358 ? -37.581 -18.113 -5.760  1.00 101.01 ? 369  ARG A N   1 
ATOM   2268  C CA  . ARG A 1 358 ? -37.159 -16.839 -6.332  1.00 101.01 ? 369  ARG A CA  1 
ATOM   2269  C C   . ARG A 1 358 ? -37.352 -15.675 -5.355  1.00 101.01 ? 369  ARG A C   1 
ATOM   2270  O O   . ARG A 1 358 ? -38.479 -15.320 -4.996  1.00 101.01 ? 369  ARG A O   1 
ATOM   2271  C CB  . ARG A 1 358 ? -37.921 -16.572 -7.644  1.00 66.63  ? 369  ARG A CB  1 
ATOM   2272  C CG  . ARG A 1 358 ? -37.674 -15.195 -8.298  1.00 66.63  ? 369  ARG A CG  1 
ATOM   2273  C CD  . ARG A 1 358 ? -38.217 -15.171 -9.727  1.00 66.63  ? 369  ARG A CD  1 
ATOM   2274  N NE  . ARG A 1 358 ? -38.243 -13.840 -10.337 1.00 66.63  ? 369  ARG A NE  1 
ATOM   2275  C CZ  . ARG A 1 358 ? -37.167 -13.140 -10.688 1.00 66.63  ? 369  ARG A CZ  1 
ATOM   2276  N NH1 . ARG A 1 358 ? -35.952 -13.634 -10.493 1.00 66.63  ? 369  ARG A NH1 1 
ATOM   2277  N NH2 . ARG A 1 358 ? -37.307 -11.942 -11.244 1.00 66.63  ? 369  ARG A NH2 1 
ATOM   2278  N N   . LYS A 1 359 ? -36.231 -15.099 -4.926  1.00 87.56  ? 370  LYS A N   1 
ATOM   2279  C CA  . LYS A 1 359 ? -36.209 -13.965 -4.007  1.00 87.56  ? 370  LYS A CA  1 
ATOM   2280  C C   . LYS A 1 359 ? -36.702 -12.746 -4.784  1.00 87.56  ? 370  LYS A C   1 
ATOM   2281  O O   . LYS A 1 359 ? -37.882 -12.634 -5.105  1.00 87.56  ? 370  LYS A O   1 
ATOM   2282  C CB  . LYS A 1 359 ? -34.772 -13.719 -3.544  1.00 73.96  ? 370  LYS A CB  1 
ATOM   2283  C CG  . LYS A 1 359 ? -34.053 -14.932 -2.961  1.00 73.96  ? 370  LYS A CG  1 
ATOM   2284  C CD  . LYS A 1 359 ? -34.649 -15.344 -1.622  1.00 73.96  ? 370  LYS A CD  1 
ATOM   2285  C CE  . LYS A 1 359 ? -33.870 -16.491 -0.997  1.00 73.96  ? 370  LYS A CE  1 
ATOM   2286  N NZ  . LYS A 1 359 ? -34.522 -16.984 0.257   1.00 73.96  ? 370  LYS A NZ  1 
ATOM   2287  N N   . VAL A 1 360 ? -35.771 -11.839 -5.061  1.00 59.03  ? 371  VAL A N   1 
ATOM   2288  C CA  . VAL A 1 360 ? -35.991 -10.617 -5.843  1.00 59.03  ? 371  VAL A CA  1 
ATOM   2289  C C   . VAL A 1 360 ? -36.642 -9.400  -5.219  1.00 59.03  ? 371  VAL A C   1 
ATOM   2290  O O   . VAL A 1 360 ? -37.642 -9.495  -4.512  1.00 59.03  ? 371  VAL A O   1 
ATOM   2291  C CB  . VAL A 1 360 ? -36.776 -10.895 -7.153  1.00 51.54  ? 371  VAL A CB  1 
ATOM   2292  C CG1 . VAL A 1 360 ? -38.242 -10.559 -6.966  1.00 51.54  ? 371  VAL A CG1 1 
ATOM   2293  C CG2 . VAL A 1 360 ? -36.218 -10.054 -8.282  1.00 51.54  ? 371  VAL A CG2 1 
ATOM   2294  N N   . LEU A 1 361 ? -36.063 -8.245  -5.520  1.00 55.76  ? 372  LEU A N   1 
ATOM   2295  C CA  . LEU A 1 361 ? -36.592 -6.979  -5.056  1.00 55.76  ? 372  LEU A CA  1 
ATOM   2296  C C   . LEU A 1 361 ? -36.894 -6.150  -6.309  1.00 55.76  ? 372  LEU A C   1 
ATOM   2297  O O   . LEU A 1 361 ? -36.000 -5.836  -7.089  1.00 55.76  ? 372  LEU A O   1 
ATOM   2298  C CB  . LEU A 1 361 ? -35.578 -6.260  -4.152  1.00 46.14  ? 372  LEU A CB  1 
ATOM   2299  C CG  . LEU A 1 361 ? -35.386 -6.761  -2.720  1.00 46.14  ? 372  LEU A CG  1 
ATOM   2300  C CD1 . LEU A 1 361 ? -34.623 -8.081  -2.718  1.00 46.14  ? 372  LEU A CD1 1 
ATOM   2301  C CD2 . LEU A 1 361 ? -34.620 -5.731  -1.929  1.00 46.14  ? 372  LEU A CD2 1 
ATOM   2302  N N   . LYS A 1 362 ? -38.155 -5.816  -6.529  1.00 62.28  ? 373  LYS A N   1 
ATOM   2303  C CA  . LYS A 1 362 ? -38.473 -5.030  -7.704  1.00 62.28  ? 373  LYS A CA  1 
ATOM   2304  C C   . LYS A 1 362 ? -38.540 -3.533  -7.420  1.00 62.28  ? 373  LYS A C   1 
ATOM   2305  O O   . LYS A 1 362 ? -39.514 -2.860  -7.788  1.00 62.28  ? 373  LYS A O   1 
ATOM   2306  C CB  . LYS A 1 362 ? -39.783 -5.503  -8.346  1.00 116.38 ? 373  LYS A CB  1 
ATOM   2307  C CG  . LYS A 1 362 ? -39.681 -6.823  -9.123  1.00 116.38 ? 373  LYS A CG  1 
ATOM   2308  C CD  . LYS A 1 362 ? -40.953 -7.071  -9.932  1.00 116.38 ? 373  LYS A CD  1 
ATOM   2309  C CE  . LYS A 1 362 ? -40.943 -8.414  -10.642 1.00 116.38 ? 373  LYS A CE  1 
ATOM   2310  N NZ  . LYS A 1 362 ? -42.174 -8.600  -11.468 1.00 116.38 ? 373  LYS A NZ  1 
ATOM   2311  N N   . LEU A 1 363 ? -37.495 -3.012  -6.776  1.00 41.79  ? 374  LEU A N   1 
ATOM   2312  C CA  . LEU A 1 363 ? -37.430 -1.580  -6.468  1.00 41.79  ? 374  LEU A CA  1 
ATOM   2313  C C   . LEU A 1 363 ? -37.576 -0.728  -7.737  1.00 41.79  ? 374  LEU A C   1 
ATOM   2314  O O   . LEU A 1 363 ? -36.911 -0.970  -8.743  1.00 41.79  ? 374  LEU A O   1 
ATOM   2315  C CB  . LEU A 1 363 ? -36.106 -1.257  -5.767  1.00 43.91  ? 374  LEU A CB  1 
ATOM   2316  C CG  . LEU A 1 363 ? -36.053 -1.528  -4.263  1.00 43.91  ? 374  LEU A CG  1 
ATOM   2317  C CD1 . LEU A 1 363 ? -34.624 -1.440  -3.745  1.00 43.91  ? 374  LEU A CD1 1 
ATOM   2318  C CD2 . LEU A 1 363 ? -36.940 -0.513  -3.564  1.00 43.91  ? 374  LEU A CD2 1 
ATOM   2319  N N   . HIS A 1 364 ? -38.450 0.268   -7.695  1.00 60.37  ? 375  HIS A N   1 
ATOM   2320  C CA  . HIS A 1 364 ? -38.652 1.115   -8.867  1.00 60.37  ? 375  HIS A CA  1 
ATOM   2321  C C   . HIS A 1 364 ? -37.317 1.465   -9.518  1.00 60.37  ? 375  HIS A C   1 
ATOM   2322  O O   . HIS A 1 364 ? -36.302 1.607   -8.846  1.00 60.37  ? 375  HIS A O   1 
ATOM   2323  C CB  . HIS A 1 364 ? -39.389 2.406   -8.480  1.00 79.95  ? 375  HIS A CB  1 
ATOM   2324  C CG  . HIS A 1 364 ? -39.747 3.280   -9.646  1.00 79.95  ? 375  HIS A CG  1 
ATOM   2325  N ND1 . HIS A 1 364 ? -38.831 3.663   -10.601 1.00 79.95  ? 375  HIS A ND1 1 
ATOM   2326  C CD2 . HIS A 1 364 ? -40.915 3.873   -9.988  1.00 79.95  ? 375  HIS A CD2 1 
ATOM   2327  C CE1 . HIS A 1 364 ? -39.418 4.455   -11.480 1.00 79.95  ? 375  HIS A CE1 1 
ATOM   2328  N NE2 . HIS A 1 364 ? -40.683 4.599   -11.131 1.00 79.95  ? 375  HIS A NE2 1 
ATOM   2329  N N   . PRO A 1 365 ? -37.303 1.598   -10.844 1.00 61.96  ? 376  PRO A N   1 
ATOM   2330  C CA  . PRO A 1 365 ? -36.061 1.934   -11.532 1.00 61.96  ? 376  PRO A CA  1 
ATOM   2331  C C   . PRO A 1 365 ? -35.389 3.227   -11.029 1.00 61.96  ? 376  PRO A C   1 
ATOM   2332  O O   . PRO A 1 365 ? -34.165 3.288   -10.901 1.00 61.96  ? 376  PRO A O   1 
ATOM   2333  C CB  . PRO A 1 365 ? -36.514 2.022   -12.987 1.00 49.90  ? 376  PRO A CB  1 
ATOM   2334  C CG  . PRO A 1 365 ? -37.558 0.982   -13.049 1.00 49.90  ? 376  PRO A CG  1 
ATOM   2335  C CD  . PRO A 1 365 ? -38.356 1.268   -11.817 1.00 49.90  ? 376  PRO A CD  1 
ATOM   2336  N N   . CYS A 1 366 ? -36.190 4.252   -10.745 1.00 45.82  ? 377  CYS A N   1 
ATOM   2337  C CA  . CYS A 1 366 ? -35.665 5.535   -10.273 1.00 45.82  ? 377  CYS A CA  1 
ATOM   2338  C C   . CYS A 1 366 ? -35.158 5.510   -8.834  1.00 45.82  ? 377  CYS A C   1 
ATOM   2339  O O   . CYS A 1 366 ? -34.592 6.504   -8.348  1.00 45.82  ? 377  CYS A O   1 
ATOM   2340  C CB  . CYS A 1 366 ? -36.729 6.631   -10.383 1.00 95.04  ? 377  CYS A CB  1 
ATOM   2341  S SG  . CYS A 1 366 ? -37.143 7.132   -12.048 1.00 95.04  ? 377  CYS A SG  1 
ATOM   2342  N N   . LEU A 1 367 ? -35.369 4.388   -8.154  1.00 38.45  ? 378  LEU A N   1 
ATOM   2343  C CA  . LEU A 1 367 ? -34.951 4.266   -6.766  1.00 38.45  ? 378  LEU A CA  1 
ATOM   2344  C C   . LEU A 1 367 ? -33.982 3.127   -6.547  1.00 38.45  ? 378  LEU A C   1 
ATOM   2345  O O   . LEU A 1 367 ? -33.414 2.983   -5.468  1.00 38.45  ? 378  LEU A O   1 
ATOM   2346  C CB  . LEU A 1 367 ? -36.177 4.073   -5.864  1.00 54.23  ? 378  LEU A CB  1 
ATOM   2347  C CG  . LEU A 1 367 ? -36.926 5.289   -5.306  1.00 54.23  ? 378  LEU A CG  1 
ATOM   2348  C CD1 . LEU A 1 367 ? -37.153 6.348   -6.355  1.00 54.23  ? 378  LEU A CD1 1 
ATOM   2349  C CD2 . LEU A 1 367 ? -38.243 4.818   -4.762  1.00 54.23  ? 378  LEU A CD2 1 
ATOM   2350  N N   . ALA A 1 368 ? -33.799 2.311   -7.572  1.00 46.95  ? 379  ALA A N   1 
ATOM   2351  C CA  . ALA A 1 368 ? -32.910 1.175   -7.450  1.00 46.95  ? 379  ALA A CA  1 
ATOM   2352  C C   . ALA A 1 368 ? -31.513 1.658   -7.137  1.00 46.95  ? 379  ALA A C   1 
ATOM   2353  O O   . ALA A 1 368 ? -31.022 2.593   -7.770  1.00 46.95  ? 379  ALA A O   1 
ATOM   2354  C CB  . ALA A 1 368 ? -32.904 0.369   -8.738  1.00 72.55  ? 379  ALA A CB  1 
ATOM   2355  N N   . PRO A 1 369 ? -30.860 1.043   -6.136  1.00 34.30  ? 380  PRO A N   1 
ATOM   2356  C CA  . PRO A 1 369 ? -29.499 1.443   -5.775  1.00 34.30  ? 380  PRO A CA  1 
ATOM   2357  C C   . PRO A 1 369 ? -28.530 1.301   -6.972  1.00 34.30  ? 380  PRO A C   1 
ATOM   2358  O O   . PRO A 1 369 ? -27.969 2.290   -7.449  1.00 34.30  ? 380  PRO A O   1 
ATOM   2359  C CB  . PRO A 1 369 ? -29.162 0.496   -4.625  1.00 99.13  ? 380  PRO A CB  1 
ATOM   2360  C CG  . PRO A 1 369 ? -29.986 -0.719  -4.936  1.00 99.13  ? 380  PRO A CG  1 
ATOM   2361  C CD  . PRO A 1 369 ? -31.298 -0.111  -5.336  1.00 99.13  ? 380  PRO A CD  1 
ATOM   2362  N N   . ILE A 1 370 ? -28.368 0.081   -7.480  1.00 76.35  ? 381  ILE A N   1 
ATOM   2363  C CA  . ILE A 1 370 ? -27.454 -0.139  -8.596  1.00 76.35  ? 381  ILE A CA  1 
ATOM   2364  C C   . ILE A 1 370 ? -28.055 -0.550  -9.952  1.00 76.35  ? 381  ILE A C   1 
ATOM   2365  O O   . ILE A 1 370 ? -28.152 -1.733  -10.281 1.00 76.35  ? 381  ILE A O   1 
ATOM   2366  C CB  . ILE A 1 370 ? -26.361 -1.146  -8.189  1.00 73.10  ? 381  ILE A CB  1 
ATOM   2367  C CG1 . ILE A 1 370 ? -26.973 -2.260  -7.352  1.00 73.10  ? 381  ILE A CG1 1 
ATOM   2368  C CG2 . ILE A 1 370 ? -25.273 -0.441  -7.396  1.00 73.10  ? 381  ILE A CG2 1 
ATOM   2369  C CD1 . ILE A 1 370 ? -25.953 -3.223  -6.795  1.00 73.10  ? 381  ILE A CD1 1 
ATOM   2370  N N   . LYS A 1 371 ? -28.417 0.462   -10.738 1.00 55.65  ? 382  LYS A N   1 
ATOM   2371  C CA  . LYS A 1 371 ? -29.005 0.337   -12.080 1.00 55.65  ? 382  LYS A CA  1 
ATOM   2372  C C   . LYS A 1 371 ? -28.624 -0.845  -12.972 1.00 55.65  ? 382  LYS A C   1 
ATOM   2373  O O   . LYS A 1 371 ? -29.420 -1.250  -13.812 1.00 55.65  ? 382  LYS A O   1 
ATOM   2374  C CB  . LYS A 1 371 ? -28.741 1.624   -12.882 1.00 49.65  ? 382  LYS A CB  1 
ATOM   2375  C CG  . LYS A 1 371 ? -29.806 2.698   -12.760 1.00 49.65  ? 382  LYS A CG  1 
ATOM   2376  C CD  . LYS A 1 371 ? -30.137 3.010   -11.305 1.00 49.65  ? 382  LYS A CD  1 
ATOM   2377  C CE  . LYS A 1 371 ? -31.330 3.958   -11.194 1.00 49.65  ? 382  LYS A CE  1 
ATOM   2378  N NZ  . LYS A 1 371 ? -31.906 4.003   -9.817  1.00 49.65  ? 382  LYS A NZ  1 
ATOM   2379  N N   . VAL A 1 372 ? -27.419 -1.386  -12.823 1.00 71.54  ? 383  VAL A N   1 
ATOM   2380  C CA  . VAL A 1 372 ? -27.003 -2.492  -13.682 1.00 71.54  ? 383  VAL A CA  1 
ATOM   2381  C C   . VAL A 1 372 ? -25.646 -3.085  -13.350 1.00 71.54  ? 383  VAL A C   1 
ATOM   2382  O O   . VAL A 1 372 ? -24.642 -2.374  -13.274 1.00 71.54  ? 383  VAL A O   1 
ATOM   2383  C CB  . VAL A 1 372 ? -26.949 -2.050  -15.162 1.00 53.25  ? 383  VAL A CB  1 
ATOM   2384  C CG1 . VAL A 1 372 ? -26.021 -0.869  -15.315 1.00 53.25  ? 383  VAL A CG1 1 
ATOM   2385  C CG2 . VAL A 1 372 ? -26.460 -3.189  -16.029 1.00 53.25  ? 383  VAL A CG2 1 
ATOM   2386  N N   . ALA A 1 373 ? -25.617 -4.397  -13.168 1.00 49.44  ? 384  ALA A N   1 
ATOM   2387  C CA  . ALA A 1 373 ? -24.368 -5.079  -12.883 1.00 49.44  ? 384  ALA A CA  1 
ATOM   2388  C C   . ALA A 1 373 ? -23.809 -5.460  -14.231 1.00 49.44  ? 384  ALA A C   1 
ATOM   2389  O O   . ALA A 1 373 ? -24.342 -5.056  -15.258 1.00 49.44  ? 384  ALA A O   1 
ATOM   2390  C CB  . ALA A 1 373 ? -24.618 -6.308  -12.076 1.00 57.53  ? 384  ALA A CB  1 
ATOM   2391  N N   . LEU A 1 374 ? -22.732 -6.230  -14.236 1.00 74.20  ? 385  LEU A N   1 
ATOM   2392  C CA  . LEU A 1 374 ? -22.143 -6.664  -15.490 1.00 74.20  ? 385  LEU A CA  1 
ATOM   2393  C C   . LEU A 1 374 ? -20.863 -7.448  -15.218 1.00 74.20  ? 385  LEU A C   1 
ATOM   2394  O O   . LEU A 1 374 ? -19.985 -6.994  -14.480 1.00 74.20  ? 385  LEU A O   1 
ATOM   2395  C CB  . LEU A 1 374 ? -21.862 -5.460  -16.401 1.00 30.94  ? 385  LEU A CB  1 
ATOM   2396  C CG  . LEU A 1 374 ? -20.453 -4.891  -16.394 1.00 30.94  ? 385  LEU A CG  1 
ATOM   2397  C CD1 . LEU A 1 374 ? -20.291 -3.728  -17.343 1.00 30.94  ? 385  LEU A CD1 1 
ATOM   2398  C CD2 . LEU A 1 374 ? -20.172 -4.452  -15.005 1.00 30.94  ? 385  LEU A CD2 1 
ATOM   2399  N N   . ASP A 1 375 ? -20.776 -8.641  -15.799 1.00 164.77 ? 386  ASP A N   1 
ATOM   2400  C CA  . ASP A 1 375 ? -19.605 -9.493  -15.626 1.00 164.77 ? 386  ASP A CA  1 
ATOM   2401  C C   . ASP A 1 375 ? -18.988 -9.810  -16.980 1.00 164.77 ? 386  ASP A C   1 
ATOM   2402  O O   . ASP A 1 375 ? -19.305 -9.180  -17.990 1.00 164.77 ? 386  ASP A O   1 
ATOM   2403  C CB  . ASP A 1 375 ? -19.985 -10.811 -14.932 1.00 96.48  ? 386  ASP A CB  1 
ATOM   2404  C CG  . ASP A 1 375 ? -20.445 -10.615 -13.500 1.00 96.48  ? 386  ASP A CG  1 
ATOM   2405  O OD1 . ASP A 1 375 ? -19.604 -10.297 -12.634 1.00 96.48  ? 386  ASP A OD1 1 
ATOM   2406  O OD2 . ASP A 1 375 ? -21.653 -10.779 -13.236 1.00 96.48  ? 386  ASP A OD2 1 
ATOM   2407  N N   . VAL A 1 376 ? -18.099 -10.795 -16.982 1.00 86.83  ? 387  VAL A N   1 
ATOM   2408  C CA  . VAL A 1 376 ? -17.432 -11.245 -18.191 1.00 86.83  ? 387  VAL A CA  1 
ATOM   2409  C C   . VAL A 1 376 ? -17.701 -12.745 -18.271 1.00 86.83  ? 387  VAL A C   1 
ATOM   2410  O O   . VAL A 1 376 ? -17.852 -13.408 -17.235 1.00 86.83  ? 387  VAL A O   1 
ATOM   2411  C CB  . VAL A 1 376 ? -15.926 -11.008 -18.106 1.00 51.74  ? 387  VAL A CB  1 
ATOM   2412  C CG1 . VAL A 1 376 ? -15.638 -9.530  -17.991 1.00 51.74  ? 387  VAL A CG1 1 
ATOM   2413  C CG2 . VAL A 1 376 ? -15.371 -11.736 -16.895 1.00 51.74  ? 387  VAL A CG2 1 
ATOM   2414  N N   . GLY A 1 377 ? -17.766 -13.277 -19.490 1.00 138.64 ? 388  GLY A N   1 
ATOM   2415  C CA  . GLY A 1 377 ? -18.040 -14.695 -19.663 1.00 138.64 ? 388  GLY A CA  1 
ATOM   2416  C C   . GLY A 1 377 ? -17.122 -15.426 -20.622 1.00 138.64 ? 388  GLY A C   1 
ATOM   2417  O O   . GLY A 1 377 ? -15.969 -15.036 -20.806 1.00 138.64 ? 388  GLY A O   1 
ATOM   2418  N N   . ARG A 1 378 ? -17.641 -16.488 -21.234 1.00 115.42 ? 389  ARG A N   1 
ATOM   2419  C CA  . ARG A 1 378 ? -16.877 -17.306 -22.172 1.00 115.42 ? 389  ARG A CA  1 
ATOM   2420  C C   . ARG A 1 378 ? -15.934 -16.516 -23.081 1.00 115.42 ? 389  ARG A C   1 
ATOM   2421  O O   . ARG A 1 378 ? -16.368 -15.673 -23.868 1.00 115.42 ? 389  ARG A O   1 
ATOM   2422  C CB  . ARG A 1 378 ? -17.824 -18.165 -23.026 1.00 169.81 ? 389  ARG A CB  1 
ATOM   2423  C CG  . ARG A 1 378 ? -19.081 -17.460 -23.527 1.00 169.81 ? 389  ARG A CG  1 
ATOM   2424  C CD  . ARG A 1 378 ? -20.141 -17.366 -22.437 1.00 169.81 ? 389  ARG A CD  1 
ATOM   2425  N NE  . ARG A 1 378 ? -20.491 -18.678 -21.897 1.00 169.81 ? 389  ARG A NE  1 
ATOM   2426  C CZ  . ARG A 1 378 ? -21.387 -18.878 -20.934 1.00 169.81 ? 389  ARG A CZ  1 
ATOM   2427  N NH1 . ARG A 1 378 ? -22.030 -17.850 -20.397 1.00 169.81 ? 389  ARG A NH1 1 
ATOM   2428  N NH2 . ARG A 1 378 ? -21.639 -20.107 -20.505 1.00 169.81 ? 389  ARG A NH2 1 
ATOM   2429  N N   . GLY A 1 379 ? -14.638 -16.801 -22.963 1.00 182.07 ? 390  GLY A N   1 
ATOM   2430  C CA  . GLY A 1 379 ? -13.643 -16.117 -23.771 1.00 182.07 ? 390  GLY A CA  1 
ATOM   2431  C C   . GLY A 1 379 ? -12.285 -16.010 -23.095 1.00 182.07 ? 390  GLY A C   1 
ATOM   2432  O O   . GLY A 1 379 ? -11.882 -16.916 -22.363 1.00 182.07 ? 390  GLY A O   1 
ATOM   2433  N N   . PRO A 1 380 ? -11.548 -14.911 -23.332 1.00 179.78 ? 391  PRO A N   1 
ATOM   2434  C CA  . PRO A 1 380 ? -10.227 -14.699 -22.734 1.00 179.78 ? 391  PRO A CA  1 
ATOM   2435  C C   . PRO A 1 380 ? -10.305 -14.297 -21.264 1.00 179.78 ? 391  PRO A C   1 
ATOM   2436  O O   . PRO A 1 380 ? -10.731 -15.085 -20.419 1.00 179.78 ? 391  PRO A O   1 
ATOM   2437  C CB  . PRO A 1 380 ? -9.635  -13.597 -23.607 1.00 94.42  ? 391  PRO A CB  1 
ATOM   2438  C CG  . PRO A 1 380 ? -10.831 -12.791 -23.961 1.00 94.42  ? 391  PRO A CG  1 
ATOM   2439  C CD  . PRO A 1 380 ? -11.851 -13.848 -24.308 1.00 94.42  ? 391  PRO A CD  1 
ATOM   2440  N N   . THR A 1 381 ? -9.887  -13.068 -20.973 1.00 90.42  ? 392  THR A N   1 
ATOM   2441  C CA  . THR A 1 381 ? -9.901  -12.524 -19.616 1.00 90.42  ? 392  THR A CA  1 
ATOM   2442  C C   . THR A 1 381 ? -9.529  -11.051 -19.669 1.00 90.42  ? 392  THR A C   1 
ATOM   2443  O O   . THR A 1 381 ? -10.407 -10.202 -19.809 1.00 90.42  ? 392  THR A O   1 
ATOM   2444  C CB  . THR A 1 381 ? -8.911  -13.266 -18.691 1.00 90.51  ? 392  THR A CB  1 
ATOM   2445  O OG1 . THR A 1 381 ? -9.423  -14.571 -18.393 1.00 90.51  ? 392  THR A OG1 1 
ATOM   2446  C CG2 . THR A 1 381 ? -8.708  -12.503 -17.396 1.00 90.51  ? 392  THR A CG2 1 
ATOM   2447  N N   . LEU A 1 382 ? -8.234  -10.748 -19.567 1.00 105.42 ? 393  LEU A N   1 
ATOM   2448  C CA  . LEU A 1 382 ? -7.762  -9.362  -19.619 1.00 105.42 ? 393  LEU A CA  1 
ATOM   2449  C C   . LEU A 1 382 ? -8.459  -8.683  -20.788 1.00 105.42 ? 393  LEU A C   1 
ATOM   2450  O O   . LEU A 1 382 ? -8.946  -7.559  -20.669 1.00 105.42 ? 393  LEU A O   1 
ATOM   2451  C CB  . LEU A 1 382 ? -6.246  -9.315  -19.837 1.00 81.61  ? 393  LEU A CB  1 
ATOM   2452  C CG  . LEU A 1 382 ? -5.516  -7.988  -19.592 1.00 81.61  ? 393  LEU A CG  1 
ATOM   2453  C CD1 . LEU A 1 382 ? -4.052  -8.165  -19.972 1.00 81.61  ? 393  LEU A CD1 1 
ATOM   2454  C CD2 . LEU A 1 382 ? -6.138  -6.854  -20.395 1.00 81.61  ? 393  LEU A CD2 1 
ATOM   2455  N N   . GLU A 1 383 ? -8.498  -9.395  -21.912 1.00 177.31 ? 394  GLU A N   1 
ATOM   2456  C CA  . GLU A 1 383 ? -9.126  -8.929  -23.145 1.00 177.31 ? 394  GLU A CA  1 
ATOM   2457  C C   . GLU A 1 383 ? -10.616 -8.663  -22.962 1.00 177.31 ? 394  GLU A C   1 
ATOM   2458  O O   . GLU A 1 383 ? -11.151 -7.689  -23.495 1.00 177.31 ? 394  GLU A O   1 
ATOM   2459  C CB  . GLU A 1 383 ? -8.951  -9.979  -24.249 1.00 161.11 ? 394  GLU A CB  1 
ATOM   2460  C CG  . GLU A 1 383 ? -7.548  -10.100 -24.826 1.00 161.11 ? 394  GLU A CG  1 
ATOM   2461  C CD  . GLU A 1 383 ? -7.288  -9.102  -25.940 1.00 161.11 ? 394  GLU A CD  1 
ATOM   2462  O OE1 . GLU A 1 383 ? -6.180  -9.127  -26.518 1.00 161.11 ? 394  GLU A OE1 1 
ATOM   2463  O OE2 . GLU A 1 383 ? -8.194  -8.294  -26.238 1.00 161.11 ? 394  GLU A OE2 1 
ATOM   2464  N N   . LEU A 1 384 ? -11.282 -9.537  -22.212 1.00 64.02  ? 395  LEU A N   1 
ATOM   2465  C CA  . LEU A 1 384 ? -12.714 -9.408  -21.988 1.00 64.02  ? 395  LEU A CA  1 
ATOM   2466  C C   . LEU A 1 384 ? -13.068 -8.292  -21.007 1.00 64.02  ? 395  LEU A C   1 
ATOM   2467  O O   . LEU A 1 384 ? -13.985 -7.518  -21.270 1.00 64.02  ? 395  LEU A O   1 
ATOM   2468  C CB  . LEU A 1 384 ? -13.293 -10.746 -21.520 1.00 97.46  ? 395  LEU A CB  1 
ATOM   2469  C CG  . LEU A 1 384 ? -14.699 -11.072 -22.043 1.00 97.46  ? 395  LEU A CG  1 
ATOM   2470  C CD1 . LEU A 1 384 ? -15.713 -10.127 -21.424 1.00 97.46  ? 395  LEU A CD1 1 
ATOM   2471  C CD2 . LEU A 1 384 ? -14.725 -10.968 -23.565 1.00 97.46  ? 395  LEU A CD2 1 
ATOM   2472  N N   . ARG A 1 385 ? -12.362 -8.204  -19.881 1.00 102.30 ? 396  ARG A N   1 
ATOM   2473  C CA  . ARG A 1 385 ? -12.644 -7.131  -18.928 1.00 102.30 ? 396  ARG A CA  1 
ATOM   2474  C C   . ARG A 1 385 ? -11.954 -5.843  -19.373 1.00 102.30 ? 396  ARG A C   1 
ATOM   2475  O O   . ARG A 1 385 ? -11.488 -5.055  -18.553 1.00 102.30 ? 396  ARG A O   1 
ATOM   2476  C CB  . ARG A 1 385 ? -12.224 -7.510  -17.490 1.00 113.99 ? 396  ARG A CB  1 
ATOM   2477  C CG  . ARG A 1 385 ? -11.092 -8.505  -17.367 1.00 113.99 ? 396  ARG A CG  1 
ATOM   2478  C CD  . ARG A 1 385 ? -10.786 -8.842  -15.910 1.00 113.99 ? 396  ARG A CD  1 
ATOM   2479  N NE  . ARG A 1 385 ? -9.942  -7.838  -15.264 1.00 113.99 ? 396  ARG A NE  1 
ATOM   2480  C CZ  . ARG A 1 385 ? -9.295  -8.021  -14.111 1.00 113.99 ? 396  ARG A CZ  1 
ATOM   2481  N NH1 . ARG A 1 385 ? -9.391  -9.177  -13.458 1.00 113.99 ? 396  ARG A NH1 1 
ATOM   2482  N NH2 . ARG A 1 385 ? -8.533  -7.049  -13.616 1.00 113.99 ? 396  ARG A NH2 1 
ATOM   2483  N N   . GLN A 1 386 ? -11.900 -5.649  -20.688 1.00 109.37 ? 397  GLN A N   1 
ATOM   2484  C CA  . GLN A 1 386 ? -11.300 -4.464  -21.293 1.00 109.37 ? 397  GLN A CA  1 
ATOM   2485  C C   . GLN A 1 386 ? -12.389 -3.438  -21.573 1.00 109.37 ? 397  GLN A C   1 
ATOM   2486  O O   . GLN A 1 386 ? -12.277 -2.276  -21.187 1.00 109.37 ? 397  GLN A O   1 
ATOM   2487  C CB  . GLN A 1 386 ? -10.600 -4.826  -22.607 1.00 176.47 ? 397  GLN A CB  1 
ATOM   2488  C CG  . GLN A 1 386 ? -9.232  -5.455  -22.436 1.00 176.47 ? 397  GLN A CG  1 
ATOM   2489  C CD  . GLN A 1 386 ? -8.170  -4.450  -22.032 1.00 176.47 ? 397  GLN A CD  1 
ATOM   2490  O OE1 . GLN A 1 386 ? -8.365  -3.652  -21.113 1.00 176.47 ? 397  GLN A OE1 1 
ATOM   2491  N NE2 . GLN A 1 386 ? -7.032  -4.490  -22.716 1.00 176.47 ? 397  GLN A NE2 1 
ATOM   2492  N N   . VAL A 1 387 ? -13.442 -3.876  -22.255 1.00 159.37 ? 398  VAL A N   1 
ATOM   2493  C CA  . VAL A 1 387 ? -14.560 -3.002  -22.584 1.00 159.37 ? 398  VAL A CA  1 
ATOM   2494  C C   . VAL A 1 387 ? -15.410 -2.761  -21.336 1.00 159.37 ? 398  VAL A C   1 
ATOM   2495  O O   . VAL A 1 387 ? -16.106 -1.750  -21.229 1.00 159.37 ? 398  VAL A O   1 
ATOM   2496  C CB  . VAL A 1 387 ? -15.438 -3.624  -23.701 1.00 131.74 ? 398  VAL A CB  1 
ATOM   2497  C CG1 . VAL A 1 387 ? -15.926 -4.998  -23.278 1.00 131.74 ? 398  VAL A CG1 1 
ATOM   2498  C CG2 . VAL A 1 387 ? -16.612 -2.710  -24.021 1.00 131.74 ? 398  VAL A CG2 1 
ATOM   2499  N N   . CYS A 1 388 ? -15.338 -3.695  -20.391 1.00 108.42 ? 399  CYS A N   1 
ATOM   2500  C CA  . CYS A 1 388 ? -16.088 -3.602  -19.144 1.00 108.42 ? 399  CYS A CA  1 
ATOM   2501  C C   . CYS A 1 388 ? -15.857 -2.248  -18.504 1.00 108.42 ? 399  CYS A C   1 
ATOM   2502  O O   . CYS A 1 388 ? -16.795 -1.580  -18.075 1.00 108.42 ? 399  CYS A O   1 
ATOM   2503  C CB  . CYS A 1 388 ? -15.645 -4.706  -18.183 1.00 76.96  ? 399  CYS A CB  1 
ATOM   2504  S SG  . CYS A 1 388 ? -16.072 -6.374  -18.737 1.00 76.96  ? 399  CYS A SG  1 
ATOM   2505  N N   . GLN A 1 389 ? -14.592 -1.854  -18.451 1.00 102.77 ? 400  GLN A N   1 
ATOM   2506  C CA  . GLN A 1 389 ? -14.210 -0.580  -17.872 1.00 102.77 ? 400  GLN A CA  1 
ATOM   2507  C C   . GLN A 1 389 ? -14.517 0.569   -18.828 1.00 102.77 ? 400  GLN A C   1 
ATOM   2508  O O   . GLN A 1 389 ? -14.618 1.726   -18.416 1.00 102.77 ? 400  GLN A O   1 
ATOM   2509  C CB  . GLN A 1 389 ? -12.731 -0.621  -17.517 1.00 105.42 ? 400  GLN A CB  1 
ATOM   2510  C CG  . GLN A 1 389 ? -12.432 -1.697  -16.493 1.00 105.42 ? 400  GLN A CG  1 
ATOM   2511  C CD  . GLN A 1 389 ? -10.955 -1.957  -16.322 1.00 105.42 ? 400  GLN A CD  1 
ATOM   2512  O OE1 . GLN A 1 389 ? -10.546 -2.718  -15.441 1.00 105.42 ? 400  GLN A OE1 1 
ATOM   2513  N NE2 . GLN A 1 389 ? -10.140 -1.332  -17.169 1.00 105.42 ? 400  GLN A NE2 1 
ATOM   2514  N N   . GLY A 1 390 ? -14.663 0.249   -20.108 1.00 64.63  ? 401  GLY A N   1 
ATOM   2515  C CA  . GLY A 1 390 ? -14.989 1.275   -21.073 1.00 64.63  ? 401  GLY A CA  1 
ATOM   2516  C C   . GLY A 1 390 ? -16.469 1.544   -20.915 1.00 64.63  ? 401  GLY A C   1 
ATOM   2517  O O   . GLY A 1 390 ? -16.981 2.589   -21.324 1.00 64.63  ? 401  GLY A O   1 
ATOM   2518  N N   . LEU A 1 391 ? -17.152 0.571   -20.315 1.00 76.13  ? 402  LEU A N   1 
ATOM   2519  C CA  . LEU A 1 391 ? -18.583 0.651   -20.058 1.00 76.13  ? 402  LEU A CA  1 
ATOM   2520  C C   . LEU A 1 391 ? -18.798 1.222   -18.682 1.00 76.13  ? 402  LEU A C   1 
ATOM   2521  O O   . LEU A 1 391 ? -19.456 2.245   -18.514 1.00 76.13  ? 402  LEU A O   1 
ATOM   2522  C CB  . LEU A 1 391 ? -19.218 -0.730  -20.100 1.00 58.07  ? 402  LEU A CB  1 
ATOM   2523  C CG  . LEU A 1 391 ? -19.933 -1.105  -21.386 1.00 58.07  ? 402  LEU A CG  1 
ATOM   2524  C CD1 . LEU A 1 391 ? -20.881 -2.271  -21.106 1.00 58.07  ? 402  LEU A CD1 1 
ATOM   2525  C CD2 . LEU A 1 391 ? -20.712 0.095   -21.903 1.00 58.07  ? 402  LEU A CD2 1 
ATOM   2526  N N   . PHE A 1 392 ? -18.250 0.530   -17.692 1.00 62.32  ? 403  PHE A N   1 
ATOM   2527  C CA  . PHE A 1 392 ? -18.359 0.965   -16.311 1.00 62.32  ? 403  PHE A CA  1 
ATOM   2528  C C   . PHE A 1 392 ? -18.224 2.482   -16.296 1.00 62.32  ? 403  PHE A C   1 
ATOM   2529  O O   . PHE A 1 392 ? -19.044 3.182   -15.709 1.00 62.32  ? 403  PHE A O   1 
ATOM   2530  C CB  . PHE A 1 392 ? -17.247 0.331   -15.484 1.00 86.63  ? 403  PHE A CB  1 
ATOM   2531  C CG  . PHE A 1 392 ? -17.219 0.798   -14.074 1.00 86.63  ? 403  PHE A CG  1 
ATOM   2532  C CD1 . PHE A 1 392 ? -18.008 0.189   -13.114 1.00 86.63  ? 403  PHE A CD1 1 
ATOM   2533  C CD2 . PHE A 1 392 ? -16.424 1.874   -13.708 1.00 86.63  ? 403  PHE A CD2 1 
ATOM   2534  C CE1 . PHE A 1 392 ? -18.004 0.646   -11.816 1.00 86.63  ? 403  PHE A CE1 1 
ATOM   2535  C CE2 . PHE A 1 392 ? -16.414 2.337   -12.412 1.00 86.63  ? 403  PHE A CE2 1 
ATOM   2536  C CZ  . PHE A 1 392 ? -17.203 1.724   -11.466 1.00 86.63  ? 403  PHE A CZ  1 
ATOM   2537  N N   . ASN A 1 393 ? -17.181 2.969   -16.966 1.00 87.63  ? 404  ASN A N   1 
ATOM   2538  C CA  . ASN A 1 393 ? -16.913 4.397   -17.083 1.00 87.63  ? 404  ASN A CA  1 
ATOM   2539  C C   . ASN A 1 393 ? -17.998 4.995   -17.975 1.00 87.63  ? 404  ASN A C   1 
ATOM   2540  O O   . ASN A 1 393 ? -18.598 6.017   -17.644 1.00 87.63  ? 404  ASN A O   1 
ATOM   2541  C CB  . ASN A 1 393 ? -15.543 4.644   -17.736 1.00 90.38  ? 404  ASN A CB  1 
ATOM   2542  C CG  . ASN A 1 393 ? -14.367 4.275   -16.835 1.00 90.38  ? 404  ASN A CG  1 
ATOM   2543  O OD1 . ASN A 1 393 ? -14.204 3.123   -16.435 1.00 90.38  ? 404  ASN A OD1 1 
ATOM   2544  N ND2 . ASN A 1 393 ? -13.531 5.264   -16.527 1.00 90.38  ? 404  ASN A ND2 1 
ATOM   2545  N N   . GLU A 1 394 ? -18.238 4.343   -19.111 1.00 122.71 ? 405  GLU A N   1 
ATOM   2546  C CA  . GLU A 1 394 ? -19.238 4.787   -20.080 1.00 122.71 ? 405  GLU A CA  1 
ATOM   2547  C C   . GLU A 1 394 ? -20.555 5.103   -19.390 1.00 122.71 ? 405  GLU A C   1 
ATOM   2548  O O   . GLU A 1 394 ? -21.050 6.226   -19.462 1.00 122.71 ? 405  GLU A O   1 
ATOM   2549  C CB  . GLU A 1 394 ? -19.466 3.707   -21.143 1.00 168.84 ? 405  GLU A CB  1 
ATOM   2550  C CG  . GLU A 1 394 ? -20.274 4.170   -22.347 1.00 168.84 ? 405  GLU A CG  1 
ATOM   2551  C CD  . GLU A 1 394 ? -20.453 3.079   -23.390 1.00 168.84 ? 405  GLU A CD  1 
ATOM   2552  O OE1 . GLU A 1 394 ? -19.439 2.468   -23.796 1.00 168.84 ? 405  GLU A OE1 1 
ATOM   2553  O OE2 . GLU A 1 394 ? -21.606 2.839   -23.809 1.00 168.84 ? 405  GLU A OE2 1 
ATOM   2554  N N   . LEU A 1 395 ? -21.120 4.103   -18.726 1.00 116.39 ? 406  LEU A N   1 
ATOM   2555  C CA  . LEU A 1 395 ? -22.379 4.279   -18.021 1.00 116.39 ? 406  LEU A CA  1 
ATOM   2556  C C   . LEU A 1 395 ? -22.259 5.404   -16.997 1.00 116.39 ? 406  LEU A C   1 
ATOM   2557  O O   . LEU A 1 395 ? -23.179 6.204   -16.829 1.00 116.39 ? 406  LEU A O   1 
ATOM   2558  C CB  . LEU A 1 395 ? -22.778 2.986   -17.302 1.00 81.53  ? 406  LEU A CB  1 
ATOM   2559  C CG  . LEU A 1 395 ? -23.165 1.718   -18.072 1.00 81.53  ? 406  LEU A CG  1 
ATOM   2560  C CD1 . LEU A 1 395 ? -24.268 2.051   -19.046 1.00 81.53  ? 406  LEU A CD1 1 
ATOM   2561  C CD2 . LEU A 1 395 ? -21.972 1.141   -18.797 1.00 81.53  ? 406  LEU A CD2 1 
ATOM   2562  N N   . LEU A 1 396 ? -21.115 5.460   -16.325 1.00 86.15  ? 407  LEU A N   1 
ATOM   2563  C CA  . LEU A 1 396 ? -20.865 6.462   -15.298 1.00 86.15  ? 407  LEU A CA  1 
ATOM   2564  C C   . LEU A 1 396 ? -20.746 7.905   -15.771 1.00 86.15  ? 407  LEU A C   1 
ATOM   2565  O O   . LEU A 1 396 ? -21.219 8.820   -15.090 1.00 86.15  ? 407  LEU A O   1 
ATOM   2566  C CB  . LEU A 1 396 ? -19.617 6.090   -14.514 1.00 42.58  ? 407  LEU A CB  1 
ATOM   2567  C CG  . LEU A 1 396 ? -19.795 4.862   -13.639 1.00 42.58  ? 407  LEU A CG  1 
ATOM   2568  C CD1 . LEU A 1 396 ? -18.500 4.543   -12.945 1.00 42.58  ? 407  LEU A CD1 1 
ATOM   2569  C CD2 . LEU A 1 396 ? -20.904 5.120   -12.642 1.00 42.58  ? 407  LEU A CD2 1 
ATOM   2570  N N   . GLU A 1 397 ? -20.101 8.121   -16.915 1.00 82.80  ? 408  GLU A N   1 
ATOM   2571  C CA  . GLU A 1 397 ? -19.954 9.470   -17.453 1.00 82.80  ? 408  GLU A CA  1 
ATOM   2572  C C   . GLU A 1 397 ? -21.348 10.058  -17.720 1.00 82.80  ? 408  GLU A C   1 
ATOM   2573  O O   . GLU A 1 397 ? -21.472 11.200  -18.166 1.00 82.80  ? 408  GLU A O   1 
ATOM   2574  C CB  . GLU A 1 397 ? -19.165 9.437   -18.767 1.00 201.86 ? 408  GLU A CB  1 
ATOM   2575  C CG  . GLU A 1 397 ? -17.746 8.899   -18.659 1.00 201.86 ? 408  GLU A CG  1 
ATOM   2576  C CD  . GLU A 1 397 ? -16.786 9.882   -18.016 1.00 201.86 ? 408  GLU A CD  1 
ATOM   2577  O OE1 . GLU A 1 397 ? -16.670 11.019  -18.523 1.00 201.86 ? 408  GLU A OE1 1 
ATOM   2578  O OE2 . GLU A 1 397 ? -16.143 9.515   -17.009 1.00 201.86 ? 408  GLU A OE2 1 
ATOM   2579  N N   . ASN A 1 398 ? -22.392 9.281   -17.433 1.00 72.57  ? 409  ASN A N   1 
ATOM   2580  C CA  . ASN A 1 398 ? -23.760 9.713   -17.685 1.00 72.57  ? 409  ASN A CA  1 
ATOM   2581  C C   . ASN A 1 398 ? -24.771 9.540   -16.560 1.00 72.57  ? 409  ASN A C   1 
ATOM   2582  O O   . ASN A 1 398 ? -25.945 9.847   -16.737 1.00 72.57  ? 409  ASN A O   1 
ATOM   2583  C CB  . ASN A 1 398 ? -24.273 9.009   -18.932 1.00 83.51  ? 409  ASN A CB  1 
ATOM   2584  C CG  . ASN A 1 398 ? -23.591 9.500   -20.182 1.00 83.51  ? 409  ASN A CG  1 
ATOM   2585  O OD1 . ASN A 1 398 ? -23.830 10.626  -20.625 1.00 83.51  ? 409  ASN A OD1 1 
ATOM   2586  N ND2 . ASN A 1 398 ? -22.720 8.670   -20.754 1.00 83.51  ? 409  ASN A ND2 1 
ATOM   2587  N N   . GLY A 1 399 ? -24.334 9.045   -15.409 1.00 77.92  ? 410  GLY A N   1 
ATOM   2588  C CA  . GLY A 1 399 ? -25.254 8.884   -14.295 1.00 77.92  ? 410  GLY A CA  1 
ATOM   2589  C C   . GLY A 1 399 ? -25.883 7.512   -14.121 1.00 77.92  ? 410  GLY A C   1 
ATOM   2590  O O   . GLY A 1 399 ? -26.987 7.388   -13.585 1.00 77.92  ? 410  GLY A O   1 
ATOM   2591  N N   . ILE A 1 400 ? -25.190 6.473   -14.564 1.00 53.24  ? 411  ILE A N   1 
ATOM   2592  C CA  . ILE A 1 400 ? -25.711 5.127   -14.426 1.00 53.24  ? 411  ILE A CA  1 
ATOM   2593  C C   . ILE A 1 400 ? -24.852 4.329   -13.454 1.00 53.24  ? 411  ILE A C   1 
ATOM   2594  O O   . ILE A 1 400 ? -23.692 4.027   -13.718 1.00 53.24  ? 411  ILE A O   1 
ATOM   2595  C CB  . ILE A 1 400 ? -25.774 4.421   -15.792 1.00 66.36  ? 411  ILE A CB  1 
ATOM   2596  C CG1 . ILE A 1 400 ? -26.790 5.135   -16.688 1.00 66.36  ? 411  ILE A CG1 1 
ATOM   2597  C CG2 . ILE A 1 400 ? -26.163 2.968   -15.617 1.00 66.36  ? 411  ILE A CG2 1 
ATOM   2598  C CD1 . ILE A 1 400 ? -26.925 4.534   -18.081 1.00 66.36  ? 411  ILE A CD1 1 
ATOM   2599  N N   . SER A 1 401 ? -25.434 4.002   -12.311 1.00 59.08  ? 412  SER A N   1 
ATOM   2600  C CA  . SER A 1 401 ? -24.732 3.240   -11.293 1.00 59.08  ? 412  SER A CA  1 
ATOM   2601  C C   . SER A 1 401 ? -24.432 1.800   -11.717 1.00 59.08  ? 412  SER A C   1 
ATOM   2602  O O   . SER A 1 401 ? -25.314 0.946   -11.738 1.00 59.08  ? 412  SER A O   1 
ATOM   2603  C CB  . SER A 1 401 ? -25.549 3.252   -9.997  1.00 96.61  ? 412  SER A CB  1 
ATOM   2604  O OG  . SER A 1 401 ? -26.942 3.210   -10.262 1.00 96.61  ? 412  SER A OG  1 
ATOM   2605  N N   . VAL A 1 402 ? -23.177 1.530   -12.051 1.00 52.22  ? 413  VAL A N   1 
ATOM   2606  C CA  . VAL A 1 402 ? -22.797 0.185   -12.458 1.00 52.22  ? 413  VAL A CA  1 
ATOM   2607  C C   . VAL A 1 402 ? -22.299 -0.606  -11.273 1.00 52.22  ? 413  VAL A C   1 
ATOM   2608  O O   . VAL A 1 402 ? -21.880 -0.040  -10.277 1.00 52.22  ? 413  VAL A O   1 
ATOM   2609  C CB  . VAL A 1 402 ? -21.654 0.202   -13.490 1.00 89.26  ? 413  VAL A CB  1 
ATOM   2610  C CG1 . VAL A 1 402 ? -21.305 -1.218  -13.902 1.00 89.26  ? 413  VAL A CG1 1 
ATOM   2611  C CG2 . VAL A 1 402 ? -22.048 1.027   -14.693 1.00 89.26  ? 413  VAL A CG2 1 
ATOM   2612  N N   . TRP A 1 403 ? -22.362 -1.921  -11.380 1.00 64.54  ? 414  TRP A N   1 
ATOM   2613  C CA  . TRP A 1 403 ? -21.845 -2.774  -10.332 1.00 64.54  ? 414  TRP A CA  1 
ATOM   2614  C C   . TRP A 1 403 ? -20.856 -3.653  -11.045 1.00 64.54  ? 414  TRP A C   1 
ATOM   2615  O O   . TRP A 1 403 ? -21.233 -4.645  -11.666 1.00 64.54  ? 414  TRP A O   1 
ATOM   2616  C CB  . TRP A 1 403 ? -22.924 -3.641  -9.701  1.00 71.79  ? 414  TRP A CB  1 
ATOM   2617  C CG  . TRP A 1 403 ? -22.345 -4.816  -8.982  1.00 71.79  ? 414  TRP A CG  1 
ATOM   2618  C CD1 . TRP A 1 403 ? -22.000 -6.016  -9.530  1.00 71.79  ? 414  TRP A CD1 1 
ATOM   2619  C CD2 . TRP A 1 403 ? -21.968 -4.887  -7.601  1.00 71.79  ? 414  TRP A CD2 1 
ATOM   2620  N NE1 . TRP A 1 403 ? -21.429 -6.829  -8.583  1.00 71.79  ? 414  TRP A NE1 1 
ATOM   2621  C CE2 . TRP A 1 403 ? -21.395 -6.159  -7.387  1.00 71.79  ? 414  TRP A CE2 1 
ATOM   2622  C CE3 . TRP A 1 403 ? -22.054 -4.000  -6.522  1.00 71.79  ? 414  TRP A CE3 1 
ATOM   2623  C CZ2 . TRP A 1 403 ? -20.909 -6.567  -6.137  1.00 71.79  ? 414  TRP A CZ2 1 
ATOM   2624  C CZ3 . TRP A 1 403 ? -21.569 -4.409  -5.274  1.00 71.79  ? 414  TRP A CZ3 1 
ATOM   2625  C CH2 . TRP A 1 403 ? -21.006 -5.678  -5.097  1.00 71.79  ? 414  TRP A CH2 1 
ATOM   2626  N N   . PRO A 1 404 ? -19.574 -3.282  -11.004 1.00 65.08  ? 415  PRO A N   1 
ATOM   2627  C CA  . PRO A 1 404 ? -18.569 -4.091  -11.672 1.00 65.08  ? 415  PRO A CA  1 
ATOM   2628  C C   . PRO A 1 404 ? -18.356 -5.360  -10.880 1.00 65.08  ? 415  PRO A C   1 
ATOM   2629  O O   . PRO A 1 404 ? -17.721 -5.346  -9.823  1.00 65.08  ? 415  PRO A O   1 
ATOM   2630  C CB  . PRO A 1 404 ? -17.352 -3.186  -11.665 1.00 58.53  ? 415  PRO A CB  1 
ATOM   2631  C CG  . PRO A 1 404 ? -17.484 -2.510  -10.380 1.00 58.53  ? 415  PRO A CG  1 
ATOM   2632  C CD  . PRO A 1 404 ? -18.947 -2.120  -10.362 1.00 58.53  ? 415  PRO A CD  1 
ATOM   2633  N N   . GLY A 1 405 ? -18.933 -6.445  -11.387 1.00 113.20 ? 416  GLY A N   1 
ATOM   2634  C CA  . GLY A 1 405 ? -18.792 -7.743  -10.764 1.00 113.20 ? 416  GLY A CA  1 
ATOM   2635  C C   . GLY A 1 405 ? -17.768 -8.481  -11.595 1.00 113.20 ? 416  GLY A C   1 
ATOM   2636  O O   . GLY A 1 405 ? -17.347 -9.582  -11.254 1.00 113.20 ? 416  GLY A O   1 
ATOM   2637  N N   . TYR A 1 406 ? -17.374 -7.852  -12.700 1.00 74.51  ? 417  TYR A N   1 
ATOM   2638  C CA  . TYR A 1 406 ? -16.385 -8.405  -13.616 1.00 74.51  ? 417  TYR A CA  1 
ATOM   2639  C C   . TYR A 1 406 ? -15.011 -8.406  -12.977 1.00 74.51  ? 417  TYR A C   1 
ATOM   2640  O O   . TYR A 1 406 ? -14.001 -8.306  -13.670 1.00 74.51  ? 417  TYR A O   1 
ATOM   2641  C CB  . TYR A 1 406 ? -16.337 -7.590  -14.916 1.00 75.23  ? 417  TYR A CB  1 
ATOM   2642  C CG  . TYR A 1 406 ? -16.035 -6.109  -14.749 1.00 75.23  ? 417  TYR A CG  1 
ATOM   2643  C CD1 . TYR A 1 406 ? -14.833 -5.671  -14.191 1.00 75.23  ? 417  TYR A CD1 1 
ATOM   2644  C CD2 . TYR A 1 406 ? -16.955 -5.144  -15.160 1.00 75.23  ? 417  TYR A CD2 1 
ATOM   2645  C CE1 . TYR A 1 406 ? -14.555 -4.311  -14.042 1.00 75.23  ? 417  TYR A CE1 1 
ATOM   2646  C CE2 . TYR A 1 406 ? -16.691 -3.779  -15.019 1.00 75.23  ? 417  TYR A CE2 1 
ATOM   2647  C CZ  . TYR A 1 406 ? -15.489 -3.366  -14.456 1.00 75.23  ? 417  TYR A CZ  1 
ATOM   2648  O OH  . TYR A 1 406 ? -15.232 -2.016  -14.288 1.00 75.23  ? 417  TYR A OH  1 
ATOM   2649  N N   . LEU A 1 407 ? -14.976 -8.513  -11.654 1.00 80.20  ? 418  LEU A N   1 
ATOM   2650  C CA  . LEU A 1 407 ? -13.717 -8.518  -10.934 1.00 80.20  ? 418  LEU A CA  1 
ATOM   2651  C C   . LEU A 1 407 ? -13.704 -9.529  -9.792  1.00 80.20  ? 418  LEU A C   1 
ATOM   2652  O O   . LEU A 1 407 ? -12.900 -9.413  -8.868  1.00 80.20  ? 418  LEU A O   1 
ATOM   2653  C CB  . LEU A 1 407 ? -13.428 -7.115  -10.387 1.00 82.46  ? 418  LEU A CB  1 
ATOM   2654  C CG  . LEU A 1 407 ? -13.230 -5.990  -11.411 1.00 82.46  ? 418  LEU A CG  1 
ATOM   2655  C CD1 . LEU A 1 407 ? -13.171 -4.637  -10.710 1.00 82.46  ? 418  LEU A CD1 1 
ATOM   2656  C CD2 . LEU A 1 407 ? -11.958 -6.250  -12.209 1.00 82.46  ? 418  LEU A CD2 1 
ATOM   2657  N N   . GLU A 1 408 ? -14.582 -10.526 -9.846  1.00 94.69  ? 419  GLU A N   1 
ATOM   2658  C CA  . GLU A 1 408 ? -14.612 -11.516 -8.779  1.00 94.69  ? 419  GLU A CA  1 
ATOM   2659  C C   . GLU A 1 408 ? -13.811 -12.757 -9.139  1.00 94.69  ? 419  GLU A C   1 
ATOM   2660  O O   . GLU A 1 408 ? -12.581 -12.721 -9.123  1.00 94.69  ? 419  GLU A O   1 
ATOM   2661  C CB  . GLU A 1 408 ? -16.049 -11.895 -8.430  1.00 165.55 ? 419  GLU A CB  1 
ATOM   2662  C CG  . GLU A 1 408 ? -16.146 -12.703 -7.148  1.00 165.55 ? 419  GLU A CG  1 
ATOM   2663  C CD  . GLU A 1 408 ? -17.564 -12.815 -6.634  1.00 165.55 ? 419  GLU A CD  1 
ATOM   2664  O OE1 . GLU A 1 408 ? -18.191 -11.762 -6.386  1.00 165.55 ? 419  GLU A OE1 1 
ATOM   2665  O OE2 . GLU A 1 408 ? -18.048 -13.955 -6.474  1.00 165.55 ? 419  GLU A OE2 1 
ATOM   2666  N N   . THR A 1 409 ? -14.494 -13.853 -9.461  1.00 201.63 ? 420  THR A N   1 
ATOM   2667  C CA  . THR A 1 409 ? -13.801 -15.090 -9.814  1.00 201.63 ? 420  THR A CA  1 
ATOM   2668  C C   . THR A 1 409 ? -14.594 -15.997 -10.763 1.00 201.63 ? 420  THR A C   1 
ATOM   2669  O O   . THR A 1 409 ? -14.973 -15.579 -11.857 1.00 201.63 ? 420  THR A O   1 
ATOM   2670  C CB  . THR A 1 409 ? -13.418 -15.886 -8.541  1.00 134.77 ? 420  THR A CB  1 
ATOM   2671  O OG1 . THR A 1 409 ? -12.725 -17.082 -8.916  1.00 134.77 ? 420  THR A OG1 1 
ATOM   2672  C CG2 . THR A 1 409 ? -14.664 -16.238 -7.724  1.00 134.77 ? 420  THR A CG2 1 
ATOM   2673  N N   . MET A 1 410 ? -14.831 -17.237 -10.342 1.00 201.99 ? 421  MET A N   1 
ATOM   2674  C CA  . MET A 1 410 ? -15.565 -18.215 -11.144 1.00 201.99 ? 421  MET A CA  1 
ATOM   2675  C C   . MET A 1 410 ? -16.847 -17.637 -11.728 1.00 201.99 ? 421  MET A C   1 
ATOM   2676  O O   . MET A 1 410 ? -17.333 -16.602 -11.272 1.00 201.99 ? 421  MET A O   1 
ATOM   2677  C CB  . MET A 1 410 ? -15.923 -19.436 -10.293 1.00 145.11 ? 421  MET A CB  1 
ATOM   2678  C CG  . MET A 1 410 ? -16.922 -19.144 -9.177  1.00 145.11 ? 421  MET A CG  1 
ATOM   2679  S SD  . MET A 1 410 ? -17.521 -20.642 -8.365  1.00 145.11 ? 421  MET A SD  1 
ATOM   2680  C CE  . MET A 1 410 ? -16.293 -20.845 -7.068  1.00 145.11 ? 421  MET A CE  1 
ATOM   2681  N N   . GLN A 1 411 ? -17.398 -18.315 -12.733 1.00 201.99 ? 422  GLN A N   1 
ATOM   2682  C CA  . GLN A 1 411 ? -18.639 -17.864 -13.352 1.00 201.99 ? 422  GLN A CA  1 
ATOM   2683  C C   . GLN A 1 411 ? -19.723 -17.826 -12.284 1.00 201.99 ? 422  GLN A C   1 
ATOM   2684  O O   . GLN A 1 411 ? -20.816 -17.309 -12.516 1.00 201.99 ? 422  GLN A O   1 
ATOM   2685  C CB  . GLN A 1 411 ? -19.065 -18.801 -14.495 1.00 104.61 ? 422  GLN A CB  1 
ATOM   2686  C CG  . GLN A 1 411 ? -19.168 -20.288 -14.132 1.00 104.61 ? 422  GLN A CG  1 
ATOM   2687  C CD  . GLN A 1 411 ? -19.872 -21.114 -15.210 1.00 104.61 ? 422  GLN A CD  1 
ATOM   2688  O OE1 . GLN A 1 411 ? -19.513 -21.057 -16.387 1.00 104.61 ? 422  GLN A OE1 1 
ATOM   2689  N NE2 . GLN A 1 411 ? -20.875 -21.888 -14.807 1.00 104.61 ? 422  GLN A NE2 1 
ATOM   2690  N N   . SER A 1 412 ? -19.401 -18.374 -11.113 1.00 180.01 ? 423  SER A N   1 
ATOM   2691  C CA  . SER A 1 412 ? -20.325 -18.425 -9.985  1.00 180.01 ? 423  SER A CA  1 
ATOM   2692  C C   . SER A 1 412 ? -21.696 -18.885 -10.459 1.00 180.01 ? 423  SER A C   1 
ATOM   2693  O O   . SER A 1 412 ? -22.722 -18.494 -9.898  1.00 180.01 ? 423  SER A O   1 
ATOM   2694  C CB  . SER A 1 412 ? -20.434 -17.046 -9.326  1.00 106.20 ? 423  SER A CB  1 
ATOM   2695  O OG  . SER A 1 412 ? -20.957 -16.078 -10.219 1.00 106.20 ? 423  SER A OG  1 
ATOM   2696  N N   . SER A 1 413 ? -21.691 -19.726 -11.492 1.00 126.97 ? 424  SER A N   1 
ATOM   2697  C CA  . SER A 1 413 ? -22.905 -20.259 -12.107 1.00 126.97 ? 424  SER A CA  1 
ATOM   2698  C C   . SER A 1 413 ? -23.464 -19.186 -13.040 1.00 126.97 ? 424  SER A C   1 
ATOM   2699  O O   . SER A 1 413 ? -22.761 -18.672 -13.913 1.00 126.97 ? 424  SER A O   1 
ATOM   2700  C CB  . SER A 1 413 ? -23.936 -20.639 -11.026 1.00 89.31  ? 424  SER A CB  1 
ATOM   2701  O OG  . SER A 1 413 ? -25.108 -21.225 -11.572 1.00 89.31  ? 424  SER A OG  1 
ATOM   2702  N N   . LEU A 1 414 ? -24.729 -18.845 -12.841 1.00 79.55  ? 425  LEU A N   1 
ATOM   2703  C CA  . LEU A 1 414 ? -25.399 -17.836 -13.641 1.00 79.55  ? 425  LEU A CA  1 
ATOM   2704  C C   . LEU A 1 414 ? -26.735 -17.664 -12.947 1.00 79.55  ? 425  LEU A C   1 
ATOM   2705  O O   . LEU A 1 414 ? -27.296 -16.575 -12.914 1.00 79.55  ? 425  LEU A O   1 
ATOM   2706  C CB  . LEU A 1 414 ? -25.593 -18.339 -15.073 1.00 65.43  ? 425  LEU A CB  1 
ATOM   2707  C CG  . LEU A 1 414 ? -25.860 -17.322 -16.182 1.00 65.43  ? 425  LEU A CG  1 
ATOM   2708  C CD1 . LEU A 1 414 ? -24.703 -16.336 -16.254 1.00 65.43  ? 425  LEU A CD1 1 
ATOM   2709  C CD2 . LEU A 1 414 ? -26.016 -18.052 -17.511 1.00 65.43  ? 425  LEU A CD2 1 
ATOM   2710  N N   . GLU A 1 415 ? -27.240 -18.763 -12.395 1.00 139.68 ? 426  GLU A N   1 
ATOM   2711  C CA  . GLU A 1 415 ? -28.494 -18.735 -11.661 1.00 139.68 ? 426  GLU A CA  1 
ATOM   2712  C C   . GLU A 1 415 ? -28.102 -18.237 -10.276 1.00 139.68 ? 426  GLU A C   1 
ATOM   2713  O O   . GLU A 1 415 ? -28.867 -17.542 -9.608  1.00 139.68 ? 426  GLU A O   1 
ATOM   2714  C CB  . GLU A 1 415 ? -29.112 -20.139 -11.559 1.00 127.26 ? 426  GLU A CB  1 
ATOM   2715  C CG  . GLU A 1 415 ? -29.389 -20.827 -12.896 1.00 127.26 ? 426  GLU A CG  1 
ATOM   2716  C CD  . GLU A 1 415 ? -28.233 -21.700 -13.366 1.00 127.26 ? 426  GLU A CD  1 
ATOM   2717  O OE1 . GLU A 1 415 ? -27.106 -21.181 -13.498 1.00 127.26 ? 426  GLU A OE1 1 
ATOM   2718  O OE2 . GLU A 1 415 ? -28.452 -22.908 -13.606 1.00 127.26 ? 426  GLU A OE2 1 
ATOM   2719  N N   . GLN A 1 416 ? -26.888 -18.597 -9.864  1.00 118.18 ? 427  GLN A N   1 
ATOM   2720  C CA  . GLN A 1 416 ? -26.352 -18.191 -8.571  1.00 118.18 ? 427  GLN A CA  1 
ATOM   2721  C C   . GLN A 1 416 ? -25.822 -16.763 -8.686  1.00 118.18 ? 427  GLN A C   1 
ATOM   2722  O O   . GLN A 1 416 ? -25.376 -16.168 -7.701  1.00 118.18 ? 427  GLN A O   1 
ATOM   2723  C CB  . GLN A 1 416 ? -25.205 -19.111 -8.153  1.00 156.29 ? 427  GLN A CB  1 
ATOM   2724  C CG  . GLN A 1 416 ? -25.540 -20.588 -8.134  1.00 156.29 ? 427  GLN A CG  1 
ATOM   2725  C CD  . GLN A 1 416 ? -24.322 -21.442 -7.836  1.00 156.29 ? 427  GLN A CD  1 
ATOM   2726  O OE1 . GLN A 1 416 ? -24.383 -22.671 -7.882  1.00 156.29 ? 427  GLN A OE1 1 
ATOM   2727  N NE2 . GLN A 1 416 ? -23.204 -20.792 -7.525  1.00 156.29 ? 427  GLN A NE2 1 
ATOM   2728  N N   . LEU A 1 417 ? -25.865 -16.222 -9.899  1.00 99.44  ? 428  LEU A N   1 
ATOM   2729  C CA  . LEU A 1 417 ? -25.384 -14.871 -10.150 1.00 99.44  ? 428  LEU A CA  1 
ATOM   2730  C C   . LEU A 1 417 ? -26.539 -13.976 -10.564 1.00 99.44  ? 428  LEU A C   1 
ATOM   2731  O O   . LEU A 1 417 ? -26.443 -12.753 -10.507 1.00 99.44  ? 428  LEU A O   1 
ATOM   2732  C CB  . LEU A 1 417 ? -24.311 -14.886 -11.248 1.00 91.71  ? 428  LEU A CB  1 
ATOM   2733  C CG  . LEU A 1 417 ? -23.655 -13.558 -11.650 1.00 91.71  ? 428  LEU A CG  1 
ATOM   2734  C CD1 . LEU A 1 417 ? -23.143 -12.834 -10.422 1.00 91.71  ? 428  LEU A CD1 1 
ATOM   2735  C CD2 . LEU A 1 417 ? -22.512 -13.822 -12.615 1.00 91.71  ? 428  LEU A CD2 1 
ATOM   2736  N N   . TYR A 1 418 ? -27.632 -14.597 -10.985 1.00 79.34  ? 429  TYR A N   1 
ATOM   2737  C CA  . TYR A 1 418 ? -28.808 -13.858 -11.408 1.00 79.34  ? 429  TYR A CA  1 
ATOM   2738  C C   . TYR A 1 418 ? -29.786 -13.692 -10.251 1.00 79.34  ? 429  TYR A C   1 
ATOM   2739  O O   . TYR A 1 418 ? -30.266 -12.587 -9.993  1.00 79.34  ? 429  TYR A O   1 
ATOM   2740  C CB  . TYR A 1 418 ? -29.475 -14.559 -12.602 1.00 142.80 ? 429  TYR A CB  1 
ATOM   2741  C CG  . TYR A 1 418 ? -28.824 -14.243 -13.942 1.00 142.80 ? 429  TYR A CG  1 
ATOM   2742  C CD1 . TYR A 1 418 ? -29.222 -14.894 -15.110 1.00 142.80 ? 429  TYR A CD1 1 
ATOM   2743  C CD2 . TYR A 1 418 ? -27.823 -13.273 -14.043 1.00 142.80 ? 429  TYR A CD2 1 
ATOM   2744  C CE1 . TYR A 1 418 ? -28.640 -14.581 -16.349 1.00 142.80 ? 429  TYR A CE1 1 
ATOM   2745  C CE2 . TYR A 1 418 ? -27.238 -12.953 -15.274 1.00 142.80 ? 429  TYR A CE2 1 
ATOM   2746  C CZ  . TYR A 1 418 ? -27.650 -13.608 -16.420 1.00 142.80 ? 429  TYR A CZ  1 
ATOM   2747  O OH  . TYR A 1 418 ? -27.076 -13.281 -17.629 1.00 142.80 ? 429  TYR A OH  1 
ATOM   2748  N N   . SER A 1 419 ? -30.077 -14.778 -9.544  1.00 109.35 ? 430  SER A N   1 
ATOM   2749  C CA  . SER A 1 419 ? -30.988 -14.700 -8.409  1.00 109.35 ? 430  SER A CA  1 
ATOM   2750  C C   . SER A 1 419 ? -30.430 -13.683 -7.410  1.00 109.35 ? 430  SER A C   1 
ATOM   2751  O O   . SER A 1 419 ? -31.182 -12.932 -6.794  1.00 109.35 ? 430  SER A O   1 
ATOM   2752  C CB  . SER A 1 419 ? -31.123 -16.070 -7.742  1.00 198.85 ? 430  SER A CB  1 
ATOM   2753  O OG  . SER A 1 419 ? -32.051 -16.027 -6.673  1.00 198.85 ? 430  SER A OG  1 
ATOM   2754  N N   . LYS A 1 420 ? -29.104 -13.667 -7.267  1.00 80.35  ? 431  LYS A N   1 
ATOM   2755  C CA  . LYS A 1 420 ? -28.411 -12.749 -6.361  1.00 80.35  ? 431  LYS A CA  1 
ATOM   2756  C C   . LYS A 1 420 ? -28.725 -11.299 -6.669  1.00 80.35  ? 431  LYS A C   1 
ATOM   2757  O O   . LYS A 1 420 ? -29.241 -10.586 -5.823  1.00 80.35  ? 431  LYS A O   1 
ATOM   2758  C CB  . LYS A 1 420 ? -26.903 -12.947 -6.453  1.00 94.58  ? 431  LYS A CB  1 
ATOM   2759  C CG  . LYS A 1 420 ? -26.100 -11.802 -5.872  1.00 94.58  ? 431  LYS A CG  1 
ATOM   2760  C CD  . LYS A 1 420 ? -24.603 -12.057 -5.980  1.00 94.58  ? 431  LYS A CD  1 
ATOM   2761  C CE  . LYS A 1 420 ? -24.127 -13.219 -5.079  1.00 94.58  ? 431  LYS A CE  1 
ATOM   2762  N NZ  . LYS A 1 420 ? -24.494 -14.593 -5.558  1.00 94.58  ? 431  LYS A NZ  1 
ATOM   2763  N N   . TYR A 1 421 ? -28.396 -10.862 -7.878  1.00 68.11  ? 432  TYR A N   1 
ATOM   2764  C CA  . TYR A 1 421 ? -28.652 -9.491  -8.284  1.00 68.11  ? 432  TYR A CA  1 
ATOM   2765  C C   . TYR A 1 421 ? -30.127 -9.150  -8.160  1.00 68.11  ? 432  TYR A C   1 
ATOM   2766  O O   . TYR A 1 421 ? -30.489 -7.972  -8.061  1.00 68.11  ? 432  TYR A O   1 
ATOM   2767  C CB  . TYR A 1 421 ? -28.190 -9.262  -9.717  1.00 66.21  ? 432  TYR A CB  1 
ATOM   2768  C CG  . TYR A 1 421 ? -26.703 -9.415  -9.905  1.00 66.21  ? 432  TYR A CG  1 
ATOM   2769  C CD1 . TYR A 1 421 ? -25.860 -9.637  -8.819  1.00 66.21  ? 432  TYR A CD1 1 
ATOM   2770  C CD2 . TYR A 1 421 ? -26.135 -9.328  -11.169 1.00 66.21  ? 432  TYR A CD2 1 
ATOM   2771  C CE1 . TYR A 1 421 ? -24.482 -9.766  -8.991  1.00 66.21  ? 432  TYR A CE1 1 
ATOM   2772  C CE2 . TYR A 1 421 ? -24.761 -9.454  -11.353 1.00 66.21  ? 432  TYR A CE2 1 
ATOM   2773  C CZ  . TYR A 1 421 ? -23.941 -9.670  -10.263 1.00 66.21  ? 432  TYR A CZ  1 
ATOM   2774  O OH  . TYR A 1 421 ? -22.582 -9.781  -10.442 1.00 66.21  ? 432  TYR A OH  1 
ATOM   2775  N N   . ASP A 1 422 ? -30.976 -10.178 -8.178  1.00 60.36  ? 433  ASP A N   1 
ATOM   2776  C CA  . ASP A 1 422 ? -32.419 -9.977  -8.025  1.00 60.36  ? 433  ASP A CA  1 
ATOM   2777  C C   . ASP A 1 422 ? -32.632 -9.439  -6.609  1.00 60.36  ? 433  ASP A C   1 
ATOM   2778  O O   . ASP A 1 422 ? -33.502 -8.598  -6.368  1.00 60.36  ? 433  ASP A O   1 
ATOM   2779  C CB  . ASP A 1 422 ? -33.181 -11.302 -8.200  1.00 97.04  ? 433  ASP A CB  1 
ATOM   2780  C CG  . ASP A 1 422 ? -33.536 -11.604 -9.655  1.00 97.04  ? 433  ASP A CG  1 
ATOM   2781  O OD1 . ASP A 1 422 ? -34.184 -10.759 -10.311 1.00 97.04  ? 433  ASP A OD1 1 
ATOM   2782  O OD2 . ASP A 1 422 ? -33.182 -12.700 -10.136 1.00 97.04  ? 433  ASP A OD2 1 
ATOM   2783  N N   . GLU A 1 423 ? -31.824 -9.946  -5.679  1.00 68.78  ? 434  GLU A N   1 
ATOM   2784  C CA  . GLU A 1 423 ? -31.868 -9.527  -4.284  1.00 68.78  ? 434  GLU A CA  1 
ATOM   2785  C C   . GLU A 1 423 ? -31.323 -8.104  -4.184  1.00 68.78  ? 434  GLU A C   1 
ATOM   2786  O O   . GLU A 1 423 ? -31.971 -7.225  -3.616  1.00 68.78  ? 434  GLU A O   1 
ATOM   2787  C CB  . GLU A 1 423 ? -31.028 -10.466 -3.417  1.00 100.66 ? 434  GLU A CB  1 
ATOM   2788  C CG  . GLU A 1 423 ? -31.667 -11.819 -3.143  1.00 100.66 ? 434  GLU A CG  1 
ATOM   2789  C CD  . GLU A 1 423 ? -30.744 -12.754 -2.378  1.00 100.66 ? 434  GLU A CD  1 
ATOM   2790  O OE1 . GLU A 1 423 ? -31.226 -13.775 -1.835  1.00 100.66 ? 434  GLU A OE1 1 
ATOM   2791  O OE2 . GLU A 1 423 ? -29.527 -12.471 -2.328  1.00 100.66 ? 434  GLU A OE2 1 
ATOM   2792  N N   . MET A 1 424 ? -30.134 -7.877  -4.739  1.00 43.09  ? 435  MET A N   1 
ATOM   2793  C CA  . MET A 1 424 ? -29.538 -6.552  -4.724  1.00 43.09  ? 435  MET A CA  1 
ATOM   2794  C C   . MET A 1 424 ? -30.474 -5.590  -5.451  1.00 43.09  ? 435  MET A C   1 
ATOM   2795  O O   . MET A 1 424 ? -30.192 -4.401  -5.582  1.00 43.09  ? 435  MET A O   1 
ATOM   2796  C CB  . MET A 1 424 ? -28.180 -6.551  -5.420  1.00 57.79  ? 435  MET A CB  1 
ATOM   2797  C CG  . MET A 1 424 ? -27.079 -7.299  -4.704  1.00 57.79  ? 435  MET A CG  1 
ATOM   2798  S SD  . MET A 1 424 ? -25.488 -7.108  -5.587  1.00 57.79  ? 435  MET A SD  1 
ATOM   2799  C CE  . MET A 1 424 ? -24.446 -6.438  -4.279  1.00 57.79  ? 435  MET A CE  1 
ATOM   2800  N N   . SER A 1 425 ? -31.590 -6.115  -5.934  1.00 48.09  ? 436  SER A N   1 
ATOM   2801  C CA  . SER A 1 425 ? -32.578 -5.309  -6.637  1.00 48.09  ? 436  SER A CA  1 
ATOM   2802  C C   . SER A 1 425 ? -32.016 -4.534  -7.823  1.00 48.09  ? 436  SER A C   1 
ATOM   2803  O O   . SER A 1 425 ? -32.453 -3.422  -8.103  1.00 48.09  ? 436  SER A O   1 
ATOM   2804  C CB  . SER A 1 425 ? -33.247 -4.333  -5.665  1.00 114.36 ? 436  SER A CB  1 
ATOM   2805  O OG  . SER A 1 425 ? -34.293 -3.616  -6.303  1.00 114.36 ? 436  SER A OG  1 
ATOM   2806  N N   . ILE A 1 426 ? -31.056 -5.117  -8.529  1.00 50.34  ? 437  ILE A N   1 
ATOM   2807  C CA  . ILE A 1 426 ? -30.483 -4.435  -9.679  1.00 50.34  ? 437  ILE A CA  1 
ATOM   2808  C C   . ILE A 1 426 ? -31.573 -4.234  -10.739 1.00 50.34  ? 437  ILE A C   1 
ATOM   2809  O O   . ILE A 1 426 ? -32.739 -4.465  -10.456 1.00 50.34  ? 437  ILE A O   1 
ATOM   2810  C CB  . ILE A 1 426 ? -29.273 -5.236  -10.218 1.00 54.05  ? 437  ILE A CB  1 
ATOM   2811  C CG1 . ILE A 1 426 ? -28.233 -5.344  -9.097  1.00 54.05  ? 437  ILE A CG1 1 
ATOM   2812  C CG2 . ILE A 1 426 ? -28.654 -4.541  -11.442 1.00 54.05  ? 437  ILE A CG2 1 
ATOM   2813  C CD1 . ILE A 1 426 ? -26.915 -5.913  -9.505  1.00 54.05  ? 437  ILE A CD1 1 
ATOM   2814  N N   . LEU A 1 427 ? -31.229 -3.754  -11.927 1.00 68.69  ? 438  LEU A N   1 
ATOM   2815  C CA  . LEU A 1 427 ? -32.249 -3.582  -12.951 1.00 68.69  ? 438  LEU A CA  1 
ATOM   2816  C C   . LEU A 1 427 ? -31.990 -4.506  -14.139 1.00 68.69  ? 438  LEU A C   1 
ATOM   2817  O O   . LEU A 1 427 ? -32.876 -5.241  -14.573 1.00 68.69  ? 438  LEU A O   1 
ATOM   2818  C CB  . LEU A 1 427 ? -32.330 -2.125  -13.420 1.00 51.87  ? 438  LEU A CB  1 
ATOM   2819  C CG  . LEU A 1 427 ? -33.018 -1.093  -12.516 1.00 51.87  ? 438  LEU A CG  1 
ATOM   2820  C CD1 . LEU A 1 427 ? -33.450 0.127   -13.347 1.00 51.87  ? 438  LEU A CD1 1 
ATOM   2821  C CD2 . LEU A 1 427 ? -34.237 -1.721  -11.856 1.00 51.87  ? 438  LEU A CD2 1 
ATOM   2822  N N   . PHE A 1 428 ? -30.769 -4.470  -14.657 1.00 77.98  ? 439  PHE A N   1 
ATOM   2823  C CA  . PHE A 1 428 ? -30.387 -5.312  -15.781 1.00 77.98  ? 439  PHE A CA  1 
ATOM   2824  C C   . PHE A 1 428 ? -29.055 -5.961  -15.465 1.00 77.98  ? 439  PHE A C   1 
ATOM   2825  O O   . PHE A 1 428 ? -28.344 -5.525  -14.560 1.00 77.98  ? 439  PHE A O   1 
ATOM   2826  C CB  . PHE A 1 428 ? -30.278 -4.477  -17.056 1.00 71.99  ? 439  PHE A CB  1 
ATOM   2827  C CG  . PHE A 1 428 ? -31.561 -3.822  -17.447 1.00 71.99  ? 439  PHE A CG  1 
ATOM   2828  C CD1 . PHE A 1 428 ? -32.671 -4.591  -17.778 1.00 71.99  ? 439  PHE A CD1 1 
ATOM   2829  C CD2 . PHE A 1 428 ? -31.679 -2.438  -17.441 1.00 71.99  ? 439  PHE A CD2 1 
ATOM   2830  C CE1 . PHE A 1 428 ? -33.883 -3.996  -18.092 1.00 71.99  ? 439  PHE A CE1 1 
ATOM   2831  C CE2 . PHE A 1 428 ? -32.884 -1.825  -17.754 1.00 71.99  ? 439  PHE A CE2 1 
ATOM   2832  C CZ  . PHE A 1 428 ? -33.992 -2.609  -18.080 1.00 71.99  ? 439  PHE A CZ  1 
ATOM   2833  N N   . THR A 1 429 ? -28.714 -7.007  -16.204 1.00 87.55  ? 440  THR A N   1 
ATOM   2834  C CA  . THR A 1 429 ? -27.457 -7.693  -15.962 1.00 87.55  ? 440  THR A CA  1 
ATOM   2835  C C   . THR A 1 429 ? -26.731 -7.985  -17.267 1.00 87.55  ? 440  THR A C   1 
ATOM   2836  O O   . THR A 1 429 ? -26.812 -9.093  -17.799 1.00 87.55  ? 440  THR A O   1 
ATOM   2837  C CB  . THR A 1 429 ? -27.688 -9.012  -15.221 1.00 59.15  ? 440  THR A CB  1 
ATOM   2838  O OG1 . THR A 1 429 ? -28.675 -8.825  -14.192 1.00 59.15  ? 440  THR A OG1 1 
ATOM   2839  C CG2 . THR A 1 429 ? -26.389 -9.487  -14.597 1.00 59.15  ? 440  THR A CG2 1 
ATOM   2840  N N   . VAL A 1 430 ? -26.023 -6.983  -17.783 1.00 53.26  ? 441  VAL A N   1 
ATOM   2841  C CA  . VAL A 1 430 ? -25.292 -7.149  -19.025 1.00 53.26  ? 441  VAL A CA  1 
ATOM   2842  C C   . VAL A 1 430 ? -24.078 -8.026  -18.759 1.00 53.26  ? 441  VAL A C   1 
ATOM   2843  O O   . VAL A 1 430 ? -23.448 -7.954  -17.701 1.00 53.26  ? 441  VAL A O   1 
ATOM   2844  C CB  . VAL A 1 430 ? -24.842 -5.782  -19.643 1.00 66.61  ? 441  VAL A CB  1 
ATOM   2845  C CG1 . VAL A 1 430 ? -25.993 -4.789  -19.627 1.00 66.61  ? 441  VAL A CG1 1 
ATOM   2846  C CG2 . VAL A 1 430 ? -23.651 -5.226  -18.908 1.00 66.61  ? 441  VAL A CG2 1 
ATOM   2847  N N   . LEU A 1 431 ? -23.776 -8.874  -19.731 1.00 69.92  ? 442  LEU A N   1 
ATOM   2848  C CA  . LEU A 1 431 ? -22.660 -9.793  -19.646 1.00 69.92  ? 442  LEU A CA  1 
ATOM   2849  C C   . LEU A 1 431 ? -21.884 -9.693  -20.964 1.00 69.92  ? 442  LEU A C   1 
ATOM   2850  O O   . LEU A 1 431 ? -22.457 -9.797  -22.050 1.00 69.92  ? 442  LEU A O   1 
ATOM   2851  C CB  . LEU A 1 431 ? -23.198 -11.209 -19.420 1.00 61.25  ? 442  LEU A CB  1 
ATOM   2852  C CG  . LEU A 1 431 ? -22.236 -12.310 -18.977 1.00 61.25  ? 442  LEU A CG  1 
ATOM   2853  C CD1 . LEU A 1 431 ? -23.022 -13.566 -18.621 1.00 61.25  ? 442  LEU A CD1 1 
ATOM   2854  C CD2 . LEU A 1 431 ? -21.231 -12.583 -20.083 1.00 61.25  ? 442  LEU A CD2 1 
ATOM   2855  N N   . VAL A 1 432 ? -20.580 -9.461  -20.857 1.00 91.80  ? 443  VAL A N   1 
ATOM   2856  C CA  . VAL A 1 432 ? -19.719 -9.337  -22.026 1.00 91.80  ? 443  VAL A CA  1 
ATOM   2857  C C   . VAL A 1 432 ? -18.919 -10.612 -22.194 1.00 91.80  ? 443  VAL A C   1 
ATOM   2858  O O   . VAL A 1 432 ? -18.357 -11.134 -21.227 1.00 91.80  ? 443  VAL A O   1 
ATOM   2859  C CB  . VAL A 1 432 ? -18.741 -8.154  -21.883 1.00 115.96 ? 443  VAL A CB  1 
ATOM   2860  C CG1 . VAL A 1 432 ? -17.812 -8.105  -23.073 1.00 115.96 ? 443  VAL A CG1 1 
ATOM   2861  C CG2 . VAL A 1 432 ? -19.513 -6.851  -21.774 1.00 115.96 ? 443  VAL A CG2 1 
ATOM   2862  N N   . THR A 1 433 ? -18.885 -11.108 -23.428 1.00 177.45 ? 444  THR A N   1 
ATOM   2863  C CA  . THR A 1 433 ? -18.164 -12.330 -23.775 1.00 177.45 ? 444  THR A CA  1 
ATOM   2864  C C   . THR A 1 433 ? -17.304 -12.119 -25.018 1.00 177.45 ? 444  THR A C   1 
ATOM   2865  O O   . THR A 1 433 ? -17.190 -11.005 -25.528 1.00 177.45 ? 444  THR A O   1 
ATOM   2866  C CB  . THR A 1 433 ? -19.139 -13.509 -24.059 1.00 95.60  ? 444  THR A CB  1 
ATOM   2867  O OG1 . THR A 1 433 ? -20.261 -13.037 -24.818 1.00 95.60  ? 444  THR A OG1 1 
ATOM   2868  C CG2 . THR A 1 433 ? -19.625 -14.135 -22.762 1.00 95.60  ? 444  THR A CG2 1 
ATOM   2869  N N   . GLU A 1 434 ? -16.692 -13.199 -25.490 1.00 146.60 ? 445  GLU A N   1 
ATOM   2870  C CA  . GLU A 1 434 ? -15.863 -13.145 -26.684 1.00 146.60 ? 445  GLU A CA  1 
ATOM   2871  C C   . GLU A 1 434 ? -16.786 -12.847 -27.854 1.00 146.60 ? 445  GLU A C   1 
ATOM   2872  O O   . GLU A 1 434 ? -16.461 -12.038 -28.723 1.00 146.60 ? 445  GLU A O   1 
ATOM   2873  C CB  . GLU A 1 434 ? -15.170 -14.487 -26.910 1.00 183.37 ? 445  GLU A CB  1 
ATOM   2874  C CG  . GLU A 1 434 ? -14.347 -14.550 -28.182 1.00 183.37 ? 445  GLU A CG  1 
ATOM   2875  C CD  . GLU A 1 434 ? -13.818 -15.941 -28.456 1.00 183.37 ? 445  GLU A CD  1 
ATOM   2876  O OE1 . GLU A 1 434 ? -14.644 -16.874 -28.549 1.00 183.37 ? 445  GLU A OE1 1 
ATOM   2877  O OE2 . GLU A 1 434 ? -12.583 -16.100 -28.579 1.00 183.37 ? 445  GLU A OE2 1 
ATOM   2878  N N   . THR A 1 435 ? -17.943 -13.505 -27.860 1.00 167.08 ? 446  THR A N   1 
ATOM   2879  C CA  . THR A 1 435 ? -18.936 -13.318 -28.911 1.00 167.08 ? 446  THR A CA  1 
ATOM   2880  C C   . THR A 1 435 ? -19.435 -11.873 -28.932 1.00 167.08 ? 446  THR A C   1 
ATOM   2881  O O   . THR A 1 435 ? -20.439 -11.559 -29.572 1.00 167.08 ? 446  THR A O   1 
ATOM   2882  C CB  . THR A 1 435 ? -20.142 -14.294 -28.734 1.00 110.22 ? 446  THR A CB  1 
ATOM   2883  O OG1 . THR A 1 435 ? -21.156 -13.988 -29.699 1.00 110.22 ? 446  THR A OG1 1 
ATOM   2884  C CG2 . THR A 1 435 ? -20.730 -14.193 -27.337 1.00 110.22 ? 446  THR A CG2 1 
ATOM   2885  N N   . THR A 1 436 ? -18.722 -10.999 -28.225 1.00 98.21  ? 447  THR A N   1 
ATOM   2886  C CA  . THR A 1 436 ? -19.061 -9.581  -28.167 1.00 98.21  ? 447  THR A CA  1 
ATOM   2887  C C   . THR A 1 436 ? -18.012 -8.846  -28.985 1.00 98.21  ? 447  THR A C   1 
ATOM   2888  O O   . THR A 1 436 ? -18.314 -7.883  -29.687 1.00 98.21  ? 447  THR A O   1 
ATOM   2889  C CB  . THR A 1 436 ? -19.003 -9.021  -26.724 1.00 103.97 ? 447  THR A CB  1 
ATOM   2890  O OG1 . THR A 1 436 ? -19.808 -9.826  -25.854 1.00 103.97 ? 447  THR A OG1 1 
ATOM   2891  C CG2 . THR A 1 436 ? -19.508 -7.576  -26.692 1.00 103.97 ? 447  THR A CG2 1 
ATOM   2892  N N   . LEU A 1 437 ? -16.772 -9.315  -28.879 1.00 104.05 ? 448  LEU A N   1 
ATOM   2893  C CA  . LEU A 1 437 ? -15.656 -8.720  -29.595 1.00 104.05 ? 448  LEU A CA  1 
ATOM   2894  C C   . LEU A 1 437 ? -15.741 -9.026  -31.080 1.00 104.05 ? 448  LEU A C   1 
ATOM   2895  O O   . LEU A 1 437 ? -15.456 -8.161  -31.910 1.00 104.05 ? 448  LEU A O   1 
ATOM   2896  C CB  . LEU A 1 437 ? -14.341 -9.248  -29.030 1.00 105.87 ? 448  LEU A CB  1 
ATOM   2897  C CG  . LEU A 1 437 ? -14.025 -8.809  -27.599 1.00 105.87 ? 448  LEU A CG  1 
ATOM   2898  C CD1 . LEU A 1 437 ? -13.100 -9.820  -26.947 1.00 105.87 ? 448  LEU A CD1 1 
ATOM   2899  C CD2 . LEU A 1 437 ? -13.406 -7.415  -27.609 1.00 105.87 ? 448  LEU A CD2 1 
ATOM   2900  N N   . GLU A 1 438 ? -16.138 -10.256 -31.410 1.00 156.09 ? 449  GLU A N   1 
ATOM   2901  C CA  . GLU A 1 438 ? -16.262 -10.683 -32.804 1.00 156.09 ? 449  GLU A CA  1 
ATOM   2902  C C   . GLU A 1 438 ? -17.551 -10.181 -33.446 1.00 156.09 ? 449  GLU A C   1 
ATOM   2903  O O   . GLU A 1 438 ? -18.218 -10.917 -34.172 1.00 156.09 ? 449  GLU A O   1 
ATOM   2904  C CB  . GLU A 1 438 ? -16.190 -12.221 -32.918 1.00 94.30  ? 449  GLU A CB  1 
ATOM   2905  C CG  . GLU A 1 438 ? -17.210 -13.011 -32.083 1.00 94.30  ? 449  GLU A CG  1 
ATOM   2906  C CD  . GLU A 1 438 ? -17.153 -14.528 -32.333 1.00 94.30  ? 449  GLU A CD  1 
ATOM   2907  O OE1 . GLU A 1 438 ? -16.040 -15.092 -32.442 1.00 94.30  ? 449  GLU A OE1 1 
ATOM   2908  O OE2 . GLU A 1 438 ? -18.229 -15.160 -32.405 1.00 94.30  ? 449  GLU A OE2 1 
ATOM   2909  N N   . ASN A 1 439 ? -17.892 -8.923  -33.176 1.00 116.76 ? 450  ASN A N   1 
ATOM   2910  C CA  . ASN A 1 439 ? -19.102 -8.312  -33.720 1.00 116.76 ? 450  ASN A CA  1 
ATOM   2911  C C   . ASN A 1 439 ? -19.367 -6.932  -33.117 1.00 116.76 ? 450  ASN A C   1 
ATOM   2912  O O   . ASN A 1 439 ? -19.010 -5.903  -33.703 1.00 116.76 ? 450  ASN A O   1 
ATOM   2913  C CB  . ASN A 1 439 ? -20.311 -9.228  -33.474 1.00 177.45 ? 450  ASN A CB  1 
ATOM   2914  C CG  . ASN A 1 439 ? -20.347 -9.787  -32.058 1.00 177.45 ? 450  ASN A CG  1 
ATOM   2915  O OD1 . ASN A 1 439 ? -19.374 -10.373 -31.585 1.00 177.45 ? 450  ASN A OD1 1 
ATOM   2916  N ND2 . ASN A 1 439 ? -21.475 -9.618  -31.382 1.00 177.45 ? 450  ASN A ND2 1 
ATOM   2917  N N   . GLY A 1 440 ? -19.993 -6.928  -31.942 1.00 91.25  ? 451  GLY A N   1 
ATOM   2918  C CA  . GLY A 1 440 ? -20.316 -5.690  -31.254 1.00 91.25  ? 451  GLY A CA  1 
ATOM   2919  C C   . GLY A 1 440 ? -21.662 -5.812  -30.564 1.00 91.25  ? 451  GLY A C   1 
ATOM   2920  O O   . GLY A 1 440 ? -22.495 -4.903  -30.632 1.00 91.25  ? 451  GLY A O   1 
ATOM   2921  N N   . LEU A 1 441 ? -21.874 -6.941  -29.892 1.00 82.21  ? 452  LEU A N   1 
ATOM   2922  C CA  . LEU A 1 441 ? -23.133 -7.198  -29.201 1.00 82.21  ? 452  LEU A CA  1 
ATOM   2923  C C   . LEU A 1 441 ? -22.946 -7.871  -27.838 1.00 82.21  ? 452  LEU A C   1 
ATOM   2924  O O   . LEU A 1 441 ? -22.036 -8.681  -27.652 1.00 82.21  ? 452  LEU A O   1 
ATOM   2925  C CB  . LEU A 1 441 ? -24.028 -8.096  -30.067 1.00 201.86 ? 452  LEU A CB  1 
ATOM   2926  C CG  . LEU A 1 441 ? -24.412 -7.735  -31.511 1.00 201.86 ? 452  LEU A CG  1 
ATOM   2927  C CD1 . LEU A 1 441 ? -25.039 -6.362  -31.536 1.00 201.86 ? 452  LEU A CD1 1 
ATOM   2928  C CD2 . LEU A 1 441 ? -23.205 -7.772  -32.429 1.00 201.86 ? 452  LEU A CD2 1 
ATOM   2929  N N   . ILE A 1 442 ? -23.810 -7.519  -26.889 1.00 99.54  ? 453  ILE A N   1 
ATOM   2930  C CA  . ILE A 1 442 ? -23.807 -8.109  -25.548 1.00 99.54  ? 453  ILE A CA  1 
ATOM   2931  C C   . ILE A 1 442 ? -25.227 -8.609  -25.312 1.00 99.54  ? 453  ILE A C   1 
ATOM   2932  O O   . ILE A 1 442 ? -26.044 -8.598  -26.236 1.00 99.54  ? 453  ILE A O   1 
ATOM   2933  C CB  . ILE A 1 442 ? -23.421 -7.082  -24.420 1.00 45.50  ? 453  ILE A CB  1 
ATOM   2934  C CG1 . ILE A 1 442 ? -23.988 -5.685  -24.717 1.00 45.50  ? 453  ILE A CG1 1 
ATOM   2935  C CG2 . ILE A 1 442 ? -21.922 -7.037  -24.257 1.00 45.50  ? 453  ILE A CG2 1 
ATOM   2936  C CD1 . ILE A 1 442 ? -25.233 -5.297  -23.906 1.00 45.50  ? 453  ILE A CD1 1 
ATOM   2937  N N   . HIS A 1 443 ? -25.531 -9.048  -24.095 1.00 92.82  ? 454  HIS A N   1 
ATOM   2938  C CA  . HIS A 1 443 ? -26.876 -9.534  -23.802 1.00 92.82  ? 454  HIS A CA  1 
ATOM   2939  C C   . HIS A 1 443 ? -27.359 -9.211  -22.393 1.00 92.82  ? 454  HIS A C   1 
ATOM   2940  O O   . HIS A 1 443 ? -26.983 -9.873  -21.426 1.00 92.82  ? 454  HIS A O   1 
ATOM   2941  C CB  . HIS A 1 443 ? -26.951 -11.042 -24.045 1.00 125.06 ? 454  HIS A CB  1 
ATOM   2942  C CG  . HIS A 1 443 ? -25.833 -11.807 -23.417 1.00 125.06 ? 454  HIS A CG  1 
ATOM   2943  N ND1 . HIS A 1 443 ? -24.509 -11.476 -23.610 1.00 125.06 ? 454  HIS A ND1 1 
ATOM   2944  C CD2 . HIS A 1 443 ? -25.837 -12.893 -22.610 1.00 125.06 ? 454  HIS A CD2 1 
ATOM   2945  C CE1 . HIS A 1 443 ? -23.746 -12.326 -22.948 1.00 125.06 ? 454  HIS A CE1 1 
ATOM   2946  N NE2 . HIS A 1 443 ? -24.526 -13.196 -22.333 1.00 125.06 ? 454  HIS A NE2 1 
ATOM   2947  N N   . LEU A 1 444 ? -28.211 -8.194  -22.291 1.00 71.01  ? 455  LEU A N   1 
ATOM   2948  C CA  . LEU A 1 444 ? -28.747 -7.777  -21.001 1.00 71.01  ? 455  LEU A CA  1 
ATOM   2949  C C   . LEU A 1 444 ? -30.007 -8.537  -20.646 1.00 71.01  ? 455  LEU A C   1 
ATOM   2950  O O   . LEU A 1 444 ? -30.915 -8.690  -21.460 1.00 71.01  ? 455  LEU A O   1 
ATOM   2951  C CB  . LEU A 1 444 ? -29.065 -6.275  -20.988 1.00 76.09  ? 455  LEU A CB  1 
ATOM   2952  C CG  . LEU A 1 444 ? -30.240 -5.812  -21.854 1.00 76.09  ? 455  LEU A CG  1 
ATOM   2953  C CD1 . LEU A 1 444 ? -30.511 -4.338  -21.648 1.00 76.09  ? 455  LEU A CD1 1 
ATOM   2954  C CD2 . LEU A 1 444 ? -29.923 -6.090  -23.298 1.00 76.09  ? 455  LEU A CD2 1 
ATOM   2955  N N   . ARG A 1 445 ? -30.045 -9.009  -19.411 1.00 107.34 ? 456  ARG A N   1 
ATOM   2956  C CA  . ARG A 1 445 ? -31.190 -9.731  -18.906 1.00 107.34 ? 456  ARG A CA  1 
ATOM   2957  C C   . ARG A 1 445 ? -31.981 -8.716  -18.105 1.00 107.34 ? 456  ARG A C   1 
ATOM   2958  O O   . ARG A 1 445 ? -31.470 -7.643  -17.794 1.00 107.34 ? 456  ARG A O   1 
ATOM   2959  C CB  . ARG A 1 445 ? -30.721 -10.868 -18.017 1.00 90.39  ? 456  ARG A CB  1 
ATOM   2960  C CG  . ARG A 1 445 ? -31.815 -11.555 -17.279 1.00 90.39  ? 456  ARG A CG  1 
ATOM   2961  C CD  . ARG A 1 445 ? -31.258 -12.744 -16.552 1.00 90.39  ? 456  ARG A CD  1 
ATOM   2962  N NE  . ARG A 1 445 ? -32.096 -13.085 -15.417 1.00 90.39  ? 456  ARG A NE  1 
ATOM   2963  C CZ  . ARG A 1 445 ? -32.303 -12.272 -14.389 1.00 90.39  ? 456  ARG A CZ  1 
ATOM   2964  N NH1 . ARG A 1 445 ? -31.722 -11.076 -14.363 1.00 90.39  ? 456  ARG A NH1 1 
ATOM   2965  N NH2 . ARG A 1 445 ? -33.105 -12.646 -13.399 1.00 90.39  ? 456  ARG A NH2 1 
ATOM   2966  N N   . SER A 1 446 ? -33.224 -9.041  -17.775 1.00 56.01  ? 457  SER A N   1 
ATOM   2967  C CA  . SER A 1 446 ? -34.056 -8.118  -17.011 1.00 56.01  ? 457  SER A CA  1 
ATOM   2968  C C   . SER A 1 446 ? -34.330 -8.631  -15.601 1.00 56.01  ? 457  SER A C   1 
ATOM   2969  O O   . SER A 1 446 ? -34.051 -9.785  -15.280 1.00 56.01  ? 457  SER A O   1 
ATOM   2970  C CB  . SER A 1 446 ? -35.384 -7.877  -17.738 1.00 52.49  ? 457  SER A CB  1 
ATOM   2971  O OG  . SER A 1 446 ? -36.114 -6.815  -17.141 1.00 52.49  ? 457  SER A OG  1 
ATOM   2972  N N   . ARG A 1 447 ? -34.857 -7.760  -14.751 1.00 88.20  ? 458  ARG A N   1 
ATOM   2973  C CA  . ARG A 1 447 ? -35.182 -8.167  -13.398 1.00 88.20  ? 458  ARG A CA  1 
ATOM   2974  C C   . ARG A 1 447 ? -36.659 -8.525  -13.396 1.00 88.20  ? 458  ARG A C   1 
ATOM   2975  O O   . ARG A 1 447 ? -37.101 -9.401  -12.649 1.00 88.20  ? 458  ARG A O   1 
ATOM   2976  C CB  . ARG A 1 447 ? -34.925 -7.037  -12.404 1.00 70.33  ? 458  ARG A CB  1 
ATOM   2977  C CG  . ARG A 1 447 ? -35.203 -7.447  -10.966 1.00 70.33  ? 458  ARG A CG  1 
ATOM   2978  C CD  . ARG A 1 447 ? -35.169 -6.263  -10.045 1.00 70.33  ? 458  ARG A CD  1 
ATOM   2979  N NE  . ARG A 1 447 ? -36.021 -5.189  -10.535 1.00 70.33  ? 458  ARG A NE  1 
ATOM   2980  C CZ  . ARG A 1 447 ? -36.091 -3.990  -9.969  1.00 70.33  ? 458  ARG A CZ  1 
ATOM   2981  N NH1 . ARG A 1 447 ? -35.357 -3.720  -8.893  1.00 70.33  ? 458  ARG A NH1 1 
ATOM   2982  N NH2 . ARG A 1 447 ? -36.889 -3.063  -10.479 1.00 70.33  ? 458  ARG A NH2 1 
ATOM   2983  N N   . ASP A 1 448 ? -37.411 -7.843  -14.256 1.00 103.14 ? 459  ASP A N   1 
ATOM   2984  C CA  . ASP A 1 448 ? -38.846 -8.059  -14.380 1.00 103.14 ? 459  ASP A CA  1 
ATOM   2985  C C   . ASP A 1 448 ? -39.177 -9.017  -15.527 1.00 103.14 ? 459  ASP A C   1 
ATOM   2986  O O   . ASP A 1 448 ? -39.396 -10.209 -15.307 1.00 103.14 ? 459  ASP A O   1 
ATOM   2987  C CB  . ASP A 1 448 ? -39.542 -6.716  -14.601 1.00 122.92 ? 459  ASP A CB  1 
ATOM   2988  C CG  . ASP A 1 448 ? -39.099 -5.665  -13.603 1.00 122.92 ? 459  ASP A CG  1 
ATOM   2989  O OD1 . ASP A 1 448 ? -39.326 -5.858  -12.389 1.00 122.92 ? 459  ASP A OD1 1 
ATOM   2990  O OD2 . ASP A 1 448 ? -38.517 -4.649  -14.034 1.00 122.92 ? 459  ASP A OD2 1 
ATOM   2991  N N   . THR A 1 449 ? -39.207 -8.497  -16.752 1.00 91.75  ? 460  THR A N   1 
ATOM   2992  C CA  . THR A 1 449 ? -39.514 -9.318  -17.916 1.00 91.75  ? 460  THR A CA  1 
ATOM   2993  C C   . THR A 1 449 ? -38.616 -10.556 -17.965 1.00 91.75  ? 460  THR A C   1 
ATOM   2994  O O   . THR A 1 449 ? -38.845 -11.471 -18.753 1.00 91.75  ? 460  THR A O   1 
ATOM   2995  C CB  . THR A 1 449 ? -39.370 -8.507  -19.246 1.00 91.60  ? 460  THR A CB  1 
ATOM   2996  O OG1 . THR A 1 449 ? -38.014 -8.078  -19.423 1.00 91.60  ? 460  THR A OG1 1 
ATOM   2997  C CG2 . THR A 1 449 ? -40.278 -7.284  -19.224 1.00 91.60  ? 460  THR A CG2 1 
ATOM   2998  N N   . THR A 1 450 ? -37.604 -10.579 -17.104 1.00 94.50  ? 461  THR A N   1 
ATOM   2999  C CA  . THR A 1 450 ? -36.652 -11.686 -17.007 1.00 94.50  ? 461  THR A CA  1 
ATOM   3000  C C   . THR A 1 450 ? -36.172 -12.309 -18.329 1.00 94.50  ? 461  THR A C   1 
ATOM   3001  O O   . THR A 1 450 ? -35.629 -13.421 -18.338 1.00 94.50  ? 461  THR A O   1 
ATOM   3002  C CB  . THR A 1 450 ? -37.204 -12.809 -16.082 1.00 43.48  ? 461  THR A CB  1 
ATOM   3003  O OG1 . THR A 1 450 ? -36.316 -13.932 -16.109 1.00 43.48  ? 461  THR A OG1 1 
ATOM   3004  C CG2 . THR A 1 450 ? -38.577 -13.247 -16.517 1.00 43.48  ? 461  THR A CG2 1 
ATOM   3005  N N   . MET A 1 451 ? -36.349 -11.585 -19.434 1.00 138.21 ? 462  MET A N   1 
ATOM   3006  C CA  . MET A 1 451 ? -35.928 -12.063 -20.753 1.00 138.21 ? 462  MET A CA  1 
ATOM   3007  C C   . MET A 1 451 ? -34.410 -12.012 -20.882 1.00 138.21 ? 462  MET A C   1 
ATOM   3008  O O   . MET A 1 451 ? -33.759 -11.228 -20.195 1.00 138.21 ? 462  MET A O   1 
ATOM   3009  C CB  . MET A 1 451 ? -36.544 -11.199 -21.858 1.00 159.92 ? 462  MET A CB  1 
ATOM   3010  C CG  . MET A 1 451 ? -38.053 -11.297 -21.989 1.00 159.92 ? 462  MET A CG  1 
ATOM   3011  S SD  . MET A 1 451 ? -38.670 -10.240 -23.317 1.00 159.92 ? 462  MET A SD  1 
ATOM   3012  C CE  . MET A 1 451 ? -38.512 -11.329 -24.734 1.00 159.92 ? 462  MET A CE  1 
ATOM   3013  N N   . LYS A 1 452 ? -33.849 -12.839 -21.764 1.00 93.85  ? 463  LYS A N   1 
ATOM   3014  C CA  . LYS A 1 452 ? -32.398 -12.863 -21.974 1.00 93.85  ? 463  LYS A CA  1 
ATOM   3015  C C   . LYS A 1 452 ? -32.021 -12.343 -23.368 1.00 93.85  ? 463  LYS A C   1 
ATOM   3016  O O   . LYS A 1 452 ? -31.257 -12.980 -24.102 1.00 93.85  ? 463  LYS A O   1 
ATOM   3017  C CB  . LYS A 1 452 ? -31.851 -14.284 -21.749 1.00 77.07  ? 463  LYS A CB  1 
ATOM   3018  C CG  . LYS A 1 452 ? -31.985 -14.772 -20.293 1.00 77.07  ? 463  LYS A CG  1 
ATOM   3019  C CD  . LYS A 1 452 ? -31.489 -16.211 -20.080 1.00 77.07  ? 463  LYS A CD  1 
ATOM   3020  C CE  . LYS A 1 452 ? -31.768 -16.688 -18.638 1.00 77.07  ? 463  LYS A CE  1 
ATOM   3021  N NZ  . LYS A 1 452 ? -31.325 -18.089 -18.353 1.00 77.07  ? 463  LYS A NZ  1 
ATOM   3022  N N   . GLU A 1 453 ? -32.563 -11.169 -23.701 1.00 88.18  ? 464  GLU A N   1 
ATOM   3023  C CA  . GLU A 1 453 ? -32.349 -10.486 -24.982 1.00 88.18  ? 464  GLU A CA  1 
ATOM   3024  C C   . GLU A 1 453 ? -30.909 -10.430 -25.485 1.00 88.18  ? 464  GLU A C   1 
ATOM   3025  O O   . GLU A 1 453 ? -29.968 -10.810 -24.785 1.00 88.18  ? 464  GLU A O   1 
ATOM   3026  C CB  . GLU A 1 453 ? -32.878 -9.048  -24.911 1.00 122.68 ? 464  GLU A CB  1 
ATOM   3027  C CG  . GLU A 1 453 ? -34.387 -8.906  -24.921 1.00 122.68 ? 464  GLU A CG  1 
ATOM   3028  C CD  . GLU A 1 453 ? -34.834 -7.453  -24.825 1.00 122.68 ? 464  GLU A CD  1 
ATOM   3029  O OE1 . GLU A 1 453 ? -36.043 -7.193  -24.988 1.00 122.68 ? 464  GLU A OE1 1 
ATOM   3030  O OE2 . GLU A 1 453 ? -33.983 -6.570  -24.583 1.00 122.68 ? 464  GLU A OE2 1 
ATOM   3031  N N   . MET A 1 454 ? -30.769 -9.941  -26.716 1.00 97.80  ? 465  MET A N   1 
ATOM   3032  C CA  . MET A 1 454 ? -29.486 -9.780  -27.399 1.00 97.80  ? 465  MET A CA  1 
ATOM   3033  C C   . MET A 1 454 ? -29.386 -8.276  -27.652 1.00 97.80  ? 465  MET A C   1 
ATOM   3034  O O   . MET A 1 454 ? -30.305 -7.695  -28.228 1.00 97.80  ? 465  MET A O   1 
ATOM   3035  C CB  . MET A 1 454 ? -29.510 -10.521 -28.746 1.00 145.30 ? 465  MET A CB  1 
ATOM   3036  C CG  . MET A 1 454 ? -30.040 -11.961 -28.692 1.00 145.30 ? 465  MET A CG  1 
ATOM   3037  S SD  . MET A 1 454 ? -30.430 -12.687 -30.323 1.00 145.30 ? 465  MET A SD  1 
ATOM   3038  C CE  . MET A 1 454 ? -28.904 -13.560 -30.707 1.00 145.30 ? 465  MET A CE  1 
ATOM   3039  N N   . MET A 1 455 ? -28.301 -7.632  -27.231 1.00 78.27  ? 466  MET A N   1 
ATOM   3040  C CA  . MET A 1 455 ? -28.200 -6.189  -27.451 1.00 78.27  ? 466  MET A CA  1 
ATOM   3041  C C   . MET A 1 455 ? -26.881 -5.699  -28.043 1.00 78.27  ? 466  MET A C   1 
ATOM   3042  O O   . MET A 1 455 ? -25.811 -6.243  -27.761 1.00 78.27  ? 466  MET A O   1 
ATOM   3043  C CB  . MET A 1 455 ? -28.492 -5.440  -26.149 1.00 151.46 ? 466  MET A CB  1 
ATOM   3044  C CG  . MET A 1 455 ? -28.756 -3.954  -26.339 1.00 151.46 ? 466  MET A CG  1 
ATOM   3045  S SD  . MET A 1 455 ? -29.529 -3.188  -24.903 1.00 151.46 ? 466  MET A SD  1 
ATOM   3046  C CE  . MET A 1 455 ? -28.133 -3.079  -23.834 1.00 151.46 ? 466  MET A CE  1 
ATOM   3047  N N   . HIS A 1 456 ? -26.976 -4.653  -28.857 1.00 130.55 ? 467  HIS A N   1 
ATOM   3048  C CA  . HIS A 1 456 ? -25.825 -4.063  -29.534 1.00 130.55 ? 467  HIS A CA  1 
ATOM   3049  C C   . HIS A 1 456 ? -24.988 -3.163  -28.619 1.00 130.55 ? 467  HIS A C   1 
ATOM   3050  O O   . HIS A 1 456 ? -25.215 -1.955  -28.565 1.00 130.55 ? 467  HIS A O   1 
ATOM   3051  C CB  . HIS A 1 456 ? -26.317 -3.260  -30.743 1.00 201.98 ? 467  HIS A CB  1 
ATOM   3052  C CG  . HIS A 1 456 ? -27.616 -3.754  -31.310 1.00 201.98 ? 467  HIS A CG  1 
ATOM   3053  N ND1 . HIS A 1 456 ? -27.795 -5.046  -31.754 1.00 201.98 ? 467  HIS A ND1 1 
ATOM   3054  C CD2 . HIS A 1 456 ? -28.802 -3.126  -31.499 1.00 201.98 ? 467  HIS A CD2 1 
ATOM   3055  C CE1 . HIS A 1 456 ? -29.032 -5.194  -32.192 1.00 201.98 ? 467  HIS A CE1 1 
ATOM   3056  N NE2 . HIS A 1 456 ? -29.665 -4.044  -32.048 1.00 201.98 ? 467  HIS A NE2 1 
ATOM   3057  N N   . ILE A 1 457 ? -24.014 -3.750  -27.922 1.00 75.61  ? 468  ILE A N   1 
ATOM   3058  C CA  . ILE A 1 457 ? -23.152 -3.009  -26.993 1.00 75.61  ? 468  ILE A CA  1 
ATOM   3059  C C   . ILE A 1 457 ? -22.579 -1.703  -27.536 1.00 75.61  ? 468  ILE A C   1 
ATOM   3060  O O   . ILE A 1 457 ? -21.392 -1.621  -27.857 1.00 75.61  ? 468  ILE A O   1 
ATOM   3061  C CB  . ILE A 1 457 ? -21.977 -3.888  -26.503 1.00 89.08  ? 468  ILE A CB  1 
ATOM   3062  C CG1 . ILE A 1 457 ? -21.105 -3.101  -25.524 1.00 89.08  ? 468  ILE A CG1 1 
ATOM   3063  C CG2 . ILE A 1 457 ? -21.165 -4.376  -27.680 1.00 89.08  ? 468  ILE A CG2 1 
ATOM   3064  C CD1 . ILE A 1 457 ? -19.979 -3.917  -24.935 1.00 89.08  ? 468  ILE A CD1 1 
ATOM   3065  N N   . SER A 1 458 ? -23.437 -0.687  -27.611 1.00 69.09  ? 469  SER A N   1 
ATOM   3066  C CA  . SER A 1 458 ? -23.090 0.645   -28.108 1.00 69.09  ? 469  SER A CA  1 
ATOM   3067  C C   . SER A 1 458 ? -24.342 1.513   -28.099 1.00 69.09  ? 469  SER A C   1 
ATOM   3068  O O   . SER A 1 458 ? -24.273 2.736   -28.240 1.00 69.09  ? 469  SER A O   1 
ATOM   3069  C CB  . SER A 1 458 ? -22.529 0.575   -29.534 1.00 201.99 ? 469  SER A CB  1 
ATOM   3070  O OG  . SER A 1 458 ? -21.181 0.138   -29.545 1.00 201.99 ? 469  SER A OG  1 
ATOM   3071  N N   . LYS A 1 459 ? -25.487 0.858   -27.930 1.00 146.45 ? 470  LYS A N   1 
ATOM   3072  C CA  . LYS A 1 459 ? -26.784 1.524   -27.878 1.00 146.45 ? 470  LYS A CA  1 
ATOM   3073  C C   . LYS A 1 459 ? -27.384 1.179   -26.517 1.00 146.45 ? 470  LYS A C   1 
ATOM   3074  O O   . LYS A 1 459 ? -28.589 1.296   -26.296 1.00 146.45 ? 470  LYS A O   1 
ATOM   3075  C CB  . LYS A 1 459 ? -27.682 1.004   -29.007 1.00 141.76 ? 470  LYS A CB  1 
ATOM   3076  C CG  . LYS A 1 459 ? -28.941 1.820   -29.252 1.00 141.76 ? 470  LYS A CG  1 
ATOM   3077  C CD  . LYS A 1 459 ? -29.593 1.416   -30.567 1.00 141.76 ? 470  LYS A CD  1 
ATOM   3078  C CE  . LYS A 1 459 ? -30.743 2.344   -30.928 1.00 141.76 ? 470  LYS A CE  1 
ATOM   3079  N NZ  . LYS A 1 459 ? -31.324 2.046   -32.271 1.00 141.76 ? 470  LYS A NZ  1 
ATOM   3080  N N   . LEU A 1 460 ? -26.509 0.747   -25.614 1.00 90.10  ? 471  LEU A N   1 
ATOM   3081  C CA  . LEU A 1 460 ? -26.876 0.359   -24.257 1.00 90.10  ? 471  LEU A CA  1 
ATOM   3082  C C   . LEU A 1 460 ? -26.982 1.588   -23.356 1.00 90.10  ? 471  LEU A C   1 
ATOM   3083  O O   . LEU A 1 460 ? -27.838 1.652   -22.474 1.00 90.10  ? 471  LEU A O   1 
ATOM   3084  C CB  . LEU A 1 460 ? -25.837 -0.646  -23.719 1.00 40.26  ? 471  LEU A CB  1 
ATOM   3085  C CG  . LEU A 1 460 ? -25.772 -1.108  -22.256 1.00 40.26  ? 471  LEU A CG  1 
ATOM   3086  C CD1 . LEU A 1 460 ? -27.068 -0.879  -21.515 1.00 40.26  ? 471  LEU A CD1 1 
ATOM   3087  C CD2 . LEU A 1 460 ? -25.412 -2.580  -22.252 1.00 40.26  ? 471  LEU A CD2 1 
ATOM   3088  N N   . LYS A 1 461 ? -26.118 2.569   -23.587 1.00 104.51 ? 472  LYS A N   1 
ATOM   3089  C CA  . LYS A 1 461 ? -26.139 3.793   -22.798 1.00 104.51 ? 472  LYS A CA  1 
ATOM   3090  C C   . LYS A 1 461 ? -27.460 4.518   -23.036 1.00 104.51 ? 472  LYS A C   1 
ATOM   3091  O O   . LYS A 1 461 ? -28.273 4.672   -22.119 1.00 104.51 ? 472  LYS A O   1 
ATOM   3092  C CB  . LYS A 1 461 ? -24.972 4.698   -23.196 1.00 120.09 ? 472  LYS A CB  1 
ATOM   3093  C CG  . LYS A 1 461 ? -24.914 6.012   -22.436 1.00 120.09 ? 472  LYS A CG  1 
ATOM   3094  C CD  . LYS A 1 461 ? -23.736 6.857   -22.893 1.00 120.09 ? 472  LYS A CD  1 
ATOM   3095  C CE  . LYS A 1 461 ? -23.897 7.339   -24.332 1.00 120.09 ? 472  LYS A CE  1 
ATOM   3096  N NZ  . LYS A 1 461 ? -25.020 8.307   -24.482 1.00 120.09 ? 472  LYS A NZ  1 
ATOM   3097  N N   . ASP A 1 462 ? -27.669 4.953   -24.276 1.00 85.38  ? 473  ASP A N   1 
ATOM   3098  C CA  . ASP A 1 462 ? -28.888 5.661   -24.650 1.00 85.38  ? 473  ASP A CA  1 
ATOM   3099  C C   . ASP A 1 462 ? -30.140 4.847   -24.353 1.00 85.38  ? 473  ASP A C   1 
ATOM   3100  O O   . ASP A 1 462 ? -31.230 5.398   -24.257 1.00 85.38  ? 473  ASP A O   1 
ATOM   3101  C CB  . ASP A 1 462 ? -28.855 6.035   -26.135 1.00 135.70 ? 473  ASP A CB  1 
ATOM   3102  C CG  . ASP A 1 462 ? -28.047 7.294   -26.403 1.00 135.70 ? 473  ASP A CG  1 
ATOM   3103  O OD1 . ASP A 1 462 ? -28.467 8.381   -25.949 1.00 135.70 ? 473  ASP A OD1 1 
ATOM   3104  O OD2 . ASP A 1 462 ? -26.994 7.197   -27.065 1.00 135.70 ? 473  ASP A OD2 1 
ATOM   3105  N N   . PHE A 1 463 ? -29.983 3.536   -24.214 1.00 79.69  ? 474  PHE A N   1 
ATOM   3106  C CA  . PHE A 1 463 ? -31.112 2.662   -23.916 1.00 79.69  ? 474  PHE A CA  1 
ATOM   3107  C C   . PHE A 1 463 ? -31.494 2.806   -22.447 1.00 79.69  ? 474  PHE A C   1 
ATOM   3108  O O   . PHE A 1 463 ? -32.660 3.051   -22.115 1.00 79.69  ? 474  PHE A O   1 
ATOM   3109  C CB  . PHE A 1 463 ? -30.751 1.201   -24.204 1.00 81.44  ? 474  PHE A CB  1 
ATOM   3110  C CG  . PHE A 1 463 ? -31.665 0.208   -23.533 1.00 81.44  ? 474  PHE A CG  1 
ATOM   3111  C CD1 . PHE A 1 463 ? -32.995 0.084   -23.924 1.00 81.44  ? 474  PHE A CD1 1 
ATOM   3112  C CD2 . PHE A 1 463 ? -31.203 -0.586  -22.486 1.00 81.44  ? 474  PHE A CD2 1 
ATOM   3113  C CE1 . PHE A 1 463 ? -33.848 -0.814  -23.280 1.00 81.44  ? 474  PHE A CE1 1 
ATOM   3114  C CE2 . PHE A 1 463 ? -32.054 -1.487  -21.839 1.00 81.44  ? 474  PHE A CE2 1 
ATOM   3115  C CZ  . PHE A 1 463 ? -33.374 -1.598  -22.237 1.00 81.44  ? 474  PHE A CZ  1 
ATOM   3116  N N   . LEU A 1 464 ? -30.494 2.639   -21.579 1.00 86.19  ? 475  LEU A N   1 
ATOM   3117  C CA  . LEU A 1 464 ? -30.676 2.742   -20.134 1.00 86.19  ? 475  LEU A CA  1 
ATOM   3118  C C   . LEU A 1 464 ? -31.199 4.121   -19.775 1.00 86.19  ? 475  LEU A C   1 
ATOM   3119  O O   . LEU A 1 464 ? -32.138 4.251   -18.993 1.00 86.19  ? 475  LEU A O   1 
ATOM   3120  C CB  . LEU A 1 464 ? -29.351 2.497   -19.400 1.00 59.49  ? 475  LEU A CB  1 
ATOM   3121  C CG  . LEU A 1 464 ? -28.721 1.101   -19.396 1.00 59.49  ? 475  LEU A CG  1 
ATOM   3122  C CD1 . LEU A 1 464 ? -27.493 1.129   -18.504 1.00 59.49  ? 475  LEU A CD1 1 
ATOM   3123  C CD2 . LEU A 1 464 ? -29.705 0.065   -18.886 1.00 59.49  ? 475  LEU A CD2 1 
ATOM   3124  N N   . ILE A 1 465 ? -30.577 5.146   -20.350 1.00 71.09  ? 476  ILE A N   1 
ATOM   3125  C CA  . ILE A 1 465 ? -30.980 6.522   -20.101 1.00 71.09  ? 476  ILE A CA  1 
ATOM   3126  C C   . ILE A 1 465 ? -32.461 6.723   -20.390 1.00 71.09  ? 476  ILE A C   1 
ATOM   3127  O O   . ILE A 1 465 ? -33.100 7.566   -19.770 1.00 71.09  ? 476  ILE A O   1 
ATOM   3128  C CB  . ILE A 1 465 ? -30.191 7.497   -20.974 1.00 85.07  ? 476  ILE A CB  1 
ATOM   3129  C CG1 . ILE A 1 465 ? -28.697 7.309   -20.729 1.00 85.07  ? 476  ILE A CG1 1 
ATOM   3130  C CG2 . ILE A 1 465 ? -30.620 8.926   -20.674 1.00 85.07  ? 476  ILE A CG2 1 
ATOM   3131  C CD1 . ILE A 1 465 ? -27.828 8.072   -21.709 1.00 85.07  ? 476  ILE A CD1 1 
ATOM   3132  N N   . LYS A 1 466 ? -32.998 5.956   -21.341 1.00 102.35 ? 477  LYS A N   1 
ATOM   3133  C CA  . LYS A 1 466 ? -34.415 6.042   -21.701 1.00 102.35 ? 477  LYS A CA  1 
ATOM   3134  C C   . LYS A 1 466 ? -35.244 5.219   -20.728 1.00 102.35 ? 477  LYS A C   1 
ATOM   3135  O O   . LYS A 1 466 ? -36.082 5.757   -20.004 1.00 102.35 ? 477  LYS A O   1 
ATOM   3136  C CB  . LYS A 1 466 ? -34.658 5.523   -23.124 1.00 103.65 ? 477  LYS A CB  1 
ATOM   3137  C CG  . LYS A 1 466 ? -34.115 6.415   -24.224 1.00 103.65 ? 477  LYS A CG  1 
ATOM   3138  C CD  . LYS A 1 466 ? -34.754 7.793   -24.205 1.00 103.65 ? 477  LYS A CD  1 
ATOM   3139  C CE  . LYS A 1 466 ? -34.067 8.704   -25.204 1.00 103.65 ? 477  LYS A CE  1 
ATOM   3140  N NZ  . LYS A 1 466 ? -34.649 10.067  -25.203 1.00 103.65 ? 477  LYS A NZ  1 
ATOM   3141  N N   . TYR A 1 467 ? -34.999 3.910   -20.717 1.00 74.12  ? 478  TYR A N   1 
ATOM   3142  C CA  . TYR A 1 467 ? -35.724 3.011   -19.835 1.00 74.12  ? 478  TYR A CA  1 
ATOM   3143  C C   . TYR A 1 467 ? -35.881 3.652   -18.475 1.00 74.12  ? 478  TYR A C   1 
ATOM   3144  O O   . TYR A 1 467 ? -36.975 3.696   -17.932 1.00 74.12  ? 478  TYR A O   1 
ATOM   3145  C CB  . TYR A 1 467 ? -34.991 1.681   -19.699 1.00 73.16  ? 478  TYR A CB  1 
ATOM   3146  C CG  . TYR A 1 467 ? -35.698 0.716   -18.783 1.00 73.16  ? 478  TYR A CG  1 
ATOM   3147  C CD1 . TYR A 1 467 ? -35.339 0.610   -17.444 1.00 73.16  ? 478  TYR A CD1 1 
ATOM   3148  C CD2 . TYR A 1 467 ? -36.767 -0.055  -19.238 1.00 73.16  ? 478  TYR A CD2 1 
ATOM   3149  C CE1 . TYR A 1 467 ? -36.031 -0.239  -16.571 1.00 73.16  ? 478  TYR A CE1 1 
ATOM   3150  C CE2 . TYR A 1 467 ? -37.468 -0.906  -18.375 1.00 73.16  ? 478  TYR A CE2 1 
ATOM   3151  C CZ  . TYR A 1 467 ? -37.096 -0.990  -17.043 1.00 73.16  ? 478  TYR A CZ  1 
ATOM   3152  O OH  . TYR A 1 467 ? -37.796 -1.799  -16.172 1.00 73.16  ? 478  TYR A OH  1 
ATOM   3153  N N   . ILE A 1 468 ? -34.783 4.166   -17.935 1.00 66.41  ? 479  ILE A N   1 
ATOM   3154  C CA  . ILE A 1 468 ? -34.809 4.809   -16.629 1.00 66.41  ? 479  ILE A CA  1 
ATOM   3155  C C   . ILE A 1 468 ? -35.650 6.071   -16.654 1.00 66.41  ? 479  ILE A C   1 
ATOM   3156  O O   . ILE A 1 468 ? -36.660 6.155   -15.960 1.00 66.41  ? 479  ILE A O   1 
ATOM   3157  C CB  . ILE A 1 468 ? -33.384 5.157   -16.139 1.00 73.53  ? 479  ILE A CB  1 
ATOM   3158  C CG1 . ILE A 1 468 ? -32.651 3.877   -15.731 1.00 73.53  ? 479  ILE A CG1 1 
ATOM   3159  C CG2 . ILE A 1 468 ? -33.454 6.105   -14.958 1.00 73.53  ? 479  ILE A CG2 1 
ATOM   3160  C CD1 . ILE A 1 468 ? -31.245 4.100   -15.241 1.00 73.53  ? 479  ILE A CD1 1 
ATOM   3161  N N   . SER A 1 469 ? -35.247 7.054   -17.449 1.00 80.01  ? 480  SER A N   1 
ATOM   3162  C CA  . SER A 1 469 ? -36.010 8.292   -17.509 1.00 80.01  ? 480  SER A CA  1 
ATOM   3163  C C   . SER A 1 469 ? -37.449 7.991   -17.906 1.00 80.01  ? 480  SER A C   1 
ATOM   3164  O O   . SER A 1 469 ? -38.343 8.809   -17.696 1.00 80.01  ? 480  SER A O   1 
ATOM   3165  C CB  . SER A 1 469 ? -35.389 9.269   -18.507 1.00 100.90 ? 480  SER A CB  1 
ATOM   3166  O OG  . SER A 1 469 ? -36.023 10.535  -18.434 1.00 100.90 ? 480  SER A OG  1 
ATOM   3167  N N   . SER A 1 470 ? -37.669 6.810   -18.475 1.00 76.82  ? 481  SER A N   1 
ATOM   3168  C CA  . SER A 1 470 ? -39.010 6.402   -18.889 1.00 76.82  ? 481  SER A CA  1 
ATOM   3169  C C   . SER A 1 470 ? -39.805 6.030   -17.644 1.00 76.82  ? 481  SER A C   1 
ATOM   3170  O O   . SER A 1 470 ? -40.834 6.637   -17.360 1.00 76.82  ? 481  SER A O   1 
ATOM   3171  C CB  . SER A 1 470 ? -38.935 5.206   -19.844 1.00 118.83 ? 481  SER A CB  1 
ATOM   3172  O OG  . SER A 1 470 ? -40.205 4.899   -20.395 1.00 118.83 ? 481  SER A OG  1 
ATOM   3173  N N   . ALA A 1 471 ? -39.306 5.037   -16.904 1.00 71.07  ? 482  ALA A N   1 
ATOM   3174  C CA  . ALA A 1 471 ? -39.928 4.562   -15.663 1.00 71.07  ? 482  ALA A CA  1 
ATOM   3175  C C   . ALA A 1 471 ? -40.283 5.747   -14.773 1.00 71.07  ? 482  ALA A C   1 
ATOM   3176  O O   . ALA A 1 471 ? -41.063 5.623   -13.828 1.00 71.07  ? 482  ALA A O   1 
ATOM   3177  C CB  . ALA A 1 471 ? -38.972 3.626   -14.925 1.00 44.67  ? 482  ALA A CB  1 
ATOM   3178  N N   . LYS A 1 472 ? -39.679 6.888   -15.097 1.00 74.45  ? 483  LYS A N   1 
ATOM   3179  C CA  . LYS A 1 472 ? -39.886 8.152   -14.401 1.00 74.45  ? 483  LYS A CA  1 
ATOM   3180  C C   . LYS A 1 472 ? -41.214 8.790   -14.848 1.00 74.45  ? 483  LYS A C   1 
ATOM   3181  O O   . LYS A 1 472 ? -42.156 8.904   -14.058 1.00 74.45  ? 483  LYS A O   1 
ATOM   3182  C CB  . LYS A 1 472 ? -38.710 9.097   -14.713 1.00 83.92  ? 483  LYS A CB  1 
ATOM   3183  C CG  . LYS A 1 472 ? -38.855 10.511  -14.161 1.00 83.92  ? 483  LYS A CG  1 
ATOM   3184  C CD  . LYS A 1 472 ? -37.693 11.434  -14.554 1.00 83.92  ? 483  LYS A CD  1 
ATOM   3185  C CE  . LYS A 1 472 ? -36.392 11.153  -13.790 1.00 83.92  ? 483  LYS A CE  1 
ATOM   3186  N NZ  . LYS A 1 472 ? -35.675 9.915   -14.219 1.00 83.92  ? 483  LYS A NZ  1 
ATOM   3187  N N   . ASN A 1 473 ? -41.275 9.187   -16.122 1.00 148.04 ? 484  ASN A N   1 
ATOM   3188  C CA  . ASN A 1 473 ? -42.457 9.821   -16.720 1.00 148.04 ? 484  ASN A CA  1 
ATOM   3189  C C   . ASN A 1 473 ? -43.776 9.113   -16.452 1.00 148.04 ? 484  ASN A C   1 
ATOM   3190  O O   . ASN A 1 473 ? -44.724 9.732   -15.973 1.00 148.04 ? 484  ASN A O   1 
ATOM   3191  C CB  . ASN A 1 473 ? -42.282 9.961   -18.235 1.00 139.46 ? 484  ASN A CB  1 
ATOM   3192  C CG  . ASN A 1 473 ? -41.753 11.325  -18.644 1.00 139.46 ? 484  ASN A CG  1 
ATOM   3193  O OD1 . ASN A 1 473 ? -40.657 11.728  -18.249 1.00 139.46 ? 484  ASN A OD1 1 
ATOM   3194  N ND2 . ASN A 1 473 ? -42.534 12.044  -19.442 1.00 139.46 ? 484  ASN A ND2 1 
ATOM   3195  N N   . VAL A 1 474 ? -43.840 7.826   -16.785 1.00 126.57 ? 485  VAL A N   1 
ATOM   3196  C CA  . VAL A 1 474 ? -45.048 7.033   -16.575 1.00 126.57 ? 485  VAL A CA  1 
ATOM   3197  C C   . VAL A 1 474 ? -45.826 7.526   -15.357 1.00 126.57 ? 485  VAL A C   1 
ATOM   3198  O O   . VAL A 1 474 ? -46.935 8.076   -15.544 1.00 126.57 ? 485  VAL A O   1 
ATOM   3199  C CB  . VAL A 1 474 ? -44.704 5.536   -16.371 1.00 196.60 ? 485  VAL A CB  1 
ATOM   3200  C CG1 . VAL A 1 474 ? -45.950 4.756   -15.982 1.00 196.60 ? 485  VAL A CG1 1 
ATOM   3201  C CG2 . VAL A 1 474 ? -44.112 4.963   -17.646 1.00 196.60 ? 485  VAL A CG2 1 
ATOM   3202  O OXT . VAL A 1 474 ? -45.308 7.366   -14.231 1.00 196.60 ? 485  VAL A OXT 1 
ATOM   3203  N N   . SER B 1 55  ? -34.081 -26.508 37.478  1.00 92.20  ? 66   SER B N   1 
ATOM   3204  C CA  . SER B 1 55  ? -33.126 -27.656 37.468  1.00 92.20  ? 66   SER B CA  1 
ATOM   3205  C C   . SER B 1 55  ? -32.891 -28.191 36.051  1.00 92.20  ? 66   SER B C   1 
ATOM   3206  O O   . SER B 1 55  ? -33.767 -28.100 35.185  1.00 92.20  ? 66   SER B O   1 
ATOM   3207  C CB  . SER B 1 55  ? -33.659 -28.780 38.364  1.00 104.14 ? 66   SER B CB  1 
ATOM   3208  O OG  . SER B 1 55  ? -32.846 -29.939 38.283  1.00 104.14 ? 66   SER B OG  1 
ATOM   3209  N N   . GLU B 1 56  ? -31.704 -28.744 35.818  1.00 114.96 ? 67   GLU B N   1 
ATOM   3210  C CA  . GLU B 1 56  ? -31.371 -29.292 34.510  1.00 114.96 ? 67   GLU B CA  1 
ATOM   3211  C C   . GLU B 1 56  ? -30.624 -30.621 34.632  1.00 114.96 ? 67   GLU B C   1 
ATOM   3212  O O   . GLU B 1 56  ? -29.937 -30.880 35.622  1.00 114.96 ? 67   GLU B O   1 
ATOM   3213  C CB  . GLU B 1 56  ? -30.533 -28.285 33.706  1.00 71.14  ? 67   GLU B CB  1 
ATOM   3214  C CG  . GLU B 1 56  ? -29.060 -28.256 34.043  1.00 71.14  ? 67   GLU B CG  1 
ATOM   3215  C CD  . GLU B 1 56  ? -28.795 -27.962 35.507  1.00 71.14  ? 67   GLU B CD  1 
ATOM   3216  O OE1 . GLU B 1 56  ? -29.416 -27.016 36.044  1.00 71.14  ? 67   GLU B OE1 1 
ATOM   3217  O OE2 . GLU B 1 56  ? -27.956 -28.670 36.115  1.00 71.14  ? 67   GLU B OE2 1 
ATOM   3218  N N   . ALA B 1 57  ? -30.776 -31.465 33.618  1.00 101.81 ? 68   ALA B N   1 
ATOM   3219  C CA  . ALA B 1 57  ? -30.124 -32.762 33.602  1.00 101.81 ? 68   ALA B CA  1 
ATOM   3220  C C   . ALA B 1 57  ? -28.980 -32.740 32.600  1.00 101.81 ? 68   ALA B C   1 
ATOM   3221  O O   . ALA B 1 57  ? -28.943 -33.527 31.651  1.00 101.81 ? 68   ALA B O   1 
ATOM   3222  C CB  . ALA B 1 57  ? -31.124 -33.849 33.241  1.00 126.31 ? 68   ALA B CB  1 
ATOM   3223  N N   . LEU B 1 58  ? -28.060 -31.806 32.813  1.00 81.23  ? 69   LEU B N   1 
ATOM   3224  C CA  . LEU B 1 58  ? -26.872 -31.651 31.978  1.00 81.23  ? 69   LEU B CA  1 
ATOM   3225  C C   . LEU B 1 58  ? -25.759 -32.383 32.725  1.00 81.23  ? 69   LEU B C   1 
ATOM   3226  O O   . LEU B 1 58  ? -24.983 -33.143 32.149  1.00 81.23  ? 69   LEU B O   1 
ATOM   3227  C CB  . LEU B 1 58  ? -26.532 -30.166 31.843  1.00 59.09  ? 69   LEU B CB  1 
ATOM   3228  C CG  . LEU B 1 58  ? -25.145 -29.745 31.350  1.00 59.09  ? 69   LEU B CG  1 
ATOM   3229  C CD1 . LEU B 1 58  ? -24.965 -30.180 29.906  1.00 59.09  ? 69   LEU B CD1 1 
ATOM   3230  C CD2 . LEU B 1 58  ? -24.990 -28.226 31.485  1.00 59.09  ? 69   LEU B CD2 1 
ATOM   3231  N N   . LEU B 1 59  ? -25.709 -32.151 34.030  1.00 75.10  ? 70   LEU B N   1 
ATOM   3232  C CA  . LEU B 1 59  ? -24.721 -32.786 34.884  1.00 75.10  ? 70   LEU B CA  1 
ATOM   3233  C C   . LEU B 1 59  ? -24.965 -34.295 34.923  1.00 75.10  ? 70   LEU B C   1 
ATOM   3234  O O   . LEU B 1 59  ? -24.268 -35.041 35.612  1.00 75.10  ? 70   LEU B O   1 
ATOM   3235  C CB  . LEU B 1 59  ? -24.795 -32.176 36.289  1.00 59.82  ? 70   LEU B CB  1 
ATOM   3236  C CG  . LEU B 1 59  ? -24.062 -30.842 36.491  1.00 59.82  ? 70   LEU B CG  1 
ATOM   3237  C CD1 . LEU B 1 59  ? -23.901 -30.120 35.164  1.00 59.82  ? 70   LEU B CD1 1 
ATOM   3238  C CD2 . LEU B 1 59  ? -24.820 -29.980 37.499  1.00 59.82  ? 70   LEU B CD2 1 
ATOM   3239  N N   . GLU B 1 60  ? -25.968 -34.734 34.173  1.00 69.57  ? 71   GLU B N   1 
ATOM   3240  C CA  . GLU B 1 60  ? -26.311 -36.148 34.092  1.00 69.57  ? 71   GLU B CA  1 
ATOM   3241  C C   . GLU B 1 60  ? -25.555 -36.653 32.889  1.00 69.57  ? 71   GLU B C   1 
ATOM   3242  O O   . GLU B 1 60  ? -24.760 -37.580 32.981  1.00 69.57  ? 71   GLU B O   1 
ATOM   3243  C CB  . GLU B 1 60  ? -27.815 -36.333 33.856  1.00 201.99 ? 71   GLU B CB  1 
ATOM   3244  C CG  . GLU B 1 60  ? -28.723 -35.923 35.012  1.00 201.99 ? 71   GLU B CG  1 
ATOM   3245  C CD  . GLU B 1 60  ? -28.704 -36.916 36.160  1.00 201.99 ? 71   GLU B CD  1 
ATOM   3246  O OE1 . GLU B 1 60  ? -29.526 -36.768 37.090  1.00 201.99 ? 71   GLU B OE1 1 
ATOM   3247  O OE2 . GLU B 1 60  ? -27.868 -37.843 36.134  1.00 201.99 ? 71   GLU B OE2 1 
ATOM   3248  N N   . ILE B 1 61  ? -25.819 -36.017 31.757  1.00 48.25  ? 72   ILE B N   1 
ATOM   3249  C CA  . ILE B 1 61  ? -25.168 -36.362 30.500  1.00 48.25  ? 72   ILE B CA  1 
ATOM   3250  C C   . ILE B 1 61  ? -23.668 -36.228 30.714  1.00 48.25  ? 72   ILE B C   1 
ATOM   3251  O O   . ILE B 1 61  ? -22.907 -37.123 30.355  1.00 48.25  ? 72   ILE B O   1 
ATOM   3252  C CB  . ILE B 1 61  ? -25.623 -35.403 29.369  1.00 60.15  ? 72   ILE B CB  1 
ATOM   3253  C CG1 . ILE B 1 61  ? -27.124 -35.565 29.130  1.00 60.15  ? 72   ILE B CG1 1 
ATOM   3254  C CG2 . ILE B 1 61  ? -24.836 -35.656 28.096  1.00 60.15  ? 72   ILE B CG2 1 
ATOM   3255  C CD1 . ILE B 1 61  ? -27.737 -34.423 28.356  1.00 60.15  ? 72   ILE B CD1 1 
ATOM   3256  N N   . CYS B 1 62  ? -23.259 -35.116 31.325  1.00 70.45  ? 73   CYS B N   1 
ATOM   3257  C CA  . CYS B 1 62  ? -21.850 -34.850 31.605  1.00 70.45  ? 73   CYS B CA  1 
ATOM   3258  C C   . CYS B 1 62  ? -21.167 -35.963 32.411  1.00 70.45  ? 73   CYS B C   1 
ATOM   3259  O O   . CYS B 1 62  ? -19.943 -36.106 32.375  1.00 70.45  ? 73   CYS B O   1 
ATOM   3260  C CB  . CYS B 1 62  ? -21.707 -33.517 32.336  1.00 77.59  ? 73   CYS B CB  1 
ATOM   3261  S SG  . CYS B 1 62  ? -22.012 -32.069 31.287  1.00 77.59  ? 73   CYS B SG  1 
ATOM   3262  N N   . GLN B 1 63  ? -21.960 -36.742 33.141  1.00 76.51  ? 74   GLN B N   1 
ATOM   3263  C CA  . GLN B 1 63  ? -21.430 -37.849 33.921  1.00 76.51  ? 74   GLN B CA  1 
ATOM   3264  C C   . GLN B 1 63  ? -21.343 -39.060 33.009  1.00 76.51  ? 74   GLN B C   1 
ATOM   3265  O O   . GLN B 1 63  ? -20.290 -39.668 32.870  1.00 76.51  ? 74   GLN B O   1 
ATOM   3266  C CB  . GLN B 1 63  ? -22.345 -38.175 35.099  1.00 195.91 ? 74   GLN B CB  1 
ATOM   3267  C CG  . GLN B 1 63  ? -21.977 -39.473 35.798  1.00 195.91 ? 74   GLN B CG  1 
ATOM   3268  C CD  . GLN B 1 63  ? -22.995 -39.896 36.838  1.00 195.91 ? 74   GLN B CD  1 
ATOM   3269  O OE1 . GLN B 1 63  ? -23.155 -39.244 37.871  1.00 195.91 ? 74   GLN B OE1 1 
ATOM   3270  N NE2 . GLN B 1 63  ? -23.695 -40.993 36.567  1.00 195.91 ? 74   GLN B NE2 1 
ATOM   3271  N N   . ARG B 1 64  ? -22.458 -39.398 32.372  1.00 80.97  ? 75   ARG B N   1 
ATOM   3272  C CA  . ARG B 1 64  ? -22.512 -40.552 31.479  1.00 80.97  ? 75   ARG B CA  1 
ATOM   3273  C C   . ARG B 1 64  ? -21.547 -40.475 30.297  1.00 80.97  ? 75   ARG B C   1 
ATOM   3274  O O   . ARG B 1 64  ? -21.146 -41.503 29.756  1.00 80.97  ? 75   ARG B O   1 
ATOM   3275  C CB  . ARG B 1 64  ? -23.948 -40.753 30.967  1.00 109.17 ? 75   ARG B CB  1 
ATOM   3276  C CG  . ARG B 1 64  ? -24.904 -41.335 32.006  1.00 109.17 ? 75   ARG B CG  1 
ATOM   3277  C CD  . ARG B 1 64  ? -26.349 -40.915 31.753  1.00 109.17 ? 75   ARG B CD  1 
ATOM   3278  N NE  . ARG B 1 64  ? -27.262 -41.476 32.749  1.00 109.17 ? 75   ARG B NE  1 
ATOM   3279  C CZ  . ARG B 1 64  ? -28.502 -41.043 32.966  1.00 109.17 ? 75   ARG B CZ  1 
ATOM   3280  N NH1 . ARG B 1 64  ? -28.992 -40.031 32.264  1.00 109.17 ? 75   ARG B NH1 1 
ATOM   3281  N NH2 . ARG B 1 64  ? -29.259 -41.632 33.882  1.00 109.17 ? 75   ARG B NH2 1 
ATOM   3282  N N   . ARG B 1 65  ? -21.168 -39.268 29.894  1.00 54.68  ? 76   ARG B N   1 
ATOM   3283  C CA  . ARG B 1 65  ? -20.256 -39.128 28.764  1.00 54.68  ? 76   ARG B CA  1 
ATOM   3284  C C   . ARG B 1 65  ? -18.831 -38.705 29.114  1.00 54.68  ? 76   ARG B C   1 
ATOM   3285  O O   . ARG B 1 65  ? -18.081 -38.249 28.243  1.00 54.68  ? 76   ARG B O   1 
ATOM   3286  C CB  . ARG B 1 65  ? -20.850 -38.169 27.723  1.00 96.36  ? 76   ARG B CB  1 
ATOM   3287  C CG  . ARG B 1 65  ? -22.127 -38.701 27.091  1.00 96.36  ? 76   ARG B CG  1 
ATOM   3288  C CD  . ARG B 1 65  ? -21.949 -40.163 26.704  1.00 96.36  ? 76   ARG B CD  1 
ATOM   3289  N NE  . ARG B 1 65  ? -23.217 -40.874 26.576  1.00 96.36  ? 76   ARG B NE  1 
ATOM   3290  C CZ  . ARG B 1 65  ? -23.347 -42.191 26.705  1.00 96.36  ? 76   ARG B CZ  1 
ATOM   3291  N NH1 . ARG B 1 65  ? -22.286 -42.946 26.968  1.00 96.36  ? 76   ARG B NH1 1 
ATOM   3292  N NH2 . ARG B 1 65  ? -24.539 -42.755 26.576  1.00 96.36  ? 76   ARG B NH2 1 
ATOM   3293  N N   . HIS B 1 66  ? -18.466 -38.873 30.384  1.00 35.61  ? 77   HIS B N   1 
ATOM   3294  C CA  . HIS B 1 66  ? -17.137 -38.537 30.880  1.00 35.61  ? 77   HIS B CA  1 
ATOM   3295  C C   . HIS B 1 66  ? -16.658 -37.090 30.697  1.00 35.61  ? 77   HIS B C   1 
ATOM   3296  O O   . HIS B 1 66  ? -15.501 -36.835 30.360  1.00 35.61  ? 77   HIS B O   1 
ATOM   3297  C CB  . HIS B 1 66  ? -16.122 -39.496 30.277  1.00 66.61  ? 77   HIS B CB  1 
ATOM   3298  C CG  . HIS B 1 66  ? -16.336 -40.912 30.686  1.00 66.61  ? 77   HIS B CG  1 
ATOM   3299  N ND1 . HIS B 1 66  ? -17.569 -41.518 30.623  1.00 66.61  ? 77   HIS B ND1 1 
ATOM   3300  C CD2 . HIS B 1 66  ? -15.480 -41.844 31.162  1.00 66.61  ? 77   HIS B CD2 1 
ATOM   3301  C CE1 . HIS B 1 66  ? -17.466 -42.767 31.042  1.00 66.61  ? 77   HIS B CE1 1 
ATOM   3302  N NE2 . HIS B 1 66  ? -16.208 -42.990 31.375  1.00 66.61  ? 77   HIS B NE2 1 
ATOM   3303  N N   . PHE B 1 67  ? -17.552 -36.137 30.897  1.00 62.66  ? 78   PHE B N   1 
ATOM   3304  C CA  . PHE B 1 67  ? -17.145 -34.749 30.811  1.00 62.66  ? 78   PHE B CA  1 
ATOM   3305  C C   . PHE B 1 67  ? -16.682 -34.440 32.225  1.00 62.66  ? 78   PHE B C   1 
ATOM   3306  O O   . PHE B 1 67  ? -15.503 -34.181 32.453  1.00 62.66  ? 78   PHE B O   1 
ATOM   3307  C CB  . PHE B 1 67  ? -18.317 -33.856 30.406  1.00 53.16  ? 78   PHE B CB  1 
ATOM   3308  C CG  . PHE B 1 67  ? -18.390 -33.602 28.934  1.00 53.16  ? 78   PHE B CG  1 
ATOM   3309  C CD1 . PHE B 1 67  ? -17.443 -32.795 28.312  1.00 53.16  ? 78   PHE B CD1 1 
ATOM   3310  C CD2 . PHE B 1 67  ? -19.360 -34.213 28.158  1.00 53.16  ? 78   PHE B CD2 1 
ATOM   3311  C CE1 . PHE B 1 67  ? -17.459 -32.605 26.940  1.00 53.16  ? 78   PHE B CE1 1 
ATOM   3312  C CE2 . PHE B 1 67  ? -19.383 -34.027 26.794  1.00 53.16  ? 78   PHE B CE2 1 
ATOM   3313  C CZ  . PHE B 1 67  ? -18.427 -33.222 26.180  1.00 53.16  ? 78   PHE B CZ  1 
ATOM   3314  N N   . LEU B 1 68  ? -17.619 -34.488 33.171  1.00 73.75  ? 79   LEU B N   1 
ATOM   3315  C CA  . LEU B 1 68  ? -17.316 -34.259 34.576  1.00 73.75  ? 79   LEU B CA  1 
ATOM   3316  C C   . LEU B 1 68  ? -17.041 -35.631 35.174  1.00 73.75  ? 79   LEU B C   1 
ATOM   3317  O O   . LEU B 1 68  ? -17.430 -36.645 34.605  1.00 73.75  ? 79   LEU B O   1 
ATOM   3318  C CB  . LEU B 1 68  ? -18.503 -33.617 35.306  1.00 65.51  ? 79   LEU B CB  1 
ATOM   3319  C CG  . LEU B 1 68  ? -18.801 -32.117 35.217  1.00 65.51  ? 79   LEU B CG  1 
ATOM   3320  C CD1 . LEU B 1 68  ? -17.545 -31.328 35.559  1.00 65.51  ? 79   LEU B CD1 1 
ATOM   3321  C CD2 . LEU B 1 68  ? -19.293 -31.762 33.840  1.00 65.51  ? 79   LEU B CD2 1 
ATOM   3322  N N   . SER B 1 69  ? -16.379 -35.668 36.321  1.00 95.78  ? 80   SER B N   1 
ATOM   3323  C CA  . SER B 1 69  ? -16.070 -36.939 36.957  1.00 95.78  ? 80   SER B CA  1 
ATOM   3324  C C   . SER B 1 69  ? -16.560 -36.948 38.406  1.00 95.78  ? 80   SER B C   1 
ATOM   3325  O O   . SER B 1 69  ? -16.831 -35.892 38.980  1.00 95.78  ? 80   SER B O   1 
ATOM   3326  C CB  . SER B 1 69  ? -14.558 -37.186 36.890  1.00 82.88  ? 80   SER B CB  1 
ATOM   3327  O OG  . SER B 1 69  ? -14.213 -38.458 37.406  1.00 82.88  ? 80   SER B OG  1 
ATOM   3328  N N   . GLY B 1 70  ? -16.686 -38.144 38.981  1.00 105.72 ? 81   GLY B N   1 
ATOM   3329  C CA  . GLY B 1 70  ? -17.139 -38.277 40.357  1.00 105.72 ? 81   GLY B CA  1 
ATOM   3330  C C   . GLY B 1 70  ? -18.579 -38.735 40.520  1.00 105.72 ? 81   GLY B C   1 
ATOM   3331  O O   . GLY B 1 70  ? -19.303 -38.914 39.541  1.00 105.72 ? 81   GLY B O   1 
ATOM   3332  N N   . SER B 1 71  ? -19.001 -38.918 41.767  1.00 128.38 ? 82   SER B N   1 
ATOM   3333  C CA  . SER B 1 71  ? -20.360 -39.358 42.058  1.00 128.38 ? 82   SER B CA  1 
ATOM   3334  C C   . SER B 1 71  ? -21.401 -38.284 41.758  1.00 128.38 ? 82   SER B C   1 
ATOM   3335  O O   . SER B 1 71  ? -21.120 -37.309 41.062  1.00 128.38 ? 82   SER B O   1 
ATOM   3336  C CB  . SER B 1 71  ? -20.468 -39.791 43.522  1.00 101.65 ? 82   SER B CB  1 
ATOM   3337  O OG  . SER B 1 71  ? -19.678 -40.943 43.765  1.00 101.65 ? 82   SER B OG  1 
ATOM   3338  N N   . LYS B 1 72  ? -22.605 -38.477 42.284  1.00 113.13 ? 83   LYS B N   1 
ATOM   3339  C CA  . LYS B 1 72  ? -23.699 -37.538 42.078  1.00 113.13 ? 83   LYS B CA  1 
ATOM   3340  C C   . LYS B 1 72  ? -23.912 -36.714 43.346  1.00 113.13 ? 83   LYS B C   1 
ATOM   3341  O O   . LYS B 1 72  ? -24.879 -35.954 43.455  1.00 113.13 ? 83   LYS B O   1 
ATOM   3342  C CB  . LYS B 1 72  ? -24.971 -38.308 41.723  1.00 141.19 ? 83   LYS B CB  1 
ATOM   3343  C CG  . LYS B 1 72  ? -24.807 -39.239 40.527  1.00 141.19 ? 83   LYS B CG  1 
ATOM   3344  C CD  . LYS B 1 72  ? -26.012 -40.165 40.350  1.00 141.19 ? 83   LYS B CD  1 
ATOM   3345  C CE  . LYS B 1 72  ? -27.306 -39.393 40.081  1.00 141.19 ? 83   LYS B CE  1 
ATOM   3346  N NZ  . LYS B 1 72  ? -28.493 -40.291 39.932  1.00 141.19 ? 83   LYS B NZ  1 
ATOM   3347  N N   . GLN B 1 73  ? -22.994 -36.876 44.300  1.00 164.79 ? 84   GLN B N   1 
ATOM   3348  C CA  . GLN B 1 73  ? -23.028 -36.162 45.579  1.00 164.79 ? 84   GLN B CA  1 
ATOM   3349  C C   . GLN B 1 73  ? -21.749 -35.331 45.749  1.00 164.79 ? 84   GLN B C   1 
ATOM   3350  O O   . GLN B 1 73  ? -21.781 -34.242 46.326  1.00 164.79 ? 84   GLN B O   1 
ATOM   3351  C CB  . GLN B 1 73  ? -23.155 -37.158 46.739  1.00 187.00 ? 84   GLN B CB  1 
ATOM   3352  C CG  . GLN B 1 73  ? -23.222 -36.527 48.133  1.00 187.00 ? 84   GLN B CG  1 
ATOM   3353  C CD  . GLN B 1 73  ? -24.633 -36.153 48.560  1.00 187.00 ? 84   GLN B CD  1 
ATOM   3354  O OE1 . GLN B 1 73  ? -24.840 -35.607 49.645  1.00 187.00 ? 84   GLN B OE1 1 
ATOM   3355  N NE2 . GLN B 1 73  ? -25.610 -36.453 47.711  1.00 187.00 ? 84   GLN B NE2 1 
ATOM   3356  N N   . GLN B 1 74  ? -20.626 -35.855 45.255  1.00 101.19 ? 85   GLN B N   1 
ATOM   3357  C CA  . GLN B 1 74  ? -19.349 -35.149 45.335  1.00 101.19 ? 85   GLN B CA  1 
ATOM   3358  C C   . GLN B 1 74  ? -19.179 -34.183 44.153  1.00 101.19 ? 85   GLN B C   1 
ATOM   3359  O O   . GLN B 1 74  ? -18.241 -33.384 44.111  1.00 101.19 ? 85   GLN B O   1 
ATOM   3360  C CB  . GLN B 1 74  ? -18.175 -36.148 45.429  1.00 73.38  ? 85   GLN B CB  1 
ATOM   3361  C CG  . GLN B 1 74  ? -18.173 -37.318 44.449  1.00 73.38  ? 85   GLN B CG  1 
ATOM   3362  C CD  . GLN B 1 74  ? -17.034 -38.308 44.725  1.00 73.38  ? 85   GLN B CD  1 
ATOM   3363  O OE1 . GLN B 1 74  ? -16.830 -39.269 43.983  1.00 73.38  ? 85   GLN B OE1 1 
ATOM   3364  N NE2 . GLN B 1 74  ? -16.293 -38.072 45.799  1.00 73.38  ? 85   GLN B NE2 1 
ATOM   3365  N N   . LEU B 1 75  ? -20.107 -34.268 43.201  1.00 162.53 ? 86   LEU B N   1 
ATOM   3366  C CA  . LEU B 1 75  ? -20.133 -33.388 42.032  1.00 162.53 ? 86   LEU B CA  1 
ATOM   3367  C C   . LEU B 1 75  ? -21.233 -32.362 42.303  1.00 162.53 ? 86   LEU B C   1 
ATOM   3368  O O   . LEU B 1 75  ? -22.071 -32.079 41.443  1.00 162.53 ? 86   LEU B O   1 
ATOM   3369  C CB  . LEU B 1 75  ? -20.462 -34.164 40.743  1.00 83.13  ? 86   LEU B CB  1 
ATOM   3370  C CG  . LEU B 1 75  ? -19.316 -34.724 39.887  1.00 83.13  ? 86   LEU B CG  1 
ATOM   3371  C CD1 . LEU B 1 75  ? -19.880 -35.506 38.718  1.00 83.13  ? 86   LEU B CD1 1 
ATOM   3372  C CD2 . LEU B 1 75  ? -18.446 -33.591 39.381  1.00 83.13  ? 86   LEU B CD2 1 
ATOM   3373  N N   . SER B 1 76  ? -21.225 -31.824 43.520  1.00 145.07 ? 87   SER B N   1 
ATOM   3374  C CA  . SER B 1 76  ? -22.202 -30.831 43.945  1.00 145.07 ? 87   SER B CA  1 
ATOM   3375  C C   . SER B 1 76  ? -22.103 -29.578 43.089  1.00 145.07 ? 87   SER B C   1 
ATOM   3376  O O   . SER B 1 76  ? -21.126 -29.374 42.369  1.00 145.07 ? 87   SER B O   1 
ATOM   3377  C CB  . SER B 1 76  ? -21.976 -30.457 45.415  1.00 162.49 ? 87   SER B CB  1 
ATOM   3378  O OG  . SER B 1 76  ? -22.018 -31.597 46.256  1.00 162.49 ? 87   SER B OG  1 
ATOM   3379  N N   . ARG B 1 77  ? -23.124 -28.737 43.176  1.00 92.79  ? 88   ARG B N   1 
ATOM   3380  C CA  . ARG B 1 77  ? -23.158 -27.495 42.416  1.00 92.79  ? 88   ARG B CA  1 
ATOM   3381  C C   . ARG B 1 77  ? -22.129 -26.560 43.041  1.00 92.79  ? 88   ARG B C   1 
ATOM   3382  O O   . ARG B 1 77  ? -21.353 -25.900 42.343  1.00 92.79  ? 88   ARG B O   1 
ATOM   3383  C CB  . ARG B 1 77  ? -24.554 -26.855 42.496  1.00 168.26 ? 88   ARG B CB  1 
ATOM   3384  C CG  . ARG B 1 77  ? -25.709 -27.836 42.765  1.00 168.26 ? 88   ARG B CG  1 
ATOM   3385  C CD  . ARG B 1 77  ? -26.134 -27.893 44.244  1.00 168.26 ? 88   ARG B CD  1 
ATOM   3386  N NE  . ARG B 1 77  ? -26.081 -29.214 44.799  1.00 168.26 ? 88   ARG B NE  1 
ATOM   3387  C CZ  . ARG B 1 77  ? -26.966 -29.970 45.445  1.00 168.26 ? 88   ARG B CZ  1 
ATOM   3388  N NH1 . ARG B 1 77  ? -28.221 -29.648 45.744  1.00 168.26 ? 88   ARG B NH1 1 
ATOM   3389  N NH2 . ARG B 1 77  ? -26.489 -31.138 45.823  1.00 168.26 ? 88   ARG B NH2 1 
ATOM   3390  N N   . ASP B 1 78  ? -22.139 -26.522 44.372  1.00 106.84 ? 89   ASP B N   1 
ATOM   3391  C CA  . ASP B 1 78  ? -21.227 -25.687 45.146  1.00 106.84 ? 89   ASP B CA  1 
ATOM   3392  C C   . ASP B 1 78  ? -19.830 -26.316 45.131  1.00 106.84 ? 89   ASP B C   1 
ATOM   3393  O O   . ASP B 1 78  ? -18.835 -25.640 45.407  1.00 106.84 ? 89   ASP B O   1 
ATOM   3394  C CB  . ASP B 1 78  ? -21.715 -25.564 46.601  1.00 107.60 ? 89   ASP B CB  1 
ATOM   3395  C CG  . ASP B 1 78  ? -23.225 -25.340 46.712  1.00 107.60 ? 89   ASP B CG  1 
ATOM   3396  O OD1 . ASP B 1 78  ? -24.001 -26.235 46.306  1.00 107.60 ? 89   ASP B OD1 1 
ATOM   3397  O OD2 . ASP B 1 78  ? -23.635 -24.271 47.219  1.00 107.60 ? 89   ASP B OD2 1 
ATOM   3398  N N   . SER B 1 79  ? -19.773 -27.615 44.819  1.00 59.41  ? 90   SER B N   1 
ATOM   3399  C CA  . SER B 1 79  ? -18.511 -28.351 44.753  1.00 59.41  ? 90   SER B CA  1 
ATOM   3400  C C   . SER B 1 79  ? -17.877 -28.063 43.386  1.00 59.41  ? 90   SER B C   1 
ATOM   3401  O O   . SER B 1 79  ? -16.659 -27.908 43.272  1.00 59.41  ? 90   SER B O   1 
ATOM   3402  C CB  . SER B 1 79  ? -18.764 -29.864 44.934  1.00 71.88  ? 90   SER B CB  1 
ATOM   3403  O OG  . SER B 1 79  ? -17.663 -30.543 45.543  1.00 71.88  ? 90   SER B OG  1 
ATOM   3404  N N   . LEU B 1 80  ? -18.713 -27.974 42.352  1.00 65.39  ? 91   LEU B N   1 
ATOM   3405  C CA  . LEU B 1 80  ? -18.231 -27.682 41.003  1.00 65.39  ? 91   LEU B CA  1 
ATOM   3406  C C   . LEU B 1 80  ? -17.610 -26.292 40.893  1.00 65.39  ? 91   LEU B C   1 
ATOM   3407  O O   . LEU B 1 80  ? -16.577 -26.115 40.255  1.00 65.39  ? 91   LEU B O   1 
ATOM   3408  C CB  . LEU B 1 80  ? -19.370 -27.807 39.989  1.00 56.67  ? 91   LEU B CB  1 
ATOM   3409  C CG  . LEU B 1 80  ? -19.624 -29.193 39.390  1.00 56.67  ? 91   LEU B CG  1 
ATOM   3410  C CD1 . LEU B 1 80  ? -20.629 -29.064 38.263  1.00 56.67  ? 91   LEU B CD1 1 
ATOM   3411  C CD2 . LEU B 1 80  ? -18.325 -29.783 38.856  1.00 56.67  ? 91   LEU B CD2 1 
ATOM   3412  N N   . LEU B 1 81  ? -18.252 -25.312 41.512  1.00 60.95  ? 92   LEU B N   1 
ATOM   3413  C CA  . LEU B 1 81  ? -17.767 -23.941 41.494  1.00 60.95  ? 92   LEU B CA  1 
ATOM   3414  C C   . LEU B 1 81  ? -16.635 -23.622 42.484  1.00 60.95  ? 92   LEU B C   1 
ATOM   3415  O O   . LEU B 1 81  ? -15.854 -22.699 42.251  1.00 60.95  ? 92   LEU B O   1 
ATOM   3416  C CB  . LEU B 1 81  ? -18.918 -22.977 41.765  1.00 61.21  ? 92   LEU B CB  1 
ATOM   3417  C CG  . LEU B 1 81  ? -19.876 -22.621 40.636  1.00 61.21  ? 92   LEU B CG  1 
ATOM   3418  C CD1 . LEU B 1 81  ? -20.831 -21.546 41.123  1.00 61.21  ? 92   LEU B CD1 1 
ATOM   3419  C CD2 . LEU B 1 81  ? -19.094 -22.113 39.442  1.00 61.21  ? 92   LEU B CD2 1 
ATOM   3420  N N   . SER B 1 82  ? -16.542 -24.360 43.588  1.00 62.91  ? 93   SER B N   1 
ATOM   3421  C CA  . SER B 1 82  ? -15.498 -24.082 44.575  1.00 62.91  ? 93   SER B CA  1 
ATOM   3422  C C   . SER B 1 82  ? -14.188 -24.787 44.265  1.00 62.91  ? 93   SER B C   1 
ATOM   3423  O O   . SER B 1 82  ? -13.219 -24.669 45.011  1.00 62.91  ? 93   SER B O   1 
ATOM   3424  C CB  . SER B 1 82  ? -15.943 -24.511 45.968  1.00 48.70  ? 93   SER B CB  1 
ATOM   3425  O OG  . SER B 1 82  ? -15.574 -25.857 46.213  1.00 48.70  ? 93   SER B OG  1 
ATOM   3426  N N   . GLY B 1 83  ? -14.156 -25.525 43.169  1.00 40.23  ? 94   GLY B N   1 
ATOM   3427  C CA  . GLY B 1 83  ? -12.944 -26.235 42.823  1.00 40.23  ? 94   GLY B CA  1 
ATOM   3428  C C   . GLY B 1 83  ? -12.743 -27.451 43.709  1.00 40.23  ? 94   GLY B C   1 
ATOM   3429  O O   . GLY B 1 83  ? -11.636 -27.957 43.814  1.00 40.23  ? 94   GLY B O   1 
ATOM   3430  N N   . CYS B 1 84  ? -13.811 -27.930 44.345  1.00 71.84  ? 95   CYS B N   1 
ATOM   3431  C CA  . CYS B 1 84  ? -13.717 -29.102 45.218  1.00 71.84  ? 95   CYS B CA  1 
ATOM   3432  C C   . CYS B 1 84  ? -14.245 -30.393 44.617  1.00 71.84  ? 95   CYS B C   1 
ATOM   3433  O O   . CYS B 1 84  ? -14.431 -31.383 45.317  1.00 71.84  ? 95   CYS B O   1 
ATOM   3434  C CB  . CYS B 1 84  ? -14.428 -28.836 46.528  1.00 74.09  ? 95   CYS B CB  1 
ATOM   3435  S SG  . CYS B 1 84  ? -13.499 -27.696 47.503  1.00 74.09  ? 95   CYS B SG  1 
ATOM   3436  N N   . HIS B 1 85  ? -14.481 -30.373 43.312  1.00 95.60  ? 96   HIS B N   1 
ATOM   3437  C CA  . HIS B 1 85  ? -14.966 -31.543 42.603  1.00 95.60  ? 96   HIS B CA  1 
ATOM   3438  C C   . HIS B 1 85  ? -13.860 -32.584 42.617  1.00 95.60  ? 96   HIS B C   1 
ATOM   3439  O O   . HIS B 1 85  ? -12.718 -32.299 42.975  1.00 95.60  ? 96   HIS B O   1 
ATOM   3440  C CB  . HIS B 1 85  ? -15.311 -31.164 41.165  1.00 85.23  ? 96   HIS B CB  1 
ATOM   3441  C CG  . HIS B 1 85  ? -14.213 -30.430 40.463  1.00 85.23  ? 96   HIS B CG  1 
ATOM   3442  N ND1 . HIS B 1 85  ? -14.452 -29.406 39.573  1.00 85.23  ? 96   HIS B ND1 1 
ATOM   3443  C CD2 . HIS B 1 85  ? -12.867 -30.561 40.530  1.00 85.23  ? 96   HIS B CD2 1 
ATOM   3444  C CE1 . HIS B 1 85  ? -13.302 -28.935 39.125  1.00 85.23  ? 96   HIS B CE1 1 
ATOM   3445  N NE2 . HIS B 1 85  ? -12.324 -29.620 39.691  1.00 85.23  ? 96   HIS B NE2 1 
ATOM   3446  N N   . PRO B 1 86  ? -14.193 -33.818 42.248  1.00 69.33  ? 97   PRO B N   1 
ATOM   3447  C CA  . PRO B 1 86  ? -13.182 -34.873 42.231  1.00 69.33  ? 97   PRO B CA  1 
ATOM   3448  C C   . PRO B 1 86  ? -12.306 -34.815 40.986  1.00 69.33  ? 97   PRO B C   1 
ATOM   3449  O O   . PRO B 1 86  ? -11.421 -35.648 40.803  1.00 69.33  ? 97   PRO B O   1 
ATOM   3450  C CB  . PRO B 1 86  ? -14.020 -36.141 42.289  1.00 41.41  ? 97   PRO B CB  1 
ATOM   3451  C CG  . PRO B 1 86  ? -15.270 -35.752 41.587  1.00 41.41  ? 97   PRO B CG  1 
ATOM   3452  C CD  . PRO B 1 86  ? -15.548 -34.385 42.145  1.00 41.41  ? 97   PRO B CD  1 
ATOM   3453  N N   . GLY B 1 87  ? -12.551 -33.835 40.126  1.00 107.80 ? 98   GLY B N   1 
ATOM   3454  C CA  . GLY B 1 87  ? -11.755 -33.726 38.918  1.00 107.80 ? 98   GLY B CA  1 
ATOM   3455  C C   . GLY B 1 87  ? -12.574 -33.859 37.648  1.00 107.80 ? 98   GLY B C   1 
ATOM   3456  O O   . GLY B 1 87  ? -13.807 -33.856 37.691  1.00 107.80 ? 98   GLY B O   1 
ATOM   3457  N N   . PHE B 1 88  ? -11.891 -33.982 36.514  1.00 59.95  ? 99   PHE B N   1 
ATOM   3458  C CA  . PHE B 1 88  ? -12.572 -34.098 35.237  1.00 59.95  ? 99   PHE B CA  1 
ATOM   3459  C C   . PHE B 1 88  ? -12.416 -35.464 34.566  1.00 59.95  ? 99   PHE B C   1 
ATOM   3460  O O   . PHE B 1 88  ? -11.586 -36.284 34.967  1.00 59.95  ? 99   PHE B O   1 
ATOM   3461  C CB  . PHE B 1 88  ? -12.080 -33.001 34.286  1.00 66.54  ? 99   PHE B CB  1 
ATOM   3462  C CG  . PHE B 1 88  ? -12.557 -31.628 34.650  1.00 66.54  ? 99   PHE B CG  1 
ATOM   3463  C CD1 . PHE B 1 88  ? -13.916 -31.329 34.660  1.00 66.54  ? 99   PHE B CD1 1 
ATOM   3464  C CD2 . PHE B 1 88  ? -11.653 -30.638 35.011  1.00 66.54  ? 99   PHE B CD2 1 
ATOM   3465  C CE1 . PHE B 1 88  ? -14.374 -30.065 35.029  1.00 66.54  ? 99   PHE B CE1 1 
ATOM   3466  C CE2 . PHE B 1 88  ? -12.097 -29.369 35.382  1.00 66.54  ? 99   PHE B CE2 1 
ATOM   3467  C CZ  . PHE B 1 88  ? -13.466 -29.082 35.392  1.00 66.54  ? 99   PHE B CZ  1 
ATOM   3468  N N   . GLY B 1 89  ? -13.250 -35.698 33.553  1.00 75.50  ? 100  GLY B N   1 
ATOM   3469  C CA  . GLY B 1 89  ? -13.200 -36.926 32.785  1.00 75.50  ? 100  GLY B CA  1 
ATOM   3470  C C   . GLY B 1 89  ? -12.304 -36.621 31.599  1.00 75.50  ? 100  GLY B C   1 
ATOM   3471  O O   . GLY B 1 89  ? -11.956 -35.454 31.396  1.00 75.50  ? 100  GLY B O   1 
ATOM   3472  N N   . PRO B 1 90  ? -11.919 -37.624 30.792  1.00 45.45  ? 101  PRO B N   1 
ATOM   3473  C CA  . PRO B 1 90  ? -11.048 -37.405 29.628  1.00 45.45  ? 101  PRO B CA  1 
ATOM   3474  C C   . PRO B 1 90  ? -11.606 -36.319 28.693  1.00 45.45  ? 101  PRO B C   1 
ATOM   3475  O O   . PRO B 1 90  ? -10.858 -35.566 28.049  1.00 45.45  ? 101  PRO B O   1 
ATOM   3476  C CB  . PRO B 1 90  ? -11.020 -38.769 28.959  1.00 58.62  ? 101  PRO B CB  1 
ATOM   3477  C CG  . PRO B 1 90  ? -11.372 -39.718 30.077  1.00 58.62  ? 101  PRO B CG  1 
ATOM   3478  C CD  . PRO B 1 90  ? -12.435 -39.000 30.809  1.00 58.62  ? 101  PRO B CD  1 
ATOM   3479  N N   . LEU B 1 91  ? -12.929 -36.241 28.616  1.00 41.26  ? 102  LEU B N   1 
ATOM   3480  C CA  . LEU B 1 91  ? -13.544 -35.251 27.768  1.00 41.26  ? 102  LEU B CA  1 
ATOM   3481  C C   . LEU B 1 91  ? -13.384 -33.883 28.385  1.00 41.26  ? 102  LEU B C   1 
ATOM   3482  O O   . LEU B 1 91  ? -13.059 -32.926 27.683  1.00 41.26  ? 102  LEU B O   1 
ATOM   3483  C CB  . LEU B 1 91  ? -15.008 -35.597 27.537  1.00 49.04  ? 102  LEU B CB  1 
ATOM   3484  C CG  . LEU B 1 91  ? -15.250 -36.112 26.117  1.00 49.04  ? 102  LEU B CG  1 
ATOM   3485  C CD1 . LEU B 1 91  ? -14.181 -37.122 25.723  1.00 49.04  ? 102  LEU B CD1 1 
ATOM   3486  C CD2 . LEU B 1 91  ? -16.616 -36.745 26.038  1.00 49.04  ? 102  LEU B CD2 1 
ATOM   3487  N N   . GLY B 1 92  ? -13.595 -33.788 29.699  1.00 48.01  ? 103  GLY B N   1 
ATOM   3488  C CA  . GLY B 1 92  ? -13.442 -32.508 30.378  1.00 48.01  ? 103  GLY B CA  1 
ATOM   3489  C C   . GLY B 1 92  ? -12.021 -32.002 30.210  1.00 48.01  ? 103  GLY B C   1 
ATOM   3490  O O   . GLY B 1 92  ? -11.773 -30.817 29.972  1.00 48.01  ? 103  GLY B O   1 
ATOM   3491  N N   . VAL B 1 93  ? -11.087 -32.938 30.322  1.00 46.88  ? 104  VAL B N   1 
ATOM   3492  C CA  . VAL B 1 93  ? -9.674  -32.651 30.173  1.00 46.88  ? 104  VAL B CA  1 
ATOM   3493  C C   . VAL B 1 93  ? -9.352  -32.167 28.773  1.00 46.88  ? 104  VAL B C   1 
ATOM   3494  O O   . VAL B 1 93  ? -8.605  -31.213 28.604  1.00 46.88  ? 104  VAL B O   1 
ATOM   3495  C CB  . VAL B 1 93  ? -8.840  -33.884 30.447  1.00 34.12  ? 104  VAL B CB  1 
ATOM   3496  C CG1 . VAL B 1 93  ? -7.384  -33.576 30.143  1.00 34.12  ? 104  VAL B CG1 1 
ATOM   3497  C CG2 . VAL B 1 93  ? -9.034  -34.328 31.900  1.00 34.12  ? 104  VAL B CG2 1 
ATOM   3498  N N   . GLU B 1 94  ? -9.888  -32.854 27.772  1.00 38.28  ? 105  GLU B N   1 
ATOM   3499  C CA  . GLU B 1 94  ? -9.687  -32.454 26.391  1.00 38.28  ? 105  GLU B CA  1 
ATOM   3500  C C   . GLU B 1 94  ? -10.359 -31.099 26.154  1.00 38.28  ? 105  GLU B C   1 
ATOM   3501  O O   . GLU B 1 94  ? -9.753  -30.215 25.572  1.00 38.28  ? 105  GLU B O   1 
ATOM   3502  C CB  . GLU B 1 94  ? -10.272 -33.497 25.442  1.00 83.75  ? 105  GLU B CB  1 
ATOM   3503  C CG  . GLU B 1 94  ? -9.253  -34.478 24.915  1.00 83.75  ? 105  GLU B CG  1 
ATOM   3504  C CD  . GLU B 1 94  ? -8.088  -33.777 24.244  1.00 83.75  ? 105  GLU B CD  1 
ATOM   3505  O OE1 . GLU B 1 94  ? -8.338  -32.829 23.469  1.00 83.75  ? 105  GLU B OE1 1 
ATOM   3506  O OE2 . GLU B 1 94  ? -6.925  -34.172 24.480  1.00 83.75  ? 105  GLU B OE2 1 
ATOM   3507  N N   . LEU B 1 95  ? -11.599 -30.930 26.618  1.00 28.29  ? 106  LEU B N   1 
ATOM   3508  C CA  . LEU B 1 95  ? -12.306 -29.675 26.440  1.00 28.29  ? 106  LEU B CA  1 
ATOM   3509  C C   . LEU B 1 95  ? -11.528 -28.514 27.030  1.00 28.29  ? 106  LEU B C   1 
ATOM   3510  O O   . LEU B 1 95  ? -11.360 -27.489 26.363  1.00 28.29  ? 106  LEU B O   1 
ATOM   3511  C CB  . LEU B 1 95  ? -13.696 -29.727 27.079  1.00 23.63  ? 106  LEU B CB  1 
ATOM   3512  C CG  . LEU B 1 95  ? -14.493 -28.402 27.140  1.00 23.63  ? 106  LEU B CG  1 
ATOM   3513  C CD1 . LEU B 1 95  ? -14.314 -27.582 25.857  1.00 23.63  ? 106  LEU B CD1 1 
ATOM   3514  C CD2 . LEU B 1 95  ? -15.954 -28.708 27.386  1.00 23.63  ? 106  LEU B CD2 1 
ATOM   3515  N N   . ARG B 1 96  ? -11.070 -28.656 28.278  1.00 29.19  ? 107  ARG B N   1 
ATOM   3516  C CA  . ARG B 1 96  ? -10.302 -27.587 28.919  1.00 29.19  ? 107  ARG B CA  1 
ATOM   3517  C C   . ARG B 1 96  ? -8.993  -27.406 28.190  1.00 29.19  ? 107  ARG B C   1 
ATOM   3518  O O   . ARG B 1 96  ? -8.473  -26.306 28.096  1.00 29.19  ? 107  ARG B O   1 
ATOM   3519  C CB  . ARG B 1 96  ? -10.007 -27.895 30.386  1.00 62.23  ? 107  ARG B CB  1 
ATOM   3520  C CG  . ARG B 1 96  ? -9.165  -26.807 31.061  1.00 62.23  ? 107  ARG B CG  1 
ATOM   3521  C CD  . ARG B 1 96  ? -8.955  -27.075 32.538  1.00 62.23  ? 107  ARG B CD  1 
ATOM   3522  N NE  . ARG B 1 96  ? -8.406  -28.407 32.744  1.00 62.23  ? 107  ARG B NE  1 
ATOM   3523  C CZ  . ARG B 1 96  ? -8.088  -28.924 33.925  1.00 62.23  ? 107  ARG B CZ  1 
ATOM   3524  N NH1 . ARG B 1 96  ? -8.259  -28.222 35.038  1.00 62.23  ? 107  ARG B NH1 1 
ATOM   3525  N NH2 . ARG B 1 96  ? -7.598  -30.155 33.990  1.00 62.23  ? 107  ARG B NH2 1 
ATOM   3526  N N   . LYS B 1 97  ? -8.467  -28.499 27.660  1.00 36.32  ? 108  LYS B N   1 
ATOM   3527  C CA  . LYS B 1 97  ? -7.207  -28.464 26.943  1.00 36.32  ? 108  LYS B CA  1 
ATOM   3528  C C   . LYS B 1 97  ? -7.291  -27.570 25.702  1.00 36.32  ? 108  LYS B C   1 
ATOM   3529  O O   . LYS B 1 97  ? -6.377  -26.788 25.418  1.00 36.32  ? 108  LYS B O   1 
ATOM   3530  C CB  . LYS B 1 97  ? -6.783  -29.894 26.565  1.00 58.20  ? 108  LYS B CB  1 
ATOM   3531  C CG  . LYS B 1 97  ? -5.321  -30.034 26.187  1.00 58.20  ? 108  LYS B CG  1 
ATOM   3532  C CD  . LYS B 1 97  ? -4.954  -31.480 25.943  1.00 58.20  ? 108  LYS B CD  1 
ATOM   3533  C CE  . LYS B 1 97  ? -4.932  -32.305 27.236  1.00 58.20  ? 108  LYS B CE  1 
ATOM   3534  N NZ  . LYS B 1 97  ? -3.753  -32.059 28.140  1.00 58.20  ? 108  LYS B NZ  1 
ATOM   3535  N N   . ASN B 1 98  ? -8.379  -27.678 24.954  1.00 49.18  ? 109  ASN B N   1 
ATOM   3536  C CA  . ASN B 1 98  ? -8.515  -26.840 23.774  1.00 49.18  ? 109  ASN B CA  1 
ATOM   3537  C C   . ASN B 1 98  ? -8.666  -25.414 24.277  1.00 49.18  ? 109  ASN B C   1 
ATOM   3538  O O   . ASN B 1 98  ? -7.913  -24.519 23.883  1.00 49.18  ? 109  ASN B O   1 
ATOM   3539  C CB  . ASN B 1 98  ? -9.725  -27.270 22.939  1.00 83.03  ? 109  ASN B CB  1 
ATOM   3540  C CG  . ASN B 1 98  ? -9.497  -28.591 22.227  1.00 83.03  ? 109  ASN B CG  1 
ATOM   3541  O OD1 . ASN B 1 98  ? -8.536  -28.743 21.475  1.00 83.03  ? 109  ASN B OD1 1 
ATOM   3542  N ND2 . ASN B 1 98  ? -10.382 -29.554 22.460  1.00 83.03  ? 109  ASN B ND2 1 
ATOM   3543  N N   . LEU B 1 99  ? -9.624  -25.220 25.177  1.00 38.76  ? 110  LEU B N   1 
ATOM   3544  C CA  . LEU B 1 99  ? -9.887  -23.915 25.767  1.00 38.76  ? 110  LEU B CA  1 
ATOM   3545  C C   . LEU B 1 99  ? -8.567  -23.265 26.167  1.00 38.76  ? 110  LEU B C   1 
ATOM   3546  O O   . LEU B 1 99  ? -8.300  -22.105 25.849  1.00 38.76  ? 110  LEU B O   1 
ATOM   3547  C CB  . LEU B 1 99  ? -10.783 -24.093 26.981  1.00 38.36  ? 110  LEU B CB  1 
ATOM   3548  C CG  . LEU B 1 99  ? -11.418 -22.865 27.621  1.00 38.36  ? 110  LEU B CG  1 
ATOM   3549  C CD1 . LEU B 1 99  ? -11.966 -21.913 26.565  1.00 38.36  ? 110  LEU B CD1 1 
ATOM   3550  C CD2 . LEU B 1 99  ? -12.529 -23.356 28.541  1.00 38.36  ? 110  LEU B CD2 1 
ATOM   3551  N N   . ALA B 1 100 ? -7.733  -24.027 26.860  1.00 37.50  ? 111  ALA B N   1 
ATOM   3552  C CA  . ALA B 1 100 ? -6.433  -23.535 27.280  1.00 37.50  ? 111  ALA B CA  1 
ATOM   3553  C C   . ALA B 1 100 ? -5.652  -23.139 26.031  1.00 37.50  ? 111  ALA B C   1 
ATOM   3554  O O   . ALA B 1 100 ? -5.045  -22.072 25.960  1.00 37.50  ? 111  ALA B O   1 
ATOM   3555  C CB  . ALA B 1 100 ? -5.695  -24.623 28.040  1.00 17.57  ? 111  ALA B CB  1 
ATOM   3556  N N   . ALA B 1 101 ? -5.691  -24.020 25.041  1.00 55.58  ? 112  ALA B N   1 
ATOM   3557  C CA  . ALA B 1 101 ? -5.000  -23.819 23.783  1.00 55.58  ? 112  ALA B CA  1 
ATOM   3558  C C   . ALA B 1 101 ? -5.458  -22.570 23.070  1.00 55.58  ? 112  ALA B C   1 
ATOM   3559  O O   . ALA B 1 101 ? -4.636  -21.779 22.612  1.00 55.58  ? 112  ALA B O   1 
ATOM   3560  C CB  . ALA B 1 101 ? -5.229  -24.976 22.922  1.00 16.80  ? 112  ALA B CB  1 
ATOM   3561  N N   . GLU B 1 102 ? -6.771  -22.402 22.957  1.00 30.65  ? 113  GLU B N   1 
ATOM   3562  C CA  . GLU B 1 102 ? -7.317  -21.224 22.303  1.00 30.65  ? 113  GLU B CA  1 
ATOM   3563  C C   . GLU B 1 102 ? -6.855  -19.953 23.040  1.00 30.65  ? 113  GLU B C   1 
ATOM   3564  O O   . GLU B 1 102 ? -6.297  -19.034 22.433  1.00 30.65  ? 113  GLU B O   1 
ATOM   3565  C CB  . GLU B 1 102 ? -8.833  -21.297 22.293  1.00 93.36  ? 113  GLU B CB  1 
ATOM   3566  C CG  . GLU B 1 102 ? -9.433  -20.734 21.044  1.00 93.36  ? 113  GLU B CG  1 
ATOM   3567  C CD  . GLU B 1 102 ? -9.063  -21.540 19.819  1.00 93.36  ? 113  GLU B CD  1 
ATOM   3568  O OE1 . GLU B 1 102 ? -9.206  -22.783 19.866  1.00 93.36  ? 113  GLU B OE1 1 
ATOM   3569  O OE2 . GLU B 1 102 ? -8.640  -20.931 18.810  1.00 93.36  ? 113  GLU B OE2 1 
ATOM   3570  N N   . TRP B 1 103 ? -7.077  -19.917 24.355  1.00 29.46  ? 114  TRP B N   1 
ATOM   3571  C CA  . TRP B 1 103 ? -6.699  -18.767 25.185  1.00 29.46  ? 114  TRP B CA  1 
ATOM   3572  C C   . TRP B 1 103 ? -5.299  -18.331 24.823  1.00 29.46  ? 114  TRP B C   1 
ATOM   3573  O O   . TRP B 1 103 ? -5.004  -17.155 24.635  1.00 29.46  ? 114  TRP B O   1 
ATOM   3574  C CB  . TRP B 1 103 ? -6.712  -19.150 26.674  1.00 48.01  ? 114  TRP B CB  1 
ATOM   3575  C CG  . TRP B 1 103 ? -6.387  -18.012 27.605  1.00 48.01  ? 114  TRP B CG  1 
ATOM   3576  C CD1 . TRP B 1 103 ? -7.270  -17.175 28.201  1.00 48.01  ? 114  TRP B CD1 1 
ATOM   3577  C CD2 . TRP B 1 103 ? -5.084  -17.547 27.981  1.00 48.01  ? 114  TRP B CD2 1 
ATOM   3578  N NE1 . TRP B 1 103 ? -6.609  -16.210 28.923  1.00 48.01  ? 114  TRP B NE1 1 
ATOM   3579  C CE2 . TRP B 1 103 ? -5.263  -16.419 28.801  1.00 48.01  ? 114  TRP B CE2 1 
ATOM   3580  C CE3 . TRP B 1 103 ? -3.781  -17.972 27.702  1.00 48.01  ? 114  TRP B CE3 1 
ATOM   3581  C CZ2 . TRP B 1 103 ? -4.187  -15.711 29.346  1.00 48.01  ? 114  TRP B CZ2 1 
ATOM   3582  C CZ3 . TRP B 1 103 ? -2.711  -17.262 28.251  1.00 48.01  ? 114  TRP B CZ3 1 
ATOM   3583  C CH2 . TRP B 1 103 ? -2.924  -16.150 29.059  1.00 48.01  ? 114  TRP B CH2 1 
ATOM   3584  N N   . TRP B 1 104 ? -4.440  -19.328 24.733  1.00 37.42  ? 115  TRP B N   1 
ATOM   3585  C CA  . TRP B 1 104 ? -3.049  -19.108 24.447  1.00 37.42  ? 115  TRP B CA  1 
ATOM   3586  C C   . TRP B 1 104 ? -2.850  -18.457 23.100  1.00 37.42  ? 115  TRP B C   1 
ATOM   3587  O O   . TRP B 1 104 ? -2.173  -17.449 22.992  1.00 37.42  ? 115  TRP B O   1 
ATOM   3588  C CB  . TRP B 1 104 ? -2.290  -20.440 24.539  1.00 59.18  ? 115  TRP B CB  1 
ATOM   3589  C CG  . TRP B 1 104 ? -0.837  -20.229 24.668  1.00 59.18  ? 115  TRP B CG  1 
ATOM   3590  C CD1 . TRP B 1 104 ? 0.070   -20.133 23.654  1.00 59.18  ? 115  TRP B CD1 1 
ATOM   3591  C CD2 . TRP B 1 104 ? -0.132  -19.914 25.869  1.00 59.18  ? 115  TRP B CD2 1 
ATOM   3592  N NE1 . TRP B 1 104 ? 1.296   -19.765 24.147  1.00 59.18  ? 115  TRP B NE1 1 
ATOM   3593  C CE2 . TRP B 1 104 ? 1.201   -19.622 25.506  1.00 59.18  ? 115  TRP B CE2 1 
ATOM   3594  C CE3 . TRP B 1 104 ? -0.497  -19.842 27.217  1.00 59.18  ? 115  TRP B CE3 1 
ATOM   3595  C CZ2 . TRP B 1 104 ? 2.173   -19.260 26.447  1.00 59.18  ? 115  TRP B CZ2 1 
ATOM   3596  C CZ3 . TRP B 1 104 ? 0.465   -19.482 28.146  1.00 59.18  ? 115  TRP B CZ3 1 
ATOM   3597  C CH2 . TRP B 1 104 ? 1.786   -19.194 27.756  1.00 59.18  ? 115  TRP B CH2 1 
ATOM   3598  N N   . THR B 1 105 ? -3.453  -19.024 22.071  1.00 34.07  ? 116  THR B N   1 
ATOM   3599  C CA  . THR B 1 105 ? -3.284  -18.462 20.753  1.00 34.07  ? 116  THR B CA  1 
ATOM   3600  C C   . THR B 1 105 ? -3.768  -17.020 20.738  1.00 34.07  ? 116  THR B C   1 
ATOM   3601  O O   . THR B 1 105 ? -3.218  -16.168 20.035  1.00 34.07  ? 116  THR B O   1 
ATOM   3602  C CB  . THR B 1 105 ? -4.070  -19.257 19.702  1.00 42.37  ? 116  THR B CB  1 
ATOM   3603  O OG1 . THR B 1 105 ? -4.487  -20.504 20.260  1.00 42.37  ? 116  THR B OG1 1 
ATOM   3604  C CG2 . THR B 1 105 ? -3.194  -19.538 18.496  1.00 42.37  ? 116  THR B CG2 1 
ATOM   3605  N N   . SER B 1 106 ? -4.788  -16.740 21.541  1.00 45.74  ? 117  SER B N   1 
ATOM   3606  C CA  . SER B 1 106 ? -5.375  -15.413 21.575  1.00 45.74  ? 117  SER B CA  1 
ATOM   3607  C C   . SER B 1 106 ? -4.472  -14.300 22.071  1.00 45.74  ? 117  SER B C   1 
ATOM   3608  O O   . SER B 1 106 ? -4.351  -13.270 21.420  1.00 45.74  ? 117  SER B O   1 
ATOM   3609  C CB  . SER B 1 106 ? -6.653  -15.439 22.393  1.00 68.73  ? 117  SER B CB  1 
ATOM   3610  O OG  . SER B 1 106 ? -7.405  -14.274 22.136  1.00 68.73  ? 117  SER B OG  1 
ATOM   3611  N N   . VAL B 1 107 ? -3.837  -14.500 23.217  1.00 46.67  ? 118  VAL B N   1 
ATOM   3612  C CA  . VAL B 1 107 ? -2.959  -13.476 23.782  1.00 46.67  ? 118  VAL B CA  1 
ATOM   3613  C C   . VAL B 1 107 ? -1.454  -13.659 23.498  1.00 46.67  ? 118  VAL B C   1 
ATOM   3614  O O   . VAL B 1 107 ? -0.776  -12.736 23.030  1.00 46.67  ? 118  VAL B O   1 
ATOM   3615  C CB  . VAL B 1 107 ? -3.190  -13.360 25.316  1.00 62.55  ? 118  VAL B CB  1 
ATOM   3616  C CG1 . VAL B 1 107 ? -3.744  -14.665 25.858  1.00 62.55  ? 118  VAL B CG1 1 
ATOM   3617  C CG2 . VAL B 1 107 ? -1.891  -13.021 26.024  1.00 62.55  ? 118  VAL B CG2 1 
ATOM   3618  N N   . VAL B 1 108 ? -0.948  -14.858 23.769  1.00 66.06  ? 119  VAL B N   1 
ATOM   3619  C CA  . VAL B 1 108 ? 0.463   -15.173 23.588  1.00 66.06  ? 119  VAL B CA  1 
ATOM   3620  C C   . VAL B 1 108 ? 0.956   -15.423 22.161  1.00 66.06  ? 119  VAL B C   1 
ATOM   3621  O O   . VAL B 1 108 ? 1.855   -14.733 21.711  1.00 66.06  ? 119  VAL B O   1 
ATOM   3622  C CB  . VAL B 1 108 ? 0.857   -16.384 24.453  1.00 114.60 ? 119  VAL B CB  1 
ATOM   3623  C CG1 . VAL B 1 108 ? 2.360   -16.492 24.533  1.00 114.60 ? 119  VAL B CG1 1 
ATOM   3624  C CG2 . VAL B 1 108 ? 0.274   -16.243 25.837  1.00 114.60 ? 119  VAL B CG2 1 
ATOM   3625  N N   . VAL B 1 109 ? 0.403   -16.395 21.442  1.00 62.59  ? 120  VAL B N   1 
ATOM   3626  C CA  . VAL B 1 109 ? 0.899   -16.640 20.088  1.00 62.59  ? 120  VAL B CA  1 
ATOM   3627  C C   . VAL B 1 109 ? 0.834   -15.361 19.254  1.00 62.59  ? 120  VAL B C   1 
ATOM   3628  O O   . VAL B 1 109 ? 1.868   -14.715 19.032  1.00 62.59  ? 120  VAL B O   1 
ATOM   3629  C CB  . VAL B 1 109 ? 0.118   -17.756 19.345  1.00 56.32  ? 120  VAL B CB  1 
ATOM   3630  C CG1 . VAL B 1 109 ? 0.860   -18.150 18.086  1.00 56.32  ? 120  VAL B CG1 1 
ATOM   3631  C CG2 . VAL B 1 109 ? -0.028  -18.973 20.218  1.00 56.32  ? 120  VAL B CG2 1 
ATOM   3632  N N   . PHE B 1 110 ? -0.375  -15.007 18.802  1.00 101.73 ? 121  PHE B N   1 
ATOM   3633  C CA  . PHE B 1 110 ? -0.631  -13.803 17.996  1.00 101.73 ? 121  PHE B CA  1 
ATOM   3634  C C   . PHE B 1 110 ? 0.534   -12.824 17.989  1.00 101.73 ? 121  PHE B C   1 
ATOM   3635  O O   . PHE B 1 110 ? 1.518   -13.030 17.287  1.00 101.73 ? 121  PHE B O   1 
ATOM   3636  C CB  . PHE B 1 110 ? -1.879  -13.069 18.514  1.00 191.79 ? 121  PHE B CB  1 
ATOM   3637  C CG  . PHE B 1 110 ? -3.179  -13.547 17.913  1.00 191.79 ? 121  PHE B CG  1 
ATOM   3638  C CD1 . PHE B 1 110 ? -4.388  -12.995 18.331  1.00 191.79 ? 121  PHE B CD1 1 
ATOM   3639  C CD2 . PHE B 1 110 ? -3.201  -14.528 16.925  1.00 191.79 ? 121  PHE B CD2 1 
ATOM   3640  C CE1 . PHE B 1 110 ? -5.598  -13.410 17.774  1.00 191.79 ? 121  PHE B CE1 1 
ATOM   3641  C CE2 . PHE B 1 110 ? -4.410  -14.950 16.361  1.00 191.79 ? 121  PHE B CE2 1 
ATOM   3642  C CZ  . PHE B 1 110 ? -5.609  -14.389 16.788  1.00 191.79 ? 121  PHE B CZ  1 
ATOM   3643  N N   . ARG B 1 111 ? 0.406   -11.757 18.773  1.00 66.91  ? 122  ARG B N   1 
ATOM   3644  C CA  . ARG B 1 111 ? 1.443   -10.723 18.891  1.00 66.91  ? 122  ARG B CA  1 
ATOM   3645  C C   . ARG B 1 111 ? 2.452   -11.108 20.001  1.00 66.91  ? 122  ARG B C   1 
ATOM   3646  O O   . ARG B 1 111 ? 2.346   -10.643 21.142  1.00 66.91  ? 122  ARG B O   1 
ATOM   3647  C CB  . ARG B 1 111 ? 0.790   -9.364  19.208  1.00 107.08 ? 122  ARG B CB  1 
ATOM   3648  C CG  . ARG B 1 111 ? -0.068  -9.374  20.484  1.00 107.08 ? 122  ARG B CG  1 
ATOM   3649  C CD  . ARG B 1 111 ? -0.673  -8.008  20.830  1.00 107.08 ? 122  ARG B CD  1 
ATOM   3650  N NE  . ARG B 1 111 ? -1.868  -7.673  20.054  1.00 107.08 ? 122  ARG B NE  1 
ATOM   3651  C CZ  . ARG B 1 111 ? -3.020  -8.334  20.116  1.00 107.08 ? 122  ARG B CZ  1 
ATOM   3652  N NH1 . ARG B 1 111 ? -3.147  -9.381  20.919  1.00 107.08 ? 122  ARG B NH1 1 
ATOM   3653  N NH2 . ARG B 1 111 ? -4.052  -7.937  19.382  1.00 107.08 ? 122  ARG B NH2 1 
ATOM   3654  N N   . GLU B 1 112 ? 3.435   -11.936 19.638  1.00 201.15 ? 123  GLU B N   1 
ATOM   3655  C CA  . GLU B 1 112 ? 4.449   -12.436 20.574  1.00 201.15 ? 123  GLU B CA  1 
ATOM   3656  C C   . GLU B 1 112 ? 5.422   -11.435 21.213  1.00 201.15 ? 123  GLU B C   1 
ATOM   3657  O O   . GLU B 1 112 ? 6.610   -11.382 20.885  1.00 201.15 ? 123  GLU B O   1 
ATOM   3658  C CB  . GLU B 1 112 ? 5.236   -13.592 19.923  1.00 122.98 ? 123  GLU B CB  1 
ATOM   3659  C CG  . GLU B 1 112 ? 6.335   -14.210 20.802  1.00 122.98 ? 123  GLU B CG  1 
ATOM   3660  C CD  . GLU B 1 112 ? 6.759   -15.604 20.347  1.00 122.98 ? 123  GLU B CD  1 
ATOM   3661  O OE1 . GLU B 1 112 ? 6.919   -15.820 19.126  1.00 122.98 ? 123  GLU B OE1 1 
ATOM   3662  O OE2 . GLU B 1 112 ? 6.941   -16.483 21.217  1.00 122.98 ? 123  GLU B OE2 1 
ATOM   3663  N N   . GLN B 1 113 ? 4.881   -10.644 22.133  1.00 76.18  ? 124  GLN B N   1 
ATOM   3664  C CA  . GLN B 1 113 ? 5.631   -9.669  22.920  1.00 76.18  ? 124  GLN B CA  1 
ATOM   3665  C C   . GLN B 1 113 ? 5.316   -10.230 24.311  1.00 76.18  ? 124  GLN B C   1 
ATOM   3666  O O   . GLN B 1 113 ? 5.673   -9.673  25.343  1.00 76.18  ? 124  GLN B O   1 
ATOM   3667  C CB  . GLN B 1 113 ? 5.028   -8.262  22.783  1.00 112.17 ? 124  GLN B CB  1 
ATOM   3668  C CG  . GLN B 1 113 ? 4.037   -8.090  21.630  1.00 112.17 ? 124  GLN B CG  1 
ATOM   3669  C CD  . GLN B 1 113 ? 3.244   -6.788  21.712  1.00 112.17 ? 124  GLN B CD  1 
ATOM   3670  O OE1 . GLN B 1 113 ? 3.794   -5.695  21.570  1.00 112.17 ? 124  GLN B OE1 1 
ATOM   3671  N NE2 . GLN B 1 113 ? 1.942   -6.907  21.947  1.00 112.17 ? 124  GLN B NE2 1 
ATOM   3672  N N   . VAL B 1 114 ? 4.604   -11.351 24.288  1.00 57.84  ? 125  VAL B N   1 
ATOM   3673  C CA  . VAL B 1 114 ? 4.178   -12.075 25.472  1.00 57.84  ? 125  VAL B CA  1 
ATOM   3674  C C   . VAL B 1 114 ? 5.047   -13.328 25.599  1.00 57.84  ? 125  VAL B C   1 
ATOM   3675  O O   . VAL B 1 114 ? 5.282   -14.037 24.625  1.00 57.84  ? 125  VAL B O   1 
ATOM   3676  C CB  . VAL B 1 114 ? 2.685   -12.489 25.349  1.00 35.72  ? 125  VAL B CB  1 
ATOM   3677  C CG1 . VAL B 1 114 ? 2.273   -13.347 26.528  1.00 35.72  ? 125  VAL B CG1 1 
ATOM   3678  C CG2 . VAL B 1 114 ? 1.809   -11.253 25.270  1.00 35.72  ? 125  VAL B CG2 1 
ATOM   3679  N N   . PHE B 1 115 ? 5.531   -13.595 26.800  1.00 65.10  ? 126  PHE B N   1 
ATOM   3680  C CA  . PHE B 1 115 ? 6.365   -14.758 27.006  1.00 65.10  ? 126  PHE B CA  1 
ATOM   3681  C C   . PHE B 1 115 ? 5.774   -15.743 28.023  1.00 65.10  ? 126  PHE B C   1 
ATOM   3682  O O   . PHE B 1 115 ? 5.197   -15.340 29.043  1.00 65.10  ? 126  PHE B O   1 
ATOM   3683  C CB  . PHE B 1 115 ? 7.756   -14.328 27.486  1.00 54.43  ? 126  PHE B CB  1 
ATOM   3684  C CG  . PHE B 1 115 ? 8.509   -13.458 26.514  1.00 54.43  ? 126  PHE B CG  1 
ATOM   3685  C CD1 . PHE B 1 115 ? 8.462   -12.077 26.615  1.00 54.43  ? 126  PHE B CD1 1 
ATOM   3686  C CD2 . PHE B 1 115 ? 9.299   -14.027 25.513  1.00 54.43  ? 126  PHE B CD2 1 
ATOM   3687  C CE1 . PHE B 1 115 ? 9.195   -11.274 25.735  1.00 54.43  ? 126  PHE B CE1 1 
ATOM   3688  C CE2 . PHE B 1 115 ? 10.030  -13.235 24.632  1.00 54.43  ? 126  PHE B CE2 1 
ATOM   3689  C CZ  . PHE B 1 115 ? 9.976   -11.856 24.747  1.00 54.43  ? 126  PHE B CZ  1 
ATOM   3690  N N   . PRO B 1 116 ? 5.888   -17.054 27.751  1.00 58.40  ? 127  PRO B N   1 
ATOM   3691  C CA  . PRO B 1 116 ? 5.343   -17.987 28.729  1.00 58.40  ? 127  PRO B CA  1 
ATOM   3692  C C   . PRO B 1 116 ? 6.420   -17.962 29.795  1.00 58.40  ? 127  PRO B C   1 
ATOM   3693  O O   . PRO B 1 116 ? 7.606   -17.879 29.475  1.00 58.40  ? 127  PRO B O   1 
ATOM   3694  C CB  . PRO B 1 116 ? 5.332   -19.296 27.969  1.00 37.59  ? 127  PRO B CB  1 
ATOM   3695  C CG  . PRO B 1 116 ? 6.596   -19.201 27.201  1.00 37.59  ? 127  PRO B CG  1 
ATOM   3696  C CD  . PRO B 1 116 ? 6.553   -17.788 26.662  1.00 37.59  ? 127  PRO B CD  1 
ATOM   3697  N N   . VAL B 1 117 ? 6.022   -18.018 31.053  1.00 41.83  ? 128  VAL B N   1 
ATOM   3698  C CA  . VAL B 1 117 ? 6.989   -17.975 32.128  1.00 41.83  ? 128  VAL B CA  1 
ATOM   3699  C C   . VAL B 1 117 ? 6.656   -19.119 33.089  1.00 41.83  ? 128  VAL B C   1 
ATOM   3700  O O   . VAL B 1 117 ? 5.538   -19.624 33.071  1.00 41.83  ? 128  VAL B O   1 
ATOM   3701  C CB  . VAL B 1 117 ? 6.907   -16.598 32.792  1.00 37.04  ? 128  VAL B CB  1 
ATOM   3702  C CG1 . VAL B 1 117 ? 5.742   -16.557 33.742  1.00 37.04  ? 128  VAL B CG1 1 
ATOM   3703  C CG2 . VAL B 1 117 ? 8.224   -16.251 33.442  1.00 37.04  ? 128  VAL B CG2 1 
ATOM   3704  N N   . ASP B 1 118 ? 7.606   -19.548 33.917  1.00 70.74  ? 129  ASP B N   1 
ATOM   3705  C CA  . ASP B 1 118 ? 7.312   -20.666 34.816  1.00 70.74  ? 129  ASP B CA  1 
ATOM   3706  C C   . ASP B 1 118 ? 7.599   -20.445 36.290  1.00 70.74  ? 129  ASP B C   1 
ATOM   3707  O O   . ASP B 1 118 ? 8.752   -20.421 36.710  1.00 70.74  ? 129  ASP B O   1 
ATOM   3708  C CB  . ASP B 1 118 ? 8.052   -21.917 34.357  1.00 121.84 ? 129  ASP B CB  1 
ATOM   3709  C CG  . ASP B 1 118 ? 7.586   -23.164 35.076  1.00 121.84 ? 129  ASP B CG  1 
ATOM   3710  O OD1 . ASP B 1 118 ? 6.390   -23.510 34.948  1.00 121.84 ? 129  ASP B OD1 1 
ATOM   3711  O OD2 . ASP B 1 118 ? 8.416   -23.796 35.765  1.00 121.84 ? 129  ASP B OD2 1 
ATOM   3712  N N   . ALA B 1 119 ? 6.525   -20.332 37.067  1.00 63.96  ? 130  ALA B N   1 
ATOM   3713  C CA  . ALA B 1 119 ? 6.588   -20.104 38.503  1.00 63.96  ? 130  ALA B CA  1 
ATOM   3714  C C   . ALA B 1 119 ? 6.324   -21.386 39.263  1.00 63.96  ? 130  ALA B C   1 
ATOM   3715  O O   . ALA B 1 119 ? 5.861   -22.361 38.687  1.00 63.96  ? 130  ALA B O   1 
ATOM   3716  C CB  . ALA B 1 119 ? 5.556   -19.077 38.887  1.00 19.85  ? 130  ALA B CB  1 
ATOM   3717  N N   . LEU B 1 120 ? 6.594   -21.376 40.563  1.00 58.22  ? 131  LEU B N   1 
ATOM   3718  C CA  . LEU B 1 120 ? 6.362   -22.552 41.401  1.00 58.22  ? 131  LEU B CA  1 
ATOM   3719  C C   . LEU B 1 120 ? 4.927   -22.592 41.927  1.00 58.22  ? 131  LEU B C   1 
ATOM   3720  O O   . LEU B 1 120 ? 4.177   -21.623 41.791  1.00 58.22  ? 131  LEU B O   1 
ATOM   3721  C CB  . LEU B 1 120 ? 7.354   -22.582 42.569  1.00 61.88  ? 131  LEU B CB  1 
ATOM   3722  C CG  . LEU B 1 120 ? 8.819   -22.487 42.131  1.00 61.88  ? 131  LEU B CG  1 
ATOM   3723  C CD1 . LEU B 1 120 ? 9.721   -22.738 43.319  1.00 61.88  ? 131  LEU B CD1 1 
ATOM   3724  C CD2 . LEU B 1 120 ? 9.103   -23.495 41.031  1.00 61.88  ? 131  LEU B CD2 1 
ATOM   3725  N N   . HIS B 1 121 ? 4.549   -23.722 42.519  1.00 42.66  ? 132  HIS B N   1 
ATOM   3726  C CA  . HIS B 1 121 ? 3.201   -23.895 43.044  1.00 42.66  ? 132  HIS B CA  1 
ATOM   3727  C C   . HIS B 1 121 ? 3.077   -23.533 44.506  1.00 42.66  ? 132  HIS B C   1 
ATOM   3728  O O   . HIS B 1 121 ? 1.973   -23.508 45.029  1.00 42.66  ? 132  HIS B O   1 
ATOM   3729  C CB  . HIS B 1 121 ? 2.720   -25.331 42.859  1.00 48.68  ? 132  HIS B CB  1 
ATOM   3730  C CG  . HIS B 1 121 ? 2.515   -25.718 41.431  1.00 48.68  ? 132  HIS B CG  1 
ATOM   3731  N ND1 . HIS B 1 121 ? 3.555   -26.057 40.593  1.00 48.68  ? 132  HIS B ND1 1 
ATOM   3732  C CD2 . HIS B 1 121 ? 1.390   -25.793 40.685  1.00 48.68  ? 132  HIS B CD2 1 
ATOM   3733  C CE1 . HIS B 1 121 ? 3.079   -26.324 39.390  1.00 48.68  ? 132  HIS B CE1 1 
ATOM   3734  N NE2 . HIS B 1 121 ? 1.768   -26.169 39.419  1.00 48.68  ? 132  HIS B NE2 1 
ATOM   3735  N N   . HIS B 1 122 ? 4.196   -23.255 45.172  1.00 50.21  ? 133  HIS B N   1 
ATOM   3736  C CA  . HIS B 1 122 ? 4.147   -22.888 46.588  1.00 50.21  ? 133  HIS B CA  1 
ATOM   3737  C C   . HIS B 1 122 ? 5.066   -21.719 46.906  1.00 50.21  ? 133  HIS B C   1 
ATOM   3738  O O   . HIS B 1 122 ? 6.156   -21.611 46.347  1.00 50.21  ? 133  HIS B O   1 
ATOM   3739  C CB  . HIS B 1 122 ? 4.537   -24.081 47.475  1.00 73.73  ? 133  HIS B CB  1 
ATOM   3740  C CG  . HIS B 1 122 ? 6.014   -24.315 47.558  1.00 73.73  ? 133  HIS B CG  1 
ATOM   3741  N ND1 . HIS B 1 122 ? 6.795   -24.548 46.447  1.00 73.73  ? 133  HIS B ND1 1 
ATOM   3742  C CD2 . HIS B 1 122 ? 6.852   -24.349 48.619  1.00 73.73  ? 133  HIS B CD2 1 
ATOM   3743  C CE1 . HIS B 1 122 ? 8.050   -24.717 46.820  1.00 73.73  ? 133  HIS B CE1 1 
ATOM   3744  N NE2 . HIS B 1 122 ? 8.112   -24.602 48.133  1.00 73.73  ? 133  HIS B NE2 1 
ATOM   3745  N N   . LYS B 1 123 ? 4.608   -20.850 47.803  1.00 78.80  ? 134  LYS B N   1 
ATOM   3746  C CA  . LYS B 1 123 ? 5.376   -19.688 48.249  1.00 78.80  ? 134  LYS B CA  1 
ATOM   3747  C C   . LYS B 1 123 ? 6.183   -20.184 49.443  1.00 78.80  ? 134  LYS B C   1 
ATOM   3748  O O   . LYS B 1 123 ? 5.667   -20.281 50.551  1.00 78.80  ? 134  LYS B O   1 
ATOM   3749  C CB  . LYS B 1 123 ? 4.425   -18.556 48.677  1.00 76.25  ? 134  LYS B CB  1 
ATOM   3750  C CG  . LYS B 1 123 ? 5.084   -17.372 49.390  1.00 76.25  ? 134  LYS B CG  1 
ATOM   3751  C CD  . LYS B 1 123 ? 5.893   -16.482 48.458  1.00 76.25  ? 134  LYS B CD  1 
ATOM   3752  C CE  . LYS B 1 123 ? 6.676   -15.430 49.245  1.00 76.25  ? 134  LYS B CE  1 
ATOM   3753  N NZ  . LYS B 1 123 ? 7.739   -16.036 50.112  1.00 76.25  ? 134  LYS B NZ  1 
ATOM   3754  N N   . PRO B 1 124 ? 7.463   -20.508 49.230  1.00 61.96  ? 135  PRO B N   1 
ATOM   3755  C CA  . PRO B 1 124 ? 8.345   -21.006 50.288  1.00 61.96  ? 135  PRO B CA  1 
ATOM   3756  C C   . PRO B 1 124 ? 8.616   -20.035 51.426  1.00 61.96  ? 135  PRO B C   1 
ATOM   3757  O O   . PRO B 1 124 ? 7.834   -19.120 51.671  1.00 61.96  ? 135  PRO B O   1 
ATOM   3758  C CB  . PRO B 1 124 ? 9.615   -21.364 49.526  1.00 86.71  ? 135  PRO B CB  1 
ATOM   3759  C CG  . PRO B 1 124 ? 9.645   -20.331 48.468  1.00 86.71  ? 135  PRO B CG  1 
ATOM   3760  C CD  . PRO B 1 124 ? 8.216   -20.313 47.982  1.00 86.71  ? 135  PRO B CD  1 
ATOM   3761  N N   . GLY B 1 125 ? 9.728   -20.274 52.119  1.00 157.05 ? 136  GLY B N   1 
ATOM   3762  C CA  . GLY B 1 125 ? 10.174  -19.440 53.224  1.00 157.05 ? 136  GLY B CA  1 
ATOM   3763  C C   . GLY B 1 125 ? 9.166   -18.802 54.166  1.00 157.05 ? 136  GLY B C   1 
ATOM   3764  O O   . GLY B 1 125 ? 7.967   -19.081 54.105  1.00 157.05 ? 136  GLY B O   1 
ATOM   3765  N N   . PRO B 1 126 ? 9.647   -17.933 55.071  1.00 87.12  ? 137  PRO B N   1 
ATOM   3766  C CA  . PRO B 1 126 ? 8.830   -17.222 56.061  1.00 87.12  ? 137  PRO B CA  1 
ATOM   3767  C C   . PRO B 1 126 ? 7.758   -16.296 55.484  1.00 87.12  ? 137  PRO B C   1 
ATOM   3768  O O   . PRO B 1 126 ? 8.036   -15.474 54.612  1.00 87.12  ? 137  PRO B O   1 
ATOM   3769  C CB  . PRO B 1 126 ? 9.871   -16.461 56.878  1.00 146.14 ? 137  PRO B CB  1 
ATOM   3770  C CG  . PRO B 1 126 ? 11.059  -17.375 56.828  1.00 146.14 ? 137  PRO B CG  1 
ATOM   3771  C CD  . PRO B 1 126 ? 11.082  -17.770 55.371  1.00 146.14 ? 137  PRO B CD  1 
ATOM   3772  N N   . LEU B 1 127 ? 6.537   -16.438 55.995  1.00 74.84  ? 138  LEU B N   1 
ATOM   3773  C CA  . LEU B 1 127 ? 5.389   -15.634 55.573  1.00 74.84  ? 138  LEU B CA  1 
ATOM   3774  C C   . LEU B 1 127 ? 5.105   -14.516 56.582  1.00 74.84  ? 138  LEU B C   1 
ATOM   3775  O O   . LEU B 1 127 ? 5.819   -14.367 57.573  1.00 74.84  ? 138  LEU B O   1 
ATOM   3776  C CB  . LEU B 1 127 ? 4.137   -16.519 55.450  1.00 49.62  ? 138  LEU B CB  1 
ATOM   3777  C CG  . LEU B 1 127 ? 3.672   -17.176 54.138  1.00 49.62  ? 138  LEU B CG  1 
ATOM   3778  C CD1 . LEU B 1 127 ? 4.780   -18.008 53.486  1.00 49.62  ? 138  LEU B CD1 1 
ATOM   3779  C CD2 . LEU B 1 127 ? 2.468   -18.036 54.455  1.00 49.62  ? 138  LEU B CD2 1 
ATOM   3780  N N   . LEU B 1 128 ? 4.054   -13.740 56.326  1.00 151.60 ? 139  LEU B N   1 
ATOM   3781  C CA  . LEU B 1 128 ? 3.663   -12.645 57.213  1.00 151.60 ? 139  LEU B CA  1 
ATOM   3782  C C   . LEU B 1 128 ? 2.747   -13.170 58.332  1.00 151.60 ? 139  LEU B C   1 
ATOM   3783  O O   . LEU B 1 128 ? 2.357   -14.339 58.321  1.00 151.60 ? 139  LEU B O   1 
ATOM   3784  C CB  . LEU B 1 128 ? 2.966   -11.536 56.402  1.00 110.93 ? 139  LEU B CB  1 
ATOM   3785  C CG  . LEU B 1 128 ? 1.635   -11.773 55.671  1.00 110.93 ? 139  LEU B CG  1 
ATOM   3786  C CD1 . LEU B 1 128 ? 0.476   -11.739 56.659  1.00 110.93 ? 139  LEU B CD1 1 
ATOM   3787  C CD2 . LEU B 1 128 ? 1.437   -10.689 54.613  1.00 110.93 ? 139  LEU B CD2 1 
ATOM   3788  N N   . PRO B 1 129 ? 2.400   -12.316 59.316  1.00 114.26 ? 140  PRO B N   1 
ATOM   3789  C CA  . PRO B 1 129 ? 1.531   -12.719 60.433  1.00 114.26 ? 140  PRO B CA  1 
ATOM   3790  C C   . PRO B 1 129 ? 0.066   -13.000 60.083  1.00 114.26 ? 140  PRO B C   1 
ATOM   3791  O O   . PRO B 1 129 ? -0.775  -12.104 60.128  1.00 114.26 ? 140  PRO B O   1 
ATOM   3792  C CB  . PRO B 1 129 ? 1.675   -11.558 61.414  1.00 199.73 ? 140  PRO B CB  1 
ATOM   3793  C CG  . PRO B 1 129 ? 1.877   -10.388 60.506  1.00 199.73 ? 140  PRO B CG  1 
ATOM   3794  C CD  . PRO B 1 129 ? 2.873   -10.932 59.507  1.00 199.73 ? 140  PRO B CD  1 
ATOM   3795  N N   . GLY B 1 130 ? -0.232  -14.253 59.750  1.00 150.51 ? 141  GLY B N   1 
ATOM   3796  C CA  . GLY B 1 130 ? -1.594  -14.620 59.407  1.00 150.51 ? 141  GLY B CA  1 
ATOM   3797  C C   . GLY B 1 130 ? -1.698  -15.420 58.121  1.00 150.51 ? 141  GLY B C   1 
ATOM   3798  O O   . GLY B 1 130 ? -1.400  -16.615 58.101  1.00 150.51 ? 141  GLY B O   1 
ATOM   3799  N N   . ASP B 1 131 ? -2.128  -14.753 57.052  1.00 201.99 ? 142  ASP B N   1 
ATOM   3800  C CA  . ASP B 1 131 ? -2.288  -15.368 55.735  1.00 201.99 ? 142  ASP B CA  1 
ATOM   3801  C C   . ASP B 1 131 ? -3.516  -16.275 55.642  1.00 201.99 ? 142  ASP B C   1 
ATOM   3802  O O   . ASP B 1 131 ? -4.110  -16.411 54.571  1.00 201.99 ? 142  ASP B O   1 
ATOM   3803  C CB  . ASP B 1 131 ? -1.030  -16.155 55.353  1.00 134.77 ? 142  ASP B CB  1 
ATOM   3804  C CG  . ASP B 1 131 ? 0.207   -15.284 55.312  1.00 134.77 ? 142  ASP B CG  1 
ATOM   3805  O OD1 . ASP B 1 131 ? 0.526   -14.675 56.353  1.00 134.77 ? 142  ASP B OD1 1 
ATOM   3806  O OD2 . ASP B 1 131 ? 0.860   -15.208 54.248  1.00 134.77 ? 142  ASP B OD2 1 
ATOM   3807  N N   . SER B 1 132 ? -3.884  -16.900 56.759  1.00 149.12 ? 143  SER B N   1 
ATOM   3808  C CA  . SER B 1 132 ? -5.053  -17.780 56.814  1.00 149.12 ? 143  SER B CA  1 
ATOM   3809  C C   . SER B 1 132 ? -4.978  -19.001 55.895  1.00 149.12 ? 143  SER B C   1 
ATOM   3810  O O   . SER B 1 132 ? -5.829  -19.890 55.961  1.00 149.12 ? 143  SER B O   1 
ATOM   3811  C CB  . SER B 1 132 ? -6.323  -16.983 56.491  1.00 177.61 ? 143  SER B CB  1 
ATOM   3812  O OG  . SER B 1 132 ? -6.504  -15.912 57.402  1.00 177.61 ? 143  SER B OG  1 
ATOM   3813  N N   . ALA B 1 133 ? -3.969  -19.043 55.033  1.00 131.47 ? 144  ALA B N   1 
ATOM   3814  C CA  . ALA B 1 133 ? -3.809  -20.169 54.124  1.00 131.47 ? 144  ALA B CA  1 
ATOM   3815  C C   . ALA B 1 133 ? -3.086  -21.307 54.836  1.00 131.47 ? 144  ALA B C   1 
ATOM   3816  O O   . ALA B 1 133 ? -2.329  -21.089 55.784  1.00 131.47 ? 144  ALA B O   1 
ATOM   3817  C CB  . ALA B 1 133 ? -3.028  -19.742 52.878  1.00 129.11 ? 144  ALA B CB  1 
ATOM   3818  N N   . PHE B 1 134 ? -3.332  -22.525 54.379  1.00 41.54  ? 145  PHE B N   1 
ATOM   3819  C CA  . PHE B 1 134 ? -2.708  -23.690 54.963  1.00 41.54  ? 145  PHE B CA  1 
ATOM   3820  C C   . PHE B 1 134 ? -1.201  -23.674 54.740  1.00 41.54  ? 145  PHE B C   1 
ATOM   3821  O O   . PHE B 1 134 ? -0.733  -23.287 53.664  1.00 41.54  ? 145  PHE B O   1 
ATOM   3822  C CB  . PHE B 1 134 ? -3.280  -24.962 54.326  1.00 83.51  ? 145  PHE B CB  1 
ATOM   3823  C CG  . PHE B 1 134 ? -4.775  -25.030 54.336  1.00 83.51  ? 145  PHE B CG  1 
ATOM   3824  C CD1 . PHE B 1 134 ? -5.477  -25.006 55.532  1.00 83.51  ? 145  PHE B CD1 1 
ATOM   3825  C CD2 . PHE B 1 134 ? -5.483  -25.115 53.144  1.00 83.51  ? 145  PHE B CD2 1 
ATOM   3826  C CE1 . PHE B 1 134 ? -6.863  -25.064 55.544  1.00 83.51  ? 145  PHE B CE1 1 
ATOM   3827  C CE2 . PHE B 1 134 ? -6.873  -25.172 53.144  1.00 83.51  ? 145  PHE B CE2 1 
ATOM   3828  C CZ  . PHE B 1 134 ? -7.565  -25.147 54.351  1.00 83.51  ? 145  PHE B CZ  1 
ATOM   3829  N N   . ARG B 1 135 ? -0.451  -24.116 55.750  1.00 50.02  ? 146  ARG B N   1 
ATOM   3830  C CA  . ARG B 1 135 ? 1.004   -24.196 55.657  1.00 50.02  ? 146  ARG B CA  1 
ATOM   3831  C C   . ARG B 1 135 ? 1.369   -25.586 55.138  1.00 50.02  ? 146  ARG B C   1 
ATOM   3832  O O   . ARG B 1 135 ? 0.615   -26.542 55.331  1.00 50.02  ? 146  ARG B O   1 
ATOM   3833  C CB  . ARG B 1 135 ? 1.640   -24.016 57.036  1.00 79.66  ? 146  ARG B CB  1 
ATOM   3834  C CG  . ARG B 1 135 ? 1.314   -22.713 57.739  1.00 79.66  ? 146  ARG B CG  1 
ATOM   3835  C CD  . ARG B 1 135 ? 2.022   -21.532 57.100  1.00 79.66  ? 146  ARG B CD  1 
ATOM   3836  N NE  . ARG B 1 135 ? 1.727   -20.273 57.782  1.00 79.66  ? 146  ARG B NE  1 
ATOM   3837  C CZ  . ARG B 1 135 ? 0.508   -19.755 57.920  1.00 79.66  ? 146  ARG B CZ  1 
ATOM   3838  N NH1 . ARG B 1 135 ? -0.553  -20.385 57.425  1.00 79.66  ? 146  ARG B NH1 1 
ATOM   3839  N NH2 . ARG B 1 135 ? 0.355   -18.600 58.558  1.00 79.66  ? 146  ARG B NH2 1 
ATOM   3840  N N   . LEU B 1 136 ? 2.517   -25.702 54.473  1.00 48.80  ? 147  LEU B N   1 
ATOM   3841  C CA  . LEU B 1 136 ? 2.989   -27.005 53.980  1.00 48.80  ? 147  LEU B CA  1 
ATOM   3842  C C   . LEU B 1 136 ? 4.018   -27.531 54.977  1.00 48.80  ? 147  LEU B C   1 
ATOM   3843  O O   . LEU B 1 136 ? 5.161   -27.069 55.014  1.00 48.80  ? 147  LEU B O   1 
ATOM   3844  C CB  . LEU B 1 136 ? 3.647   -26.873 52.610  1.00 51.02  ? 147  LEU B CB  1 
ATOM   3845  C CG  . LEU B 1 136 ? 2.770   -26.236 51.546  1.00 51.02  ? 147  LEU B CG  1 
ATOM   3846  C CD1 . LEU B 1 136 ? 3.528   -26.205 50.239  1.00 51.02  ? 147  LEU B CD1 1 
ATOM   3847  C CD2 . LEU B 1 136 ? 1.485   -27.011 51.410  1.00 51.02  ? 147  LEU B CD2 1 
ATOM   3848  N N   . VAL B 1 137 ? 3.601   -28.500 55.783  1.00 71.88  ? 148  VAL B N   1 
ATOM   3849  C CA  . VAL B 1 137 ? 4.465   -29.075 56.805  1.00 71.88  ? 148  VAL B CA  1 
ATOM   3850  C C   . VAL B 1 137 ? 5.024   -30.435 56.370  1.00 71.88  ? 148  VAL B C   1 
ATOM   3851  O O   . VAL B 1 137 ? 4.272   -31.353 56.029  1.00 71.88  ? 148  VAL B O   1 
ATOM   3852  C CB  . VAL B 1 137 ? 3.679   -29.225 58.134  1.00 68.24  ? 148  VAL B CB  1 
ATOM   3853  C CG1 . VAL B 1 137 ? 4.634   -29.181 59.318  1.00 68.24  ? 148  VAL B CG1 1 
ATOM   3854  C CG2 . VAL B 1 137 ? 2.649   -28.118 58.250  1.00 68.24  ? 148  VAL B CG2 1 
ATOM   3855  N N   . SER B 1 138 ? 6.348   -30.561 56.378  1.00 84.68  ? 149  SER B N   1 
ATOM   3856  C CA  . SER B 1 138 ? 6.981   -31.812 55.980  1.00 84.68  ? 149  SER B CA  1 
ATOM   3857  C C   . SER B 1 138 ? 6.567   -32.943 56.912  1.00 84.68  ? 149  SER B C   1 
ATOM   3858  O O   . SER B 1 138 ? 7.187   -33.157 57.955  1.00 84.68  ? 149  SER B O   1 
ATOM   3859  C CB  . SER B 1 138 ? 8.506   -31.675 55.984  1.00 201.99 ? 149  SER B CB  1 
ATOM   3860  O OG  . SER B 1 138 ? 9.127   -32.890 55.590  1.00 201.99 ? 149  SER B OG  1 
ATOM   3861  N N   . ALA B 1 139 ? 5.521   -33.666 56.515  1.00 109.87 ? 150  ALA B N   1 
ATOM   3862  C CA  . ALA B 1 139 ? 4.976   -34.784 57.286  1.00 109.87 ? 150  ALA B CA  1 
ATOM   3863  C C   . ALA B 1 139 ? 5.982   -35.512 58.164  1.00 109.87 ? 150  ALA B C   1 
ATOM   3864  O O   . ALA B 1 139 ? 5.750   -35.697 59.356  1.00 109.87 ? 150  ALA B O   1 
ATOM   3865  C CB  . ALA B 1 139 ? 4.314   -35.782 56.350  1.00 87.46  ? 150  ALA B CB  1 
ATOM   3866  N N   . GLU B 1 140 ? 7.101   -35.921 57.578  1.00 95.00  ? 151  GLU B N   1 
ATOM   3867  C CA  . GLU B 1 140 ? 8.105   -36.651 58.336  1.00 95.00  ? 151  GLU B CA  1 
ATOM   3868  C C   . GLU B 1 140 ? 8.836   -35.804 59.377  1.00 95.00  ? 151  GLU B C   1 
ATOM   3869  O O   . GLU B 1 140 ? 9.938   -36.144 59.810  1.00 95.00  ? 151  GLU B O   1 
ATOM   3870  C CB  . GLU B 1 140 ? 9.108   -37.316 57.389  1.00 201.99 ? 151  GLU B CB  1 
ATOM   3871  C CG  . GLU B 1 140 ? 9.859   -38.496 58.013  1.00 201.99 ? 151  GLU B CG  1 
ATOM   3872  C CD  . GLU B 1 140 ? 8.934   -39.619 58.475  1.00 201.99 ? 151  GLU B CD  1 
ATOM   3873  O OE1 . GLU B 1 140 ? 8.104   -39.387 59.381  1.00 201.99 ? 151  GLU B OE1 1 
ATOM   3874  O OE2 . GLU B 1 140 ? 9.038   -40.739 57.930  1.00 201.99 ? 151  GLU B OE2 1 
ATOM   3875  N N   . THR B 1 141 ? 8.223   -34.693 59.768  1.00 94.59  ? 152  THR B N   1 
ATOM   3876  C CA  . THR B 1 141 ? 8.794   -33.831 60.793  1.00 94.59  ? 152  THR B CA  1 
ATOM   3877  C C   . THR B 1 141 ? 7.839   -33.975 61.959  1.00 94.59  ? 152  THR B C   1 
ATOM   3878  O O   . THR B 1 141 ? 8.247   -34.013 63.118  1.00 94.59  ? 152  THR B O   1 
ATOM   3879  C CB  . THR B 1 141 ? 8.839   -32.350 60.367  1.00 99.28  ? 152  THR B CB  1 
ATOM   3880  O OG1 . THR B 1 141 ? 7.521   -31.907 60.020  1.00 99.28  ? 152  THR B OG1 1 
ATOM   3881  C CG2 . THR B 1 141 ? 9.767   -32.167 59.188  1.00 99.28  ? 152  THR B CG2 1 
ATOM   3882  N N   . LEU B 1 142 ? 6.555   -34.061 61.631  1.00 105.28 ? 153  LEU B N   1 
ATOM   3883  C CA  . LEU B 1 142 ? 5.527   -34.224 62.642  1.00 105.28 ? 153  LEU B CA  1 
ATOM   3884  C C   . LEU B 1 142 ? 5.901   -35.476 63.420  1.00 105.28 ? 153  LEU B C   1 
ATOM   3885  O O   . LEU B 1 142 ? 5.916   -35.474 64.650  1.00 105.28 ? 153  LEU B O   1 
ATOM   3886  C CB  . LEU B 1 142 ? 4.146   -34.384 61.984  1.00 65.51  ? 153  LEU B CB  1 
ATOM   3887  C CG  . LEU B 1 142 ? 3.610   -33.191 61.175  1.00 65.51  ? 153  LEU B CG  1 
ATOM   3888  C CD1 . LEU B 1 142 ? 2.253   -33.546 60.584  1.00 65.51  ? 153  LEU B CD1 1 
ATOM   3889  C CD2 . LEU B 1 142 ? 3.502   -31.969 62.063  1.00 65.51  ? 153  LEU B CD2 1 
ATOM   3890  N N   . ARG B 1 143 ? 6.221   -36.540 62.689  1.00 88.06  ? 154  ARG B N   1 
ATOM   3891  C CA  . ARG B 1 143 ? 6.621   -37.803 63.304  1.00 88.06  ? 154  ARG B CA  1 
ATOM   3892  C C   . ARG B 1 143 ? 7.739   -37.575 64.342  1.00 88.06  ? 154  ARG B C   1 
ATOM   3893  O O   . ARG B 1 143 ? 7.530   -37.798 65.536  1.00 88.06  ? 154  ARG B O   1 
ATOM   3894  C CB  . ARG B 1 143 ? 7.072   -38.791 62.214  1.00 82.92  ? 154  ARG B CB  1 
ATOM   3895  C CG  . ARG B 1 143 ? 6.084   -39.918 61.930  1.00 82.92  ? 154  ARG B CG  1 
ATOM   3896  C CD  . ARG B 1 143 ? 6.134   -40.966 63.047  1.00 82.92  ? 154  ARG B CD  1 
ATOM   3897  N NE  . ARG B 1 143 ? 5.303   -42.146 62.792  1.00 82.92  ? 154  ARG B NE  1 
ATOM   3898  C CZ  . ARG B 1 143 ? 4.046   -42.294 63.210  1.00 82.92  ? 154  ARG B CZ  1 
ATOM   3899  N NH1 . ARG B 1 143 ? 3.448   -41.336 63.915  1.00 82.92  ? 154  ARG B NH1 1 
ATOM   3900  N NH2 . ARG B 1 143 ? 3.382   -43.412 62.933  1.00 82.92  ? 154  ARG B NH2 1 
ATOM   3901  N N   . GLU B 1 144 ? 8.906   -37.109 63.888  1.00 93.85  ? 155  GLU B N   1 
ATOM   3902  C CA  . GLU B 1 144 ? 10.047  -36.845 64.775  1.00 93.85  ? 155  GLU B CA  1 
ATOM   3903  C C   . GLU B 1 144 ? 9.695   -35.944 65.950  1.00 93.85  ? 155  GLU B C   1 
ATOM   3904  O O   . GLU B 1 144 ? 10.547  -35.620 66.773  1.00 93.85  ? 155  GLU B O   1 
ATOM   3905  C CB  . GLU B 1 144 ? 11.206  -36.197 64.009  1.00 145.07 ? 155  GLU B CB  1 
ATOM   3906  C CG  . GLU B 1 144 ? 11.970  -37.126 63.087  1.00 145.07 ? 155  GLU B CG  1 
ATOM   3907  C CD  . GLU B 1 144 ? 13.265  -36.507 62.591  1.00 145.07 ? 155  GLU B CD  1 
ATOM   3908  O OE1 . GLU B 1 144 ? 13.945  -37.138 61.751  1.00 145.07 ? 155  GLU B OE1 1 
ATOM   3909  O OE2 . GLU B 1 144 ? 13.603  -35.390 63.045  1.00 145.07 ? 155  GLU B OE2 1 
ATOM   3910  N N   . ILE B 1 145 ? 8.441   -35.524 66.013  1.00 138.15 ? 156  ILE B N   1 
ATOM   3911  C CA  . ILE B 1 145 ? 7.987   -34.669 67.089  1.00 138.15 ? 156  ILE B CA  1 
ATOM   3912  C C   . ILE B 1 145 ? 7.153   -35.512 68.042  1.00 138.15 ? 156  ILE B C   1 
ATOM   3913  O O   . ILE B 1 145 ? 7.067   -35.219 69.232  1.00 138.15 ? 156  ILE B O   1 
ATOM   3914  C CB  . ILE B 1 145 ? 7.162   -33.507 66.530  1.00 137.94 ? 156  ILE B CB  1 
ATOM   3915  C CG1 . ILE B 1 145 ? 8.042   -32.682 65.596  1.00 137.94 ? 156  ILE B CG1 1 
ATOM   3916  C CG2 . ILE B 1 145 ? 6.639   -32.635 67.652  1.00 137.94 ? 156  ILE B CG2 1 
ATOM   3917  C CD1 . ILE B 1 145 ? 7.278   -31.689 64.775  1.00 137.94 ? 156  ILE B CD1 1 
ATOM   3918  N N   . LEU B 1 146 ? 6.541   -36.567 67.516  1.00 111.31 ? 157  LEU B N   1 
ATOM   3919  C CA  . LEU B 1 146 ? 5.745   -37.457 68.346  1.00 111.31 ? 157  LEU B CA  1 
ATOM   3920  C C   . LEU B 1 146 ? 6.706   -38.500 68.912  1.00 111.31 ? 157  LEU B C   1 
ATOM   3921  O O   . LEU B 1 146 ? 6.450   -39.708 68.892  1.00 111.31 ? 157  LEU B O   1 
ATOM   3922  C CB  . LEU B 1 146 ? 4.641   -38.115 67.515  1.00 81.28  ? 157  LEU B CB  1 
ATOM   3923  C CG  . LEU B 1 146 ? 3.651   -37.143 66.867  1.00 81.28  ? 157  LEU B CG  1 
ATOM   3924  C CD1 . LEU B 1 146 ? 2.500   -37.932 66.276  1.00 81.28  ? 157  LEU B CD1 1 
ATOM   3925  C CD2 . LEU B 1 146 ? 3.130   -36.151 67.896  1.00 81.28  ? 157  LEU B CD2 1 
ATOM   3926  N N   . GLN B 1 147 ? 7.827   -37.991 69.410  1.00 122.69 ? 158  GLN B N   1 
ATOM   3927  C CA  . GLN B 1 147 ? 8.901   -38.783 69.994  1.00 122.69 ? 158  GLN B CA  1 
ATOM   3928  C C   . GLN B 1 147 ? 9.782   -37.749 70.699  1.00 122.69 ? 158  GLN B C   1 
ATOM   3929  O O   . GLN B 1 147 ? 9.287   -36.711 71.131  1.00 122.69 ? 158  GLN B O   1 
ATOM   3930  C CB  . GLN B 1 147 ? 9.686   -39.487 68.881  1.00 197.60 ? 158  GLN B CB  1 
ATOM   3931  C CG  . GLN B 1 147 ? 10.761  -40.458 69.349  1.00 197.60 ? 158  GLN B CG  1 
ATOM   3932  C CD  . GLN B 1 147 ? 11.643  -40.935 68.209  1.00 197.60 ? 158  GLN B CD  1 
ATOM   3933  O OE1 . GLN B 1 147 ? 11.161  -41.515 67.235  1.00 197.60 ? 158  GLN B OE1 1 
ATOM   3934  N NE2 . GLN B 1 147 ? 12.945  -40.690 68.325  1.00 197.60 ? 158  GLN B NE2 1 
ATOM   3935  N N   . ASP B 1 148 ? 11.079  -38.020 70.806  1.00 130.05 ? 159  ASP B N   1 
ATOM   3936  C CA  . ASP B 1 148 ? 12.014  -37.096 71.445  1.00 130.05 ? 159  ASP B CA  1 
ATOM   3937  C C   . ASP B 1 148 ? 11.695  -36.821 72.916  1.00 130.05 ? 159  ASP B C   1 
ATOM   3938  O O   . ASP B 1 148 ? 12.603  -36.711 73.744  1.00 130.05 ? 159  ASP B O   1 
ATOM   3939  C CB  . ASP B 1 148 ? 12.052  -35.761 70.682  1.00 140.62 ? 159  ASP B CB  1 
ATOM   3940  C CG  . ASP B 1 148 ? 12.494  -35.918 69.230  1.00 140.62 ? 159  ASP B CG  1 
ATOM   3941  O OD1 . ASP B 1 148 ? 12.730  -34.886 68.561  1.00 140.62 ? 159  ASP B OD1 1 
ATOM   3942  O OD2 . ASP B 1 148 ? 12.601  -37.071 68.757  1.00 140.62 ? 159  ASP B OD2 1 
ATOM   3943  N N   . LYS B 1 149 ? 10.408  -36.701 73.230  1.00 201.99 ? 160  LYS B N   1 
ATOM   3944  C CA  . LYS B 1 149 ? 9.941   -36.423 74.586  1.00 201.99 ? 160  LYS B CA  1 
ATOM   3945  C C   . LYS B 1 149 ? 10.439  -35.068 75.079  1.00 201.99 ? 160  LYS B C   1 
ATOM   3946  O O   . LYS B 1 149 ? 10.002  -34.584 76.124  1.00 201.99 ? 160  LYS B O   1 
ATOM   3947  C CB  . LYS B 1 149 ? 10.391  -37.523 75.553  1.00 146.23 ? 160  LYS B CB  1 
ATOM   3948  C CG  . LYS B 1 149 ? 9.930   -37.315 76.991  1.00 146.23 ? 160  LYS B CG  1 
ATOM   3949  C CD  . LYS B 1 149 ? 10.310  -38.495 77.866  1.00 146.23 ? 160  LYS B CD  1 
ATOM   3950  C CE  . LYS B 1 149 ? 9.649   -39.774 77.371  1.00 146.23 ? 160  LYS B CE  1 
ATOM   3951  N NZ  . LYS B 1 149 ? 10.012  -40.963 78.193  1.00 146.23 ? 160  LYS B NZ  1 
ATOM   3952  N N   . GLU B 1 150 ? 11.352  -34.463 74.319  1.00 189.16 ? 161  GLU B N   1 
ATOM   3953  C CA  . GLU B 1 150 ? 11.909  -33.161 74.669  1.00 189.16 ? 161  GLU B CA  1 
ATOM   3954  C C   . GLU B 1 150 ? 10.775  -32.256 75.122  1.00 189.16 ? 161  GLU B C   1 
ATOM   3955  O O   . GLU B 1 150 ? 9.952   -31.824 74.315  1.00 189.16 ? 161  GLU B O   1 
ATOM   3956  C CB  . GLU B 1 150 ? 12.622  -32.541 73.465  1.00 198.12 ? 161  GLU B CB  1 
ATOM   3957  C CG  . GLU B 1 150 ? 13.238  -31.181 73.751  1.00 198.12 ? 161  GLU B CG  1 
ATOM   3958  C CD  . GLU B 1 150 ? 13.985  -30.612 72.561  1.00 198.12 ? 161  GLU B CD  1 
ATOM   3959  O OE1 . GLU B 1 150 ? 13.369  -30.451 71.487  1.00 198.12 ? 161  GLU B OE1 1 
ATOM   3960  O OE2 . GLU B 1 150 ? 15.192  -30.324 72.701  1.00 198.12 ? 161  GLU B OE2 1 
ATOM   3961  N N   . LEU B 1 151 ? 10.745  -31.977 76.422  1.00 155.91 ? 162  LEU B N   1 
ATOM   3962  C CA  . LEU B 1 151 ? 9.700   -31.159 77.016  1.00 155.91 ? 162  LEU B CA  1 
ATOM   3963  C C   . LEU B 1 151 ? 8.371   -31.550 76.393  1.00 155.91 ? 162  LEU B C   1 
ATOM   3964  O O   . LEU B 1 151 ? 7.760   -30.770 75.669  1.00 155.91 ? 162  LEU B O   1 
ATOM   3965  C CB  . LEU B 1 151 ? 9.977   -29.666 76.806  1.00 97.30  ? 162  LEU B CB  1 
ATOM   3966  C CG  . LEU B 1 151 ? 10.988  -29.012 77.757  1.00 97.30  ? 162  LEU B CG  1 
ATOM   3967  C CD1 . LEU B 1 151 ? 12.398  -29.444 77.393  1.00 97.30  ? 162  LEU B CD1 1 
ATOM   3968  C CD2 . LEU B 1 151 ? 10.868  -27.495 77.684  1.00 97.30  ? 162  LEU B CD2 1 
ATOM   3969  N N   . SER B 1 152 ? 7.944   -32.779 76.671  1.00 201.96 ? 163  SER B N   1 
ATOM   3970  C CA  . SER B 1 152 ? 6.691   -33.309 76.150  1.00 201.96 ? 163  SER B CA  1 
ATOM   3971  C C   . SER B 1 152 ? 5.494   -32.487 76.642  1.00 201.96 ? 163  SER B C   1 
ATOM   3972  O O   . SER B 1 152 ? 4.417   -33.031 76.899  1.00 201.96 ? 163  SER B O   1 
ATOM   3973  C CB  . SER B 1 152 ? 6.536   -34.776 76.574  1.00 96.41  ? 163  SER B CB  1 
ATOM   3974  O OG  . SER B 1 152 ? 7.605   -35.569 76.083  1.00 96.41  ? 163  SER B OG  1 
ATOM   3975  N N   . LYS B 1 153 ? 5.697   -31.175 76.761  1.00 114.54 ? 164  LYS B N   1 
ATOM   3976  C CA  . LYS B 1 153 ? 4.667   -30.246 77.221  1.00 114.54 ? 164  LYS B CA  1 
ATOM   3977  C C   . LYS B 1 153 ? 4.982   -28.793 76.837  1.00 114.54 ? 164  LYS B C   1 
ATOM   3978  O O   . LYS B 1 153 ? 4.079   -28.022 76.524  1.00 114.54 ? 164  LYS B O   1 
ATOM   3979  C CB  . LYS B 1 153 ? 4.510   -30.346 78.746  1.00 137.09 ? 164  LYS B CB  1 
ATOM   3980  C CG  . LYS B 1 153 ? 3.785   -31.599 79.233  1.00 137.09 ? 164  LYS B CG  1 
ATOM   3981  C CD  . LYS B 1 153 ? 3.977   -31.815 80.729  1.00 137.09 ? 164  LYS B CD  1 
ATOM   3982  C CE  . LYS B 1 153 ? 5.389   -32.286 81.045  1.00 137.09 ? 164  LYS B CE  1 
ATOM   3983  N NZ  . LYS B 1 153 ? 5.656   -33.623 80.448  1.00 137.09 ? 164  LYS B NZ  1 
ATOM   3984  N N   . GLU B 1 154 ? 6.259   -28.419 76.857  1.00 129.17 ? 165  GLU B N   1 
ATOM   3985  C CA  . GLU B 1 154 ? 6.638   -27.051 76.520  1.00 129.17 ? 165  GLU B CA  1 
ATOM   3986  C C   . GLU B 1 154 ? 7.399   -26.848 75.212  1.00 129.17 ? 165  GLU B C   1 
ATOM   3987  O O   . GLU B 1 154 ? 7.288   -25.789 74.593  1.00 129.17 ? 165  GLU B O   1 
ATOM   3988  C CB  . GLU B 1 154 ? 7.422   -26.427 77.675  1.00 135.03 ? 165  GLU B CB  1 
ATOM   3989  C CG  . GLU B 1 154 ? 6.526   -25.853 78.754  1.00 135.03 ? 165  GLU B CG  1 
ATOM   3990  C CD  . GLU B 1 154 ? 5.516   -24.866 78.188  1.00 135.03 ? 165  GLU B CD  1 
ATOM   3991  O OE1 . GLU B 1 154 ? 4.635   -25.291 77.407  1.00 135.03 ? 165  GLU B OE1 1 
ATOM   3992  O OE2 . GLU B 1 154 ? 5.608   -23.663 78.518  1.00 135.03 ? 165  GLU B OE2 1 
ATOM   3993  N N   . GLN B 1 155 ? 8.175   -27.845 74.794  1.00 201.91 ? 166  GLN B N   1 
ATOM   3994  C CA  . GLN B 1 155 ? 8.926   -27.748 73.542  1.00 201.91 ? 166  GLN B CA  1 
ATOM   3995  C C   . GLN B 1 155 ? 7.995   -27.977 72.350  1.00 201.91 ? 166  GLN B C   1 
ATOM   3996  O O   . GLN B 1 155 ? 8.177   -27.392 71.282  1.00 201.91 ? 166  GLN B O   1 
ATOM   3997  C CB  . GLN B 1 155 ? 10.063  -28.775 73.519  1.00 174.06 ? 166  GLN B CB  1 
ATOM   3998  C CG  . GLN B 1 155 ? 11.364  -28.308 74.169  1.00 174.06 ? 166  GLN B CG  1 
ATOM   3999  C CD  . GLN B 1 155 ? 12.132  -27.311 73.313  1.00 174.06 ? 166  GLN B CD  1 
ATOM   4000  O OE1 . GLN B 1 155 ? 13.253  -26.924 73.649  1.00 174.06 ? 166  GLN B OE1 1 
ATOM   4001  N NE2 . GLN B 1 155 ? 11.532  -26.892 72.203  1.00 174.06 ? 166  GLN B NE2 1 
ATOM   4002  N N   . LEU B 1 156 ? 7.002   -28.839 72.548  1.00 84.60  ? 167  LEU B N   1 
ATOM   4003  C CA  . LEU B 1 156 ? 6.011   -29.155 71.525  1.00 84.60  ? 167  LEU B CA  1 
ATOM   4004  C C   . LEU B 1 156 ? 4.882   -28.140 71.581  1.00 84.60  ? 167  LEU B C   1 
ATOM   4005  O O   . LEU B 1 156 ? 3.804   -28.379 71.046  1.00 84.60  ? 167  LEU B O   1 
ATOM   4006  C CB  . LEU B 1 156 ? 5.424   -30.546 71.763  1.00 72.52  ? 167  LEU B CB  1 
ATOM   4007  C CG  . LEU B 1 156 ? 5.748   -31.617 70.728  1.00 72.52  ? 167  LEU B CG  1 
ATOM   4008  C CD1 . LEU B 1 156 ? 7.261   -31.852 70.690  1.00 72.52  ? 167  LEU B CD1 1 
ATOM   4009  C CD2 . LEU B 1 156 ? 4.995   -32.892 71.079  1.00 72.52  ? 167  LEU B CD2 1 
ATOM   4010  N N   . VAL B 1 157 ? 5.128   -27.019 72.250  1.00 82.09  ? 168  VAL B N   1 
ATOM   4011  C CA  . VAL B 1 157 ? 4.127   -25.963 72.384  1.00 82.09  ? 168  VAL B CA  1 
ATOM   4012  C C   . VAL B 1 157 ? 4.718   -24.614 71.981  1.00 82.09  ? 168  VAL B C   1 
ATOM   4013  O O   . VAL B 1 157 ? 4.017   -23.601 71.940  1.00 82.09  ? 168  VAL B O   1 
ATOM   4014  C CB  . VAL B 1 157 ? 3.577   -25.899 73.836  1.00 201.99 ? 168  VAL B CB  1 
ATOM   4015  C CG1 . VAL B 1 157 ? 2.602   -24.738 73.992  1.00 201.99 ? 168  VAL B CG1 1 
ATOM   4016  C CG2 . VAL B 1 157 ? 2.871   -27.202 74.169  1.00 201.99 ? 168  VAL B CG2 1 
ATOM   4017  N N   . THR B 1 158 ? 6.017   -24.623 71.682  1.00 131.44 ? 169  THR B N   1 
ATOM   4018  C CA  . THR B 1 158 ? 6.748   -23.435 71.234  1.00 131.44 ? 169  THR B CA  1 
ATOM   4019  C C   . THR B 1 158 ? 7.118   -23.701 69.777  1.00 131.44 ? 169  THR B C   1 
ATOM   4020  O O   . THR B 1 158 ? 7.364   -22.782 68.993  1.00 131.44 ? 169  THR B O   1 
ATOM   4021  C CB  . THR B 1 158 ? 8.044   -23.220 72.040  1.00 201.99 ? 169  THR B CB  1 
ATOM   4022  O OG1 . THR B 1 158 ? 7.722   -23.018 73.423  1.00 201.99 ? 169  THR B OG1 1 
ATOM   4023  C CG2 . THR B 1 158 ? 8.806   -22.006 71.511  1.00 201.99 ? 169  THR B CG2 1 
ATOM   4024  N N   . PHE B 1 159 ? 7.155   -24.987 69.443  1.00 126.25 ? 170  PHE B N   1 
ATOM   4025  C CA  . PHE B 1 159 ? 7.456   -25.450 68.098  1.00 126.25 ? 170  PHE B CA  1 
ATOM   4026  C C   . PHE B 1 159 ? 6.408   -24.893 67.149  1.00 126.25 ? 170  PHE B C   1 
ATOM   4027  O O   . PHE B 1 159 ? 6.736   -24.188 66.198  1.00 126.25 ? 170  PHE B O   1 
ATOM   4028  C CB  . PHE B 1 159 ? 7.433   -26.979 68.066  1.00 117.73 ? 170  PHE B CB  1 
ATOM   4029  C CG  . PHE B 1 159 ? 7.086   -27.554 66.729  1.00 117.73 ? 170  PHE B CG  1 
ATOM   4030  C CD1 . PHE B 1 159 ? 7.872   -27.289 65.616  1.00 117.73 ? 170  PHE B CD1 1 
ATOM   4031  C CD2 . PHE B 1 159 ? 5.964   -28.361 66.581  1.00 117.73 ? 170  PHE B CD2 1 
ATOM   4032  C CE1 . PHE B 1 159 ? 7.544   -27.822 64.369  1.00 117.73 ? 170  PHE B CE1 1 
ATOM   4033  C CE2 . PHE B 1 159 ? 5.624   -28.900 65.342  1.00 117.73 ? 170  PHE B CE2 1 
ATOM   4034  C CZ  . PHE B 1 159 ? 6.415   -28.630 64.233  1.00 117.73 ? 170  PHE B CZ  1 
ATOM   4035  N N   . LEU B 1 160 ? 5.147   -25.216 67.415  1.00 67.63  ? 171  LEU B N   1 
ATOM   4036  C CA  . LEU B 1 160 ? 4.042   -24.735 66.598  1.00 67.63  ? 171  LEU B CA  1 
ATOM   4037  C C   . LEU B 1 160 ? 4.055   -23.209 66.388  1.00 67.63  ? 171  LEU B C   1 
ATOM   4038  O O   . LEU B 1 160 ? 3.198   -22.671 65.683  1.00 67.63  ? 171  LEU B O   1 
ATOM   4039  C CB  . LEU B 1 160 ? 2.698   -25.149 67.215  1.00 59.00  ? 171  LEU B CB  1 
ATOM   4040  C CG  . LEU B 1 160 ? 2.358   -26.637 67.322  1.00 59.00  ? 171  LEU B CG  1 
ATOM   4041  C CD1 . LEU B 1 160 ? 0.862   -26.793 67.525  1.00 59.00  ? 171  LEU B CD1 1 
ATOM   4042  C CD2 . LEU B 1 160 ? 2.762   -27.357 66.063  1.00 59.00  ? 171  LEU B CD2 1 
ATOM   4043  N N   . GLU B 1 161 ? 4.994   -22.504 67.014  1.00 172.62 ? 172  GLU B N   1 
ATOM   4044  C CA  . GLU B 1 161 ? 5.071   -21.060 66.809  1.00 172.62 ? 172  GLU B CA  1 
ATOM   4045  C C   . GLU B 1 161 ? 6.113   -20.823 65.718  1.00 172.62 ? 172  GLU B C   1 
ATOM   4046  O O   . GLU B 1 161 ? 6.209   -19.730 65.157  1.00 172.62 ? 172  GLU B O   1 
ATOM   4047  C CB  . GLU B 1 161 ? 5.484   -20.312 68.085  1.00 154.21 ? 172  GLU B CB  1 
ATOM   4048  C CG  . GLU B 1 161 ? 5.253   -18.792 67.976  1.00 154.21 ? 172  GLU B CG  1 
ATOM   4049  C CD  . GLU B 1 161 ? 6.029   -17.967 68.999  1.00 154.21 ? 172  GLU B CD  1 
ATOM   4050  O OE1 . GLU B 1 161 ? 5.895   -18.228 70.213  1.00 154.21 ? 172  GLU B OE1 1 
ATOM   4051  O OE2 . GLU B 1 161 ? 6.766   -17.045 68.585  1.00 154.21 ? 172  GLU B OE2 1 
ATOM   4052  N N   . ASN B 1 162 ? 6.894   -21.862 65.430  1.00 171.08 ? 173  ASN B N   1 
ATOM   4053  C CA  . ASN B 1 162 ? 7.923   -21.805 64.396  1.00 171.08 ? 173  ASN B CA  1 
ATOM   4054  C C   . ASN B 1 162 ? 7.235   -22.126 63.070  1.00 171.08 ? 173  ASN B C   1 
ATOM   4055  O O   . ASN B 1 162 ? 7.484   -21.483 62.049  1.00 171.08 ? 173  ASN B O   1 
ATOM   4056  C CB  . ASN B 1 162 ? 9.019   -22.837 64.682  1.00 102.61 ? 173  ASN B CB  1 
ATOM   4057  C CG  . ASN B 1 162 ? 10.258  -22.638 63.815  1.00 102.61 ? 173  ASN B CG  1 
ATOM   4058  O OD1 . ASN B 1 162 ? 10.938  -21.615 63.908  1.00 102.61 ? 173  ASN B OD1 1 
ATOM   4059  N ND2 . ASN B 1 162 ? 10.556  -23.620 62.972  1.00 102.61 ? 173  ASN B ND2 1 
ATOM   4060  N N   . VAL B 1 163 ? 6.368   -23.134 63.105  1.00 80.03  ? 174  VAL B N   1 
ATOM   4061  C CA  . VAL B 1 163 ? 5.601   -23.557 61.941  1.00 80.03  ? 174  VAL B CA  1 
ATOM   4062  C C   . VAL B 1 163 ? 4.894   -22.338 61.323  1.00 80.03  ? 174  VAL B C   1 
ATOM   4063  O O   . VAL B 1 163 ? 5.334   -21.836 60.288  1.00 80.03  ? 174  VAL B O   1 
ATOM   4064  C CB  . VAL B 1 163 ? 4.571   -24.668 62.355  1.00 76.36  ? 174  VAL B CB  1 
ATOM   4065  C CG1 . VAL B 1 163 ? 3.290   -24.570 61.536  1.00 76.36  ? 174  VAL B CG1 1 
ATOM   4066  C CG2 . VAL B 1 163 ? 5.197   -26.046 62.169  1.00 76.36  ? 174  VAL B CG2 1 
ATOM   4067  N N   . LEU B 1 164 ? 3.827   -21.859 61.971  1.00 83.98  ? 175  LEU B N   1 
ATOM   4068  C CA  . LEU B 1 164 ? 3.038   -20.707 61.510  1.00 83.98  ? 175  LEU B CA  1 
ATOM   4069  C C   . LEU B 1 164 ? 3.868   -19.590 60.892  1.00 83.98  ? 175  LEU B C   1 
ATOM   4070  O O   . LEU B 1 164 ? 3.410   -18.908 59.968  1.00 83.98  ? 175  LEU B O   1 
ATOM   4071  C CB  . LEU B 1 164 ? 2.233   -20.110 62.671  1.00 62.80  ? 175  LEU B CB  1 
ATOM   4072  C CG  . LEU B 1 164 ? 1.039   -20.877 63.253  1.00 62.80  ? 175  LEU B CG  1 
ATOM   4073  C CD1 . LEU B 1 164 ? 0.652   -20.286 64.595  1.00 62.80  ? 175  LEU B CD1 1 
ATOM   4074  C CD2 . LEU B 1 164 ? -0.144  -20.824 62.288  1.00 62.80  ? 175  LEU B CD2 1 
ATOM   4075  N N   . LYS B 1 165 ? 5.082   -19.412 61.411  1.00 134.01 ? 176  LYS B N   1 
ATOM   4076  C CA  . LYS B 1 165 ? 5.997   -18.366 60.957  1.00 134.01 ? 176  LYS B CA  1 
ATOM   4077  C C   . LYS B 1 165 ? 7.064   -18.796 59.952  1.00 134.01 ? 176  LYS B C   1 
ATOM   4078  O O   . LYS B 1 165 ? 7.626   -17.948 59.258  1.00 134.01 ? 176  LYS B O   1 
ATOM   4079  C CB  . LYS B 1 165 ? 6.710   -17.741 62.159  1.00 142.32 ? 176  LYS B CB  1 
ATOM   4080  C CG  . LYS B 1 165 ? 5.816   -17.001 63.137  1.00 142.32 ? 176  LYS B CG  1 
ATOM   4081  C CD  . LYS B 1 165 ? 6.620   -16.533 64.348  1.00 142.32 ? 176  LYS B CD  1 
ATOM   4082  C CE  . LYS B 1 165 ? 7.806   -15.659 63.937  1.00 142.32 ? 176  LYS B CE  1 
ATOM   4083  N NZ  . LYS B 1 165 ? 8.628   -15.203 65.097  1.00 142.32 ? 176  LYS B NZ  1 
ATOM   4084  N N   . THR B 1 166 ? 7.354   -20.093 59.866  1.00 101.99 ? 177  THR B N   1 
ATOM   4085  C CA  . THR B 1 166 ? 8.394   -20.549 58.944  1.00 101.99 ? 177  THR B CA  1 
ATOM   4086  C C   . THR B 1 166 ? 8.009   -21.550 57.845  1.00 101.99 ? 177  THR B C   1 
ATOM   4087  O O   . THR B 1 166 ? 8.865   -21.965 57.058  1.00 101.99 ? 177  THR B O   1 
ATOM   4088  C CB  . THR B 1 166 ? 9.576   -21.146 59.718  1.00 107.88 ? 177  THR B CB  1 
ATOM   4089  O OG1 . THR B 1 166 ? 9.194   -22.404 60.291  1.00 107.88 ? 177  THR B OG1 1 
ATOM   4090  C CG2 . THR B 1 166 ? 10.007  -20.199 60.822  1.00 107.88 ? 177  THR B CG2 1 
ATOM   4091  N N   . SER B 1 167 ? 6.742   -21.946 57.779  1.00 139.34 ? 178  SER B N   1 
ATOM   4092  C CA  . SER B 1 167 ? 6.319   -22.895 56.752  1.00 139.34 ? 178  SER B CA  1 
ATOM   4093  C C   . SER B 1 167 ? 5.798   -22.204 55.500  1.00 139.34 ? 178  SER B C   1 
ATOM   4094  O O   . SER B 1 167 ? 5.341   -21.060 55.554  1.00 139.34 ? 178  SER B O   1 
ATOM   4095  C CB  . SER B 1 167 ? 5.253   -23.845 57.304  1.00 85.80  ? 178  SER B CB  1 
ATOM   4096  O OG  . SER B 1 167 ? 5.853   -24.916 58.013  1.00 85.80  ? 178  SER B OG  1 
ATOM   4097  N N   . GLY B 1 168 ? 5.870   -22.908 54.373  1.00 73.85  ? 179  GLY B N   1 
ATOM   4098  C CA  . GLY B 1 168 ? 5.409   -22.336 53.124  1.00 73.85  ? 179  GLY B CA  1 
ATOM   4099  C C   . GLY B 1 168 ? 3.911   -22.414 52.938  1.00 73.85  ? 179  GLY B C   1 
ATOM   4100  O O   . GLY B 1 168 ? 3.178   -22.724 53.873  1.00 73.85  ? 179  GLY B O   1 
ATOM   4101  N N   . LYS B 1 169 ? 3.457   -22.120 51.723  1.00 63.72  ? 180  LYS B N   1 
ATOM   4102  C CA  . LYS B 1 169 ? 2.039   -22.177 51.380  1.00 63.72  ? 180  LYS B CA  1 
ATOM   4103  C C   . LYS B 1 169 ? 1.877   -22.444 49.891  1.00 63.72  ? 180  LYS B C   1 
ATOM   4104  O O   . LYS B 1 169 ? 2.851   -22.467 49.143  1.00 63.72  ? 180  LYS B O   1 
ATOM   4105  C CB  . LYS B 1 169 ? 1.357   -20.861 51.728  1.00 54.32  ? 180  LYS B CB  1 
ATOM   4106  C CG  . LYS B 1 169 ? 1.975   -19.656 51.054  1.00 54.32  ? 180  LYS B CG  1 
ATOM   4107  C CD  . LYS B 1 169 ? 1.105   -18.434 51.273  1.00 54.32  ? 180  LYS B CD  1 
ATOM   4108  C CE  . LYS B 1 169 ? 1.796   -17.161 50.819  1.00 54.32  ? 180  LYS B CE  1 
ATOM   4109  N NZ  . LYS B 1 169 ? 0.976   -15.954 51.137  1.00 54.32  ? 180  LYS B NZ  1 
ATOM   4110  N N   . LEU B 1 170 ? 0.642   -22.657 49.464  1.00 34.15  ? 181  LEU B N   1 
ATOM   4111  C CA  . LEU B 1 170 ? 0.363   -22.891 48.052  1.00 34.15  ? 181  LEU B CA  1 
ATOM   4112  C C   . LEU B 1 170 ? -0.124  -21.570 47.416  1.00 34.15  ? 181  LEU B C   1 
ATOM   4113  O O   . LEU B 1 170 ? -0.862  -20.802 48.030  1.00 34.15  ? 181  LEU B O   1 
ATOM   4114  C CB  . LEU B 1 170 ? -0.696  -23.991 47.904  1.00 42.40  ? 181  LEU B CB  1 
ATOM   4115  C CG  . LEU B 1 170 ? -0.393  -25.360 48.520  1.00 42.40  ? 181  LEU B CG  1 
ATOM   4116  C CD1 . LEU B 1 170 ? -1.688  -26.161 48.677  1.00 42.40  ? 181  LEU B CD1 1 
ATOM   4117  C CD2 . LEU B 1 170 ? 0.613   -26.096 47.658  1.00 42.40  ? 181  LEU B CD2 1 
ATOM   4118  N N   . ARG B 1 171 ? 0.296   -21.315 46.182  1.00 33.37  ? 182  ARG B N   1 
ATOM   4119  C CA  . ARG B 1 171 ? -0.058  -20.087 45.474  1.00 33.37  ? 182  ARG B CA  1 
ATOM   4120  C C   . ARG B 1 171 ? -1.532  -19.821 45.370  1.00 33.37  ? 182  ARG B C   1 
ATOM   4121  O O   . ARG B 1 171 ? -2.299  -20.724 45.102  1.00 33.37  ? 182  ARG B O   1 
ATOM   4122  C CB  . ARG B 1 171 ? 0.558   -20.072 44.066  1.00 30.09  ? 182  ARG B CB  1 
ATOM   4123  C CG  . ARG B 1 171 ? 0.663   -21.413 43.432  1.00 30.09  ? 182  ARG B CG  1 
ATOM   4124  C CD  . ARG B 1 171 ? 0.251   -21.382 41.995  1.00 30.09  ? 182  ARG B CD  1 
ATOM   4125  N NE  . ARG B 1 171 ? 1.375   -21.394 41.072  1.00 30.09  ? 182  ARG B NE  1 
ATOM   4126  C CZ  . ARG B 1 171 ? 1.333   -21.981 39.883  1.00 30.09  ? 182  ARG B CZ  1 
ATOM   4127  N NH1 . ARG B 1 171 ? 0.235   -22.608 39.474  1.00 30.09  ? 182  ARG B NH1 1 
ATOM   4128  N NH2 . ARG B 1 171 ? 2.385   -21.930 39.094  1.00 30.09  ? 182  ARG B NH2 1 
ATOM   4129  N N   . GLU B 1 172 ? -1.898  -18.561 45.592  1.00 44.65  ? 183  GLU B N   1 
ATOM   4130  C CA  . GLU B 1 172 ? -3.273  -18.094 45.514  1.00 44.65  ? 183  GLU B CA  1 
ATOM   4131  C C   . GLU B 1 172 ? -3.493  -17.584 44.106  1.00 44.65  ? 183  GLU B C   1 
ATOM   4132  O O   . GLU B 1 172 ? -4.622  -17.554 43.632  1.00 44.65  ? 183  GLU B O   1 
ATOM   4133  C CB  . GLU B 1 172 ? -3.518  -16.960 46.522  1.00 189.27 ? 183  GLU B CB  1 
ATOM   4134  C CG  . GLU B 1 172 ? -4.624  -15.949 46.139  1.00 189.27 ? 183  GLU B CG  1 
ATOM   4135  C CD  . GLU B 1 172 ? -6.041  -16.497 46.255  1.00 189.27 ? 183  GLU B CD  1 
ATOM   4136  O OE1 . GLU B 1 172 ? -6.997  -15.743 45.968  1.00 189.27 ? 183  GLU B OE1 1 
ATOM   4137  O OE2 . GLU B 1 172 ? -6.202  -17.673 46.636  1.00 189.27 ? 183  GLU B OE2 1 
ATOM   4138  N N   . ASN B 1 173 ? -2.417  -17.169 43.445  1.00 105.19 ? 184  ASN B N   1 
ATOM   4139  C CA  . ASN B 1 173 ? -2.516  -16.671 42.076  1.00 105.19 ? 184  ASN B CA  1 
ATOM   4140  C C   . ASN B 1 173 ? -1.229  -16.819 41.270  1.00 105.19 ? 184  ASN B C   1 
ATOM   4141  O O   . ASN B 1 173 ? -0.200  -17.264 41.786  1.00 105.19 ? 184  ASN B O   1 
ATOM   4142  C CB  . ASN B 1 173 ? -2.972  -15.203 42.046  1.00 61.59  ? 184  ASN B CB  1 
ATOM   4143  C CG  . ASN B 1 173 ? -2.242  -14.333 43.053  1.00 61.59  ? 184  ASN B CG  1 
ATOM   4144  O OD1 . ASN B 1 173 ? -1.017  -14.386 43.183  1.00 61.59  ? 184  ASN B OD1 1 
ATOM   4145  N ND2 . ASN B 1 173 ? -3.002  -13.508 43.764  1.00 61.59  ? 184  ASN B ND2 1 
ATOM   4146  N N   . LEU B 1 174 ? -1.298  -16.431 39.999  1.00 43.02  ? 185  LEU B N   1 
ATOM   4147  C CA  . LEU B 1 174 ? -0.162  -16.548 39.109  1.00 43.02  ? 185  LEU B CA  1 
ATOM   4148  C C   . LEU B 1 174 ? 0.583   -15.249 38.944  1.00 43.02  ? 185  LEU B C   1 
ATOM   4149  O O   . LEU B 1 174 ? 1.613   -15.201 38.259  1.00 43.02  ? 185  LEU B O   1 
ATOM   4150  C CB  . LEU B 1 174 ? -0.634  -17.041 37.745  1.00 13.69  ? 185  LEU B CB  1 
ATOM   4151  C CG  . LEU B 1 174 ? -1.092  -18.515 37.639  1.00 13.69  ? 185  LEU B CG  1 
ATOM   4152  C CD1 . LEU B 1 174 ? -1.277  -18.822 36.173  1.00 13.69  ? 185  LEU B CD1 1 
ATOM   4153  C CD2 . LEU B 1 174 ? -0.071  -19.501 38.237  1.00 13.69  ? 185  LEU B CD2 1 
ATOM   4154  N N   . LEU B 1 175 ? 0.063   -14.207 39.592  1.00 32.34  ? 186  LEU B N   1 
ATOM   4155  C CA  . LEU B 1 175 ? 0.619   -12.851 39.529  1.00 32.34  ? 186  LEU B CA  1 
ATOM   4156  C C   . LEU B 1 175 ? 1.929   -12.657 40.264  1.00 32.34  ? 186  LEU B C   1 
ATOM   4157  O O   . LEU B 1 175 ? 2.804   -11.954 39.777  1.00 32.34  ? 186  LEU B O   1 
ATOM   4158  C CB  . LEU B 1 175 ? -0.413  -11.849 40.050  1.00 35.32  ? 186  LEU B CB  1 
ATOM   4159  C CG  . LEU B 1 175 ? -0.267  -10.345 39.821  1.00 35.32  ? 186  LEU B CG  1 
ATOM   4160  C CD1 . LEU B 1 175 ? -1.543  -9.681  40.298  1.00 35.32  ? 186  LEU B CD1 1 
ATOM   4161  C CD2 . LEU B 1 175 ? 0.931   -9.780  40.555  1.00 35.32  ? 186  LEU B CD2 1 
ATOM   4162  N N   . HIS B 1 176 ? 2.073   -13.263 41.436  1.00 51.10  ? 187  HIS B N   1 
ATOM   4163  C CA  . HIS B 1 176 ? 3.322   -13.119 42.175  1.00 51.10  ? 187  HIS B CA  1 
ATOM   4164  C C   . HIS B 1 176 ? 4.465   -13.687 41.327  1.00 51.10  ? 187  HIS B C   1 
ATOM   4165  O O   . HIS B 1 176 ? 5.431   -12.995 41.024  1.00 51.10  ? 187  HIS B O   1 
ATOM   4166  C CB  . HIS B 1 176 ? 3.250   -13.855 43.517  1.00 63.96  ? 187  HIS B CB  1 
ATOM   4167  C CG  . HIS B 1 176 ? 4.372   -13.516 44.452  1.00 63.96  ? 187  HIS B CG  1 
ATOM   4168  N ND1 . HIS B 1 176 ? 4.480   -12.288 45.073  1.00 63.96  ? 187  HIS B ND1 1 
ATOM   4169  C CD2 . HIS B 1 176 ? 5.444   -14.237 44.855  1.00 63.96  ? 187  HIS B CD2 1 
ATOM   4170  C CE1 . HIS B 1 176 ? 5.572   -12.269 45.817  1.00 63.96  ? 187  HIS B CE1 1 
ATOM   4171  N NE2 . HIS B 1 176 ? 6.174   -13.439 45.701  1.00 63.96  ? 187  HIS B NE2 1 
ATOM   4172  N N   . GLY B 1 177 ? 4.334   -14.946 40.929  1.00 42.24  ? 188  GLY B N   1 
ATOM   4173  C CA  . GLY B 1 177 ? 5.358   -15.570 40.123  1.00 42.24  ? 188  GLY B CA  1 
ATOM   4174  C C   . GLY B 1 177 ? 5.625   -14.772 38.874  1.00 42.24  ? 188  GLY B C   1 
ATOM   4175  O O   . GLY B 1 177 ? 6.724   -14.829 38.320  1.00 42.24  ? 188  GLY B O   1 
ATOM   4176  N N   . ALA B 1 178 ? 4.628   -14.024 38.417  1.00 40.44  ? 189  ALA B N   1 
ATOM   4177  C CA  . ALA B 1 178 ? 4.812   -13.219 37.219  1.00 40.44  ? 189  ALA B CA  1 
ATOM   4178  C C   . ALA B 1 178 ? 5.788   -12.109 37.541  1.00 40.44  ? 189  ALA B C   1 
ATOM   4179  O O   . ALA B 1 178 ? 6.852   -11.995 36.930  1.00 40.44  ? 189  ALA B O   1 
ATOM   4180  C CB  . ALA B 1 178 ? 3.507   -12.638 36.779  1.00 26.23  ? 189  ALA B CB  1 
ATOM   4181  N N   . LEU B 1 179 ? 5.412   -11.299 38.522  1.00 36.60  ? 190  LEU B N   1 
ATOM   4182  C CA  . LEU B 1 179 ? 6.223   -10.185 38.964  1.00 36.60  ? 190  LEU B CA  1 
ATOM   4183  C C   . LEU B 1 179 ? 7.636   -10.619 39.303  1.00 36.60  ? 190  LEU B C   1 
ATOM   4184  O O   . LEU B 1 179 ? 8.591   -9.948  38.923  1.00 36.60  ? 190  LEU B O   1 
ATOM   4185  C CB  . LEU B 1 179 ? 5.588   -9.532  40.187  1.00 37.94  ? 190  LEU B CB  1 
ATOM   4186  C CG  . LEU B 1 179 ? 4.163   -9.013  40.014  1.00 37.94  ? 190  LEU B CG  1 
ATOM   4187  C CD1 . LEU B 1 179 ? 3.792   -8.133  41.182  1.00 37.94  ? 190  LEU B CD1 1 
ATOM   4188  C CD2 . LEU B 1 179 ? 4.070   -8.239  38.719  1.00 37.94  ? 190  LEU B CD2 1 
ATOM   4189  N N   . GLU B 1 180 ? 7.775   -11.729 40.023  1.00 38.41  ? 191  GLU B N   1 
ATOM   4190  C CA  . GLU B 1 180 ? 9.096   -12.230 40.400  1.00 38.41  ? 191  GLU B CA  1 
ATOM   4191  C C   . GLU B 1 180 ? 10.018  -12.358 39.198  1.00 38.41  ? 191  GLU B C   1 
ATOM   4192  O O   . GLU B 1 180 ? 11.234  -12.408 39.361  1.00 38.41  ? 191  GLU B O   1 
ATOM   4193  C CB  . GLU B 1 180 ? 9.000   -13.590 41.112  1.00 79.05  ? 191  GLU B CB  1 
ATOM   4194  C CG  . GLU B 1 180 ? 8.691   -13.520 42.610  1.00 79.05  ? 191  GLU B CG  1 
ATOM   4195  C CD  . GLU B 1 180 ? 8.868   -14.859 43.330  1.00 79.05  ? 191  GLU B CD  1 
ATOM   4196  O OE1 . GLU B 1 180 ? 9.973   -15.439 43.272  1.00 79.05  ? 191  GLU B OE1 1 
ATOM   4197  O OE2 . GLU B 1 180 ? 7.904   -15.334 43.964  1.00 79.05  ? 191  GLU B OE2 1 
ATOM   4198  N N   . HIS B 1 181 ? 9.442   -12.388 37.996  1.00 71.40  ? 192  HIS B N   1 
ATOM   4199  C CA  . HIS B 1 181 ? 10.222  -12.511 36.759  1.00 71.40  ? 192  HIS B CA  1 
ATOM   4200  C C   . HIS B 1 181 ? 10.547  -11.204 36.033  1.00 71.40  ? 192  HIS B C   1 
ATOM   4201  O O   . HIS B 1 181 ? 11.548  -11.113 35.327  1.00 71.40  ? 192  HIS B O   1 
ATOM   4202  C CB  . HIS B 1 181 ? 9.508   -13.459 35.792  1.00 70.09  ? 192  HIS B CB  1 
ATOM   4203  C CG  . HIS B 1 181 ? 9.672   -14.901 36.146  1.00 70.09  ? 192  HIS B CG  1 
ATOM   4204  N ND1 . HIS B 1 181 ? 10.852  -15.582 35.947  1.00 70.09  ? 192  HIS B ND1 1 
ATOM   4205  C CD2 . HIS B 1 181 ? 8.835   -15.771 36.757  1.00 70.09  ? 192  HIS B CD2 1 
ATOM   4206  C CE1 . HIS B 1 181 ? 10.737  -16.807 36.425  1.00 70.09  ? 192  HIS B CE1 1 
ATOM   4207  N NE2 . HIS B 1 181 ? 9.522   -16.947 36.923  1.00 70.09  ? 192  HIS B NE2 1 
ATOM   4208  N N   . TYR B 1 182 ? 9.707   -10.195 36.213  1.00 42.62  ? 193  TYR B N   1 
ATOM   4209  C CA  . TYR B 1 182 ? 9.888   -8.907  35.554  1.00 42.62  ? 193  TYR B CA  1 
ATOM   4210  C C   . TYR B 1 182 ? 11.321  -8.467  35.263  1.00 42.62  ? 193  TYR B C   1 
ATOM   4211  O O   . TYR B 1 182 ? 11.665  -8.190  34.122  1.00 42.62  ? 193  TYR B O   1 
ATOM   4212  C CB  . TYR B 1 182 ? 9.201   -7.799  36.353  1.00 47.61  ? 193  TYR B CB  1 
ATOM   4213  C CG  . TYR B 1 182 ? 9.397   -6.434  35.725  1.00 47.61  ? 193  TYR B CG  1 
ATOM   4214  C CD1 . TYR B 1 182 ? 8.805   -6.117  34.505  1.00 47.61  ? 193  TYR B CD1 1 
ATOM   4215  C CD2 . TYR B 1 182 ? 10.197  -5.474  36.335  1.00 47.61  ? 193  TYR B CD2 1 
ATOM   4216  C CE1 . TYR B 1 182 ? 9.001   -4.885  33.913  1.00 47.61  ? 193  TYR B CE1 1 
ATOM   4217  C CE2 . TYR B 1 182 ? 10.398  -4.242  35.746  1.00 47.61  ? 193  TYR B CE2 1 
ATOM   4218  C CZ  . TYR B 1 182 ? 9.797   -3.950  34.536  1.00 47.61  ? 193  TYR B CZ  1 
ATOM   4219  O OH  . TYR B 1 182 ? 9.985   -2.711  33.965  1.00 47.61  ? 193  TYR B OH  1 
ATOM   4220  N N   . VAL B 1 183 ? 12.155  -8.371  36.289  1.00 51.80  ? 194  VAL B N   1 
ATOM   4221  C CA  . VAL B 1 183 ? 13.522  -7.925  36.054  1.00 51.80  ? 194  VAL B CA  1 
ATOM   4222  C C   . VAL B 1 183 ? 14.187  -8.842  35.049  1.00 51.80  ? 194  VAL B C   1 
ATOM   4223  O O   . VAL B 1 183 ? 14.518  -8.415  33.953  1.00 51.80  ? 194  VAL B O   1 
ATOM   4224  C CB  . VAL B 1 183 ? 14.359  -7.875  37.368  1.00 42.05  ? 194  VAL B CB  1 
ATOM   4225  C CG1 . VAL B 1 183 ? 15.844  -7.703  37.046  1.00 42.05  ? 194  VAL B CG1 1 
ATOM   4226  C CG2 . VAL B 1 183 ? 13.889  -6.710  38.232  1.00 42.05  ? 194  VAL B CG2 1 
ATOM   4227  N N   . ASN B 1 184 ? 14.360  -10.104 35.421  1.00 90.73  ? 195  ASN B N   1 
ATOM   4228  C CA  . ASN B 1 184 ? 14.991  -11.076 34.543  1.00 90.73  ? 195  ASN B CA  1 
ATOM   4229  C C   . ASN B 1 184 ? 14.422  -11.027 33.125  1.00 90.73  ? 195  ASN B C   1 
ATOM   4230  O O   . ASN B 1 184 ? 15.166  -11.149 32.153  1.00 90.73  ? 195  ASN B O   1 
ATOM   4231  C CB  . ASN B 1 184 ? 14.831  -12.484 35.119  1.00 168.25 ? 195  ASN B CB  1 
ATOM   4232  C CG  . ASN B 1 184 ? 15.370  -12.598 36.531  1.00 168.25 ? 195  ASN B CG  1 
ATOM   4233  O OD1 . ASN B 1 184 ? 16.545  -12.332 36.783  1.00 168.25 ? 195  ASN B OD1 1 
ATOM   4234  N ND2 . ASN B 1 184 ? 14.510  -12.994 37.461  1.00 168.25 ? 195  ASN B ND2 1 
ATOM   4235  N N   . CYS B 1 185 ? 13.110  -10.833 33.003  1.00 57.61  ? 196  CYS B N   1 
ATOM   4236  C CA  . CYS B 1 185 ? 12.474  -10.786 31.685  1.00 57.61  ? 196  CYS B CA  1 
ATOM   4237  C C   . CYS B 1 185 ? 12.461  -9.417  31.028  1.00 57.61  ? 196  CYS B C   1 
ATOM   4238  O O   . CYS B 1 185 ? 12.197  -9.301  29.841  1.00 57.61  ? 196  CYS B O   1 
ATOM   4239  C CB  . CYS B 1 185 ? 11.049  -11.339 31.761  1.00 86.44  ? 196  CYS B CB  1 
ATOM   4240  S SG  . CYS B 1 185 ? 10.996  -13.147 31.798  1.00 86.44  ? 196  CYS B SG  1 
ATOM   4241  N N   . LEU B 1 186 ? 12.751  -8.377  31.798  1.00 90.51  ? 197  LEU B N   1 
ATOM   4242  C CA  . LEU B 1 186 ? 12.771  -7.027  31.255  1.00 90.51  ? 197  LEU B CA  1 
ATOM   4243  C C   . LEU B 1 186 ? 13.973  -6.895  30.345  1.00 90.51  ? 197  LEU B C   1 
ATOM   4244  O O   . LEU B 1 186 ? 14.078  -5.957  29.564  1.00 90.51  ? 197  LEU B O   1 
ATOM   4245  C CB  . LEU B 1 186 ? 12.871  -5.997  32.375  1.00 44.70  ? 197  LEU B CB  1 
ATOM   4246  C CG  . LEU B 1 186 ? 12.742  -4.550  31.910  1.00 44.70  ? 197  LEU B CG  1 
ATOM   4247  C CD1 . LEU B 1 186 ? 11.424  -4.356  31.178  1.00 44.70  ? 197  LEU B CD1 1 
ATOM   4248  C CD2 . LEU B 1 186 ? 12.814  -3.633  33.097  1.00 44.70  ? 197  LEU B CD2 1 
ATOM   4249  N N   . ASP B 1 187 ? 14.891  -7.841  30.471  1.00 70.10  ? 198  ASP B N   1 
ATOM   4250  C CA  . ASP B 1 187 ? 16.089  -7.855  29.655  1.00 70.10  ? 198  ASP B CA  1 
ATOM   4251  C C   . ASP B 1 187 ? 15.615  -8.257  28.274  1.00 70.10  ? 198  ASP B C   1 
ATOM   4252  O O   . ASP B 1 187 ? 15.608  -7.453  27.348  1.00 70.10  ? 198  ASP B O   1 
ATOM   4253  C CB  . ASP B 1 187 ? 17.068  -8.901  30.191  1.00 90.21  ? 198  ASP B CB  1 
ATOM   4254  C CG  . ASP B 1 187 ? 18.305  -9.046  29.327  1.00 90.21  ? 198  ASP B CG  1 
ATOM   4255  O OD1 . ASP B 1 187 ? 19.140  -8.114  29.334  1.00 90.21  ? 198  ASP B OD1 1 
ATOM   4256  O OD2 . ASP B 1 187 ? 18.433  -10.090 28.642  1.00 90.21  ? 198  ASP B OD2 1 
ATOM   4257  N N   . LEU B 1 188 ? 15.201  -9.516  28.177  1.00 64.29  ? 199  LEU B N   1 
ATOM   4258  C CA  . LEU B 1 188 ? 14.696  -10.163 26.968  1.00 64.29  ? 199  LEU B CA  1 
ATOM   4259  C C   . LEU B 1 188 ? 14.067  -9.288  25.874  1.00 64.29  ? 199  LEU B C   1 
ATOM   4260  O O   . LEU B 1 188 ? 14.004  -9.686  24.714  1.00 64.29  ? 199  LEU B O   1 
ATOM   4261  C CB  . LEU B 1 188 ? 13.701  -11.226 27.394  1.00 51.16  ? 199  LEU B CB  1 
ATOM   4262  C CG  . LEU B 1 188 ? 13.265  -12.236 26.359  1.00 51.16  ? 199  LEU B CG  1 
ATOM   4263  C CD1 . LEU B 1 188 ? 14.443  -13.076 25.941  1.00 51.16  ? 199  LEU B CD1 1 
ATOM   4264  C CD2 . LEU B 1 188 ? 12.170  -13.083 26.968  1.00 51.16  ? 199  LEU B CD2 1 
ATOM   4265  N N   . VAL B 1 189 ? 13.573  -8.115  26.235  1.00 100.99 ? 200  VAL B N   1 
ATOM   4266  C CA  . VAL B 1 189 ? 12.988  -7.225  25.246  1.00 100.99 ? 200  VAL B CA  1 
ATOM   4267  C C   . VAL B 1 189 ? 13.781  -5.929  25.244  1.00 100.99 ? 200  VAL B C   1 
ATOM   4268  O O   . VAL B 1 189 ? 13.200  -4.846  25.281  1.00 100.99 ? 200  VAL B O   1 
ATOM   4269  C CB  . VAL B 1 189 ? 11.515  -6.918  25.572  1.00 45.99  ? 200  VAL B CB  1 
ATOM   4270  C CG1 . VAL B 1 189 ? 10.704  -8.181  25.473  1.00 45.99  ? 200  VAL B CG1 1 
ATOM   4271  C CG2 . VAL B 1 189 ? 11.389  -6.332  26.969  1.00 45.99  ? 200  VAL B CG2 1 
ATOM   4272  N N   . ASN B 1 190 ? 15.107  -6.051  25.185  1.00 131.34 ? 201  ASN B N   1 
ATOM   4273  C CA  . ASN B 1 190 ? 16.010  -4.902  25.213  1.00 131.34 ? 201  ASN B CA  1 
ATOM   4274  C C   . ASN B 1 190 ? 15.747  -4.150  26.506  1.00 131.34 ? 201  ASN B C   1 
ATOM   4275  O O   . ASN B 1 190 ? 16.634  -4.009  27.345  1.00 131.34 ? 201  ASN B O   1 
ATOM   4276  C CB  . ASN B 1 190 ? 15.779  -3.988  24.004  1.00 141.92 ? 201  ASN B CB  1 
ATOM   4277  C CG  . ASN B 1 190 ? 16.477  -4.488  22.749  1.00 141.92 ? 201  ASN B CG  1 
ATOM   4278  O OD1 . ASN B 1 190 ? 17.705  -4.541  22.689  1.00 141.92 ? 201  ASN B OD1 1 
ATOM   4279  N ND2 . ASN B 1 190 ? 15.696  -4.857  21.741  1.00 141.92 ? 201  ASN B ND2 1 
ATOM   4280  N N   . LYS B 1 191 ? 14.511  -3.686  26.657  1.00 73.49  ? 202  LYS B N   1 
ATOM   4281  C CA  . LYS B 1 191 ? 14.049  -2.961  27.834  1.00 73.49  ? 202  LYS B CA  1 
ATOM   4282  C C   . LYS B 1 191 ? 12.793  -2.164  27.451  1.00 73.49  ? 202  LYS B C   1 
ATOM   4283  O O   . LYS B 1 191 ? 12.257  -1.372  28.240  1.00 73.49  ? 202  LYS B O   1 
ATOM   4284  C CB  . LYS B 1 191 ? 15.148  -2.028  28.354  1.00 75.27  ? 202  LYS B CB  1 
ATOM   4285  C CG  . LYS B 1 191 ? 15.046  -1.727  29.832  1.00 75.27  ? 202  LYS B CG  1 
ATOM   4286  C CD  . LYS B 1 191 ? 16.331  -2.059  30.569  1.00 75.27  ? 202  LYS B CD  1 
ATOM   4287  C CE  . LYS B 1 191 ? 16.176  -1.738  32.046  1.00 75.27  ? 202  LYS B CE  1 
ATOM   4288  N NZ  . LYS B 1 191 ? 17.409  -2.027  32.805  1.00 75.27  ? 202  LYS B NZ  1 
ATOM   4289  N N   . ARG B 1 192 ? 12.321  -2.398  26.230  1.00 100.39 ? 203  ARG B N   1 
ATOM   4290  C CA  . ARG B 1 192 ? 11.138  -1.721  25.714  1.00 100.39 ? 203  ARG B CA  1 
ATOM   4291  C C   . ARG B 1 192 ? 9.860   -2.295  26.304  1.00 100.39 ? 203  ARG B C   1 
ATOM   4292  O O   . ARG B 1 192 ? 9.755   -3.500  26.530  1.00 100.39 ? 203  ARG B O   1 
ATOM   4293  C CB  . ARG B 1 192 ? 11.060  -1.852  24.190  1.00 113.67 ? 203  ARG B CB  1 
ATOM   4294  C CG  . ARG B 1 192 ? 12.277  -1.375  23.427  1.00 113.67 ? 203  ARG B CG  1 
ATOM   4295  C CD  . ARG B 1 192 ? 11.996  -1.407  21.938  1.00 113.67 ? 203  ARG B CD  1 
ATOM   4296  N NE  . ARG B 1 192 ? 11.407  -2.680  21.522  1.00 113.67 ? 203  ARG B NE  1 
ATOM   4297  C CZ  . ARG B 1 192 ? 12.022  -3.859  21.599  1.00 113.67 ? 203  ARG B CZ  1 
ATOM   4298  N NH1 . ARG B 1 192 ? 11.400  -4.961  21.196  1.00 113.67 ? 203  ARG B NH1 1 
ATOM   4299  N NH2 . ARG B 1 192 ? 13.258  -3.940  22.069  1.00 113.67 ? 203  ARG B NH2 1 
ATOM   4300  N N   . LEU B 1 193 ? 8.889   -1.421  26.540  1.00 55.38  ? 204  LEU B N   1 
ATOM   4301  C CA  . LEU B 1 193 ? 7.596   -1.829  27.078  1.00 55.38  ? 204  LEU B CA  1 
ATOM   4302  C C   . LEU B 1 193 ? 6.572   -1.451  26.036  1.00 55.38  ? 204  LEU B C   1 
ATOM   4303  O O   . LEU B 1 193 ? 6.828   -0.608  25.192  1.00 55.38  ? 204  LEU B O   1 
ATOM   4304  C CB  . LEU B 1 193 ? 7.301   -1.101  28.385  1.00 45.18  ? 204  LEU B CB  1 
ATOM   4305  C CG  . LEU B 1 193 ? 8.369   -1.326  29.457  1.00 45.18  ? 204  LEU B CG  1 
ATOM   4306  C CD1 . LEU B 1 193 ? 7.964   -0.561  30.701  1.00 45.18  ? 204  LEU B CD1 1 
ATOM   4307  C CD2 . LEU B 1 193 ? 8.544   -2.817  29.759  1.00 45.18  ? 204  LEU B CD2 1 
ATOM   4308  N N   . PRO B 1 194 ? 5.394   -2.059  26.077  1.00 87.99  ? 205  PRO B N   1 
ATOM   4309  C CA  . PRO B 1 194 ? 4.925   -3.065  27.014  1.00 87.99  ? 205  PRO B CA  1 
ATOM   4310  C C   . PRO B 1 194 ? 5.148   -4.477  26.477  1.00 87.99  ? 205  PRO B C   1 
ATOM   4311  O O   . PRO B 1 194 ? 5.315   -4.679  25.267  1.00 87.99  ? 205  PRO B O   1 
ATOM   4312  C CB  . PRO B 1 194 ? 3.454   -2.734  27.113  1.00 34.77  ? 205  PRO B CB  1 
ATOM   4313  C CG  . PRO B 1 194 ? 3.139   -2.498  25.670  1.00 34.77  ? 205  PRO B CG  1 
ATOM   4314  C CD  . PRO B 1 194 ? 4.319   -1.698  25.145  1.00 34.77  ? 205  PRO B CD  1 
ATOM   4315  N N   . TYR B 1 195 ? 5.140   -5.441  27.395  1.00 41.77  ? 206  TYR B N   1 
ATOM   4316  C CA  . TYR B 1 195 ? 5.301   -6.845  27.076  1.00 41.77  ? 206  TYR B CA  1 
ATOM   4317  C C   . TYR B 1 195 ? 4.651   -7.617  28.208  1.00 41.77  ? 206  TYR B C   1 
ATOM   4318  O O   . TYR B 1 195 ? 4.675   -7.182  29.359  1.00 41.77  ? 206  TYR B O   1 
ATOM   4319  C CB  . TYR B 1 195 ? 6.780   -7.201  26.981  1.00 41.52  ? 206  TYR B CB  1 
ATOM   4320  C CG  . TYR B 1 195 ? 7.460   -7.364  28.309  1.00 41.52  ? 206  TYR B CG  1 
ATOM   4321  C CD1 . TYR B 1 195 ? 7.464   -8.588  28.968  1.00 41.52  ? 206  TYR B CD1 1 
ATOM   4322  C CD2 . TYR B 1 195 ? 8.102   -6.294  28.910  1.00 41.52  ? 206  TYR B CD2 1 
ATOM   4323  C CE1 . TYR B 1 195 ? 8.094   -8.730  30.187  1.00 41.52  ? 206  TYR B CE1 1 
ATOM   4324  C CE2 . TYR B 1 195 ? 8.734   -6.430  30.130  1.00 41.52  ? 206  TYR B CE2 1 
ATOM   4325  C CZ  . TYR B 1 195 ? 8.723   -7.643  30.755  1.00 41.52  ? 206  TYR B CZ  1 
ATOM   4326  O OH  . TYR B 1 195 ? 9.342   -7.760  31.959  1.00 41.52  ? 206  TYR B OH  1 
ATOM   4327  N N   . GLY B 1 196 ? 4.069   -8.763  27.885  1.00 46.21  ? 207  GLY B N   1 
ATOM   4328  C CA  . GLY B 1 196 ? 3.442   -9.549  28.922  1.00 46.21  ? 207  GLY B CA  1 
ATOM   4329  C C   . GLY B 1 196 ? 4.159   -10.840 29.260  1.00 46.21  ? 207  GLY B C   1 
ATOM   4330  O O   . GLY B 1 196 ? 5.104   -11.259 28.580  1.00 46.21  ? 207  GLY B O   1 
ATOM   4331  N N   . LEU B 1 197 ? 3.702   -11.453 30.349  1.00 51.14  ? 208  LEU B N   1 
ATOM   4332  C CA  . LEU B 1 197 ? 4.199   -12.736 30.838  1.00 51.14  ? 208  LEU B CA  1 
ATOM   4333  C C   . LEU B 1 197 ? 2.952   -13.591 31.104  1.00 51.14  ? 208  LEU B C   1 
ATOM   4334  O O   . LEU B 1 197 ? 2.237   -13.390 32.091  1.00 51.14  ? 208  LEU B O   1 
ATOM   4335  C CB  . LEU B 1 197 ? 5.009   -12.540 32.118  1.00 39.32  ? 208  LEU B CB  1 
ATOM   4336  C CG  . LEU B 1 197 ? 6.373   -11.876 31.946  1.00 39.32  ? 208  LEU B CG  1 
ATOM   4337  C CD1 . LEU B 1 197 ? 7.130   -11.905 33.260  1.00 39.32  ? 208  LEU B CD1 1 
ATOM   4338  C CD2 . LEU B 1 197 ? 7.155   -12.609 30.898  1.00 39.32  ? 208  LEU B CD2 1 
ATOM   4339  N N   . ALA B 1 198 ? 2.687   -14.529 30.200  1.00 53.67  ? 209  ALA B N   1 
ATOM   4340  C CA  . ALA B 1 198 ? 1.509   -15.386 30.298  1.00 53.67  ? 209  ALA B CA  1 
ATOM   4341  C C   . ALA B 1 198 ? 1.779   -16.679 31.038  1.00 53.67  ? 209  ALA B C   1 
ATOM   4342  O O   . ALA B 1 198 ? 2.871   -17.242 30.941  1.00 53.67  ? 209  ALA B O   1 
ATOM   4343  C CB  . ALA B 1 198 ? 0.980   -15.694 28.908  1.00 35.01  ? 209  ALA B CB  1 
ATOM   4344  N N   . GLN B 1 199 ? 0.764   -17.163 31.746  1.00 31.33  ? 210  GLN B N   1 
ATOM   4345  C CA  . GLN B 1 199 ? 0.890   -18.378 32.526  1.00 31.33  ? 210  GLN B CA  1 
ATOM   4346  C C   . GLN B 1 199 ? -0.478  -19.044 32.716  1.00 31.33  ? 210  GLN B C   1 
ATOM   4347  O O   . GLN B 1 199 ? -1.453  -18.372 32.992  1.00 31.33  ? 210  GLN B O   1 
ATOM   4348  C CB  . GLN B 1 199 ? 1.491   -18.002 33.876  1.00 61.43  ? 210  GLN B CB  1 
ATOM   4349  C CG  . GLN B 1 199 ? 2.058   -19.142 34.678  1.00 61.43  ? 210  GLN B CG  1 
ATOM   4350  C CD  . GLN B 1 199 ? 2.776   -18.653 35.916  1.00 61.43  ? 210  GLN B CD  1 
ATOM   4351  O OE1 . GLN B 1 199 ? 3.348   -19.444 36.666  1.00 61.43  ? 210  GLN B OE1 1 
ATOM   4352  N NE2 . GLN B 1 199 ? 2.748   -17.338 36.140  1.00 61.43  ? 210  GLN B NE2 1 
ATOM   4353  N N   . ILE B 1 200 ? -0.564  -20.356 32.552  1.00 41.13  ? 211  ILE B N   1 
ATOM   4354  C CA  . ILE B 1 200 ? -1.833  -21.058 32.747  1.00 41.13  ? 211  ILE B CA  1 
ATOM   4355  C C   . ILE B 1 200 ? -1.550  -22.153 33.762  1.00 41.13  ? 211  ILE B C   1 
ATOM   4356  O O   . ILE B 1 200 ? -0.756  -23.047 33.510  1.00 41.13  ? 211  ILE B O   1 
ATOM   4357  C CB  . ILE B 1 200 ? -2.343  -21.699 31.426  1.00 34.88  ? 211  ILE B CB  1 
ATOM   4358  C CG1 . ILE B 1 200 ? -3.016  -20.633 30.564  1.00 34.88  ? 211  ILE B CG1 1 
ATOM   4359  C CG2 . ILE B 1 200 ? -3.306  -22.856 31.716  1.00 34.88  ? 211  ILE B CG2 1 
ATOM   4360  C CD1 . ILE B 1 200 ? -3.576  -21.166 29.264  1.00 34.88  ? 211  ILE B CD1 1 
ATOM   4361  N N   . GLY B 1 201 ? -2.183  -22.089 34.919  1.00 44.38  ? 212  GLY B N   1 
ATOM   4362  C CA  . GLY B 1 201 ? -1.898  -23.106 35.904  1.00 44.38  ? 212  GLY B CA  1 
ATOM   4363  C C   . GLY B 1 201 ? -2.911  -23.232 37.013  1.00 44.38  ? 212  GLY B C   1 
ATOM   4364  O O   . GLY B 1 201 ? -3.863  -22.451 37.122  1.00 44.38  ? 212  GLY B O   1 
ATOM   4365  N N   . VAL B 1 202 ? -2.683  -24.233 37.853  1.00 27.73  ? 213  VAL B N   1 
ATOM   4366  C CA  . VAL B 1 202 ? -3.560  -24.526 38.968  1.00 27.73  ? 213  VAL B CA  1 
ATOM   4367  C C   . VAL B 1 202 ? -3.250  -23.642 40.156  1.00 27.73  ? 213  VAL B C   1 
ATOM   4368  O O   . VAL B 1 202 ? -2.102  -23.314 40.441  1.00 27.73  ? 213  VAL B O   1 
ATOM   4369  C CB  . VAL B 1 202 ? -3.424  -25.997 39.376  1.00 40.60  ? 213  VAL B CB  1 
ATOM   4370  C CG1 . VAL B 1 202 ? -4.369  -26.306 40.516  1.00 40.60  ? 213  VAL B CG1 1 
ATOM   4371  C CG2 . VAL B 1 202 ? -3.701  -26.891 38.166  1.00 40.60  ? 213  VAL B CG2 1 
ATOM   4372  N N   . CYS B 1 203 ? -4.301  -23.253 40.849  1.00 58.61  ? 214  CYS B N   1 
ATOM   4373  C CA  . CYS B 1 203 ? -4.156  -22.411 42.008  1.00 58.61  ? 214  CYS B CA  1 
ATOM   4374  C C   . CYS B 1 203 ? -5.063  -22.922 43.106  1.00 58.61  ? 214  CYS B C   1 
ATOM   4375  O O   . CYS B 1 203 ? -6.192  -23.345 42.859  1.00 58.61  ? 214  CYS B O   1 
ATOM   4376  C CB  . CYS B 1 203 ? -4.503  -20.971 41.645  1.00 61.57  ? 214  CYS B CB  1 
ATOM   4377  S SG  . CYS B 1 203 ? -3.298  -20.235 40.537  1.00 61.57  ? 214  CYS B SG  1 
ATOM   4378  N N   . PHE B 1 204 ? -4.561  -22.880 44.328  1.00 22.65  ? 215  PHE B N   1 
ATOM   4379  C CA  . PHE B 1 204 ? -5.326  -23.354 45.459  1.00 22.65  ? 215  PHE B CA  1 
ATOM   4380  C C   . PHE B 1 204 ? -5.941  -22.231 46.266  1.00 22.65  ? 215  PHE B C   1 
ATOM   4381  O O   . PHE B 1 204 ? -5.247  -21.354 46.786  1.00 22.65  ? 215  PHE B O   1 
ATOM   4382  C CB  . PHE B 1 204 ? -4.437  -24.233 46.317  1.00 32.89  ? 215  PHE B CB  1 
ATOM   4383  C CG  . PHE B 1 204 ? -3.576  -25.143 45.512  1.00 32.89  ? 215  PHE B CG  1 
ATOM   4384  C CD1 . PHE B 1 204 ? -2.392  -24.675 44.940  1.00 32.89  ? 215  PHE B CD1 1 
ATOM   4385  C CD2 . PHE B 1 204 ? -3.956  -26.459 45.293  1.00 32.89  ? 215  PHE B CD2 1 
ATOM   4386  C CE1 . PHE B 1 204 ? -1.595  -25.516 44.161  1.00 32.89  ? 215  PHE B CE1 1 
ATOM   4387  C CE2 . PHE B 1 204 ? -3.173  -27.301 44.522  1.00 32.89  ? 215  PHE B CE2 1 
ATOM   4388  C CZ  . PHE B 1 204 ? -1.983  -26.832 43.950  1.00 32.89  ? 215  PHE B CZ  1 
ATOM   4389  N N   . HIS B 1 205 ? -7.267  -22.281 46.345  1.00 49.93  ? 216  HIS B N   1 
ATOM   4390  C CA  . HIS B 1 205 ? -8.080  -21.307 47.058  1.00 49.93  ? 216  HIS B CA  1 
ATOM   4391  C C   . HIS B 1 205 ? -8.910  -22.056 48.073  1.00 49.93  ? 216  HIS B C   1 
ATOM   4392  O O   . HIS B 1 205 ? -9.522  -23.071 47.749  1.00 49.93  ? 216  HIS B O   1 
ATOM   4393  C CB  . HIS B 1 205 ? -9.049  -20.614 46.105  1.00 72.00  ? 216  HIS B CB  1 
ATOM   4394  C CG  . HIS B 1 205 ? -8.394  -19.984 44.920  1.00 72.00  ? 216  HIS B CG  1 
ATOM   4395  N ND1 . HIS B 1 205 ? -9.104  -19.589 43.808  1.00 72.00  ? 216  HIS B ND1 1 
ATOM   4396  C CD2 . HIS B 1 205 ? -7.105  -19.649 44.687  1.00 72.00  ? 216  HIS B CD2 1 
ATOM   4397  C CE1 . HIS B 1 205 ? -8.277  -19.035 42.940  1.00 72.00  ? 216  HIS B CE1 1 
ATOM   4398  N NE2 . HIS B 1 205 ? -7.059  -19.059 43.449  1.00 72.00  ? 216  HIS B NE2 1 
ATOM   4399  N N   . PRO B 1 206 ? -8.947  -21.563 49.316  1.00 56.82  ? 217  PRO B N   1 
ATOM   4400  C CA  . PRO B 1 206 ? -9.721  -22.185 50.397  1.00 56.82  ? 217  PRO B CA  1 
ATOM   4401  C C   . PRO B 1 206 ? -11.214 -21.821 50.350  1.00 56.82  ? 217  PRO B C   1 
ATOM   4402  O O   . PRO B 1 206 ? -11.580 -20.700 49.995  1.00 56.82  ? 217  PRO B O   1 
ATOM   4403  C CB  . PRO B 1 206 ? -9.031  -21.654 51.650  1.00 99.08  ? 217  PRO B CB  1 
ATOM   4404  C CG  . PRO B 1 206 ? -8.613  -20.285 51.228  1.00 99.08  ? 217  PRO B CG  1 
ATOM   4405  C CD  . PRO B 1 206 ? -8.045  -20.527 49.848  1.00 99.08  ? 217  PRO B CD  1 
ATOM   4406  N N   . VAL B 1 207 ? -12.074 -22.770 50.708  1.00 70.26  ? 218  VAL B N   1 
ATOM   4407  C CA  . VAL B 1 207 ? -13.507 -22.514 50.699  1.00 70.26  ? 218  VAL B CA  1 
ATOM   4408  C C   . VAL B 1 207 ? -14.039 -22.371 52.114  1.00 70.26  ? 218  VAL B C   1 
ATOM   4409  O O   . VAL B 1 207 ? -14.083 -23.349 52.854  1.00 70.26  ? 218  VAL B O   1 
ATOM   4410  C CB  . VAL B 1 207 ? -14.279 -23.646 50.026  1.00 82.11  ? 218  VAL B CB  1 
ATOM   4411  C CG1 . VAL B 1 207 ? -15.594 -23.102 49.483  1.00 82.11  ? 218  VAL B CG1 1 
ATOM   4412  C CG2 . VAL B 1 207 ? -13.444 -24.266 48.930  1.00 82.11  ? 218  VAL B CG2 1 
ATOM   4413  N N   . LYS B 1 218 ? -12.092 -26.966 57.159  1.00 97.66  ? 229  LYS B N   1 
ATOM   4414  C CA  . LYS B 1 218 ? -12.121 -26.198 55.921  1.00 97.66  ? 229  LYS B CA  1 
ATOM   4415  C C   . LYS B 1 218 ? -11.420 -26.982 54.813  1.00 97.66  ? 229  LYS B C   1 
ATOM   4416  O O   . LYS B 1 218 ? -10.384 -27.606 55.047  1.00 97.66  ? 229  LYS B O   1 
ATOM   4417  C CB  . LYS B 1 218 ? -11.424 -24.855 56.124  1.00 97.85  ? 229  LYS B CB  1 
ATOM   4418  C CG  . LYS B 1 218 ? -11.746 -23.827 55.054  1.00 97.85  ? 229  LYS B CG  1 
ATOM   4419  C CD  . LYS B 1 218 ? -10.820 -22.614 55.111  1.00 97.85  ? 229  LYS B CD  1 
ATOM   4420  C CE  . LYS B 1 218 ? -10.863 -21.909 56.453  1.00 97.85  ? 229  LYS B CE  1 
ATOM   4421  N NZ  . LYS B 1 218 ? -10.233 -22.715 57.532  1.00 97.85  ? 229  LYS B NZ  1 
ATOM   4422  N N   . SER B 1 219 ? -11.986 -26.944 53.611  1.00 98.67  ? 230  SER B N   1 
ATOM   4423  C CA  . SER B 1 219 ? -11.430 -27.671 52.472  1.00 98.67  ? 230  SER B CA  1 
ATOM   4424  C C   . SER B 1 219 ? -10.638 -26.781 51.519  1.00 98.67  ? 230  SER B C   1 
ATOM   4425  O O   . SER B 1 219 ? -10.726 -25.556 51.596  1.00 98.67  ? 230  SER B O   1 
ATOM   4426  C CB  . SER B 1 219 ? -12.559 -28.364 51.710  1.00 201.99 ? 230  SER B CB  1 
ATOM   4427  O OG  . SER B 1 219 ? -13.600 -27.448 51.416  1.00 201.99 ? 230  SER B OG  1 
ATOM   4428  N N   . ILE B 1 220 ? -9.870  -27.402 50.622  1.00 77.86  ? 231  ILE B N   1 
ATOM   4429  C CA  . ILE B 1 220 ? -9.053  -26.665 49.650  1.00 77.86  ? 231  ILE B CA  1 
ATOM   4430  C C   . ILE B 1 220 ? -9.547  -26.867 48.221  1.00 77.86  ? 231  ILE B C   1 
ATOM   4431  O O   . ILE B 1 220 ? -9.826  -27.984 47.797  1.00 77.86  ? 231  ILE B O   1 
ATOM   4432  C CB  . ILE B 1 220 ? -7.563  -27.089 49.671  1.00 61.78  ? 231  ILE B CB  1 
ATOM   4433  C CG1 . ILE B 1 220 ? -7.217  -27.799 50.983  1.00 61.78  ? 231  ILE B CG1 1 
ATOM   4434  C CG2 . ILE B 1 220 ? -6.686  -25.853 49.493  1.00 61.78  ? 231  ILE B CG2 1 
ATOM   4435  C CD1 . ILE B 1 220 ? -7.883  -29.166 51.188  1.00 61.78  ? 231  ILE B CD1 1 
ATOM   4436  N N   . GLY B 1 221 ? -9.635  -25.777 47.476  1.00 41.05  ? 232  GLY B N   1 
ATOM   4437  C CA  . GLY B 1 221 ? -10.102 -25.867 46.117  1.00 41.05  ? 232  GLY B CA  1 
ATOM   4438  C C   . GLY B 1 221 ? -8.995  -25.657 45.113  1.00 41.05  ? 232  GLY B C   1 
ATOM   4439  O O   . GLY B 1 221 ? -8.096  -24.853 45.324  1.00 41.05  ? 232  GLY B O   1 
ATOM   4440  N N   . GLU B 1 222 ? -9.070  -26.395 44.013  1.00 38.15  ? 233  GLU B N   1 
ATOM   4441  C CA  . GLU B 1 222 ? -8.106  -26.299 42.947  1.00 38.15  ? 233  GLU B CA  1 
ATOM   4442  C C   . GLU B 1 222 ? -8.762  -25.711 41.703  1.00 38.15  ? 233  GLU B C   1 
ATOM   4443  O O   . GLU B 1 222 ? -9.851  -26.116 41.312  1.00 38.15  ? 233  GLU B O   1 
ATOM   4444  C CB  . GLU B 1 222 ? -7.531  -27.678 42.658  1.00 39.21  ? 233  GLU B CB  1 
ATOM   4445  C CG  . GLU B 1 222 ? -6.568  -28.140 43.738  1.00 39.21  ? 233  GLU B CG  1 
ATOM   4446  C CD  . GLU B 1 222 ? -5.790  -29.401 43.372  1.00 39.21  ? 233  GLU B CD  1 
ATOM   4447  O OE1 . GLU B 1 222 ? -5.598  -29.677 42.163  1.00 39.21  ? 233  GLU B OE1 1 
ATOM   4448  O OE2 . GLU B 1 222 ? -5.348  -30.104 44.308  1.00 39.21  ? 233  GLU B OE2 1 
ATOM   4449  N N   . LYS B 1 223 ? -8.103  -24.729 41.100  1.00 46.60  ? 234  LYS B N   1 
ATOM   4450  C CA  . LYS B 1 223 ? -8.607  -24.082 39.899  1.00 46.60  ? 234  LYS B CA  1 
ATOM   4451  C C   . LYS B 1 223 ? -7.480  -23.847 38.907  1.00 46.60  ? 234  LYS B C   1 
ATOM   4452  O O   . LYS B 1 223 ? -6.357  -23.522 39.291  1.00 46.60  ? 234  LYS B O   1 
ATOM   4453  C CB  . LYS B 1 223 ? -9.248  -22.745 40.241  1.00 52.12  ? 234  LYS B CB  1 
ATOM   4454  C CG  . LYS B 1 223 ? -10.617 -22.855 40.847  1.00 52.12  ? 234  LYS B CG  1 
ATOM   4455  C CD  . LYS B 1 223 ? -11.022 -21.512 41.448  1.00 52.12  ? 234  LYS B CD  1 
ATOM   4456  C CE  . LYS B 1 223 ? -12.437 -21.520 42.014  1.00 52.12  ? 234  LYS B CE  1 
ATOM   4457  N NZ  . LYS B 1 223 ? -13.447 -21.707 40.938  1.00 52.12  ? 234  LYS B NZ  1 
ATOM   4458  N N   . THR B 1 224 ? -7.778  -24.034 37.626  1.00 47.76  ? 235  THR B N   1 
ATOM   4459  C CA  . THR B 1 224 ? -6.804  -23.802 36.574  1.00 47.76  ? 235  THR B CA  1 
ATOM   4460  C C   . THR B 1 224 ? -7.036  -22.402 36.063  1.00 47.76  ? 235  THR B C   1 
ATOM   4461  O O   . THR B 1 224 ? -8.020  -22.133 35.365  1.00 47.76  ? 235  THR B O   1 
ATOM   4462  C CB  . THR B 1 224 ? -6.977  -24.761 35.410  1.00 41.92  ? 235  THR B CB  1 
ATOM   4463  O OG1 . THR B 1 224 ? -6.355  -26.003 35.731  1.00 41.92  ? 235  THR B OG1 1 
ATOM   4464  C CG2 . THR B 1 224 ? -6.337  -24.206 34.172  1.00 41.92  ? 235  THR B CG2 1 
ATOM   4465  N N   . GLU B 1 225 ? -6.132  -21.502 36.423  1.00 36.34  ? 236  GLU B N   1 
ATOM   4466  C CA  . GLU B 1 225 ? -6.253  -20.136 35.986  1.00 36.34  ? 236  GLU B CA  1 
ATOM   4467  C C   . GLU B 1 225 ? -5.289  -19.839 34.823  1.00 36.34  ? 236  GLU B C   1 
ATOM   4468  O O   . GLU B 1 225 ? -4.221  -20.465 34.669  1.00 36.34  ? 236  GLU B O   1 
ATOM   4469  C CB  . GLU B 1 225 ? -5.992  -19.185 37.157  1.00 111.30 ? 236  GLU B CB  1 
ATOM   4470  C CG  . GLU B 1 225 ? -6.651  -19.616 38.466  1.00 111.30 ? 236  GLU B CG  1 
ATOM   4471  C CD  . GLU B 1 225 ? -6.827  -18.470 39.457  1.00 111.30 ? 236  GLU B CD  1 
ATOM   4472  O OE1 . GLU B 1 225 ? -7.786  -17.684 39.289  1.00 111.30 ? 236  GLU B OE1 1 
ATOM   4473  O OE2 . GLU B 1 225 ? -6.010  -18.348 40.399  1.00 111.30 ? 236  GLU B OE2 1 
ATOM   4474  N N   . ALA B 1 226 ? -5.722  -18.899 33.983  1.00 38.78  ? 237  ALA B N   1 
ATOM   4475  C CA  . ALA B 1 226 ? -4.942  -18.424 32.858  1.00 38.78  ? 237  ALA B CA  1 
ATOM   4476  C C   . ALA B 1 226 ? -4.615  -16.976 33.244  1.00 38.78  ? 237  ALA B C   1 
ATOM   4477  O O   . ALA B 1 226 ? -5.510  -16.182 33.501  1.00 38.78  ? 237  ALA B O   1 
ATOM   4478  C CB  . ALA B 1 226 ? -5.768  -18.484 31.584  1.00 11.14  ? 237  ALA B CB  1 
ATOM   4479  N N   . SER B 1 227 ? -3.329  -16.653 33.310  1.00 38.15  ? 238  SER B N   1 
ATOM   4480  C CA  . SER B 1 227 ? -2.903  -15.320 33.694  1.00 38.15  ? 238  SER B CA  1 
ATOM   4481  C C   . SER B 1 227 ? -1.915  -14.598 32.773  1.00 38.15  ? 238  SER B C   1 
ATOM   4482  O O   . SER B 1 227 ? -0.851  -15.127 32.427  1.00 38.15  ? 238  SER B O   1 
ATOM   4483  C CB  . SER B 1 227 ? -2.306  -15.344 35.104  1.00 52.71  ? 238  SER B CB  1 
ATOM   4484  O OG  . SER B 1 227 ? -1.819  -14.055 35.469  1.00 52.71  ? 238  SER B OG  1 
ATOM   4485  N N   . LEU B 1 228 ? -2.289  -13.372 32.401  1.00 45.86  ? 239  LEU B N   1 
ATOM   4486  C CA  . LEU B 1 228 ? -1.464  -12.503 31.577  1.00 45.86  ? 239  LEU B CA  1 
ATOM   4487  C C   . LEU B 1 228 ? -1.164  -11.243 32.378  1.00 45.86  ? 239  LEU B C   1 
ATOM   4488  O O   . LEU B 1 228 ? -2.071  -10.543 32.813  1.00 45.86  ? 239  LEU B O   1 
ATOM   4489  C CB  . LEU B 1 228 ? -2.188  -12.104 30.292  1.00 40.09  ? 239  LEU B CB  1 
ATOM   4490  C CG  . LEU B 1 228 ? -1.552  -10.911 29.549  1.00 40.09  ? 239  LEU B CG  1 
ATOM   4491  C CD1 . LEU B 1 228 ? -0.165  -11.263 29.032  1.00 40.09  ? 239  LEU B CD1 1 
ATOM   4492  C CD2 . LEU B 1 228 ? -2.448  -10.504 28.405  1.00 40.09  ? 239  LEU B CD2 1 
ATOM   4493  N N   . VAL B 1 229 ? 0.108   -10.960 32.595  1.00 49.64  ? 240  VAL B N   1 
ATOM   4494  C CA  . VAL B 1 229 ? 0.451   -9.762  33.319  1.00 49.64  ? 240  VAL B CA  1 
ATOM   4495  C C   . VAL B 1 229 ? 1.110   -8.845  32.304  1.00 49.64  ? 240  VAL B C   1 
ATOM   4496  O O   . VAL B 1 229 ? 2.160   -9.165  31.759  1.00 49.64  ? 240  VAL B O   1 
ATOM   4497  C CB  . VAL B 1 229 ? 1.395   -10.061 34.493  1.00 55.91  ? 240  VAL B CB  1 
ATOM   4498  C CG1 . VAL B 1 229 ? 1.758   -8.772  35.206  1.00 55.91  ? 240  VAL B CG1 1 
ATOM   4499  C CG2 . VAL B 1 229 ? 0.711   -11.001 35.476  1.00 55.91  ? 240  VAL B CG2 1 
ATOM   4500  N N   . TRP B 1 230 ? 0.461   -7.712  32.048  1.00 41.19  ? 241  TRP B N   1 
ATOM   4501  C CA  . TRP B 1 230 ? 0.901   -6.717  31.084  1.00 41.19  ? 241  TRP B CA  1 
ATOM   4502  C C   . TRP B 1 230 ? 1.716   -5.612  31.742  1.00 41.19  ? 241  TRP B C   1 
ATOM   4503  O O   . TRP B 1 230 ? 1.237   -4.939  32.651  1.00 41.19  ? 241  TRP B O   1 
ATOM   4504  C CB  . TRP B 1 230 ? -0.334  -6.110  30.420  1.00 74.69  ? 241  TRP B CB  1 
ATOM   4505  C CG  . TRP B 1 230 ? -0.094  -5.521  29.075  1.00 74.69  ? 241  TRP B CG  1 
ATOM   4506  C CD1 . TRP B 1 230 ? -0.390  -4.254  28.672  1.00 74.69  ? 241  TRP B CD1 1 
ATOM   4507  C CD2 . TRP B 1 230 ? 0.454   -6.187  27.937  1.00 74.69  ? 241  TRP B CD2 1 
ATOM   4508  N NE1 . TRP B 1 230 ? -0.062  -4.089  27.354  1.00 74.69  ? 241  TRP B NE1 1 
ATOM   4509  C CE2 . TRP B 1 230 ? 0.459   -5.261  26.877  1.00 74.69  ? 241  TRP B CE2 1 
ATOM   4510  C CE3 . TRP B 1 230 ? 0.944   -7.479  27.710  1.00 74.69  ? 241  TRP B CE3 1 
ATOM   4511  C CZ2 . TRP B 1 230 ? 0.938   -5.585  25.598  1.00 74.69  ? 241  TRP B CZ2 1 
ATOM   4512  C CZ3 . TRP B 1 230 ? 1.421   -7.803  26.440  1.00 74.69  ? 241  TRP B CZ3 1 
ATOM   4513  C CH2 . TRP B 1 230 ? 1.413   -6.856  25.399  1.00 74.69  ? 241  TRP B CH2 1 
ATOM   4514  N N   . PHE B 1 231 ? 2.943   -5.411  31.280  1.00 69.13  ? 242  PHE B N   1 
ATOM   4515  C CA  . PHE B 1 231 ? 3.788   -4.358  31.839  1.00 69.13  ? 242  PHE B CA  1 
ATOM   4516  C C   . PHE B 1 231 ? 3.750   -3.115  30.967  1.00 69.13  ? 242  PHE B C   1 
ATOM   4517  O O   . PHE B 1 231 ? 4.650   -2.896  30.166  1.00 69.13  ? 242  PHE B O   1 
ATOM   4518  C CB  . PHE B 1 231 ? 5.227   -4.828  31.937  1.00 52.67  ? 242  PHE B CB  1 
ATOM   4519  C CG  . PHE B 1 231 ? 5.404   -6.040  32.781  1.00 52.67  ? 242  PHE B CG  1 
ATOM   4520  C CD1 . PHE B 1 231 ? 5.381   -5.947  34.161  1.00 52.67  ? 242  PHE B CD1 1 
ATOM   4521  C CD2 . PHE B 1 231 ? 5.620   -7.279  32.195  1.00 52.67  ? 242  PHE B CD2 1 
ATOM   4522  C CE1 . PHE B 1 231 ? 5.577   -7.070  34.943  1.00 52.67  ? 242  PHE B CE1 1 
ATOM   4523  C CE2 . PHE B 1 231 ? 5.818   -8.408  32.971  1.00 52.67  ? 242  PHE B CE2 1 
ATOM   4524  C CZ  . PHE B 1 231 ? 5.797   -8.304  34.343  1.00 52.67  ? 242  PHE B CZ  1 
ATOM   4525  N N   . THR B 1 232 ? 2.724   -2.294  31.130  1.00 84.00  ? 243  THR B N   1 
ATOM   4526  C CA  . THR B 1 232 ? 2.604   -1.083  30.333  1.00 84.00  ? 243  THR B CA  1 
ATOM   4527  C C   . THR B 1 232 ? 2.823   0.221   31.105  1.00 84.00  ? 243  THR B C   1 
ATOM   4528  O O   . THR B 1 232 ? 2.543   0.300   32.298  1.00 84.00  ? 243  THR B O   1 
ATOM   4529  C CB  . THR B 1 232 ? 1.232   -1.002  29.694  1.00 67.23  ? 243  THR B CB  1 
ATOM   4530  O OG1 . THR B 1 232 ? 1.051   0.308   29.148  1.00 67.23  ? 243  THR B OG1 1 
ATOM   4531  C CG2 . THR B 1 232 ? 0.156   -1.274  30.726  1.00 67.23  ? 243  THR B CG2 1 
ATOM   4532  N N   . PRO B 1 233 ? 3.326   1.266   30.422  1.00 84.71  ? 244  PRO B N   1 
ATOM   4533  C CA  . PRO B 1 233 ? 3.578   2.574   31.039  1.00 84.71  ? 244  PRO B CA  1 
ATOM   4534  C C   . PRO B 1 233 ? 2.284   3.333   31.347  1.00 84.71  ? 244  PRO B C   1 
ATOM   4535  O O   . PRO B 1 233 ? 1.339   3.313   30.558  1.00 84.71  ? 244  PRO B O   1 
ATOM   4536  C CB  . PRO B 1 233 ? 4.441   3.286   29.998  1.00 53.21  ? 244  PRO B CB  1 
ATOM   4537  C CG  . PRO B 1 233 ? 3.946   2.715   28.716  1.00 53.21  ? 244  PRO B CG  1 
ATOM   4538  C CD  . PRO B 1 233 ? 3.827   1.246   29.037  1.00 53.21  ? 244  PRO B CD  1 
ATOM   4539  N N   . PRO B 1 234 ? 2.244   4.026   32.498  1.00 75.05  ? 245  PRO B N   1 
ATOM   4540  C CA  . PRO B 1 234 ? 1.137   4.828   33.035  1.00 75.05  ? 245  PRO B CA  1 
ATOM   4541  C C   . PRO B 1 234 ? 0.254   5.548   32.014  1.00 75.05  ? 245  PRO B C   1 
ATOM   4542  O O   . PRO B 1 234 ? -0.974  5.607   32.169  1.00 75.05  ? 245  PRO B O   1 
ATOM   4543  C CB  . PRO B 1 234 ? 1.851   5.806   33.956  1.00 89.19  ? 245  PRO B CB  1 
ATOM   4544  C CG  . PRO B 1 234 ? 2.945   4.973   34.510  1.00 89.19  ? 245  PRO B CG  1 
ATOM   4545  C CD  . PRO B 1 234 ? 3.467   4.249   33.293  1.00 89.19  ? 245  PRO B CD  1 
ATOM   4546  N N   . ARG B 1 235 ? 0.884   6.105   30.984  1.00 53.58  ? 246  ARG B N   1 
ATOM   4547  C CA  . ARG B 1 235 ? 0.170   6.839   29.942  1.00 53.58  ? 246  ARG B CA  1 
ATOM   4548  C C   . ARG B 1 235 ? -0.827  5.926   29.233  1.00 53.58  ? 246  ARG B C   1 
ATOM   4549  O O   . ARG B 1 235 ? -2.039  6.195   29.225  1.00 53.58  ? 246  ARG B O   1 
ATOM   4550  C CB  . ARG B 1 235 ? 1.191   7.408   28.947  1.00 107.65 ? 246  ARG B CB  1 
ATOM   4551  C CG  . ARG B 1 235 ? 0.616   8.277   27.835  1.00 107.65 ? 246  ARG B CG  1 
ATOM   4552  C CD  . ARG B 1 235 ? 1.723   9.081   27.136  1.00 107.65 ? 246  ARG B CD  1 
ATOM   4553  N NE  . ARG B 1 235 ? 2.626   8.261   26.330  1.00 107.65 ? 246  ARG B NE  1 
ATOM   4554  C CZ  . ARG B 1 235 ? 2.262   7.617   25.227  1.00 107.65 ? 246  ARG B CZ  1 
ATOM   4555  N NH1 . ARG B 1 235 ? 1.011   7.691   24.795  1.00 107.65 ? 246  ARG B NH1 1 
ATOM   4556  N NH2 . ARG B 1 235 ? 3.151   6.908   24.550  1.00 107.65 ? 246  ARG B NH2 1 
ATOM   4557  N N   . THR B 1 236 ? -0.307  4.836   28.661  1.00 46.66  ? 247  THR B N   1 
ATOM   4558  C CA  . THR B 1 236 ? -1.126  3.866   27.939  1.00 46.66  ? 247  THR B CA  1 
ATOM   4559  C C   . THR B 1 236 ? -1.849  2.959   28.926  1.00 46.66  ? 247  THR B C   1 
ATOM   4560  O O   . THR B 1 236 ? -2.879  2.372   28.599  1.00 46.66  ? 247  THR B O   1 
ATOM   4561  C CB  . THR B 1 236 ? -0.271  2.983   26.987  1.00 84.49  ? 247  THR B CB  1 
ATOM   4562  O OG1 . THR B 1 236 ? 0.964   3.640   26.694  1.00 84.49  ? 247  THR B OG1 1 
ATOM   4563  C CG2 . THR B 1 236 ? -1.017  2.738   25.667  1.00 84.49  ? 247  THR B CG2 1 
ATOM   4564  N N   . SER B 1 237 ? -1.292  2.865   30.133  1.00 60.66  ? 248  SER B N   1 
ATOM   4565  C CA  . SER B 1 237 ? -1.829  2.043   31.220  1.00 60.66  ? 248  SER B CA  1 
ATOM   4566  C C   . SER B 1 237 ? -3.334  1.879   31.198  1.00 60.66  ? 248  SER B C   1 
ATOM   4567  O O   . SER B 1 237 ? -3.841  0.844   30.771  1.00 60.66  ? 248  SER B O   1 
ATOM   4568  C CB  . SER B 1 237 ? -1.424  2.628   32.572  1.00 72.41  ? 248  SER B CB  1 
ATOM   4569  O OG  . SER B 1 237 ? -2.041  1.928   33.636  1.00 72.41  ? 248  SER B OG  1 
ATOM   4570  N N   . ASN B 1 238 ? -4.044  2.901   31.669  1.00 101.72 ? 249  ASN B N   1 
ATOM   4571  C CA  . ASN B 1 238 ? -5.502  2.871   31.717  1.00 101.72 ? 249  ASN B CA  1 
ATOM   4572  C C   . ASN B 1 238 ? -6.108  2.607   30.338  1.00 101.72 ? 249  ASN B C   1 
ATOM   4573  O O   . ASN B 1 238 ? -7.263  2.189   30.225  1.00 101.72 ? 249  ASN B O   1 
ATOM   4574  C CB  . ASN B 1 238 ? -6.031  4.192   32.290  1.00 126.45 ? 249  ASN B CB  1 
ATOM   4575  C CG  . ASN B 1 238 ? -7.544  4.224   32.394  1.00 126.45 ? 249  ASN B CG  1 
ATOM   4576  O OD1 . ASN B 1 238 ? -8.238  4.636   31.463  1.00 126.45 ? 249  ASN B OD1 1 
ATOM   4577  N ND2 . ASN B 1 238 ? -8.066  3.775   33.529  1.00 126.45 ? 249  ASN B ND2 1 
ATOM   4578  N N   . GLN B 1 239 ? -5.322  2.838   29.292  1.00 70.93  ? 250  GLN B N   1 
ATOM   4579  C CA  . GLN B 1 239 ? -5.792  2.625   27.931  1.00 70.93  ? 250  GLN B CA  1 
ATOM   4580  C C   . GLN B 1 239 ? -5.766  1.134   27.581  1.00 70.93  ? 250  GLN B C   1 
ATOM   4581  O O   . GLN B 1 239 ? -6.767  0.589   27.105  1.00 70.93  ? 250  GLN B O   1 
ATOM   4582  C CB  . GLN B 1 239 ? -4.927  3.431   26.958  1.00 92.91  ? 250  GLN B CB  1 
ATOM   4583  C CG  . GLN B 1 239 ? -5.500  3.578   25.550  1.00 92.91  ? 250  GLN B CG  1 
ATOM   4584  C CD  . GLN B 1 239 ? -6.917  4.112   25.543  1.00 92.91  ? 250  GLN B CD  1 
ATOM   4585  O OE1 . GLN B 1 239 ? -7.321  4.822   26.463  1.00 92.91  ? 250  GLN B OE1 1 
ATOM   4586  N NE2 . GLN B 1 239 ? -7.677  3.785   24.498  1.00 92.91  ? 250  GLN B NE2 1 
ATOM   4587  N N   . TRP B 1 240 ? -4.628  0.478   27.825  1.00 88.58  ? 251  TRP B N   1 
ATOM   4588  C CA  . TRP B 1 240 ? -4.480  -0.957  27.547  1.00 88.58  ? 251  TRP B CA  1 
ATOM   4589  C C   . TRP B 1 240 ? -5.547  -1.763  28.270  1.00 88.58  ? 251  TRP B C   1 
ATOM   4590  O O   . TRP B 1 240 ? -6.089  -2.731  27.731  1.00 88.58  ? 251  TRP B O   1 
ATOM   4591  C CB  . TRP B 1 240 ? -3.105  -1.467  27.988  1.00 45.74  ? 251  TRP B CB  1 
ATOM   4592  C CG  . TRP B 1 240 ? -2.005  -1.217  27.000  1.00 45.74  ? 251  TRP B CG  1 
ATOM   4593  C CD1 . TRP B 1 240 ? -1.016  -0.278  27.088  1.00 45.74  ? 251  TRP B CD1 1 
ATOM   4594  C CD2 . TRP B 1 240 ? -1.796  -1.902  25.764  1.00 45.74  ? 251  TRP B CD2 1 
ATOM   4595  N NE1 . TRP B 1 240 ? -0.199  -0.332  25.978  1.00 45.74  ? 251  TRP B NE1 1 
ATOM   4596  C CE2 . TRP B 1 240 ? -0.657  -1.320  25.148  1.00 45.74  ? 251  TRP B CE2 1 
ATOM   4597  C CE3 . TRP B 1 240 ? -2.458  -2.947  25.112  1.00 45.74  ? 251  TRP B CE3 1 
ATOM   4598  C CZ2 . TRP B 1 240 ? -0.171  -1.750  23.917  1.00 45.74  ? 251  TRP B CZ2 1 
ATOM   4599  C CZ3 . TRP B 1 240 ? -1.976  -3.374  23.891  1.00 45.74  ? 251  TRP B CZ3 1 
ATOM   4600  C CH2 . TRP B 1 240 ? -0.841  -2.775  23.303  1.00 45.74  ? 251  TRP B CH2 1 
ATOM   4601  N N   . LEU B 1 241 ? -5.830  -1.364  29.504  1.00 54.17  ? 252  LEU B N   1 
ATOM   4602  C CA  . LEU B 1 241 ? -6.843  -2.033  30.296  1.00 54.17  ? 252  LEU B CA  1 
ATOM   4603  C C   . LEU B 1 241 ? -8.109  -2.136  29.465  1.00 54.17  ? 252  LEU B C   1 
ATOM   4604  O O   . LEU B 1 241 ? -8.788  -3.159  29.493  1.00 54.17  ? 252  LEU B O   1 
ATOM   4605  C CB  . LEU B 1 241 ? -7.117  -1.247  31.576  1.00 37.99  ? 252  LEU B CB  1 
ATOM   4606  C CG  . LEU B 1 241 ? -8.114  -1.832  32.578  1.00 37.99  ? 252  LEU B CG  1 
ATOM   4607  C CD1 . LEU B 1 241 ? -9.527  -1.577  32.112  1.00 37.99  ? 252  LEU B CD1 1 
ATOM   4608  C CD2 . LEU B 1 241 ? -7.867  -3.312  32.750  1.00 37.99  ? 252  LEU B CD2 1 
ATOM   4609  N N   . ASP B 1 242 ? -8.420  -1.068  28.730  1.00 70.62  ? 253  ASP B N   1 
ATOM   4610  C CA  . ASP B 1 242 ? -9.600  -1.041  27.873  1.00 70.62  ? 253  ASP B CA  1 
ATOM   4611  C C   . ASP B 1 242 ? -9.434  -2.146  26.844  1.00 70.62  ? 253  ASP B C   1 
ATOM   4612  O O   . ASP B 1 242 ? -10.286 -3.028  26.713  1.00 70.62  ? 253  ASP B O   1 
ATOM   4613  C CB  . ASP B 1 242 ? -9.714  0.302   27.143  1.00 201.99 ? 253  ASP B CB  1 
ATOM   4614  C CG  . ASP B 1 242 ? -9.676  1.489   28.085  1.00 201.99 ? 253  ASP B CG  1 
ATOM   4615  O OD1 . ASP B 1 242 ? -10.532 1.560   28.993  1.00 201.99 ? 253  ASP B OD1 1 
ATOM   4616  O OD2 . ASP B 1 242 ? -8.791  2.355   27.914  1.00 201.99 ? 253  ASP B OD2 1 
ATOM   4617  N N   . PHE B 1 243 ? -8.316  -2.090  26.126  1.00 57.71  ? 254  PHE B N   1 
ATOM   4618  C CA  . PHE B 1 243 ? -8.017  -3.064  25.093  1.00 57.71  ? 254  PHE B CA  1 
ATOM   4619  C C   . PHE B 1 243 ? -8.310  -4.469  25.553  1.00 57.71  ? 254  PHE B C   1 
ATOM   4620  O O   . PHE B 1 243 ? -9.085  -5.185  24.919  1.00 57.71  ? 254  PHE B O   1 
ATOM   4621  C CB  . PHE B 1 243 ? -6.550  -2.983  24.684  1.00 81.13  ? 254  PHE B CB  1 
ATOM   4622  C CG  . PHE B 1 243 ? -6.170  -3.963  23.608  1.00 81.13  ? 254  PHE B CG  1 
ATOM   4623  C CD1 . PHE B 1 243 ? -6.838  -3.967  22.383  1.00 81.13  ? 254  PHE B CD1 1 
ATOM   4624  C CD2 . PHE B 1 243 ? -5.131  -4.866  23.804  1.00 81.13  ? 254  PHE B CD2 1 
ATOM   4625  C CE1 . PHE B 1 243 ? -6.475  -4.851  21.372  1.00 81.13  ? 254  PHE B CE1 1 
ATOM   4626  C CE2 . PHE B 1 243 ? -4.762  -5.754  22.795  1.00 81.13  ? 254  PHE B CE2 1 
ATOM   4627  C CZ  . PHE B 1 243 ? -5.437  -5.744  21.577  1.00 81.13  ? 254  PHE B CZ  1 
ATOM   4628  N N   . TRP B 1 244 ? -7.698  -4.854  26.669  1.00 61.48  ? 255  TRP B N   1 
ATOM   4629  C CA  . TRP B 1 244 ? -7.864  -6.197  27.207  1.00 61.48  ? 255  TRP B CA  1 
ATOM   4630  C C   . TRP B 1 244 ? -9.267  -6.617  27.664  1.00 61.48  ? 255  TRP B C   1 
ATOM   4631  O O   . TRP B 1 244 ? -9.641  -7.777  27.496  1.00 61.48  ? 255  TRP B O   1 
ATOM   4632  C CB  . TRP B 1 244 ? -6.838  -6.418  28.311  1.00 36.47  ? 255  TRP B CB  1 
ATOM   4633  C CG  . TRP B 1 244 ? -5.448  -6.490  27.751  1.00 36.47  ? 255  TRP B CG  1 
ATOM   4634  C CD1 . TRP B 1 244 ? -4.435  -5.581  27.906  1.00 36.47  ? 255  TRP B CD1 1 
ATOM   4635  C CD2 . TRP B 1 244 ? -4.942  -7.506  26.900  1.00 36.47  ? 255  TRP B CD2 1 
ATOM   4636  N NE1 . TRP B 1 244 ? -3.329  -5.976  27.196  1.00 36.47  ? 255  TRP B NE1 1 
ATOM   4637  C CE2 . TRP B 1 244 ? -3.615  -7.156  26.569  1.00 36.47  ? 255  TRP B CE2 1 
ATOM   4638  C CE3 . TRP B 1 244 ? -5.482  -8.686  26.380  1.00 36.47  ? 255  TRP B CE3 1 
ATOM   4639  C CZ2 . TRP B 1 244 ? -2.823  -7.939  25.744  1.00 36.47  ? 255  TRP B CZ2 1 
ATOM   4640  C CZ3 . TRP B 1 244 ? -4.691  -9.472  25.555  1.00 36.47  ? 255  TRP B CZ3 1 
ATOM   4641  C CH2 . TRP B 1 244 ? -3.375  -9.094  25.245  1.00 36.47  ? 255  TRP B CH2 1 
ATOM   4642  N N   . LEU B 1 245 ? -10.050 -5.704  28.232  1.00 47.13  ? 256  LEU B N   1 
ATOM   4643  C CA  . LEU B 1 245 ? -11.393 -6.081  28.638  1.00 47.13  ? 256  LEU B CA  1 
ATOM   4644  C C   . LEU B 1 245 ? -12.085 -6.439  27.353  1.00 47.13  ? 256  LEU B C   1 
ATOM   4645  O O   . LEU B 1 245 ? -12.799 -7.442  27.272  1.00 47.13  ? 256  LEU B O   1 
ATOM   4646  C CB  . LEU B 1 245 ? -12.150 -4.928  29.305  1.00 65.66  ? 256  LEU B CB  1 
ATOM   4647  C CG  . LEU B 1 245 ? -13.645 -5.192  29.601  1.00 65.66  ? 256  LEU B CG  1 
ATOM   4648  C CD1 . LEU B 1 245 ? -13.822 -6.406  30.502  1.00 65.66  ? 256  LEU B CD1 1 
ATOM   4649  C CD2 . LEU B 1 245 ? -14.258 -3.976  30.268  1.00 65.66  ? 256  LEU B CD2 1 
ATOM   4650  N N   . ARG B 1 246 ? -11.867 -5.611  26.339  1.00 87.77  ? 257  ARG B N   1 
ATOM   4651  C CA  . ARG B 1 246 ? -12.481 -5.852  25.050  1.00 87.77  ? 257  ARG B CA  1 
ATOM   4652  C C   . ARG B 1 246 ? -12.017 -7.220  24.533  1.00 87.77  ? 257  ARG B C   1 
ATOM   4653  O O   . ARG B 1 246 ? -12.835 -8.121  24.318  1.00 87.77  ? 257  ARG B O   1 
ATOM   4654  C CB  . ARG B 1 246 ? -12.104 -4.737  24.075  1.00 69.25  ? 257  ARG B CB  1 
ATOM   4655  C CG  . ARG B 1 246 ? -13.257 -4.329  23.157  1.00 69.25  ? 257  ARG B CG  1 
ATOM   4656  C CD  . ARG B 1 246 ? -12.860 -3.256  22.139  1.00 69.25  ? 257  ARG B CD  1 
ATOM   4657  N NE  . ARG B 1 246 ? -12.123 -2.178  22.781  1.00 69.25  ? 257  ARG B NE  1 
ATOM   4658  C CZ  . ARG B 1 246 ? -12.590 -1.471  23.801  1.00 69.25  ? 257  ARG B CZ  1 
ATOM   4659  N NH1 . ARG B 1 246 ? -11.837 -0.506  24.333  1.00 69.25  ? 257  ARG B NH1 1 
ATOM   4660  N NH2 . ARG B 1 246 ? -13.811 -1.722  24.280  1.00 69.25  ? 257  ARG B NH2 1 
ATOM   4661  N N   . HIS B 1 247 ? -10.705 -7.377  24.369  1.00 42.99  ? 258  HIS B N   1 
ATOM   4662  C CA  . HIS B 1 247 ? -10.122 -8.629  23.888  1.00 42.99  ? 258  HIS B CA  1 
ATOM   4663  C C   . HIS B 1 247 ? -10.714 -9.836  24.613  1.00 42.99  ? 258  HIS B C   1 
ATOM   4664  O O   . HIS B 1 247 ? -11.275 -10.744 23.997  1.00 42.99  ? 258  HIS B O   1 
ATOM   4665  C CB  . HIS B 1 247 ? -8.610  -8.588  24.094  1.00 70.36  ? 258  HIS B CB  1 
ATOM   4666  C CG  . HIS B 1 247 ? -7.890  -9.795  23.579  1.00 70.36  ? 258  HIS B CG  1 
ATOM   4667  N ND1 . HIS B 1 247 ? -8.015  -11.040 24.155  1.00 70.36  ? 258  HIS B ND1 1 
ATOM   4668  C CD2 . HIS B 1 247 ? -7.013  -9.939  22.558  1.00 70.36  ? 258  HIS B CD2 1 
ATOM   4669  C CE1 . HIS B 1 247 ? -7.244  -11.898 23.512  1.00 70.36  ? 258  HIS B CE1 1 
ATOM   4670  N NE2 . HIS B 1 247 ? -6.625  -11.255 22.539  1.00 70.36  ? 258  HIS B NE2 1 
ATOM   4671  N N   . ARG B 1 248 ? -10.588 -9.832  25.930  1.00 48.81  ? 259  ARG B N   1 
ATOM   4672  C CA  . ARG B 1 248 ? -11.098 -10.917 26.749  1.00 48.81  ? 259  ARG B CA  1 
ATOM   4673  C C   . ARG B 1 248 ? -12.594 -11.149 26.551  1.00 48.81  ? 259  ARG B C   1 
ATOM   4674  O O   . ARG B 1 248 ? -13.034 -12.254 26.209  1.00 48.81  ? 259  ARG B O   1 
ATOM   4675  C CB  . ARG B 1 248 ? -10.816 -10.629 28.226  1.00 43.10  ? 259  ARG B CB  1 
ATOM   4676  C CG  . ARG B 1 248 ? -9.341  -10.583 28.583  1.00 43.10  ? 259  ARG B CG  1 
ATOM   4677  C CD  . ARG B 1 248 ? -8.663  -11.833 28.093  1.00 43.10  ? 259  ARG B CD  1 
ATOM   4678  N NE  . ARG B 1 248 ? -9.383  -13.000 28.562  1.00 43.10  ? 259  ARG B NE  1 
ATOM   4679  C CZ  . ARG B 1 248 ? -9.558  -14.104 27.847  1.00 43.10  ? 259  ARG B CZ  1 
ATOM   4680  N NH1 . ARG B 1 248 ? -9.058  -14.182 26.619  1.00 43.10  ? 259  ARG B NH1 1 
ATOM   4681  N NH2 . ARG B 1 248 ? -10.229 -15.131 28.358  1.00 43.10  ? 259  ARG B NH2 1 
ATOM   4682  N N   . LEU B 1 249 ? -13.381 -10.108 26.783  1.00 82.05  ? 260  LEU B N   1 
ATOM   4683  C CA  . LEU B 1 249 ? -14.817 -10.227 26.626  1.00 82.05  ? 260  LEU B CA  1 
ATOM   4684  C C   . LEU B 1 249 ? -15.141 -10.754 25.228  1.00 82.05  ? 260  LEU B C   1 
ATOM   4685  O O   . LEU B 1 249 ? -15.930 -11.690 25.065  1.00 82.05  ? 260  LEU B O   1 
ATOM   4686  C CB  . LEU B 1 249 ? -15.481 -8.870  26.865  1.00 66.13  ? 260  LEU B CB  1 
ATOM   4687  C CG  . LEU B 1 249 ? -17.013 -8.831  26.831  1.00 66.13  ? 260  LEU B CG  1 
ATOM   4688  C CD1 . LEU B 1 249 ? -17.643 -9.910  27.729  1.00 66.13  ? 260  LEU B CD1 1 
ATOM   4689  C CD2 . LEU B 1 249 ? -17.447 -7.446  27.264  1.00 66.13  ? 260  LEU B CD2 1 
ATOM   4690  N N   . GLN B 1 250 ? -14.510 -10.173 24.216  1.00 55.20  ? 261  GLN B N   1 
ATOM   4691  C CA  . GLN B 1 250 ? -14.761 -10.606 22.851  1.00 55.20  ? 261  GLN B CA  1 
ATOM   4692  C C   . GLN B 1 250 ? -14.430 -12.083 22.664  1.00 55.20  ? 261  GLN B C   1 
ATOM   4693  O O   . GLN B 1 250 ? -15.146 -12.790 21.954  1.00 55.20  ? 261  GLN B O   1 
ATOM   4694  C CB  . GLN B 1 250 ? -13.971 -9.729  21.872  1.00 101.60 ? 261  GLN B CB  1 
ATOM   4695  C CG  . GLN B 1 250 ? -14.233 -8.236  22.085  1.00 101.60 ? 261  GLN B CG  1 
ATOM   4696  C CD  . GLN B 1 250 ? -13.956 -7.381  20.862  1.00 101.60 ? 261  GLN B CD  1 
ATOM   4697  O OE1 . GLN B 1 250 ? -12.875 -7.437  20.275  1.00 101.60 ? 261  GLN B OE1 1 
ATOM   4698  N NE2 . GLN B 1 250 ? -14.939 -6.571  20.477  1.00 101.60 ? 261  GLN B NE2 1 
ATOM   4699  N N   . TRP B 1 251 ? -13.362 -12.535 23.331  1.00 38.21  ? 262  TRP B N   1 
ATOM   4700  C CA  . TRP B 1 251 ? -12.886 -13.929 23.279  1.00 38.21  ? 262  TRP B CA  1 
ATOM   4701  C C   . TRP B 1 251 ? -13.906 -14.953 23.799  1.00 38.21  ? 262  TRP B C   1 
ATOM   4702  O O   . TRP B 1 251 ? -14.182 -15.947 23.140  1.00 38.21  ? 262  TRP B O   1 
ATOM   4703  C CB  . TRP B 1 251 ? -11.597 -14.050 24.091  1.00 47.61  ? 262  TRP B CB  1 
ATOM   4704  C CG  . TRP B 1 251 ? -10.898 -15.369 23.980  1.00 47.61  ? 262  TRP B CG  1 
ATOM   4705  C CD1 . TRP B 1 251 ? -10.078 -15.760 22.986  1.00 47.61  ? 262  TRP B CD1 1 
ATOM   4706  C CD2 . TRP B 1 251 ? -10.968 -16.473 24.902  1.00 47.61  ? 262  TRP B CD2 1 
ATOM   4707  N NE1 . TRP B 1 251 ? -9.626  -17.032 23.215  1.00 47.61  ? 262  TRP B NE1 1 
ATOM   4708  C CE2 . TRP B 1 251 ? -10.157 -17.496 24.384  1.00 47.61  ? 262  TRP B CE2 1 
ATOM   4709  C CE3 . TRP B 1 251 ? -11.643 -16.694 26.117  1.00 47.61  ? 262  TRP B CE3 1 
ATOM   4710  C CZ2 . TRP B 1 251 ? -9.994  -18.725 25.026  1.00 47.61  ? 262  TRP B CZ2 1 
ATOM   4711  C CZ3 . TRP B 1 251 ? -11.483 -17.921 26.762  1.00 47.61  ? 262  TRP B CZ3 1 
ATOM   4712  C CH2 . TRP B 1 251 ? -10.662 -18.920 26.210  1.00 47.61  ? 262  TRP B CH2 1 
ATOM   4713  N N   . TRP B 1 252 ? -14.468 -14.706 24.982  1.00 48.48  ? 263  TRP B N   1 
ATOM   4714  C CA  . TRP B 1 252 ? -15.447 -15.623 25.571  1.00 48.48  ? 263  TRP B CA  1 
ATOM   4715  C C   . TRP B 1 252 ? -16.699 -15.822 24.740  1.00 48.48  ? 263  TRP B C   1 
ATOM   4716  O O   . TRP B 1 252 ? -17.246 -16.922 24.688  1.00 48.48  ? 263  TRP B O   1 
ATOM   4717  C CB  . TRP B 1 252 ? -15.882 -15.150 26.950  1.00 33.98  ? 263  TRP B CB  1 
ATOM   4718  C CG  . TRP B 1 252 ? -14.859 -15.290 28.022  1.00 33.98  ? 263  TRP B CG  1 
ATOM   4719  C CD1 . TRP B 1 252 ? -14.047 -14.312 28.507  1.00 33.98  ? 263  TRP B CD1 1 
ATOM   4720  C CD2 . TRP B 1 252 ? -14.583 -16.464 28.794  1.00 33.98  ? 263  TRP B CD2 1 
ATOM   4721  N NE1 . TRP B 1 252 ? -13.285 -14.802 29.551  1.00 33.98  ? 263  TRP B NE1 1 
ATOM   4722  C CE2 . TRP B 1 252 ? -13.599 -16.120 29.742  1.00 33.98  ? 263  TRP B CE2 1 
ATOM   4723  C CE3 . TRP B 1 252 ? -15.072 -17.767 28.775  1.00 33.98  ? 263  TRP B CE3 1 
ATOM   4724  C CZ2 . TRP B 1 252 ? -13.099 -17.031 30.661  1.00 33.98  ? 263  TRP B CZ2 1 
ATOM   4725  C CZ3 . TRP B 1 252 ? -14.576 -18.677 29.687  1.00 33.98  ? 263  TRP B CZ3 1 
ATOM   4726  C CH2 . TRP B 1 252 ? -13.598 -18.305 30.621  1.00 33.98  ? 263  TRP B CH2 1 
ATOM   4727  N N   . ARG B 1 253 ? -17.165 -14.747 24.113  1.00 84.73  ? 264  ARG B N   1 
ATOM   4728  C CA  . ARG B 1 253 ? -18.370 -14.799 23.291  1.00 84.73  ? 264  ARG B CA  1 
ATOM   4729  C C   . ARG B 1 253 ? -18.115 -15.569 21.989  1.00 84.73  ? 264  ARG B C   1 
ATOM   4730  O O   . ARG B 1 253 ? -18.996 -16.254 21.473  1.00 84.73  ? 264  ARG B O   1 
ATOM   4731  C CB  . ARG B 1 253 ? -18.852 -13.363 23.005  1.00 86.89  ? 264  ARG B CB  1 
ATOM   4732  C CG  . ARG B 1 253 ? -19.368 -12.635 24.251  1.00 86.89  ? 264  ARG B CG  1 
ATOM   4733  C CD  . ARG B 1 253 ? -19.683 -11.150 24.034  1.00 86.89  ? 264  ARG B CD  1 
ATOM   4734  N NE  . ARG B 1 253 ? -20.221 -10.539 25.257  1.00 86.89  ? 264  ARG B NE  1 
ATOM   4735  C CZ  . ARG B 1 253 ? -20.344 -9.229  25.470  1.00 86.89  ? 264  ARG B CZ  1 
ATOM   4736  N NH1 . ARG B 1 253 ? -19.970 -8.357  24.547  1.00 86.89  ? 264  ARG B NH1 1 
ATOM   4737  N NH2 . ARG B 1 253 ? -20.834 -8.786  26.617  1.00 86.89  ? 264  ARG B NH2 1 
ATOM   4738  N N   . LYS B 1 254 ? -16.886 -15.462 21.497  1.00 46.64  ? 265  LYS B N   1 
ATOM   4739  C CA  . LYS B 1 254 ? -16.421 -16.096 20.265  1.00 46.64  ? 265  LYS B CA  1 
ATOM   4740  C C   . LYS B 1 254 ? -16.807 -17.565 20.107  1.00 46.64  ? 265  LYS B C   1 
ATOM   4741  O O   . LYS B 1 254 ? -16.969 -18.049 18.993  1.00 46.64  ? 265  LYS B O   1 
ATOM   4742  C CB  . LYS B 1 254 ? -14.898 -15.968 20.204  1.00 83.86  ? 265  LYS B CB  1 
ATOM   4743  C CG  . LYS B 1 254 ? -14.247 -16.378 18.896  1.00 83.86  ? 265  LYS B CG  1 
ATOM   4744  C CD  . LYS B 1 254 ? -12.722 -16.507 19.049  1.00 83.86  ? 265  LYS B CD  1 
ATOM   4745  C CE  . LYS B 1 254 ? -12.064 -15.227 19.559  1.00 83.86  ? 265  LYS B CE  1 
ATOM   4746  N NZ  . LYS B 1 254 ? -10.607 -15.416 19.816  1.00 83.86  ? 265  LYS B NZ  1 
ATOM   4747  N N   . PHE B 1 255 ? -16.947 -18.272 21.220  1.00 48.16  ? 266  PHE B N   1 
ATOM   4748  C CA  . PHE B 1 255 ? -17.287 -19.696 21.182  1.00 48.16  ? 266  PHE B CA  1 
ATOM   4749  C C   . PHE B 1 255 ? -18.622 -19.989 21.839  1.00 48.16  ? 266  PHE B C   1 
ATOM   4750  O O   . PHE B 1 255 ? -18.974 -21.154 22.032  1.00 48.16  ? 266  PHE B O   1 
ATOM   4751  C CB  . PHE B 1 255 ? -16.227 -20.527 21.917  1.00 53.38  ? 266  PHE B CB  1 
ATOM   4752  C CG  . PHE B 1 255 ? -14.820 -20.220 21.511  1.00 53.38  ? 266  PHE B CG  1 
ATOM   4753  C CD1 . PHE B 1 255 ? -14.293 -20.735 20.345  1.00 53.38  ? 266  PHE B CD1 1 
ATOM   4754  C CD2 . PHE B 1 255 ? -14.034 -19.383 22.286  1.00 53.38  ? 266  PHE B CD2 1 
ATOM   4755  C CE1 . PHE B 1 255 ? -13.017 -20.418 19.962  1.00 53.38  ? 266  PHE B CE1 1 
ATOM   4756  C CE2 . PHE B 1 255 ? -12.754 -19.066 21.903  1.00 53.38  ? 266  PHE B CE2 1 
ATOM   4757  C CZ  . PHE B 1 255 ? -12.248 -19.581 20.742  1.00 53.38  ? 266  PHE B CZ  1 
ATOM   4758  N N   . ALA B 1 256 ? -19.347 -18.933 22.198  1.00 75.85  ? 267  ALA B N   1 
ATOM   4759  C CA  . ALA B 1 256 ? -20.639 -19.066 22.861  1.00 75.85  ? 267  ALA B CA  1 
ATOM   4760  C C   . ALA B 1 256 ? -21.780 -19.149 21.871  1.00 75.85  ? 267  ALA B C   1 
ATOM   4761  O O   . ALA B 1 256 ? -21.674 -18.669 20.748  1.00 75.85  ? 267  ALA B O   1 
ATOM   4762  C CB  . ALA B 1 256 ? -20.866 -17.881 23.807  1.00 47.85  ? 267  ALA B CB  1 
ATOM   4763  N N   . MET B 1 257 ? -22.866 -19.776 22.306  1.00 66.15  ? 268  MET B N   1 
ATOM   4764  C CA  . MET B 1 257 ? -24.077 -19.912 21.505  1.00 66.15  ? 268  MET B CA  1 
ATOM   4765  C C   . MET B 1 257 ? -25.010 -18.754 21.859  1.00 66.15  ? 268  MET B C   1 
ATOM   4766  O O   . MET B 1 257 ? -25.781 -18.275 21.030  1.00 66.15  ? 268  MET B O   1 
ATOM   4767  C CB  . MET B 1 257 ? -24.787 -21.228 21.819  1.00 75.19  ? 268  MET B CB  1 
ATOM   4768  C CG  . MET B 1 257 ? -24.133 -22.455 21.235  1.00 75.19  ? 268  MET B CG  1 
ATOM   4769  S SD  . MET B 1 257 ? -25.356 -23.458 20.359  1.00 75.19  ? 268  MET B SD  1 
ATOM   4770  C CE  . MET B 1 257 ? -25.114 -22.875 18.650  1.00 75.19  ? 268  MET B CE  1 
ATOM   4771  N N   . SER B 1 258 ? -24.916 -18.321 23.113  1.00 52.15  ? 269  SER B N   1 
ATOM   4772  C CA  . SER B 1 258 ? -25.720 -17.238 23.666  1.00 52.15  ? 269  SER B CA  1 
ATOM   4773  C C   . SER B 1 258 ? -24.753 -16.194 24.220  1.00 52.15  ? 269  SER B C   1 
ATOM   4774  O O   . SER B 1 258 ? -24.719 -15.940 25.422  1.00 52.15  ? 269  SER B O   1 
ATOM   4775  C CB  . SER B 1 258 ? -26.601 -17.778 24.800  1.00 59.13  ? 269  SER B CB  1 
ATOM   4776  O OG  . SER B 1 258 ? -27.137 -19.059 24.490  1.00 59.13  ? 269  SER B OG  1 
ATOM   4777  N N   . PRO B 1 259 ? -23.946 -15.584 23.344  1.00 51.80  ? 270  PRO B N   1 
ATOM   4778  C CA  . PRO B 1 259 ? -22.972 -14.569 23.747  1.00 51.80  ? 270  PRO B CA  1 
ATOM   4779  C C   . PRO B 1 259 ? -23.610 -13.485 24.578  1.00 51.80  ? 270  PRO B C   1 
ATOM   4780  O O   . PRO B 1 259 ? -22.933 -12.571 25.056  1.00 51.80  ? 270  PRO B O   1 
ATOM   4781  C CB  . PRO B 1 259 ? -22.453 -14.034 22.418  1.00 67.00  ? 270  PRO B CB  1 
ATOM   4782  C CG  . PRO B 1 259 ? -23.603 -14.237 21.509  1.00 67.00  ? 270  PRO B CG  1 
ATOM   4783  C CD  . PRO B 1 259 ? -24.070 -15.619 21.882  1.00 67.00  ? 270  PRO B CD  1 
ATOM   4784  N N   . SER B 1 260 ? -24.922 -13.595 24.739  1.00 76.80  ? 271  SER B N   1 
ATOM   4785  C CA  . SER B 1 260 ? -25.676 -12.631 25.511  1.00 76.80  ? 271  SER B CA  1 
ATOM   4786  C C   . SER B 1 260 ? -25.451 -12.855 27.000  1.00 76.80  ? 271  SER B C   1 
ATOM   4787  O O   . SER B 1 260 ? -25.535 -11.911 27.781  1.00 76.80  ? 271  SER B O   1 
ATOM   4788  C CB  . SER B 1 260 ? -27.163 -12.756 25.181  1.00 154.30 ? 271  SER B CB  1 
ATOM   4789  O OG  . SER B 1 260 ? -27.374 -12.679 23.780  1.00 154.30 ? 271  SER B OG  1 
ATOM   4790  N N   . ASN B 1 261 ? -25.141 -14.096 27.383  1.00 50.86  ? 272  ASN B N   1 
ATOM   4791  C CA  . ASN B 1 261 ? -24.932 -14.440 28.791  1.00 50.86  ? 272  ASN B CA  1 
ATOM   4792  C C   . ASN B 1 261 ? -23.513 -14.256 29.336  1.00 50.86  ? 272  ASN B C   1 
ATOM   4793  O O   . ASN B 1 261 ? -23.190 -14.728 30.429  1.00 50.86  ? 272  ASN B O   1 
ATOM   4794  C CB  . ASN B 1 261 ? -25.401 -15.871 29.056  1.00 83.93  ? 272  ASN B CB  1 
ATOM   4795  C CG  . ASN B 1 261 ? -26.875 -16.056 28.771  1.00 83.93  ? 272  ASN B CG  1 
ATOM   4796  O OD1 . ASN B 1 261 ? -27.684 -15.176 29.063  1.00 83.93  ? 272  ASN B OD1 1 
ATOM   4797  N ND2 . ASN B 1 261 ? -27.236 -17.208 28.212  1.00 83.93  ? 272  ASN B ND2 1 
ATOM   4798  N N   . PHE B 1 262 ? -22.670 -13.576 28.568  1.00 74.41  ? 273  PHE B N   1 
ATOM   4799  C CA  . PHE B 1 262 ? -21.304 -13.294 28.992  1.00 74.41  ? 273  PHE B CA  1 
ATOM   4800  C C   . PHE B 1 262 ? -21.254 -11.777 29.065  1.00 74.41  ? 273  PHE B C   1 
ATOM   4801  O O   . PHE B 1 262 ? -21.262 -11.115 28.028  1.00 74.41  ? 273  PHE B O   1 
ATOM   4802  C CB  . PHE B 1 262 ? -20.289 -13.813 27.958  1.00 49.35  ? 273  PHE B CB  1 
ATOM   4803  C CG  . PHE B 1 262 ? -19.930 -15.280 28.120  1.00 49.35  ? 273  PHE B CG  1 
ATOM   4804  C CD1 . PHE B 1 262 ? -18.946 -15.679 29.013  1.00 49.35  ? 273  PHE B CD1 1 
ATOM   4805  C CD2 . PHE B 1 262 ? -20.596 -16.261 27.391  1.00 49.35  ? 273  PHE B CD2 1 
ATOM   4806  C CE1 . PHE B 1 262 ? -18.637 -17.033 29.176  1.00 49.35  ? 273  PHE B CE1 1 
ATOM   4807  C CE2 . PHE B 1 262 ? -20.292 -17.615 27.550  1.00 49.35  ? 273  PHE B CE2 1 
ATOM   4808  C CZ  . PHE B 1 262 ? -19.316 -18.002 28.441  1.00 49.35  ? 273  PHE B CZ  1 
ATOM   4809  N N   . SER B 1 263 ? -21.224 -11.227 30.280  1.00 39.37  ? 274  SER B N   1 
ATOM   4810  C CA  . SER B 1 263 ? -21.200 -9.773  30.452  1.00 39.37  ? 274  SER B CA  1 
ATOM   4811  C C   . SER B 1 263 ? -19.985 -9.255  31.207  1.00 39.37  ? 274  SER B C   1 
ATOM   4812  O O   . SER B 1 263 ? -19.263 -10.040 31.826  1.00 39.37  ? 274  SER B O   1 
ATOM   4813  C CB  . SER B 1 263 ? -22.477 -9.304  31.161  1.00 74.87  ? 274  SER B CB  1 
ATOM   4814  O OG  . SER B 1 263 ? -22.625 -9.900  32.438  1.00 74.87  ? 274  SER B OG  1 
ATOM   4815  N N   . SER B 1 264 ? -19.775 -7.932  31.147  1.00 53.84  ? 275  SER B N   1 
ATOM   4816  C CA  . SER B 1 264 ? -18.652 -7.252  31.818  1.00 53.84  ? 275  SER B CA  1 
ATOM   4817  C C   . SER B 1 264 ? -19.097 -6.220  32.861  1.00 53.84  ? 275  SER B C   1 
ATOM   4818  O O   . SER B 1 264 ? -20.260 -5.855  32.932  1.00 53.84  ? 275  SER B O   1 
ATOM   4819  C CB  . SER B 1 264 ? -17.755 -6.550  30.792  1.00 106.37 ? 275  SER B CB  1 
ATOM   4820  O OG  . SER B 1 264 ? -18.353 -5.363  30.306  1.00 106.37 ? 275  SER B OG  1 
ATOM   4821  N N   . SER B 1 265 ? -18.168 -5.733  33.668  1.00 73.92  ? 276  SER B N   1 
ATOM   4822  C CA  . SER B 1 265 ? -18.538 -4.765  34.687  1.00 73.92  ? 276  SER B CA  1 
ATOM   4823  C C   . SER B 1 265 ? -17.374 -3.905  35.146  1.00 73.92  ? 276  SER B C   1 
ATOM   4824  O O   . SER B 1 265 ? -16.215 -4.210  34.868  1.00 73.92  ? 276  SER B O   1 
ATOM   4825  C CB  . SER B 1 265 ? -19.131 -5.483  35.893  1.00 66.34  ? 276  SER B CB  1 
ATOM   4826  O OG  . SER B 1 265 ? -18.142 -6.265  36.531  1.00 66.34  ? 276  SER B OG  1 
ATOM   4827  N N   . ASP B 1 266 ? -17.705 -2.836  35.868  1.00 73.02  ? 277  ASP B N   1 
ATOM   4828  C CA  . ASP B 1 266 ? -16.725 -1.887  36.388  1.00 73.02  ? 277  ASP B CA  1 
ATOM   4829  C C   . ASP B 1 266 ? -16.460 -2.185  37.864  1.00 73.02  ? 277  ASP B C   1 
ATOM   4830  O O   . ASP B 1 266 ? -17.024 -3.132  38.407  1.00 73.02  ? 277  ASP B O   1 
ATOM   4831  C CB  . ASP B 1 266 ? -17.265 -0.464  36.213  1.00 166.68 ? 277  ASP B CB  1 
ATOM   4832  C CG  . ASP B 1 266 ? -17.745 -0.191  34.789  1.00 166.68 ? 277  ASP B CG  1 
ATOM   4833  O OD1 . ASP B 1 266 ? -18.278 0.911   34.540  1.00 166.68 ? 277  ASP B OD1 1 
ATOM   4834  O OD2 . ASP B 1 266 ? -17.592 -1.076  33.917  1.00 166.68 ? 277  ASP B OD2 1 
ATOM   4835  N N   . CYS B 1 267 ? -15.589 -1.392  38.491  1.00 61.21  ? 278  CYS B N   1 
ATOM   4836  C CA  . CYS B 1 267 ? -15.237 -1.538  39.913  1.00 61.21  ? 278  CYS B CA  1 
ATOM   4837  C C   . CYS B 1 267 ? -13.823 -1.025  40.172  1.00 61.21  ? 278  CYS B C   1 
ATOM   4838  O O   . CYS B 1 267 ? -13.060 -0.831  39.226  1.00 61.21  ? 278  CYS B O   1 
ATOM   4839  C CB  . CYS B 1 267 ? -15.332 -3.000  40.371  1.00 93.41  ? 278  CYS B CB  1 
ATOM   4840  S SG  . CYS B 1 267 ? -14.096 -4.091  39.664  1.00 93.41  ? 278  CYS B SG  1 
ATOM   4841  N N   . GLN B 1 268 ? -13.469 -0.835  41.448  1.00 155.38 ? 279  GLN B N   1 
ATOM   4842  C CA  . GLN B 1 268 ? -12.142 -0.315  41.796  1.00 155.38 ? 279  GLN B CA  1 
ATOM   4843  C C   . GLN B 1 268 ? -11.670 -0.416  43.258  1.00 155.38 ? 279  GLN B C   1 
ATOM   4844  O O   . GLN B 1 268 ? -12.467 -0.624  44.175  1.00 155.38 ? 279  GLN B O   1 
ATOM   4845  C CB  . GLN B 1 268 ? -12.068 1.144   41.357  1.00 103.78 ? 279  GLN B CB  1 
ATOM   4846  C CG  . GLN B 1 268 ? -13.204 1.988   41.890  1.00 103.78 ? 279  GLN B CG  1 
ATOM   4847  C CD  . GLN B 1 268 ? -13.406 3.244   41.077  1.00 103.78 ? 279  GLN B CD  1 
ATOM   4848  O OE1 . GLN B 1 268 ? -12.478 4.031   40.900  1.00 103.78 ? 279  GLN B OE1 1 
ATOM   4849  N NE2 . GLN B 1 268 ? -14.622 3.440   40.572  1.00 103.78 ? 279  GLN B NE2 1 
ATOM   4850  N N   . ASP B 1 269 ? -10.356 -0.253  43.441  1.00 94.71  ? 280  ASP B N   1 
ATOM   4851  C CA  . ASP B 1 269 ? -9.675  -0.285  44.742  1.00 94.71  ? 280  ASP B CA  1 
ATOM   4852  C C   . ASP B 1 269 ? -9.642  -1.651  45.428  1.00 94.71  ? 280  ASP B C   1 
ATOM   4853  O O   . ASP B 1 269 ? -10.451 -1.939  46.311  1.00 94.71  ? 280  ASP B O   1 
ATOM   4854  C CB  . ASP B 1 269 ? -10.286 0.762   45.687  1.00 119.34 ? 280  ASP B CB  1 
ATOM   4855  C CG  . ASP B 1 269 ? -9.355  1.127   46.843  1.00 119.34 ? 280  ASP B CG  1 
ATOM   4856  O OD1 . ASP B 1 269 ? -9.148  0.292   47.749  1.00 119.34 ? 280  ASP B OD1 1 
ATOM   4857  O OD2 . ASP B 1 269 ? -8.820  2.256   46.839  1.00 119.34 ? 280  ASP B OD2 1 
ATOM   4858  N N   . GLU B 1 270 ? -8.683  -2.480  45.018  1.00 106.43 ? 281  GLU B N   1 
ATOM   4859  C CA  . GLU B 1 270 ? -8.504  -3.831  45.563  1.00 106.43 ? 281  GLU B CA  1 
ATOM   4860  C C   . GLU B 1 270 ? -7.012  -4.160  45.649  1.00 106.43 ? 281  GLU B C   1 
ATOM   4861  O O   . GLU B 1 270 ? -6.608  -5.147  46.271  1.00 106.43 ? 281  GLU B O   1 
ATOM   4862  C CB  . GLU B 1 270 ? -9.245  -4.845  44.677  1.00 95.36  ? 281  GLU B CB  1 
ATOM   4863  C CG  . GLU B 1 270 ? -8.815  -6.303  44.800  1.00 95.36  ? 281  GLU B CG  1 
ATOM   4864  C CD  . GLU B 1 270 ? -7.696  -6.655  43.839  1.00 95.36  ? 281  GLU B CD  1 
ATOM   4865  O OE1 . GLU B 1 270 ? -7.462  -7.859  43.603  1.00 95.36  ? 281  GLU B OE1 1 
ATOM   4866  O OE2 . GLU B 1 270 ? -7.049  -5.721  43.320  1.00 95.36  ? 281  GLU B OE2 1 
ATOM   4867  N N   . GLU B 1 271 ? -6.216  -3.297  45.021  1.00 89.85  ? 282  GLU B N   1 
ATOM   4868  C CA  . GLU B 1 271 ? -4.757  -3.384  44.973  1.00 89.85  ? 282  GLU B CA  1 
ATOM   4869  C C   . GLU B 1 271 ? -4.301  -2.283  44.017  1.00 89.85  ? 282  GLU B C   1 
ATOM   4870  O O   . GLU B 1 271 ? -3.192  -2.300  43.488  1.00 89.85  ? 282  GLU B O   1 
ATOM   4871  C CB  . GLU B 1 271 ? -4.312  -4.767  44.480  1.00 148.65 ? 282  GLU B CB  1 
ATOM   4872  C CG  . GLU B 1 271 ? -3.957  -5.738  45.609  1.00 148.65 ? 282  GLU B CG  1 
ATOM   4873  C CD  . GLU B 1 271 ? -3.899  -7.186  45.158  1.00 148.65 ? 282  GLU B CD  1 
ATOM   4874  O OE1 . GLU B 1 271 ? -3.194  -7.486  44.172  1.00 148.65 ? 282  GLU B OE1 1 
ATOM   4875  O OE2 . GLU B 1 271 ? -4.558  -8.031  45.798  1.00 148.65 ? 282  GLU B OE2 1 
ATOM   4876  N N   . GLY B 1 272 ? -5.195  -1.318  43.832  1.00 68.87  ? 283  GLY B N   1 
ATOM   4877  C CA  . GLY B 1 272 ? -4.976  -0.182  42.954  1.00 68.87  ? 283  GLY B CA  1 
ATOM   4878  C C   . GLY B 1 272 ? -6.362  0.353   42.616  1.00 68.87  ? 283  GLY B C   1 
ATOM   4879  O O   . GLY B 1 272 ? -7.348  -0.001  43.265  1.00 68.87  ? 283  GLY B O   1 
ATOM   4880  N N   . ARG B 1 273 ? -6.471  1.204   41.610  1.00 109.49 ? 284  ARG B N   1 
ATOM   4881  C CA  . ARG B 1 273 ? -7.783  1.719   41.254  1.00 109.49 ? 284  ARG B CA  1 
ATOM   4882  C C   . ARG B 1 273 ? -8.056  1.490   39.775  1.00 109.49 ? 284  ARG B C   1 
ATOM   4883  O O   . ARG B 1 273 ? -7.228  1.831   38.929  1.00 109.49 ? 284  ARG B O   1 
ATOM   4884  C CB  . ARG B 1 273 ? -7.878  3.214   41.586  1.00 165.71 ? 284  ARG B CB  1 
ATOM   4885  C CG  . ARG B 1 273 ? -6.740  4.055   41.012  1.00 165.71 ? 284  ARG B CG  1 
ATOM   4886  C CD  . ARG B 1 273 ? -6.930  5.550   41.269  1.00 165.71 ? 284  ARG B CD  1 
ATOM   4887  N NE  . ARG B 1 273 ? -8.046  6.110   40.508  1.00 165.71 ? 284  ARG B NE  1 
ATOM   4888  C CZ  . ARG B 1 273 ? -8.391  7.394   40.520  1.00 165.71 ? 284  ARG B CZ  1 
ATOM   4889  N NH1 . ARG B 1 273 ? -7.705  8.258   41.257  1.00 165.71 ? 284  ARG B NH1 1 
ATOM   4890  N NH2 . ARG B 1 273 ? -9.421  7.816   39.797  1.00 165.71 ? 284  ARG B NH2 1 
ATOM   4891  N N   . LYS B 1 274 ? -9.208  0.889   39.482  1.00 79.68  ? 285  LYS B N   1 
ATOM   4892  C CA  . LYS B 1 274 ? -9.656  0.619   38.112  1.00 79.68  ? 285  LYS B CA  1 
ATOM   4893  C C   . LYS B 1 274 ? -9.577  -0.857  37.727  1.00 79.68  ? 285  LYS B C   1 
ATOM   4894  O O   . LYS B 1 274 ? -8.492  -1.410  37.542  1.00 79.68  ? 285  LYS B O   1 
ATOM   4895  C CB  . LYS B 1 274 ? -8.860  1.460   37.094  1.00 168.05 ? 285  LYS B CB  1 
ATOM   4896  C CG  . LYS B 1 274 ? -9.645  1.935   35.867  1.00 168.05 ? 285  LYS B CG  1 
ATOM   4897  C CD  . LYS B 1 274 ? -10.573 3.107   36.189  1.00 168.05 ? 285  LYS B CD  1 
ATOM   4898  C CE  . LYS B 1 274 ? -11.261 3.634   34.932  1.00 168.05 ? 285  LYS B CE  1 
ATOM   4899  N NZ  . LYS B 1 274 ? -12.149 4.801   35.204  1.00 168.05 ? 285  LYS B NZ  1 
ATOM   4900  N N   . GLY B 1 275 ? -10.743 -1.483  37.599  1.00 98.05  ? 286  GLY B N   1 
ATOM   4901  C CA  . GLY B 1 275 ? -10.790 -2.882  37.226  1.00 98.05  ? 286  GLY B CA  1 
ATOM   4902  C C   . GLY B 1 275 ? -12.172 -3.361  36.824  1.00 98.05  ? 286  GLY B C   1 
ATOM   4903  O O   . GLY B 1 275 ? -13.174 -2.829  37.304  1.00 98.05  ? 286  GLY B O   1 
ATOM   4904  N N   . ASN B 1 276 ? -12.215 -4.366  35.944  1.00 53.64  ? 287  ASN B N   1 
ATOM   4905  C CA  . ASN B 1 276 ? -13.465 -4.958  35.461  1.00 53.64  ? 287  ASN B CA  1 
ATOM   4906  C C   . ASN B 1 276 ? -13.601 -6.440  35.846  1.00 53.64  ? 287  ASN B C   1 
ATOM   4907  O O   . ASN B 1 276 ? -12.685 -7.050  36.391  1.00 53.64  ? 287  ASN B O   1 
ATOM   4908  C CB  . ASN B 1 276 ? -13.541 -4.853  33.941  1.00 77.14  ? 287  ASN B CB  1 
ATOM   4909  C CG  . ASN B 1 276 ? -13.082 -3.521  33.434  1.00 77.14  ? 287  ASN B CG  1 
ATOM   4910  O OD1 . ASN B 1 276 ? -13.727 -2.502  33.662  1.00 77.14  ? 287  ASN B OD1 1 
ATOM   4911  N ND2 . ASN B 1 276 ? -11.949 -3.515  32.743  1.00 77.14  ? 287  ASN B ND2 1 
ATOM   4912  N N   . LYS B 1 277 ? -14.754 -7.016  35.538  1.00 43.54  ? 288  LYS B N   1 
ATOM   4913  C CA  . LYS B 1 277 ? -15.008 -8.415  35.829  1.00 43.54  ? 288  LYS B CA  1 
ATOM   4914  C C   . LYS B 1 277 ? -15.875 -9.015  34.718  1.00 43.54  ? 288  LYS B C   1 
ATOM   4915  O O   . LYS B 1 277 ? -16.795 -8.374  34.224  1.00 43.54  ? 288  LYS B O   1 
ATOM   4916  C CB  . LYS B 1 277 ? -15.723 -8.554  37.177  1.00 83.69  ? 288  LYS B CB  1 
ATOM   4917  C CG  . LYS B 1 277 ? -14.881 -8.230  38.398  1.00 83.69  ? 288  LYS B CG  1 
ATOM   4918  C CD  . LYS B 1 277 ? -15.692 -8.448  39.670  1.00 83.69  ? 288  LYS B CD  1 
ATOM   4919  C CE  . LYS B 1 277 ? -14.811 -8.509  40.921  1.00 83.69  ? 288  LYS B CE  1 
ATOM   4920  N NZ  . LYS B 1 277 ? -14.080 -7.239  41.230  1.00 83.69  ? 288  LYS B NZ  1 
ATOM   4921  N N   . LEU B 1 278 ? -15.577 -10.240 34.316  1.00 47.86  ? 289  LEU B N   1 
ATOM   4922  C CA  . LEU B 1 278 ? -16.354 -10.898 33.276  1.00 47.86  ? 289  LEU B CA  1 
ATOM   4923  C C   . LEU B 1 278 ? -17.255 -11.901 33.954  1.00 47.86  ? 289  LEU B C   1 
ATOM   4924  O O   . LEU B 1 278 ? -16.812 -12.656 34.805  1.00 47.86  ? 289  LEU B O   1 
ATOM   4925  C CB  . LEU B 1 278 ? -15.437 -11.604 32.270  1.00 35.44  ? 289  LEU B CB  1 
ATOM   4926  C CG  . LEU B 1 278 ? -14.804 -10.712 31.203  1.00 35.44  ? 289  LEU B CG  1 
ATOM   4927  C CD1 . LEU B 1 278 ? -15.907 -9.969  30.498  1.00 35.44  ? 289  LEU B CD1 1 
ATOM   4928  C CD2 . LEU B 1 278 ? -13.832 -9.730  31.826  1.00 35.44  ? 289  LEU B CD2 1 
ATOM   4929  N N   . TYR B 1 279 ? -18.520 -11.917 33.573  1.00 59.79  ? 290  TYR B N   1 
ATOM   4930  C CA  . TYR B 1 279 ? -19.466 -12.822 34.198  1.00 59.79  ? 290  TYR B CA  1 
ATOM   4931  C C   . TYR B 1 279 ? -20.140 -13.746 33.198  1.00 59.79  ? 290  TYR B C   1 
ATOM   4932  O O   . TYR B 1 279 ? -20.217 -13.433 32.007  1.00 59.79  ? 290  TYR B O   1 
ATOM   4933  C CB  . TYR B 1 279 ? -20.550 -12.005 34.921  1.00 54.39  ? 290  TYR B CB  1 
ATOM   4934  C CG  . TYR B 1 279 ? -20.063 -11.228 36.129  1.00 54.39  ? 290  TYR B CG  1 
ATOM   4935  C CD1 . TYR B 1 279 ? -20.187 -11.756 37.408  1.00 54.39  ? 290  TYR B CD1 1 
ATOM   4936  C CD2 . TYR B 1 279 ? -19.430 -9.997  35.987  1.00 54.39  ? 290  TYR B CD2 1 
ATOM   4937  C CE1 . TYR B 1 279 ? -19.691 -11.094 38.509  1.00 54.39  ? 290  TYR B CE1 1 
ATOM   4938  C CE2 . TYR B 1 279 ? -18.926 -9.327  37.089  1.00 54.39  ? 290  TYR B CE2 1 
ATOM   4939  C CZ  . TYR B 1 279 ? -19.056 -9.887  38.348  1.00 54.39  ? 290  TYR B CZ  1 
ATOM   4940  O OH  . TYR B 1 279 ? -18.502 -9.275  39.451  1.00 54.39  ? 290  TYR B OH  1 
ATOM   4941  N N   . TYR B 1 280 ? -20.612 -14.893 33.681  1.00 64.54  ? 291  TYR B N   1 
ATOM   4942  C CA  . TYR B 1 280 ? -21.360 -15.803 32.827  1.00 64.54  ? 291  TYR B CA  1 
ATOM   4943  C C   . TYR B 1 280 ? -22.674 -16.185 33.515  1.00 64.54  ? 291  TYR B C   1 
ATOM   4944  O O   . TYR B 1 280 ? -22.681 -16.648 34.660  1.00 64.54  ? 291  TYR B O   1 
ATOM   4945  C CB  . TYR B 1 280 ? -20.597 -17.070 32.494  1.00 63.05  ? 291  TYR B CB  1 
ATOM   4946  C CG  . TYR B 1 280 ? -21.494 -17.993 31.720  1.00 63.05  ? 291  TYR B CG  1 
ATOM   4947  C CD1 . TYR B 1 280 ? -22.080 -17.567 30.538  1.00 63.05  ? 291  TYR B CD1 1 
ATOM   4948  C CD2 . TYR B 1 280 ? -21.867 -19.231 32.231  1.00 63.05  ? 291  TYR B CD2 1 
ATOM   4949  C CE1 . TYR B 1 280 ? -23.024 -18.335 29.888  1.00 63.05  ? 291  TYR B CE1 1 
ATOM   4950  C CE2 . TYR B 1 280 ? -22.819 -20.015 31.585  1.00 63.05  ? 291  TYR B CE2 1 
ATOM   4951  C CZ  . TYR B 1 280 ? -23.398 -19.554 30.413  1.00 63.05  ? 291  TYR B CZ  1 
ATOM   4952  O OH  . TYR B 1 280 ? -24.380 -20.293 29.783  1.00 63.05  ? 291  TYR B OH  1 
ATOM   4953  N N   . ASN B 1 281 ? -23.779 -15.997 32.793  1.00 77.56  ? 292  ASN B N   1 
ATOM   4954  C CA  . ASN B 1 281 ? -25.123 -16.274 33.303  1.00 77.56  ? 292  ASN B CA  1 
ATOM   4955  C C   . ASN B 1 281 ? -25.503 -17.754 33.392  1.00 77.56  ? 292  ASN B C   1 
ATOM   4956  O O   . ASN B 1 281 ? -26.034 -18.342 32.444  1.00 77.56  ? 292  ASN B O   1 
ATOM   4957  C CB  . ASN B 1 281 ? -26.160 -15.530 32.448  1.00 138.10 ? 292  ASN B CB  1 
ATOM   4958  C CG  . ASN B 1 281 ? -27.285 -14.927 33.277  1.00 138.10 ? 292  ASN B CG  1 
ATOM   4959  O OD1 . ASN B 1 281 ? -28.008 -15.636 33.977  1.00 138.10 ? 292  ASN B OD1 1 
ATOM   4960  N ND2 . ASN B 1 281 ? -27.435 -13.607 33.198  1.00 138.10 ? 292  ASN B ND2 1 
ATOM   4961  N N   . PHE B 1 282 ? -25.216 -18.352 34.541  1.00 90.33  ? 293  PHE B N   1 
ATOM   4962  C CA  . PHE B 1 282 ? -25.562 -19.744 34.777  1.00 90.33  ? 293  PHE B CA  1 
ATOM   4963  C C   . PHE B 1 282 ? -27.070 -19.709 34.960  1.00 90.33  ? 293  PHE B C   1 
ATOM   4964  O O   . PHE B 1 282 ? -27.602 -18.740 35.494  1.00 90.33  ? 293  PHE B O   1 
ATOM   4965  C CB  . PHE B 1 282 ? -24.876 -20.263 36.051  1.00 81.05  ? 293  PHE B CB  1 
ATOM   4966  C CG  . PHE B 1 282 ? -23.421 -20.642 35.856  1.00 81.05  ? 293  PHE B CG  1 
ATOM   4967  C CD1 . PHE B 1 282 ? -23.077 -21.878 35.330  1.00 81.05  ? 293  PHE B CD1 1 
ATOM   4968  C CD2 . PHE B 1 282 ? -22.400 -19.756 36.190  1.00 81.05  ? 293  PHE B CD2 1 
ATOM   4969  C CE1 . PHE B 1 282 ? -21.748 -22.224 35.145  1.00 81.05  ? 293  PHE B CE1 1 
ATOM   4970  C CE2 . PHE B 1 282 ? -21.070 -20.096 36.006  1.00 81.05  ? 293  PHE B CE2 1 
ATOM   4971  C CZ  . PHE B 1 282 ? -20.745 -21.331 35.483  1.00 81.05  ? 293  PHE B CZ  1 
ATOM   4972  N N   . PRO B 1 283 ? -27.783 -20.752 34.499  1.00 150.47 ? 294  PRO B N   1 
ATOM   4973  C CA  . PRO B 1 283 ? -29.243 -20.827 34.619  1.00 150.47 ? 294  PRO B CA  1 
ATOM   4974  C C   . PRO B 1 283 ? -29.799 -20.426 35.983  1.00 150.47 ? 294  PRO B C   1 
ATOM   4975  O O   . PRO B 1 283 ? -31.006 -20.483 36.204  1.00 150.47 ? 294  PRO B O   1 
ATOM   4976  C CB  . PRO B 1 283 ? -29.531 -22.281 34.278  1.00 125.80 ? 294  PRO B CB  1 
ATOM   4977  C CG  . PRO B 1 283 ? -28.523 -22.550 33.207  1.00 125.80 ? 294  PRO B CG  1 
ATOM   4978  C CD  . PRO B 1 283 ? -27.261 -21.929 33.778  1.00 125.80 ? 294  PRO B CD  1 
ATOM   4979  N N   . TRP B 1 284 ? -28.916 -20.017 36.888  1.00 76.57  ? 295  TRP B N   1 
ATOM   4980  C CA  . TRP B 1 284 ? -29.316 -19.604 38.227  1.00 76.57  ? 295  TRP B CA  1 
ATOM   4981  C C   . TRP B 1 284 ? -28.732 -18.233 38.617  1.00 76.57  ? 295  TRP B C   1 
ATOM   4982  O O   . TRP B 1 284 ? -28.804 -17.827 39.783  1.00 76.57  ? 295  TRP B O   1 
ATOM   4983  C CB  . TRP B 1 284 ? -28.888 -20.675 39.244  1.00 74.95  ? 295  TRP B CB  1 
ATOM   4984  C CG  . TRP B 1 284 ? -27.402 -20.745 39.478  1.00 74.95  ? 295  TRP B CG  1 
ATOM   4985  C CD1 . TRP B 1 284 ? -26.656 -19.900 40.240  1.00 74.95  ? 295  TRP B CD1 1 
ATOM   4986  C CD2 . TRP B 1 284 ? -26.486 -21.698 38.929  1.00 74.95  ? 295  TRP B CD2 1 
ATOM   4987  N NE1 . TRP B 1 284 ? -25.334 -20.263 40.200  1.00 74.95  ? 295  TRP B NE1 1 
ATOM   4988  C CE2 . TRP B 1 284 ? -25.202 -21.365 39.404  1.00 74.95  ? 295  TRP B CE2 1 
ATOM   4989  C CE3 . TRP B 1 284 ? -26.627 -22.801 38.083  1.00 74.95  ? 295  TRP B CE3 1 
ATOM   4990  C CZ2 . TRP B 1 284 ? -24.066 -22.093 39.066  1.00 74.95  ? 295  TRP B CZ2 1 
ATOM   4991  C CZ3 . TRP B 1 284 ? -25.492 -23.527 37.744  1.00 74.95  ? 295  TRP B CZ3 1 
ATOM   4992  C CH2 . TRP B 1 284 ? -24.228 -23.167 38.238  1.00 74.95  ? 295  TRP B CH2 1 
ATOM   4993  N N   . GLY B 1 285 ? -28.151 -17.524 37.649  1.00 76.34  ? 296  GLY B N   1 
ATOM   4994  C CA  . GLY B 1 285 ? -27.580 -16.215 37.937  1.00 76.34  ? 296  GLY B CA  1 
ATOM   4995  C C   . GLY B 1 285 ? -26.073 -16.042 37.762  1.00 76.34  ? 296  GLY B C   1 
ATOM   4996  O O   . GLY B 1 285 ? -25.280 -16.916 38.101  1.00 76.34  ? 296  GLY B O   1 
ATOM   4997  N N   . LYS B 1 286 ? -25.691 -14.877 37.245  1.00 69.02  ? 297  LYS B N   1 
ATOM   4998  C CA  . LYS B 1 286 ? -24.300 -14.514 36.993  1.00 69.02  ? 297  LYS B CA  1 
ATOM   4999  C C   . LYS B 1 286 ? -23.283 -15.041 37.999  1.00 69.02  ? 297  LYS B C   1 
ATOM   5000  O O   . LYS B 1 286 ? -23.515 -15.038 39.205  1.00 69.02  ? 297  LYS B O   1 
ATOM   5001  C CB  . LYS B 1 286 ? -24.173 -12.990 36.898  1.00 78.85  ? 297  LYS B CB  1 
ATOM   5002  C CG  . LYS B 1 286 ? -24.976 -12.386 35.765  1.00 78.85  ? 297  LYS B CG  1 
ATOM   5003  C CD  . LYS B 1 286 ? -25.020 -10.870 35.859  1.00 78.85  ? 297  LYS B CD  1 
ATOM   5004  C CE  . LYS B 1 286 ? -25.941 -10.283 34.784  1.00 78.85  ? 297  LYS B CE  1 
ATOM   5005  N NZ  . LYS B 1 286 ? -26.126 -8.805  34.917  1.00 78.85  ? 297  LYS B NZ  1 
ATOM   5006  N N   . GLU B 1 287 ? -22.149 -15.486 37.464  1.00 88.65  ? 298  GLU B N   1 
ATOM   5007  C CA  . GLU B 1 287 ? -21.046 -16.018 38.247  1.00 88.65  ? 298  GLU B CA  1 
ATOM   5008  C C   . GLU B 1 287 ? -19.755 -15.538 37.578  1.00 88.65  ? 298  GLU B C   1 
ATOM   5009  O O   . GLU B 1 287 ? -19.641 -15.548 36.354  1.00 88.65  ? 298  GLU B O   1 
ATOM   5010  C CB  . GLU B 1 287 ? -21.096 -17.545 38.255  1.00 55.58  ? 298  GLU B CB  1 
ATOM   5011  C CG  . GLU B 1 287 ? -20.499 -18.160 39.499  1.00 55.58  ? 298  GLU B CG  1 
ATOM   5012  C CD  . GLU B 1 287 ? -21.416 -18.035 40.699  1.00 55.58  ? 298  GLU B CD  1 
ATOM   5013  O OE1 . GLU B 1 287 ? -20.915 -17.944 41.846  1.00 55.58  ? 298  GLU B OE1 1 
ATOM   5014  O OE2 . GLU B 1 287 ? -22.645 -18.041 40.481  1.00 55.58  ? 298  GLU B OE2 1 
ATOM   5015  N N   . LEU B 1 288 ? -18.789 -15.120 38.386  1.00 57.29  ? 299  LEU B N   1 
ATOM   5016  C CA  . LEU B 1 288 ? -17.512 -14.601 37.903  1.00 57.29  ? 299  LEU B CA  1 
ATOM   5017  C C   . LEU B 1 288 ? -16.666 -15.632 37.165  1.00 57.29  ? 299  LEU B C   1 
ATOM   5018  O O   . LEU B 1 288 ? -16.639 -16.791 37.568  1.00 57.29  ? 299  LEU B O   1 
ATOM   5019  C CB  . LEU B 1 288 ? -16.710 -14.093 39.090  1.00 29.64  ? 299  LEU B CB  1 
ATOM   5020  C CG  . LEU B 1 288 ? -16.003 -12.741 39.019  1.00 29.64  ? 299  LEU B CG  1 
ATOM   5021  C CD1 . LEU B 1 288 ? -14.745 -12.799 39.893  1.00 29.64  ? 299  LEU B CD1 1 
ATOM   5022  C CD2 . LEU B 1 288 ? -15.630 -12.410 37.582  1.00 29.64  ? 299  LEU B CD2 1 
ATOM   5023  N N   . ILE B 1 289 ? -15.978 -15.221 36.096  1.00 51.25  ? 300  ILE B N   1 
ATOM   5024  C CA  . ILE B 1 289 ? -15.099 -16.137 35.357  1.00 51.25  ? 300  ILE B CA  1 
ATOM   5025  C C   . ILE B 1 289 ? -13.757 -15.505 35.041  1.00 51.25  ? 300  ILE B C   1 
ATOM   5026  O O   . ILE B 1 289 ? -12.752 -16.206 34.943  1.00 51.25  ? 300  ILE B O   1 
ATOM   5027  C CB  . ILE B 1 289 ? -15.692 -16.662 34.007  1.00 34.89  ? 300  ILE B CB  1 
ATOM   5028  C CG1 . ILE B 1 289 ? -16.046 -15.492 33.081  1.00 34.89  ? 300  ILE B CG1 1 
ATOM   5029  C CG2 . ILE B 1 289 ? -16.864 -17.571 34.277  1.00 34.89  ? 300  ILE B CG2 1 
ATOM   5030  C CD1 . ILE B 1 289 ? -16.601 -15.914 31.713  1.00 34.89  ? 300  ILE B CD1 1 
ATOM   5031  N N   . GLU B 1 290 ? -13.720 -14.190 34.869  1.00 49.94  ? 301  GLU B N   1 
ATOM   5032  C CA  . GLU B 1 290 ? -12.449 -13.533 34.580  1.00 49.94  ? 301  GLU B CA  1 
ATOM   5033  C C   . GLU B 1 290 ? -12.420 -12.133 35.143  1.00 49.94  ? 301  GLU B C   1 
ATOM   5034  O O   . GLU B 1 290 ? -13.389 -11.409 35.047  1.00 49.94  ? 301  GLU B O   1 
ATOM   5035  C CB  . GLU B 1 290 ? -12.193 -13.502 33.069  1.00 91.44  ? 301  GLU B CB  1 
ATOM   5036  C CG  . GLU B 1 290 ? -10.825 -12.944 32.679  1.00 91.44  ? 301  GLU B CG  1 
ATOM   5037  C CD  . GLU B 1 290 ? -10.391 -13.369 31.287  1.00 91.44  ? 301  GLU B CD  1 
ATOM   5038  O OE1 . GLU B 1 290 ? -11.231 -13.325 30.367  1.00 91.44  ? 301  GLU B OE1 1 
ATOM   5039  O OE2 . GLU B 1 290 ? -9.209  -13.739 31.110  1.00 91.44  ? 301  GLU B OE2 1 
ATOM   5040  N N   . THR B 1 291 ? -11.297 -11.751 35.728  1.00 43.38  ? 302  THR B N   1 
ATOM   5041  C CA  . THR B 1 291 ? -11.158 -10.431 36.335  1.00 43.38  ? 302  THR B CA  1 
ATOM   5042  C C   . THR B 1 291 ? -9.986  -9.650  35.744  1.00 43.38  ? 302  THR B C   1 
ATOM   5043  O O   . THR B 1 291 ? -8.970  -10.242 35.384  1.00 43.38  ? 302  THR B O   1 
ATOM   5044  C CB  . THR B 1 291 ? -10.919 -10.567 37.857  1.00 46.69  ? 302  THR B CB  1 
ATOM   5045  O OG1 . THR B 1 291 ? -9.594  -11.068 38.101  1.00 46.69  ? 302  THR B OG1 1 
ATOM   5046  C CG2 . THR B 1 291 ? -11.910 -11.540 38.452  1.00 46.69  ? 302  THR B CG2 1 
ATOM   5047  N N   . LEU B 1 292 ? -10.124 -8.327  35.648  1.00 57.28  ? 303  LEU B N   1 
ATOM   5048  C CA  . LEU B 1 292 ? -9.046  -7.472  35.137  1.00 57.28  ? 303  LEU B CA  1 
ATOM   5049  C C   . LEU B 1 292 ? -8.717  -6.411  36.180  1.00 57.28  ? 303  LEU B C   1 
ATOM   5050  O O   . LEU B 1 292 ? -9.571  -6.048  36.974  1.00 57.28  ? 303  LEU B O   1 
ATOM   5051  C CB  . LEU B 1 292 ? -9.451  -6.817  33.814  1.00 62.93  ? 303  LEU B CB  1 
ATOM   5052  C CG  . LEU B 1 292 ? -9.655  -7.839  32.686  1.00 62.93  ? 303  LEU B CG  1 
ATOM   5053  C CD1 . LEU B 1 292 ? -11.127 -8.221  32.616  1.00 62.93  ? 303  LEU B CD1 1 
ATOM   5054  C CD2 . LEU B 1 292 ? -9.186  -7.275  31.356  1.00 62.93  ? 303  LEU B CD2 1 
ATOM   5055  N N   . TRP B 1 293 ? -7.483  -5.923  36.198  1.00 36.94  ? 304  TRP B N   1 
ATOM   5056  C CA  . TRP B 1 293 ? -7.088  -4.918  37.188  1.00 36.94  ? 304  TRP B CA  1 
ATOM   5057  C C   . TRP B 1 293 ? -5.865  -4.146  36.761  1.00 36.94  ? 304  TRP B C   1 
ATOM   5058  O O   . TRP B 1 293 ? -4.952  -4.712  36.157  1.00 36.94  ? 304  TRP B O   1 
ATOM   5059  C CB  . TRP B 1 293 ? -6.730  -5.567  38.531  1.00 53.09  ? 304  TRP B CB  1 
ATOM   5060  C CG  . TRP B 1 293 ? -7.870  -5.970  39.370  1.00 53.09  ? 304  TRP B CG  1 
ATOM   5061  C CD1 . TRP B 1 293 ? -8.238  -7.241  39.711  1.00 53.09  ? 304  TRP B CD1 1 
ATOM   5062  C CD2 . TRP B 1 293 ? -8.800  -5.103  39.996  1.00 53.09  ? 304  TRP B CD2 1 
ATOM   5063  N NE1 . TRP B 1 293 ? -9.346  -7.217  40.515  1.00 53.09  ? 304  TRP B NE1 1 
ATOM   5064  C CE2 . TRP B 1 293 ? -9.715  -5.914  40.707  1.00 53.09  ? 304  TRP B CE2 1 
ATOM   5065  C CE3 . TRP B 1 293 ? -8.955  -3.713  40.030  1.00 53.09  ? 304  TRP B CE3 1 
ATOM   5066  C CZ2 . TRP B 1 293 ? -10.768 -5.380  41.440  1.00 53.09  ? 304  TRP B CZ2 1 
ATOM   5067  C CZ3 . TRP B 1 293 ? -10.001 -3.177  40.760  1.00 53.09  ? 304  TRP B CZ3 1 
ATOM   5068  C CH2 . TRP B 1 293 ? -10.896 -4.012  41.457  1.00 53.09  ? 304  TRP B CH2 1 
ATOM   5069  N N   . ASN B 1 294 ? -5.833  -2.862  37.115  1.00 89.61  ? 305  ASN B N   1 
ATOM   5070  C CA  . ASN B 1 294 ? -4.679  -2.010  36.830  1.00 89.61  ? 305  ASN B CA  1 
ATOM   5071  C C   . ASN B 1 294 ? -4.057  -1.703  38.184  1.00 89.61  ? 305  ASN B C   1 
ATOM   5072  O O   . ASN B 1 294 ? -4.397  -0.709  38.816  1.00 89.61  ? 305  ASN B O   1 
ATOM   5073  C CB  . ASN B 1 294 ? -5.094  -0.697  36.166  1.00 71.47  ? 305  ASN B CB  1 
ATOM   5074  C CG  . ASN B 1 294 ? -3.902  0.089   35.646  1.00 71.47  ? 305  ASN B CG  1 
ATOM   5075  O OD1 . ASN B 1 294 ? -2.887  0.237   36.329  1.00 71.47  ? 305  ASN B OD1 1 
ATOM   5076  N ND2 . ASN B 1 294 ? -4.024  0.600   34.433  1.00 71.47  ? 305  ASN B ND2 1 
ATOM   5077  N N   . LEU B 1 295 ? -3.149  -2.564  38.627  1.00 43.76  ? 306  LEU B N   1 
ATOM   5078  C CA  . LEU B 1 295 ? -2.506  -2.399  39.926  1.00 43.76  ? 306  LEU B CA  1 
ATOM   5079  C C   . LEU B 1 295 ? -1.601  -1.174  40.026  1.00 43.76  ? 306  LEU B C   1 
ATOM   5080  O O   . LEU B 1 295 ? -1.376  -0.654  41.116  1.00 43.76  ? 306  LEU B O   1 
ATOM   5081  C CB  . LEU B 1 295 ? -1.682  -3.640  40.269  1.00 34.31  ? 306  LEU B CB  1 
ATOM   5082  C CG  . LEU B 1 295 ? -2.305  -5.014  40.021  1.00 34.31  ? 306  LEU B CG  1 
ATOM   5083  C CD1 . LEU B 1 295 ? -1.228  -6.109  40.166  1.00 34.31  ? 306  LEU B CD1 1 
ATOM   5084  C CD2 . LEU B 1 295 ? -3.456  -5.227  40.986  1.00 34.31  ? 306  LEU B CD2 1 
ATOM   5085  N N   . GLY B 1 296 ? -1.089  -0.710  38.894  1.00 66.23  ? 307  GLY B N   1 
ATOM   5086  C CA  . GLY B 1 296 ? -0.190  0.424   38.925  1.00 66.23  ? 307  GLY B CA  1 
ATOM   5087  C C   . GLY B 1 296 ? 1.231   -0.055  39.193  1.00 66.23  ? 307  GLY B C   1 
ATOM   5088  O O   . GLY B 1 296 ? 1.562   -1.210  38.945  1.00 66.23  ? 307  GLY B O   1 
ATOM   5089  N N   . ASP B 1 297 ? 2.082   0.824   39.703  1.00 83.71  ? 308  ASP B N   1 
ATOM   5090  C CA  . ASP B 1 297 ? 3.457   0.445   39.976  1.00 83.71  ? 308  ASP B CA  1 
ATOM   5091  C C   . ASP B 1 297 ? 3.611   -0.146  41.369  1.00 83.71  ? 308  ASP B C   1 
ATOM   5092  O O   . ASP B 1 297 ? 4.667   -0.677  41.717  1.00 83.71  ? 308  ASP B O   1 
ATOM   5093  C CB  . ASP B 1 297 ? 4.382   1.657   39.803  1.00 154.42 ? 308  ASP B CB  1 
ATOM   5094  C CG  . ASP B 1 297 ? 3.870   2.897   40.514  1.00 154.42 ? 308  ASP B CG  1 
ATOM   5095  O OD1 . ASP B 1 297 ? 4.502   3.964   40.361  1.00 154.42 ? 308  ASP B OD1 1 
ATOM   5096  O OD2 . ASP B 1 297 ? 2.842   2.808   41.221  1.00 154.42 ? 308  ASP B OD2 1 
ATOM   5097  N N   . HIS B 1 298 ? 2.542   -0.079  42.151  1.00 102.01 ? 309  HIS B N   1 
ATOM   5098  C CA  . HIS B 1 298 ? 2.551   -0.581  43.520  1.00 102.01 ? 309  HIS B CA  1 
ATOM   5099  C C   . HIS B 1 298 ? 3.375   -1.841  43.813  1.00 102.01 ? 309  HIS B C   1 
ATOM   5100  O O   . HIS B 1 298 ? 4.531   -1.737  44.218  1.00 102.01 ? 309  HIS B O   1 
ATOM   5101  C CB  . HIS B 1 298 ? 1.110   -0.763  43.999  1.00 168.28 ? 309  HIS B CB  1 
ATOM   5102  C CG  . HIS B 1 298 ? 0.355   0.525   44.109  1.00 168.28 ? 309  HIS B CG  1 
ATOM   5103  N ND1 . HIS B 1 298 ? -0.982  0.582   44.439  1.00 168.28 ? 309  HIS B ND1 1 
ATOM   5104  C CD2 . HIS B 1 298 ? 0.753   1.808   43.931  1.00 168.28 ? 309  HIS B CD2 1 
ATOM   5105  C CE1 . HIS B 1 298 ? -1.375  1.843   44.458  1.00 168.28 ? 309  HIS B CE1 1 
ATOM   5106  N NE2 . HIS B 1 298 ? -0.341  2.607   44.153  1.00 168.28 ? 309  HIS B NE2 1 
ATOM   5107  N N   . GLU B 1 299 ? 2.800   -3.023  43.610  1.00 84.16  ? 310  GLU B N   1 
ATOM   5108  C CA  . GLU B 1 299 ? 3.518   -4.260  43.910  1.00 84.16  ? 310  GLU B CA  1 
ATOM   5109  C C   . GLU B 1 299 ? 4.850   -4.405  43.210  1.00 84.16  ? 310  GLU B C   1 
ATOM   5110  O O   . GLU B 1 299 ? 5.723   -5.140  43.680  1.00 84.16  ? 310  GLU B O   1 
ATOM   5111  C CB  . GLU B 1 299 ? 2.665   -5.482  43.588  1.00 71.03  ? 310  GLU B CB  1 
ATOM   5112  C CG  . GLU B 1 299 ? 1.332   -5.479  44.271  1.00 71.03  ? 310  GLU B CG  1 
ATOM   5113  C CD  . GLU B 1 299 ? 0.234   -5.070  43.332  1.00 71.03  ? 310  GLU B CD  1 
ATOM   5114  O OE1 . GLU B 1 299 ? 0.379   -4.038  42.634  1.00 71.03  ? 310  GLU B OE1 1 
ATOM   5115  O OE2 . GLU B 1 299 ? -0.779  -5.792  43.293  1.00 71.03  ? 310  GLU B OE2 1 
ATOM   5116  N N   . LEU B 1 300 ? 5.022   -3.720  42.088  1.00 48.03  ? 311  LEU B N   1 
ATOM   5117  C CA  . LEU B 1 300 ? 6.288   -3.844  41.397  1.00 48.03  ? 311  LEU B CA  1 
ATOM   5118  C C   . LEU B 1 300 ? 7.361   -3.268  42.286  1.00 48.03  ? 311  LEU B C   1 
ATOM   5119  O O   . LEU B 1 300 ? 8.389   -3.892  42.520  1.00 48.03  ? 311  LEU B O   1 
ATOM   5120  C CB  . LEU B 1 300 ? 6.258   -3.117  40.065  1.00 38.93  ? 311  LEU B CB  1 
ATOM   5121  C CG  . LEU B 1 300 ? 7.257   -3.675  39.054  1.00 38.93  ? 311  LEU B CG  1 
ATOM   5122  C CD1 . LEU B 1 300 ? 7.391   -5.164  39.236  1.00 38.93  ? 311  LEU B CD1 1 
ATOM   5123  C CD2 . LEU B 1 300 ? 6.770   -3.382  37.634  1.00 38.93  ? 311  LEU B CD2 1 
ATOM   5124  N N   . LEU B 1 301 ? 7.097   -2.081  42.812  1.00 53.59  ? 312  LEU B N   1 
ATOM   5125  C CA  . LEU B 1 301 ? 8.049   -1.414  43.688  1.00 53.59  ? 312  LEU B CA  1 
ATOM   5126  C C   . LEU B 1 301 ? 8.215   -2.162  45.009  1.00 53.59  ? 312  LEU B C   1 
ATOM   5127  O O   . LEU B 1 301 ? 9.333   -2.388  45.460  1.00 53.59  ? 312  LEU B O   1 
ATOM   5128  C CB  . LEU B 1 301 ? 7.598   0.035   43.939  1.00 43.33  ? 312  LEU B CB  1 
ATOM   5129  C CG  . LEU B 1 301 ? 7.515   0.931   42.691  1.00 43.33  ? 312  LEU B CG  1 
ATOM   5130  C CD1 . LEU B 1 301 ? 7.000   2.303   43.054  1.00 43.33  ? 312  LEU B CD1 1 
ATOM   5131  C CD2 . LEU B 1 301 ? 8.890   1.031   42.046  1.00 43.33  ? 312  LEU B CD2 1 
ATOM   5132  N N   . HIS B 1 302 ? 7.102   -2.553  45.617  1.00 65.51  ? 313  HIS B N   1 
ATOM   5133  C CA  . HIS B 1 302 ? 7.129   -3.266  46.884  1.00 65.51  ? 313  HIS B CA  1 
ATOM   5134  C C   . HIS B 1 302 ? 7.869   -4.594  46.772  1.00 65.51  ? 313  HIS B C   1 
ATOM   5135  O O   . HIS B 1 302 ? 8.469   -5.065  47.749  1.00 65.51  ? 313  HIS B O   1 
ATOM   5136  C CB  . HIS B 1 302 ? 5.703   -3.503  47.378  1.00 68.10  ? 313  HIS B CB  1 
ATOM   5137  C CG  . HIS B 1 302 ? 5.627   -4.246  48.674  1.00 68.10  ? 313  HIS B CG  1 
ATOM   5138  N ND1 . HIS B 1 302 ? 4.836   -3.830  49.722  1.00 68.10  ? 313  HIS B ND1 1 
ATOM   5139  C CD2 . HIS B 1 302 ? 6.221   -5.392  49.084  1.00 68.10  ? 313  HIS B CD2 1 
ATOM   5140  C CE1 . HIS B 1 302 ? 4.947   -4.688  50.721  1.00 68.10  ? 313  HIS B CE1 1 
ATOM   5141  N NE2 . HIS B 1 302 ? 5.782   -5.645  50.359  1.00 68.10  ? 313  HIS B NE2 1 
ATOM   5142  N N   . MET B 1 303 ? 7.835   -5.211  45.594  1.00 45.47  ? 314  MET B N   1 
ATOM   5143  C CA  . MET B 1 303 ? 8.536   -6.474  45.441  1.00 45.47  ? 314  MET B CA  1 
ATOM   5144  C C   . MET B 1 303 ? 9.992   -6.220  45.148  1.00 45.47  ? 314  MET B C   1 
ATOM   5145  O O   . MET B 1 303 ? 10.863  -6.949  45.611  1.00 45.47  ? 314  MET B O   1 
ATOM   5146  C CB  . MET B 1 303 ? 7.960   -7.305  44.305  1.00 78.60  ? 314  MET B CB  1 
ATOM   5147  C CG  . MET B 1 303 ? 8.798   -8.549  44.021  1.00 78.60  ? 314  MET B CG  1 
ATOM   5148  S SD  . MET B 1 303 ? 8.132   -9.573  42.719  1.00 78.60  ? 314  MET B SD  1 
ATOM   5149  C CE  . MET B 1 303 ? 6.474   -9.861  43.377  1.00 78.60  ? 314  MET B CE  1 
ATOM   5150  N N   . TYR B 1 304 ? 10.241  -5.179  44.363  1.00 55.85  ? 315  TYR B N   1 
ATOM   5151  C CA  . TYR B 1 304 ? 11.593  -4.796  43.959  1.00 55.85  ? 315  TYR B CA  1 
ATOM   5152  C C   . TYR B 1 304 ? 12.103  -3.523  44.640  1.00 55.85  ? 315  TYR B C   1 
ATOM   5153  O O   . TYR B 1 304 ? 12.234  -2.466  44.018  1.00 55.85  ? 315  TYR B O   1 
ATOM   5154  C CB  . TYR B 1 304 ? 11.650  -4.627  42.431  1.00 44.08  ? 315  TYR B CB  1 
ATOM   5155  C CG  . TYR B 1 304 ? 11.435  -5.908  41.666  1.00 44.08  ? 315  TYR B CG  1 
ATOM   5156  C CD1 . TYR B 1 304 ? 12.387  -6.917  41.691  1.00 44.08  ? 315  TYR B CD1 1 
ATOM   5157  C CD2 . TYR B 1 304 ? 10.276  -6.115  40.916  1.00 44.08  ? 315  TYR B CD2 1 
ATOM   5158  C CE1 . TYR B 1 304 ? 12.195  -8.106  40.983  1.00 44.08  ? 315  TYR B CE1 1 
ATOM   5159  C CE2 . TYR B 1 304 ? 10.074  -7.303  40.202  1.00 44.08  ? 315  TYR B CE2 1 
ATOM   5160  C CZ  . TYR B 1 304 ? 11.039  -8.289  40.240  1.00 44.08  ? 315  TYR B CZ  1 
ATOM   5161  O OH  . TYR B 1 304 ? 10.882  -9.438  39.514  1.00 44.08  ? 315  TYR B OH  1 
ATOM   5162  N N   . PRO B 1 305 ? 12.396  -3.612  45.939  1.00 67.50  ? 316  PRO B N   1 
ATOM   5163  C CA  . PRO B 1 305 ? 12.894  -2.429  46.629  1.00 67.50  ? 316  PRO B CA  1 
ATOM   5164  C C   . PRO B 1 305 ? 14.276  -2.126  46.070  1.00 67.50  ? 316  PRO B C   1 
ATOM   5165  O O   . PRO B 1 305 ? 14.814  -2.885  45.254  1.00 67.50  ? 316  PRO B O   1 
ATOM   5166  C CB  . PRO B 1 305 ? 12.944  -2.883  48.083  1.00 65.52  ? 316  PRO B CB  1 
ATOM   5167  C CG  . PRO B 1 305 ? 13.312  -4.327  47.954  1.00 65.52  ? 316  PRO B CG  1 
ATOM   5168  C CD  . PRO B 1 305 ? 12.404  -4.782  46.833  1.00 65.52  ? 316  PRO B CD  1 
ATOM   5169  N N   . GLY B 1 306 ? 14.850  -1.020  46.520  1.00 124.97 ? 317  GLY B N   1 
ATOM   5170  C CA  . GLY B 1 306 ? 16.166  -0.642  46.053  1.00 124.97 ? 317  GLY B CA  1 
ATOM   5171  C C   . GLY B 1 306 ? 16.100  0.209   44.804  1.00 124.97 ? 317  GLY B C   1 
ATOM   5172  O O   . GLY B 1 306 ? 15.124  0.919   44.567  1.00 124.97 ? 317  GLY B O   1 
ATOM   5173  N N   . ASN B 1 307 ? 17.149  0.128   43.998  1.00 122.46 ? 318  ASN B N   1 
ATOM   5174  C CA  . ASN B 1 307 ? 17.233  0.894   42.768  1.00 122.46 ? 318  ASN B CA  1 
ATOM   5175  C C   . ASN B 1 307 ? 15.971  0.767   41.913  1.00 122.46 ? 318  ASN B C   1 
ATOM   5176  O O   . ASN B 1 307 ? 15.633  -0.317  41.428  1.00 122.46 ? 318  ASN B O   1 
ATOM   5177  C CB  . ASN B 1 307 ? 18.444  0.434   41.963  1.00 101.96 ? 318  ASN B CB  1 
ATOM   5178  C CG  . ASN B 1 307 ? 18.831  1.419   40.900  1.00 101.96 ? 318  ASN B CG  1 
ATOM   5179  O OD1 . ASN B 1 307 ? 19.573  1.090   39.979  1.00 101.96 ? 318  ASN B OD1 1 
ATOM   5180  N ND2 . ASN B 1 307 ? 18.337  2.646   41.024  1.00 101.96 ? 318  ASN B ND2 1 
ATOM   5181  N N   . VAL B 1 308 ? 15.272  1.884   41.738  1.00 91.55  ? 319  VAL B N   1 
ATOM   5182  C CA  . VAL B 1 308 ? 14.061  1.899   40.932  1.00 91.55  ? 319  VAL B CA  1 
ATOM   5183  C C   . VAL B 1 308 ? 14.526  1.873   39.496  1.00 91.55  ? 319  VAL B C   1 
ATOM   5184  O O   . VAL B 1 308 ? 13.831  1.380   38.619  1.00 91.55  ? 319  VAL B O   1 
ATOM   5185  C CB  . VAL B 1 308 ? 13.233  3.178   41.168  1.00 126.53 ? 319  VAL B CB  1 
ATOM   5186  C CG1 . VAL B 1 308 ? 14.019  4.403   40.718  1.00 126.53 ? 319  VAL B CG1 1 
ATOM   5187  C CG2 . VAL B 1 308 ? 11.916  3.084   40.427  1.00 126.53 ? 319  VAL B CG2 1 
ATOM   5188  N N   . SER B 1 309 ? 15.722  2.404   39.274  1.00 57.52  ? 320  SER B N   1 
ATOM   5189  C CA  . SER B 1 309 ? 16.332  2.453   37.947  1.00 57.52  ? 320  SER B CA  1 
ATOM   5190  C C   . SER B 1 309 ? 16.772  1.064   37.502  1.00 57.52  ? 320  SER B C   1 
ATOM   5191  O O   . SER B 1 309 ? 17.478  0.924   36.511  1.00 57.52  ? 320  SER B O   1 
ATOM   5192  C CB  . SER B 1 309 ? 17.549  3.391   37.950  1.00 168.67 ? 320  SER B CB  1 
ATOM   5193  O OG  . SER B 1 309 ? 17.193  4.724   38.282  1.00 168.67 ? 320  SER B OG  1 
ATOM   5194  N N   . LYS B 1 310 ? 16.358  0.048   38.257  1.00 64.36  ? 321  LYS B N   1 
ATOM   5195  C CA  . LYS B 1 310 ? 16.686  -1.353  37.978  1.00 64.36  ? 321  LYS B CA  1 
ATOM   5196  C C   . LYS B 1 310 ? 15.454  -1.950  37.333  1.00 64.36  ? 321  LYS B C   1 
ATOM   5197  O O   . LYS B 1 310 ? 15.497  -2.990  36.680  1.00 64.36  ? 321  LYS B O   1 
ATOM   5198  C CB  . LYS B 1 310 ? 16.992  -2.091  39.288  1.00 112.16 ? 321  LYS B CB  1 
ATOM   5199  C CG  . LYS B 1 310 ? 17.334  -3.568  39.128  1.00 112.16 ? 321  LYS B CG  1 
ATOM   5200  C CD  . LYS B 1 310 ? 17.385  -4.280  40.474  1.00 112.16 ? 321  LYS B CD  1 
ATOM   5201  C CE  . LYS B 1 310 ? 17.516  -5.787  40.289  1.00 112.16 ? 321  LYS B CE  1 
ATOM   5202  N NZ  . LYS B 1 310 ? 17.341  -6.546  41.561  1.00 112.16 ? 321  LYS B NZ  1 
ATOM   5203  N N   . LEU B 1 311 ? 14.345  -1.261  37.546  1.00 80.09  ? 322  LEU B N   1 
ATOM   5204  C CA  . LEU B 1 311 ? 13.069  -1.656  37.000  1.00 80.09  ? 322  LEU B CA  1 
ATOM   5205  C C   . LEU B 1 311 ? 12.881  -0.961  35.656  1.00 80.09  ? 322  LEU B C   1 
ATOM   5206  O O   . LEU B 1 311 ? 13.688  -1.128  34.735  1.00 80.09  ? 322  LEU B O   1 
ATOM   5207  C CB  . LEU B 1 311 ? 11.950  -1.254  37.966  1.00 46.41  ? 322  LEU B CB  1 
ATOM   5208  C CG  . LEU B 1 311 ? 11.992  -1.939  39.337  1.00 46.41  ? 322  LEU B CG  1 
ATOM   5209  C CD1 . LEU B 1 311 ? 10.973  -1.301  40.279  1.00 46.41  ? 322  LEU B CD1 1 
ATOM   5210  C CD2 . LEU B 1 311 ? 11.722  -3.445  39.163  1.00 46.41  ? 322  LEU B CD2 1 
ATOM   5211  N N   . HIS B 1 312 ? 11.817  -0.170  35.570  1.00 59.32  ? 323  HIS B N   1 
ATOM   5212  C CA  . HIS B 1 312 ? 11.440  0.581   34.370  1.00 59.32  ? 323  HIS B CA  1 
ATOM   5213  C C   . HIS B 1 312 ? 12.138  0.338   33.031  1.00 59.32  ? 323  HIS B C   1 
ATOM   5214  O O   . HIS B 1 312 ? 13.367  0.334   32.914  1.00 59.32  ? 323  HIS B O   1 
ATOM   5215  C CB  . HIS B 1 312 ? 11.431  2.094   34.669  1.00 74.36  ? 323  HIS B CB  1 
ATOM   5216  C CG  . HIS B 1 312 ? 12.766  2.684   35.006  1.00 74.36  ? 323  HIS B CG  1 
ATOM   5217  N ND1 . HIS B 1 312 ? 12.887  3.895   35.654  1.00 74.36  ? 323  HIS B ND1 1 
ATOM   5218  C CD2 . HIS B 1 312 ? 14.027  2.255   34.772  1.00 74.36  ? 323  HIS B CD2 1 
ATOM   5219  C CE1 . HIS B 1 312 ? 14.165  4.185   35.806  1.00 74.36  ? 323  HIS B CE1 1 
ATOM   5220  N NE2 . HIS B 1 312 ? 14.878  3.206   35.279  1.00 74.36  ? 323  HIS B NE2 1 
ATOM   5221  N N   . GLY B 1 313 ? 11.305  0.133   32.018  1.00 104.44 ? 324  GLY B N   1 
ATOM   5222  C CA  . GLY B 1 313 ? 11.794  -0.086  30.676  1.00 104.44 ? 324  GLY B CA  1 
ATOM   5223  C C   . GLY B 1 313 ? 11.782  1.254   29.984  1.00 104.44 ? 324  GLY B C   1 
ATOM   5224  O O   . GLY B 1 313 ? 12.294  2.232   30.521  1.00 104.44 ? 324  GLY B O   1 
ATOM   5225  N N   . ARG B 1 314 ? 11.181  1.321   28.806  1.00 70.51  ? 325  ARG B N   1 
ATOM   5226  C CA  . ARG B 1 314 ? 11.142  2.586   28.089  1.00 70.51  ? 325  ARG B CA  1 
ATOM   5227  C C   . ARG B 1 314 ? 9.802   2.835   27.417  1.00 70.51  ? 325  ARG B C   1 
ATOM   5228  O O   . ARG B 1 314 ? 9.206   1.928   26.838  1.00 70.51  ? 325  ARG B O   1 
ATOM   5229  C CB  . ARG B 1 314 ? 12.248  2.617   27.030  1.00 155.14 ? 325  ARG B CB  1 
ATOM   5230  C CG  . ARG B 1 314 ? 13.628  2.271   27.558  1.00 155.14 ? 325  ARG B CG  1 
ATOM   5231  C CD  . ARG B 1 314 ? 14.642  2.163   26.430  1.00 155.14 ? 325  ARG B CD  1 
ATOM   5232  N NE  . ARG B 1 314 ? 15.927  1.633   26.888  1.00 155.14 ? 325  ARG B NE  1 
ATOM   5233  C CZ  . ARG B 1 314 ? 16.755  2.266   27.716  1.00 155.14 ? 325  ARG B CZ  1 
ATOM   5234  N NH1 . ARG B 1 314 ? 16.439  3.465   28.185  1.00 155.14 ? 325  ARG B NH1 1 
ATOM   5235  N NH2 . ARG B 1 314 ? 17.902  1.699   28.077  1.00 155.14 ? 325  ARG B NH2 1 
ATOM   5236  N N   . ASP B 1 315 ? 9.330   4.072   27.502  1.00 80.37  ? 326  ASP B N   1 
ATOM   5237  C CA  . ASP B 1 315 ? 8.075   4.453   26.868  1.00 80.37  ? 326  ASP B CA  1 
ATOM   5238  C C   . ASP B 1 315 ? 8.472   5.004   25.505  1.00 80.37  ? 326  ASP B C   1 
ATOM   5239  O O   . ASP B 1 315 ? 7.804   4.781   24.490  1.00 80.37  ? 326  ASP B O   1 
ATOM   5240  C CB  . ASP B 1 315 ? 7.382   5.546   27.672  1.00 89.26  ? 326  ASP B CB  1 
ATOM   5241  C CG  . ASP B 1 315 ? 5.979   5.817   27.185  1.00 89.26  ? 326  ASP B CG  1 
ATOM   5242  O OD1 . ASP B 1 315 ? 5.787   5.977   25.959  1.00 89.26  ? 326  ASP B OD1 1 
ATOM   5243  O OD2 . ASP B 1 315 ? 5.064   5.875   28.030  1.00 89.26  ? 326  ASP B OD2 1 
ATOM   5244  N N   . GLY B 1 316 ? 9.582   5.733   25.516  1.00 88.31  ? 327  GLY B N   1 
ATOM   5245  C CA  . GLY B 1 316 ? 10.132  6.327   24.316  1.00 88.31  ? 327  GLY B CA  1 
ATOM   5246  C C   . GLY B 1 316 ? 11.570  6.708   24.605  1.00 88.31  ? 327  GLY B C   1 
ATOM   5247  O O   . GLY B 1 316 ? 12.380  5.869   24.999  1.00 88.31  ? 327  GLY B O   1 
ATOM   5248  N N   . ARG B 1 317 ? 11.888  7.982   24.419  1.00 140.57 ? 328  ARG B N   1 
ATOM   5249  C CA  . ARG B 1 317 ? 13.234  8.468   24.677  1.00 140.57 ? 328  ARG B CA  1 
ATOM   5250  C C   . ARG B 1 317 ? 13.434  8.622   26.183  1.00 140.57 ? 328  ARG B C   1 
ATOM   5251  O O   . ARG B 1 317 ? 14.482  9.088   26.632  1.00 140.57 ? 328  ARG B O   1 
ATOM   5252  C CB  . ARG B 1 317 ? 13.452  9.820   23.982  1.00 138.41 ? 328  ARG B CB  1 
ATOM   5253  C CG  . ARG B 1 317 ? 13.281  9.780   22.465  1.00 138.41 ? 328  ARG B CG  1 
ATOM   5254  C CD  . ARG B 1 317 ? 13.597  11.122  21.804  1.00 138.41 ? 328  ARG B CD  1 
ATOM   5255  N NE  . ARG B 1 317 ? 13.541  11.031  20.345  1.00 138.41 ? 328  ARG B NE  1 
ATOM   5256  C CZ  . ARG B 1 317 ? 13.892  12.009  19.516  1.00 138.41 ? 328  ARG B CZ  1 
ATOM   5257  N NH1 . ARG B 1 317 ? 14.327  13.166  19.996  1.00 138.41 ? 328  ARG B NH1 1 
ATOM   5258  N NH2 . ARG B 1 317 ? 13.818  11.827  18.204  1.00 138.41 ? 328  ARG B NH2 1 
ATOM   5259  N N   . LYS B 1 318 ? 12.428  8.219   26.959  1.00 141.43 ? 329  LYS B N   1 
ATOM   5260  C CA  . LYS B 1 318 ? 12.494  8.338   28.414  1.00 141.43 ? 329  LYS B CA  1 
ATOM   5261  C C   . LYS B 1 318 ? 12.060  7.074   29.164  1.00 141.43 ? 329  LYS B C   1 
ATOM   5262  O O   . LYS B 1 318 ? 11.001  6.509   28.896  1.00 141.43 ? 329  LYS B O   1 
ATOM   5263  C CB  . LYS B 1 318 ? 11.652  9.542   28.856  1.00 177.59 ? 329  LYS B CB  1 
ATOM   5264  C CG  . LYS B 1 318 ? 12.086  10.854  28.190  1.00 177.59 ? 329  LYS B CG  1 
ATOM   5265  C CD  . LYS B 1 318 ? 11.212  12.038  28.585  1.00 177.59 ? 329  LYS B CD  1 
ATOM   5266  C CE  . LYS B 1 318 ? 11.700  13.336  27.941  1.00 177.59 ? 329  LYS B CE  1 
ATOM   5267  N NZ  . LYS B 1 318 ? 11.655  13.294  26.451  1.00 177.59 ? 329  LYS B NZ  1 
ATOM   5268  N N   . ASN B 1 319 ? 12.899  6.641   30.103  1.00 62.97  ? 330  ASN B N   1 
ATOM   5269  C CA  . ASN B 1 319 ? 12.644  5.452   30.911  1.00 62.97  ? 330  ASN B CA  1 
ATOM   5270  C C   . ASN B 1 319 ? 11.609  5.738   31.993  1.00 62.97  ? 330  ASN B C   1 
ATOM   5271  O O   . ASN B 1 319 ? 11.640  6.794   32.620  1.00 62.97  ? 330  ASN B O   1 
ATOM   5272  C CB  . ASN B 1 319 ? 13.934  4.993   31.575  1.00 145.41 ? 330  ASN B CB  1 
ATOM   5273  C CG  . ASN B 1 319 ? 15.010  4.675   30.576  1.00 145.41 ? 330  ASN B CG  1 
ATOM   5274  O OD1 . ASN B 1 319 ? 15.272  5.459   29.665  1.00 145.41 ? 330  ASN B OD1 1 
ATOM   5275  N ND2 . ASN B 1 319 ? 15.649  3.523   30.740  1.00 145.41 ? 330  ASN B ND2 1 
ATOM   5276  N N   . VAL B 1 320 ? 10.713  4.784   32.232  1.00 60.27  ? 331  VAL B N   1 
ATOM   5277  C CA  . VAL B 1 320 ? 9.660   4.956   33.225  1.00 60.27  ? 331  VAL B CA  1 
ATOM   5278  C C   . VAL B 1 320 ? 9.253   3.616   33.824  1.00 60.27  ? 331  VAL B C   1 
ATOM   5279  O O   . VAL B 1 320 ? 9.228   2.612   33.114  1.00 60.27  ? 331  VAL B O   1 
ATOM   5280  C CB  . VAL B 1 320 ? 8.411   5.613   32.575  1.00 63.31  ? 331  VAL B CB  1 
ATOM   5281  C CG1 . VAL B 1 320 ? 7.981   4.812   31.377  1.00 63.31  ? 331  VAL B CG1 1 
ATOM   5282  C CG2 . VAL B 1 320 ? 7.261   5.674   33.555  1.00 63.31  ? 331  VAL B CG2 1 
ATOM   5283  N N   . VAL B 1 321 ? 8.970   3.596   35.132  1.00 44.41  ? 332  VAL B N   1 
ATOM   5284  C CA  . VAL B 1 321 ? 8.514   2.381   35.825  1.00 44.41  ? 332  VAL B CA  1 
ATOM   5285  C C   . VAL B 1 321 ? 7.138   2.044   35.258  1.00 44.41  ? 332  VAL B C   1 
ATOM   5286  O O   . VAL B 1 321 ? 6.222   2.874   35.266  1.00 44.41  ? 332  VAL B O   1 
ATOM   5287  C CB  . VAL B 1 321 ? 8.384   2.588   37.361  1.00 110.12 ? 332  VAL B CB  1 
ATOM   5288  C CG1 . VAL B 1 321 ? 7.763   1.359   38.008  1.00 110.12 ? 332  VAL B CG1 1 
ATOM   5289  C CG2 . VAL B 1 321 ? 9.749   2.853   37.969  1.00 110.12 ? 332  VAL B CG2 1 
ATOM   5290  N N   . PRO B 1 322 ? 6.977   0.815   34.758  1.00 54.96  ? 333  PRO B N   1 
ATOM   5291  C CA  . PRO B 1 322 ? 5.714   0.369   34.172  1.00 54.96  ? 333  PRO B CA  1 
ATOM   5292  C C   . PRO B 1 322 ? 4.608   0.149   35.188  1.00 54.96  ? 333  PRO B C   1 
ATOM   5293  O O   . PRO B 1 322 ? 4.874   -0.049  36.369  1.00 54.96  ? 333  PRO B O   1 
ATOM   5294  C CB  . PRO B 1 322 ? 6.113   -0.924  33.495  1.00 61.87  ? 333  PRO B CB  1 
ATOM   5295  C CG  . PRO B 1 322 ? 7.083   -1.492  34.499  1.00 61.87  ? 333  PRO B CG  1 
ATOM   5296  C CD  . PRO B 1 322 ? 7.945   -0.296  34.821  1.00 61.87  ? 333  PRO B CD  1 
ATOM   5297  N N   . CYS B 1 323 ? 3.365   0.199   34.719  1.00 68.56  ? 334  CYS B N   1 
ATOM   5298  C CA  . CYS B 1 323 ? 2.211   -0.058  35.570  1.00 68.56  ? 334  CYS B CA  1 
ATOM   5299  C C   . CYS B 1 323 ? 1.864   -1.520  35.313  1.00 68.56  ? 334  CYS B C   1 
ATOM   5300  O O   . CYS B 1 323 ? 2.000   -1.999  34.185  1.00 68.56  ? 334  CYS B O   1 
ATOM   5301  C CB  . CYS B 1 323 ? 1.039   0.847   35.194  1.00 102.72 ? 334  CYS B CB  1 
ATOM   5302  S SG  . CYS B 1 323 ? 1.081   2.453   36.028  1.00 102.72 ? 334  CYS B SG  1 
ATOM   5303  N N   . VAL B 1 324 ? 1.430   -2.234  36.348  1.00 48.95  ? 335  VAL B N   1 
ATOM   5304  C CA  . VAL B 1 324 ? 1.112   -3.655  36.205  1.00 48.95  ? 335  VAL B CA  1 
ATOM   5305  C C   . VAL B 1 324 ? -0.366  -3.960  36.026  1.00 48.95  ? 335  VAL B C   1 
ATOM   5306  O O   . VAL B 1 324 ? -1.132  -3.975  36.985  1.00 48.95  ? 335  VAL B O   1 
ATOM   5307  C CB  . VAL B 1 324 ? 1.636   -4.481  37.419  1.00 35.05  ? 335  VAL B CB  1 
ATOM   5308  C CG1 . VAL B 1 324 ? 1.175   -5.905  37.318  1.00 35.05  ? 335  VAL B CG1 1 
ATOM   5309  C CG2 . VAL B 1 324 ? 3.155   -4.439  37.473  1.00 35.05  ? 335  VAL B CG2 1 
ATOM   5310  N N   . LEU B 1 325 ? -0.749  -4.217  34.783  1.00 49.46  ? 336  LEU B N   1 
ATOM   5311  C CA  . LEU B 1 325 ? -2.121  -4.559  34.437  1.00 49.46  ? 336  LEU B CA  1 
ATOM   5312  C C   . LEU B 1 325 ? -2.183  -6.083  34.672  1.00 49.46  ? 336  LEU B C   1 
ATOM   5313  O O   . LEU B 1 325 ? -1.189  -6.772  34.472  1.00 49.46  ? 336  LEU B O   1 
ATOM   5314  C CB  . LEU B 1 325 ? -2.350  -4.184  32.969  1.00 56.50  ? 336  LEU B CB  1 
ATOM   5315  C CG  . LEU B 1 325 ? -3.731  -3.800  32.445  1.00 56.50  ? 336  LEU B CG  1 
ATOM   5316  C CD1 . LEU B 1 325 ? -3.545  -3.076  31.136  1.00 56.50  ? 336  LEU B CD1 1 
ATOM   5317  C CD2 . LEU B 1 325 ? -4.614  -5.030  32.257  1.00 56.50  ? 336  LEU B CD2 1 
ATOM   5318  N N   . SER B 1 326 ? -3.324  -6.617  35.099  1.00 51.27  ? 337  SER B N   1 
ATOM   5319  C CA  . SER B 1 326 ? -3.413  -8.057  35.386  1.00 51.27  ? 337  SER B CA  1 
ATOM   5320  C C   . SER B 1 326 ? -4.706  -8.739  34.933  1.00 51.27  ? 337  SER B C   1 
ATOM   5321  O O   . SER B 1 326 ? -5.783  -8.439  35.434  1.00 51.27  ? 337  SER B O   1 
ATOM   5322  C CB  . SER B 1 326 ? -3.222  -8.275  36.896  1.00 63.97  ? 337  SER B CB  1 
ATOM   5323  O OG  . SER B 1 326 ? -3.258  -9.645  37.241  1.00 63.97  ? 337  SER B OG  1 
ATOM   5324  N N   . VAL B 1 327 ? -4.585  -9.667  33.993  1.00 49.04  ? 338  VAL B N   1 
ATOM   5325  C CA  . VAL B 1 327 ? -5.743  -10.399 33.479  1.00 49.04  ? 338  VAL B CA  1 
ATOM   5326  C C   . VAL B 1 327 ? -5.778  -11.808 34.090  1.00 49.04  ? 338  VAL B C   1 
ATOM   5327  O O   . VAL B 1 327 ? -4.764  -12.502 34.103  1.00 49.04  ? 338  VAL B O   1 
ATOM   5328  C CB  . VAL B 1 327 ? -5.688  -10.503 31.930  1.00 33.69  ? 338  VAL B CB  1 
ATOM   5329  C CG1 . VAL B 1 327 ? -6.903  -11.232 31.413  1.00 33.69  ? 338  VAL B CG1 1 
ATOM   5330  C CG2 . VAL B 1 327 ? -5.633  -9.119  31.317  1.00 33.69  ? 338  VAL B CG2 1 
ATOM   5331  N N   . ASN B 1 328 ? -6.938  -12.230 34.596  1.00 35.97  ? 339  ASN B N   1 
ATOM   5332  C CA  . ASN B 1 328 ? -7.055  -13.551 35.221  1.00 35.97  ? 339  ASN B CA  1 
ATOM   5333  C C   . ASN B 1 328 ? -8.392  -14.274 34.956  1.00 35.97  ? 339  ASN B C   1 
ATOM   5334  O O   . ASN B 1 328 ? -9.464  -13.819 35.355  1.00 35.97  ? 339  ASN B O   1 
ATOM   5335  C CB  . ASN B 1 328 ? -6.832  -13.408 36.729  1.00 65.18  ? 339  ASN B CB  1 
ATOM   5336  C CG  . ASN B 1 328 ? -5.942  -14.493 37.289  1.00 65.18  ? 339  ASN B CG  1 
ATOM   5337  O OD1 . ASN B 1 328 ? -6.306  -15.663 37.291  1.00 65.18  ? 339  ASN B OD1 1 
ATOM   5338  N ND2 . ASN B 1 328 ? -4.760  -14.110 37.767  1.00 65.18  ? 339  ASN B ND2 1 
ATOM   5339  N N   . GLY B 1 329 ? -8.333  -15.417 34.290  1.00 44.57  ? 340  GLY B N   1 
ATOM   5340  C CA  . GLY B 1 329 ? -9.562  -16.125 34.008  1.00 44.57  ? 340  GLY B CA  1 
ATOM   5341  C C   . GLY B 1 329 ? -9.601  -17.517 34.595  1.00 44.57  ? 340  GLY B C   1 
ATOM   5342  O O   . GLY B 1 329 ? -8.572  -18.198 34.677  1.00 44.57  ? 340  GLY B O   1 
ATOM   5343  N N   . ASP B 1 330 ? -10.796 -17.940 34.999  1.00 59.19  ? 341  ASP B N   1 
ATOM   5344  C CA  . ASP B 1 330 ? -11.002 -19.256 35.581  1.00 59.19  ? 341  ASP B CA  1 
ATOM   5345  C C   . ASP B 1 330 ? -11.359 -20.223 34.445  1.00 59.19  ? 341  ASP B C   1 
ATOM   5346  O O   . ASP B 1 330 ? -12.471 -20.186 33.922  1.00 59.19  ? 341  ASP B O   1 
ATOM   5347  C CB  . ASP B 1 330 ? -12.138 -19.177 36.601  1.00 96.51  ? 341  ASP B CB  1 
ATOM   5348  C CG  . ASP B 1 330 ? -12.017 -20.213 37.691  1.00 96.51  ? 341  ASP B CG  1 
ATOM   5349  O OD1 . ASP B 1 330 ? -10.949 -20.275 38.336  1.00 96.51  ? 341  ASP B OD1 1 
ATOM   5350  O OD2 . ASP B 1 330 ? -12.992 -20.958 37.912  1.00 96.51  ? 341  ASP B OD2 1 
ATOM   5351  N N   . LEU B 1 331 ? -10.417 -21.079 34.051  1.00 50.77  ? 342  LEU B N   1 
ATOM   5352  C CA  . LEU B 1 331 ? -10.672 -22.016 32.965  1.00 50.77  ? 342  LEU B CA  1 
ATOM   5353  C C   . LEU B 1 331 ? -11.661 -23.124 33.303  1.00 50.77  ? 342  LEU B C   1 
ATOM   5354  O O   . LEU B 1 331 ? -12.475 -23.505 32.465  1.00 50.77  ? 342  LEU B O   1 
ATOM   5355  C CB  . LEU B 1 331 ? -9.362  -22.650 32.486  1.00 42.12  ? 342  LEU B CB  1 
ATOM   5356  C CG  . LEU B 1 331 ? -8.395  -21.787 31.673  1.00 42.12  ? 342  LEU B CG  1 
ATOM   5357  C CD1 . LEU B 1 331 ? -7.338  -22.702 31.028  1.00 42.12  ? 342  LEU B CD1 1 
ATOM   5358  C CD2 . LEU B 1 331 ? -9.163  -21.007 30.602  1.00 42.12  ? 342  LEU B CD2 1 
ATOM   5359  N N   . ASP B 1 332 ? -11.587 -23.644 34.525  1.00 49.88  ? 343  ASP B N   1 
ATOM   5360  C CA  . ASP B 1 332 ? -12.466 -24.733 34.940  1.00 49.88  ? 343  ASP B CA  1 
ATOM   5361  C C   . ASP B 1 332 ? -13.916 -24.312 35.044  1.00 49.88  ? 343  ASP B C   1 
ATOM   5362  O O   . ASP B 1 332 ? -14.820 -25.114 34.861  1.00 49.88  ? 343  ASP B O   1 
ATOM   5363  C CB  . ASP B 1 332 ? -11.981 -25.331 36.265  1.00 96.41  ? 343  ASP B CB  1 
ATOM   5364  C CG  . ASP B 1 332 ? -10.645 -26.047 36.121  1.00 96.41  ? 343  ASP B CG  1 
ATOM   5365  O OD1 . ASP B 1 332 ? -10.499 -26.820 35.154  1.00 96.41  ? 343  ASP B OD1 1 
ATOM   5366  O OD2 . ASP B 1 332 ? -9.742  -25.851 36.962  1.00 96.41  ? 343  ASP B OD2 1 
ATOM   5367  N N   . ARG B 1 333 ? -14.132 -23.042 35.340  1.00 35.29  ? 344  ARG B N   1 
ATOM   5368  C CA  . ARG B 1 333 ? -15.481 -22.507 35.449  1.00 35.29  ? 344  ARG B CA  1 
ATOM   5369  C C   . ARG B 1 333 ? -15.878 -22.057 34.060  1.00 35.29  ? 344  ARG B C   1 
ATOM   5370  O O   . ARG B 1 333 ? -17.056 -22.024 33.728  1.00 35.29  ? 344  ARG B O   1 
ATOM   5371  C CB  . ARG B 1 333 ? -15.513 -21.329 36.422  1.00 63.21  ? 344  ARG B CB  1 
ATOM   5372  C CG  . ARG B 1 333 ? -16.893 -20.770 36.657  1.00 63.21  ? 344  ARG B CG  1 
ATOM   5373  C CD  . ARG B 1 333 ? -16.884 -19.761 37.796  1.00 63.21  ? 344  ARG B CD  1 
ATOM   5374  N NE  . ARG B 1 333 ? -16.553 -20.374 39.081  1.00 63.21  ? 344  ARG B NE  1 
ATOM   5375  C CZ  . ARG B 1 333 ? -16.469 -19.702 40.224  1.00 63.21  ? 344  ARG B CZ  1 
ATOM   5376  N NH1 . ARG B 1 333 ? -16.688 -18.396 40.246  1.00 63.21  ? 344  ARG B NH1 1 
ATOM   5377  N NH2 . ARG B 1 333 ? -16.178 -20.338 41.346  1.00 63.21  ? 344  ARG B NH2 1 
ATOM   5378  N N   . GLY B 1 334 ? -14.872 -21.709 33.258  1.00 42.35  ? 345  GLY B N   1 
ATOM   5379  C CA  . GLY B 1 334 ? -15.100 -21.303 31.881  1.00 42.35  ? 345  GLY B CA  1 
ATOM   5380  C C   . GLY B 1 334 ? -15.520 -22.572 31.170  1.00 42.35  ? 345  GLY B C   1 
ATOM   5381  O O   . GLY B 1 334 ? -16.298 -22.565 30.229  1.00 42.35  ? 345  GLY B O   1 
ATOM   5382  N N   . MET B 1 335 ? -14.973 -23.684 31.640  1.00 46.78  ? 346  MET B N   1 
ATOM   5383  C CA  . MET B 1 335 ? -15.296 -24.990 31.112  1.00 46.78  ? 346  MET B CA  1 
ATOM   5384  C C   . MET B 1 335 ? -16.802 -25.101 31.241  1.00 46.78  ? 346  MET B C   1 
ATOM   5385  O O   . MET B 1 335 ? -17.514 -25.056 30.250  1.00 46.78  ? 346  MET B O   1 
ATOM   5386  C CB  . MET B 1 335 ? -14.630 -26.051 31.973  1.00 91.14  ? 346  MET B CB  1 
ATOM   5387  C CG  . MET B 1 335 ? -13.419 -26.665 31.358  1.00 91.14  ? 346  MET B CG  1 
ATOM   5388  S SD  . MET B 1 335 ? -13.935 -28.060 30.396  1.00 91.14  ? 346  MET B SD  1 
ATOM   5389  C CE  . MET B 1 335 ? -14.168 -29.278 31.699  1.00 91.14  ? 346  MET B CE  1 
ATOM   5390  N N   . LEU B 1 336 ? -17.263 -25.227 32.488  1.00 71.96  ? 347  LEU B N   1 
ATOM   5391  C CA  . LEU B 1 336 ? -18.682 -25.332 32.848  1.00 71.96  ? 347  LEU B CA  1 
ATOM   5392  C C   . LEU B 1 336 ? -19.540 -24.375 32.026  1.00 71.96  ? 347  LEU B C   1 
ATOM   5393  O O   . LEU B 1 336 ? -20.465 -24.791 31.324  1.00 71.96  ? 347  LEU B O   1 
ATOM   5394  C CB  . LEU B 1 336 ? -18.856 -25.003 34.333  1.00 81.83  ? 347  LEU B CB  1 
ATOM   5395  C CG  . LEU B 1 336 ? -17.952 -25.747 35.321  1.00 81.83  ? 347  LEU B CG  1 
ATOM   5396  C CD1 . LEU B 1 336 ? -17.877 -24.965 36.615  1.00 81.83  ? 347  LEU B CD1 1 
ATOM   5397  C CD2 . LEU B 1 336 ? -18.472 -27.154 35.564  1.00 81.83  ? 347  LEU B CD2 1 
ATOM   5398  N N   . ALA B 1 337 ? -19.232 -23.088 32.135  1.00 54.38  ? 348  ALA B N   1 
ATOM   5399  C CA  . ALA B 1 337 ? -19.951 -22.067 31.391  1.00 54.38  ? 348  ALA B CA  1 
ATOM   5400  C C   . ALA B 1 337 ? -20.241 -22.592 29.992  1.00 54.38  ? 348  ALA B C   1 
ATOM   5401  O O   . ALA B 1 337 ? -21.345 -22.468 29.493  1.00 54.38  ? 348  ALA B O   1 
ATOM   5402  C CB  . ALA B 1 337 ? -19.119 -20.776 31.310  1.00 15.66  ? 348  ALA B CB  1 
ATOM   5403  N N   . TYR B 1 338 ? -19.254 -23.200 29.359  1.00 79.25  ? 349  TYR B N   1 
ATOM   5404  C CA  . TYR B 1 338 ? -19.479 -23.703 28.025  1.00 79.25  ? 349  TYR B CA  1 
ATOM   5405  C C   . TYR B 1 338 ? -20.367 -24.928 27.965  1.00 79.25  ? 349  TYR B C   1 
ATOM   5406  O O   . TYR B 1 338 ? -21.160 -25.064 27.037  1.00 79.25  ? 349  TYR B O   1 
ATOM   5407  C CB  . TYR B 1 338 ? -18.143 -23.949 27.317  1.00 47.99  ? 349  TYR B CB  1 
ATOM   5408  C CG  . TYR B 1 338 ? -17.613 -22.665 26.735  1.00 47.99  ? 349  TYR B CG  1 
ATOM   5409  C CD1 . TYR B 1 338 ? -18.431 -21.886 25.911  1.00 47.99  ? 349  TYR B CD1 1 
ATOM   5410  C CD2 . TYR B 1 338 ? -16.351 -22.177 27.065  1.00 47.99  ? 349  TYR B CD2 1 
ATOM   5411  C CE1 . TYR B 1 338 ? -18.022 -20.655 25.442  1.00 47.99  ? 349  TYR B CE1 1 
ATOM   5412  C CE2 . TYR B 1 338 ? -15.929 -20.946 26.600  1.00 47.99  ? 349  TYR B CE2 1 
ATOM   5413  C CZ  . TYR B 1 338 ? -16.778 -20.190 25.791  1.00 47.99  ? 349  TYR B CZ  1 
ATOM   5414  O OH  . TYR B 1 338 ? -16.429 -18.946 25.341  1.00 47.99  ? 349  TYR B OH  1 
ATOM   5415  N N   . LEU B 1 339 ? -20.265 -25.808 28.953  1.00 53.03  ? 350  LEU B N   1 
ATOM   5416  C CA  . LEU B 1 339 ? -21.083 -27.000 28.939  1.00 53.03  ? 350  LEU B CA  1 
ATOM   5417  C C   . LEU B 1 339 ? -22.525 -26.651 29.206  1.00 53.03  ? 350  LEU B C   1 
ATOM   5418  O O   . LEU B 1 339 ? -23.421 -27.361 28.769  1.00 53.03  ? 350  LEU B O   1 
ATOM   5419  C CB  . LEU B 1 339 ? -20.583 -28.028 29.949  1.00 53.97  ? 350  LEU B CB  1 
ATOM   5420  C CG  . LEU B 1 339 ? -19.400 -28.865 29.472  1.00 53.97  ? 350  LEU B CG  1 
ATOM   5421  C CD1 . LEU B 1 339 ? -19.143 -30.014 30.432  1.00 53.97  ? 350  LEU B CD1 1 
ATOM   5422  C CD2 . LEU B 1 339 ? -19.712 -29.410 28.094  1.00 53.97  ? 350  LEU B CD2 1 
ATOM   5423  N N   . TYR B 1 340 ? -22.765 -25.560 29.922  1.00 68.71  ? 351  TYR B N   1 
ATOM   5424  C CA  . TYR B 1 340 ? -24.140 -25.142 30.186  1.00 68.71  ? 351  TYR B CA  1 
ATOM   5425  C C   . TYR B 1 340 ? -24.686 -24.456 28.936  1.00 68.71  ? 351  TYR B C   1 
ATOM   5426  O O   . TYR B 1 340 ? -25.785 -24.740 28.471  1.00 68.71  ? 351  TYR B O   1 
ATOM   5427  C CB  . TYR B 1 340 ? -24.179 -24.178 31.362  1.00 60.03  ? 351  TYR B CB  1 
ATOM   5428  C CG  . TYR B 1 340 ? -24.508 -24.853 32.659  1.00 60.03  ? 351  TYR B CG  1 
ATOM   5429  C CD1 . TYR B 1 340 ? -25.808 -25.206 32.958  1.00 60.03  ? 351  TYR B CD1 1 
ATOM   5430  C CD2 . TYR B 1 340 ? -23.510 -25.162 33.579  1.00 60.03  ? 351  TYR B CD2 1 
ATOM   5431  C CE1 . TYR B 1 340 ? -26.114 -25.846 34.136  1.00 60.03  ? 351  TYR B CE1 1 
ATOM   5432  C CE2 . TYR B 1 340 ? -23.801 -25.811 34.769  1.00 60.03  ? 351  TYR B CE2 1 
ATOM   5433  C CZ  . TYR B 1 340 ? -25.111 -26.152 35.044  1.00 60.03  ? 351  TYR B CZ  1 
ATOM   5434  O OH  . TYR B 1 340 ? -25.429 -26.813 36.214  1.00 60.03  ? 351  TYR B OH  1 
ATOM   5435  N N   . ASP B 1 341 ? -23.884 -23.555 28.399  1.00 56.13  ? 352  ASP B N   1 
ATOM   5436  C CA  . ASP B 1 341 ? -24.209 -22.799 27.204  1.00 56.13  ? 352  ASP B CA  1 
ATOM   5437  C C   . ASP B 1 341 ? -24.527 -23.659 25.964  1.00 56.13  ? 352  ASP B C   1 
ATOM   5438  O O   . ASP B 1 341 ? -25.095 -23.161 24.989  1.00 56.13  ? 352  ASP B O   1 
ATOM   5439  C CB  . ASP B 1 341 ? -23.029 -21.883 26.898  1.00 67.17  ? 352  ASP B CB  1 
ATOM   5440  C CG  . ASP B 1 341 ? -23.290 -20.954 25.743  1.00 67.17  ? 352  ASP B CG  1 
ATOM   5441  O OD1 . ASP B 1 341 ? -24.177 -20.086 25.885  1.00 67.17  ? 352  ASP B OD1 1 
ATOM   5442  O OD2 . ASP B 1 341 ? -22.603 -21.093 24.706  1.00 67.17  ? 352  ASP B OD2 1 
ATOM   5443  N N   . SER B 1 342 ? -24.174 -24.939 25.990  1.00 65.96  ? 353  SER B N   1 
ATOM   5444  C CA  . SER B 1 342 ? -24.428 -25.796 24.834  1.00 65.96  ? 353  SER B CA  1 
ATOM   5445  C C   . SER B 1 342 ? -25.635 -26.726 24.994  1.00 65.96  ? 353  SER B C   1 
ATOM   5446  O O   . SER B 1 342 ? -25.989 -27.475 24.074  1.00 65.96  ? 353  SER B O   1 
ATOM   5447  C CB  . SER B 1 342 ? -23.178 -26.623 24.517  1.00 67.51  ? 353  SER B CB  1 
ATOM   5448  O OG  . SER B 1 342 ? -22.830 -27.478 25.594  1.00 67.51  ? 353  SER B OG  1 
ATOM   5449  N N   . PHE B 1 343 ? -26.267 -26.674 26.161  1.00 66.41  ? 354  PHE B N   1 
ATOM   5450  C CA  . PHE B 1 343 ? -27.428 -27.507 26.444  1.00 66.41  ? 354  PHE B CA  1 
ATOM   5451  C C   . PHE B 1 343 ? -28.647 -26.593 26.617  1.00 66.41  ? 354  PHE B C   1 
ATOM   5452  O O   . PHE B 1 343 ? -28.700 -25.505 26.025  1.00 66.41  ? 354  PHE B O   1 
ATOM   5453  C CB  . PHE B 1 343 ? -27.163 -28.305 27.715  1.00 75.56  ? 354  PHE B CB  1 
ATOM   5454  C CG  . PHE B 1 343 ? -28.131 -29.421 27.955  1.00 75.56  ? 354  PHE B CG  1 
ATOM   5455  C CD1 . PHE B 1 343 ? -28.309 -30.422 27.011  1.00 75.56  ? 354  PHE B CD1 1 
ATOM   5456  C CD2 . PHE B 1 343 ? -28.832 -29.498 29.153  1.00 75.56  ? 354  PHE B CD2 1 
ATOM   5457  C CE1 . PHE B 1 343 ? -29.175 -31.495 27.262  1.00 75.56  ? 354  PHE B CE1 1 
ATOM   5458  C CE2 . PHE B 1 343 ? -29.695 -30.559 29.415  1.00 75.56  ? 354  PHE B CE2 1 
ATOM   5459  C CZ  . PHE B 1 343 ? -29.868 -31.561 28.470  1.00 75.56  ? 354  PHE B CZ  1 
ATOM   5460  N N   . GLN B 1 344 ? -29.618 -27.036 27.420  1.00 112.82 ? 355  GLN B N   1 
ATOM   5461  C CA  . GLN B 1 344 ? -30.844 -26.273 27.689  1.00 112.82 ? 355  GLN B CA  1 
ATOM   5462  C C   . GLN B 1 344 ? -31.134 -26.175 29.185  1.00 112.82 ? 355  GLN B C   1 
ATOM   5463  O O   . GLN B 1 344 ? -32.182 -25.675 29.592  1.00 112.82 ? 355  GLN B O   1 
ATOM   5464  C CB  . GLN B 1 344 ? -32.044 -26.915 26.981  1.00 173.34 ? 355  GLN B CB  1 
ATOM   5465  C CG  . GLN B 1 344 ? -32.278 -26.433 25.554  1.00 173.34 ? 355  GLN B CG  1 
ATOM   5466  C CD  . GLN B 1 344 ? -32.735 -24.984 25.491  1.00 173.34 ? 355  GLN B CD  1 
ATOM   5467  O OE1 . GLN B 1 344 ? -33.718 -24.605 26.127  1.00 173.34 ? 355  GLN B OE1 1 
ATOM   5468  N NE2 . GLN B 1 344 ? -32.025 -24.169 24.718  1.00 173.34 ? 355  GLN B NE2 1 
ATOM   5469  N N   . ARG B 1 358 ? -34.486 -35.275 22.627  1.00 106.70 ? 369  ARG B N   1 
ATOM   5470  C CA  . ARG B 1 358 ? -33.170 -35.006 22.055  1.00 106.70 ? 369  ARG B CA  1 
ATOM   5471  C C   . ARG B 1 358 ? -32.254 -34.254 23.030  1.00 106.70 ? 369  ARG B C   1 
ATOM   5472  O O   . ARG B 1 358 ? -32.503 -33.098 23.383  1.00 106.70 ? 369  ARG B O   1 
ATOM   5473  C CB  . ARG B 1 358 ? -33.316 -34.219 20.735  1.00 65.63  ? 369  ARG B CB  1 
ATOM   5474  C CG  . ARG B 1 358 ? -32.002 -33.745 20.083  1.00 65.63  ? 369  ARG B CG  1 
ATOM   5475  C CD  . ARG B 1 358 ? -32.250 -33.259 18.661  1.00 65.63  ? 369  ARG B CD  1 
ATOM   5476  N NE  . ARG B 1 358 ? -31.109 -32.574 18.048  1.00 65.63  ? 369  ARG B NE  1 
ATOM   5477  C CZ  . ARG B 1 358 ? -29.960 -33.155 17.698  1.00 65.63  ? 369  ARG B CZ  1 
ATOM   5478  N NH1 . ARG B 1 358 ? -29.776 -34.453 17.899  1.00 65.63  ? 369  ARG B NH1 1 
ATOM   5479  N NH2 . ARG B 1 358 ? -28.990 -32.436 17.139  1.00 65.63  ? 369  ARG B NH2 1 
ATOM   5480  N N   . LYS B 1 359 ? -31.198 -34.941 23.463  1.00 90.29  ? 370  LYS B N   1 
ATOM   5481  C CA  . LYS B 1 359 ? -30.200 -34.392 24.379  1.00 90.29  ? 370  LYS B CA  1 
ATOM   5482  C C   . LYS B 1 359 ? -29.393 -33.357 23.597  1.00 90.29  ? 370  LYS B C   1 
ATOM   5483  O O   . LYS B 1 359 ? -29.891 -32.287 23.268  1.00 90.29  ? 370  LYS B O   1 
ATOM   5484  C CB  . LYS B 1 359 ? -29.265 -35.515 24.847  1.00 84.25  ? 370  LYS B CB  1 
ATOM   5485  C CG  . LYS B 1 359 ? -29.955 -36.747 25.431  1.00 84.25  ? 370  LYS B CG  1 
ATOM   5486  C CD  . LYS B 1 359 ? -30.606 -36.441 26.771  1.00 84.25  ? 370  LYS B CD  1 
ATOM   5487  C CE  . LYS B 1 359 ? -31.209 -37.693 27.389  1.00 84.25  ? 370  LYS B CE  1 
ATOM   5488  N NZ  . LYS B 1 359 ? -31.953 -37.392 28.650  1.00 84.25  ? 370  LYS B NZ  1 
ATOM   5489  N N   . VAL B 1 360 ? -28.139 -33.705 23.323  1.00 63.57  ? 371  VAL B N   1 
ATOM   5490  C CA  . VAL B 1 360 ? -27.195 -32.907 22.541  1.00 63.57  ? 371  VAL B CA  1 
ATOM   5491  C C   . VAL B 1 360 ? -26.465 -31.727 23.165  1.00 63.57  ? 371  VAL B C   1 
ATOM   5492  O O   . VAL B 1 360 ? -27.046 -30.902 23.875  1.00 63.57  ? 371  VAL B O   1 
ATOM   5493  C CB  . VAL B 1 360 ? -27.828 -32.380 21.236  1.00 55.32  ? 371  VAL B CB  1 
ATOM   5494  C CG1 . VAL B 1 360 ? -28.277 -30.944 21.412  1.00 55.32  ? 371  VAL B CG1 1 
ATOM   5495  C CG2 . VAL B 1 360 ? -26.811 -32.445 20.110  1.00 55.32  ? 371  VAL B CG2 1 
ATOM   5496  N N   . LEU B 1 361 ? -25.173 -31.651 22.866  1.00 49.14  ? 372  LEU B N   1 
ATOM   5497  C CA  . LEU B 1 361 ? -24.344 -30.558 23.332  1.00 49.14  ? 372  LEU B CA  1 
ATOM   5498  C C   . LEU B 1 361 ? -23.779 -29.887 22.073  1.00 49.14  ? 372  LEU B C   1 
ATOM   5499  O O   . LEU B 1 361 ? -23.073 -30.507 21.288  1.00 49.14  ? 372  LEU B O   1 
ATOM   5500  C CB  . LEU B 1 361 ? -23.215 -31.079 24.238  1.00 43.27  ? 372  LEU B CB  1 
ATOM   5501  C CG  . LEU B 1 361 ? -23.548 -31.507 25.670  1.00 43.27  ? 372  LEU B CG  1 
ATOM   5502  C CD1 . LEU B 1 361 ? -24.291 -32.829 25.665  1.00 43.27  ? 372  LEU B CD1 1 
ATOM   5503  C CD2 . LEU B 1 361 ? -22.287 -31.667 26.462  1.00 43.27  ? 372  LEU B CD2 1 
ATOM   5504  N N   . LYS B 1 362 ? -24.113 -28.626 21.853  1.00 80.83  ? 373  LYS B N   1 
ATOM   5505  C CA  . LYS B 1 362 ? -23.594 -27.961 20.671  1.00 80.83  ? 373  LYS B CA  1 
ATOM   5506  C C   . LYS B 1 362 ? -22.332 -27.151 20.955  1.00 80.83  ? 373  LYS B C   1 
ATOM   5507  O O   . LYS B 1 362 ? -22.231 -25.975 20.586  1.00 80.83  ? 373  LYS B O   1 
ATOM   5508  C CB  . LYS B 1 362 ? -24.664 -27.064 20.034  1.00 103.49 ? 373  LYS B CB  1 
ATOM   5509  C CG  . LYS B 1 362 ? -25.759 -27.812 19.262  1.00 103.49 ? 373  LYS B CG  1 
ATOM   5510  C CD  . LYS B 1 362 ? -26.608 -26.830 18.455  1.00 103.49 ? 373  LYS B CD  1 
ATOM   5511  C CE  . LYS B 1 362 ? -27.771 -27.507 17.751  1.00 103.49 ? 373  LYS B CE  1 
ATOM   5512  N NZ  . LYS B 1 362 ? -28.548 -26.535 16.928  1.00 103.49 ? 373  LYS B NZ  1 
ATOM   5513  N N   . LEU B 1 363 ? -21.366 -27.790 21.604  1.00 36.11  ? 374  LEU B N   1 
ATOM   5514  C CA  . LEU B 1 363 ? -20.098 -27.135 21.919  1.00 36.11  ? 374  LEU B CA  1 
ATOM   5515  C C   . LEU B 1 363 ? -19.439 -26.581 20.652  1.00 36.11  ? 374  LEU B C   1 
ATOM   5516  O O   . LEU B 1 363 ? -19.323 -27.278 19.646  1.00 36.11  ? 374  LEU B O   1 
ATOM   5517  C CB  . LEU B 1 363 ? -19.156 -28.136 22.612  1.00 39.69  ? 374  LEU B CB  1 
ATOM   5518  C CG  . LEU B 1 363 ? -19.351 -28.321 24.122  1.00 39.69  ? 374  LEU B CG  1 
ATOM   5519  C CD1 . LEU B 1 363 ? -18.566 -29.512 24.643  1.00 39.69  ? 374  LEU B CD1 1 
ATOM   5520  C CD2 . LEU B 1 363 ? -18.922 -27.030 24.817  1.00 39.69  ? 374  LEU B CD2 1 
ATOM   5521  N N   . HIS B 1 364 ? -19.004 -25.330 20.694  1.00 60.67  ? 375  HIS B N   1 
ATOM   5522  C CA  . HIS B 1 364 ? -18.369 -24.734 19.519  1.00 60.67  ? 375  HIS B CA  1 
ATOM   5523  C C   . HIS B 1 364 ? -17.396 -25.716 18.873  1.00 60.67  ? 375  HIS B C   1 
ATOM   5524  O O   . HIS B 1 364 ? -16.763 -26.513 19.558  1.00 60.67  ? 375  HIS B O   1 
ATOM   5525  C CB  . HIS B 1 364 ? -17.617 -23.450 19.903  1.00 81.78  ? 375  HIS B CB  1 
ATOM   5526  C CG  . HIS B 1 364 ? -17.040 -22.703 18.735  1.00 81.78  ? 375  HIS B CG  1 
ATOM   5527  N ND1 . HIS B 1 364 ? -16.238 -23.301 17.788  1.00 81.78  ? 375  HIS B ND1 1 
ATOM   5528  C CD2 . HIS B 1 364 ? -17.125 -21.398 18.384  1.00 81.78  ? 375  HIS B CD2 1 
ATOM   5529  C CE1 . HIS B 1 364 ? -15.855 -22.398 16.904  1.00 81.78  ? 375  HIS B CE1 1 
ATOM   5530  N NE2 . HIS B 1 364 ? -16.379 -21.235 17.243  1.00 81.78  ? 375  HIS B NE2 1 
ATOM   5531  N N   . PRO B 1 365 ? -17.274 -25.676 17.540  1.00 59.10  ? 376  PRO B N   1 
ATOM   5532  C CA  . PRO B 1 365 ? -16.360 -26.577 16.844  1.00 59.10  ? 376  PRO B CA  1 
ATOM   5533  C C   . PRO B 1 365 ? -14.900 -26.507 17.340  1.00 59.10  ? 376  PRO B C   1 
ATOM   5534  O O   . PRO B 1 365 ? -14.234 -27.536 17.471  1.00 59.10  ? 376  PRO B O   1 
ATOM   5535  C CB  . PRO B 1 365 ? -16.511 -26.136 15.394  1.00 64.28  ? 376  PRO B CB  1 
ATOM   5536  C CG  . PRO B 1 365 ? -17.936 -25.759 15.332  1.00 64.28  ? 376  PRO B CG  1 
ATOM   5537  C CD  . PRO B 1 365 ? -18.098 -24.935 16.571  1.00 64.28  ? 376  PRO B CD  1 
ATOM   5538  N N   . CYS B 1 366 ? -14.409 -25.299 17.615  1.00 52.78  ? 377  CYS B N   1 
ATOM   5539  C CA  . CYS B 1 366 ? -13.039 -25.116 18.088  1.00 52.78  ? 377  CYS B CA  1 
ATOM   5540  C C   . CYS B 1 366 ? -12.812 -25.580 19.527  1.00 52.78  ? 377  CYS B C   1 
ATOM   5541  O O   . CYS B 1 366 ? -11.671 -25.595 20.001  1.00 52.78  ? 377  CYS B O   1 
ATOM   5542  C CB  . CYS B 1 366 ? -12.632 -23.644 17.989  1.00 108.09 ? 377  CYS B CB  1 
ATOM   5543  S SG  . CYS B 1 366 ? -12.401 -23.019 16.324  1.00 108.09 ? 377  CYS B SG  1 
ATOM   5544  N N   . LEU B 1 367 ? -13.888 -25.944 20.221  1.00 49.42  ? 378  LEU B N   1 
ATOM   5545  C CA  . LEU B 1 367 ? -13.789 -26.369 21.612  1.00 49.42  ? 378  LEU B CA  1 
ATOM   5546  C C   . LEU B 1 367 ? -14.296 -27.774 21.836  1.00 49.42  ? 378  LEU B C   1 
ATOM   5547  O O   . LEU B 1 367 ? -14.123 -28.336 22.915  1.00 49.42  ? 378  LEU B O   1 
ATOM   5548  C CB  . LEU B 1 367 ? -14.564 -25.400 22.515  1.00 43.19  ? 378  LEU B CB  1 
ATOM   5549  C CG  . LEU B 1 367 ? -13.875 -24.146 23.076  1.00 43.19  ? 378  LEU B CG  1 
ATOM   5550  C CD1 . LEU B 1 367 ? -13.058 -23.410 22.035  1.00 43.19  ? 378  LEU B CD1 1 
ATOM   5551  C CD2 . LEU B 1 367 ? -14.950 -23.240 23.624  1.00 43.19  ? 378  LEU B CD2 1 
ATOM   5552  N N   . ALA B 1 368 ? -14.925 -28.342 20.817  1.00 51.49  ? 379  ALA B N   1 
ATOM   5553  C CA  . ALA B 1 368 ? -15.461 -29.689 20.930  1.00 51.49  ? 379  ALA B CA  1 
ATOM   5554  C C   . ALA B 1 368 ? -14.343 -30.660 21.239  1.00 51.49  ? 379  ALA B C   1 
ATOM   5555  O O   . ALA B 1 368 ? -13.290 -30.626 20.600  1.00 51.49  ? 379  ALA B O   1 
ATOM   5556  C CB  . ALA B 1 368 ? -16.143 -30.089 19.647  1.00 78.99  ? 379  ALA B CB  1 
ATOM   5557  N N   . PRO B 1 369 ? -14.548 -31.538 22.233  1.00 31.35  ? 380  PRO B N   1 
ATOM   5558  C CA  . PRO B 1 369 ? -13.523 -32.516 22.598  1.00 31.35  ? 380  PRO B CA  1 
ATOM   5559  C C   . PRO B 1 369 ? -13.156 -33.420 21.423  1.00 31.35  ? 380  PRO B C   1 
ATOM   5560  O O   . PRO B 1 369 ? -12.010 -33.412 20.966  1.00 31.35  ? 380  PRO B O   1 
ATOM   5561  C CB  . PRO B 1 369 ? -14.167 -33.273 23.752  1.00 86.14  ? 380  PRO B CB  1 
ATOM   5562  C CG  . PRO B 1 369 ? -15.625 -33.160 23.452  1.00 86.14  ? 380  PRO B CG  1 
ATOM   5563  C CD  . PRO B 1 369 ? -15.756 -31.724 23.046  1.00 86.14  ? 380  PRO B CD  1 
ATOM   5564  N N   . ILE B 1 370 ? -14.128 -34.164 20.901  1.00 83.76  ? 381  ILE B N   1 
ATOM   5565  C CA  . ILE B 1 370 ? -13.851 -35.064 19.784  1.00 83.76  ? 381  ILE B CA  1 
ATOM   5566  C C   . ILE B 1 370 ? -14.506 -34.751 18.422  1.00 83.76  ? 381  ILE B C   1 
ATOM   5567  O O   . ILE B 1 370 ? -15.575 -35.255 18.090  1.00 83.76  ? 381  ILE B O   1 
ATOM   5568  C CB  . ILE B 1 370 ? -14.173 -36.504 20.190  1.00 72.11  ? 381  ILE B CB  1 
ATOM   5569  C CG1 . ILE B 1 370 ? -15.444 -36.526 21.035  1.00 72.11  ? 381  ILE B CG1 1 
ATOM   5570  C CG2 . ILE B 1 370 ? -13.011 -37.091 20.974  1.00 72.11  ? 381  ILE B CG2 1 
ATOM   5571  C CD1 . ILE B 1 370 ? -15.782 -37.899 21.596  1.00 72.11  ? 381  ILE B CD1 1 
ATOM   5572  N N   . LYS B 1 371 ? -13.810 -33.931 17.637  1.00 61.68  ? 382  LYS B N   1 
ATOM   5573  C CA  . LYS B 1 371 ? -14.207 -33.484 16.302  1.00 61.68  ? 382  LYS B CA  1 
ATOM   5574  C C   . LYS B 1 371 ? -15.043 -34.397 15.416  1.00 61.68  ? 382  LYS B C   1 
ATOM   5575  O O   . LYS B 1 371 ? -15.795 -33.904 14.583  1.00 61.68  ? 382  LYS B O   1 
ATOM   5576  C CB  . LYS B 1 371 ? -12.954 -33.086 15.507  1.00 38.06  ? 382  LYS B CB  1 
ATOM   5577  C CG  . LYS B 1 371 ? -12.553 -31.625 15.634  1.00 38.06  ? 382  LYS B CG  1 
ATOM   5578  C CD  . LYS B 1 371 ? -12.464 -31.168 17.096  1.00 38.06  ? 382  LYS B CD  1 
ATOM   5579  C CE  . LYS B 1 371 ? -12.238 -29.659 17.201  1.00 38.06  ? 382  LYS B CE  1 
ATOM   5580  N NZ  . LYS B 1 371 ? -12.506 -29.126 18.565  1.00 38.06  ? 382  LYS B NZ  1 
ATOM   5581  N N   . VAL B 1 372 ? -14.909 -35.712 15.561  1.00 59.42  ? 383  VAL B N   1 
ATOM   5582  C CA  . VAL B 1 372 ? -15.663 -36.624 14.703  1.00 59.42  ? 383  VAL B CA  1 
ATOM   5583  C C   . VAL B 1 372 ? -15.502 -38.096 15.034  1.00 59.42  ? 383  VAL B C   1 
ATOM   5584  O O   . VAL B 1 372 ? -14.390 -38.611 15.119  1.00 59.42  ? 383  VAL B O   1 
ATOM   5585  C CB  . VAL B 1 372 ? -15.258 -36.448 13.220  1.00 43.17  ? 383  VAL B CB  1 
ATOM   5586  C CG1 . VAL B 1 372 ? -13.770 -36.661 13.059  1.00 43.17  ? 383  VAL B CG1 1 
ATOM   5587  C CG2 . VAL B 1 372 ? -15.999 -37.439 12.353  1.00 43.17  ? 383  VAL B CG2 1 
ATOM   5588  N N   . ALA B 1 373 ? -16.624 -38.776 15.208  1.00 49.43  ? 384  ALA B N   1 
ATOM   5589  C CA  . ALA B 1 373 ? -16.595 -40.196 15.489  1.00 49.43  ? 384  ALA B CA  1 
ATOM   5590  C C   . ALA B 1 373 ? -16.646 -40.869 14.142  1.00 49.43  ? 384  ALA B C   1 
ATOM   5591  O O   . ALA B 1 373 ? -16.571 -40.203 13.114  1.00 49.43  ? 384  ALA B O   1 
ATOM   5592  C CB  . ALA B 1 373 ? -17.792 -40.589 16.284  1.00 47.10  ? 384  ALA B CB  1 
ATOM   5593  N N   . LEU B 1 374 ? -16.773 -42.189 14.137  1.00 66.49  ? 385  LEU B N   1 
ATOM   5594  C CA  . LEU B 1 374 ? -16.859 -42.923 12.884  1.00 66.49  ? 385  LEU B CA  1 
ATOM   5595  C C   . LEU B 1 374 ? -16.896 -44.416 13.161  1.00 66.49  ? 385  LEU B C   1 
ATOM   5596  O O   . LEU B 1 374 ? -16.068 -44.942 13.905  1.00 66.49  ? 385  LEU B O   1 
ATOM   5597  C CB  . LEU B 1 374 ? -15.674 -42.582 11.971  1.00 20.55  ? 385  LEU B CB  1 
ATOM   5598  C CG  . LEU B 1 374 ? -14.459 -43.499 12.000  1.00 20.55  ? 385  LEU B CG  1 
ATOM   5599  C CD1 . LEU B 1 374 ? -13.381 -43.048 11.042  1.00 20.55  ? 385  LEU B CD1 1 
ATOM   5600  C CD2 . LEU B 1 374 ? -13.948 -43.511 13.388  1.00 20.55  ? 385  LEU B CD2 1 
ATOM   5601  N N   . ASP B 1 375 ? -17.877 -45.092 12.574  1.00 116.15 ? 386  ASP B N   1 
ATOM   5602  C CA  . ASP B 1 375 ? -18.026 -46.531 12.750  1.00 116.15 ? 386  ASP B CA  1 
ATOM   5603  C C   . ASP B 1 375 ? -17.991 -47.221 11.393  1.00 116.15 ? 386  ASP B C   1 
ATOM   5604  O O   . ASP B 1 375 ? -17.600 -46.629 10.384  1.00 116.15 ? 386  ASP B O   1 
ATOM   5605  C CB  . ASP B 1 375 ? -19.357 -46.862 13.447  1.00 93.12  ? 386  ASP B CB  1 
ATOM   5606  C CG  . ASP B 1 375 ? -19.415 -46.366 14.881  1.00 93.12  ? 386  ASP B CG  1 
ATOM   5607  O OD1 . ASP B 1 375 ? -18.721 -46.935 15.747  1.00 93.12  ? 386  ASP B OD1 1 
ATOM   5608  O OD2 . ASP B 1 375 ? -20.159 -45.402 15.144  1.00 93.12  ? 386  ASP B OD2 1 
ATOM   5609  N N   . VAL B 1 376 ? -18.403 -48.483 11.391  1.00 100.16 ? 387  VAL B N   1 
ATOM   5610  C CA  . VAL B 1 376 ? -18.463 -49.292 10.185  1.00 100.16 ? 387  VAL B CA  1 
ATOM   5611  C C   . VAL B 1 376 ? -19.896 -49.807 10.103  1.00 100.16 ? 387  VAL B C   1 
ATOM   5612  O O   . VAL B 1 376 ? -20.547 -50.001 11.134  1.00 100.16 ? 387  VAL B O   1 
ATOM   5613  C CB  . VAL B 1 376 ? -17.504 -50.477 10.272  1.00 46.13  ? 387  VAL B CB  1 
ATOM   5614  C CG1 . VAL B 1 376 ? -16.078 -49.980 10.391  1.00 46.13  ? 387  VAL B CG1 1 
ATOM   5615  C CG2 . VAL B 1 376 ? -17.859 -51.324 11.477  1.00 46.13  ? 387  VAL B CG2 1 
ATOM   5616  N N   . GLY B 1 377 ? -20.386 -50.020 8.885   1.00 122.96 ? 388  GLY B N   1 
ATOM   5617  C CA  . GLY B 1 377 ? -21.751 -50.489 8.714   1.00 122.96 ? 388  GLY B CA  1 
ATOM   5618  C C   . GLY B 1 377 ? -21.922 -51.649 7.754   1.00 122.96 ? 388  GLY B C   1 
ATOM   5619  O O   . GLY B 1 377 ? -21.005 -52.447 7.567   1.00 122.96 ? 388  GLY B O   1 
ATOM   5620  N N   . ARG B 1 378 ? -23.103 -51.737 7.146   1.00 146.32 ? 389  ARG B N   1 
ATOM   5621  C CA  . ARG B 1 378 ? -23.430 -52.807 6.205   1.00 146.32 ? 389  ARG B CA  1 
ATOM   5622  C C   . ARG B 1 378 ? -22.276 -53.226 5.294   1.00 146.32 ? 389  ARG B C   1 
ATOM   5623  O O   . ARG B 1 378 ? -21.770 -52.429 4.505   1.00 146.32 ? 389  ARG B O   1 
ATOM   5624  C CB  . ARG B 1 378 ? -24.648 -52.414 5.352   1.00 194.79 ? 389  ARG B CB  1 
ATOM   5625  C CG  . ARG B 1 378 ? -24.666 -50.972 4.851   1.00 194.79 ? 389  ARG B CG  1 
ATOM   5626  C CD  . ARG B 1 378 ? -25.115 -50.004 5.940   1.00 194.79 ? 389  ARG B CD  1 
ATOM   5627  N NE  . ARG B 1 378 ? -26.427 -50.356 6.480   1.00 194.79 ? 389  ARG B NE  1 
ATOM   5628  C CZ  . ARG B 1 378 ? -27.046 -49.681 7.444   1.00 194.79 ? 389  ARG B CZ  1 
ATOM   5629  N NH1 . ARG B 1 378 ? -26.478 -48.610 7.982   1.00 194.79 ? 389  ARG B NH1 1 
ATOM   5630  N NH2 . ARG B 1 378 ? -28.237 -50.078 7.873   1.00 194.79 ? 389  ARG B NH2 1 
ATOM   5631  N N   . GLY B 1 379 ? -21.871 -54.489 5.414   1.00 158.15 ? 390  GLY B N   1 
ATOM   5632  C CA  . GLY B 1 379 ? -20.782 -55.007 4.603   1.00 158.15 ? 390  GLY B CA  1 
ATOM   5633  C C   . GLY B 1 379 ? -20.008 -56.128 5.279   1.00 158.15 ? 390  GLY B C   1 
ATOM   5634  O O   . GLY B 1 379 ? -20.588 -56.932 6.011   1.00 158.15 ? 390  GLY B O   1 
ATOM   5635  N N   . PRO B 1 380 ? -18.688 -56.215 5.040   1.00 186.99 ? 391  PRO B N   1 
ATOM   5636  C CA  . PRO B 1 380 ? -17.843 -57.253 5.638   1.00 186.99 ? 391  PRO B CA  1 
ATOM   5637  C C   . PRO B 1 380 ? -17.535 -56.984 7.110   1.00 186.99 ? 391  PRO B C   1 
ATOM   5638  O O   . PRO B 1 380 ? -18.429 -57.009 7.956   1.00 186.99 ? 391  PRO B O   1 
ATOM   5639  C CB  . PRO B 1 380 ? -16.591 -57.213 4.765   1.00 71.36  ? 391  PRO B CB  1 
ATOM   5640  C CG  . PRO B 1 380 ? -16.493 -55.778 4.405   1.00 71.36  ? 391  PRO B CG  1 
ATOM   5641  C CD  . PRO B 1 380 ? -17.920 -55.420 4.063   1.00 71.36  ? 391  PRO B CD  1 
ATOM   5642  N N   . THR B 1 381 ? -16.261 -56.733 7.400   1.00 97.17  ? 392  THR B N   1 
ATOM   5643  C CA  . THR B 1 381 ? -15.795 -56.447 8.754   1.00 97.17  ? 392  THR B CA  1 
ATOM   5644  C C   . THR B 1 381 ? -14.332 -56.035 8.697   1.00 97.17  ? 392  THR B C   1 
ATOM   5645  O O   . THR B 1 381 ? -14.034 -54.850 8.554   1.00 97.17  ? 392  THR B O   1 
ATOM   5646  C CB  . THR B 1 381 ? -15.950 -57.670 9.678   1.00 80.88  ? 392  THR B CB  1 
ATOM   5647  O OG1 . THR B 1 381 ? -17.338 -57.860 9.981   1.00 80.88  ? 392  THR B OG1 1 
ATOM   5648  C CG2 . THR B 1 381 ? -15.175 -57.476 10.971  1.00 80.88  ? 392  THR B CG2 1 
ATOM   5649  N N   . LEU B 1 382 ? -13.425 -57.006 8.800   1.00 106.37 ? 393  LEU B N   1 
ATOM   5650  C CA  . LEU B 1 382 ? -11.990 -56.720 8.749   1.00 106.37 ? 393  LEU B CA  1 
ATOM   5651  C C   . LEU B 1 382 ? -11.753 -55.778 7.583   1.00 106.37 ? 393  LEU B C   1 
ATOM   5652  O O   . LEU B 1 382 ? -11.026 -54.796 7.704   1.00 106.37 ? 393  LEU B O   1 
ATOM   5653  C CB  . LEU B 1 382 ? -11.189 -58.005 8.529   1.00 85.76  ? 393  LEU B CB  1 
ATOM   5654  C CG  . LEU B 1 382 ? -9.676  -57.968 8.775   1.00 85.76  ? 393  LEU B CG  1 
ATOM   5655  C CD1 . LEU B 1 382 ? -9.095  -59.325 8.399   1.00 85.76  ? 393  LEU B CD1 1 
ATOM   5656  C CD2 . LEU B 1 382 ? -9.008  -56.866 7.971   1.00 85.76  ? 393  LEU B CD2 1 
ATOM   5657  N N   . GLU B 1 383 ? -12.390 -56.100 6.460   1.00 198.58 ? 394  GLU B N   1 
ATOM   5658  C CA  . GLU B 1 383 ? -12.300 -55.321 5.228   1.00 198.58 ? 394  GLU B CA  1 
ATOM   5659  C C   . GLU B 1 383 ? -12.815 -53.897 5.413   1.00 198.58 ? 394  GLU B C   1 
ATOM   5660  O O   . GLU B 1 383 ? -12.240 -52.944 4.880   1.00 198.58 ? 394  GLU B O   1 
ATOM   5661  C CB  . GLU B 1 383 ? -13.121 -55.997 4.122   1.00 141.92 ? 394  GLU B CB  1 
ATOM   5662  C CG  . GLU B 1 383 ? -12.524 -57.270 3.545   1.00 141.92 ? 394  GLU B CG  1 
ATOM   5663  C CD  . GLU B 1 383 ? -11.529 -56.995 2.431   1.00 141.92 ? 394  GLU B CD  1 
ATOM   5664  O OE1 . GLU B 1 383 ? -10.996 -57.967 1.851   1.00 141.92 ? 394  GLU B OE1 1 
ATOM   5665  O OE2 . GLU B 1 383 ? -11.284 -55.806 2.134   1.00 141.92 ? 394  GLU B OE2 1 
ATOM   5666  N N   . LEU B 1 384 ? -13.903 -53.759 6.168   1.00 72.85  ? 395  LEU B N   1 
ATOM   5667  C CA  . LEU B 1 384 ? -14.509 -52.455 6.392   1.00 72.85  ? 395  LEU B CA  1 
ATOM   5668  C C   . LEU B 1 384 ? -13.721 -51.585 7.370   1.00 72.85  ? 395  LEU B C   1 
ATOM   5669  O O   . LEU B 1 384 ? -13.519 -50.399 7.111   1.00 72.85  ? 395  LEU B O   1 
ATOM   5670  C CB  . LEU B 1 384 ? -15.957 -52.625 6.861   1.00 113.72 ? 395  LEU B CB  1 
ATOM   5671  C CG  . LEU B 1 384 ? -16.943 -51.571 6.339   1.00 113.72 ? 395  LEU B CG  1 
ATOM   5672  C CD1 . LEU B 1 384 ? -16.627 -50.219 6.955   1.00 113.72 ? 395  LEU B CD1 1 
ATOM   5673  C CD2 . LEU B 1 384 ? -16.867 -51.497 4.814   1.00 113.72 ? 395  LEU B CD2 1 
ATOM   5674  N N   . ARG B 1 385 ? -13.285 -52.155 8.493   1.00 124.14 ? 396  ARG B N   1 
ATOM   5675  C CA  . ARG B 1 385 ? -12.500 -51.375 9.446   1.00 124.14 ? 396  ARG B CA  1 
ATOM   5676  C C   . ARG B 1 385 ? -11.040 -51.334 9.000   1.00 124.14 ? 396  ARG B C   1 
ATOM   5677  O O   . ARG B 1 385 ? -10.124 -51.357 9.820   1.00 124.14 ? 396  ARG B O   1 
ATOM   5678  C CB  . ARG B 1 385 ? -12.618 -51.929 10.881  1.00 103.09 ? 396  ARG B CB  1 
ATOM   5679  C CG  . ARG B 1 385 ? -12.917 -53.405 11.003  1.00 103.09 ? 396  ARG B CG  1 
ATOM   5680  C CD  . ARG B 1 385 ? -13.052 -53.839 12.465  1.00 103.09 ? 396  ARG B CD  1 
ATOM   5681  N NE  . ARG B 1 385 ? -11.759 -54.070 13.109  1.00 103.09 ? 396  ARG B NE  1 
ATOM   5682  C CZ  . ARG B 1 385 ? -11.591 -54.726 14.259  1.00 103.09 ? 396  ARG B CZ  1 
ATOM   5683  N NH1 . ARG B 1 385 ? -12.637 -55.226 14.912  1.00 103.09 ? 396  ARG B NH1 1 
ATOM   5684  N NH2 . ARG B 1 385 ? -10.367 -54.900 14.749  1.00 103.09 ? 396  ARG B NH2 1 
ATOM   5685  N N   . GLN B 1 386 ? -10.845 -51.276 7.684   1.00 109.55 ? 397  GLN B N   1 
ATOM   5686  C CA  . GLN B 1 386 ? -9.518  -51.203 7.078   1.00 109.55 ? 397  GLN B CA  1 
ATOM   5687  C C   . GLN B 1 386 ? -9.174  -49.745 6.797   1.00 109.55 ? 397  GLN B C   1 
ATOM   5688  O O   . GLN B 1 386 ? -8.110  -49.258 7.181   1.00 109.55 ? 397  GLN B O   1 
ATOM   5689  C CB  . GLN B 1 386 ? -9.484  -51.990 5.764   1.00 149.40 ? 397  GLN B CB  1 
ATOM   5690  C CG  . GLN B 1 386 ? -9.340  -53.491 5.932   1.00 149.40 ? 397  GLN B CG  1 
ATOM   5691  C CD  . GLN B 1 386 ? -7.938  -53.908 6.337   1.00 149.40 ? 397  GLN B CD  1 
ATOM   5692  O OE1 . GLN B 1 386 ? -7.344  -53.338 7.254   1.00 149.40 ? 397  GLN B OE1 1 
ATOM   5693  N NE2 . GLN B 1 386 ? -7.404  -54.915 5.656   1.00 149.40 ? 397  GLN B NE2 1 
ATOM   5694  N N   . VAL B 1 387 ? -10.081 -49.054 6.116   1.00 166.92 ? 398  VAL B N   1 
ATOM   5695  C CA  . VAL B 1 387 ? -9.885  -47.649 5.788   1.00 166.92 ? 398  VAL B CA  1 
ATOM   5696  C C   . VAL B 1 387 ? -10.098 -46.794 7.037   1.00 166.92 ? 398  VAL B C   1 
ATOM   5697  O O   . VAL B 1 387 ? -9.568  -45.688 7.145   1.00 166.92 ? 398  VAL B O   1 
ATOM   5698  C CB  . VAL B 1 387 ? -10.867 -47.199 4.674   1.00 120.88 ? 398  VAL B CB  1 
ATOM   5699  C CG1 . VAL B 1 387 ? -12.301 -47.468 5.098   1.00 120.88 ? 398  VAL B CG1 1 
ATOM   5700  C CG2 . VAL B 1 387 ? -10.668 -45.723 4.361   1.00 120.88 ? 398  VAL B CG2 1 
ATOM   5701  N N   . CYS B 1 388 ? -10.873 -47.322 7.980   1.00 112.58 ? 399  CYS B N   1 
ATOM   5702  C CA  . CYS B 1 388 ? -11.165 -46.626 9.230   1.00 112.58 ? 399  CYS B CA  1 
ATOM   5703  C C   . CYS B 1 388 ? -9.877  -46.150 9.871   1.00 112.58 ? 399  CYS B C   1 
ATOM   5704  O O   . CYS B 1 388 ? -9.767  -45.004 10.305  1.00 112.58 ? 399  CYS B O   1 
ATOM   5705  C CB  . CYS B 1 388 ? -11.902 -47.561 10.192  1.00 71.94  ? 399  CYS B CB  1 
ATOM   5706  S SG  . CYS B 1 388 ? -13.557 -48.027 9.640   1.00 71.94  ? 399  CYS B SG  1 
ATOM   5707  N N   . GLN B 1 389 ? -8.902  -47.047 9.918   1.00 116.13 ? 400  GLN B N   1 
ATOM   5708  C CA  . GLN B 1 389 ? -7.609  -46.742 10.498  1.00 116.13 ? 400  GLN B CA  1 
ATOM   5709  C C   . GLN B 1 389 ? -6.769  -45.900 9.542   1.00 116.13 ? 400  GLN B C   1 
ATOM   5710  O O   . GLN B 1 389 ? -5.819  -45.229 9.952   1.00 116.13 ? 400  GLN B O   1 
ATOM   5711  C CB  . GLN B 1 389 ? -6.902  -48.044 10.855  1.00 120.26 ? 400  GLN B CB  1 
ATOM   5712  C CG  . GLN B 1 389 ? -7.681  -48.839 11.884  1.00 120.26 ? 400  GLN B CG  1 
ATOM   5713  C CD  . GLN B 1 389 ? -7.169  -50.246 12.052  1.00 120.26 ? 400  GLN B CD  1 
ATOM   5714  O OE1 . GLN B 1 389 ? -7.624  -50.983 12.932  1.00 120.26 ? 400  GLN B OE1 1 
ATOM   5715  N NE2 . GLN B 1 389 ? -6.223  -50.637 11.203  1.00 120.26 ? 400  GLN B NE2 1 
ATOM   5716  N N   . GLY B 1 390 ? -7.120  -45.939 8.262   1.00 65.49  ? 401  GLY B N   1 
ATOM   5717  C CA  . GLY B 1 390 ? -6.397  -45.134 7.298   1.00 65.49  ? 401  GLY B CA  1 
ATOM   5718  C C   . GLY B 1 390 ? -6.907  -43.714 7.455   1.00 65.49  ? 401  GLY B C   1 
ATOM   5719  O O   . GLY B 1 390 ? -6.265  -42.745 7.044   1.00 65.49  ? 401  GLY B O   1 
ATOM   5720  N N   . LEU B 1 391 ? -8.088  -43.610 8.058   1.00 89.85  ? 402  LEU B N   1 
ATOM   5721  C CA  . LEU B 1 391 ? -8.731  -42.334 8.315   1.00 89.85  ? 402  LEU B CA  1 
ATOM   5722  C C   . LEU B 1 391 ? -8.342  -41.865 9.694   1.00 89.85  ? 402  LEU B C   1 
ATOM   5723  O O   . LEU B 1 391 ? -7.784  -40.780 9.870   1.00 89.85  ? 402  LEU B O   1 
ATOM   5724  C CB  . LEU B 1 391 ? -10.245 -42.473 8.277   1.00 58.00  ? 402  LEU B CB  1 
ATOM   5725  C CG  . LEU B 1 391 ? -10.933 -42.041 6.988   1.00 58.00  ? 402  LEU B CG  1 
ATOM   5726  C CD1 . LEU B 1 391 ? -12.422 -41.807 7.268   1.00 58.00  ? 402  LEU B CD1 1 
ATOM   5727  C CD2 . LEU B 1 391 ? -10.285 -40.763 6.466   1.00 58.00  ? 402  LEU B CD2 1 
ATOM   5728  N N   . PHE B 1 392 ? -8.667  -42.692 10.680  1.00 58.22  ? 403  PHE B N   1 
ATOM   5729  C CA  . PHE B 1 392 ? -8.344  -42.381 12.063  1.00 58.22  ? 403  PHE B CA  1 
ATOM   5730  C C   . PHE B 1 392 ? -6.963  -41.740 12.074  1.00 58.22  ? 403  PHE B C   1 
ATOM   5731  O O   . PHE B 1 392 ? -6.768  -40.676 12.653  1.00 58.22  ? 403  PHE B O   1 
ATOM   5732  C CB  . PHE B 1 392 ? -8.340  -43.659 12.891  1.00 94.17  ? 403  PHE B CB  1 
ATOM   5733  C CG  . PHE B 1 392 ? -7.927  -43.451 14.302  1.00 94.17  ? 403  PHE B CG  1 
ATOM   5734  C CD1 . PHE B 1 392 ? -8.850  -43.073 15.260  1.00 94.17  ? 403  PHE B CD1 1 
ATOM   5735  C CD2 . PHE B 1 392 ? -6.598  -43.604 14.669  1.00 94.17  ? 403  PHE B CD2 1 
ATOM   5736  C CE1 . PHE B 1 392 ? -8.454  -42.850 16.555  1.00 94.17  ? 403  PHE B CE1 1 
ATOM   5737  C CE2 . PHE B 1 392 ? -6.194  -43.384 15.964  1.00 94.17  ? 403  PHE B CE2 1 
ATOM   5738  C CZ  . PHE B 1 392 ? -7.120  -43.006 16.907  1.00 94.17  ? 403  PHE B CZ  1 
ATOM   5739  N N   . ASN B 1 393 ? -6.021  -42.403 11.404  1.00 78.55  ? 404  ASN B N   1 
ATOM   5740  C CA  . ASN B 1 393 ? -4.651  -41.916 11.285  1.00 78.55  ? 404  ASN B CA  1 
ATOM   5741  C C   . ASN B 1 393 ? -4.673  -40.676 10.393  1.00 78.55  ? 404  ASN B C   1 
ATOM   5742  O O   . ASN B 1 393 ? -4.084  -39.648 10.723  1.00 78.55  ? 404  ASN B O   1 
ATOM   5743  C CB  . ASN B 1 393 ? -3.751  -42.975 10.633  1.00 103.64 ? 404  ASN B CB  1 
ATOM   5744  C CG  . ASN B 1 393 ? -3.480  -44.171 11.535  1.00 103.64 ? 404  ASN B CG  1 
ATOM   5745  O OD1 . ASN B 1 393 ? -4.395  -44.886 11.939  1.00 103.64 ? 404  ASN B OD1 1 
ATOM   5746  N ND2 . ASN B 1 393 ? -2.208  -44.397 11.842  1.00 103.64 ? 404  ASN B ND2 1 
ATOM   5747  N N   . GLU B 1 394 ? -5.364  -40.792 9.261   1.00 123.12 ? 405  GLU B N   1 
ATOM   5748  C CA  . GLU B 1 394 ? -5.481  -39.704 8.295   1.00 123.12 ? 405  GLU B CA  1 
ATOM   5749  C C   . GLU B 1 394 ? -5.870  -38.407 8.984   1.00 123.12 ? 405  GLU B C   1 
ATOM   5750  O O   . GLU B 1 394 ? -5.150  -37.411 8.905   1.00 123.12 ? 405  GLU B O   1 
ATOM   5751  C CB  . GLU B 1 394 ? -6.528  -40.047 7.230   1.00 194.00 ? 405  GLU B CB  1 
ATOM   5752  C CG  . GLU B 1 394 ? -6.533  -39.116 6.025   1.00 194.00 ? 405  GLU B CG  1 
ATOM   5753  C CD  . GLU B 1 394 ? -7.568  -39.507 4.982   1.00 194.00 ? 405  GLU B CD  1 
ATOM   5754  O OE1 . GLU B 1 394 ? -7.592  -40.691 4.578   1.00 194.00 ? 405  GLU B OE1 1 
ATOM   5755  O OE2 . GLU B 1 394 ? -8.352  -38.630 4.561   1.00 194.00 ? 405  GLU B OE2 1 
ATOM   5756  N N   . LEU B 1 395 ? -7.015  -38.423 9.656   1.00 141.99 ? 406  LEU B N   1 
ATOM   5757  C CA  . LEU B 1 395 ? -7.492  -37.243 10.361  1.00 141.99 ? 406  LEU B CA  1 
ATOM   5758  C C   . LEU B 1 395 ? -6.457  -36.779 11.383  1.00 141.99 ? 406  LEU B C   1 
ATOM   5759  O O   . LEU B 1 395 ? -6.229  -35.580 11.551  1.00 141.99 ? 406  LEU B O   1 
ATOM   5760  C CB  . LEU B 1 395 ? -8.812  -37.542 11.083  1.00 84.54  ? 406  LEU B CB  1 
ATOM   5761  C CG  . LEU B 1 395 ? -10.101 -37.838 10.310  1.00 84.54  ? 406  LEU B CG  1 
ATOM   5762  C CD1 . LEU B 1 395 ? -10.363 -36.719 9.335   1.00 84.54  ? 406  LEU B CD1 1 
ATOM   5763  C CD2 . LEU B 1 395 ? -9.998  -39.158 9.583   1.00 84.54  ? 406  LEU B CD2 1 
ATOM   5764  N N   . LEU B 1 396 ? -5.829  -37.741 12.051  1.00 83.30  ? 407  LEU B N   1 
ATOM   5765  C CA  . LEU B 1 396 ? -4.836  -37.454 13.076  1.00 83.30  ? 407  LEU B CA  1 
ATOM   5766  C C   . LEU B 1 396 ? -3.528  -36.843 12.604  1.00 83.30  ? 407  LEU B C   1 
ATOM   5767  O O   . LEU B 1 396 ? -2.969  -35.981 13.285  1.00 83.30  ? 407  LEU B O   1 
ATOM   5768  C CB  . LEU B 1 396 ? -4.540  -38.715 13.856  1.00 43.07  ? 407  LEU B CB  1 
ATOM   5769  C CG  . LEU B 1 396 ? -5.704  -39.162 14.720  1.00 43.07  ? 407  LEU B CG  1 
ATOM   5770  C CD1 . LEU B 1 396 ? -5.332  -40.455 15.413  1.00 43.07  ? 407  LEU B CD1 1 
ATOM   5771  C CD2 . LEU B 1 396 ? -6.033  -38.072 15.719  1.00 43.07  ? 407  LEU B CD2 1 
ATOM   5772  N N   . GLU B 1 397 ? -3.024  -37.293 11.461  1.00 111.24 ? 408  GLU B N   1 
ATOM   5773  C CA  . GLU B 1 397 ? -1.783  -36.746 10.924  1.00 111.24 ? 408  GLU B CA  1 
ATOM   5774  C C   . GLU B 1 397 ? -1.970  -35.248 10.654  1.00 111.24 ? 408  GLU B C   1 
ATOM   5775  O O   . GLU B 1 397 ? -1.041  -34.574 10.199  1.00 111.24 ? 408  GLU B O   1 
ATOM   5776  C CB  . GLU B 1 397 ? -1.418  -37.443 9.609   1.00 201.40 ? 408  GLU B CB  1 
ATOM   5777  C CG  . GLU B 1 397 ? -1.172  -38.940 9.714   1.00 201.40 ? 408  GLU B CG  1 
ATOM   5778  C CD  . GLU B 1 397 ? 0.159   -39.277 10.357  1.00 201.40 ? 408  GLU B CD  1 
ATOM   5779  O OE1 . GLU B 1 397 ? 1.202   -38.809 9.848   1.00 201.40 ? 408  GLU B OE1 1 
ATOM   5780  O OE2 . GLU B 1 397 ? 0.164   -40.017 11.365  1.00 201.40 ? 408  GLU B OE2 1 
ATOM   5781  N N   . ASN B 1 398 ? -3.166  -34.729 10.942  1.00 92.42  ? 409  ASN B N   1 
ATOM   5782  C CA  . ASN B 1 398 ? -3.476  -33.325 10.686  1.00 92.42  ? 409  ASN B CA  1 
ATOM   5783  C C   . ASN B 1 398 ? -4.130  -32.532 11.810  1.00 92.42  ? 409  ASN B C   1 
ATOM   5784  O O   . ASN B 1 398 ? -4.452  -31.358 11.632  1.00 92.42  ? 409  ASN B O   1 
ATOM   5785  C CB  . ASN B 1 398 ? -4.346  -33.233 9.438   1.00 92.63  ? 409  ASN B CB  1 
ATOM   5786  C CG  . ASN B 1 398 ? -3.582  -33.573 8.179   1.00 92.63  ? 409  ASN B CG  1 
ATOM   5787  O OD1 . ASN B 1 398 ? -2.732  -32.798 7.734   1.00 92.63  ? 409  ASN B OD1 1 
ATOM   5788  N ND2 . ASN B 1 398 ? -3.866  -34.741 7.605   1.00 92.63  ? 409  ASN B ND2 1 
ATOM   5789  N N   . GLY B 1 399 ? -4.343  -33.163 12.959  1.00 69.50  ? 410  GLY B N   1 
ATOM   5790  C CA  . GLY B 1 399 ? -4.940  -32.450 14.077  1.00 69.50  ? 410  GLY B CA  1 
ATOM   5791  C C   . GLY B 1 399 ? -6.440  -32.588 14.251  1.00 69.50  ? 410  GLY B C   1 
ATOM   5792  O O   . GLY B 1 399 ? -7.094  -31.690 14.782  1.00 69.50  ? 410  GLY B O   1 
ATOM   5793  N N   . ILE B 1 400 ? -6.991  -33.711 13.813  1.00 51.11  ? 411  ILE B N   1 
ATOM   5794  C CA  . ILE B 1 400 ? -8.418  -33.937 13.948  1.00 51.11  ? 411  ILE B CA  1 
ATOM   5795  C C   . ILE B 1 400 ? -8.688  -35.076 14.916  1.00 51.11  ? 411  ILE B C   1 
ATOM   5796  O O   . ILE B 1 400 ? -8.380  -36.230 14.644  1.00 51.11  ? 411  ILE B O   1 
ATOM   5797  C CB  . ILE B 1 400 ? -9.061  -34.234 12.578  1.00 71.66  ? 411  ILE B CB  1 
ATOM   5798  C CG1 . ILE B 1 400 ? -8.962  -32.990 11.686  1.00 71.66  ? 411  ILE B CG1 1 
ATOM   5799  C CG2 . ILE B 1 400 ? -10.514 -34.623 12.755  1.00 71.66  ? 411  ILE B CG2 1 
ATOM   5800  C CD1 . ILE B 1 400 ? -9.544  -33.163 10.296  1.00 71.66  ? 411  ILE B CD1 1 
ATOM   5801  N N   . SER B 1 401 ? -9.258  -34.735 16.061  1.00 50.54  ? 412  SER B N   1 
ATOM   5802  C CA  . SER B 1 401 ? -9.565  -35.724 17.078  1.00 50.54  ? 412  SER B CA  1 
ATOM   5803  C C   . SER B 1 401 ? -10.661 -36.702 16.658  1.00 50.54  ? 412  SER B C   1 
ATOM   5804  O O   . SER B 1 401 ? -11.841 -36.364 16.646  1.00 50.54  ? 412  SER B O   1 
ATOM   5805  C CB  . SER B 1 401 ? -9.962  -35.011 18.371  1.00 73.40  ? 412  SER B CB  1 
ATOM   5806  O OG  . SER B 1 401 ? -10.691 -33.824 18.098  1.00 73.40  ? 412  SER B OG  1 
ATOM   5807  N N   . VAL B 1 402 ? -10.271 -37.923 16.318  1.00 53.50  ? 413  VAL B N   1 
ATOM   5808  C CA  . VAL B 1 402 ? -11.246 -38.928 15.912  1.00 53.50  ? 413  VAL B CA  1 
ATOM   5809  C C   . VAL B 1 402 ? -11.682 -39.761 17.099  1.00 53.50  ? 413  VAL B C   1 
ATOM   5810  O O   . VAL B 1 402 ? -10.985 -39.845 18.099  1.00 53.50  ? 413  VAL B O   1 
ATOM   5811  C CB  . VAL B 1 402 ? -10.661 -39.905 14.882  1.00 90.16  ? 413  VAL B CB  1 
ATOM   5812  C CG1 . VAL B 1 402 ? -11.711 -40.924 14.477  1.00 90.16  ? 413  VAL B CG1 1 
ATOM   5813  C CG2 . VAL B 1 402 ? -10.155 -39.148 13.681  1.00 90.16  ? 413  VAL B CG2 1 
ATOM   5814  N N   . TRP B 1 403 ? -12.849 -40.367 16.989  1.00 48.00  ? 414  TRP B N   1 
ATOM   5815  C CA  . TRP B 1 403 ? -13.327 -41.238 18.041  1.00 48.00  ? 414  TRP B CA  1 
ATOM   5816  C C   . TRP B 1 403 ? -13.596 -42.536 17.334  1.00 48.00  ? 414  TRP B C   1 
ATOM   5817  O O   . TRP B 1 403 ? -14.646 -42.718 16.720  1.00 48.00  ? 414  TRP B O   1 
ATOM   5818  C CB  . TRP B 1 403 ? -14.615 -40.732 18.681  1.00 68.28  ? 414  TRP B CB  1 
ATOM   5819  C CG  . TRP B 1 403 ? -15.345 -41.818 19.398  1.00 68.28  ? 414  TRP B CG  1 
ATOM   5820  C CD1 . TRP B 1 403 ? -16.199 -42.725 18.846  1.00 68.28  ? 414  TRP B CD1 1 
ATOM   5821  C CD2 . TRP B 1 403 ? -15.220 -42.177 20.780  1.00 68.28  ? 414  TRP B CD2 1 
ATOM   5822  N NE1 . TRP B 1 403 ? -16.609 -43.630 19.789  1.00 68.28  ? 414  TRP B NE1 1 
ATOM   5823  C CE2 . TRP B 1 403 ? -16.021 -43.318 20.988  1.00 68.28  ? 414  TRP B CE2 1 
ATOM   5824  C CE3 . TRP B 1 403 ? -14.506 -41.649 21.864  1.00 68.28  ? 414  TRP B CE3 1 
ATOM   5825  C CZ2 . TRP B 1 403 ? -16.128 -43.944 22.237  1.00 68.28  ? 414  TRP B CZ2 1 
ATOM   5826  C CZ3 . TRP B 1 403 ? -14.616 -42.272 23.109  1.00 68.28  ? 414  TRP B CZ3 1 
ATOM   5827  C CH2 . TRP B 1 403 ? -15.419 -43.406 23.279  1.00 68.28  ? 414  TRP B CH2 1 
ATOM   5828  N N   . PRO B 1 404 ? -12.628 -43.453 17.372  1.00 70.35  ? 415  PRO B N   1 
ATOM   5829  C CA  . PRO B 1 404 ? -12.826 -44.728 16.708  1.00 70.35  ? 415  PRO B CA  1 
ATOM   5830  C C   . PRO B 1 404 ? -13.815 -45.552 17.498  1.00 70.35  ? 415  PRO B C   1 
ATOM   5831  O O   . PRO B 1 404 ? -13.478 -46.102 18.547  1.00 70.35  ? 415  PRO B O   1 
ATOM   5832  C CB  . PRO B 1 404 ? -11.432 -45.324 16.709  1.00 49.24  ? 415  PRO B CB  1 
ATOM   5833  C CG  . PRO B 1 404 ? -10.918 -44.874 17.991  1.00 49.24  ? 415  PRO B CG  1 
ATOM   5834  C CD  . PRO B 1 404 ? -11.303 -43.414 18.002  1.00 49.24  ? 415  PRO B CD  1 
ATOM   5835  N N   . GLY B 1 405 ? -15.045 -45.589 16.996  1.00 106.61 ? 416  GLY B N   1 
ATOM   5836  C CA  . GLY B 1 405 ? -16.098 -46.365 17.616  1.00 106.61 ? 416  GLY B CA  1 
ATOM   5837  C C   . GLY B 1 405 ? -16.225 -47.619 16.780  1.00 106.61 ? 416  GLY B C   1 
ATOM   5838  O O   . GLY B 1 405 ? -16.973 -48.535 17.112  1.00 106.61 ? 416  GLY B O   1 
ATOM   5839  N N   . TYR B 1 406 ? -15.474 -47.646 15.682  1.00 77.01  ? 417  TYR B N   1 
ATOM   5840  C CA  . TYR B 1 406 ? -15.467 -48.773 14.766  1.00 77.01  ? 417  TYR B CA  1 
ATOM   5841  C C   . TYR B 1 406 ? -14.780 -49.960 15.409  1.00 77.01  ? 417  TYR B C   1 
ATOM   5842  O O   . TYR B 1 406 ? -14.184 -50.791 14.722  1.00 77.01  ? 417  TYR B O   1 
ATOM   5843  C CB  . TYR B 1 406 ? -14.746 -48.404 13.464  1.00 82.64  ? 417  TYR B CB  1 
ATOM   5844  C CG  . TYR B 1 406 ? -13.312 -47.927 13.626  1.00 82.64  ? 417  TYR B CG  1 
ATOM   5845  C CD1 . TYR B 1 406 ? -12.329 -48.752 14.178  1.00 82.64  ? 417  TYR B CD1 1 
ATOM   5846  C CD2 . TYR B 1 406 ? -12.938 -46.646 13.217  1.00 82.64  ? 417  TYR B CD2 1 
ATOM   5847  C CE1 . TYR B 1 406 ? -11.011 -48.313 14.323  1.00 82.64  ? 417  TYR B CE1 1 
ATOM   5848  C CE2 . TYR B 1 406 ? -11.623 -46.193 13.353  1.00 82.64  ? 417  TYR B CE2 1 
ATOM   5849  C CZ  . TYR B 1 406 ? -10.662 -47.027 13.908  1.00 82.64  ? 417  TYR B CZ  1 
ATOM   5850  O OH  . TYR B 1 406 ? -9.365  -46.566 14.065  1.00 82.64  ? 417  TYR B OH  1 
ATOM   5851  N N   . LEU B 1 407 ? -14.858 -50.042 16.730  1.00 71.28  ? 418  LEU B N   1 
ATOM   5852  C CA  . LEU B 1 407 ? -14.232 -51.140 17.443  1.00 71.28  ? 418  LEU B CA  1 
ATOM   5853  C C   . LEU B 1 407 ? -15.099 -51.659 18.581  1.00 71.28  ? 418  LEU B C   1 
ATOM   5854  O O   . LEU B 1 407 ? -14.595 -52.305 19.497  1.00 71.28  ? 418  LEU B O   1 
ATOM   5855  C CB  . LEU B 1 407 ? -12.870 -50.698 17.990  1.00 81.19  ? 418  LEU B CB  1 
ATOM   5856  C CG  . LEU B 1 407 ? -11.798 -50.307 16.963  1.00 81.19  ? 418  LEU B CG  1 
ATOM   5857  C CD1 . LEU B 1 407 ? -10.591 -49.678 17.657  1.00 81.19  ? 418  LEU B CD1 1 
ATOM   5858  C CD2 . LEU B 1 407 ? -11.391 -51.537 16.166  1.00 81.19  ? 418  LEU B CD2 1 
ATOM   5859  N N   . GLU B 1 408 ? -16.401 -51.393 18.534  1.00 88.13  ? 419  GLU B N   1 
ATOM   5860  C CA  . GLU B 1 408 ? -17.274 -51.866 19.600  1.00 88.13  ? 419  GLU B CA  1 
ATOM   5861  C C   . GLU B 1 408 ? -17.948 -53.178 19.234  1.00 88.13  ? 419  GLU B C   1 
ATOM   5862  O O   . GLU B 1 408 ? -17.297 -54.219 19.233  1.00 88.13  ? 419  GLU B O   1 
ATOM   5863  C CB  . GLU B 1 408 ? -18.324 -50.813 19.950  1.00 170.29 ? 419  GLU B CB  1 
ATOM   5864  C CG  . GLU B 1 408 ? -19.072 -51.135 21.231  1.00 170.29 ? 419  GLU B CG  1 
ATOM   5865  C CD  . GLU B 1 408 ? -19.878 -49.965 21.745  1.00 170.29 ? 419  GLU B CD  1 
ATOM   5866  O OE1 . GLU B 1 408 ? -19.280 -48.896 21.997  1.00 170.29 ? 419  GLU B OE1 1 
ATOM   5867  O OE2 . GLU B 1 408 ? -21.107 -50.115 21.902  1.00 170.29 ? 419  GLU B OE2 1 
ATOM   5868  N N   . THR B 1 409 ? -19.241 -53.138 18.919  1.00 169.65 ? 420  THR B N   1 
ATOM   5869  C CA  . THR B 1 409 ? -19.965 -54.356 18.562  1.00 169.65 ? 420  THR B CA  1 
ATOM   5870  C C   . THR B 1 409 ? -21.147 -54.124 17.613  1.00 169.65 ? 420  THR B C   1 
ATOM   5871  O O   . THR B 1 409 ? -20.975 -53.588 16.518  1.00 169.65 ? 420  THR B O   1 
ATOM   5872  C CB  . THR B 1 409 ? -20.462 -55.088 19.833  1.00 132.83 ? 420  THR B CB  1 
ATOM   5873  O OG1 . THR B 1 409 ? -21.154 -56.285 19.457  1.00 132.83 ? 420  THR B OG1 1 
ATOM   5874  C CG2 . THR B 1 409 ? -21.389 -54.187 20.651  1.00 132.83 ? 420  THR B CG2 1 
ATOM   5875  N N   . MET B 1 410 ? -22.339 -54.538 18.035  1.00 201.99 ? 421  MET B N   1 
ATOM   5876  C CA  . MET B 1 410 ? -23.553 -54.393 17.234  1.00 201.99 ? 421  MET B CA  1 
ATOM   5877  C C   . MET B 1 410 ? -23.695 -52.995 16.650  1.00 201.99 ? 421  MET B C   1 
ATOM   5878  O O   . MET B 1 410 ? -23.042 -52.055 17.106  1.00 201.99 ? 421  MET B O   1 
ATOM   5879  C CB  . MET B 1 410 ? -24.789 -54.696 18.087  1.00 133.81 ? 421  MET B CB  1 
ATOM   5880  C CG  . MET B 1 410 ? -25.034 -53.687 19.206  1.00 133.81 ? 421  MET B CG  1 
ATOM   5881  S SD  . MET B 1 410 ? -26.632 -53.919 20.023  1.00 133.81 ? 421  MET B SD  1 
ATOM   5882  C CE  . MET B 1 410 ? -26.193 -55.084 21.314  1.00 133.81 ? 421  MET B CE  1 
ATOM   5883  N N   . GLN B 1 411 ? -24.558 -52.858 15.645  1.00 201.99 ? 422  GLN B N   1 
ATOM   5884  C CA  . GLN B 1 411 ? -24.788 -51.558 15.026  1.00 201.99 ? 422  GLN B CA  1 
ATOM   5885  C C   . GLN B 1 411 ? -25.298 -50.599 16.094  1.00 201.99 ? 422  GLN B C   1 
ATOM   5886  O O   . GLN B 1 411 ? -25.395 -49.394 15.863  1.00 201.99 ? 422  GLN B O   1 
ATOM   5887  C CB  . GLN B 1 411 ? -25.814 -51.662 13.883  1.00 100.13 ? 422  GLN B CB  1 
ATOM   5888  C CG  . GLN B 1 411 ? -27.151 -52.314 14.247  1.00 100.13 ? 422  GLN B CG  1 
ATOM   5889  C CD  . GLN B 1 411 ? -28.218 -52.115 13.170  1.00 100.13 ? 422  GLN B CD  1 
ATOM   5890  O OE1 . GLN B 1 411 ? -27.993 -52.401 11.993  1.00 100.13 ? 422  GLN B OE1 1 
ATOM   5891  N NE2 . GLN B 1 411 ? -29.387 -51.625 13.576  1.00 100.13 ? 422  GLN B NE2 1 
ATOM   5892  N N   . SER B 1 412 ? -25.612 -51.153 17.265  1.00 184.20 ? 423  SER B N   1 
ATOM   5893  C CA  . SER B 1 412 ? -26.118 -50.381 18.394  1.00 184.20 ? 423  SER B CA  1 
ATOM   5894  C C   . SER B 1 412 ? -27.202 -49.422 17.921  1.00 184.20 ? 423  SER B C   1 
ATOM   5895  O O   . SER B 1 412 ? -27.376 -48.340 18.483  1.00 184.20 ? 423  SER B O   1 
ATOM   5896  C CB  . SER B 1 412 ? -24.979 -49.598 19.054  1.00 135.59 ? 423  SER B CB  1 
ATOM   5897  O OG  . SER B 1 412 ? -24.401 -48.667 18.157  1.00 135.59 ? 423  SER B OG  1 
ATOM   5898  N N   . SER B 1 413 ? -27.928 -49.847 16.888  1.00 123.50 ? 424  SER B N   1 
ATOM   5899  C CA  . SER B 1 413 ? -28.997 -49.061 16.272  1.00 123.50 ? 424  SER B CA  1 
ATOM   5900  C C   . SER B 1 413 ? -28.347 -48.038 15.340  1.00 123.50 ? 424  SER B C   1 
ATOM   5901  O O   . SER B 1 413 ? -27.543 -48.385 14.470  1.00 123.50 ? 424  SER B O   1 
ATOM   5902  C CB  . SER B 1 413 ? -29.847 -48.356 17.351  1.00 76.93  ? 424  SER B CB  1 
ATOM   5903  O OG  . SER B 1 413 ? -30.936 -47.622 16.800  1.00 76.93  ? 424  SER B OG  1 
ATOM   5904  N N   . LEU B 1 414 ? -28.697 -46.777 15.533  1.00 72.32  ? 425  LEU B N   1 
ATOM   5905  C CA  . LEU B 1 414 ? -28.158 -45.691 14.736  1.00 72.32  ? 425  LEU B CA  1 
ATOM   5906  C C   . LEU B 1 414 ? -28.672 -44.444 15.431  1.00 72.32  ? 425  LEU B C   1 
ATOM   5907  O O   . LEU B 1 414 ? -28.005 -43.415 15.468  1.00 72.32  ? 425  LEU B O   1 
ATOM   5908  C CB  . LEU B 1 414 ? -28.689 -45.774 13.306  1.00 62.17  ? 425  LEU B CB  1 
ATOM   5909  C CG  . LEU B 1 414 ? -27.940 -45.031 12.202  1.00 62.17  ? 425  LEU B CG  1 
ATOM   5910  C CD1 . LEU B 1 414 ? -26.495 -45.527 12.119  1.00 62.17  ? 425  LEU B CD1 1 
ATOM   5911  C CD2 . LEU B 1 414 ? -28.668 -45.266 10.880  1.00 62.17  ? 425  LEU B CD2 1 
ATOM   5912  N N   . GLU B 1 415 ? -29.875 -44.556 15.982  1.00 191.34 ? 426  GLU B N   1 
ATOM   5913  C CA  . GLU B 1 415 ? -30.474 -43.457 16.718  1.00 191.34 ? 426  GLU B CA  1 
ATOM   5914  C C   . GLU B 1 415 ? -29.846 -43.548 18.103  1.00 191.34 ? 426  GLU B C   1 
ATOM   5915  O O   . GLU B 1 415 ? -29.628 -42.538 18.772  1.00 191.34 ? 426  GLU B O   1 
ATOM   5916  C CB  . GLU B 1 415 ? -31.996 -43.623 16.819  1.00 141.85 ? 426  GLU B CB  1 
ATOM   5917  C CG  . GLU B 1 415 ? -32.728 -43.731 15.482  1.00 141.85 ? 426  GLU B CG  1 
ATOM   5918  C CD  . GLU B 1 415 ? -32.909 -45.170 15.018  1.00 141.85 ? 426  GLU B CD  1 
ATOM   5919  O OE1 . GLU B 1 415 ? -31.895 -45.886 14.888  1.00 141.85 ? 426  GLU B OE1 1 
ATOM   5920  O OE2 . GLU B 1 415 ? -34.067 -45.585 14.784  1.00 141.85 ? 426  GLU B OE2 1 
ATOM   5921  N N   . GLN B 1 416 ? -29.549 -44.779 18.515  1.00 109.86 ? 427  GLN B N   1 
ATOM   5922  C CA  . GLN B 1 416 ? -28.930 -45.041 19.809  1.00 109.86 ? 427  GLN B CA  1 
ATOM   5923  C C   . GLN B 1 416 ? -27.429 -44.785 19.692  1.00 109.86 ? 427  GLN B C   1 
ATOM   5924  O O   . GLN B 1 416 ? -26.688 -44.872 20.675  1.00 109.86 ? 427  GLN B O   1 
ATOM   5925  C CB  . GLN B 1 416 ? -29.152 -46.496 20.226  1.00 144.40 ? 427  GLN B CB  1 
ATOM   5926  C CG  . GLN B 1 416 ? -30.599 -46.949 20.249  1.00 144.40 ? 427  GLN B CG  1 
ATOM   5927  C CD  . GLN B 1 416 ? -30.726 -48.433 20.545  1.00 144.40 ? 427  GLN B CD  1 
ATOM   5928  O OE1 . GLN B 1 416 ? -31.819 -48.997 20.496  1.00 144.40 ? 427  GLN B OE1 1 
ATOM   5929  N NE2 . GLN B 1 416 ? -29.603 -49.073 20.855  1.00 144.40 ? 427  GLN B NE2 1 
ATOM   5930  N N   . LEU B 1 417 ? -26.984 -44.479 18.478  1.00 106.56 ? 428  LEU B N   1 
ATOM   5931  C CA  . LEU B 1 417 ? -25.574 -44.219 18.232  1.00 106.56 ? 428  LEU B CA  1 
ATOM   5932  C C   . LEU B 1 417 ? -25.381 -42.771 17.824  1.00 106.56 ? 428  LEU B C   1 
ATOM   5933  O O   . LEU B 1 417 ? -24.276 -42.239 17.896  1.00 106.56 ? 428  LEU B O   1 
ATOM   5934  C CB  . LEU B 1 417 ? -25.045 -45.151 17.131  1.00 85.61  ? 428  LEU B CB  1 
ATOM   5935  C CG  . LEU B 1 417 ? -23.567 -45.053 16.728  1.00 85.61  ? 428  LEU B CG  1 
ATOM   5936  C CD1 . LEU B 1 417 ? -22.682 -45.141 17.954  1.00 85.61  ? 428  LEU B CD1 1 
ATOM   5937  C CD2 . LEU B 1 417 ? -23.225 -46.173 15.763  1.00 85.61  ? 428  LEU B CD2 1 
ATOM   5938  N N   . TYR B 1 418 ? -26.465 -42.138 17.395  1.00 89.15  ? 429  TYR B N   1 
ATOM   5939  C CA  . TYR B 1 418 ? -26.411 -40.749 16.973  1.00 89.15  ? 429  TYR B CA  1 
ATOM   5940  C C   . TYR B 1 418 ? -26.749 -39.818 18.127  1.00 89.15  ? 429  TYR B C   1 
ATOM   5941  O O   . TYR B 1 418 ? -26.028 -38.848 18.378  1.00 89.15  ? 429  TYR B O   1 
ATOM   5942  C CB  . TYR B 1 418 ? -27.351 -40.521 15.780  1.00 149.89 ? 429  TYR B CB  1 
ATOM   5943  C CG  . TYR B 1 418 ? -26.750 -40.928 14.440  1.00 149.89 ? 429  TYR B CG  1 
ATOM   5944  C CD1 . TYR B 1 418 ? -27.513 -40.909 13.272  1.00 149.89 ? 429  TYR B CD1 1 
ATOM   5945  C CD2 . TYR B 1 418 ? -25.408 -41.306 14.338  1.00 149.89 ? 429  TYR B CD2 1 
ATOM   5946  C CE1 . TYR B 1 418 ? -26.950 -41.255 12.033  1.00 149.89 ? 429  TYR B CE1 1 
ATOM   5947  C CE2 . TYR B 1 418 ? -24.839 -41.650 13.108  1.00 149.89 ? 429  TYR B CE2 1 
ATOM   5948  C CZ  . TYR B 1 418 ? -25.613 -41.622 11.963  1.00 149.89 ? 429  TYR B CZ  1 
ATOM   5949  O OH  . TYR B 1 418 ? -25.041 -41.950 10.754  1.00 149.89 ? 429  TYR B OH  1 
ATOM   5950  N N   . SER B 1 419 ? -27.833 -40.111 18.838  1.00 141.54 ? 430  SER B N   1 
ATOM   5951  C CA  . SER B 1 419 ? -28.223 -39.286 19.975  1.00 141.54 ? 430  SER B CA  1 
ATOM   5952  C C   . SER B 1 419 ? -27.063 -39.262 20.974  1.00 141.54 ? 430  SER B C   1 
ATOM   5953  O O   . SER B 1 419 ? -26.784 -38.236 21.590  1.00 141.54 ? 430  SER B O   1 
ATOM   5954  C CB  . SER B 1 419 ? -29.478 -39.854 20.641  1.00 201.99 ? 430  SER B CB  1 
ATOM   5955  O OG  . SER B 1 419 ? -29.908 -39.027 21.707  1.00 201.99 ? 430  SER B OG  1 
ATOM   5956  N N   . LYS B 1 420 ? -26.389 -40.402 21.115  1.00 79.23  ? 431  LYS B N   1 
ATOM   5957  C CA  . LYS B 1 420 ? -25.248 -40.542 22.017  1.00 79.23  ? 431  LYS B CA  1 
ATOM   5958  C C   . LYS B 1 420 ? -24.152 -39.544 21.709  1.00 79.23  ? 431  LYS B C   1 
ATOM   5959  O O   . LYS B 1 420 ? -23.795 -38.736 22.554  1.00 79.23  ? 431  LYS B O   1 
ATOM   5960  C CB  . LYS B 1 420 ? -24.663 -41.945 21.922  1.00 92.91  ? 431  LYS B CB  1 
ATOM   5961  C CG  . LYS B 1 420 ? -23.277 -42.064 22.513  1.00 92.91  ? 431  LYS B CG  1 
ATOM   5962  C CD  . LYS B 1 420 ? -22.745 -43.485 22.409  1.00 92.91  ? 431  LYS B CD  1 
ATOM   5963  C CE  . LYS B 1 420 ? -23.515 -44.474 23.307  1.00 92.91  ? 431  LYS B CE  1 
ATOM   5964  N NZ  . LYS B 1 420 ? -24.886 -44.838 22.819  1.00 92.91  ? 431  LYS B NZ  1 
ATOM   5965  N N   . TYR B 1 421 ? -23.605 -39.614 20.501  1.00 68.90  ? 432  TYR B N   1 
ATOM   5966  C CA  . TYR B 1 421 ? -22.544 -38.700 20.099  1.00 68.90  ? 432  TYR B CA  1 
ATOM   5967  C C   . TYR B 1 421 ? -22.993 -37.254 20.223  1.00 68.90  ? 432  TYR B C   1 
ATOM   5968  O O   . TYR B 1 421 ? -22.154 -36.352 20.320  1.00 68.90  ? 432  TYR B O   1 
ATOM   5969  C CB  . TYR B 1 421 ? -22.103 -38.980 18.667  1.00 71.74  ? 432  TYR B CB  1 
ATOM   5970  C CG  . TYR B 1 421 ? -21.491 -40.344 18.476  1.00 71.74  ? 432  TYR B CG  1 
ATOM   5971  C CD1 . TYR B 1 421 ? -21.261 -41.187 19.561  1.00 71.74  ? 432  TYR B CD1 1 
ATOM   5972  C CD2 . TYR B 1 421 ? -21.133 -40.792 17.211  1.00 71.74  ? 432  TYR B CD2 1 
ATOM   5973  C CE1 . TYR B 1 421 ? -20.687 -42.444 19.390  1.00 71.74  ? 432  TYR B CE1 1 
ATOM   5974  C CE2 . TYR B 1 421 ? -20.562 -42.043 17.028  1.00 71.74  ? 432  TYR B CE2 1 
ATOM   5975  C CZ  . TYR B 1 421 ? -20.341 -42.862 18.119  1.00 71.74  ? 432  TYR B CZ  1 
ATOM   5976  O OH  . TYR B 1 421 ? -19.772 -44.100 17.938  1.00 71.74  ? 432  TYR B OH  1 
ATOM   5977  N N   . ASP B 1 422 ? -24.311 -37.036 20.205  1.00 60.98  ? 433  ASP B N   1 
ATOM   5978  C CA  . ASP B 1 422 ? -24.861 -35.688 20.360  1.00 60.98  ? 433  ASP B CA  1 
ATOM   5979  C C   . ASP B 1 422 ? -24.505 -35.226 21.775  1.00 60.98  ? 433  ASP B C   1 
ATOM   5980  O O   . ASP B 1 422 ? -24.217 -34.046 22.013  1.00 60.98  ? 433  ASP B O   1 
ATOM   5981  C CB  . ASP B 1 422 ? -26.387 -35.688 20.183  1.00 104.53 ? 433  ASP B CB  1 
ATOM   5982  C CG  . ASP B 1 422 ? -26.822 -35.523 18.730  1.00 104.53 ? 433  ASP B CG  1 
ATOM   5983  O OD1 . ASP B 1 422 ? -26.414 -34.537 18.078  1.00 104.53 ? 433  ASP B OD1 1 
ATOM   5984  O OD2 . ASP B 1 422 ? -27.592 -36.377 18.244  1.00 104.53 ? 433  ASP B OD2 1 
ATOM   5985  N N   . GLU B 1 423 ? -24.532 -36.180 22.705  1.00 72.86  ? 434  GLU B N   1 
ATOM   5986  C CA  . GLU B 1 423 ? -24.192 -35.930 24.100  1.00 72.86  ? 434  GLU B CA  1 
ATOM   5987  C C   . GLU B 1 423 ? -22.690 -35.687 24.194  1.00 72.86  ? 434  GLU B C   1 
ATOM   5988  O O   . GLU B 1 423 ? -22.257 -34.680 24.754  1.00 72.86  ? 434  GLU B O   1 
ATOM   5989  C CB  . GLU B 1 423 ? -24.580 -37.128 24.967  1.00 101.34 ? 434  GLU B CB  1 
ATOM   5990  C CG  . GLU B 1 423 ? -26.070 -37.254 25.243  1.00 101.34 ? 434  GLU B CG  1 
ATOM   5991  C CD  . GLU B 1 423 ? -26.415 -38.525 26.008  1.00 101.34 ? 434  GLU B CD  1 
ATOM   5992  O OE1 . GLU B 1 423 ? -27.537 -38.618 26.557  1.00 101.34 ? 434  GLU B OE1 1 
ATOM   5993  O OE2 . GLU B 1 423 ? -25.565 -39.441 26.054  1.00 101.34 ? 434  GLU B OE2 1 
ATOM   5994  N N   . MET B 1 424 ? -21.898 -36.603 23.636  1.00 43.11  ? 435  MET B N   1 
ATOM   5995  C CA  . MET B 1 424 ? -20.446 -36.457 23.649  1.00 43.11  ? 435  MET B CA  1 
ATOM   5996  C C   . MET B 1 424 ? -20.073 -35.165 22.929  1.00 43.11  ? 435  MET B C   1 
ATOM   5997  O O   . MET B 1 424 ? -18.894 -34.811 22.811  1.00 43.11  ? 435  MET B O   1 
ATOM   5998  C CB  . MET B 1 424 ? -19.757 -37.635 22.957  1.00 66.10  ? 435  MET B CB  1 
ATOM   5999  C CG  . MET B 1 424 ? -19.842 -38.953 23.687  1.00 66.10  ? 435  MET B CG  1 
ATOM   6000  S SD  . MET B 1 424 ? -18.898 -40.216 22.814  1.00 66.10  ? 435  MET B SD  1 
ATOM   6001  C CE  . MET B 1 424 ? -17.824 -40.808 24.114  1.00 66.10  ? 435  MET B CE  1 
ATOM   6002  N N   . SER B 1 425 ? -21.090 -34.466 22.439  1.00 52.68  ? 436  SER B N   1 
ATOM   6003  C CA  . SER B 1 425 ? -20.893 -33.203 21.739  1.00 52.68  ? 436  SER B CA  1 
ATOM   6004  C C   . SER B 1 425 ? -19.940 -33.301 20.553  1.00 52.68  ? 436  SER B C   1 
ATOM   6005  O O   . SER B 1 425 ? -19.195 -32.371 20.275  1.00 52.68  ? 436  SER B O   1 
ATOM   6006  C CB  . SER B 1 425 ? -20.380 -32.139 22.719  1.00 88.34  ? 436  SER B CB  1 
ATOM   6007  O OG  . SER B 1 425 ? -20.260 -30.875 22.081  1.00 88.34  ? 436  SER B OG  1 
ATOM   6008  N N   . ILE B 1 426 ? -19.966 -34.420 19.845  1.00 58.16  ? 437  ILE B N   1 
ATOM   6009  C CA  . ILE B 1 426 ? -19.083 -34.579 18.701  1.00 58.16  ? 437  ILE B CA  1 
ATOM   6010  C C   . ILE B 1 426 ? -19.458 -33.536 17.649  1.00 58.16  ? 437  ILE B C   1 
ATOM   6011  O O   . ILE B 1 426 ? -20.244 -32.645 17.939  1.00 58.16  ? 437  ILE B O   1 
ATOM   6012  C CB  . ILE B 1 426 ? -19.174 -36.027 18.160  1.00 65.80  ? 437  ILE B CB  1 
ATOM   6013  C CG1 . ILE B 1 426 ? -18.742 -36.986 19.278  1.00 65.80  ? 437  ILE B CG1 1 
ATOM   6014  C CG2 . ILE B 1 426 ? -18.277 -36.213 16.938  1.00 65.80  ? 437  ILE B CG2 1 
ATOM   6015  C CD1 . ILE B 1 426 ? -18.570 -38.414 18.871  1.00 65.80  ? 437  ILE B CD1 1 
ATOM   6016  N N   . LEU B 1 427 ? -18.875 -33.594 16.457  1.00 71.06  ? 438  LEU B N   1 
ATOM   6017  C CA  . LEU B 1 427 ? -19.234 -32.624 15.427  1.00 71.06  ? 438  LEU B CA  1 
ATOM   6018  C C   . LEU B 1 427 ? -19.899 -33.306 14.239  1.00 71.06  ? 438  LEU B C   1 
ATOM   6019  O O   . LEU B 1 427 ? -20.970 -32.896 13.799  1.00 71.06  ? 438  LEU B O   1 
ATOM   6020  C CB  . LEU B 1 427 ? -18.011 -31.825 14.957  1.00 51.56  ? 438  LEU B CB  1 
ATOM   6021  C CG  . LEU B 1 427 ? -17.457 -30.714 15.869  1.00 51.56  ? 438  LEU B CG  1 
ATOM   6022  C CD1 . LEU B 1 427 ? -16.604 -29.742 15.038  1.00 51.56  ? 438  LEU B CD1 1 
ATOM   6023  C CD2 . LEU B 1 427 ? -18.609 -29.965 16.537  1.00 51.56  ? 438  LEU B CD2 1 
ATOM   6024  N N   . PHE B 1 428 ? -19.264 -34.352 13.727  1.00 81.75  ? 439  PHE B N   1 
ATOM   6025  C CA  . PHE B 1 428 ? -19.803 -35.103 12.602  1.00 81.75  ? 439  PHE B CA  1 
ATOM   6026  C C   . PHE B 1 428 ? -19.698 -36.579 12.924  1.00 81.75  ? 439  PHE B C   1 
ATOM   6027  O O   . PHE B 1 428 ? -18.971 -36.972 13.836  1.00 81.75  ? 439  PHE B O   1 
ATOM   6028  C CB  . PHE B 1 428 ? -19.027 -34.783 11.322  1.00 78.04  ? 439  PHE B CB  1 
ATOM   6029  C CG  . PHE B 1 428 ? -19.100 -33.341 10.930  1.00 78.04  ? 439  PHE B CG  1 
ATOM   6030  C CD1 . PHE B 1 428 ? -20.322 -32.762 10.602  1.00 78.04  ? 439  PHE B CD1 1 
ATOM   6031  C CD2 . PHE B 1 428 ? -17.959 -32.545 10.939  1.00 78.04  ? 439  PHE B CD2 1 
ATOM   6032  C CE1 . PHE B 1 428 ? -20.413 -31.409 10.292  1.00 78.04  ? 439  PHE B CE1 1 
ATOM   6033  C CE2 . PHE B 1 428 ? -18.035 -31.188 10.630  1.00 78.04  ? 439  PHE B CE2 1 
ATOM   6034  C CZ  . PHE B 1 428 ? -19.270 -30.620 10.306  1.00 78.04  ? 439  PHE B CZ  1 
ATOM   6035  N N   . THR B 1 429 ? -20.429 -37.398 12.180  1.00 90.55  ? 440  THR B N   1 
ATOM   6036  C CA  . THR B 1 429 ? -20.403 -38.831 12.417  1.00 90.55  ? 440  THR B CA  1 
ATOM   6037  C C   . THR B 1 429 ? -20.287 -39.602 11.111  1.00 90.55  ? 440  THR B C   1 
ATOM   6038  O O   . THR B 1 429 ? -21.287 -40.088 10.579  1.00 90.55  ? 440  THR B O   1 
ATOM   6039  C CB  . THR B 1 429 ? -21.672 -39.291 13.147  1.00 75.88  ? 440  THR B CB  1 
ATOM   6040  O OG1 . THR B 1 429 ? -22.017 -38.344 14.173  1.00 75.88  ? 440  THR B OG1 1 
ATOM   6041  C CG2 . THR B 1 429 ? -21.435 -40.657 13.773  1.00 75.88  ? 440  THR B CG2 1 
ATOM   6042  N N   . VAL B 1 430 ? -19.064 -39.712 10.597  1.00 53.46  ? 441  VAL B N   1 
ATOM   6043  C CA  . VAL B 1 430 ? -18.840 -40.431 9.355   1.00 53.46  ? 441  VAL B CA  1 
ATOM   6044  C C   . VAL B 1 430 ? -18.983 -41.918 9.619   1.00 53.46  ? 441  VAL B C   1 
ATOM   6045  O O   . VAL B 1 430 ? -18.580 -42.420 10.671  1.00 53.46  ? 441  VAL B O   1 
ATOM   6046  C CB  . VAL B 1 430 ? -17.433 -40.141 8.737   1.00 72.01  ? 441  VAL B CB  1 
ATOM   6047  C CG1 . VAL B 1 430 ? -17.151 -38.640 8.742   1.00 72.01  ? 441  VAL B CG1 1 
ATOM   6048  C CG2 . VAL B 1 430 ? -16.356 -40.899 9.476   1.00 72.01  ? 441  VAL B CG2 1 
ATOM   6049  N N   . LEU B 1 431 ? -19.578 -42.608 8.653   1.00 63.58  ? 442  LEU B N   1 
ATOM   6050  C CA  . LEU B 1 431 ? -19.818 -44.040 8.735   1.00 63.58  ? 442  LEU B CA  1 
ATOM   6051  C C   . LEU B 1 431 ? -19.349 -44.669 7.421   1.00 63.58  ? 442  LEU B C   1 
ATOM   6052  O O   . LEU B 1 431 ? -19.739 -44.238 6.334   1.00 63.58  ? 442  LEU B O   1 
ATOM   6053  C CB  . LEU B 1 431 ? -21.311 -44.283 8.957   1.00 72.33  ? 442  LEU B CB  1 
ATOM   6054  C CG  . LEU B 1 431 ? -21.785 -45.662 9.398   1.00 72.33  ? 442  LEU B CG  1 
ATOM   6055  C CD1 . LEU B 1 431 ? -23.278 -45.610 9.751   1.00 72.33  ? 442  LEU B CD1 1 
ATOM   6056  C CD2 . LEU B 1 431 ? -21.510 -46.661 8.291   1.00 72.33  ? 442  LEU B CD2 1 
ATOM   6057  N N   . VAL B 1 432 ? -18.488 -45.674 7.530   1.00 93.92  ? 443  VAL B N   1 
ATOM   6058  C CA  . VAL B 1 432 ? -17.953 -46.354 6.359   1.00 93.92  ? 443  VAL B CA  1 
ATOM   6059  C C   . VAL B 1 432 ? -18.657 -47.687 6.183   1.00 93.92  ? 443  VAL B C   1 
ATOM   6060  O O   . VAL B 1 432 ? -18.825 -48.440 7.143   1.00 93.92  ? 443  VAL B O   1 
ATOM   6061  C CB  . VAL B 1 432 ? -16.433 -46.603 6.496   1.00 94.10  ? 443  VAL B CB  1 
ATOM   6062  C CG1 . VAL B 1 432 ? -15.922 -47.383 5.305   1.00 94.10  ? 443  VAL B CG1 1 
ATOM   6063  C CG2 . VAL B 1 432 ? -15.698 -45.284 6.595   1.00 94.10  ? 443  VAL B CG2 1 
ATOM   6064  N N   . THR B 1 433 ? -19.071 -47.960 4.948   1.00 156.32 ? 444  THR B N   1 
ATOM   6065  C CA  . THR B 1 433 ? -19.766 -49.195 4.600   1.00 156.32 ? 444  THR B CA  1 
ATOM   6066  C C   . THR B 1 433 ? -19.154 -49.832 3.357   1.00 156.32 ? 444  THR B C   1 
ATOM   6067  O O   . THR B 1 433 ? -18.133 -49.374 2.846   1.00 156.32 ? 444  THR B O   1 
ATOM   6068  C CB  . THR B 1 433 ? -21.273 -48.942 4.319   1.00 98.28  ? 444  THR B CB  1 
ATOM   6069  O OG1 . THR B 1 433 ? -21.425 -47.738 3.556   1.00 98.28  ? 444  THR B OG1 1 
ATOM   6070  C CG2 . THR B 1 433 ? -22.057 -48.831 5.617   1.00 98.28  ? 444  THR B CG2 1 
ATOM   6071  N N   . GLU B 1 434 ? -19.783 -50.902 2.884   1.00 131.59 ? 445  GLU B N   1 
ATOM   6072  C CA  . GLU B 1 434 ? -19.322 -51.594 1.690   1.00 131.59 ? 445  GLU B CA  1 
ATOM   6073  C C   . GLU B 1 434 ? -19.526 -50.645 0.524   1.00 131.59 ? 445  GLU B C   1 
ATOM   6074  O O   . GLU B 1 434 ? -18.661 -50.516 -0.341  1.00 131.59 ? 445  GLU B O   1 
ATOM   6075  C CB  . GLU B 1 434 ? -20.137 -52.866 1.466   1.00 188.02 ? 445  GLU B CB  1 
ATOM   6076  C CG  . GLU B 1 434 ? -19.778 -53.611 0.196   1.00 188.02 ? 445  GLU B CG  1 
ATOM   6077  C CD  . GLU B 1 434 ? -20.716 -54.764 -0.078  1.00 188.02 ? 445  GLU B CD  1 
ATOM   6078  O OE1 . GLU B 1 434 ? -21.938 -54.517 -0.171  1.00 188.02 ? 445  GLU B OE1 1 
ATOM   6079  O OE2 . GLU B 1 434 ? -20.236 -55.912 -0.201  1.00 188.02 ? 445  GLU B OE2 1 
ATOM   6080  N N   . THR B 1 435 ? -20.676 -49.974 0.519   1.00 167.90 ? 446  THR B N   1 
ATOM   6081  C CA  . THR B 1 435 ? -21.009 -49.020 -0.533  1.00 167.90 ? 446  THR B CA  1 
ATOM   6082  C C   . THR B 1 435 ? -20.006 -47.867 -0.553  1.00 167.90 ? 446  THR B C   1 
ATOM   6083  O O   . THR B 1 435 ? -20.235 -46.840 -1.193  1.00 167.90 ? 446  THR B O   1 
ATOM   6084  C CB  . THR B 1 435 ? -22.458 -48.462 -0.359  1.00 114.16 ? 446  THR B CB  1 
ATOM   6085  O OG1 . THR B 1 435 ? -22.698 -47.426 -1.323  1.00 114.16 ? 446  THR B OG1 1 
ATOM   6086  C CG2 . THR B 1 435 ? -22.667 -47.909 1.041   1.00 114.16 ? 446  THR B CG2 1 
ATOM   6087  N N   . THR B 1 436 ? -18.893 -48.049 0.156   1.00 102.95 ? 447  THR B N   1 
ATOM   6088  C CA  . THR B 1 436 ? -17.834 -47.046 0.213   1.00 102.95 ? 447  THR B CA  1 
ATOM   6089  C C   . THR B 1 436 ? -16.673 -47.585 -0.604  1.00 102.95 ? 447  THR B C   1 
ATOM   6090  O O   . THR B 1 436 ? -15.987 -46.839 -1.302  1.00 102.95 ? 447  THR B O   1 
ATOM   6091  C CB  . THR B 1 436 ? -17.318 -46.815 1.656   1.00 83.91  ? 447  THR B CB  1 
ATOM   6092  O OG1 . THR B 1 436 ? -18.418 -46.522 2.528   1.00 83.91  ? 447  THR B OG1 1 
ATOM   6093  C CG2 . THR B 1 436 ? -16.319 -45.654 1.686   1.00 83.91  ? 447  THR B CG2 1 
ATOM   6094  N N   . LEU B 1 437 ? -16.463 -48.894 -0.503  1.00 95.52  ? 448  LEU B N   1 
ATOM   6095  C CA  . LEU B 1 437 ? -15.388 -49.562 -1.219  1.00 95.52  ? 448  LEU B CA  1 
ATOM   6096  C C   . LEU B 1 437 ? -15.695 -49.643 -2.706  1.00 95.52  ? 448  LEU B C   1 
ATOM   6097  O O   . LEU B 1 437 ? -14.804 -49.460 -3.536  1.00 95.52  ? 448  LEU B O   1 
ATOM   6098  C CB  . LEU B 1 437 ? -15.186 -50.964 -0.653  1.00 88.64  ? 448  LEU B CB  1 
ATOM   6099  C CG  . LEU B 1 437 ? -14.644 -51.019 0.777   1.00 88.64  ? 448  LEU B CG  1 
ATOM   6100  C CD1 . LEU B 1 437 ? -15.052 -52.325 1.430   1.00 88.64  ? 448  LEU B CD1 1 
ATOM   6101  C CD2 . LEU B 1 437 ? -13.127 -50.858 0.761   1.00 88.64  ? 448  LEU B CD2 1 
ATOM   6102  N N   . GLU B 1 438 ? -16.959 -49.912 -3.037  1.00 196.01 ? 449  GLU B N   1 
ATOM   6103  C CA  . GLU B 1 438 ? -17.390 -50.019 -4.430  1.00 196.01 ? 449  GLU B CA  1 
ATOM   6104  C C   . GLU B 1 438 ? -17.599 -48.652 -5.073  1.00 196.01 ? 449  GLU B C   1 
ATOM   6105  O O   . GLU B 1 438 ? -18.568 -48.443 -5.801  1.00 196.01 ? 449  GLU B O   1 
ATOM   6106  C CB  . GLU B 1 438 ? -18.687 -50.848 -4.543  1.00 98.87  ? 449  GLU B CB  1 
ATOM   6107  C CG  . GLU B 1 438 ? -19.880 -50.358 -3.709  1.00 98.87  ? 449  GLU B CG  1 
ATOM   6108  C CD  . GLU B 1 438 ? -21.164 -51.167 -3.957  1.00 98.87  ? 449  GLU B CD  1 
ATOM   6109  O OE1 . GLU B 1 438 ? -21.093 -52.414 -4.058  1.00 98.87  ? 449  GLU B OE1 1 
ATOM   6110  O OE2 . GLU B 1 438 ? -22.251 -50.553 -4.037  1.00 98.87  ? 449  GLU B OE2 1 
ATOM   6111  N N   . ASN B 1 439 ? -16.683 -47.726 -4.800  1.00 102.58 ? 450  ASN B N   1 
ATOM   6112  C CA  . ASN B 1 439 ? -16.761 -46.371 -5.344  1.00 102.58 ? 450  ASN B CA  1 
ATOM   6113  C C   . ASN B 1 439 ? -15.700 -45.451 -4.741  1.00 102.58 ? 450  ASN B C   1 
ATOM   6114  O O   . ASN B 1 439 ? -14.630 -45.245 -5.327  1.00 102.58 ? 450  ASN B O   1 
ATOM   6115  C CB  . ASN B 1 439 ? -18.156 -45.782 -5.096  1.00 148.16 ? 450  ASN B CB  1 
ATOM   6116  C CG  . ASN B 1 439 ? -18.655 -46.030 -3.681  1.00 148.16 ? 450  ASN B CG  1 
ATOM   6117  O OD1 . ASN B 1 439 ? -18.673 -47.165 -3.207  1.00 148.16 ? 450  ASN B OD1 1 
ATOM   6118  N ND2 . ASN B 1 439 ? -19.071 -44.969 -3.004  1.00 148.16 ? 450  ASN B ND2 1 
ATOM   6119  N N   . GLY B 1 440 ? -16.010 -44.906 -3.567  1.00 92.91  ? 451  GLY B N   1 
ATOM   6120  C CA  . GLY B 1 440 ? -15.097 -44.010 -2.881  1.00 92.91  ? 451  GLY B CA  1 
ATOM   6121  C C   . GLY B 1 440 ? -15.873 -42.906 -2.189  1.00 92.91  ? 451  GLY B C   1 
ATOM   6122  O O   . GLY B 1 440 ? -15.502 -41.732 -2.262  1.00 92.91  ? 451  GLY B O   1 
ATOM   6123  N N   . LEU B 1 441 ? -16.953 -43.289 -1.512  1.00 82.04  ? 452  LEU B N   1 
ATOM   6124  C CA  . LEU B 1 441 ? -17.806 -42.330 -0.821  1.00 82.04  ? 452  LEU B CA  1 
ATOM   6125  C C   . LEU B 1 441 ? -18.295 -42.827 0.542   1.00 82.04  ? 452  LEU B C   1 
ATOM   6126  O O   . LEU B 1 441 ? -18.544 -44.016 0.725   1.00 82.04  ? 452  LEU B O   1 
ATOM   6127  C CB  . LEU B 1 441 ? -19.033 -42.001 -1.687  1.00 165.38 ? 452  LEU B CB  1 
ATOM   6128  C CG  . LEU B 1 441 ? -18.915 -41.486 -3.131  1.00 165.38 ? 452  LEU B CG  1 
ATOM   6129  C CD1 . LEU B 1 441 ? -18.041 -40.257 -3.158  1.00 165.38 ? 452  LEU B CD1 1 
ATOM   6130  C CD2 . LEU B 1 441 ? -18.344 -42.550 -4.051  1.00 165.38 ? 452  LEU B CD2 1 
ATOM   6131  N N   . ILE B 1 442 ? -18.420 -41.904 1.493   1.00 113.27 ? 453  ILE B N   1 
ATOM   6132  C CA  . ILE B 1 442 ? -18.932 -42.201 2.832   1.00 113.27 ? 453  ILE B CA  1 
ATOM   6133  C C   . ILE B 1 442 ? -20.076 -41.219 3.068   1.00 113.27 ? 453  ILE B C   1 
ATOM   6134  O O   . ILE B 1 442 ? -20.478 -40.504 2.143   1.00 113.27 ? 453  ILE B O   1 
ATOM   6135  C CB  . ILE B 1 442 ? -17.852 -42.022 3.957   1.00 48.58  ? 453  ILE B CB  1 
ATOM   6136  C CG1 . ILE B 1 442 ? -16.925 -40.830 3.655   1.00 48.58  ? 453  ILE B CG1 1 
ATOM   6137  C CG2 . ILE B 1 442 ? -17.070 -43.303 4.125   1.00 48.58  ? 453  ILE B CG2 1 
ATOM   6138  C CD1 . ILE B 1 442 ? -17.202 -39.562 4.478   1.00 48.58  ? 453  ILE B CD1 1 
ATOM   6139  N N   . HIS B 1 443 ? -20.610 -41.180 4.285   1.00 86.14  ? 454  HIS B N   1 
ATOM   6140  C CA  . HIS B 1 443 ? -21.701 -40.255 4.580   1.00 86.14  ? 454  HIS B CA  1 
ATOM   6141  C C   . HIS B 1 443 ? -21.661 -39.675 5.986   1.00 86.14  ? 454  HIS B C   1 
ATOM   6142  O O   . HIS B 1 443 ? -22.044 -40.334 6.950   1.00 86.14  ? 454  HIS B O   1 
ATOM   6143  C CB  . HIS B 1 443 ? -23.045 -40.941 4.338   1.00 119.47 ? 454  HIS B CB  1 
ATOM   6144  C CG  . HIS B 1 443 ? -23.147 -42.294 4.961   1.00 119.47 ? 454  HIS B CG  1 
ATOM   6145  N ND1 . HIS B 1 443 ? -22.194 -43.271 4.770   1.00 119.47 ? 454  HIS B ND1 1 
ATOM   6146  C CD2 . HIS B 1 443 ? -24.092 -42.838 5.762   1.00 119.47 ? 454  HIS B CD2 1 
ATOM   6147  C CE1 . HIS B 1 443 ? -22.548 -44.359 5.428   1.00 119.47 ? 454  HIS B CE1 1 
ATOM   6148  N NE2 . HIS B 1 443 ? -23.696 -44.123 6.039   1.00 119.47 ? 454  HIS B NE2 1 
ATOM   6149  N N   . LEU B 1 444 ? -21.204 -38.430 6.091   1.00 75.41  ? 455  LEU B N   1 
ATOM   6150  C CA  . LEU B 1 444 ? -21.114 -37.755 7.383   1.00 75.41  ? 455  LEU B CA  1 
ATOM   6151  C C   . LEU B 1 444 ? -22.402 -37.040 7.739   1.00 75.41  ? 455  LEU B C   1 
ATOM   6152  O O   . LEU B 1 444 ? -22.985 -36.323 6.926   1.00 75.41  ? 455  LEU B O   1 
ATOM   6153  C CB  . LEU B 1 444 ? -19.970 -36.729 7.405   1.00 50.51  ? 455  LEU B CB  1 
ATOM   6154  C CG  . LEU B 1 444 ? -20.153 -35.486 6.531   1.00 50.51  ? 455  LEU B CG  1 
ATOM   6155  C CD1 . LEU B 1 444 ? -19.013 -34.517 6.733   1.00 50.51  ? 455  LEU B CD1 1 
ATOM   6156  C CD2 . LEU B 1 444 ? -20.233 -35.911 5.085   1.00 50.51  ? 455  LEU B CD2 1 
ATOM   6157  N N   . ARG B 1 445 ? -22.834 -37.248 8.972   1.00 84.16  ? 456  ARG B N   1 
ATOM   6158  C CA  . ARG B 1 445 ? -24.031 -36.617 9.480   1.00 84.16  ? 456  ARG B CA  1 
ATOM   6159  C C   . ARG B 1 445 ? -23.547 -35.425 10.284  1.00 84.16  ? 456  ARG B C   1 
ATOM   6160  O O   . ARG B 1 445 ? -22.358 -35.327 10.591  1.00 84.16  ? 456  ARG B O   1 
ATOM   6161  C CB  . ARG B 1 445 ? -24.784 -37.588 10.367  1.00 92.59  ? 456  ARG B CB  1 
ATOM   6162  C CG  . ARG B 1 445 ? -25.923 -36.980 11.100  1.00 92.59  ? 456  ARG B CG  1 
ATOM   6163  C CD  . ARG B 1 445 ? -26.671 -38.055 11.823  1.00 92.59  ? 456  ARG B CD  1 
ATOM   6164  N NE  . ARG B 1 445 ? -27.388 -37.503 12.956  1.00 92.59  ? 456  ARG B NE  1 
ATOM   6165  C CZ  . ARG B 1 445 ? -26.789 -36.922 13.986  1.00 92.59  ? 456  ARG B CZ  1 
ATOM   6166  N NH1 . ARG B 1 445 ? -25.462 -36.831 14.015  1.00 92.59  ? 456  ARG B NH1 1 
ATOM   6167  N NH2 . ARG B 1 445 ? -27.516 -36.426 14.978  1.00 92.59  ? 456  ARG B NH2 1 
ATOM   6168  N N   . SER B 1 446 ? -24.451 -34.514 10.620  1.00 67.52  ? 457  SER B N   1 
ATOM   6169  C CA  . SER B 1 446 ? -24.062 -33.333 11.377  1.00 67.52  ? 457  SER B CA  1 
ATOM   6170  C C   . SER B 1 446 ? -24.642 -33.351 12.782  1.00 67.52  ? 457  SER B C   1 
ATOM   6171  O O   . SER B 1 446 ? -25.503 -34.168 13.100  1.00 67.52  ? 457  SER B O   1 
ATOM   6172  C CB  . SER B 1 446 ? -24.519 -32.066 10.648  1.00 68.54  ? 457  SER B CB  1 
ATOM   6173  O OG  . SER B 1 446 ? -23.955 -30.905 11.235  1.00 68.54  ? 457  SER B OG  1 
ATOM   6174  N N   . ARG B 1 447 ? -24.150 -32.460 13.630  1.00 98.24  ? 458  ARG B N   1 
ATOM   6175  C CA  . ARG B 1 447 ? -24.664 -32.381 14.981  1.00 98.24  ? 458  ARG B CA  1 
ATOM   6176  C C   . ARG B 1 447 ? -25.715 -31.281 14.984  1.00 98.24  ? 458  ARG B C   1 
ATOM   6177  O O   . ARG B 1 447 ? -26.702 -31.341 15.726  1.00 98.24  ? 458  ARG B O   1 
ATOM   6178  C CB  . ARG B 1 447 ? -23.553 -32.039 15.971  1.00 65.06  ? 458  ARG B CB  1 
ATOM   6179  C CG  . ARG B 1 447 ? -24.043 -32.012 17.416  1.00 65.06  ? 458  ARG B CG  1 
ATOM   6180  C CD  . ARG B 1 447 ? -23.005 -31.441 18.339  1.00 65.06  ? 458  ARG B CD  1 
ATOM   6181  N NE  . ARG B 1 447 ? -22.502 -30.163 17.853  1.00 65.06  ? 458  ARG B NE  1 
ATOM   6182  C CZ  . ARG B 1 447 ? -21.503 -29.501 18.420  1.00 65.06  ? 458  ARG B CZ  1 
ATOM   6183  N NH1 . ARG B 1 447 ? -20.900 -29.995 19.492  1.00 65.06  ? 458  ARG B NH1 1 
ATOM   6184  N NH2 . ARG B 1 447 ? -21.107 -28.346 17.916  1.00 65.06  ? 458  ARG B NH2 1 
ATOM   6185  N N   . ASP B 1 448 ? -25.499 -30.284 14.130  1.00 94.38  ? 459  ASP B N   1 
ATOM   6186  C CA  . ASP B 1 448 ? -26.408 -29.151 14.008  1.00 94.38  ? 459  ASP B CA  1 
ATOM   6187  C C   . ASP B 1 448 ? -27.405 -29.344 12.862  1.00 94.38  ? 459  ASP B C   1 
ATOM   6188  O O   . ASP B 1 448 ? -28.548 -29.749 13.086  1.00 94.38  ? 459  ASP B O   1 
ATOM   6189  C CB  . ASP B 1 448 ? -25.596 -27.877 13.788  1.00 117.08 ? 459  ASP B CB  1 
ATOM   6190  C CG  . ASP B 1 448 ? -24.464 -27.733 14.785  1.00 117.08 ? 459  ASP B CG  1 
ATOM   6191  O OD1 . ASP B 1 448 ? -24.743 -27.625 15.997  1.00 117.08 ? 459  ASP B OD1 1 
ATOM   6192  O OD2 . ASP B 1 448 ? -23.292 -27.735 14.355  1.00 117.08 ? 459  ASP B OD2 1 
ATOM   6193  N N   . THR B 1 449 ? -26.968 -29.061 11.636  1.00 94.37  ? 460  THR B N   1 
ATOM   6194  C CA  . THR B 1 449 ? -27.832 -29.207 10.470  1.00 94.37  ? 460  THR B CA  1 
ATOM   6195  C C   . THR B 1 449 ? -28.455 -30.606 10.420  1.00 94.37  ? 460  THR B C   1 
ATOM   6196  O O   . THR B 1 449 ? -29.359 -30.866 9.628   1.00 94.37  ? 460  THR B O   1 
ATOM   6197  C CB  . THR B 1 449 ? -27.057 -28.925 9.144   1.00 99.83  ? 460  THR B CB  1 
ATOM   6198  O OG1 . THR B 1 449 ? -25.999 -29.877 8.975   1.00 99.83  ? 460  THR B OG1 1 
ATOM   6199  C CG2 . THR B 1 449 ? -26.462 -27.527 9.163   1.00 99.83  ? 460  THR B CG2 1 
ATOM   6200  N N   . THR B 1 450 ? -27.972 -31.493 11.283  1.00 96.46  ? 461  THR B N   1 
ATOM   6201  C CA  . THR B 1 450 ? -28.457 -32.869 11.379  1.00 96.46  ? 461  THR B CA  1 
ATOM   6202  C C   . THR B 1 450 ? -28.761 -33.593 10.054  1.00 96.46  ? 461  THR B C   1 
ATOM   6203  O O   . THR B 1 450 ? -29.464 -34.613 10.042  1.00 96.46  ? 461  THR B O   1 
ATOM   6204  C CB  . THR B 1 450 ? -29.702 -32.949 12.308  1.00 50.03  ? 461  THR B CB  1 
ATOM   6205  O OG1 . THR B 1 450 ? -30.244 -34.276 12.272  1.00 50.03  ? 461  THR B OG1 1 
ATOM   6206  C CG2 . THR B 1 450 ? -30.763 -31.969 11.880  1.00 50.03  ? 461  THR B CG2 1 
ATOM   6207  N N   . MET B 1 451 ? -28.217 -33.081 8.950   1.00 140.60 ? 462  MET B N   1 
ATOM   6208  C CA  . MET B 1 451 ? -28.422 -33.683 7.630   1.00 140.60 ? 462  MET B CA  1 
ATOM   6209  C C   . MET B 1 451 ? -27.619 -34.973 7.502   1.00 140.60 ? 462  MET B C   1 
ATOM   6210  O O   . MET B 1 451 ? -26.618 -35.149 8.194   1.00 140.60 ? 462  MET B O   1 
ATOM   6211  C CB  . MET B 1 451 ? -27.983 -32.719 6.524   1.00 190.54 ? 462  MET B CB  1 
ATOM   6212  C CG  . MET B 1 451 ? -28.822 -31.462 6.393   1.00 190.54 ? 462  MET B CG  1 
ATOM   6213  S SD  . MET B 1 451 ? -28.215 -30.401 5.065   1.00 190.54 ? 462  MET B SD  1 
ATOM   6214  C CE  . MET B 1 451 ? -29.082 -31.080 3.652   1.00 190.54 ? 462  MET B CE  1 
ATOM   6215  N N   . LYS B 1 452 ? -28.054 -35.868 6.617   1.00 94.70  ? 463  LYS B N   1 
ATOM   6216  C CA  . LYS B 1 452 ? -27.351 -37.136 6.407   1.00 94.70  ? 463  LYS B CA  1 
ATOM   6217  C C   . LYS B 1 452 ? -26.712 -37.202 5.009   1.00 94.70  ? 463  LYS B C   1 
ATOM   6218  O O   . LYS B 1 452 ? -26.883 -38.179 4.269   1.00 94.70  ? 463  LYS B O   1 
ATOM   6219  C CB  . LYS B 1 452 ? -28.312 -38.317 6.634   1.00 87.44  ? 463  LYS B CB  1 
ATOM   6220  C CG  . LYS B 1 452 ? -28.790 -38.450 8.089   1.00 87.44  ? 463  LYS B CG  1 
ATOM   6221  C CD  . LYS B 1 452 ? -29.795 -39.591 8.301   1.00 87.44  ? 463  LYS B CD  1 
ATOM   6222  C CE  . LYS B 1 452 ? -30.346 -39.588 9.741   1.00 87.44  ? 463  LYS B CE  1 
ATOM   6223  N NZ  . LYS B 1 452 ? -31.339 -40.673 10.025  1.00 87.44  ? 463  LYS B NZ  1 
ATOM   6224  N N   . GLU B 1 453 ? -25.964 -36.145 4.679   1.00 98.40  ? 464  GLU B N   1 
ATOM   6225  C CA  . GLU B 1 453 ? -25.265 -35.987 3.401   1.00 98.40  ? 464  GLU B CA  1 
ATOM   6226  C C   . GLU B 1 453 ? -24.496 -37.205 2.899   1.00 98.40  ? 464  GLU B C   1 
ATOM   6227  O O   . GLU B 1 453 ? -24.350 -38.208 3.602   1.00 98.40  ? 464  GLU B O   1 
ATOM   6228  C CB  . GLU B 1 453 ? -24.284 -34.812 3.474   1.00 128.89 ? 464  GLU B CB  1 
ATOM   6229  C CG  . GLU B 1 453 ? -24.917 -33.435 3.466   1.00 128.89 ? 464  GLU B CG  1 
ATOM   6230  C CD  . GLU B 1 453 ? -23.884 -32.319 3.561   1.00 128.89 ? 464  GLU B CD  1 
ATOM   6231  O OE1 . GLU B 1 453 ? -24.268 -31.144 3.399   1.00 128.89 ? 464  GLU B OE1 1 
ATOM   6232  O OE2 . GLU B 1 453 ? -22.693 -32.610 3.801   1.00 128.89 ? 464  GLU B OE2 1 
ATOM   6233  N N   . MET B 1 454 ? -24.002 -37.080 1.668   1.00 84.30  ? 465  MET B N   1 
ATOM   6234  C CA  . MET B 1 454 ? -23.221 -38.112 0.984   1.00 84.30  ? 465  MET B CA  1 
ATOM   6235  C C   . MET B 1 454 ? -21.870 -37.448 0.729   1.00 84.30  ? 465  MET B C   1 
ATOM   6236  O O   . MET B 1 454 ? -21.826 -36.364 0.152   1.00 84.30  ? 465  MET B O   1 
ATOM   6237  C CB  . MET B 1 454 ? -23.877 -38.463 -0.364  1.00 150.73 ? 465  MET B CB  1 
ATOM   6238  C CG  . MET B 1 454 ? -25.391 -38.726 -0.310  1.00 150.73 ? 465  MET B CG  1 
ATOM   6239  S SD  . MET B 1 454 ? -26.214 -38.752 -1.942  1.00 150.73 ? 465  MET B SD  1 
ATOM   6240  C CE  . MET B 1 454 ? -26.204 -40.510 -2.326  1.00 150.73 ? 465  MET B CE  1 
ATOM   6241  N N   . MET B 1 455 ? -20.769 -38.065 1.150   1.00 86.30  ? 466  MET B N   1 
ATOM   6242  C CA  . MET B 1 455 ? -19.472 -37.428 0.929   1.00 86.30  ? 466  MET B CA  1 
ATOM   6243  C C   . MET B 1 455 ? -18.392 -38.324 0.337   1.00 86.30  ? 466  MET B C   1 
ATOM   6244  O O   . MET B 1 455 ? -18.333 -39.517 0.622   1.00 86.30  ? 466  MET B O   1 
ATOM   6245  C CB  . MET B 1 455 ? -18.970 -36.804 2.232   1.00 125.07 ? 466  MET B CB  1 
ATOM   6246  C CG  . MET B 1 455 ? -17.811 -35.831 2.046   1.00 125.07 ? 466  MET B CG  1 
ATOM   6247  S SD  . MET B 1 455 ? -17.526 -34.776 3.487   1.00 125.07 ? 466  MET B SD  1 
ATOM   6248  C CE  . MET B 1 455 ? -16.733 -35.932 4.547   1.00 125.07 ? 466  MET B CE  1 
ATOM   6249  N N   . HIS B 1 456 ? -17.530 -37.722 -0.477  1.00 127.52 ? 467  HIS B N   1 
ATOM   6250  C CA  . HIS B 1 456 ? -16.444 -38.427 -1.156  1.00 127.52 ? 467  HIS B CA  1 
ATOM   6251  C C   . HIS B 1 456 ? -15.243 -38.701 -0.243  1.00 127.52 ? 467  HIS B C   1 
ATOM   6252  O O   . HIS B 1 456 ? -14.309 -37.903 -0.193  1.00 127.52 ? 467  HIS B O   1 
ATOM   6253  C CB  . HIS B 1 456 ? -15.995 -37.599 -2.365  1.00 201.99 ? 467  HIS B CB  1 
ATOM   6254  C CG  . HIS B 1 456 ? -17.072 -36.720 -2.931  1.00 201.99 ? 467  HIS B CG  1 
ATOM   6255  N ND1 . HIS B 1 456 ? -18.281 -37.211 -3.375  1.00 201.99 ? 467  HIS B ND1 1 
ATOM   6256  C CD2 . HIS B 1 456 ? -17.121 -35.379 -3.119  1.00 201.99 ? 467  HIS B CD2 1 
ATOM   6257  C CE1 . HIS B 1 456 ? -19.027 -36.212 -3.813  1.00 201.99 ? 467  HIS B CE1 1 
ATOM   6258  N NE2 . HIS B 1 456 ? -18.347 -35.090 -3.669  1.00 201.99 ? 467  HIS B NE2 1 
ATOM   6259  N N   . ILE B 1 457 ? -15.264 -39.834 0.457   1.00 79.35  ? 468  ILE B N   1 
ATOM   6260  C CA  . ILE B 1 457 ? -14.190 -40.210 1.383   1.00 79.35  ? 468  ILE B CA  1 
ATOM   6261  C C   . ILE B 1 457 ? -12.771 -40.053 0.832   1.00 79.35  ? 468  ILE B C   1 
ATOM   6262  O O   . ILE B 1 457 ? -12.103 -41.037 0.507   1.00 79.35  ? 468  ILE B O   1 
ATOM   6263  C CB  . ILE B 1 457 ? -14.367 -41.665 1.883   1.00 81.15  ? 468  ILE B CB  1 
ATOM   6264  C CG1 . ILE B 1 457 ? -13.248 -42.023 2.863   1.00 81.15  ? 468  ILE B CG1 1 
ATOM   6265  C CG2 . ILE B 1 457 ? -14.389 -42.621 0.709   1.00 81.15  ? 468  ILE B CG2 1 
ATOM   6266  C CD1 . ILE B 1 457 ? -13.381 -43.407 3.451   1.00 81.15  ? 468  ILE B CD1 1 
ATOM   6267  N N   . SER B 1 458 ? -12.322 -38.801 0.757   1.00 78.88  ? 469  SER B N   1 
ATOM   6268  C CA  . SER B 1 458 ? -10.996 -38.437 0.266   1.00 78.88  ? 469  SER B CA  1 
ATOM   6269  C C   . SER B 1 458 ? -10.875 -36.917 0.284   1.00 78.88  ? 469  SER B C   1 
ATOM   6270  O O   . SER B 1 458 ? -9.784  -36.361 0.152   1.00 78.88  ? 469  SER B O   1 
ATOM   6271  C CB  . SER B 1 458 ? -10.777 -38.957 -1.160  1.00 195.27 ? 469  SER B CB  1 
ATOM   6272  O OG  . SER B 1 458 ? -10.484 -40.344 -1.169  1.00 195.27 ? 469  SER B OG  1 
ATOM   6273  N N   . LYS B 1 459 ? -12.016 -36.256 0.448   1.00 142.55 ? 470  LYS B N   1 
ATOM   6274  C CA  . LYS B 1 459 ? -12.086 -34.801 0.502   1.00 142.55 ? 470  LYS B CA  1 
ATOM   6275  C C   . LYS B 1 459 ? -12.683 -34.458 1.864   1.00 142.55 ? 470  LYS B C   1 
ATOM   6276  O O   . LYS B 1 459 ? -13.190 -33.356 2.086   1.00 142.55 ? 470  LYS B O   1 
ATOM   6277  C CB  . LYS B 1 459 ? -12.985 -34.282 -0.627  1.00 137.37 ? 470  LYS B CB  1 
ATOM   6278  C CG  . LYS B 1 459 ? -12.910 -32.785 -0.870  1.00 137.37 ? 470  LYS B CG  1 
ATOM   6279  C CD  . LYS B 1 459 ? -13.587 -32.422 -2.185  1.00 137.37 ? 470  LYS B CD  1 
ATOM   6280  C CE  . LYS B 1 459 ? -13.360 -30.960 -2.546  1.00 137.37 ? 470  LYS B CE  1 
ATOM   6281  N NZ  . LYS B 1 459 ? -13.908 -30.606 -3.890  1.00 137.37 ? 470  LYS B NZ  1 
ATOM   6282  N N   . LEU B 1 460 ? -12.612 -35.434 2.767   1.00 96.32  ? 471  LEU B N   1 
ATOM   6283  C CA  . LEU B 1 460 ? -13.129 -35.314 4.125   1.00 96.32  ? 471  LEU B CA  1 
ATOM   6284  C C   . LEU B 1 460 ? -12.121 -34.601 5.022   1.00 96.32  ? 471  LEU B C   1 
ATOM   6285  O O   . LEU B 1 460 ? -12.494 -33.824 5.901   1.00 96.32  ? 471  LEU B O   1 
ATOM   6286  C CB  . LEU B 1 460 ? -13.460 -36.716 4.666   1.00 47.24  ? 471  LEU B CB  1 
ATOM   6287  C CG  . LEU B 1 460 ? -13.845 -37.008 6.127   1.00 47.24  ? 471  LEU B CG  1 
ATOM   6288  C CD1 . LEU B 1 460 ? -14.292 -35.764 6.866   1.00 47.24  ? 471  LEU B CD1 1 
ATOM   6289  C CD2 . LEU B 1 460 ? -14.953 -38.048 6.133   1.00 47.24  ? 471  LEU B CD2 1 
ATOM   6290  N N   . LYS B 1 461 ? -10.840 -34.860 4.790   1.00 101.42 ? 472  LYS B N   1 
ATOM   6291  C CA  . LYS B 1 461 ? -9.792  -34.225 5.577   1.00 101.42 ? 472  LYS B CA  1 
ATOM   6292  C C   . LYS B 1 461 ? -9.826  -32.720 5.338   1.00 101.42 ? 472  LYS B C   1 
ATOM   6293  O O   . LYS B 1 461 ? -10.100 -31.939 6.253   1.00 101.42 ? 472  LYS B O   1 
ATOM   6294  C CB  . LYS B 1 461 ? -8.425  -34.784 5.182   1.00 106.93 ? 472  LYS B CB  1 
ATOM   6295  C CG  . LYS B 1 461 ? -7.263  -34.179 5.942   1.00 106.93 ? 472  LYS B CG  1 
ATOM   6296  C CD  . LYS B 1 461 ? -5.942  -34.775 5.485   1.00 106.93 ? 472  LYS B CD  1 
ATOM   6297  C CE  . LYS B 1 461 ? -5.605  -34.393 4.046   1.00 106.93 ? 472  LYS B CE  1 
ATOM   6298  N NZ  . LYS B 1 461 ? -5.334  -32.936 3.891   1.00 106.93 ? 472  LYS B NZ  1 
ATOM   6299  N N   . ASP B 1 462 ? -9.553  -32.324 4.097   1.00 88.75  ? 473  ASP B N   1 
ATOM   6300  C CA  . ASP B 1 462 ? -9.552  -30.914 3.723   1.00 88.75  ? 473  ASP B CA  1 
ATOM   6301  C C   . ASP B 1 462 ? -10.881 -30.238 4.019   1.00 88.75  ? 473  ASP B C   1 
ATOM   6302  O O   . ASP B 1 462 ? -10.944 -29.018 4.113   1.00 88.75  ? 473  ASP B O   1 
ATOM   6303  C CB  . ASP B 1 462 ? -9.212  -30.754 2.239   1.00 135.06 ? 473  ASP B CB  1 
ATOM   6304  C CG  . ASP B 1 462 ? -7.718  -30.825 1.970   1.00 135.06 ? 473  ASP B CG  1 
ATOM   6305  O OD1 . ASP B 1 462 ? -6.987  -29.914 2.419   1.00 135.06 ? 473  ASP B OD1 1 
ATOM   6306  O OD2 . ASP B 1 462 ? -7.272  -31.788 1.312   1.00 135.06 ? 473  ASP B OD2 1 
ATOM   6307  N N   . PHE B 1 463 ? -11.940 -31.030 4.162   1.00 88.27  ? 474  PHE B N   1 
ATOM   6308  C CA  . PHE B 1 463 ? -13.261 -30.487 4.461   1.00 88.27  ? 474  PHE B CA  1 
ATOM   6309  C C   . PHE B 1 463 ? -13.329 -30.089 5.928   1.00 88.27  ? 474  PHE B C   1 
ATOM   6310  O O   . PHE B 1 463 ? -13.709 -28.961 6.262   1.00 88.27  ? 474  PHE B O   1 
ATOM   6311  C CB  . PHE B 1 463 ? -14.346 -31.524 4.174   1.00 83.10  ? 474  PHE B CB  1 
ATOM   6312  C CG  . PHE B 1 463 ? -15.660 -31.228 4.851   1.00 83.10  ? 474  PHE B CG  1 
ATOM   6313  C CD1 . PHE B 1 463 ? -16.431 -30.142 4.462   1.00 83.10  ? 474  PHE B CD1 1 
ATOM   6314  C CD2 . PHE B 1 463 ? -16.116 -32.025 5.897   1.00 83.10  ? 474  PHE B CD2 1 
ATOM   6315  C CE1 . PHE B 1 463 ? -17.636 -29.854 5.107   1.00 83.10  ? 474  PHE B CE1 1 
ATOM   6316  C CE2 . PHE B 1 463 ? -17.319 -31.742 6.544   1.00 83.10  ? 474  PHE B CE2 1 
ATOM   6317  C CZ  . PHE B 1 463 ? -18.077 -30.658 6.149   1.00 83.10  ? 474  PHE B CZ  1 
ATOM   6318  N N   . LEU B 1 464 ? -12.964 -31.035 6.795   1.00 105.78 ? 475  LEU B N   1 
ATOM   6319  C CA  . LEU B 1 464 ? -12.965 -30.829 8.241   1.00 105.78 ? 475  LEU B CA  1 
ATOM   6320  C C   . LEU B 1 464 ? -12.039 -29.684 8.607   1.00 105.78 ? 475  LEU B C   1 
ATOM   6321  O O   . LEU B 1 464 ? -12.401 -28.810 9.394   1.00 105.78 ? 475  LEU B O   1 
ATOM   6322  C CB  . LEU B 1 464 ? -12.511 -32.102 8.966   1.00 60.67  ? 475  LEU B CB  1 
ATOM   6323  C CG  . LEU B 1 464 ? -13.414 -33.343 8.974   1.00 60.67  ? 475  LEU B CG  1 
ATOM   6324  C CD1 . LEU B 1 464 ? -12.778 -34.402 9.861   1.00 60.67  ? 475  LEU B CD1 1 
ATOM   6325  C CD2 . LEU B 1 464 ? -14.811 -33.000 9.500   1.00 60.67  ? 475  LEU B CD2 1 
ATOM   6326  N N   . ILE B 1 465 ? -10.841 -29.702 8.032   1.00 73.34  ? 476  ILE B N   1 
ATOM   6327  C CA  . ILE B 1 465 ? -9.850  -28.662 8.279   1.00 73.34  ? 476  ILE B CA  1 
ATOM   6328  C C   . ILE B 1 465 ? -10.419 -27.274 7.990   1.00 73.34  ? 476  ILE B C   1 
ATOM   6329  O O   . ILE B 1 465 ? -10.008 -26.294 8.607   1.00 73.34  ? 476  ILE B O   1 
ATOM   6330  C CB  . ILE B 1 465 ? -8.608  -28.861 7.405   1.00 85.89  ? 476  ILE B CB  1 
ATOM   6331  C CG1 . ILE B 1 465 ? -8.026  -30.249 7.651   1.00 85.89  ? 476  ILE B CG1 1 
ATOM   6332  C CG2 . ILE B 1 465 ? -7.580  -27.776 7.706   1.00 85.89  ? 476  ILE B CG2 1 
ATOM   6333  C CD1 . ILE B 1 465 ? -6.928  -30.619 6.685   1.00 85.89  ? 476  ILE B CD1 1 
ATOM   6334  N N   . LYS B 1 466 ? -11.350 -27.195 7.040   1.00 112.08 ? 477  LYS B N   1 
ATOM   6335  C CA  . LYS B 1 466 ? -11.986 -25.925 6.680   1.00 112.08 ? 477  LYS B CA  1 
ATOM   6336  C C   . LYS B 1 466 ? -13.116 -25.626 7.650   1.00 112.08 ? 477  LYS B C   1 
ATOM   6337  O O   . LYS B 1 466 ? -13.071 -24.635 8.376   1.00 112.08 ? 477  LYS B O   1 
ATOM   6338  C CB  . LYS B 1 466 ? -12.555 -25.972 5.257   1.00 87.01  ? 477  LYS B CB  1 
ATOM   6339  C CG  . LYS B 1 466 ? -11.510 -25.995 4.157   1.00 87.01  ? 477  LYS B CG  1 
ATOM   6340  C CD  . LYS B 1 466 ? -10.639 -24.760 4.183   1.00 87.01  ? 477  LYS B CD  1 
ATOM   6341  C CE  . LYS B 1 466 ? -9.514  -24.900 3.184   1.00 87.01  ? 477  LYS B CE  1 
ATOM   6342  N NZ  . LYS B 1 466 ? -8.626  -23.715 3.181   1.00 87.01  ? 477  LYS B NZ  1 
ATOM   6343  N N   . TYR B 1 467 ? -14.128 -26.492 7.657   1.00 68.08  ? 478  TYR B N   1 
ATOM   6344  C CA  . TYR B 1 467 ? -15.269 -26.316 8.544   1.00 68.08  ? 478  TYR B CA  1 
ATOM   6345  C C   . TYR B 1 467 ? -14.791 -25.858 9.911   1.00 68.08  ? 478  TYR B C   1 
ATOM   6346  O O   . TYR B 1 467 ? -15.298 -24.886 10.458  1.00 68.08  ? 478  TYR B O   1 
ATOM   6347  C CB  . TYR B 1 467 ? -16.052 -27.619 8.675   1.00 64.16  ? 478  TYR B CB  1 
ATOM   6348  C CG  . TYR B 1 467 ? -17.241 -27.491 9.595   1.00 64.16  ? 478  TYR B CG  1 
ATOM   6349  C CD1 . TYR B 1 467 ? -17.153 -27.864 10.936  1.00 64.16  ? 478  TYR B CD1 1 
ATOM   6350  C CD2 . TYR B 1 467 ? -18.443 -26.941 9.144   1.00 64.16  ? 478  TYR B CD2 1 
ATOM   6351  C CE1 . TYR B 1 467 ? -18.236 -27.687 11.815  1.00 64.16  ? 478  TYR B CE1 1 
ATOM   6352  C CE2 . TYR B 1 467 ? -19.532 -26.758 10.012  1.00 64.16  ? 478  TYR B CE2 1 
ATOM   6353  C CZ  . TYR B 1 467 ? -19.420 -27.131 11.345  1.00 64.16  ? 478  TYR B CZ  1 
ATOM   6354  O OH  . TYR B 1 467 ? -20.472 -26.931 12.215  1.00 64.16  ? 478  TYR B OH  1 
ATOM   6355  N N   . ILE B 1 468 ? -13.796 -26.553 10.450  1.00 74.99  ? 479  ILE B N   1 
ATOM   6356  C CA  . ILE B 1 468 ? -13.250 -26.208 11.753  1.00 74.99  ? 479  ILE B CA  1 
ATOM   6357  C C   . ILE B 1 468 ? -12.577 -24.847 11.724  1.00 74.99  ? 479  ILE B C   1 
ATOM   6358  O O   . ILE B 1 468 ? -13.011 -23.927 12.409  1.00 74.99  ? 479  ILE B O   1 
ATOM   6359  C CB  . ILE B 1 468 ? -12.238 -27.273 12.241  1.00 73.98  ? 479  ILE B CB  1 
ATOM   6360  C CG1 . ILE B 1 468 ? -12.987 -28.546 12.647  1.00 73.98  ? 479  ILE B CG1 1 
ATOM   6361  C CG2 . ILE B 1 468 ? -11.444 -26.743 13.422  1.00 73.98  ? 479  ILE B CG2 1 
ATOM   6362  C CD1 . ILE B 1 468 ? -12.100 -29.650 13.145  1.00 73.98  ? 479  ILE B CD1 1 
ATOM   6363  N N   . SER B 1 469 ? -11.520 -24.707 10.936  1.00 81.50  ? 480  SER B N   1 
ATOM   6364  C CA  . SER B 1 469 ? -10.835 -23.424 10.875  1.00 81.50  ? 480  SER B CA  1 
ATOM   6365  C C   . SER B 1 469 ? -11.817 -22.330 10.473  1.00 81.50  ? 480  SER B C   1 
ATOM   6366  O O   . SER B 1 469 ? -11.554 -21.143 10.665  1.00 81.50  ? 480  SER B O   1 
ATOM   6367  C CB  . SER B 1 469 ? -9.679  -23.467 9.877   1.00 85.27  ? 480  SER B CB  1 
ATOM   6368  O OG  . SER B 1 469 ? -8.915  -22.273 9.938   1.00 85.27  ? 480  SER B OG  1 
ATOM   6369  N N   . SER B 1 470 ? -12.953 -22.734 9.914   1.00 77.11  ? 481  SER B N   1 
ATOM   6370  C CA  . SER B 1 470 ? -13.974 -21.778 9.496   1.00 77.11  ? 481  SER B CA  1 
ATOM   6371  C C   . SER B 1 470 ? -14.691 -21.275 10.741  1.00 77.11  ? 481  SER B C   1 
ATOM   6372  O O   . SER B 1 470 ? -14.672 -20.081 11.025  1.00 77.11  ? 481  SER B O   1 
ATOM   6373  C CB  . SER B 1 470 ? -14.974 -22.443 8.540   1.00 124.80 ? 481  SER B CB  1 
ATOM   6374  O OG  . SER B 1 470 ? -15.874 -21.497 7.985   1.00 124.80 ? 481  SER B OG  1 
ATOM   6375  N N   . ALA B 1 471 ? -15.308 -22.201 11.479  1.00 70.22  ? 482  ALA B N   1 
ATOM   6376  C CA  . ALA B 1 471 ? -16.031 -21.897 12.719  1.00 70.22  ? 482  ALA B CA  1 
ATOM   6377  C C   . ALA B 1 471 ? -15.183 -21.004 13.611  1.00 70.22  ? 482  ALA B C   1 
ATOM   6378  O O   . ALA B 1 471 ? -15.684 -20.395 14.559  1.00 70.22  ? 482  ALA B O   1 
ATOM   6379  C CB  . ALA B 1 471 ? -16.372 -23.186 13.453  1.00 63.17  ? 482  ALA B CB  1 
ATOM   6380  N N   . LYS B 1 472 ? -13.892 -20.955 13.288  1.00 64.73  ? 483  LYS B N   1 
ATOM   6381  C CA  . LYS B 1 472 ? -12.899 -20.143 13.987  1.00 64.73  ? 483  LYS B CA  1 
ATOM   6382  C C   . LYS B 1 472 ? -13.016 -18.674 13.538  1.00 64.73  ? 483  LYS B C   1 
ATOM   6383  O O   . LYS B 1 472 ? -13.408 -17.806 14.322  1.00 64.73  ? 483  LYS B O   1 
ATOM   6384  C CB  . LYS B 1 472 ? -11.491 -20.687 13.678  1.00 74.13  ? 483  LYS B CB  1 
ATOM   6385  C CG  . LYS B 1 472 ? -10.343 -19.849 14.224  1.00 74.13  ? 483  LYS B CG  1 
ATOM   6386  C CD  . LYS B 1 472 ? -8.962  -20.399 13.833  1.00 74.13  ? 483  LYS B CD  1 
ATOM   6387  C CE  . LYS B 1 472 ? -8.557  -21.667 14.599  1.00 74.13  ? 483  LYS B CE  1 
ATOM   6388  N NZ  . LYS B 1 472 ? -9.283  -22.901 14.170  1.00 74.13  ? 483  LYS B NZ  1 
ATOM   6389  N N   . ASN B 1 473 ? -12.690 -18.422 12.267  1.00 153.34 ? 484  ASN B N   1 
ATOM   6390  C CA  . ASN B 1 473 ? -12.735 -17.081 11.668  1.00 153.34 ? 484  ASN B CA  1 
ATOM   6391  C C   . ASN B 1 473 ? -14.008 -16.293 11.938  1.00 153.34 ? 484  ASN B C   1 
ATOM   6392  O O   . ASN B 1 473 ? -13.945 -15.164 12.420  1.00 153.34 ? 484  ASN B O   1 
ATOM   6393  C CB  . ASN B 1 473 ? -12.529 -17.163 10.151  1.00 128.85 ? 484  ASN B CB  1 
ATOM   6394  C CG  . ASN B 1 473 ? -11.085 -16.940 9.742   1.00 128.85 ? 484  ASN B CG  1 
ATOM   6395  O OD1 . ASN B 1 473 ? -10.188 -17.683 10.142  1.00 128.85 ? 484  ASN B OD1 1 
ATOM   6396  N ND2 . ASN B 1 473 ? -10.854 -15.909 8.936   1.00 128.85 ? 484  ASN B ND2 1 
ATOM   6397  N N   . VAL B 1 474 ? -15.154 -16.880 11.601  1.00 107.48 ? 485  VAL B N   1 
ATOM   6398  C CA  . VAL B 1 474 ? -16.447 -16.231 11.810  1.00 107.48 ? 485  VAL B CA  1 
ATOM   6399  C C   . VAL B 1 474 ? -16.413 -15.309 13.028  1.00 107.48 ? 485  VAL B C   1 
ATOM   6400  O O   . VAL B 1 474 ? -16.505 -14.073 12.841  1.00 107.48 ? 485  VAL B O   1 
ATOM   6401  C CB  . VAL B 1 474 ? -17.572 -17.279 12.014  1.00 148.08 ? 485  VAL B CB  1 
ATOM   6402  C CG1 . VAL B 1 474 ? -18.871 -16.591 12.403  1.00 148.08 ? 485  VAL B CG1 1 
ATOM   6403  C CG2 . VAL B 1 474 ? -17.774 -18.078 10.740  1.00 148.08 ? 485  VAL B CG2 1 
ATOM   6404  O OXT . VAL B 1 474 ? -16.282 -15.836 14.153  1.00 148.08 ? 485  VAL B OXT 1 
ATOM   6405  N N   . GLU C 1 56  ? -15.311 41.756  5.712   1.00 94.55  ? 67   GLU C N   1 
ATOM   6406  C CA  . GLU C 1 56  ? -15.481 43.229  5.568   1.00 94.55  ? 67   GLU C CA  1 
ATOM   6407  C C   . GLU C 1 56  ? -16.387 43.513  4.376   1.00 94.55  ? 67   GLU C C   1 
ATOM   6408  O O   . GLU C 1 56  ? -17.614 43.460  4.486   1.00 94.55  ? 67   GLU C O   1 
ATOM   6409  C CB  . GLU C 1 56  ? -14.124 43.902  5.339   1.00 129.56 ? 67   GLU C CB  1 
ATOM   6410  C CG  . GLU C 1 56  ? -12.921 43.061  5.737   1.00 129.56 ? 67   GLU C CG  1 
ATOM   6411  C CD  . GLU C 1 56  ? -12.770 41.816  4.882   1.00 129.56 ? 67   GLU C CD  1 
ATOM   6412  O OE1 . GLU C 1 56  ? -12.625 41.954  3.648   1.00 129.56 ? 67   GLU C OE1 1 
ATOM   6413  O OE2 . GLU C 1 56  ? -12.799 40.703  5.447   1.00 129.56 ? 67   GLU C OE2 1 
ATOM   6414  N N   . ALA C 1 57  ? -15.767 43.817  3.238   1.00 133.49 ? 68   ALA C N   1 
ATOM   6415  C CA  . ALA C 1 57  ? -16.491 44.105  2.005   1.00 133.49 ? 68   ALA C CA  1 
ATOM   6416  C C   . ALA C 1 57  ? -17.011 42.801  1.417   1.00 133.49 ? 68   ALA C C   1 
ATOM   6417  O O   . ALA C 1 57  ? -18.006 42.782  0.693   1.00 133.49 ? 68   ALA C O   1 
ATOM   6418  C CB  . ALA C 1 57  ? -15.568 44.797  1.008   1.00 82.83  ? 68   ALA C CB  1 
ATOM   6419  N N   . LEU C 1 58  ? -16.315 41.713  1.733   1.00 85.26  ? 69   LEU C N   1 
ATOM   6420  C CA  . LEU C 1 58  ? -16.689 40.386  1.263   1.00 85.26  ? 69   LEU C CA  1 
ATOM   6421  C C   . LEU C 1 58  ? -17.755 39.867  2.214   1.00 85.26  ? 69   LEU C C   1 
ATOM   6422  O O   . LEU C 1 58  ? -18.755 39.289  1.802   1.00 85.26  ? 69   LEU C O   1 
ATOM   6423  C CB  . LEU C 1 58  ? -15.462 39.459  1.268   1.00 55.80  ? 69   LEU C CB  1 
ATOM   6424  C CG  . LEU C 1 58  ? -15.622 37.993  0.852   1.00 55.80  ? 69   LEU C CG  1 
ATOM   6425  C CD1 . LEU C 1 58  ? -16.302 37.889  -0.509  1.00 55.80  ? 69   LEU C CD1 1 
ATOM   6426  C CD2 . LEU C 1 58  ? -14.255 37.334  0.828   1.00 55.80  ? 69   LEU C CD2 1 
ATOM   6427  N N   . LEU C 1 59  ? -17.537 40.102  3.496   1.00 41.20  ? 70   LEU C N   1 
ATOM   6428  C CA  . LEU C 1 59  ? -18.470 39.664  4.515   1.00 41.20  ? 70   LEU C CA  1 
ATOM   6429  C C   . LEU C 1 59  ? -19.825 40.345  4.339   1.00 41.20  ? 70   LEU C C   1 
ATOM   6430  O O   . LEU C 1 59  ? -20.866 39.699  4.366   1.00 41.20  ? 70   LEU C O   1 
ATOM   6431  C CB  . LEU C 1 59  ? -17.908 39.983  5.899   1.00 91.66  ? 70   LEU C CB  1 
ATOM   6432  C CG  . LEU C 1 59  ? -18.462 39.134  7.042   1.00 91.66  ? 70   LEU C CG  1 
ATOM   6433  C CD1 . LEU C 1 59  ? -19.956 39.385  7.236   1.00 91.66  ? 70   LEU C CD1 1 
ATOM   6434  C CD2 . LEU C 1 59  ? -18.191 37.670  6.725   1.00 91.66  ? 70   LEU C CD2 1 
ATOM   6435  N N   . GLU C 1 60  ? -19.810 41.661  4.165   1.00 71.37  ? 71   GLU C N   1 
ATOM   6436  C CA  . GLU C 1 60  ? -21.048 42.407  3.992   1.00 71.37  ? 71   GLU C CA  1 
ATOM   6437  C C   . GLU C 1 60  ? -21.794 41.805  2.818   1.00 71.37  ? 71   GLU C C   1 
ATOM   6438  O O   . GLU C 1 60  ? -22.954 41.437  2.945   1.00 71.37  ? 71   GLU C O   1 
ATOM   6439  C CB  . GLU C 1 60  ? -20.743 43.884  3.730   1.00 180.36 ? 71   GLU C CB  1 
ATOM   6440  C CG  . GLU C 1 60  ? -21.762 44.848  4.324   1.00 180.36 ? 71   GLU C CG  1 
ATOM   6441  C CD  . GLU C 1 60  ? -23.139 44.716  3.704   1.00 180.36 ? 71   GLU C CD  1 
ATOM   6442  O OE1 . GLU C 1 60  ? -23.281 45.017  2.502   1.00 180.36 ? 71   GLU C OE1 1 
ATOM   6443  O OE2 . GLU C 1 60  ? -24.080 44.314  4.420   1.00 180.36 ? 71   GLU C OE2 1 
ATOM   6444  N N   . ILE C 1 61  ? -21.111 41.689  1.684   1.00 72.87  ? 72   ILE C N   1 
ATOM   6445  C CA  . ILE C 1 61  ? -21.697 41.116  0.471   1.00 72.87  ? 72   ILE C CA  1 
ATOM   6446  C C   . ILE C 1 61  ? -22.291 39.741  0.769   1.00 72.87  ? 72   ILE C C   1 
ATOM   6447  O O   . ILE C 1 61  ? -23.479 39.506  0.525   1.00 72.87  ? 72   ILE C O   1 
ATOM   6448  C CB  . ILE C 1 61  ? -20.636 40.965  -0.660  1.00 57.00  ? 72   ILE C CB  1 
ATOM   6449  C CG1 . ILE C 1 61  ? -20.260 42.337  -1.218  1.00 57.00  ? 72   ILE C CG1 1 
ATOM   6450  C CG2 . ILE C 1 61  ? -21.167 40.091  -1.771  1.00 57.00  ? 72   ILE C CG2 1 
ATOM   6451  C CD1 . ILE C 1 61  ? -19.083 42.313  -2.169  1.00 57.00  ? 72   ILE C CD1 1 
ATOM   6452  N N   . CYS C 1 62  ? -21.457 38.842  1.295   1.00 62.16  ? 73   CYS C N   1 
ATOM   6453  C CA  . CYS C 1 62  ? -21.879 37.487  1.638   1.00 62.16  ? 73   CYS C CA  1 
ATOM   6454  C C   . CYS C 1 62  ? -23.160 37.553  2.446   1.00 62.16  ? 73   CYS C C   1 
ATOM   6455  O O   . CYS C 1 62  ? -23.961 36.623  2.452   1.00 62.16  ? 73   CYS C O   1 
ATOM   6456  C CB  . CYS C 1 62  ? -20.799 36.780  2.455   1.00 54.54  ? 73   CYS C CB  1 
ATOM   6457  S SG  . CYS C 1 62  ? -19.392 36.167  1.504   1.00 54.54  ? 73   CYS C SG  1 
ATOM   6458  N N   . GLN C 1 63  ? -23.349 38.667  3.136   1.00 65.16  ? 74   GLN C N   1 
ATOM   6459  C CA  . GLN C 1 63  ? -24.540 38.844  3.927   1.00 65.16  ? 74   GLN C CA  1 
ATOM   6460  C C   . GLN C 1 63  ? -25.662 39.284  3.006   1.00 65.16  ? 74   GLN C C   1 
ATOM   6461  O O   . GLN C 1 63  ? -26.603 38.525  2.779   1.00 65.16  ? 74   GLN C O   1 
ATOM   6462  C CB  . GLN C 1 63  ? -24.316 39.892  5.001   1.00 102.35 ? 74   GLN C CB  1 
ATOM   6463  C CG  . GLN C 1 63  ? -25.438 39.946  5.994   1.00 102.35 ? 74   GLN C CG  1 
ATOM   6464  C CD  . GLN C 1 63  ? -25.322 41.136  6.899   1.00 102.35 ? 74   GLN C CD  1 
ATOM   6465  O OE1 . GLN C 1 63  ? -24.218 41.507  7.302   1.00 102.35 ? 74   GLN C OE1 1 
ATOM   6466  N NE2 . GLN C 1 63  ? -26.458 41.744  7.238   1.00 102.35 ? 74   GLN C NE2 1 
ATOM   6467  N N   . ARG C 1 64  ? -25.545 40.499  2.465   1.00 84.61  ? 75   ARG C N   1 
ATOM   6468  C CA  . ARG C 1 64  ? -26.558 41.065  1.569   1.00 84.61  ? 75   ARG C CA  1 
ATOM   6469  C C   . ARG C 1 64  ? -26.987 40.115  0.462   1.00 84.61  ? 75   ARG C C   1 
ATOM   6470  O O   . ARG C 1 64  ? -28.173 40.059  0.103   1.00 84.61  ? 75   ARG C O   1 
ATOM   6471  C CB  . ARG C 1 64  ? -26.066 42.369  0.923   1.00 104.65 ? 75   ARG C CB  1 
ATOM   6472  C CG  . ARG C 1 64  ? -26.108 43.598  1.822   1.00 104.65 ? 75   ARG C CG  1 
ATOM   6473  C CD  . ARG C 1 64  ? -25.854 44.876  1.027   1.00 104.65 ? 75   ARG C CD  1 
ATOM   6474  N NE  . ARG C 1 64  ? -24.630 44.799  0.233   1.00 104.65 ? 75   ARG C NE  1 
ATOM   6475  C CZ  . ARG C 1 64  ? -24.118 45.811  -0.462  1.00 104.65 ? 75   ARG C CZ  1 
ATOM   6476  N NH1 . ARG C 1 64  ? -24.726 46.991  -0.462  1.00 104.65 ? 75   ARG C NH1 1 
ATOM   6477  N NH2 . ARG C 1 64  ? -22.998 45.648  -1.160  1.00 104.65 ? 75   ARG C NH2 1 
ATOM   6478  N N   . ARG C 1 65  ? -26.024 39.374  -0.083  1.00 58.23  ? 76   ARG C N   1 
ATOM   6479  C CA  . ARG C 1 65  ? -26.312 38.440  -1.164  1.00 58.23  ? 76   ARG C CA  1 
ATOM   6480  C C   . ARG C 1 65  ? -26.679 37.014  -0.736  1.00 58.23  ? 76   ARG C C   1 
ATOM   6481  O O   . ARG C 1 65  ? -26.616 36.077  -1.524  1.00 58.23  ? 76   ARG C O   1 
ATOM   6482  C CB  . ARG C 1 65  ? -25.149 38.452  -2.157  1.00 86.34  ? 76   ARG C CB  1 
ATOM   6483  C CG  . ARG C 1 65  ? -25.079 39.773  -2.921  1.00 86.34  ? 76   ARG C CG  1 
ATOM   6484  C CD  . ARG C 1 65  ? -26.414 40.059  -3.638  1.00 86.34  ? 76   ARG C CD  1 
ATOM   6485  N NE  . ARG C 1 65  ? -26.471 41.350  -4.331  1.00 86.34  ? 76   ARG C NE  1 
ATOM   6486  C CZ  . ARG C 1 65  ? -26.801 42.507  -3.760  1.00 86.34  ? 76   ARG C CZ  1 
ATOM   6487  N NH1 . ARG C 1 65  ? -27.114 42.565  -2.471  1.00 86.34  ? 76   ARG C NH1 1 
ATOM   6488  N NH2 . ARG C 1 65  ? -26.822 43.614  -4.486  1.00 86.34  ? 76   ARG C NH2 1 
ATOM   6489  N N   . HIS C 1 66  ? -27.074 36.868  0.522   1.00 61.27  ? 77   HIS C N   1 
ATOM   6490  C CA  . HIS C 1 66  ? -27.496 35.589  1.058   1.00 61.27  ? 77   HIS C CA  1 
ATOM   6491  C C   . HIS C 1 66  ? -26.512 34.417  0.958   1.00 61.27  ? 77   HIS C C   1 
ATOM   6492  O O   . HIS C 1 66  ? -26.819 33.357  0.399   1.00 61.27  ? 77   HIS C O   1 
ATOM   6493  C CB  . HIS C 1 66  ? -28.822 35.218  0.413   1.00 71.03  ? 77   HIS C CB  1 
ATOM   6494  C CG  . HIS C 1 66  ? -29.890 36.239  0.630   1.00 71.03  ? 77   HIS C CG  1 
ATOM   6495  N ND1 . HIS C 1 66  ? -30.680 36.262  1.758   1.00 71.03  ? 77   HIS C ND1 1 
ATOM   6496  C CD2 . HIS C 1 66  ? -30.271 37.302  -0.118  1.00 71.03  ? 77   HIS C CD2 1 
ATOM   6497  C CE1 . HIS C 1 66  ? -31.503 37.295  1.694   1.00 71.03  ? 77   HIS C CE1 1 
ATOM   6498  N NE2 . HIS C 1 66  ? -31.275 37.942  0.565   1.00 71.03  ? 77   HIS C NE2 1 
ATOM   6499  N N   . PHE C 1 67  ? -25.326 34.610  1.516   1.00 67.21  ? 78   PHE C N   1 
ATOM   6500  C CA  . PHE C 1 67  ? -24.319 33.563  1.535   1.00 67.21  ? 78   PHE C CA  1 
ATOM   6501  C C   . PHE C 1 67  ? -24.184 33.149  2.998   1.00 67.21  ? 78   PHE C C   1 
ATOM   6502  O O   . PHE C 1 67  ? -24.298 31.974  3.333   1.00 67.21  ? 78   PHE C O   1 
ATOM   6503  C CB  . PHE C 1 67  ? -22.976 34.086  1.007   1.00 64.21  ? 78   PHE C CB  1 
ATOM   6504  C CG  . PHE C 1 67  ? -22.768 33.865  -0.465  1.00 64.21  ? 78   PHE C CG  1 
ATOM   6505  C CD1 . PHE C 1 67  ? -22.660 32.577  -0.979  1.00 64.21  ? 78   PHE C CD1 1 
ATOM   6506  C CD2 . PHE C 1 67  ? -22.696 34.942  -1.343  1.00 64.21  ? 78   PHE C CD2 1 
ATOM   6507  C CE1 . PHE C 1 67  ? -22.485 32.360  -2.352  1.00 64.21  ? 78   PHE C CE1 1 
ATOM   6508  C CE2 . PHE C 1 67  ? -22.520 34.735  -2.722  1.00 64.21  ? 78   PHE C CE2 1 
ATOM   6509  C CZ  . PHE C 1 67  ? -22.416 33.444  -3.225  1.00 64.21  ? 78   PHE C CZ  1 
ATOM   6510  N N   . LEU C 1 68  ? -23.963 34.136  3.864   1.00 68.55  ? 79   LEU C N   1 
ATOM   6511  C CA  . LEU C 1 68  ? -23.808 33.912  5.295   1.00 68.55  ? 79   LEU C CA  1 
ATOM   6512  C C   . LEU C 1 68  ? -24.949 34.554  6.066   1.00 68.55  ? 79   LEU C C   1 
ATOM   6513  O O   . LEU C 1 68  ? -25.107 35.769  6.053   1.00 68.55  ? 79   LEU C O   1 
ATOM   6514  C CB  . LEU C 1 68  ? -22.485 34.500  5.767   1.00 62.97  ? 79   LEU C CB  1 
ATOM   6515  C CG  . LEU C 1 68  ? -21.240 33.723  5.350   1.00 62.97  ? 79   LEU C CG  1 
ATOM   6516  C CD1 . LEU C 1 68  ? -21.480 32.262  5.665   1.00 62.97  ? 79   LEU C CD1 1 
ATOM   6517  C CD2 . LEU C 1 68  ? -20.940 33.891  3.879   1.00 62.97  ? 79   LEU C CD2 1 
ATOM   6518  N N   . SER C 1 69  ? -25.741 33.738  6.749   1.00 85.94  ? 80   SER C N   1 
ATOM   6519  C CA  . SER C 1 69  ? -26.881 34.242  7.515   1.00 85.94  ? 80   SER C CA  1 
ATOM   6520  C C   . SER C 1 69  ? -26.429 34.759  8.873   1.00 85.94  ? 80   SER C C   1 
ATOM   6521  O O   . SER C 1 69  ? -25.425 34.292  9.411   1.00 85.94  ? 80   SER C O   1 
ATOM   6522  C CB  . SER C 1 69  ? -27.917 33.123  7.704   1.00 55.37  ? 80   SER C CB  1 
ATOM   6523  O OG  . SER C 1 69  ? -29.127 33.597  8.270   1.00 55.37  ? 80   SER C OG  1 
ATOM   6524  N N   . GLY C 1 70  ? -27.161 35.730  9.419   1.00 131.43 ? 81   GLY C N   1 
ATOM   6525  C CA  . GLY C 1 70  ? -26.818 36.267  10.727  1.00 131.43 ? 81   GLY C CA  1 
ATOM   6526  C C   . GLY C 1 70  ? -26.654 37.773  10.859  1.00 131.43 ? 81   GLY C C   1 
ATOM   6527  O O   . GLY C 1 70  ? -26.990 38.537  9.957   1.00 131.43 ? 81   GLY C O   1 
ATOM   6528  N N   . SER C 1 71  ? -26.142 38.191  12.013  1.00 139.63 ? 82   SER C N   1 
ATOM   6529  C CA  . SER C 1 71  ? -25.898 39.598  12.313  1.00 139.63 ? 82   SER C CA  1 
ATOM   6530  C C   . SER C 1 71  ? -24.410 39.871  12.147  1.00 139.63 ? 82   SER C C   1 
ATOM   6531  O O   . SER C 1 71  ? -23.583 39.001  12.417  1.00 139.63 ? 82   SER C O   1 
ATOM   6532  C CB  . SER C 1 71  ? -26.310 39.918  13.754  1.00 89.95  ? 82   SER C CB  1 
ATOM   6533  O OG  . SER C 1 71  ? -25.922 41.233  14.121  1.00 89.95  ? 82   SER C OG  1 
ATOM   6534  N N   . LYS C 1 72  ? -24.069 41.079  11.708  1.00 175.17 ? 83   LYS C N   1 
ATOM   6535  C CA  . LYS C 1 72  ? -22.672 41.442  11.510  1.00 175.17 ? 83   LYS C CA  1 
ATOM   6536  C C   . LYS C 1 72  ? -21.937 41.462  12.846  1.00 175.17 ? 83   LYS C C   1 
ATOM   6537  O O   . LYS C 1 72  ? -21.090 42.321  13.093  1.00 175.17 ? 83   LYS C O   1 
ATOM   6538  C CB  . LYS C 1 72  ? -22.570 42.810  10.827  1.00 132.63 ? 83   LYS C CB  1 
ATOM   6539  C CG  . LYS C 1 72  ? -21.167 43.148  10.333  1.00 132.63 ? 83   LYS C CG  1 
ATOM   6540  C CD  . LYS C 1 72  ? -21.150 44.418  9.494   1.00 132.63 ? 83   LYS C CD  1 
ATOM   6541  C CE  . LYS C 1 72  ? -22.015 44.278  8.249   1.00 132.63 ? 83   LYS C CE  1 
ATOM   6542  N NZ  . LYS C 1 72  ? -22.036 45.527  7.442   1.00 132.63 ? 83   LYS C NZ  1 
ATOM   6543  N N   . GLN C 1 73  ? -22.277 40.502  13.703  1.00 110.96 ? 84   GLN C N   1 
ATOM   6544  C CA  . GLN C 1 73  ? -21.669 40.365  15.022  1.00 110.96 ? 84   GLN C CA  1 
ATOM   6545  C C   . GLN C 1 73  ? -21.589 38.889  15.414  1.00 110.96 ? 84   GLN C C   1 
ATOM   6546  O O   . GLN C 1 73  ? -20.595 38.443  15.999  1.00 110.96 ? 84   GLN C O   1 
ATOM   6547  C CB  . GLN C 1 73  ? -22.476 41.145  16.065  1.00 201.99 ? 84   GLN C CB  1 
ATOM   6548  C CG  . GLN C 1 73  ? -22.373 42.663  15.932  1.00 201.99 ? 84   GLN C CG  1 
ATOM   6549  C CD  . GLN C 1 73  ? -20.958 43.185  16.154  1.00 201.99 ? 84   GLN C CD  1 
ATOM   6550  O OE1 . GLN C 1 73  ? -20.033 42.848  15.413  1.00 201.99 ? 84   GLN C OE1 1 
ATOM   6551  N NE2 . GLN C 1 73  ? -20.787 44.012  17.180  1.00 201.99 ? 84   GLN C NE2 1 
ATOM   6552  N N   . GLN C 1 74  ? -22.638 38.136  15.095  1.00 158.21 ? 85   GLN C N   1 
ATOM   6553  C CA  . GLN C 1 74  ? -22.662 36.709  15.398  1.00 158.21 ? 85   GLN C CA  1 
ATOM   6554  C C   . GLN C 1 74  ? -22.026 35.972  14.227  1.00 158.21 ? 85   GLN C C   1 
ATOM   6555  O O   . GLN C 1 74  ? -21.641 34.807  14.334  1.00 158.21 ? 85   GLN C O   1 
ATOM   6556  C CB  . GLN C 1 74  ? -24.099 36.228  15.624  1.00 106.93 ? 85   GLN C CB  1 
ATOM   6557  C CG  . GLN C 1 74  ? -25.062 36.524  14.491  1.00 106.93 ? 85   GLN C CG  1 
ATOM   6558  C CD  . GLN C 1 74  ? -26.483 36.074  14.808  1.00 106.93 ? 85   GLN C CD  1 
ATOM   6559  O OE1 . GLN C 1 74  ? -27.390 36.198  13.982  1.00 106.93 ? 85   GLN C OE1 1 
ATOM   6560  N NE2 . GLN C 1 74  ? -26.681 35.550  16.014  1.00 106.93 ? 85   GLN C NE2 1 
ATOM   6561  N N   . LEU C 1 75  ? -21.916 36.681  13.109  1.00 96.92  ? 86   LEU C N   1 
ATOM   6562  C CA  . LEU C 1 75  ? -21.315 36.155  11.890  1.00 96.92  ? 86   LEU C CA  1 
ATOM   6563  C C   . LEU C 1 75  ? -19.955 36.835  11.791  1.00 96.92  ? 86   LEU C C   1 
ATOM   6564  O O   . LEU C 1 75  ? -19.728 37.687  10.929  1.00 96.92  ? 86   LEU C O   1 
ATOM   6565  C CB  . LEU C 1 75  ? -22.176 36.525  10.676  1.00 147.87 ? 86   LEU C CB  1 
ATOM   6566  C CG  . LEU C 1 75  ? -21.995 35.754  9.364   1.00 147.87 ? 86   LEU C CG  1 
ATOM   6567  C CD1 . LEU C 1 75  ? -20.591 35.934  8.820   1.00 147.87 ? 86   LEU C CD1 1 
ATOM   6568  C CD2 . LEU C 1 75  ? -22.291 34.288  9.611   1.00 147.87 ? 86   LEU C CD2 1 
ATOM   6569  N N   . SER C 1 76  ? -19.055 36.458  12.691  1.00 157.11 ? 87   SER C N   1 
ATOM   6570  C CA  . SER C 1 76  ? -17.730 37.052  12.723  1.00 157.11 ? 87   SER C CA  1 
ATOM   6571  C C   . SER C 1 76  ? -16.599 36.082  12.422  1.00 157.11 ? 87   SER C C   1 
ATOM   6572  O O   . SER C 1 76  ? -16.797 34.876  12.286  1.00 157.11 ? 87   SER C O   1 
ATOM   6573  C CB  . SER C 1 76  ? -17.484 37.701  14.090  1.00 109.74 ? 87   SER C CB  1 
ATOM   6574  O OG  . SER C 1 76  ? -17.535 36.741  15.135  1.00 109.74 ? 87   SER C OG  1 
ATOM   6575  N N   . ARG C 1 77  ? -15.406 36.654  12.323  1.00 91.34  ? 88   ARG C N   1 
ATOM   6576  C CA  . ARG C 1 77  ? -14.170 35.935  12.061  1.00 91.34  ? 88   ARG C CA  1 
ATOM   6577  C C   . ARG C 1 77  ? -14.009 34.651  12.876  1.00 91.34  ? 88   ARG C C   1 
ATOM   6578  O O   . ARG C 1 77  ? -13.720 33.593  12.320  1.00 91.34  ? 88   ARG C O   1 
ATOM   6579  C CB  . ARG C 1 77  ? -12.982 36.865  12.340  1.00 176.81 ? 88   ARG C CB  1 
ATOM   6580  C CG  . ARG C 1 77  ? -13.275 38.016  13.337  1.00 176.81 ? 88   ARG C CG  1 
ATOM   6581  C CD  . ARG C 1 77  ? -13.821 37.546  14.703  1.00 176.81 ? 88   ARG C CD  1 
ATOM   6582  N NE  . ARG C 1 77  ? -14.133 38.661  15.604  1.00 176.81 ? 88   ARG C NE  1 
ATOM   6583  C CZ  . ARG C 1 77  ? -14.748 38.540  16.781  1.00 176.81 ? 88   ARG C CZ  1 
ATOM   6584  N NH1 . ARG C 1 77  ? -15.129 37.349  17.223  1.00 176.81 ? 88   ARG C NH1 1 
ATOM   6585  N NH2 . ARG C 1 77  ? -14.985 39.615  17.521  1.00 176.81 ? 88   ARG C NH2 1 
ATOM   6586  N N   . ASP C 1 78  ? -14.191 34.756  14.193  1.00 111.54 ? 89   ASP C N   1 
ATOM   6587  C CA  . ASP C 1 78  ? -14.044 33.623  15.108  1.00 111.54 ? 89   ASP C CA  1 
ATOM   6588  C C   . ASP C 1 78  ? -15.163 32.586  15.023  1.00 111.54 ? 89   ASP C C   1 
ATOM   6589  O O   . ASP C 1 78  ? -14.891 31.389  14.922  1.00 111.54 ? 89   ASP C O   1 
ATOM   6590  C CB  . ASP C 1 78  ? -13.917 34.122  16.557  1.00 106.58 ? 89   ASP C CB  1 
ATOM   6591  C CG  . ASP C 1 78  ? -12.609 34.875  16.817  1.00 106.58 ? 89   ASP C CG  1 
ATOM   6592  O OD1 . ASP C 1 78  ? -12.419 35.357  17.955  1.00 106.58 ? 89   ASP C OD1 1 
ATOM   6593  O OD2 . ASP C 1 78  ? -11.772 34.982  15.893  1.00 106.58 ? 89   ASP C OD2 1 
ATOM   6594  N N   . SER C 1 79  ? -16.415 33.036  15.073  1.00 73.00  ? 90   SER C N   1 
ATOM   6595  C CA  . SER C 1 79  ? -17.543 32.112  14.990  1.00 73.00  ? 90   SER C CA  1 
ATOM   6596  C C   . SER C 1 79  ? -17.496 31.290  13.698  1.00 73.00  ? 90   SER C C   1 
ATOM   6597  O O   . SER C 1 79  ? -17.586 30.063  13.731  1.00 73.00  ? 90   SER C O   1 
ATOM   6598  C CB  . SER C 1 79  ? -18.867 32.878  15.083  1.00 85.12  ? 90   SER C CB  1 
ATOM   6599  O OG  . SER C 1 79  ? -19.119 33.292  16.415  1.00 85.12  ? 90   SER C OG  1 
ATOM   6600  N N   . LEU C 1 80  ? -17.340 31.976  12.568  1.00 81.45  ? 91   LEU C N   1 
ATOM   6601  C CA  . LEU C 1 80  ? -17.271 31.344  11.246  1.00 81.45  ? 91   LEU C CA  1 
ATOM   6602  C C   . LEU C 1 80  ? -16.217 30.220  11.132  1.00 81.45  ? 91   LEU C C   1 
ATOM   6603  O O   . LEU C 1 80  ? -16.477 29.166  10.551  1.00 81.45  ? 91   LEU C O   1 
ATOM   6604  C CB  . LEU C 1 80  ? -17.004 32.429  10.201  1.00 32.65  ? 91   LEU C CB  1 
ATOM   6605  C CG  . LEU C 1 80  ? -17.982 32.664  9.042   1.00 32.65  ? 91   LEU C CG  1 
ATOM   6606  C CD1 . LEU C 1 80  ? -19.434 32.566  9.490   1.00 32.65  ? 91   LEU C CD1 1 
ATOM   6607  C CD2 . LEU C 1 80  ? -17.692 34.039  8.456   1.00 32.65  ? 91   LEU C CD2 1 
ATOM   6608  N N   . LEU C 1 81  ? -15.024 30.448  11.669  1.00 61.90  ? 92   LEU C N   1 
ATOM   6609  C CA  . LEU C 1 81  ? -13.983 29.432  11.631  1.00 61.90  ? 92   LEU C CA  1 
ATOM   6610  C C   . LEU C 1 81  ? -14.285 28.406  12.709  1.00 61.90  ? 92   LEU C C   1 
ATOM   6611  O O   . LEU C 1 81  ? -14.339 27.216  12.437  1.00 61.90  ? 92   LEU C O   1 
ATOM   6612  C CB  . LEU C 1 81  ? -12.593 30.050  11.868  1.00 42.66  ? 92   LEU C CB  1 
ATOM   6613  C CG  . LEU C 1 81  ? -11.956 30.805  10.690  1.00 42.66  ? 92   LEU C CG  1 
ATOM   6614  C CD1 . LEU C 1 81  ? -10.593 31.330  11.086  1.00 42.66  ? 92   LEU C CD1 1 
ATOM   6615  C CD2 . LEU C 1 81  ? -11.829 29.877  9.490   1.00 42.66  ? 92   LEU C CD2 1 
ATOM   6616  N N   . SER C 1 82  ? -14.497 28.867  13.933  1.00 42.06  ? 93   SER C N   1 
ATOM   6617  C CA  . SER C 1 82  ? -14.804 27.955  15.029  1.00 42.06  ? 93   SER C CA  1 
ATOM   6618  C C   . SER C 1 82  ? -16.034 27.135  14.642  1.00 42.06  ? 93   SER C C   1 
ATOM   6619  O O   . SER C 1 82  ? -16.413 26.179  15.327  1.00 42.06  ? 93   SER C O   1 
ATOM   6620  C CB  . SER C 1 82  ? -15.098 28.734  16.321  1.00 54.94  ? 93   SER C CB  1 
ATOM   6621  O OG  . SER C 1 82  ? -16.365 29.377  16.276  1.00 54.94  ? 93   SER C OG  1 
ATOM   6622  N N   . GLY C 1 83  ? -16.655 27.519  13.536  1.00 43.35  ? 94   GLY C N   1 
ATOM   6623  C CA  . GLY C 1 83  ? -17.837 26.817  13.091  1.00 43.35  ? 94   GLY C CA  1 
ATOM   6624  C C   . GLY C 1 83  ? -18.961 27.003  14.088  1.00 43.35  ? 94   GLY C C   1 
ATOM   6625  O O   . GLY C 1 83  ? -19.875 26.188  14.172  1.00 43.35  ? 94   GLY C O   1 
ATOM   6626  N N   . CYS C 1 84  ? -18.901 28.090  14.845  1.00 87.10  ? 95   CYS C N   1 
ATOM   6627  C CA  . CYS C 1 84  ? -19.919 28.375  15.845  1.00 87.10  ? 95   CYS C CA  1 
ATOM   6628  C C   . CYS C 1 84  ? -20.790 29.550  15.405  1.00 87.10  ? 95   CYS C C   1 
ATOM   6629  O O   . CYS C 1 84  ? -21.008 30.496  16.164  1.00 87.10  ? 95   CYS C O   1 
ATOM   6630  C CB  . CYS C 1 84  ? -19.247 28.687  17.181  1.00 89.97  ? 95   CYS C CB  1 
ATOM   6631  S SG  . CYS C 1 84  ? -20.384 28.746  18.556  1.00 89.97  ? 95   CYS C SG  1 
ATOM   6632  N N   . HIS C 1 85  ? -21.281 29.483  14.170  1.00 82.98  ? 96   HIS C N   1 
ATOM   6633  C CA  . HIS C 1 85  ? -22.122 30.540  13.627  1.00 82.98  ? 96   HIS C CA  1 
ATOM   6634  C C   . HIS C 1 85  ? -23.615 30.215  13.602  1.00 82.98  ? 96   HIS C C   1 
ATOM   6635  O O   . HIS C 1 85  ? -24.038 29.139  14.027  1.00 82.98  ? 96   HIS C O   1 
ATOM   6636  C CB  . HIS C 1 85  ? -21.647 30.948  12.220  1.00 79.88  ? 96   HIS C CB  1 
ATOM   6637  C CG  . HIS C 1 85  ? -21.369 29.805  11.292  1.00 79.88  ? 96   HIS C CG  1 
ATOM   6638  N ND1 . HIS C 1 85  ? -20.105 29.281  11.119  1.00 79.88  ? 96   HIS C ND1 1 
ATOM   6639  C CD2 . HIS C 1 85  ? -22.173 29.136  10.431  1.00 79.88  ? 96   HIS C CD2 1 
ATOM   6640  C CE1 . HIS C 1 85  ? -20.142 28.343  10.189  1.00 79.88  ? 96   HIS C CE1 1 
ATOM   6641  N NE2 . HIS C 1 85  ? -21.385 28.235  9.754   1.00 79.88  ? 96   HIS C NE2 1 
ATOM   6642  N N   . PRO C 1 86  ? -24.437 31.163  13.122  1.00 143.92 ? 97   PRO C N   1 
ATOM   6643  C CA  . PRO C 1 86  ? -25.889 30.984  13.045  1.00 143.92 ? 97   PRO C CA  1 
ATOM   6644  C C   . PRO C 1 86  ? -26.406 30.138  11.884  1.00 143.92 ? 97   PRO C C   1 
ATOM   6645  O O   . PRO C 1 86  ? -27.512 29.603  11.954  1.00 143.92 ? 97   PRO C O   1 
ATOM   6646  C CB  . PRO C 1 86  ? -26.399 32.416  12.980  1.00 68.05  ? 97   PRO C CB  1 
ATOM   6647  C CG  . PRO C 1 86  ? -25.316 33.108  12.211  1.00 68.05  ? 97   PRO C CG  1 
ATOM   6648  C CD  . PRO C 1 86  ? -24.076 32.570  12.859  1.00 68.05  ? 97   PRO C CD  1 
ATOM   6649  N N   . GLY C 1 87  ? -25.627 30.023  10.815  1.00 92.89  ? 98   GLY C N   1 
ATOM   6650  C CA  . GLY C 1 87  ? -26.085 29.226  9.691   1.00 92.89  ? 98   GLY C CA  1 
ATOM   6651  C C   . GLY C 1 87  ? -25.694 29.754  8.325   1.00 92.89  ? 98   GLY C C   1 
ATOM   6652  O O   . GLY C 1 87  ? -24.882 30.675  8.214   1.00 92.89  ? 98   GLY C O   1 
ATOM   6653  N N   . PHE C 1 88  ? -26.272 29.162  7.281   1.00 57.21  ? 99   PHE C N   1 
ATOM   6654  C CA  . PHE C 1 88  ? -25.980 29.568  5.912   1.00 57.21  ? 99   PHE C CA  1 
ATOM   6655  C C   . PHE C 1 88  ? -27.240 29.919  5.161   1.00 57.21  ? 99   PHE C C   1 
ATOM   6656  O O   . PHE C 1 88  ? -28.222 29.181  5.220   1.00 57.21  ? 99   PHE C O   1 
ATOM   6657  C CB  . PHE C 1 88  ? -25.289 28.449  5.124   1.00 63.17  ? 99   PHE C CB  1 
ATOM   6658  C CG  . PHE C 1 88  ? -23.867 28.200  5.516   1.00 63.17  ? 99   PHE C CG  1 
ATOM   6659  C CD1 . PHE C 1 88  ? -23.014 29.256  5.812   1.00 63.17  ? 99   PHE C CD1 1 
ATOM   6660  C CD2 . PHE C 1 88  ? -23.365 26.905  5.536   1.00 63.17  ? 99   PHE C CD2 1 
ATOM   6661  C CE1 . PHE C 1 88  ? -21.677 29.029  6.123   1.00 63.17  ? 99   PHE C CE1 1 
ATOM   6662  C CE2 . PHE C 1 88  ? -22.037 26.660  5.842   1.00 63.17  ? 99   PHE C CE2 1 
ATOM   6663  C CZ  . PHE C 1 88  ? -21.184 27.729  6.138   1.00 63.17  ? 99   PHE C CZ  1 
ATOM   6664  N N   . GLY C 1 89  ? -27.207 31.036  4.441   1.00 65.04  ? 100  GLY C N   1 
ATOM   6665  C CA  . GLY C 1 89  ? -28.356 31.430  3.649   1.00 65.04  ? 100  GLY C CA  1 
ATOM   6666  C C   . GLY C 1 89  ? -28.394 30.529  2.430   1.00 65.04  ? 100  GLY C C   1 
ATOM   6667  O O   . GLY C 1 89  ? -27.453 29.767  2.205   1.00 65.04  ? 100  GLY C O   1 
ATOM   6668  N N   . PRO C 1 90  ? -29.456 30.589  1.619   1.00 41.71  ? 101  PRO C N   1 
ATOM   6669  C CA  . PRO C 1 90  ? -29.607 29.764  0.409   1.00 41.71  ? 101  PRO C CA  1 
ATOM   6670  C C   . PRO C 1 90  ? -28.353 29.661  -0.484  1.00 41.71  ? 101  PRO C C   1 
ATOM   6671  O O   . PRO C 1 90  ? -27.954 28.564  -0.889  1.00 41.71  ? 101  PRO C O   1 
ATOM   6672  C CB  . PRO C 1 90  ? -30.769 30.434  -0.315  1.00 42.54  ? 101  PRO C CB  1 
ATOM   6673  C CG  . PRO C 1 90  ? -31.599 30.924  0.808   1.00 42.54  ? 101  PRO C CG  1 
ATOM   6674  C CD  . PRO C 1 90  ? -30.587 31.519  1.761   1.00 42.54  ? 101  PRO C CD  1 
ATOM   6675  N N   . LEU C 1 91  ? -27.741 30.801  -0.800  1.00 43.95  ? 102  LEU C N   1 
ATOM   6676  C CA  . LEU C 1 91  ? -26.566 30.775  -1.637  1.00 43.95  ? 102  LEU C CA  1 
ATOM   6677  C C   . LEU C 1 91  ? -25.499 29.943  -0.990  1.00 43.95  ? 102  LEU C C   1 
ATOM   6678  O O   . LEU C 1 91  ? -24.933 29.070  -1.642  1.00 43.95  ? 102  LEU C O   1 
ATOM   6679  C CB  . LEU C 1 91  ? -26.050 32.178  -1.922  1.00 55.65  ? 102  LEU C CB  1 
ATOM   6680  C CG  . LEU C 1 91  ? -26.584 32.732  -3.250  1.00 55.65  ? 102  LEU C CG  1 
ATOM   6681  C CD1 . LEU C 1 91  ? -28.084 32.967  -3.114  1.00 55.65  ? 102  LEU C CD1 1 
ATOM   6682  C CD2 . LEU C 1 91  ? -25.850 34.015  -3.647  1.00 55.65  ? 102  LEU C CD2 1 
ATOM   6683  N N   . GLY C 1 92  ? -25.234 30.191  0.292   1.00 33.54  ? 103  GLY C N   1 
ATOM   6684  C CA  . GLY C 1 92  ? -24.219 29.411  0.998   1.00 33.54  ? 103  GLY C CA  1 
ATOM   6685  C C   . GLY C 1 92  ? -24.464 27.914  0.903   1.00 33.54  ? 103  GLY C C   1 
ATOM   6686  O O   . GLY C 1 92  ? -23.605 27.119  0.504   1.00 33.54  ? 103  GLY C O   1 
ATOM   6687  N N   . VAL C 1 93  ? -25.674 27.541  1.276   1.00 37.37  ? 104  VAL C N   1 
ATOM   6688  C CA  . VAL C 1 93  ? -26.091 26.159  1.242   1.00 37.37  ? 104  VAL C CA  1 
ATOM   6689  C C   . VAL C 1 93  ? -25.967 25.567  -0.148  1.00 37.37  ? 104  VAL C C   1 
ATOM   6690  O O   . VAL C 1 93  ? -25.708 24.384  -0.301  1.00 37.37  ? 104  VAL C O   1 
ATOM   6691  C CB  . VAL C 1 93  ? -27.544 26.027  1.712   1.00 42.33  ? 104  VAL C CB  1 
ATOM   6692  C CG1 . VAL C 1 93  ? -28.012 24.588  1.598   1.00 42.33  ? 104  VAL C CG1 1 
ATOM   6693  C CG2 . VAL C 1 93  ? -27.657 26.528  3.135   1.00 42.33  ? 104  VAL C CG2 1 
ATOM   6694  N N   . GLU C 1 94  ? -26.167 26.372  -1.173  1.00 49.29  ? 105  GLU C N   1 
ATOM   6695  C CA  . GLU C 1 94  ? -26.054 25.825  -2.509  1.00 49.29  ? 105  GLU C CA  1 
ATOM   6696  C C   . GLU C 1 94  ? -24.596 25.755  -2.908  1.00 49.29  ? 105  GLU C C   1 
ATOM   6697  O O   . GLU C 1 94  ? -24.234 24.922  -3.731  1.00 49.29  ? 105  GLU C O   1 
ATOM   6698  C CB  . GLU C 1 94  ? -26.835 26.666  -3.528  1.00 71.33  ? 105  GLU C CB  1 
ATOM   6699  C CG  . GLU C 1 94  ? -28.266 26.193  -3.799  1.00 71.33  ? 105  GLU C CG  1 
ATOM   6700  C CD  . GLU C 1 94  ? -28.331 24.744  -4.258  1.00 71.33  ? 105  GLU C CD  1 
ATOM   6701  O OE1 . GLU C 1 94  ? -27.557 24.367  -5.157  1.00 71.33  ? 105  GLU C OE1 1 
ATOM   6702  O OE2 . GLU C 1 94  ? -29.162 23.978  -3.731  1.00 71.33  ? 105  GLU C OE2 1 
ATOM   6703  N N   . LEU C 1 95  ? -23.762 26.624  -2.329  1.00 43.55  ? 106  LEU C N   1 
ATOM   6704  C CA  . LEU C 1 95  ? -22.334 26.638  -2.652  1.00 43.55  ? 106  LEU C CA  1 
ATOM   6705  C C   . LEU C 1 95  ? -21.696 25.422  -2.029  1.00 43.55  ? 106  LEU C C   1 
ATOM   6706  O O   . LEU C 1 95  ? -21.012 24.651  -2.703  1.00 43.55  ? 106  LEU C O   1 
ATOM   6707  C CB  . LEU C 1 95  ? -21.658 27.899  -2.117  1.00 19.60  ? 106  LEU C CB  1 
ATOM   6708  C CG  . LEU C 1 95  ? -20.133 28.030  -2.271  1.00 19.60  ? 106  LEU C CG  1 
ATOM   6709  C CD1 . LEU C 1 95  ? -19.722 27.730  -3.709  1.00 19.60  ? 106  LEU C CD1 1 
ATOM   6710  C CD2 . LEU C 1 95  ? -19.694 29.428  -1.844  1.00 19.60  ? 106  LEU C CD2 1 
ATOM   6711  N N   . ARG C 1 96  ? -21.910 25.252  -0.731  1.00 33.05  ? 107  ARG C N   1 
ATOM   6712  C CA  . ARG C 1 96  ? -21.374 24.086  -0.068  1.00 33.05  ? 107  ARG C CA  1 
ATOM   6713  C C   . ARG C 1 96  ? -21.911 22.839  -0.781  1.00 33.05  ? 107  ARG C C   1 
ATOM   6714  O O   . ARG C 1 96  ? -21.198 21.872  -1.017  1.00 33.05  ? 107  ARG C O   1 
ATOM   6715  C CB  . ARG C 1 96  ? -21.803 24.075  1.391   1.00 46.54  ? 107  ARG C CB  1 
ATOM   6716  C CG  . ARG C 1 96  ? -21.678 22.707  2.010   1.00 46.54  ? 107  ARG C CG  1 
ATOM   6717  C CD  . ARG C 1 96  ? -21.446 22.793  3.498   1.00 46.54  ? 107  ARG C CD  1 
ATOM   6718  N NE  . ARG C 1 96  ? -22.537 23.453  4.219   1.00 46.54  ? 107  ARG C NE  1 
ATOM   6719  C CZ  . ARG C 1 96  ? -23.447 22.807  4.935   1.00 46.54  ? 107  ARG C CZ  1 
ATOM   6720  N NH1 . ARG C 1 96  ? -23.403 21.486  5.027   1.00 46.54  ? 107  ARG C NH1 1 
ATOM   6721  N NH2 . ARG C 1 96  ? -24.385 23.485  5.568   1.00 46.54  ? 107  ARG C NH2 1 
ATOM   6722  N N   . LYS C 1 97  ? -23.188 22.882  -1.128  1.00 41.43  ? 108  LYS C N   1 
ATOM   6723  C CA  . LYS C 1 97  ? -23.854 21.778  -1.792  1.00 41.43  ? 108  LYS C CA  1 
ATOM   6724  C C   . LYS C 1 97  ? -23.057 21.304  -2.995  1.00 41.43  ? 108  LYS C C   1 
ATOM   6725  O O   . LYS C 1 97  ? -22.834 20.109  -3.175  1.00 41.43  ? 108  LYS C O   1 
ATOM   6726  C CB  . LYS C 1 97  ? -25.259 22.215  -2.212  1.00 82.02  ? 108  LYS C CB  1 
ATOM   6727  C CG  . LYS C 1 97  ? -26.236 21.087  -2.434  1.00 82.02  ? 108  LYS C CG  1 
ATOM   6728  C CD  . LYS C 1 97  ? -27.636 21.644  -2.641  1.00 82.02  ? 108  LYS C CD  1 
ATOM   6729  C CE  . LYS C 1 97  ? -28.671 20.546  -2.894  1.00 82.02  ? 108  LYS C CE  1 
ATOM   6730  N NZ  . LYS C 1 97  ? -30.011 21.104  -3.252  1.00 82.02  ? 108  LYS C NZ  1 
ATOM   6731  N N   . ASN C 1 98  ? -22.621 22.237  -3.827  1.00 41.71  ? 109  ASN C N   1 
ATOM   6732  C CA  . ASN C 1 98  ? -21.854 21.856  -4.999  1.00 41.71  ? 109  ASN C CA  1 
ATOM   6733  C C   . ASN C 1 98  ? -20.487 21.389  -4.558  1.00 41.71  ? 109  ASN C C   1 
ATOM   6734  O O   . ASN C 1 98  ? -19.989 20.377  -5.036  1.00 41.71  ? 109  ASN C O   1 
ATOM   6735  C CB  . ASN C 1 98  ? -21.754 23.020  -5.978  1.00 48.38  ? 109  ASN C CB  1 
ATOM   6736  C CG  . ASN C 1 98  ? -23.104 23.412  -6.528  1.00 48.38  ? 109  ASN C CG  1 
ATOM   6737  O OD1 . ASN C 1 98  ? -23.956 22.546  -6.753  1.00 48.38  ? 109  ASN C OD1 1 
ATOM   6738  N ND2 . ASN C 1 98  ? -23.312 24.710  -6.753  1.00 48.38  ? 109  ASN C ND2 1 
ATOM   6739  N N   . LEU C 1 99  ? -19.883 22.109  -3.624  1.00 28.79  ? 110  LEU C N   1 
ATOM   6740  C CA  . LEU C 1 99  ? -18.578 21.704  -3.124  1.00 28.79  ? 110  LEU C CA  1 
ATOM   6741  C C   . LEU C 1 99  ? -18.648 20.226  -2.736  1.00 28.79  ? 110  LEU C C   1 
ATOM   6742  O O   . LEU C 1 99  ? -17.814 19.442  -3.145  1.00 28.79  ? 110  LEU C O   1 
ATOM   6743  C CB  . LEU C 1 99  ? -18.190 22.555  -1.922  1.00 26.23  ? 110  LEU C CB  1 
ATOM   6744  C CG  . LEU C 1 99  ? -16.700 22.549  -1.589  1.00 26.23  ? 110  LEU C CG  1 
ATOM   6745  C CD1 . LEU C 1 99  ? -15.900 22.860  -2.842  1.00 26.23  ? 110  LEU C CD1 1 
ATOM   6746  C CD2 . LEU C 1 99  ? -16.419 23.565  -0.510  1.00 26.23  ? 110  LEU C CD2 1 
ATOM   6747  N N   . ALA C 1 100 ? -19.663 19.849  -1.969  1.00 41.28  ? 111  ALA C N   1 
ATOM   6748  C CA  . ALA C 1 100 ? -19.851 18.456  -1.554  1.00 41.28  ? 111  ALA C CA  1 
ATOM   6749  C C   . ALA C 1 100 ? -20.170 17.565  -2.770  1.00 41.28  ? 111  ALA C C   1 
ATOM   6750  O O   . ALA C 1 100 ? -19.655 16.444  -2.917  1.00 41.28  ? 111  ALA C O   1 
ATOM   6751  C CB  . ALA C 1 100 ? -20.999 18.366  -0.508  1.00 8.43   ? 111  ALA C CB  1 
ATOM   6752  N N   . ALA C 1 101 ? -21.028 18.088  -3.640  1.00 58.86  ? 112  ALA C N   1 
ATOM   6753  C CA  . ALA C 1 101 ? -21.448 17.377  -4.833  1.00 58.86  ? 112  ALA C CA  1 
ATOM   6754  C C   . ALA C 1 101 ? -20.270 17.063  -5.726  1.00 58.86  ? 112  ALA C C   1 
ATOM   6755  O O   . ALA C 1 101 ? -20.247 16.025  -6.378  1.00 58.86  ? 112  ALA C O   1 
ATOM   6756  C CB  . ALA C 1 101 ? -22.467 18.204  -5.594  1.00 126.70 ? 112  ALA C CB  1 
ATOM   6757  N N   . GLU C 1 102 ? -19.296 17.971  -5.748  1.00 58.47  ? 113  GLU C N   1 
ATOM   6758  C CA  . GLU C 1 102 ? -18.096 17.823  -6.571  1.00 58.47  ? 113  GLU C CA  1 
ATOM   6759  C C   . GLU C 1 102 ? -17.116 16.889  -5.879  1.00 58.47  ? 113  GLU C C   1 
ATOM   6760  O O   . GLU C 1 102 ? -16.480 16.038  -6.511  1.00 58.47  ? 113  GLU C O   1 
ATOM   6761  C CB  . GLU C 1 102 ? -17.448 19.183  -6.790  1.00 82.86  ? 113  GLU C CB  1 
ATOM   6762  C CG  . GLU C 1 102 ? -16.557 19.227  -8.000  1.00 82.86  ? 113  GLU C CG  1 
ATOM   6763  C CD  . GLU C 1 102 ? -17.314 18.979  -9.301  1.00 82.86  ? 113  GLU C CD  1 
ATOM   6764  O OE1 . GLU C 1 102 ? -18.340 19.659  -9.535  1.00 82.86  ? 113  GLU C OE1 1 
ATOM   6765  O OE2 . GLU C 1 102 ? -16.875 18.112  -10.094 1.00 82.86  ? 113  GLU C OE2 1 
ATOM   6766  N N   . TRP C 1 103 ? -17.002 17.068  -4.568  1.00 36.99  ? 114  TRP C N   1 
ATOM   6767  C CA  . TRP C 1 103 ? -16.135 16.238  -3.752  1.00 36.99  ? 114  TRP C CA  1 
ATOM   6768  C C   . TRP C 1 103 ? -16.513 14.814  -4.093  1.00 36.99  ? 114  TRP C C   1 
ATOM   6769  O O   . TRP C 1 103 ? -15.691 14.028  -4.532  1.00 36.99  ? 114  TRP C O   1 
ATOM   6770  C CB  . TRP C 1 103 ? -16.411 16.468  -2.262  1.00 45.54  ? 114  TRP C CB  1 
ATOM   6771  C CG  . TRP C 1 103 ? -15.484 15.748  -1.335  1.00 45.54  ? 114  TRP C CG  1 
ATOM   6772  C CD1 . TRP C 1 103 ? -14.323 16.222  -0.835  1.00 45.54  ? 114  TRP C CD1 1 
ATOM   6773  C CD2 . TRP C 1 103 ? -15.625 14.417  -0.823  1.00 45.54  ? 114  TRP C CD2 1 
ATOM   6774  N NE1 . TRP C 1 103 ? -13.720 15.282  -0.040  1.00 45.54  ? 114  TRP C NE1 1 
ATOM   6775  C CE2 . TRP C 1 103 ? -14.498 14.161  -0.014  1.00 45.54  ? 114  TRP C CE2 1 
ATOM   6776  C CE3 . TRP C 1 103 ? -16.590 13.414  -0.969  1.00 45.54  ? 114  TRP C CE3 1 
ATOM   6777  C CZ2 . TRP C 1 103 ? -14.303 12.939  0.655   1.00 45.54  ? 114  TRP C CZ2 1 
ATOM   6778  C CZ3 . TRP C 1 103 ? -16.396 12.186  -0.298  1.00 45.54  ? 114  TRP C CZ3 1 
ATOM   6779  C CH2 . TRP C 1 103 ? -15.258 11.968  0.502   1.00 45.54  ? 114  TRP C CH2 1 
ATOM   6780  N N   . TRP C 1 104 ? -17.785 14.496  -3.916  1.00 29.54  ? 115  TRP C N   1 
ATOM   6781  C CA  . TRP C 1 104 ? -18.242 13.147  -4.160  1.00 29.54  ? 115  TRP C CA  1 
ATOM   6782  C C   . TRP C 1 104 ? -17.698 12.454  -5.417  1.00 29.54  ? 115  TRP C C   1 
ATOM   6783  O O   . TRP C 1 104 ? -17.044 11.416  -5.303  1.00 29.54  ? 115  TRP C O   1 
ATOM   6784  C CB  . TRP C 1 104 ? -19.773 13.105  -4.147  1.00 55.82  ? 115  TRP C CB  1 
ATOM   6785  C CG  . TRP C 1 104 ? -20.294 11.750  -3.801  1.00 55.82  ? 115  TRP C CG  1 
ATOM   6786  C CD1 . TRP C 1 104 ? -20.895 10.865  -4.642  1.00 55.82  ? 115  TRP C CD1 1 
ATOM   6787  C CD2 . TRP C 1 104 ? -20.181 11.088  -2.534  1.00 55.82  ? 115  TRP C CD2 1 
ATOM   6788  N NE1 . TRP C 1 104 ? -21.160 9.686   -3.982  1.00 55.82  ? 115  TRP C NE1 1 
ATOM   6789  C CE2 . TRP C 1 104 ? -20.732 9.796   -2.686  1.00 55.82  ? 115  TRP C CE2 1 
ATOM   6790  C CE3 . TRP C 1 104 ? -19.664 11.461  -1.285  1.00 55.82  ? 115  TRP C CE3 1 
ATOM   6791  C CZ2 . TRP C 1 104 ? -20.779 8.873   -1.635  1.00 55.82  ? 115  TRP C CZ2 1 
ATOM   6792  C CZ3 . TRP C 1 104 ? -19.711 10.543  -0.244  1.00 55.82  ? 115  TRP C CZ3 1 
ATOM   6793  C CH2 . TRP C 1 104 ? -20.264 9.266   -0.426  1.00 55.82  ? 115  TRP C CH2 1 
ATOM   6794  N N   . THR C 1 105 ? -17.941 13.015  -6.602  1.00 43.97  ? 116  THR C N   1 
ATOM   6795  C CA  . THR C 1 105 ? -17.481 12.362  -7.831  1.00 43.97  ? 116  THR C CA  1 
ATOM   6796  C C   . THR C 1 105 ? -15.958 12.253  -7.924  1.00 43.97  ? 116  THR C C   1 
ATOM   6797  O O   . THR C 1 105 ? -15.430 11.289  -8.468  1.00 43.97  ? 116  THR C O   1 
ATOM   6798  C CB  . THR C 1 105 ? -18.027 13.071  -9.117  1.00 35.19  ? 116  THR C CB  1 
ATOM   6799  O OG1 . THR C 1 105 ? -17.075 14.021  -9.599  1.00 35.19  ? 116  THR C OG1 1 
ATOM   6800  C CG2 . THR C 1 105 ? -19.314 13.796  -8.821  1.00 35.19  ? 116  THR C CG2 1 
ATOM   6801  N N   . SER C 1 106 ? -15.261 13.234  -7.367  1.00 46.01  ? 117  SER C N   1 
ATOM   6802  C CA  . SER C 1 106 ? -13.807 13.263  -7.393  1.00 46.01  ? 117  SER C CA  1 
ATOM   6803  C C   . SER C 1 106 ? -13.137 12.112  -6.664  1.00 46.01  ? 117  SER C C   1 
ATOM   6804  O O   . SER C 1 106 ? -12.045 11.707  -7.028  1.00 46.01  ? 117  SER C O   1 
ATOM   6805  C CB  . SER C 1 106 ? -13.314 14.590  -6.811  1.00 61.25  ? 117  SER C CB  1 
ATOM   6806  O OG  . SER C 1 106 ? -11.905 14.606  -6.684  1.00 61.25  ? 117  SER C OG  1 
ATOM   6807  N N   . VAL C 1 107 ? -13.786 11.572  -5.643  1.00 57.51  ? 118  VAL C N   1 
ATOM   6808  C CA  . VAL C 1 107 ? -13.185 10.489  -4.871  1.00 57.51  ? 118  VAL C CA  1 
ATOM   6809  C C   . VAL C 1 107 ? -14.034 9.239   -4.764  1.00 57.51  ? 118  VAL C C   1 
ATOM   6810  O O   . VAL C 1 107 ? -13.555 8.208   -4.318  1.00 57.51  ? 118  VAL C O   1 
ATOM   6811  C CB  . VAL C 1 107 ? -12.817 10.987  -3.426  1.00 41.62  ? 118  VAL C CB  1 
ATOM   6812  C CG1 . VAL C 1 107 ? -13.642 12.196  -3.069  1.00 41.62  ? 118  VAL C CG1 1 
ATOM   6813  C CG2 . VAL C 1 107 ? -13.069 9.908   -2.391  1.00 41.62  ? 118  VAL C CG2 1 
ATOM   6814  N N   . VAL C 1 108 ? -15.286 9.304   -5.189  1.00 73.24  ? 119  VAL C N   1 
ATOM   6815  C CA  . VAL C 1 108 ? -16.139 8.131   -5.056  1.00 73.24  ? 119  VAL C CA  1 
ATOM   6816  C C   . VAL C 1 108 ? -16.813 7.602   -6.327  1.00 73.24  ? 119  VAL C C   1 
ATOM   6817  O O   . VAL C 1 108 ? -16.601 6.451   -6.701  1.00 73.24  ? 119  VAL C O   1 
ATOM   6818  C CB  . VAL C 1 108 ? -17.234 8.393   -3.990  1.00 86.36  ? 119  VAL C CB  1 
ATOM   6819  C CG1 . VAL C 1 108 ? -17.862 7.086   -3.540  1.00 86.36  ? 119  VAL C CG1 1 
ATOM   6820  C CG2 . VAL C 1 108 ? -16.636 9.131   -2.810  1.00 86.36  ? 119  VAL C CG2 1 
ATOM   6821  N N   . VAL C 1 109 ? -17.618 8.440   -6.979  1.00 75.54  ? 120  VAL C N   1 
ATOM   6822  C CA  . VAL C 1 109 ? -18.362 8.046   -8.176  1.00 75.54  ? 120  VAL C CA  1 
ATOM   6823  C C   . VAL C 1 109 ? -17.651 7.106   -9.135  1.00 75.54  ? 120  VAL C C   1 
ATOM   6824  O O   . VAL C 1 109 ? -18.290 6.470   -9.972  1.00 75.54  ? 120  VAL C O   1 
ATOM   6825  C CB  . VAL C 1 109 ? -18.846 9.278   -8.965  1.00 79.03  ? 120  VAL C CB  1 
ATOM   6826  C CG1 . VAL C 1 109 ? -19.623 8.840   -10.204 1.00 79.03  ? 120  VAL C CG1 1 
ATOM   6827  C CG2 . VAL C 1 109 ? -19.739 10.121  -8.086  1.00 79.03  ? 120  VAL C CG2 1 
ATOM   6828  N N   . PHE C 1 110 ? -16.336 7.008   -9.017  1.00 98.22  ? 121  PHE C N   1 
ATOM   6829  C CA  . PHE C 1 110 ? -15.570 6.127   -9.883  1.00 98.22  ? 121  PHE C CA  1 
ATOM   6830  C C   . PHE C 1 110 ? -14.914 5.049   -9.032  1.00 98.22  ? 121  PHE C C   1 
ATOM   6831  O O   . PHE C 1 110 ? -15.398 4.740   -7.943  1.00 98.22  ? 121  PHE C O   1 
ATOM   6832  C CB  . PHE C 1 110 ? -14.532 6.953   -10.632 1.00 94.13  ? 121  PHE C CB  1 
ATOM   6833  C CG  . PHE C 1 110 ? -15.119 8.145   -11.325 1.00 94.13  ? 121  PHE C CG  1 
ATOM   6834  C CD1 . PHE C 1 110 ? -14.497 9.385   -11.258 1.00 94.13  ? 121  PHE C CD1 1 
ATOM   6835  C CD2 . PHE C 1 110 ? -16.313 8.035   -12.025 1.00 94.13  ? 121  PHE C CD2 1 
ATOM   6836  C CE1 . PHE C 1 110 ? -15.061 10.507  -11.878 1.00 94.13  ? 121  PHE C CE1 1 
ATOM   6837  C CE2 . PHE C 1 110 ? -16.885 9.146   -12.647 1.00 94.13  ? 121  PHE C CE2 1 
ATOM   6838  C CZ  . PHE C 1 110 ? -16.259 10.382  -12.573 1.00 94.13  ? 121  PHE C CZ  1 
ATOM   6839  N N   . ARG C 1 111 ? -13.830 4.467   -9.531  1.00 148.00 ? 122  ARG C N   1 
ATOM   6840  C CA  . ARG C 1 111 ? -13.113 3.434   -8.791  1.00 148.00 ? 122  ARG C CA  1 
ATOM   6841  C C   . ARG C 1 111 ? -14.034 2.742   -7.778  1.00 148.00 ? 122  ARG C C   1 
ATOM   6842  O O   . ARG C 1 111 ? -13.954 3.021   -6.583  1.00 148.00 ? 122  ARG C O   1 
ATOM   6843  C CB  . ARG C 1 111 ? -11.917 4.074   -8.067  1.00 105.29 ? 122  ARG C CB  1 
ATOM   6844  C CG  . ARG C 1 111 ? -12.281 5.267   -7.174  1.00 105.29 ? 122  ARG C CG  1 
ATOM   6845  C CD  . ARG C 1 111 ? -11.081 5.833   -6.408  1.00 105.29 ? 122  ARG C CD  1 
ATOM   6846  N NE  . ARG C 1 111 ? -10.355 6.871   -7.141  1.00 105.29 ? 122  ARG C NE  1 
ATOM   6847  C CZ  . ARG C 1 111 ? -9.516  6.644   -8.149  1.00 105.29 ? 122  ARG C CZ  1 
ATOM   6848  N NH1 . ARG C 1 111 ? -9.283  5.406   -8.557  1.00 105.29 ? 122  ARG C NH1 1 
ATOM   6849  N NH2 . ARG C 1 111 ? -8.906  7.658   -8.751  1.00 105.29 ? 122  ARG C NH2 1 
ATOM   6850  N N   . GLU C 1 112 ? -14.907 1.849   -8.249  1.00 92.54  ? 123  GLU C N   1 
ATOM   6851  C CA  . GLU C 1 112 ? -15.837 1.170   -7.342  1.00 92.54  ? 123  GLU C CA  1 
ATOM   6852  C C   . GLU C 1 112 ? -15.208 0.221   -6.323  1.00 92.54  ? 123  GLU C C   1 
ATOM   6853  O O   . GLU C 1 112 ? -15.407 -1.003  -6.334  1.00 92.54  ? 123  GLU C O   1 
ATOM   6854  C CB  . GLU C 1 112 ? -16.962 0.453   -8.109  1.00 128.85 ? 123  GLU C CB  1 
ATOM   6855  C CG  . GLU C 1 112 ? -18.124 1.374   -8.583  1.00 128.85 ? 123  GLU C CG  1 
ATOM   6856  C CD  . GLU C 1 112 ? -19.095 1.816   -7.484  1.00 128.85 ? 123  GLU C CD  1 
ATOM   6857  O OE1 . GLU C 1 112 ? -19.733 0.941   -6.851  1.00 128.85 ? 123  GLU C OE1 1 
ATOM   6858  O OE2 . GLU C 1 112 ? -19.230 3.043   -7.269  1.00 128.85 ? 123  GLU C OE2 1 
ATOM   6859  N N   . GLN C 1 113 ? -14.452 0.848   -5.431  1.00 72.05  ? 124  GLN C N   1 
ATOM   6860  C CA  . GLN C 1 113 ? -13.790 0.208   -4.325  1.00 72.05  ? 124  GLN C CA  1 
ATOM   6861  C C   . GLN C 1 113 ? -14.454 0.952   -3.160  1.00 72.05  ? 124  GLN C C   1 
ATOM   6862  O O   . GLN C 1 113 ? -14.816 0.355   -2.155  1.00 72.05  ? 124  GLN C O   1 
ATOM   6863  C CB  . GLN C 1 113 ? -12.297 0.512   -4.374  1.00 69.99  ? 124  GLN C CB  1 
ATOM   6864  C CG  . GLN C 1 113 ? -11.721 0.620   -5.779  1.00 69.99  ? 124  GLN C CG  1 
ATOM   6865  C CD  . GLN C 1 113 ? -10.187 0.626   -5.800  1.00 69.99  ? 124  GLN C CD  1 
ATOM   6866  O OE1 . GLN C 1 113 ? -9.547  -0.309  -5.313  1.00 69.99  ? 124  GLN C OE1 1 
ATOM   6867  N NE2 . GLN C 1 113 ? -9.597  1.673   -6.379  1.00 69.99  ? 124  GLN C NE2 1 
ATOM   6868  N N   . VAL C 1 114 ? -14.647 2.260   -3.348  1.00 47.97  ? 125  VAL C N   1 
ATOM   6869  C CA  . VAL C 1 114 ? -15.270 3.174   -2.369  1.00 47.97  ? 125  VAL C CA  1 
ATOM   6870  C C   . VAL C 1 114 ? -16.801 3.076   -2.273  1.00 47.97  ? 125  VAL C C   1 
ATOM   6871  O O   . VAL C 1 114 ? -17.497 3.204   -3.271  1.00 47.97  ? 125  VAL C O   1 
ATOM   6872  C CB  . VAL C 1 114 ? -14.943 4.635   -2.713  1.00 36.07  ? 125  VAL C CB  1 
ATOM   6873  C CG1 . VAL C 1 114 ? -15.440 5.552   -1.612  1.00 36.07  ? 125  VAL C CG1 1 
ATOM   6874  C CG2 . VAL C 1 114 ? -13.453 4.790   -2.931  1.00 36.07  ? 125  VAL C CG2 1 
ATOM   6875  N N   . PHE C 1 115 ? -17.314 2.895   -1.061  1.00 51.84  ? 126  PHE C N   1 
ATOM   6876  C CA  . PHE C 1 115 ? -18.751 2.763   -0.834  1.00 51.84  ? 126  PHE C CA  1 
ATOM   6877  C C   . PHE C 1 115 ? -19.334 3.771   0.155   1.00 51.84  ? 126  PHE C C   1 
ATOM   6878  O O   . PHE C 1 115 ? -18.699 4.115   1.144   1.00 51.84  ? 126  PHE C O   1 
ATOM   6879  C CB  . PHE C 1 115 ? -19.056 1.354   -0.328  1.00 74.10  ? 126  PHE C CB  1 
ATOM   6880  C CG  . PHE C 1 115 ? -18.796 0.280   -1.336  1.00 74.10  ? 126  PHE C CG  1 
ATOM   6881  C CD1 . PHE C 1 115 ? -18.483 -1.008  -0.927  1.00 74.10  ? 126  PHE C CD1 1 
ATOM   6882  C CD2 . PHE C 1 115 ? -18.903 0.541   -2.691  1.00 74.10  ? 126  PHE C CD2 1 
ATOM   6883  C CE1 . PHE C 1 115 ? -18.281 -2.021  -1.852  1.00 74.10  ? 126  PHE C CE1 1 
ATOM   6884  C CE2 . PHE C 1 115 ? -18.706 -0.460  -3.624  1.00 74.10  ? 126  PHE C CE2 1 
ATOM   6885  C CZ  . PHE C 1 115 ? -18.394 -1.747  -3.205  1.00 74.10  ? 126  PHE C CZ  1 
ATOM   6886  N N   . PRO C 1 116 ? -20.564 4.258   -0.098  1.00 44.60  ? 127  PRO C N   1 
ATOM   6887  C CA  . PRO C 1 116 ? -21.133 5.218   0.845   1.00 44.60  ? 127  PRO C CA  1 
ATOM   6888  C C   . PRO C 1 116 ? -21.432 4.456   2.110   1.00 44.60  ? 127  PRO C C   1 
ATOM   6889  O O   . PRO C 1 116 ? -21.916 3.322   2.056   1.00 44.60  ? 127  PRO C O   1 
ATOM   6890  C CB  . PRO C 1 116 ? -22.396 5.677   0.140   1.00 59.23  ? 127  PRO C CB  1 
ATOM   6891  C CG  . PRO C 1 116 ? -22.842 4.432   -0.530  1.00 59.23  ? 127  PRO C CG  1 
ATOM   6892  C CD  . PRO C 1 116 ? -21.555 3.914   -1.134  1.00 59.23  ? 127  PRO C CD  1 
ATOM   6893  N N   . VAL C 1 117 ? -21.115 5.074   3.240   1.00 44.01  ? 128  VAL C N   1 
ATOM   6894  C CA  . VAL C 1 117 ? -21.348 4.461   4.539   1.00 44.01  ? 128  VAL C CA  1 
ATOM   6895  C C   . VAL C 1 117 ? -22.154 5.438   5.404   1.00 44.01  ? 128  VAL C C   1 
ATOM   6896  O O   . VAL C 1 117 ? -22.030 6.651   5.252   1.00 44.01  ? 128  VAL C O   1 
ATOM   6897  C CB  . VAL C 1 117 ? -20.005 4.077   5.207   1.00 34.11  ? 128  VAL C CB  1 
ATOM   6898  C CG1 . VAL C 1 117 ? -19.185 5.294   5.441   1.00 34.11  ? 128  VAL C CG1 1 
ATOM   6899  C CG2 . VAL C 1 117 ? -20.249 3.351   6.486   1.00 34.11  ? 128  VAL C CG2 1 
ATOM   6900  N N   . ASP C 1 118 ? -22.984 4.905   6.302   1.00 81.82  ? 129  ASP C N   1 
ATOM   6901  C CA  . ASP C 1 118 ? -23.848 5.739   7.142   1.00 81.82  ? 129  ASP C CA  1 
ATOM   6902  C C   . ASP C 1 118 ? -23.651 5.666   8.658   1.00 81.82  ? 129  ASP C C   1 
ATOM   6903  O O   . ASP C 1 118 ? -24.289 4.863   9.334   1.00 81.82  ? 129  ASP C O   1 
ATOM   6904  C CB  . ASP C 1 118 ? -25.304 5.415   6.823   1.00 95.09  ? 129  ASP C CB  1 
ATOM   6905  C CG  . ASP C 1 118 ? -26.269 6.275   7.591   1.00 95.09  ? 129  ASP C CG  1 
ATOM   6906  O OD1 . ASP C 1 118 ? -26.368 7.477   7.268   1.00 95.09  ? 129  ASP C OD1 1 
ATOM   6907  O OD2 . ASP C 1 118 ? -26.924 5.751   8.519   1.00 95.09  ? 129  ASP C OD2 1 
ATOM   6908  N N   . ALA C 1 119 ? -22.799 6.538   9.189   1.00 69.71  ? 130  ALA C N   1 
ATOM   6909  C CA  . ALA C 1 119 ? -22.515 6.586   10.627  1.00 69.71  ? 130  ALA C CA  1 
ATOM   6910  C C   . ALA C 1 119 ? -23.540 7.397   11.410  1.00 69.71  ? 130  ALA C C   1 
ATOM   6911  O O   . ALA C 1 119 ? -23.882 8.497   11.008  1.00 69.71  ? 130  ALA C O   1 
ATOM   6912  C CB  . ALA C 1 119 ? -21.128 7.179   10.856  1.00 39.24  ? 130  ALA C CB  1 
ATOM   6913  N N   . LEU C 1 120 ? -24.017 6.863   12.529  1.00 43.86  ? 131  LEU C N   1 
ATOM   6914  C CA  . LEU C 1 120 ? -24.982 7.582   13.363  1.00 43.86  ? 131  LEU C CA  1 
ATOM   6915  C C   . LEU C 1 120 ? -24.347 8.820   14.018  1.00 43.86  ? 131  LEU C C   1 
ATOM   6916  O O   . LEU C 1 120 ? -23.129 8.883   14.194  1.00 43.86  ? 131  LEU C O   1 
ATOM   6917  C CB  . LEU C 1 120 ? -25.537 6.664   14.446  1.00 44.30  ? 131  LEU C CB  1 
ATOM   6918  C CG  . LEU C 1 120 ? -26.306 5.427   13.984  1.00 44.30  ? 131  LEU C CG  1 
ATOM   6919  C CD1 . LEU C 1 120 ? -26.761 4.682   15.221  1.00 44.30  ? 131  LEU C CD1 1 
ATOM   6920  C CD2 . LEU C 1 120 ? -27.501 5.806   13.109  1.00 44.30  ? 131  LEU C CD2 1 
ATOM   6921  N N   . HIS C 1 121 ? -25.158 9.804   14.391  1.00 44.29  ? 132  HIS C N   1 
ATOM   6922  C CA  . HIS C 1 121 ? -24.603 11.021  14.970  1.00 44.29  ? 132  HIS C CA  1 
ATOM   6923  C C   . HIS C 1 121 ? -24.143 10.906  16.420  1.00 44.29  ? 132  HIS C C   1 
ATOM   6924  O O   . HIS C 1 121 ? -23.297 11.691  16.864  1.00 44.29  ? 132  HIS C O   1 
ATOM   6925  C CB  . HIS C 1 121 ? -25.590 12.179  14.828  1.00 48.48  ? 132  HIS C CB  1 
ATOM   6926  C CG  . HIS C 1 121 ? -25.788 12.631  13.417  1.00 48.48  ? 132  HIS C CG  1 
ATOM   6927  N ND1 . HIS C 1 121 ? -26.453 11.873  12.475  1.00 48.48  ? 132  HIS C ND1 1 
ATOM   6928  C CD2 . HIS C 1 121 ? -25.385 13.753  12.778  1.00 48.48  ? 132  HIS C CD2 1 
ATOM   6929  C CE1 . HIS C 1 121 ? -26.450 12.509  11.316  1.00 48.48  ? 132  HIS C CE1 1 
ATOM   6930  N NE2 . HIS C 1 121 ? -25.808 13.652  11.471  1.00 48.48  ? 132  HIS C NE2 1 
ATOM   6931  N N   . HIS C 1 122 ? -24.682 9.932   17.156  1.00 43.40  ? 133  HIS C N   1 
ATOM   6932  C CA  . HIS C 1 122 ? -24.309 9.735   18.563  1.00 43.40  ? 133  HIS C CA  1 
ATOM   6933  C C   . HIS C 1 122 ? -24.144 8.264   18.849  1.00 43.40  ? 133  HIS C C   1 
ATOM   6934  O O   . HIS C 1 122 ? -25.013 7.474   18.503  1.00 43.40  ? 133  HIS C O   1 
ATOM   6935  C CB  . HIS C 1 122 ? -25.393 10.253  19.506  1.00 68.52  ? 133  HIS C CB  1 
ATOM   6936  C CG  . HIS C 1 122 ? -26.493 9.265   19.748  1.00 68.52  ? 133  HIS C CG  1 
ATOM   6937  N ND1 . HIS C 1 122 ? -27.387 8.895   18.768  1.00 68.52  ? 133  HIS C ND1 1 
ATOM   6938  C CD2 . HIS C 1 122 ? -26.786 8.507   20.830  1.00 68.52  ? 133  HIS C CD2 1 
ATOM   6939  C CE1 . HIS C 1 122 ? -28.180 7.949   19.235  1.00 68.52  ? 133  HIS C CE1 1 
ATOM   6940  N NE2 . HIS C 1 122 ? -27.835 7.695   20.484  1.00 68.52  ? 133  HIS C NE2 1 
ATOM   6941  N N   . LYS C 1 123 ? -23.040 7.901   19.497  1.00 78.60  ? 134  LYS C N   1 
ATOM   6942  C CA  . LYS C 1 123 ? -22.764 6.506   19.851  1.00 78.60  ? 134  LYS C CA  1 
ATOM   6943  C C   . LYS C 1 123 ? -23.108 6.257   21.319  1.00 78.60  ? 134  LYS C C   1 
ATOM   6944  O O   . LYS C 1 123 ? -22.395 6.699   22.218  1.00 78.60  ? 134  LYS C O   1 
ATOM   6945  C CB  . LYS C 1 123 ? -21.291 6.163   19.592  1.00 151.21 ? 134  LYS C CB  1 
ATOM   6946  C CG  . LYS C 1 123 ? -21.022 5.475   18.246  1.00 151.21 ? 134  LYS C CG  1 
ATOM   6947  C CD  . LYS C 1 123 ? -20.940 6.445   17.069  1.00 151.21 ? 134  LYS C CD  1 
ATOM   6948  C CE  . LYS C 1 123 ? -19.626 7.211   17.064  1.00 151.21 ? 134  LYS C CE  1 
ATOM   6949  N NZ  . LYS C 1 123 ? -19.463 8.018   15.825  1.00 151.21 ? 134  LYS C NZ  1 
ATOM   6950  N N   . PRO C 1 124 ? -24.214 5.538   21.572  1.00 78.60  ? 135  PRO C N   1 
ATOM   6951  C CA  . PRO C 1 124 ? -24.687 5.213   22.924  1.00 78.60  ? 135  PRO C CA  1 
ATOM   6952  C C   . PRO C 1 124 ? -23.797 4.265   23.738  1.00 78.60  ? 135  PRO C C   1 
ATOM   6953  O O   . PRO C 1 124 ? -22.577 4.402   23.742  1.00 78.60  ? 135  PRO C O   1 
ATOM   6954  C CB  . PRO C 1 124 ? -26.079 4.632   22.663  1.00 144.49 ? 135  PRO C CB  1 
ATOM   6955  C CG  . PRO C 1 124 ? -25.919 3.974   21.328  1.00 144.49 ? 135  PRO C CG  1 
ATOM   6956  C CD  . PRO C 1 124 ? -25.140 5.008   20.554  1.00 144.49 ? 135  PRO C CD  1 
ATOM   6957  N N   . GLY C 1 125 ? -24.434 3.323   24.436  1.00 201.99 ? 136  GLY C N   1 
ATOM   6958  C CA  . GLY C 1 125 ? -23.724 2.341   25.246  1.00 201.99 ? 136  GLY C CA  1 
ATOM   6959  C C   . GLY C 1 125 ? -22.629 2.878   26.152  1.00 201.99 ? 136  GLY C C   1 
ATOM   6960  O O   . GLY C 1 125 ? -22.494 4.092   26.302  1.00 201.99 ? 136  GLY C O   1 
ATOM   6961  N N   . PRO C 1 126 ? -21.835 1.993   26.786  1.00 95.12  ? 137  PRO C N   1 
ATOM   6962  C CA  . PRO C 1 126 ? -20.752 2.429   27.675  1.00 95.12  ? 137  PRO C CA  1 
ATOM   6963  C C   . PRO C 1 126 ? -19.642 3.146   26.910  1.00 95.12  ? 137  PRO C C   1 
ATOM   6964  O O   . PRO C 1 126 ? -19.224 2.698   25.843  1.00 95.12  ? 137  PRO C O   1 
ATOM   6965  C CB  . PRO C 1 126 ? -20.276 1.118   28.306  1.00 128.56 ? 137  PRO C CB  1 
ATOM   6966  C CG  . PRO C 1 126 ? -20.542 0.109   27.229  1.00 128.56 ? 137  PRO C CG  1 
ATOM   6967  C CD  . PRO C 1 126 ? -21.916 0.520   26.744  1.00 128.56 ? 137  PRO C CD  1 
ATOM   6968  N N   . LEU C 1 127 ? -19.178 4.267   27.449  1.00 100.21 ? 138  LEU C N   1 
ATOM   6969  C CA  . LEU C 1 127 ? -18.119 5.021   26.794  1.00 100.21 ? 138  LEU C CA  1 
ATOM   6970  C C   . LEU C 1 127 ? -16.959 5.378   27.706  1.00 100.21 ? 138  LEU C C   1 
ATOM   6971  O O   . LEU C 1 127 ? -17.149 5.714   28.878  1.00 100.21 ? 138  LEU C O   1 
ATOM   6972  C CB  . LEU C 1 127 ? -18.665 6.307   26.165  1.00 87.28  ? 138  LEU C CB  1 
ATOM   6973  C CG  . LEU C 1 127 ? -19.238 6.209   24.750  1.00 87.28  ? 138  LEU C CG  1 
ATOM   6974  C CD1 . LEU C 1 127 ? -18.405 5.239   23.906  1.00 87.28  ? 138  LEU C CD1 1 
ATOM   6975  C CD2 . LEU C 1 127 ? -20.666 5.752   24.830  1.00 87.28  ? 138  LEU C CD2 1 
ATOM   6976  N N   . LEU C 1 128 ? -15.756 5.310   27.136  1.00 114.61 ? 139  LEU C N   1 
ATOM   6977  C CA  . LEU C 1 128 ? -14.519 5.618   27.843  1.00 114.61 ? 139  LEU C CA  1 
ATOM   6978  C C   . LEU C 1 128 ? -14.634 6.934   28.606  1.00 114.61 ? 139  LEU C C   1 
ATOM   6979  O O   . LEU C 1 128 ? -14.561 8.014   28.017  1.00 114.61 ? 139  LEU C O   1 
ATOM   6980  C CB  . LEU C 1 128 ? -13.362 5.693   26.843  1.00 147.97 ? 139  LEU C CB  1 
ATOM   6981  C CG  . LEU C 1 128 ? -11.957 5.997   27.373  1.00 147.97 ? 139  LEU C CG  1 
ATOM   6982  C CD1 . LEU C 1 128 ? -11.507 4.901   28.329  1.00 147.97 ? 139  LEU C CD1 1 
ATOM   6983  C CD2 . LEU C 1 128 ? -10.995 6.110   26.197  1.00 147.97 ? 139  LEU C CD2 1 
ATOM   6984  N N   . PRO C 1 129 ? -14.811 6.857   29.935  1.00 169.16 ? 140  PRO C N   1 
ATOM   6985  C CA  . PRO C 1 129 ? -14.937 8.055   30.770  1.00 169.16 ? 140  PRO C CA  1 
ATOM   6986  C C   . PRO C 1 129 ? -13.787 9.036   30.580  1.00 169.16 ? 140  PRO C C   1 
ATOM   6987  O O   . PRO C 1 129 ? -12.646 8.638   30.337  1.00 169.16 ? 140  PRO C O   1 
ATOM   6988  C CB  . PRO C 1 129 ? -14.998 7.484   32.187  1.00 201.99 ? 140  PRO C CB  1 
ATOM   6989  C CG  . PRO C 1 129 ? -14.207 6.217   32.079  1.00 201.99 ? 140  PRO C CG  1 
ATOM   6990  C CD  . PRO C 1 129 ? -14.708 5.650   30.774  1.00 201.99 ? 140  PRO C CD  1 
ATOM   6991  N N   . GLY C 1 130 ? -14.100 10.323  30.691  1.00 155.12 ? 141  GLY C N   1 
ATOM   6992  C CA  . GLY C 1 130 ? -13.086 11.345  30.527  1.00 155.12 ? 141  GLY C CA  1 
ATOM   6993  C C   . GLY C 1 130 ? -12.975 11.792  29.084  1.00 155.12 ? 141  GLY C C   1 
ATOM   6994  O O   . GLY C 1 130 ? -13.766 11.371  28.236  1.00 155.12 ? 141  GLY C O   1 
ATOM   6995  N N   . ASP C 1 131 ? -11.986 12.641  28.813  1.00 201.99 ? 142  ASP C N   1 
ATOM   6996  C CA  . ASP C 1 131 ? -11.736 13.179  27.476  1.00 201.99 ? 142  ASP C CA  1 
ATOM   6997  C C   . ASP C 1 131 ? -12.641 14.392  27.233  1.00 201.99 ? 142  ASP C C   1 
ATOM   6998  O O   . ASP C 1 131 ? -13.395 14.790  28.124  1.00 201.99 ? 142  ASP C O   1 
ATOM   6999  C CB  . ASP C 1 131 ? -11.977 12.098  26.417  1.00 169.22 ? 142  ASP C CB  1 
ATOM   7000  C CG  . ASP C 1 131 ? -11.330 12.427  25.094  1.00 169.22 ? 142  ASP C CG  1 
ATOM   7001  O OD1 . ASP C 1 131 ? -10.116 12.728  25.087  1.00 169.22 ? 142  ASP C OD1 1 
ATOM   7002  O OD2 . ASP C 1 131 ? -12.030 12.377  24.063  1.00 169.22 ? 142  ASP C OD2 1 
ATOM   7003  N N   . SER C 1 132 ? -12.567 14.984  26.041  1.00 173.06 ? 143  SER C N   1 
ATOM   7004  C CA  . SER C 1 132 ? -13.383 16.160  25.727  1.00 173.06 ? 143  SER C CA  1 
ATOM   7005  C C   . SER C 1 132 ? -14.341 15.945  24.560  1.00 173.06 ? 143  SER C C   1 
ATOM   7006  O O   . SER C 1 132 ? -13.924 15.899  23.403  1.00 173.06 ? 143  SER C O   1 
ATOM   7007  C CB  . SER C 1 132 ? -12.486 17.364  25.422  1.00 201.99 ? 143  SER C CB  1 
ATOM   7008  O OG  . SER C 1 132 ? -11.763 17.174  24.219  1.00 201.99 ? 143  SER C OG  1 
ATOM   7009  N N   . ALA C 1 133 ? -15.627 15.830  24.876  1.00 70.97  ? 144  ALA C N   1 
ATOM   7010  C CA  . ALA C 1 133 ? -16.671 15.625  23.872  1.00 70.97  ? 144  ALA C CA  1 
ATOM   7011  C C   . ALA C 1 133 ? -17.999 16.146  24.408  1.00 70.97  ? 144  ALA C C   1 
ATOM   7012  O O   . ALA C 1 133 ? -18.019 16.931  25.361  1.00 70.97  ? 144  ALA C O   1 
ATOM   7013  C CB  . ALA C 1 133 ? -16.796 14.135  23.533  1.00 103.35 ? 144  ALA C CB  1 
ATOM   7014  N N   . PHE C 1 134 ? -19.103 15.726  23.788  1.00 55.79  ? 145  PHE C N   1 
ATOM   7015  C CA  . PHE C 1 134 ? -20.419 16.145  24.256  1.00 55.79  ? 145  PHE C CA  1 
ATOM   7016  C C   . PHE C 1 134 ? -21.273 14.953  24.645  1.00 55.79  ? 145  PHE C C   1 
ATOM   7017  O O   . PHE C 1 134 ? -21.612 14.119  23.810  1.00 55.79  ? 145  PHE C O   1 
ATOM   7018  C CB  . PHE C 1 134 ? -21.140 17.021  23.218  1.00 60.14  ? 145  PHE C CB  1 
ATOM   7019  C CG  . PHE C 1 134 ? -20.707 18.466  23.254  1.00 60.14  ? 145  PHE C CG  1 
ATOM   7020  C CD1 . PHE C 1 134 ? -19.804 18.967  22.317  1.00 60.14  ? 145  PHE C CD1 1 
ATOM   7021  C CD2 . PHE C 1 134 ? -21.127 19.300  24.289  1.00 60.14  ? 145  PHE C CD2 1 
ATOM   7022  C CE1 . PHE C 1 134 ? -19.316 20.280  22.417  1.00 60.14  ? 145  PHE C CE1 1 
ATOM   7023  C CE2 . PHE C 1 134 ? -20.647 20.611  24.401  1.00 60.14  ? 145  PHE C CE2 1 
ATOM   7024  C CZ  . PHE C 1 134 ? -19.740 21.100  23.467  1.00 60.14  ? 145  PHE C CZ  1 
ATOM   7025  N N   . ARG C 1 135 ? -21.589 14.890  25.940  1.00 59.33  ? 146  ARG C N   1 
ATOM   7026  C CA  . ARG C 1 135 ? -22.394 13.827  26.534  1.00 59.33  ? 146  ARG C CA  1 
ATOM   7027  C C   . ARG C 1 135 ? -23.892 14.114  26.517  1.00 59.33  ? 146  ARG C C   1 
ATOM   7028  O O   . ARG C 1 135 ? -24.349 15.130  27.059  1.00 59.33  ? 146  ARG C O   1 
ATOM   7029  C CB  . ARG C 1 135 ? -21.972 13.598  27.986  1.00 98.54  ? 146  ARG C CB  1 
ATOM   7030  C CG  . ARG C 1 135 ? -20.650 12.888  28.172  1.00 98.54  ? 146  ARG C CG  1 
ATOM   7031  C CD  . ARG C 1 135 ? -20.679 11.493  27.578  1.00 98.54  ? 146  ARG C CD  1 
ATOM   7032  N NE  . ARG C 1 135 ? -19.460 10.743  27.865  1.00 98.54  ? 146  ARG C NE  1 
ATOM   7033  C CZ  . ARG C 1 135 ? -18.226 11.191  27.646  1.00 98.54  ? 146  ARG C CZ  1 
ATOM   7034  N NH1 . ARG C 1 135 ? -18.027 12.397  27.137  1.00 98.54  ? 146  ARG C NH1 1 
ATOM   7035  N NH2 . ARG C 1 135 ? -17.183 10.423  27.925  1.00 98.54  ? 146  ARG C NH2 1 
ATOM   7036  N N   . LEU C 1 136 ? -24.660 13.218  25.905  1.00 50.59  ? 147  LEU C N   1 
ATOM   7037  C CA  . LEU C 1 136 ? -26.101 13.405  25.868  1.00 50.59  ? 147  LEU C CA  1 
ATOM   7038  C C   . LEU C 1 136 ? -26.610 12.984  27.234  1.00 50.59  ? 147  LEU C C   1 
ATOM   7039  O O   . LEU C 1 136 ? -26.756 11.796  27.505  1.00 50.59  ? 147  LEU C O   1 
ATOM   7040  C CB  . LEU C 1 136 ? -26.758 12.535  24.788  1.00 53.00  ? 147  LEU C CB  1 
ATOM   7041  C CG  . LEU C 1 136 ? -26.391 12.726  23.316  1.00 53.00  ? 147  LEU C CG  1 
ATOM   7042  C CD1 . LEU C 1 136 ? -27.269 11.807  22.479  1.00 53.00  ? 147  LEU C CD1 1 
ATOM   7043  C CD2 . LEU C 1 136 ? -26.585 14.159  22.899  1.00 53.00  ? 147  LEU C CD2 1 
ATOM   7044  N N   . VAL C 1 137 ? -26.869 13.954  28.100  1.00 59.78  ? 148  VAL C N   1 
ATOM   7045  C CA  . VAL C 1 137 ? -27.353 13.644  29.434  1.00 59.78  ? 148  VAL C CA  1 
ATOM   7046  C C   . VAL C 1 137 ? -28.871 13.594  29.484  1.00 59.78  ? 148  VAL C C   1 
ATOM   7047  O O   . VAL C 1 137 ? -29.542 14.436  28.885  1.00 59.78  ? 148  VAL C O   1 
ATOM   7048  C CB  . VAL C 1 137 ? -26.863 14.676  30.454  1.00 83.98  ? 148  VAL C CB  1 
ATOM   7049  C CG1 . VAL C 1 137 ? -27.422 14.343  31.831  1.00 83.98  ? 148  VAL C CG1 1 
ATOM   7050  C CG2 . VAL C 1 137 ? -25.348 14.686  30.486  1.00 83.98  ? 148  VAL C CG2 1 
ATOM   7051  N N   . SER C 1 138 ? -29.402 12.610  30.208  1.00 101.64 ? 149  SER C N   1 
ATOM   7052  C CA  . SER C 1 138 ? -30.848 12.431  30.353  1.00 101.64 ? 149  SER C CA  1 
ATOM   7053  C C   . SER C 1 138 ? -31.411 13.445  31.349  1.00 101.64 ? 149  SER C C   1 
ATOM   7054  O O   . SER C 1 138 ? -30.709 13.881  32.256  1.00 101.64 ? 149  SER C O   1 
ATOM   7055  C CB  . SER C 1 138 ? -31.150 11.013  30.851  1.00 201.99 ? 149  SER C CB  1 
ATOM   7056  O OG  . SER C 1 138 ? -30.459 10.037  30.089  1.00 201.99 ? 149  SER C OG  1 
ATOM   7057  N N   . ALA C 1 139 ? -32.673 13.827  31.183  1.00 67.23  ? 150  ALA C N   1 
ATOM   7058  C CA  . ALA C 1 139 ? -33.285 14.785  32.104  1.00 67.23  ? 150  ALA C CA  1 
ATOM   7059  C C   . ALA C 1 139 ? -34.318 14.048  32.943  1.00 67.23  ? 150  ALA C C   1 
ATOM   7060  O O   . ALA C 1 139 ? -34.768 14.542  33.977  1.00 67.23  ? 150  ALA C O   1 
ATOM   7061  C CB  . ALA C 1 139 ? -33.945 15.955  31.331  1.00 26.67  ? 150  ALA C CB  1 
ATOM   7062  N N   . GLU C 1 140 ? -34.689 12.856  32.484  1.00 144.38 ? 151  GLU C N   1 
ATOM   7063  C CA  . GLU C 1 140 ? -35.651 12.025  33.189  1.00 144.38 ? 151  GLU C CA  1 
ATOM   7064  C C   . GLU C 1 140 ? -34.858 11.268  34.246  1.00 144.38 ? 151  GLU C C   1 
ATOM   7065  O O   . GLU C 1 140 ? -35.415 10.542  35.073  1.00 144.38 ? 151  GLU C O   1 
ATOM   7066  C CB  . GLU C 1 140 ? -36.319 11.043  32.223  1.00 172.37 ? 151  GLU C CB  1 
ATOM   7067  C CG  . GLU C 1 140 ? -37.049 11.705  31.058  1.00 172.37 ? 151  GLU C CG  1 
ATOM   7068  C CD  . GLU C 1 140 ? -36.129 12.071  29.903  1.00 172.37 ? 151  GLU C CD  1 
ATOM   7069  O OE1 . GLU C 1 140 ? -35.075 12.696  30.143  1.00 172.37 ? 151  GLU C OE1 1 
ATOM   7070  O OE2 . GLU C 1 140 ? -36.468 11.740  28.747  1.00 172.37 ? 151  GLU C OE2 1 
ATOM   7071  N N   . THR C 1 141 ? -33.541 11.458  34.197  1.00 145.60 ? 152  THR C N   1 
ATOM   7072  C CA  . THR C 1 141 ? -32.599 10.836  35.121  1.00 145.60 ? 152  THR C CA  1 
ATOM   7073  C C   . THR C 1 141 ? -31.960 11.947  35.954  1.00 145.60 ? 152  THR C C   1 
ATOM   7074  O O   . THR C 1 141 ? -31.517 11.729  37.082  1.00 145.60 ? 152  THR C O   1 
ATOM   7075  C CB  . THR C 1 141 ? -31.486 10.097  34.353  1.00 110.19 ? 152  THR C CB  1 
ATOM   7076  O OG1 . THR C 1 141 ? -32.073 9.172   33.429  1.00 110.19 ? 152  THR C OG1 1 
ATOM   7077  C CG2 . THR C 1 141 ? -30.588 9.342   35.311  1.00 110.19 ? 152  THR C CG2 1 
ATOM   7078  N N   . LEU C 1 142 ? -31.926 13.140  35.371  1.00 86.85  ? 153  LEU C N   1 
ATOM   7079  C CA  . LEU C 1 142 ? -31.354 14.326  36.001  1.00 86.85  ? 153  LEU C CA  1 
ATOM   7080  C C   . LEU C 1 142 ? -32.442 14.986  36.841  1.00 86.85  ? 153  LEU C C   1 
ATOM   7081  O O   . LEU C 1 142 ? -32.159 15.840  37.677  1.00 86.85  ? 153  LEU C O   1 
ATOM   7082  C CB  . LEU C 1 142 ? -30.880 15.309  34.916  1.00 72.71  ? 153  LEU C CB  1 
ATOM   7083  C CG  . LEU C 1 142 ? -29.656 16.212  35.127  1.00 72.71  ? 153  LEU C CG  1 
ATOM   7084  C CD1 . LEU C 1 142 ? -28.397 15.393  34.960  1.00 72.71  ? 153  LEU C CD1 1 
ATOM   7085  C CD2 . LEU C 1 142 ? -29.643 17.334  34.099  1.00 72.71  ? 153  LEU C CD2 1 
ATOM   7086  N N   . ARG C 1 143 ? -33.688 14.578  36.607  1.00 173.00 ? 154  ARG C N   1 
ATOM   7087  C CA  . ARG C 1 143 ? -34.837 15.135  37.314  1.00 173.00 ? 154  ARG C CA  1 
ATOM   7088  C C   . ARG C 1 143 ? -35.037 14.550  38.710  1.00 173.00 ? 154  ARG C C   1 
ATOM   7089  O O   . ARG C 1 143 ? -35.068 15.296  39.689  1.00 173.00 ? 154  ARG C O   1 
ATOM   7090  C CB  . ARG C 1 143 ? -36.111 14.932  36.483  1.00 186.59 ? 154  ARG C CB  1 
ATOM   7091  C CG  . ARG C 1 143 ? -37.291 15.818  36.884  1.00 186.59 ? 154  ARG C CG  1 
ATOM   7092  C CD  . ARG C 1 143 ? -37.869 15.437  38.240  1.00 186.59 ? 154  ARG C CD  1 
ATOM   7093  N NE  . ARG C 1 143 ? -38.941 16.336  38.663  1.00 186.59 ? 154  ARG C NE  1 
ATOM   7094  C CZ  . ARG C 1 143 ? -38.786 17.638  38.884  1.00 186.59 ? 154  ARG C CZ  1 
ATOM   7095  N NH1 . ARG C 1 143 ? -37.598 18.206  38.720  1.00 186.59 ? 154  ARG C NH1 1 
ATOM   7096  N NH2 . ARG C 1 143 ? -39.818 18.373  39.274  1.00 186.59 ? 154  ARG C NH2 1 
ATOM   7097  N N   . GLU C 1 144 ? -35.184 13.228  38.804  1.00 88.25  ? 155  GLU C N   1 
ATOM   7098  C CA  . GLU C 1 144 ? -35.392 12.586  40.100  1.00 88.25  ? 155  GLU C CA  1 
ATOM   7099  C C   . GLU C 1 144 ? -34.138 12.655  40.967  1.00 88.25  ? 155  GLU C C   1 
ATOM   7100  O O   . GLU C 1 144 ? -33.553 11.640  41.340  1.00 88.25  ? 155  GLU C O   1 
ATOM   7101  C CB  . GLU C 1 144 ? -35.862 11.133  39.919  1.00 111.07 ? 155  GLU C CB  1 
ATOM   7102  C CG  . GLU C 1 144 ? -34.905 10.211  39.189  1.00 111.07 ? 155  GLU C CG  1 
ATOM   7103  C CD  . GLU C 1 144 ? -34.223 9.214   40.115  1.00 111.07 ? 155  GLU C CD  1 
ATOM   7104  O OE1 . GLU C 1 144 ? -33.531 8.310   39.599  1.00 111.07 ? 155  GLU C OE1 1 
ATOM   7105  O OE2 . GLU C 1 144 ? -34.375 9.331   41.352  1.00 111.07 ? 155  GLU C OE2 1 
ATOM   7106  N N   . ILE C 1 145 ? -33.749 13.883  41.290  1.00 157.42 ? 156  ILE C N   1 
ATOM   7107  C CA  . ILE C 1 145 ? -32.574 14.159  42.100  1.00 157.42 ? 156  ILE C CA  1 
ATOM   7108  C C   . ILE C 1 145 ? -32.694 15.570  42.669  1.00 157.42 ? 156  ILE C C   1 
ATOM   7109  O O   . ILE C 1 145 ? -32.555 15.776  43.874  1.00 157.42 ? 156  ILE C O   1 
ATOM   7110  C CB  . ILE C 1 145 ? -31.290 14.051  41.245  1.00 99.48  ? 156  ILE C CB  1 
ATOM   7111  C CG1 . ILE C 1 145 ? -31.063 12.592  40.852  1.00 99.48  ? 156  ILE C CG1 1 
ATOM   7112  C CG2 . ILE C 1 145 ? -30.092 14.605  42.004  1.00 99.48  ? 156  ILE C CG2 1 
ATOM   7113  C CD1 . ILE C 1 145 ? -29.892 12.373  39.937  1.00 99.48  ? 156  ILE C CD1 1 
ATOM   7114  N N   . LEU C 1 146 ? -32.963 16.534  41.792  1.00 175.35 ? 157  LEU C N   1 
ATOM   7115  C CA  . LEU C 1 146 ? -33.106 17.932  42.189  1.00 175.35 ? 157  LEU C CA  1 
ATOM   7116  C C   . LEU C 1 146 ? -34.430 18.194  42.902  1.00 175.35 ? 157  LEU C C   1 
ATOM   7117  O O   . LEU C 1 146 ? -34.485 18.201  44.132  1.00 175.35 ? 157  LEU C O   1 
ATOM   7118  C CB  . LEU C 1 146 ? -32.990 18.843  40.962  1.00 131.35 ? 157  LEU C CB  1 
ATOM   7119  C CG  . LEU C 1 146 ? -31.602 19.051  40.345  1.00 131.35 ? 157  LEU C CG  1 
ATOM   7120  C CD1 . LEU C 1 146 ? -30.725 19.838  41.304  1.00 131.35 ? 157  LEU C CD1 1 
ATOM   7121  C CD2 . LEU C 1 146 ? -30.967 17.713  40.013  1.00 131.35 ? 157  LEU C CD2 1 
ATOM   7122  N N   . GLN C 1 147 ? -35.493 18.417  42.130  1.00 155.52 ? 158  GLN C N   1 
ATOM   7123  C CA  . GLN C 1 147 ? -36.812 18.671  42.707  1.00 155.52 ? 158  GLN C CA  1 
ATOM   7124  C C   . GLN C 1 147 ? -37.419 17.380  43.258  1.00 155.52 ? 158  GLN C C   1 
ATOM   7125  O O   . GLN C 1 147 ? -38.580 17.053  42.999  1.00 155.52 ? 158  GLN C O   1 
ATOM   7126  C CB  . GLN C 1 147 ? -37.747 19.291  41.660  1.00 181.68 ? 158  GLN C CB  1 
ATOM   7127  C CG  . GLN C 1 147 ? -37.307 20.669  41.166  1.00 181.68 ? 158  GLN C CG  1 
ATOM   7128  C CD  . GLN C 1 147 ? -38.388 21.394  40.378  1.00 181.68 ? 158  GLN C CD  1 
ATOM   7129  O OE1 . GLN C 1 147 ? -38.177 22.506  39.891  1.00 181.68 ? 158  GLN C OE1 1 
ATOM   7130  N NE2 . GLN C 1 147 ? -39.554 20.769  40.254  1.00 181.68 ? 158  GLN C NE2 1 
ATOM   7131  N N   . ASP C 1 148 ? -36.611 16.653  44.021  1.00 187.40 ? 159  ASP C N   1 
ATOM   7132  C CA  . ASP C 1 148 ? -37.021 15.398  44.635  1.00 187.40 ? 159  ASP C CA  1 
ATOM   7133  C C   . ASP C 1 148 ? -36.217 15.230  45.920  1.00 187.40 ? 159  ASP C C   1 
ATOM   7134  O O   . ASP C 1 148 ? -36.707 14.684  46.912  1.00 187.40 ? 159  ASP C O   1 
ATOM   7135  C CB  . ASP C 1 148 ? -36.744 14.230  43.683  1.00 178.20 ? 159  ASP C CB  1 
ATOM   7136  C CG  . ASP C 1 148 ? -37.217 12.897  44.238  1.00 178.20 ? 159  ASP C CG  1 
ATOM   7137  O OD1 . ASP C 1 148 ? -36.698 12.466  45.290  1.00 178.20 ? 159  ASP C OD1 1 
ATOM   7138  O OD2 . ASP C 1 148 ? -38.109 12.278  43.619  1.00 178.20 ? 159  ASP C OD2 1 
ATOM   7139  N N   . LYS C 1 149 ? -34.978 15.715  45.890  1.00 201.59 ? 160  LYS C N   1 
ATOM   7140  C CA  . LYS C 1 149 ? -34.087 15.642  47.041  1.00 201.59 ? 160  LYS C CA  1 
ATOM   7141  C C   . LYS C 1 149 ? -33.961 14.187  47.482  1.00 201.59 ? 160  LYS C C   1 
ATOM   7142  O O   . LYS C 1 149 ? -34.028 13.867  48.670  1.00 201.59 ? 160  LYS C O   1 
ATOM   7143  C CB  . LYS C 1 149 ? -34.643 16.521  48.168  1.00 116.66 ? 160  LYS C CB  1 
ATOM   7144  C CG  . LYS C 1 149 ? -35.056 17.909  47.666  1.00 116.66 ? 160  LYS C CG  1 
ATOM   7145  C CD  . LYS C 1 149 ? -35.756 18.753  48.718  1.00 116.66 ? 160  LYS C CD  1 
ATOM   7146  C CE  . LYS C 1 149 ? -36.446 19.955  48.075  1.00 116.66 ? 160  LYS C CE  1 
ATOM   7147  N NZ  . LYS C 1 149 ? -35.524 20.758  47.222  1.00 116.66 ? 160  LYS C NZ  1 
ATOM   7148  N N   . GLU C 1 150 ? -33.779 13.316  46.492  1.00 201.73 ? 161  GLU C N   1 
ATOM   7149  C CA  . GLU C 1 150 ? -33.640 11.879  46.701  1.00 201.73 ? 161  GLU C CA  1 
ATOM   7150  C C   . GLU C 1 150 ? -32.477 11.556  47.633  1.00 201.73 ? 161  GLU C C   1 
ATOM   7151  O O   . GLU C 1 150 ? -31.375 11.245  47.178  1.00 201.73 ? 161  GLU C O   1 
ATOM   7152  C CB  . GLU C 1 150 ? -33.430 11.181  45.351  1.00 201.98 ? 161  GLU C CB  1 
ATOM   7153  C CG  . GLU C 1 150 ? -33.204 9.674   45.427  1.00 201.98 ? 161  GLU C CG  1 
ATOM   7154  C CD  . GLU C 1 150 ? -34.439 8.910   45.861  1.00 201.98 ? 161  GLU C CD  1 
ATOM   7155  O OE1 . GLU C 1 150 ? -35.471 9.007   45.165  1.00 201.98 ? 161  GLU C OE1 1 
ATOM   7156  O OE2 . GLU C 1 150 ? -34.377 8.209   46.894  1.00 201.98 ? 161  GLU C OE2 1 
ATOM   7157  N N   . LEU C 1 151 ? -32.732 11.631  48.937  1.00 193.47 ? 162  LEU C N   1 
ATOM   7158  C CA  . LEU C 1 151 ? -31.717 11.346  49.947  1.00 193.47 ? 162  LEU C CA  1 
ATOM   7159  C C   . LEU C 1 151 ? -30.593 12.392  49.912  1.00 193.47 ? 162  LEU C C   1 
ATOM   7160  O O   . LEU C 1 151 ? -30.254 12.978  50.941  1.00 193.47 ? 162  LEU C O   1 
ATOM   7161  C CB  . LEU C 1 151 ? -31.151 9.931   49.732  1.00 135.93 ? 162  LEU C CB  1 
ATOM   7162  C CG  . LEU C 1 151 ? -32.155 8.766   49.656  1.00 135.93 ? 162  LEU C CG  1 
ATOM   7163  C CD1 . LEU C 1 151 ? -31.414 7.463   49.397  1.00 135.93 ? 162  LEU C CD1 1 
ATOM   7164  C CD2 . LEU C 1 151 ? -32.956 8.666   50.951  1.00 135.93 ? 162  LEU C CD2 1 
ATOM   7165  N N   . SER C 1 152 ? -30.033 12.621  48.724  1.00 164.84 ? 163  SER C N   1 
ATOM   7166  C CA  . SER C 1 152 ? -28.955 13.592  48.502  1.00 164.84 ? 163  SER C CA  1 
ATOM   7167  C C   . SER C 1 152 ? -27.814 13.540  49.516  1.00 164.84 ? 163  SER C C   1 
ATOM   7168  O O   . SER C 1 152 ? -27.159 12.508  49.669  1.00 164.84 ? 163  SER C O   1 
ATOM   7169  C CB  . SER C 1 152 ? -29.525 15.016  48.451  1.00 142.52 ? 163  SER C CB  1 
ATOM   7170  O OG  . SER C 1 152 ? -30.318 15.215  47.292  1.00 142.52 ? 163  SER C OG  1 
ATOM   7171  N N   . LYS C 1 153 ? -27.580 14.665  50.191  1.00 174.68 ? 164  LYS C N   1 
ATOM   7172  C CA  . LYS C 1 153 ? -26.520 14.786  51.194  1.00 174.68 ? 164  LYS C CA  1 
ATOM   7173  C C   . LYS C 1 153 ? -25.271 14.051  50.710  1.00 174.68 ? 164  LYS C C   1 
ATOM   7174  O O   . LYS C 1 153 ? -24.554 14.523  49.826  1.00 174.68 ? 164  LYS C O   1 
ATOM   7175  C CB  . LYS C 1 153 ? -26.978 14.192  52.537  1.00 82.72  ? 164  LYS C CB  1 
ATOM   7176  C CG  . LYS C 1 153 ? -28.381 14.594  52.978  1.00 82.72  ? 164  LYS C CG  1 
ATOM   7177  C CD  . LYS C 1 153 ? -28.809 13.814  54.220  1.00 82.72  ? 164  LYS C CD  1 
ATOM   7178  C CE  . LYS C 1 153 ? -30.304 13.956  54.476  1.00 82.72  ? 164  LYS C CE  1 
ATOM   7179  N NZ  . LYS C 1 153 ? -30.719 15.387  54.542  1.00 82.72  ? 164  LYS C NZ  1 
ATOM   7180  N N   . GLU C 1 154 ? -25.024 12.888  51.304  1.00 136.47 ? 165  GLU C N   1 
ATOM   7181  C CA  . GLU C 1 154 ? -23.888 12.054  50.946  1.00 136.47 ? 165  GLU C CA  1 
ATOM   7182  C C   . GLU C 1 154 ? -24.346 11.011  49.939  1.00 136.47 ? 165  GLU C C   1 
ATOM   7183  O O   . GLU C 1 154 ? -24.665 9.877   50.302  1.00 136.47 ? 165  GLU C O   1 
ATOM   7184  C CB  . GLU C 1 154 ? -23.323 11.354  52.181  1.00 156.82 ? 165  GLU C CB  1 
ATOM   7185  C CG  . GLU C 1 154 ? -22.624 12.274  53.159  1.00 156.82 ? 165  GLU C CG  1 
ATOM   7186  C CD  . GLU C 1 154 ? -22.263 11.567  54.447  1.00 156.82 ? 165  GLU C CD  1 
ATOM   7187  O OE1 . GLU C 1 154 ? -21.594 10.514  54.380  1.00 156.82 ? 165  GLU C OE1 1 
ATOM   7188  O OE2 . GLU C 1 154 ? -22.649 12.064  55.526  1.00 156.82 ? 165  GLU C OE2 1 
ATOM   7189  N N   . GLN C 1 155 ? -24.387 11.416  48.675  1.00 144.49 ? 166  GLN C N   1 
ATOM   7190  C CA  . GLN C 1 155 ? -24.785 10.538  47.584  1.00 144.49 ? 166  GLN C CA  1 
ATOM   7191  C C   . GLN C 1 155 ? -24.315 11.094  46.243  1.00 144.49 ? 166  GLN C C   1 
ATOM   7192  O O   . GLN C 1 155 ? -23.592 10.421  45.507  1.00 144.49 ? 166  GLN C O   1 
ATOM   7193  C CB  . GLN C 1 155 ? -26.310 10.349  47.564  1.00 123.97 ? 166  GLN C CB  1 
ATOM   7194  C CG  . GLN C 1 155 ? -26.817 9.201   48.433  1.00 123.97 ? 166  GLN C CG  1 
ATOM   7195  C CD  . GLN C 1 155 ? -28.249 8.795   48.108  1.00 123.97 ? 166  GLN C CD  1 
ATOM   7196  O OE1 . GLN C 1 155 ? -28.718 7.738   48.534  1.00 123.97 ? 166  GLN C OE1 1 
ATOM   7197  N NE2 . GLN C 1 155 ? -28.950 9.635   47.356  1.00 123.97 ? 166  GLN C NE2 1 
ATOM   7198  N N   . LEU C 1 156 ? -24.719 12.326  45.939  1.00 201.99 ? 167  LEU C N   1 
ATOM   7199  C CA  . LEU C 1 156 ? -24.352 12.972  44.680  1.00 201.99 ? 167  LEU C CA  1 
ATOM   7200  C C   . LEU C 1 156 ? -22.854 13.003  44.431  1.00 201.99 ? 167  LEU C C   1 
ATOM   7201  O O   . LEU C 1 156 ? -22.109 13.719  45.101  1.00 201.99 ? 167  LEU C O   1 
ATOM   7202  C CB  . LEU C 1 156 ? -24.911 14.398  44.619  1.00 89.01  ? 167  LEU C CB  1 
ATOM   7203  C CG  . LEU C 1 156 ? -26.414 14.509  44.339  1.00 89.01  ? 167  LEU C CG  1 
ATOM   7204  C CD1 . LEU C 1 156 ? -26.716 13.911  42.973  1.00 89.01  ? 167  LEU C CD1 1 
ATOM   7205  C CD2 . LEU C 1 156 ? -27.213 13.782  45.418  1.00 89.01  ? 167  LEU C CD2 1 
ATOM   7206  N N   . VAL C 1 157 ? -22.438 12.212  43.448  1.00 125.94 ? 168  VAL C N   1 
ATOM   7207  C CA  . VAL C 1 157 ? -21.043 12.085  43.037  1.00 125.94 ? 168  VAL C CA  1 
ATOM   7208  C C   . VAL C 1 157 ? -20.924 10.752  42.303  1.00 125.94 ? 168  VAL C C   1 
ATOM   7209  O O   . VAL C 1 157 ? -19.903 10.456  41.680  1.00 125.94 ? 168  VAL C O   1 
ATOM   7210  C CB  . VAL C 1 157 ? -20.072 12.103  44.246  1.00 142.91 ? 168  VAL C CB  1 
ATOM   7211  C CG1 . VAL C 1 157 ? -20.280 10.867  45.115  1.00 142.91 ? 168  VAL C CG1 1 
ATOM   7212  C CG2 . VAL C 1 157 ? -18.636 12.198  43.753  1.00 142.91 ? 168  VAL C CG2 1 
ATOM   7213  N N   . THR C 1 158 ? -21.986 9.953   42.393  1.00 186.36 ? 169  THR C N   1 
ATOM   7214  C CA  . THR C 1 158 ? -22.054 8.656   41.726  1.00 186.36 ? 169  THR C CA  1 
ATOM   7215  C C   . THR C 1 158 ? -22.763 8.907   40.402  1.00 186.36 ? 169  THR C C   1 
ATOM   7216  O O   . THR C 1 158 ? -22.571 8.182   39.429  1.00 186.36 ? 169  THR C O   1 
ATOM   7217  C CB  . THR C 1 158 ? -22.883 7.635   42.532  1.00 99.04  ? 169  THR C CB  1 
ATOM   7218  O OG1 . THR C 1 158 ? -22.446 7.627   43.895  1.00 99.04  ? 169  THR C OG1 1 
ATOM   7219  C CG2 . THR C 1 158 ? -22.707 6.240   41.958  1.00 99.04  ? 169  THR C CG2 1 
ATOM   7220  N N   . PHE C 1 159 ? -23.592 9.946   40.390  1.00 201.99 ? 170  PHE C N   1 
ATOM   7221  C CA  . PHE C 1 159 ? -24.335 10.339  39.200  1.00 201.99 ? 170  PHE C CA  1 
ATOM   7222  C C   . PHE C 1 159 ? -23.333 10.977  38.242  1.00 201.99 ? 170  PHE C C   1 
ATOM   7223  O O   . PHE C 1 159 ? -23.049 10.425  37.179  1.00 201.99 ? 170  PHE C O   1 
ATOM   7224  C CB  . PHE C 1 159 ? -25.428 11.343  39.576  1.00 99.00  ? 170  PHE C CB  1 
ATOM   7225  C CG  . PHE C 1 159 ? -26.418 11.617  38.473  1.00 99.00  ? 170  PHE C CG  1 
ATOM   7226  C CD1 . PHE C 1 159 ? -27.171 10.587  37.917  1.00 99.00  ? 170  PHE C CD1 1 
ATOM   7227  C CD2 . PHE C 1 159 ? -26.611 12.910  38.000  1.00 99.00  ? 170  PHE C CD2 1 
ATOM   7228  C CE1 . PHE C 1 159 ? -28.102 10.843  36.906  1.00 99.00  ? 170  PHE C CE1 1 
ATOM   7229  C CE2 . PHE C 1 159 ? -27.540 13.169  36.990  1.00 99.00  ? 170  PHE C CE2 1 
ATOM   7230  C CZ  . PHE C 1 159 ? -28.284 12.134  36.444  1.00 99.00  ? 170  PHE C CZ  1 
ATOM   7231  N N   . LEU C 1 160 ? -22.794 12.134  38.627  1.00 64.45  ? 171  LEU C N   1 
ATOM   7232  C CA  . LEU C 1 160 ? -21.800 12.828  37.808  1.00 64.45  ? 171  LEU C CA  1 
ATOM   7233  C C   . LEU C 1 160 ? -20.682 11.864  37.433  1.00 64.45  ? 171  LEU C C   1 
ATOM   7234  O O   . LEU C 1 160 ? -19.944 12.098  36.484  1.00 64.45  ? 171  LEU C O   1 
ATOM   7235  C CB  . LEU C 1 160 ? -21.216 14.019  38.567  1.00 88.30  ? 171  LEU C CB  1 
ATOM   7236  C CG  . LEU C 1 160 ? -22.042 15.308  38.561  1.00 88.30  ? 171  LEU C CG  1 
ATOM   7237  C CD1 . LEU C 1 160 ? -21.944 15.948  37.187  1.00 88.30  ? 171  LEU C CD1 1 
ATOM   7238  C CD2 . LEU C 1 160 ? -23.504 15.018  38.933  1.00 88.30  ? 171  LEU C CD2 1 
ATOM   7239  N N   . GLU C 1 161 ? -20.568 10.776  38.190  1.00 201.99 ? 172  GLU C N   1 
ATOM   7240  C CA  . GLU C 1 161 ? -19.559 9.751   37.941  1.00 201.99 ? 172  GLU C CA  1 
ATOM   7241  C C   . GLU C 1 161 ? -20.108 8.771   36.910  1.00 201.99 ? 172  GLU C C   1 
ATOM   7242  O O   . GLU C 1 161 ? -19.575 8.633   35.809  1.00 201.99 ? 172  GLU C O   1 
ATOM   7243  C CB  . GLU C 1 161 ? -19.246 8.993   39.234  1.00 193.07 ? 172  GLU C CB  1 
ATOM   7244  C CG  . GLU C 1 161 ? -18.299 7.817   39.054  1.00 193.07 ? 172  GLU C CG  1 
ATOM   7245  C CD  . GLU C 1 161 ? -18.346 6.844   40.218  1.00 193.07 ? 172  GLU C CD  1 
ATOM   7246  O OE1 . GLU C 1 161 ? -17.571 5.863   40.204  1.00 193.07 ? 172  GLU C OE1 1 
ATOM   7247  O OE2 . GLU C 1 161 ? -19.160 7.056   41.143  1.00 193.07 ? 172  GLU C OE2 1 
ATOM   7248  N N   . ASN C 1 162 ? -21.184 8.094   37.290  1.00 154.74 ? 173  ASN C N   1 
ATOM   7249  C CA  . ASN C 1 162 ? -21.843 7.119   36.435  1.00 154.74 ? 173  ASN C CA  1 
ATOM   7250  C C   . ASN C 1 162 ? -22.274 7.726   35.100  1.00 154.74 ? 173  ASN C C   1 
ATOM   7251  O O   . ASN C 1 162 ? -22.553 7.003   34.140  1.00 154.74 ? 173  ASN C O   1 
ATOM   7252  C CB  . ASN C 1 162 ? -23.058 6.545   37.168  1.00 118.54 ? 173  ASN C CB  1 
ATOM   7253  C CG  . ASN C 1 162 ? -23.958 5.732   36.264  1.00 118.54 ? 173  ASN C CG  1 
ATOM   7254  O OD1 . ASN C 1 162 ? -23.551 4.712   35.715  1.00 118.54 ? 173  ASN C OD1 1 
ATOM   7255  N ND2 . ASN C 1 162 ? -25.197 6.186   36.104  1.00 118.54 ? 173  ASN C ND2 1 
ATOM   7256  N N   . VAL C 1 163 ? -22.323 9.053   35.036  1.00 123.42 ? 174  VAL C N   1 
ATOM   7257  C CA  . VAL C 1 163 ? -22.727 9.735   33.812  1.00 123.42 ? 174  VAL C CA  1 
ATOM   7258  C C   . VAL C 1 163 ? -21.736 9.551   32.674  1.00 123.42 ? 174  VAL C C   1 
ATOM   7259  O O   . VAL C 1 163 ? -22.101 9.063   31.608  1.00 123.42 ? 174  VAL C O   1 
ATOM   7260  C CB  . VAL C 1 163 ? -22.941 11.241  34.050  1.00 64.15  ? 174  VAL C CB  1 
ATOM   7261  C CG1 . VAL C 1 163 ? -22.805 11.998  32.743  1.00 64.15  ? 174  VAL C CG1 1 
ATOM   7262  C CG2 . VAL C 1 163 ? -24.334 11.475  34.638  1.00 64.15  ? 174  VAL C CG2 1 
ATOM   7263  N N   . LEU C 1 164 ? -20.486 9.944   32.891  1.00 94.89  ? 175  LEU C N   1 
ATOM   7264  C CA  . LEU C 1 164 ? -19.473 9.804   31.853  1.00 94.89  ? 175  LEU C CA  1 
ATOM   7265  C C   . LEU C 1 164 ? -19.420 8.383   31.294  1.00 94.89  ? 175  LEU C C   1 
ATOM   7266  O O   . LEU C 1 164 ? -18.824 8.149   30.242  1.00 94.89  ? 175  LEU C O   1 
ATOM   7267  C CB  . LEU C 1 164 ? -18.096 10.200  32.389  1.00 109.26 ? 175  LEU C CB  1 
ATOM   7268  C CG  . LEU C 1 164 ? -17.841 11.694  32.609  1.00 109.26 ? 175  LEU C CG  1 
ATOM   7269  C CD1 . LEU C 1 164 ? -17.988 12.430  31.287  1.00 109.26 ? 175  LEU C CD1 1 
ATOM   7270  C CD2 . LEU C 1 164 ? -18.806 12.247  33.638  1.00 109.26 ? 175  LEU C CD2 1 
ATOM   7271  N N   . LYS C 1 165 ? -20.045 7.441   32.001  1.00 59.94  ? 176  LYS C N   1 
ATOM   7272  C CA  . LYS C 1 165 ? -20.084 6.042   31.573  1.00 59.94  ? 176  LYS C CA  1 
ATOM   7273  C C   . LYS C 1 165 ? -21.382 5.738   30.819  1.00 59.94  ? 176  LYS C C   1 
ATOM   7274  O O   . LYS C 1 165 ? -21.364 5.347   29.650  1.00 59.94  ? 176  LYS C O   1 
ATOM   7275  C CB  . LYS C 1 165 ? -19.957 5.107   32.785  1.00 117.16 ? 176  LYS C CB  1 
ATOM   7276  C CG  . LYS C 1 165 ? -18.553 4.557   33.032  1.00 117.16 ? 176  LYS C CG  1 
ATOM   7277  C CD  . LYS C 1 165 ? -18.178 3.471   32.017  1.00 117.16 ? 176  LYS C CD  1 
ATOM   7278  C CE  . LYS C 1 165 ? -16.770 2.919   32.266  1.00 117.16 ? 176  LYS C CE  1 
ATOM   7279  N NZ  . LYS C 1 165 ? -16.390 1.814   31.333  1.00 117.16 ? 176  LYS C NZ  1 
ATOM   7280  N N   . THR C 1 166 ? -22.505 5.930   31.498  1.00 99.52  ? 177  THR C N   1 
ATOM   7281  C CA  . THR C 1 166 ? -23.819 5.676   30.922  1.00 99.52  ? 177  THR C CA  1 
ATOM   7282  C C   . THR C 1 166 ? -24.168 6.606   29.742  1.00 99.52  ? 177  THR C C   1 
ATOM   7283  O O   . THR C 1 166 ? -24.845 6.202   28.787  1.00 99.52  ? 177  THR C O   1 
ATOM   7284  C CB  . THR C 1 166 ? -24.905 5.814   32.023  1.00 140.10 ? 177  THR C CB  1 
ATOM   7285  O OG1 . THR C 1 166 ? -24.630 4.885   33.077  1.00 140.10 ? 177  THR C OG1 1 
ATOM   7286  C CG2 . THR C 1 166 ? -26.295 5.539   31.465  1.00 140.10 ? 177  THR C CG2 1 
ATOM   7287  N N   . SER C 1 167 ? -23.685 7.842   29.817  1.00 91.26  ? 178  SER C N   1 
ATOM   7288  C CA  . SER C 1 167 ? -23.950 8.875   28.818  1.00 91.26  ? 178  SER C CA  1 
ATOM   7289  C C   . SER C 1 167 ? -23.461 8.638   27.383  1.00 91.26  ? 178  SER C C   1 
ATOM   7290  O O   . SER C 1 167 ? -22.379 8.086   27.164  1.00 91.26  ? 178  SER C O   1 
ATOM   7291  C CB  . SER C 1 167 ? -23.389 10.203  29.330  1.00 100.56 ? 178  SER C CB  1 
ATOM   7292  O OG  . SER C 1 167 ? -23.605 11.240  28.397  1.00 100.56 ? 178  SER C OG  1 
ATOM   7293  N N   . GLY C 1 168 ? -24.272 9.077   26.416  1.00 75.92  ? 179  GLY C N   1 
ATOM   7294  C CA  . GLY C 1 168 ? -23.923 8.947   25.009  1.00 75.92  ? 179  GLY C CA  1 
ATOM   7295  C C   . GLY C 1 168 ? -23.057 10.119  24.569  1.00 75.92  ? 179  GLY C C   1 
ATOM   7296  O O   . GLY C 1 168 ? -22.855 11.050  25.346  1.00 75.92  ? 179  GLY C O   1 
ATOM   7297  N N   . LYS C 1 169 ? -22.547 10.092  23.338  1.00 55.49  ? 180  LYS C N   1 
ATOM   7298  C CA  . LYS C 1 169 ? -21.697 11.182  22.849  1.00 55.49  ? 180  LYS C CA  1 
ATOM   7299  C C   . LYS C 1 169 ? -22.050 11.593  21.419  1.00 55.49  ? 180  LYS C C   1 
ATOM   7300  O O   . LYS C 1 169 ? -22.447 10.759  20.616  1.00 55.49  ? 180  LYS C O   1 
ATOM   7301  C CB  . LYS C 1 169 ? -20.235 10.746  22.895  1.00 67.85  ? 180  LYS C CB  1 
ATOM   7302  C CG  . LYS C 1 169 ? -19.886 9.658   21.877  1.00 67.85  ? 180  LYS C CG  1 
ATOM   7303  C CD  . LYS C 1 169 ? -18.469 9.147   22.070  1.00 67.85  ? 180  LYS C CD  1 
ATOM   7304  C CE  . LYS C 1 169 ? -17.481 10.306  22.137  1.00 67.85  ? 180  LYS C CE  1 
ATOM   7305  N NZ  . LYS C 1 169 ? -16.102 9.868   22.489  1.00 67.85  ? 180  LYS C NZ  1 
ATOM   7306  N N   . LEU C 1 170 ? -21.926 12.877  21.102  1.00 46.24  ? 181  LEU C N   1 
ATOM   7307  C CA  . LEU C 1 170 ? -22.207 13.335  19.743  1.00 46.24  ? 181  LEU C CA  1 
ATOM   7308  C C   . LEU C 1 170 ? -20.887 13.181  19.013  1.00 46.24  ? 181  LEU C C   1 
ATOM   7309  O O   . LEU C 1 170 ? -19.851 13.662  19.473  1.00 46.24  ? 181  LEU C O   1 
ATOM   7310  C CB  . LEU C 1 170 ? -22.654 14.799  19.723  1.00 52.46  ? 181  LEU C CB  1 
ATOM   7311  C CG  . LEU C 1 170 ? -23.986 15.136  20.401  1.00 52.46  ? 181  LEU C CG  1 
ATOM   7312  C CD1 . LEU C 1 170 ? -24.294 16.601  20.198  1.00 52.46  ? 181  LEU C CD1 1 
ATOM   7313  C CD2 . LEU C 1 170 ? -25.097 14.301  19.821  1.00 52.46  ? 181  LEU C CD2 1 
ATOM   7314  N N   . ARG C 1 171 ? -20.909 12.529  17.862  1.00 32.70  ? 182  ARG C N   1 
ATOM   7315  C CA  . ARG C 1 171 ? -19.660 12.293  17.164  1.00 32.70  ? 182  ARG C CA  1 
ATOM   7316  C C   . ARG C 1 171 ? -18.728 13.478  16.951  1.00 32.70  ? 182  ARG C C   1 
ATOM   7317  O O   . ARG C 1 171 ? -19.168 14.581  16.653  1.00 32.70  ? 182  ARG C O   1 
ATOM   7318  C CB  . ARG C 1 171 ? -19.922 11.544  15.849  1.00 35.17  ? 182  ARG C CB  1 
ATOM   7319  C CG  . ARG C 1 171 ? -20.842 12.179  14.901  1.00 35.17  ? 182  ARG C CG  1 
ATOM   7320  C CD  . ARG C 1 171 ? -20.063 12.606  13.684  1.00 35.17  ? 182  ARG C CD  1 
ATOM   7321  N NE  . ARG C 1 171 ? -20.920 12.822  12.515  1.00 35.17  ? 182  ARG C NE  1 
ATOM   7322  C CZ  . ARG C 1 171 ? -21.743 11.910  12.017  1.00 35.17  ? 182  ARG C CZ  1 
ATOM   7323  N NH1 . ARG C 1 171 ? -21.833 10.714  12.587  1.00 35.17  ? 182  ARG C NH1 1 
ATOM   7324  N NH2 . ARG C 1 171 ? -22.451 12.192  10.940  1.00 35.17  ? 182  ARG C NH2 1 
ATOM   7325  N N   . GLU C 1 172 ? -17.432 13.212  17.149  1.00 33.81  ? 183  GLU C N   1 
ATOM   7326  C CA  . GLU C 1 172 ? -16.336 14.174  16.987  1.00 33.81  ? 183  GLU C CA  1 
ATOM   7327  C C   . GLU C 1 172 ? -15.772 14.103  15.566  1.00 33.81  ? 183  GLU C C   1 
ATOM   7328  O O   . GLU C 1 172 ? -15.241 15.088  15.054  1.00 33.81  ? 183  GLU C O   1 
ATOM   7329  C CB  . GLU C 1 172 ? -15.212 13.872  17.983  1.00 145.97 ? 183  GLU C CB  1 
ATOM   7330  C CG  . GLU C 1 172 ? -14.075 14.893  17.982  1.00 145.97 ? 183  GLU C CG  1 
ATOM   7331  C CD  . GLU C 1 172 ? -14.335 16.070  18.913  1.00 145.97 ? 183  GLU C CD  1 
ATOM   7332  O OE1 . GLU C 1 172 ? -13.530 17.029  18.908  1.00 145.97 ? 183  GLU C OE1 1 
ATOM   7333  O OE2 . GLU C 1 172 ? -15.338 16.033  19.657  1.00 145.97 ? 183  GLU C OE2 1 
ATOM   7334  N N   . ASN C 1 173 ? -15.882 12.926  14.949  1.00 88.04  ? 184  ASN C N   1 
ATOM   7335  C CA  . ASN C 1 173 ? -15.417 12.686  13.579  1.00 88.04  ? 184  ASN C CA  1 
ATOM   7336  C C   . ASN C 1 173 ? -16.224 11.552  12.936  1.00 88.04  ? 184  ASN C C   1 
ATOM   7337  O O   . ASN C 1 173 ? -17.067 10.942  13.592  1.00 88.04  ? 184  ASN C O   1 
ATOM   7338  C CB  . ASN C 1 173 ? -13.928 12.329  13.563  1.00 79.66  ? 184  ASN C CB  1 
ATOM   7339  C CG  . ASN C 1 173 ? -13.593 11.163  14.480  1.00 79.66  ? 184  ASN C CG  1 
ATOM   7340  O OD1 . ASN C 1 173 ? -14.150 10.074  14.356  1.00 79.66  ? 184  ASN C OD1 1 
ATOM   7341  N ND2 . ASN C 1 173 ? -12.671 11.389  15.405  1.00 79.66  ? 184  ASN C ND2 1 
ATOM   7342  N N   . LEU C 1 174 ? -15.961 11.268  11.659  1.00 41.18  ? 185  LEU C N   1 
ATOM   7343  C CA  . LEU C 1 174 ? -16.679 10.219  10.934  1.00 41.18  ? 185  LEU C CA  1 
ATOM   7344  C C   . LEU C 1 174 ? -15.868 8.949   10.843  1.00 41.18  ? 185  LEU C C   1 
ATOM   7345  O O   . LEU C 1 174 ? -16.382 7.919   10.438  1.00 41.18  ? 185  LEU C O   1 
ATOM   7346  C CB  . LEU C 1 174 ? -17.035 10.683  9.512   1.00 24.58  ? 185  LEU C CB  1 
ATOM   7347  C CG  . LEU C 1 174 ? -17.900 11.942  9.287   1.00 24.58  ? 185  LEU C CG  1 
ATOM   7348  C CD1 . LEU C 1 174 ? -17.984 12.232  7.816   1.00 24.58  ? 185  LEU C CD1 1 
ATOM   7349  C CD2 . LEU C 1 174 ? -19.290 11.753  9.854   1.00 24.58  ? 185  LEU C CD2 1 
ATOM   7350  N N   . LEU C 1 175 ? -14.597 9.032   11.219  1.00 37.28  ? 186  LEU C N   1 
ATOM   7351  C CA  . LEU C 1 175 ? -13.667 7.890   11.194  1.00 37.28  ? 186  LEU C CA  1 
ATOM   7352  C C   . LEU C 1 175 ? -14.121 6.658   11.975  1.00 37.28  ? 186  LEU C C   1 
ATOM   7353  O O   . LEU C 1 175 ? -14.092 5.549   11.453  1.00 37.28  ? 186  LEU C O   1 
ATOM   7354  C CB  . LEU C 1 175 ? -12.293 8.306   11.731  1.00 39.03  ? 186  LEU C CB  1 
ATOM   7355  C CG  . LEU C 1 175 ? -11.199 7.262   11.518  1.00 39.03  ? 186  LEU C CG  1 
ATOM   7356  C CD1 . LEU C 1 175 ? -10.781 7.266   10.053  1.00 39.03  ? 186  LEU C CD1 1 
ATOM   7357  C CD2 . LEU C 1 175 ? -10.008 7.583   12.359  1.00 39.03  ? 186  LEU C CD2 1 
ATOM   7358  N N   . HIS C 1 176 ? -14.526 6.860   13.228  1.00 58.82  ? 187  HIS C N   1 
ATOM   7359  C CA  . HIS C 1 176 ? -14.971 5.763   14.084  1.00 58.82  ? 187  HIS C CA  1 
ATOM   7360  C C   . HIS C 1 176 ? -16.148 5.027   13.464  1.00 58.82  ? 187  HIS C C   1 
ATOM   7361  O O   . HIS C 1 176 ? -16.159 3.798   13.411  1.00 58.82  ? 187  HIS C O   1 
ATOM   7362  C CB  . HIS C 1 176 ? -15.356 6.287   15.474  1.00 91.55  ? 187  HIS C CB  1 
ATOM   7363  C CG  . HIS C 1 176 ? -15.445 5.217   16.522  1.00 91.55  ? 187  HIS C CG  1 
ATOM   7364  N ND1 . HIS C 1 176 ? -14.349 4.496   16.948  1.00 91.55  ? 187  HIS C ND1 1 
ATOM   7365  C CD2 . HIS C 1 176 ? -16.503 4.736   17.219  1.00 91.55  ? 187  HIS C CD2 1 
ATOM   7366  C CE1 . HIS C 1 176 ? -14.727 3.617   17.859  1.00 91.55  ? 187  HIS C CE1 1 
ATOM   7367  N NE2 . HIS C 1 176 ? -16.030 3.742   18.041  1.00 91.55  ? 187  HIS C NE2 1 
ATOM   7368  N N   . GLY C 1 177 ? -17.137 5.777   12.993  1.00 33.97  ? 188  GLY C N   1 
ATOM   7369  C CA  . GLY C 1 177 ? -18.298 5.156   12.372  1.00 33.97  ? 188  GLY C CA  1 
ATOM   7370  C C   . GLY C 1 177 ? -17.971 4.297   11.158  1.00 33.97  ? 188  GLY C C   1 
ATOM   7371  O O   . GLY C 1 177 ? -18.701 3.360   10.829  1.00 33.97  ? 188  GLY C O   1 
ATOM   7372  N N   . ALA C 1 178 ? -16.870 4.627   10.491  1.00 52.23  ? 189  ALA C N   1 
ATOM   7373  C CA  . ALA C 1 178 ? -16.421 3.894   9.321   1.00 52.23  ? 189  ALA C CA  1 
ATOM   7374  C C   . ALA C 1 178 ? -15.857 2.530   9.696   1.00 52.23  ? 189  ALA C C   1 
ATOM   7375  O O   . ALA C 1 178 ? -16.301 1.498   9.194   1.00 52.23  ? 189  ALA C O   1 
ATOM   7376  C CB  . ALA C 1 178 ? -15.364 4.683   8.600   1.00 25.30  ? 189  ALA C CB  1 
ATOM   7377  N N   . LEU C 1 179 ? -14.858 2.526   10.567  1.00 33.53  ? 190  LEU C N   1 
ATOM   7378  C CA  . LEU C 1 179 ? -14.245 1.283   10.966  1.00 33.53  ? 190  LEU C CA  1 
ATOM   7379  C C   . LEU C 1 179 ? -15.313 0.314   11.464  1.00 33.53  ? 190  LEU C C   1 
ATOM   7380  O O   . LEU C 1 179 ? -15.219 -0.881  11.227  1.00 33.53  ? 190  LEU C O   1 
ATOM   7381  C CB  . LEU C 1 179 ? -13.188 1.543   12.043  1.00 51.73  ? 190  LEU C CB  1 
ATOM   7382  C CG  . LEU C 1 179 ? -12.132 2.610   11.716  1.00 51.73  ? 190  LEU C CG  1 
ATOM   7383  C CD1 . LEU C 1 179 ? -11.088 2.675   12.816  1.00 51.73  ? 190  LEU C CD1 1 
ATOM   7384  C CD2 . LEU C 1 179 ? -11.473 2.291   10.397  1.00 51.73  ? 190  LEU C CD2 1 
ATOM   7385  N N   . GLU C 1 180 ? -16.341 0.814   12.141  1.00 29.56  ? 191  GLU C N   1 
ATOM   7386  C CA  . GLU C 1 180 ? -17.396 -0.073  12.638  1.00 29.56  ? 191  GLU C CA  1 
ATOM   7387  C C   . GLU C 1 180 ? -18.192 -0.613  11.467  1.00 29.56  ? 191  GLU C C   1 
ATOM   7388  O O   . GLU C 1 180 ? -19.289 -1.141  11.632  1.00 29.56  ? 191  GLU C O   1 
ATOM   7389  C CB  . GLU C 1 180 ? -18.348 0.673   13.580  1.00 115.31 ? 191  GLU C CB  1 
ATOM   7390  C CG  . GLU C 1 180 ? -17.704 1.224   14.840  1.00 115.31 ? 191  GLU C CG  1 
ATOM   7391  C CD  . GLU C 1 180 ? -18.720 1.817   15.797  1.00 115.31 ? 191  GLU C CD  1 
ATOM   7392  O OE1 . GLU C 1 180 ? -19.579 1.061   16.296  1.00 115.31 ? 191  GLU C OE1 1 
ATOM   7393  O OE2 . GLU C 1 180 ? -18.664 3.038   16.049  1.00 115.31 ? 191  GLU C OE2 1 
ATOM   7394  N N   . HIS C 1 181 ? -17.640 -0.452  10.273  1.00 66.88  ? 192  HIS C N   1 
ATOM   7395  C CA  . HIS C 1 181 ? -18.288 -0.909  9.053   1.00 66.88  ? 192  HIS C CA  1 
ATOM   7396  C C   . HIS C 1 181 ? -17.310 -1.726  8.234   1.00 66.88  ? 192  HIS C C   1 
ATOM   7397  O O   . HIS C 1 181 ? -17.697 -2.498  7.362   1.00 66.88  ? 192  HIS C O   1 
ATOM   7398  C CB  . HIS C 1 181 ? -18.768 0.289   8.238   1.00 65.76  ? 192  HIS C CB  1 
ATOM   7399  C CG  . HIS C 1 181 ? -20.163 0.720   8.561   1.00 65.76  ? 192  HIS C CG  1 
ATOM   7400  N ND1 . HIS C 1 181 ? -21.271 0.119   8.005   1.00 65.76  ? 192  HIS C ND1 1 
ATOM   7401  C CD2 . HIS C 1 181 ? -20.630 1.695   9.373   1.00 65.76  ? 192  HIS C CD2 1 
ATOM   7402  C CE1 . HIS C 1 181 ? -22.362 0.708   8.458   1.00 65.76  ? 192  HIS C CE1 1 
ATOM   7403  N NE2 . HIS C 1 181 ? -22.001 1.668   9.290   1.00 65.76  ? 192  HIS C NE2 1 
ATOM   7404  N N   . TYR C 1 182 ? -16.031 -1.544  8.521   1.00 52.66  ? 193  TYR C N   1 
ATOM   7405  C CA  . TYR C 1 182 ? -14.998 -2.277  7.819   1.00 52.66  ? 193  TYR C CA  1 
ATOM   7406  C C   . TYR C 1 182 ? -15.381 -3.758  7.666   1.00 52.66  ? 193  TYR C C   1 
ATOM   7407  O O   . TYR C 1 182 ? -15.719 -4.232  6.577   1.00 52.66  ? 193  TYR C O   1 
ATOM   7408  C CB  . TYR C 1 182 ? -13.666 -2.159  8.576   1.00 57.47  ? 193  TYR C CB  1 
ATOM   7409  C CG  . TYR C 1 182 ? -12.579 -2.983  7.947   1.00 57.47  ? 193  TYR C CG  1 
ATOM   7410  C CD1 . TYR C 1 182 ? -12.146 -2.704  6.658   1.00 57.47  ? 193  TYR C CD1 1 
ATOM   7411  C CD2 . TYR C 1 182 ? -12.044 -4.096  8.595   1.00 57.47  ? 193  TYR C CD2 1 
ATOM   7412  C CE1 . TYR C 1 182 ? -11.220 -3.505  6.019   1.00 57.47  ? 193  TYR C CE1 1 
ATOM   7413  C CE2 . TYR C 1 182 ? -11.108 -4.911  7.957   1.00 57.47  ? 193  TYR C CE2 1 
ATOM   7414  C CZ  . TYR C 1 182 ? -10.706 -4.605  6.665   1.00 57.47  ? 193  TYR C CZ  1 
ATOM   7415  O OH  . TYR C 1 182 ? -9.799  -5.388  5.994   1.00 57.47  ? 193  TYR C OH  1 
ATOM   7416  N N   . VAL C 1 183 ? -15.346 -4.480  8.777   1.00 44.31  ? 194  VAL C N   1 
ATOM   7417  C CA  . VAL C 1 183 ? -15.633 -5.905  8.767   1.00 44.31  ? 194  VAL C CA  1 
ATOM   7418  C C   . VAL C 1 183 ? -16.869 -6.332  8.003   1.00 44.31  ? 194  VAL C C   1 
ATOM   7419  O O   . VAL C 1 183 ? -16.823 -7.284  7.244   1.00 44.31  ? 194  VAL C O   1 
ATOM   7420  C CB  . VAL C 1 183 ? -15.723 -6.453  10.198  1.00 53.58  ? 194  VAL C CB  1 
ATOM   7421  C CG1 . VAL C 1 183 ? -16.242 -7.873  10.166  1.00 53.58  ? 194  VAL C CG1 1 
ATOM   7422  C CG2 . VAL C 1 183 ? -14.349 -6.404  10.864  1.00 53.58  ? 194  VAL C CG2 1 
ATOM   7423  N N   . ASN C 1 184 ? -17.975 -5.635  8.206   1.00 57.60  ? 195  ASN C N   1 
ATOM   7424  C CA  . ASN C 1 184 ? -19.212 -5.994  7.529   1.00 57.60  ? 195  ASN C CA  1 
ATOM   7425  C C   . ASN C 1 184 ? -19.135 -5.661  6.035   1.00 57.60  ? 195  ASN C C   1 
ATOM   7426  O O   . ASN C 1 184 ? -19.630 -6.411  5.195   1.00 57.60  ? 195  ASN C O   1 
ATOM   7427  C CB  . ASN C 1 184 ? -20.389 -5.271  8.190   1.00 128.92 ? 195  ASN C CB  1 
ATOM   7428  C CG  . ASN C 1 184 ? -21.691 -6.032  8.055   1.00 128.92 ? 195  ASN C CG  1 
ATOM   7429  O OD1 . ASN C 1 184 ? -22.323 -6.035  6.995   1.00 128.92 ? 195  ASN C OD1 1 
ATOM   7430  N ND2 . ASN C 1 184 ? -22.096 -6.696  9.132   1.00 128.92 ? 195  ASN C ND2 1 
ATOM   7431  N N   . CYS C 1 185 ? -18.508 -4.540  5.698   1.00 61.63  ? 196  CYS C N   1 
ATOM   7432  C CA  . CYS C 1 185 ? -18.373 -4.158  4.295   1.00 61.63  ? 196  CYS C CA  1 
ATOM   7433  C C   . CYS C 1 185 ? -17.156 -4.818  3.668   1.00 61.63  ? 196  CYS C C   1 
ATOM   7434  O O   . CYS C 1 185 ? -16.648 -4.353  2.659   1.00 61.63  ? 196  CYS C O   1 
ATOM   7435  C CB  . CYS C 1 185 ? -18.275 -2.632  4.139   1.00 73.11  ? 196  CYS C CB  1 
ATOM   7436  S SG  . CYS C 1 185 ? -19.874 -1.783  4.145   1.00 73.11  ? 196  CYS C SG  1 
ATOM   7437  N N   . LEU C 1 186 ? -16.682 -5.897  4.282   1.00 102.50 ? 197  LEU C N   1 
ATOM   7438  C CA  . LEU C 1 186 ? -15.541 -6.619  3.744   1.00 102.50 ? 197  LEU C CA  1 
ATOM   7439  C C   . LEU C 1 186 ? -16.108 -7.666  2.801   1.00 102.50 ? 197  LEU C C   1 
ATOM   7440  O O   . LEU C 1 186 ? -15.633 -7.830  1.682   1.00 102.50 ? 197  LEU C O   1 
ATOM   7441  C CB  . LEU C 1 186 ? -14.743 -7.291  4.855   1.00 58.50  ? 197  LEU C CB  1 
ATOM   7442  C CG  . LEU C 1 186 ? -13.284 -7.525  4.466   1.00 58.50  ? 197  LEU C CG  1 
ATOM   7443  C CD1 . LEU C 1 186 ? -12.607 -6.213  4.088   1.00 58.50  ? 197  LEU C CD1 1 
ATOM   7444  C CD2 . LEU C 1 186 ? -12.576 -8.150  5.625   1.00 58.50  ? 197  LEU C CD2 1 
ATOM   7445  N N   . ASP C 1 187 ? -17.129 -8.382  3.255   1.00 82.48  ? 198  ASP C N   1 
ATOM   7446  C CA  . ASP C 1 187 ? -17.770 -9.368  2.400   1.00 82.48  ? 198  ASP C CA  1 
ATOM   7447  C C   . ASP C 1 187 ? -18.642 -8.565  1.439   1.00 82.48  ? 198  ASP C C   1 
ATOM   7448  O O   . ASP C 1 187 ? -19.868 -8.712  1.414   1.00 82.48  ? 198  ASP C O   1 
ATOM   7449  C CB  . ASP C 1 187 ? -18.646 -10.319 3.217   1.00 167.67 ? 198  ASP C CB  1 
ATOM   7450  C CG  . ASP C 1 187 ? -19.363 -11.339 2.348   1.00 167.67 ? 198  ASP C CG  1 
ATOM   7451  O OD1 . ASP C 1 187 ? -18.700 -12.272 1.841   1.00 167.67 ? 198  ASP C OD1 1 
ATOM   7452  O OD2 . ASP C 1 187 ? -20.591 -11.197 2.161   1.00 167.67 ? 198  ASP C OD2 1 
ATOM   7453  N N   . LEU C 1 188 ? -17.989 -7.704  0.665   1.00 53.46  ? 199  LEU C N   1 
ATOM   7454  C CA  . LEU C 1 188 ? -18.656 -6.844  -0.301  1.00 53.46  ? 199  LEU C CA  1 
ATOM   7455  C C   . LEU C 1 188 ? -17.651 -6.526  -1.407  1.00 53.46  ? 199  LEU C C   1 
ATOM   7456  O O   . LEU C 1 188 ? -17.861 -5.639  -2.244  1.00 53.46  ? 199  LEU C O   1 
ATOM   7457  C CB  . LEU C 1 188 ? -19.123 -5.558  0.383   1.00 58.53  ? 199  LEU C CB  1 
ATOM   7458  C CG  . LEU C 1 188 ? -20.024 -4.605  -0.403  1.00 58.53  ? 199  LEU C CG  1 
ATOM   7459  C CD1 . LEU C 1 188 ? -21.223 -5.369  -0.893  1.00 58.53  ? 199  LEU C CD1 1 
ATOM   7460  C CD2 . LEU C 1 188 ? -20.471 -3.444  0.473   1.00 58.53  ? 199  LEU C CD2 1 
ATOM   7461  N N   . VAL C 1 189 ? -16.543 -7.253  -1.371  1.00 50.87  ? 200  VAL C N   1 
ATOM   7462  C CA  . VAL C 1 189 ? -15.463 -7.149  -2.344  1.00 50.87  ? 200  VAL C CA  1 
ATOM   7463  C C   . VAL C 1 189 ? -14.543 -8.306  -2.026  1.00 50.87  ? 200  VAL C C   1 
ATOM   7464  O O   . VAL C 1 189 ? -13.327 -8.192  -2.129  1.00 50.87  ? 200  VAL C O   1 
ATOM   7465  C CB  . VAL C 1 189 ? -14.635 -5.826  -2.256  1.00 45.84  ? 200  VAL C CB  1 
ATOM   7466  C CG1 . VAL C 1 189 ? -15.455 -4.668  -2.728  1.00 45.84  ? 200  VAL C CG1 1 
ATOM   7467  C CG2 . VAL C 1 189 ? -14.134 -5.589  -0.849  1.00 45.84  ? 200  VAL C CG2 1 
ATOM   7468  N N   . ASN C 1 190 ? -15.142 -9.412  -1.606  1.00 92.67  ? 201  ASN C N   1 
ATOM   7469  C CA  . ASN C 1 190 ? -14.394 -10.613 -1.287  1.00 92.67  ? 201  ASN C CA  1 
ATOM   7470  C C   . ASN C 1 190 ? -13.022 -10.321 -0.674  1.00 92.67  ? 201  ASN C C   1 
ATOM   7471  O O   . ASN C 1 190 ? -11.981 -10.674 -1.240  1.00 92.67  ? 201  ASN C O   1 
ATOM   7472  C CB  . ASN C 1 190 ? -14.238 -11.451 -2.556  1.00 149.53 ? 201  ASN C CB  1 
ATOM   7473  C CG  . ASN C 1 190 ? -15.554 -11.647 -3.279  1.00 149.53 ? 201  ASN C CG  1 
ATOM   7474  O OD1 . ASN C 1 190 ? -16.483 -12.252 -2.745  1.00 149.53 ? 201  ASN C OD1 1 
ATOM   7475  N ND2 . ASN C 1 190 ? -15.646 -11.124 -4.497  1.00 149.53 ? 201  ASN C ND2 1 
ATOM   7476  N N   . LYS C 1 191 ? -13.034 -9.664  0.479   1.00 67.27  ? 202  LYS C N   1 
ATOM   7477  C CA  . LYS C 1 191 ? -11.815 -9.326  1.206   1.00 67.27  ? 202  LYS C CA  1 
ATOM   7478  C C   . LYS C 1 191 ? -10.708 -8.643  0.381   1.00 67.27  ? 202  LYS C C   1 
ATOM   7479  O O   . LYS C 1 191 ? -9.533  -8.691  0.746   1.00 67.27  ? 202  LYS C O   1 
ATOM   7480  C CB  . LYS C 1 191 ? -11.257 -10.585 1.879   1.00 105.11 ? 202  LYS C CB  1 
ATOM   7481  C CG  . LYS C 1 191 ? -12.152 -11.170 2.963   1.00 105.11 ? 202  LYS C CG  1 
ATOM   7482  C CD  . LYS C 1 191 ? -13.467 -11.698 2.403   1.00 105.11 ? 202  LYS C CD  1 
ATOM   7483  C CE  . LYS C 1 191 ? -14.392 -12.209 3.516   1.00 105.11 ? 202  LYS C CE  1 
ATOM   7484  N NZ  . LYS C 1 191 ? -15.684 -12.786 3.010   1.00 105.11 ? 202  LYS C NZ  1 
ATOM   7485  N N   . ARG C 1 192 ? -11.069 -7.984  -0.713  1.00 60.87  ? 203  ARG C N   1 
ATOM   7486  C CA  . ARG C 1 192 ? -10.048 -7.331  -1.526  1.00 60.87  ? 203  ARG C CA  1 
ATOM   7487  C C   . ARG C 1 192 ? -9.727  -5.887  -1.161  1.00 60.87  ? 203  ARG C C   1 
ATOM   7488  O O   . ARG C 1 192 ? -10.583 -5.005  -1.225  1.00 60.87  ? 203  ARG C O   1 
ATOM   7489  C CB  . ARG C 1 192 ? -10.416 -7.382  -3.017  1.00 115.13 ? 203  ARG C CB  1 
ATOM   7490  C CG  . ARG C 1 192 ? -10.290 -8.751  -3.686  1.00 115.13 ? 203  ARG C CG  1 
ATOM   7491  C CD  . ARG C 1 192 ? -10.204 -8.580  -5.197  1.00 115.13 ? 203  ARG C CD  1 
ATOM   7492  N NE  . ARG C 1 192 ? -11.224 -7.660  -5.694  1.00 115.13 ? 203  ARG C NE  1 
ATOM   7493  C CZ  . ARG C 1 192 ? -12.527 -7.925  -5.720  1.00 115.13 ? 203  ARG C CZ  1 
ATOM   7494  N NH1 . ARG C 1 192 ? -13.380 -7.022  -6.185  1.00 115.13 ? 203  ARG C NH1 1 
ATOM   7495  N NH2 . ARG C 1 192 ? -12.979 -9.096  -5.295  1.00 115.13 ? 203  ARG C NH2 1 
ATOM   7496  N N   . LEU C 1 193 ? -8.475  -5.653  -0.788  1.00 65.26  ? 204  LEU C N   1 
ATOM   7497  C CA  . LEU C 1 193 ? -8.028  -4.309  -0.451  1.00 65.26  ? 204  LEU C CA  1 
ATOM   7498  C C   . LEU C 1 193 ? -7.306  -3.821  -1.704  1.00 65.26  ? 204  LEU C C   1 
ATOM   7499  O O   . LEU C 1 193 ? -6.821  -4.623  -2.503  1.00 65.26  ? 204  LEU C O   1 
ATOM   7500  C CB  . LEU C 1 193 ? -7.040  -4.335  0.717   1.00 108.49 ? 204  LEU C CB  1 
ATOM   7501  C CG  . LEU C 1 193 ? -7.194  -5.362  1.843   1.00 108.49 ? 204  LEU C CG  1 
ATOM   7502  C CD1 . LEU C 1 193 ? -5.981  -5.244  2.749   1.00 108.49 ? 204  LEU C CD1 1 
ATOM   7503  C CD2 . LEU C 1 193 ? -8.477  -5.148  2.628   1.00 108.49 ? 204  LEU C CD2 1 
ATOM   7504  N N   . PRO C 1 194 ? -7.247  -2.504  -1.905  1.00 105.03 ? 205  PRO C N   1 
ATOM   7505  C CA  . PRO C 1 194 ? -7.821  -1.493  -1.024  1.00 105.03 ? 205  PRO C CA  1 
ATOM   7506  C C   . PRO C 1 194 ? -9.232  -1.106  -1.479  1.00 105.03 ? 205  PRO C C   1 
ATOM   7507  O O   . PRO C 1 194 ? -9.546  -1.158  -2.665  1.00 105.03 ? 205  PRO C O   1 
ATOM   7508  C CB  . PRO C 1 194 ? -6.836  -0.342  -1.167  1.00 71.62  ? 205  PRO C CB  1 
ATOM   7509  C CG  . PRO C 1 194 ? -6.545  -0.388  -2.631  1.00 71.62  ? 205  PRO C CG  1 
ATOM   7510  C CD  . PRO C 1 194 ? -6.360  -1.879  -2.902  1.00 71.62  ? 205  PRO C CD  1 
ATOM   7511  N N   . TYR C 1 195 ? -10.076 -0.733  -0.525  1.00 42.09  ? 206  TYR C N   1 
ATOM   7512  C CA  . TYR C 1 195 ? -11.430 -0.301  -0.815  1.00 42.09  ? 206  TYR C CA  1 
ATOM   7513  C C   . TYR C 1 195 ? -11.766 0.715   0.264   1.00 42.09  ? 206  TYR C C   1 
ATOM   7514  O O   . TYR C 1 195 ? -11.371 0.525   1.405   1.00 42.09  ? 206  TYR C O   1 
ATOM   7515  C CB  . TYR C 1 195 ? -12.380 -1.485  -0.734  1.00 40.63  ? 206  TYR C CB  1 
ATOM   7516  C CG  . TYR C 1 195 ? -12.903 -1.767  0.651   1.00 40.63  ? 206  TYR C CG  1 
ATOM   7517  C CD1 . TYR C 1 195 ? -14.110 -1.227  1.080   1.00 40.63  ? 206  TYR C CD1 1 
ATOM   7518  C CD2 . TYR C 1 195 ? -12.214 -2.612  1.508   1.00 40.63  ? 206  TYR C CD2 1 
ATOM   7519  C CE1 . TYR C 1 195 ? -14.621 -1.531  2.321   1.00 40.63  ? 206  TYR C CE1 1 
ATOM   7520  C CE2 . TYR C 1 195 ? -12.708 -2.924  2.744   1.00 40.63  ? 206  TYR C CE2 1 
ATOM   7521  C CZ  . TYR C 1 195 ? -13.916 -2.385  3.149   1.00 40.63  ? 206  TYR C CZ  1 
ATOM   7522  O OH  . TYR C 1 195 ? -14.432 -2.725  4.376   1.00 40.63  ? 206  TYR C OH  1 
ATOM   7523  N N   . GLY C 1 196 ? -12.496 1.775   -0.075  1.00 73.75  ? 207  GLY C N   1 
ATOM   7524  C CA  . GLY C 1 196 ? -12.809 2.772   0.936   1.00 73.75  ? 207  GLY C CA  1 
ATOM   7525  C C   . GLY C 1 196 ? -14.247 2.922   1.385   1.00 73.75  ? 207  GLY C C   1 
ATOM   7526  O O   . GLY C 1 196 ? -15.155 2.293   0.844   1.00 73.75  ? 207  GLY C O   1 
ATOM   7527  N N   . LEU C 1 197 ? -14.444 3.747   2.408   1.00 55.82  ? 208  LEU C N   1 
ATOM   7528  C CA  . LEU C 1 197 ? -15.781 4.023   2.923   1.00 55.82  ? 208  LEU C CA  1 
ATOM   7529  C C   . LEU C 1 197 ? -15.947 5.539   2.992   1.00 55.82  ? 208  LEU C C   1 
ATOM   7530  O O   . LEU C 1 197 ? -15.438 6.180   3.903   1.00 55.82  ? 208  LEU C O   1 
ATOM   7531  C CB  . LEU C 1 197 ? -15.977 3.418   4.317   1.00 28.02  ? 208  LEU C CB  1 
ATOM   7532  C CG  . LEU C 1 197 ? -15.913 1.900   4.511   1.00 28.02  ? 208  LEU C CG  1 
ATOM   7533  C CD1 . LEU C 1 197 ? -16.521 1.575   5.877   1.00 28.02  ? 208  LEU C CD1 1 
ATOM   7534  C CD2 . LEU C 1 197 ? -16.668 1.161   3.381   1.00 28.02  ? 208  LEU C CD2 1 
ATOM   7535  N N   . ALA C 1 198 ? -16.655 6.118   2.029   1.00 25.71  ? 209  ALA C N   1 
ATOM   7536  C CA  . ALA C 1 198 ? -16.824 7.564   2.014   1.00 25.71  ? 209  ALA C CA  1 
ATOM   7537  C C   . ALA C 1 198 ? -18.018 8.006   2.820   1.00 25.71  ? 209  ALA C C   1 
ATOM   7538  O O   . ALA C 1 198 ? -18.952 7.233   3.045   1.00 25.71  ? 209  ALA C O   1 
ATOM   7539  C CB  . ALA C 1 198 ? -16.950 8.071   0.594   1.00 35.74  ? 209  ALA C CB  1 
ATOM   7540  N N   . GLN C 1 199 ? -17.976 9.270   3.233   1.00 47.32  ? 210  GLN C N   1 
ATOM   7541  C CA  . GLN C 1 199 ? -19.032 9.864   4.033   1.00 47.32  ? 210  GLN C CA  1 
ATOM   7542  C C   . GLN C 1 199 ? -18.853 11.389  4.098   1.00 47.32  ? 210  GLN C C   1 
ATOM   7543  O O   . GLN C 1 199 ? -17.725 11.883  4.132   1.00 47.32  ? 210  GLN C O   1 
ATOM   7544  C CB  . GLN C 1 199 ? -18.970 9.258   5.424   1.00 46.69  ? 210  GLN C CB  1 
ATOM   7545  C CG  . GLN C 1 199 ? -20.094 9.625   6.331   1.00 46.69  ? 210  GLN C CG  1 
ATOM   7546  C CD  . GLN C 1 199 ? -20.107 8.762   7.577   1.00 46.69  ? 210  GLN C CD  1 
ATOM   7547  O OE1 . GLN C 1 199 ? -21.102 8.745   8.322   1.00 46.69  ? 210  GLN C OE1 1 
ATOM   7548  N NE2 . GLN C 1 199 ? -18.998 8.039   7.819   1.00 46.69  ? 210  GLN C NE2 1 
ATOM   7549  N N   . ILE C 1 200 ? -19.966 12.123  4.061   1.00 53.19  ? 211  ILE C N   1 
ATOM   7550  C CA  . ILE C 1 200 ? -19.961 13.588  4.158   1.00 53.19  ? 211  ILE C CA  1 
ATOM   7551  C C   . ILE C 1 200 ? -20.988 13.922  5.225   1.00 53.19  ? 211  ILE C C   1 
ATOM   7552  O O   . ILE C 1 200 ? -22.178 13.684  5.033   1.00 53.19  ? 211  ILE C O   1 
ATOM   7553  C CB  . ILE C 1 200 ? -20.387 14.283  2.838   1.00 39.43  ? 211  ILE C CB  1 
ATOM   7554  C CG1 . ILE C 1 200 ? -19.250 14.205  1.817   1.00 39.43  ? 211  ILE C CG1 1 
ATOM   7555  C CG2 . ILE C 1 200 ? -20.787 15.741  3.110   1.00 39.43  ? 211  ILE C CG2 1 
ATOM   7556  C CD1 . ILE C 1 200 ? -19.305 15.299  0.739   1.00 39.43  ? 211  ILE C CD1 1 
ATOM   7557  N N   . GLY C 1 201 ? -20.536 14.463  6.352   1.00 54.75  ? 212  GLY C N   1 
ATOM   7558  C CA  . GLY C 1 201 ? -21.469 14.762  7.423   1.00 54.75  ? 212  GLY C CA  1 
ATOM   7559  C C   . GLY C 1 201 ? -20.997 15.714  8.497   1.00 54.75  ? 212  GLY C C   1 
ATOM   7560  O O   . GLY C 1 201 ? -19.869 16.213  8.468   1.00 54.75  ? 212  GLY C O   1 
ATOM   7561  N N   . VAL C 1 202 ? -21.876 15.944  9.467   1.00 38.05  ? 213  VAL C N   1 
ATOM   7562  C CA  . VAL C 1 202 ? -21.600 16.874  10.555  1.00 38.05  ? 213  VAL C CA  1 
ATOM   7563  C C   . VAL C 1 202 ? -21.037 16.263  11.825  1.00 38.05  ? 213  VAL C C   1 
ATOM   7564  O O   . VAL C 1 202 ? -21.510 15.236  12.308  1.00 38.05  ? 213  VAL C O   1 
ATOM   7565  C CB  . VAL C 1 202 ? -22.876 17.653  10.930  1.00 37.27  ? 213  VAL C CB  1 
ATOM   7566  C CG1 . VAL C 1 202 ? -22.570 18.694  11.971  1.00 37.27  ? 213  VAL C CG1 1 
ATOM   7567  C CG2 . VAL C 1 202 ? -23.456 18.303  9.700   1.00 37.27  ? 213  VAL C CG2 1 
ATOM   7568  N N   . CYS C 1 203 ? -20.025 16.931  12.367  1.00 47.01  ? 214  CYS C N   1 
ATOM   7569  C CA  . CYS C 1 203 ? -19.383 16.517  13.604  1.00 47.01  ? 214  CYS C CA  1 
ATOM   7570  C C   . CYS C 1 203 ? -19.455 17.700  14.563  1.00 47.01  ? 214  CYS C C   1 
ATOM   7571  O O   . CYS C 1 203 ? -19.373 18.849  14.144  1.00 47.01  ? 214  CYS C O   1 
ATOM   7572  C CB  . CYS C 1 203 ? -17.936 16.154  13.328  1.00 100.45 ? 214  CYS C CB  1 
ATOM   7573  S SG  . CYS C 1 203 ? -17.774 15.003  11.971  1.00 100.45 ? 214  CYS C SG  1 
ATOM   7574  N N   . PHE C 1 204 ? -19.610 17.427  15.848  1.00 37.21  ? 215  PHE C N   1 
ATOM   7575  C CA  . PHE C 1 204 ? -19.703 18.508  16.814  1.00 37.21  ? 215  PHE C CA  1 
ATOM   7576  C C   . PHE C 1 204 ? -18.480 18.587  17.704  1.00 37.21  ? 215  PHE C C   1 
ATOM   7577  O O   . PHE C 1 204 ? -18.221 17.669  18.466  1.00 37.21  ? 215  PHE C O   1 
ATOM   7578  C CB  . PHE C 1 204 ? -20.931 18.311  17.686  1.00 42.58  ? 215  PHE C CB  1 
ATOM   7579  C CG  . PHE C 1 204 ? -22.131 17.846  16.935  1.00 42.58  ? 215  PHE C CG  1 
ATOM   7580  C CD1 . PHE C 1 204 ? -22.273 16.504  16.596  1.00 42.58  ? 215  PHE C CD1 1 
ATOM   7581  C CD2 . PHE C 1 204 ? -23.131 18.738  16.583  1.00 42.58  ? 215  PHE C CD2 1 
ATOM   7582  C CE1 . PHE C 1 204 ? -23.401 16.055  15.921  1.00 42.58  ? 215  PHE C CE1 1 
ATOM   7583  C CE2 . PHE C 1 204 ? -24.256 18.306  15.912  1.00 42.58  ? 215  PHE C CE2 1 
ATOM   7584  C CZ  . PHE C 1 204 ? -24.398 16.954  15.578  1.00 42.58  ? 215  PHE C CZ  1 
ATOM   7585  N N   . HIS C 1 205 ? -17.740 19.688  17.623  1.00 40.89  ? 216  HIS C N   1 
ATOM   7586  C CA  . HIS C 1 205 ? -16.540 19.882  18.436  1.00 40.89  ? 216  HIS C CA  1 
ATOM   7587  C C   . HIS C 1 205 ? -16.760 21.075  19.350  1.00 40.89  ? 216  HIS C C   1 
ATOM   7588  O O   . HIS C 1 205 ? -17.412 22.031  18.965  1.00 40.89  ? 216  HIS C O   1 
ATOM   7589  C CB  . HIS C 1 205 ? -15.339 20.187  17.550  1.00 75.74  ? 216  HIS C CB  1 
ATOM   7590  C CG  . HIS C 1 205 ? -15.243 19.318  16.339  1.00 75.74  ? 216  HIS C CG  1 
ATOM   7591  N ND1 . HIS C 1 205 ? -16.247 19.240  15.401  1.00 75.74  ? 216  HIS C ND1 1 
ATOM   7592  C CD2 . HIS C 1 205 ? -14.255 18.503  15.905  1.00 75.74  ? 216  HIS C CD2 1 
ATOM   7593  C CE1 . HIS C 1 205 ? -15.882 18.413  14.439  1.00 75.74  ? 216  HIS C CE1 1 
ATOM   7594  N NE2 . HIS C 1 205 ? -14.678 17.952  14.721  1.00 75.74  ? 216  HIS C NE2 1 
ATOM   7595  N N   . PRO C 1 206 ? -16.205 21.042  20.570  1.00 58.32  ? 217  PRO C N   1 
ATOM   7596  C CA  . PRO C 1 206 ? -16.355 22.147  21.522  1.00 58.32  ? 217  PRO C CA  1 
ATOM   7597  C C   . PRO C 1 206 ? -15.462 23.360  21.202  1.00 58.32  ? 217  PRO C C   1 
ATOM   7598  O O   . PRO C 1 206 ? -14.356 23.213  20.672  1.00 58.32  ? 217  PRO C O   1 
ATOM   7599  C CB  . PRO C 1 206 ? -15.989 21.498  22.850  1.00 53.91  ? 217  PRO C CB  1 
ATOM   7600  C CG  . PRO C 1 206 ? -14.914 20.556  22.449  1.00 53.91  ? 217  PRO C CG  1 
ATOM   7601  C CD  . PRO C 1 206 ? -15.480 19.918  21.191  1.00 53.91  ? 217  PRO C CD  1 
ATOM   7602  N N   . VAL C 1 207 ? -15.956 24.551  21.541  1.00 72.76  ? 218  VAL C N   1 
ATOM   7603  C CA  . VAL C 1 207 ? -15.244 25.798  21.307  1.00 72.76  ? 218  VAL C CA  1 
ATOM   7604  C C   . VAL C 1 207 ? -14.564 26.309  22.576  1.00 72.76  ? 218  VAL C C   1 
ATOM   7605  O O   . VAL C 1 207 ? -13.378 26.666  22.567  1.00 72.76  ? 218  VAL C O   1 
ATOM   7606  C CB  . VAL C 1 207 ? -16.204 26.876  20.809  1.00 80.05  ? 218  VAL C CB  1 
ATOM   7607  C CG1 . VAL C 1 207 ? -15.435 28.141  20.463  1.00 80.05  ? 218  VAL C CG1 1 
ATOM   7608  C CG2 . VAL C 1 207 ? -16.956 26.365  19.600  1.00 80.05  ? 218  VAL C CG2 1 
ATOM   7609  N N   . LYS C 1 218 ? -19.247 26.094  28.082  1.00 87.92  ? 229  LYS C N   1 
ATOM   7610  C CA  . LYS C 1 218 ? -18.568 26.032  26.791  1.00 87.92  ? 229  LYS C CA  1 
ATOM   7611  C C   . LYS C 1 218 ? -19.603 25.994  25.657  1.00 87.92  ? 229  LYS C C   1 
ATOM   7612  O O   . LYS C 1 218 ? -20.759 25.617  25.875  1.00 87.92  ? 229  LYS C O   1 
ATOM   7613  C CB  . LYS C 1 218 ? -17.658 24.790  26.724  1.00 86.63  ? 229  LYS C CB  1 
ATOM   7614  C CG  . LYS C 1 218 ? -16.576 24.712  27.823  1.00 86.63  ? 229  LYS C CG  1 
ATOM   7615  C CD  . LYS C 1 218 ? -15.475 23.675  27.508  1.00 86.63  ? 229  LYS C CD  1 
ATOM   7616  C CE  . LYS C 1 218 ? -14.581 24.119  26.332  1.00 86.63  ? 229  LYS C CE  1 
ATOM   7617  N NZ  . LYS C 1 218 ? -13.510 23.153  25.940  1.00 86.63  ? 229  LYS C NZ  1 
ATOM   7618  N N   . SER C 1 219 ? -19.187 26.384  24.451  1.00 127.70 ? 230  SER C N   1 
ATOM   7619  C CA  . SER C 1 219 ? -20.089 26.397  23.299  1.00 127.70 ? 230  SER C CA  1 
ATOM   7620  C C   . SER C 1 219 ? -19.810 25.317  22.257  1.00 127.70 ? 230  SER C C   1 
ATOM   7621  O O   . SER C 1 219 ? -18.664 25.083  21.875  1.00 127.70 ? 230  SER C O   1 
ATOM   7622  C CB  . SER C 1 219 ? -20.059 27.766  22.613  1.00 81.07  ? 230  SER C CB  1 
ATOM   7623  O OG  . SER C 1 219 ? -20.668 28.758  23.417  1.00 81.07  ? 230  SER C OG  1 
ATOM   7624  N N   . ILE C 1 220 ? -20.885 24.674  21.806  1.00 79.71  ? 231  ILE C N   1 
ATOM   7625  C CA  . ILE C 1 220 ? -20.847 23.620  20.795  1.00 79.71  ? 231  ILE C CA  1 
ATOM   7626  C C   . ILE C 1 220 ? -20.294 24.172  19.483  1.00 79.71  ? 231  ILE C C   1 
ATOM   7627  O O   . ILE C 1 220 ? -20.103 25.382  19.339  1.00 79.71  ? 231  ILE C O   1 
ATOM   7628  C CB  . ILE C 1 220 ? -22.278 23.058  20.563  1.00 38.55  ? 231  ILE C CB  1 
ATOM   7629  C CG1 . ILE C 1 220 ? -22.650 22.121  21.706  1.00 38.55  ? 231  ILE C CG1 1 
ATOM   7630  C CG2 . ILE C 1 220 ? -22.382 22.348  19.240  1.00 38.55  ? 231  ILE C CG2 1 
ATOM   7631  C CD1 . ILE C 1 220 ? -23.996 21.460  21.564  1.00 38.55  ? 231  ILE C CD1 1 
ATOM   7632  N N   . GLY C 1 221 ? -20.034 23.288  18.528  1.00 40.16  ? 232  GLY C N   1 
ATOM   7633  C CA  . GLY C 1 221 ? -19.507 23.730  17.252  1.00 40.16  ? 232  GLY C CA  1 
ATOM   7634  C C   . GLY C 1 221 ? -19.729 22.730  16.139  1.00 40.16  ? 232  GLY C C   1 
ATOM   7635  O O   . GLY C 1 221 ? -19.093 21.683  16.090  1.00 40.16  ? 232  GLY C O   1 
ATOM   7636  N N   . GLU C 1 222 ? -20.636 23.060  15.234  1.00 33.64  ? 233  GLU C N   1 
ATOM   7637  C CA  . GLU C 1 222 ? -20.944 22.188  14.123  1.00 33.64  ? 233  GLU C CA  1 
ATOM   7638  C C   . GLU C 1 222 ? -20.133 22.505  12.873  1.00 33.64  ? 233  GLU C C   1 
ATOM   7639  O O   . GLU C 1 222 ? -20.012 23.652  12.463  1.00 33.64  ? 233  GLU C O   1 
ATOM   7640  C CB  . GLU C 1 222 ? -22.436 22.260  13.811  1.00 62.93  ? 233  GLU C CB  1 
ATOM   7641  C CG  . GLU C 1 222 ? -23.300 21.515  14.817  1.00 62.93  ? 233  GLU C CG  1 
ATOM   7642  C CD  . GLU C 1 222 ? -24.794 21.633  14.527  1.00 62.93  ? 233  GLU C CD  1 
ATOM   7643  O OE1 . GLU C 1 222 ? -25.166 21.719  13.338  1.00 62.93  ? 233  GLU C OE1 1 
ATOM   7644  O OE2 . GLU C 1 222 ? -25.602 21.621  15.480  1.00 62.93  ? 233  GLU C OE2 1 
ATOM   7645  N N   . LYS C 1 223 ? -19.558 21.459  12.288  1.00 62.25  ? 234  LYS C N   1 
ATOM   7646  C CA  . LYS C 1 223 ? -18.786 21.554  11.056  1.00 62.25  ? 234  LYS C CA  1 
ATOM   7647  C C   . LYS C 1 223 ? -19.199 20.347  10.210  1.00 62.25  ? 234  LYS C C   1 
ATOM   7648  O O   . LYS C 1 223 ? -19.413 19.249  10.726  1.00 62.25  ? 234  LYS C O   1 
ATOM   7649  C CB  . LYS C 1 223 ? -17.278 21.510  11.332  1.00 100.05 ? 234  LYS C CB  1 
ATOM   7650  C CG  . LYS C 1 223 ? -16.769 22.616  12.248  1.00 100.05 ? 234  LYS C CG  1 
ATOM   7651  C CD  . LYS C 1 223 ? -15.533 23.324  11.671  1.00 100.05 ? 234  LYS C CD  1 
ATOM   7652  C CE  . LYS C 1 223 ? -15.902 24.288  10.531  1.00 100.05 ? 234  LYS C CE  1 
ATOM   7653  N NZ  . LYS C 1 223 ? -14.725 24.998  9.941   1.00 100.05 ? 234  LYS C NZ  1 
ATOM   7654  N N   . THR C 1 224 ? -19.349 20.566  8.912   1.00 50.91  ? 235  THR C N   1 
ATOM   7655  C CA  . THR C 1 224 ? -19.727 19.505  7.987   1.00 50.91  ? 235  THR C CA  1 
ATOM   7656  C C   . THR C 1 224 ? -18.451 18.917  7.434   1.00 50.91  ? 235  THR C C   1 
ATOM   7657  O O   . THR C 1 224 ? -17.717 19.570  6.680   1.00 50.91  ? 235  THR C O   1 
ATOM   7658  C CB  . THR C 1 224 ? -20.541 20.041  6.807   1.00 48.55  ? 235  THR C CB  1 
ATOM   7659  O OG1 . THR C 1 224 ? -21.767 20.600  7.283   1.00 48.55  ? 235  THR C OG1 1 
ATOM   7660  C CG2 . THR C 1 224 ? -20.842 18.941  5.842   1.00 48.55  ? 235  THR C CG2 1 
ATOM   7661  N N   . GLU C 1 225 ? -18.172 17.683  7.806   1.00 46.18  ? 236  GLU C N   1 
ATOM   7662  C CA  . GLU C 1 225 ? -16.966 17.071  7.322   1.00 46.18  ? 236  GLU C CA  1 
ATOM   7663  C C   . GLU C 1 225 ? -17.202 15.978  6.278   1.00 46.18  ? 236  GLU C C   1 
ATOM   7664  O O   . GLU C 1 225 ? -18.188 15.232  6.338   1.00 46.18  ? 236  GLU C O   1 
ATOM   7665  C CB  . GLU C 1 225 ? -16.164 16.558  8.513   1.00 81.81  ? 236  GLU C CB  1 
ATOM   7666  C CG  . GLU C 1 225 ? -15.658 17.707  9.364   1.00 81.81  ? 236  GLU C CG  1 
ATOM   7667  C CD  . GLU C 1 225 ? -15.054 17.275  10.679  1.00 81.81  ? 236  GLU C CD  1 
ATOM   7668  O OE1 . GLU C 1 225 ? -14.554 18.163  11.401  1.00 81.81  ? 236  GLU C OE1 1 
ATOM   7669  O OE2 . GLU C 1 225 ? -15.079 16.062  10.992  1.00 81.81  ? 236  GLU C OE2 1 
ATOM   7670  N N   . ALA C 1 226 ? -16.304 15.938  5.291   1.00 57.96  ? 237  ALA C N   1 
ATOM   7671  C CA  . ALA C 1 226 ? -16.333 14.949  4.222   1.00 57.96  ? 237  ALA C CA  1 
ATOM   7672  C C   . ALA C 1 226 ? -15.131 14.082  4.509   1.00 57.96  ? 237  ALA C C   1 
ATOM   7673  O O   . ALA C 1 226 ? -14.029 14.603  4.649   1.00 57.96  ? 237  ALA C O   1 
ATOM   7674  C CB  . ALA C 1 226 ? -16.161 15.618  2.894   1.00 6.99   ? 237  ALA C CB  1 
ATOM   7675  N N   . SER C 1 227 ? -15.324 12.772  4.600   1.00 46.69  ? 238  SER C N   1 
ATOM   7676  C CA  . SER C 1 227 ? -14.199 11.904  4.901   1.00 46.69  ? 238  SER C CA  1 
ATOM   7677  C C   . SER C 1 227 ? -14.108 10.630  4.087   1.00 46.69  ? 238  SER C C   1 
ATOM   7678  O O   . SER C 1 227 ? -15.119 10.021  3.720   1.00 46.69  ? 238  SER C O   1 
ATOM   7679  C CB  . SER C 1 227 ? -14.215 11.491  6.367   1.00 27.26  ? 238  SER C CB  1 
ATOM   7680  O OG  . SER C 1 227 ? -14.681 10.150  6.479   1.00 27.26  ? 238  SER C OG  1 
ATOM   7681  N N   . LEU C 1 228 ? -12.869 10.232  3.829   1.00 43.74  ? 239  LEU C N   1 
ATOM   7682  C CA  . LEU C 1 228 ? -12.589 9.003   3.121   1.00 43.74  ? 239  LEU C CA  1 
ATOM   7683  C C   . LEU C 1 228 ? -11.681 8.181   4.028   1.00 43.74  ? 239  LEU C C   1 
ATOM   7684  O O   . LEU C 1 228 ? -10.663 8.663   4.523   1.00 43.74  ? 239  LEU C O   1 
ATOM   7685  C CB  . LEU C 1 228 ? -11.907 9.288   1.772   1.00 38.97  ? 239  LEU C CB  1 
ATOM   7686  C CG  . LEU C 1 228 ? -11.205 8.119   1.048   1.00 38.97  ? 239  LEU C CG  1 
ATOM   7687  C CD1 . LEU C 1 228 ? -12.142 6.919   0.879   1.00 38.97  ? 239  LEU C CD1 1 
ATOM   7688  C CD2 . LEU C 1 228 ? -10.701 8.610   -0.281  1.00 38.97  ? 239  LEU C CD2 1 
ATOM   7689  N N   . VAL C 1 229 ? -12.088 6.947   4.268   1.00 41.88  ? 240  VAL C N   1 
ATOM   7690  C CA  . VAL C 1 229 ? -11.331 6.024   5.088   1.00 41.88  ? 240  VAL C CA  1 
ATOM   7691  C C   . VAL C 1 229 ? -10.913 4.910   4.133   1.00 41.88  ? 240  VAL C C   1 
ATOM   7692  O O   . VAL C 1 229 ? -11.708 4.018   3.814   1.00 41.88  ? 240  VAL C O   1 
ATOM   7693  C CB  . VAL C 1 229 ? -12.206 5.456   6.209   1.00 38.76  ? 240  VAL C CB  1 
ATOM   7694  C CG1 . VAL C 1 229 ? -11.529 4.302   6.859   1.00 38.76  ? 240  VAL C CG1 1 
ATOM   7695  C CG2 . VAL C 1 229 ? -12.477 6.523   7.230   1.00 38.76  ? 240  VAL C CG2 1 
ATOM   7696  N N   . TRP C 1 230 ? -9.660  4.997   3.682   1.00 56.01  ? 241  TRP C N   1 
ATOM   7697  C CA  . TRP C 1 230 ? -9.026  4.082   2.728   1.00 56.01  ? 241  TRP C CA  1 
ATOM   7698  C C   . TRP C 1 230 ? -8.297  2.933   3.439   1.00 56.01  ? 241  TRP C C   1 
ATOM   7699  O O   . TRP C 1 230 ? -7.273  3.147   4.075   1.00 56.01  ? 241  TRP C O   1 
ATOM   7700  C CB  . TRP C 1 230 ? -8.014  4.895   1.923   1.00 76.97  ? 241  TRP C CB  1 
ATOM   7701  C CG  . TRP C 1 230 ? -7.592  4.377   0.581   1.00 76.97  ? 241  TRP C CG  1 
ATOM   7702  C CD1 . TRP C 1 230 ? -6.355  4.516   0.020   1.00 76.97  ? 241  TRP C CD1 1 
ATOM   7703  C CD2 . TRP C 1 230 ? -8.422  3.786   -0.431  1.00 76.97  ? 241  TRP C CD2 1 
ATOM   7704  N NE1 . TRP C 1 230 ? -6.363  4.063   -1.274  1.00 76.97  ? 241  TRP C NE1 1 
ATOM   7705  C CE2 . TRP C 1 230 ? -7.617  3.608   -1.579  1.00 76.97  ? 241  TRP C CE2 1 
ATOM   7706  C CE3 . TRP C 1 230 ? -9.766  3.394   -0.482  1.00 76.97  ? 241  TRP C CE3 1 
ATOM   7707  C CZ2 . TRP C 1 230 ? -8.110  3.057   -2.764  1.00 76.97  ? 241  TRP C CZ2 1 
ATOM   7708  C CZ3 . TRP C 1 230 ? -10.257 2.846   -1.666  1.00 76.97  ? 241  TRP C CZ3 1 
ATOM   7709  C CH2 . TRP C 1 230 ? -9.426  2.684   -2.789  1.00 76.97  ? 241  TRP C CH2 1 
ATOM   7710  N N   . PHE C 1 231 ? -8.816  1.716   3.337   1.00 57.33  ? 242  PHE C N   1 
ATOM   7711  C CA  . PHE C 1 231 ? -8.170  0.561   3.960   1.00 57.33  ? 242  PHE C CA  1 
ATOM   7712  C C   . PHE C 1 231 ? -7.226  0.027   2.918   1.00 57.33  ? 242  PHE C C   1 
ATOM   7713  O O   . PHE C 1 231 ? -7.590  -0.053  1.758   1.00 57.33  ? 242  PHE C O   1 
ATOM   7714  C CB  . PHE C 1 231 ? -9.202  -0.501  4.302   1.00 77.82  ? 242  PHE C CB  1 
ATOM   7715  C CG  . PHE C 1 231 ? -10.215 -0.045  5.298   1.00 77.82  ? 242  PHE C CG  1 
ATOM   7716  C CD1 . PHE C 1 231 ? -9.870  0.111   6.628   1.00 77.82  ? 242  PHE C CD1 1 
ATOM   7717  C CD2 . PHE C 1 231 ? -11.507 0.267   4.900   1.00 77.82  ? 242  PHE C CD2 1 
ATOM   7718  C CE1 . PHE C 1 231 ? -10.796 0.569   7.547   1.00 77.82  ? 242  PHE C CE1 1 
ATOM   7719  C CE2 . PHE C 1 231 ? -12.440 0.727   5.811   1.00 77.82  ? 242  PHE C CE2 1 
ATOM   7720  C CZ  . PHE C 1 231 ? -12.083 0.879   7.138   1.00 77.82  ? 242  PHE C CZ  1 
ATOM   7721  N N   . THR C 1 232 ? -6.011  -0.333  3.303   1.00 64.42  ? 243  THR C N   1 
ATOM   7722  C CA  . THR C 1 232 ? -5.060  -0.825  2.310   1.00 64.42  ? 243  THR C CA  1 
ATOM   7723  C C   . THR C 1 232 ? -4.061  -1.789  2.890   1.00 64.42  ? 243  THR C C   1 
ATOM   7724  O O   . THR C 1 232 ? -3.939  -1.912  4.099   1.00 64.42  ? 243  THR C O   1 
ATOM   7725  C CB  . THR C 1 232 ? -4.234  0.312   1.692   1.00 69.10  ? 243  THR C CB  1 
ATOM   7726  O OG1 . THR C 1 232 ? -3.308  0.800   2.671   1.00 69.10  ? 243  THR C OG1 1 
ATOM   7727  C CG2 . THR C 1 232 ? -5.138  1.444   1.208   1.00 69.10  ? 243  THR C CG2 1 
ATOM   7728  N N   . PRO C 1 233 ? -3.326  -2.493  2.024   1.00 60.58  ? 244  PRO C N   1 
ATOM   7729  C CA  . PRO C 1 233 ? -2.336  -3.435  2.530   1.00 60.58  ? 244  PRO C CA  1 
ATOM   7730  C C   . PRO C 1 233 ? -1.160  -2.589  2.972   1.00 60.58  ? 244  PRO C C   1 
ATOM   7731  O O   . PRO C 1 233 ? -0.913  -1.516  2.403   1.00 60.58  ? 244  PRO C O   1 
ATOM   7732  C CB  . PRO C 1 233 ? -2.016  -4.279  1.308   1.00 81.51  ? 244  PRO C CB  1 
ATOM   7733  C CG  . PRO C 1 233 ? -2.081  -3.272  0.220   1.00 81.51  ? 244  PRO C CG  1 
ATOM   7734  C CD  . PRO C 1 233 ? -3.354  -2.520  0.552   1.00 81.51  ? 244  PRO C CD  1 
ATOM   7735  N N   . PRO C 1 234 ? -0.441  -3.043  4.014   1.00 74.51  ? 245  PRO C N   1 
ATOM   7736  C CA  . PRO C 1 234 ? 0.728   -2.352  4.570   1.00 74.51  ? 245  PRO C CA  1 
ATOM   7737  C C   . PRO C 1 234 ? 1.760   -2.093  3.476   1.00 74.51  ? 245  PRO C C   1 
ATOM   7738  O O   . PRO C 1 234 ? 2.389   -1.030  3.420   1.00 74.51  ? 245  PRO C O   1 
ATOM   7739  C CB  . PRO C 1 234 ? 1.221   -3.331  5.627   1.00 43.41  ? 245  PRO C CB  1 
ATOM   7740  C CG  . PRO C 1 234 ? -0.062  -3.960  6.116   1.00 43.41  ? 245  PRO C CG  1 
ATOM   7741  C CD  . PRO C 1 234 ? -0.770  -4.241  4.811   1.00 43.41  ? 245  PRO C CD  1 
ATOM   7742  N N   . ARG C 1 235 ? 1.918   -3.091  2.613   1.00 54.47  ? 246  ARG C N   1 
ATOM   7743  C CA  . ARG C 1 235 ? 2.825   -3.021  1.488   1.00 54.47  ? 246  ARG C CA  1 
ATOM   7744  C C   . ARG C 1 235 ? 2.757   -1.631  0.840   1.00 54.47  ? 246  ARG C C   1 
ATOM   7745  O O   . ARG C 1 235 ? 3.761   -0.922  0.778   1.00 54.47  ? 246  ARG C O   1 
ATOM   7746  C CB  . ARG C 1 235 ? 2.441   -4.114  0.484   1.00 89.21  ? 246  ARG C CB  1 
ATOM   7747  C CG  . ARG C 1 235 ? 3.243   -4.136  -0.807  1.00 89.21  ? 246  ARG C CG  1 
ATOM   7748  C CD  . ARG C 1 235 ? 3.109   -5.484  -1.520  1.00 89.21  ? 246  ARG C CD  1 
ATOM   7749  N NE  . ARG C 1 235 ? 1.790   -5.723  -2.097  1.00 89.21  ? 246  ARG C NE  1 
ATOM   7750  C CZ  . ARG C 1 235 ? 1.339   -5.127  -3.197  1.00 89.21  ? 246  ARG C CZ  1 
ATOM   7751  N NH1 . ARG C 1 235 ? 2.102   -4.251  -3.843  1.00 89.21  ? 246  ARG C NH1 1 
ATOM   7752  N NH2 . ARG C 1 235 ? 0.131   -5.417  -3.666  1.00 89.21  ? 246  ARG C NH2 1 
ATOM   7753  N N   . THR C 1 236 ? 1.567   -1.232  0.391   1.00 46.75  ? 247  THR C N   1 
ATOM   7754  C CA  . THR C 1 236 ? 1.378   0.061   -0.275  1.00 46.75  ? 247  THR C CA  1 
ATOM   7755  C C   . THR C 1 236 ? 0.892   1.224   0.587   1.00 46.75  ? 247  THR C C   1 
ATOM   7756  O O   . THR C 1 236 ? 0.675   2.328   0.069   1.00 46.75  ? 247  THR C O   1 
ATOM   7757  C CB  . THR C 1 236 ? 0.403   -0.063  -1.449  1.00 69.95  ? 247  THR C CB  1 
ATOM   7758  O OG1 . THR C 1 236 ? -0.232  -1.347  -1.412  1.00 69.95  ? 247  THR C OG1 1 
ATOM   7759  C CG2 . THR C 1 236 ? 1.135   0.123   -2.764  1.00 69.95  ? 247  THR C CG2 1 
ATOM   7760  N N   . SER C 1 237 ? 0.734   0.981   1.889   1.00 70.09  ? 248  SER C N   1 
ATOM   7761  C CA  . SER C 1 237 ? 0.265   2.004   2.826   1.00 70.09  ? 248  SER C CA  1 
ATOM   7762  C C   . SER C 1 237 ? 0.870   3.366   2.525   1.00 70.09  ? 248  SER C C   1 
ATOM   7763  O O   . SER C 1 237 ? 0.155   4.361   2.439   1.00 70.09  ? 248  SER C O   1 
ATOM   7764  C CB  . SER C 1 237 ? 0.596   1.607   4.270   1.00 76.99  ? 248  SER C CB  1 
ATOM   7765  O OG  . SER C 1 237 ? -0.049  2.458   5.210   1.00 76.99  ? 248  SER C OG  1 
ATOM   7766  N N   . ASN C 1 238 ? 2.186   3.406   2.363   1.00 60.75  ? 249  ASN C N   1 
ATOM   7767  C CA  . ASN C 1 238 ? 2.888   4.650   2.063   1.00 60.75  ? 249  ASN C CA  1 
ATOM   7768  C C   . ASN C 1 238 ? 2.494   5.193   0.678   1.00 60.75  ? 249  ASN C C   1 
ATOM   7769  O O   . ASN C 1 238 ? 2.228   6.396   0.501   1.00 60.75  ? 249  ASN C O   1 
ATOM   7770  C CB  . ASN C 1 238 ? 4.401   4.412   2.095   1.00 201.99 ? 249  ASN C CB  1 
ATOM   7771  C CG  . ASN C 1 238 ? 4.843   3.325   1.124   1.00 201.99 ? 249  ASN C CG  1 
ATOM   7772  O OD1 . ASN C 1 238 ? 4.498   2.154   1.286   1.00 201.99 ? 249  ASN C OD1 1 
ATOM   7773  N ND2 . ASN C 1 238 ? 5.605   3.712   0.105   1.00 201.99 ? 249  ASN C ND2 1 
ATOM   7774  N N   . GLN C 1 239 ? 2.469   4.294   -0.303  1.00 75.07  ? 250  GLN C N   1 
ATOM   7775  C CA  . GLN C 1 239 ? 2.129   4.668   -1.666  1.00 75.07  ? 250  GLN C CA  1 
ATOM   7776  C C   . GLN C 1 239 ? 0.826   5.463   -1.698  1.00 75.07  ? 250  GLN C C   1 
ATOM   7777  O O   . GLN C 1 239 ? 0.809   6.617   -2.119  1.00 75.07  ? 250  GLN C O   1 
ATOM   7778  C CB  . GLN C 1 239 ? 2.002   3.413   -2.539  1.00 199.00 ? 250  GLN C CB  1 
ATOM   7779  C CG  . GLN C 1 239 ? 1.965   3.685   -4.044  1.00 199.00 ? 250  GLN C CG  1 
ATOM   7780  C CD  . GLN C 1 239 ? 3.329   4.048   -4.619  1.00 199.00 ? 250  GLN C CD  1 
ATOM   7781  O OE1 . GLN C 1 239 ? 4.023   4.927   -4.105  1.00 199.00 ? 250  GLN C OE1 1 
ATOM   7782  N NE2 . GLN C 1 239 ? 3.712   3.373   -5.699  1.00 199.00 ? 250  GLN C NE2 1 
ATOM   7783  N N   . TRP C 1 240 ? -0.256  4.841   -1.236  1.00 62.18  ? 251  TRP C N   1 
ATOM   7784  C CA  . TRP C 1 240 ? -1.569  5.478   -1.219  1.00 62.18  ? 251  TRP C CA  1 
ATOM   7785  C C   . TRP C 1 240 ? -1.630  6.857   -0.582  1.00 62.18  ? 251  TRP C C   1 
ATOM   7786  O O   . TRP C 1 240 ? -2.069  7.814   -1.234  1.00 62.18  ? 251  TRP C O   1 
ATOM   7787  C CB  . TRP C 1 240 ? -2.586  4.561   -0.550  1.00 45.19  ? 251  TRP C CB  1 
ATOM   7788  C CG  . TRP C 1 240 ? -2.985  3.437   -1.437  1.00 45.19  ? 251  TRP C CG  1 
ATOM   7789  C CD1 . TRP C 1 240 ? -2.781  2.098   -1.223  1.00 45.19  ? 251  TRP C CD1 1 
ATOM   7790  C CD2 . TRP C 1 240 ? -3.638  3.545   -2.706  1.00 45.19  ? 251  TRP C CD2 1 
ATOM   7791  N NE1 . TRP C 1 240 ? -3.270  1.365   -2.288  1.00 45.19  ? 251  TRP C NE1 1 
ATOM   7792  C CE2 . TRP C 1 240 ? -3.800  2.230   -3.209  1.00 45.19  ? 251  TRP C CE2 1 
ATOM   7793  C CE3 . TRP C 1 240 ? -4.105  4.629   -3.469  1.00 45.19  ? 251  TRP C CE3 1 
ATOM   7794  C CZ2 . TRP C 1 240 ? -4.406  1.970   -4.433  1.00 45.19  ? 251  TRP C CZ2 1 
ATOM   7795  C CZ3 . TRP C 1 240 ? -4.710  4.376   -4.685  1.00 45.19  ? 251  TRP C CZ3 1 
ATOM   7796  C CH2 . TRP C 1 240 ? -4.856  3.053   -5.157  1.00 45.19  ? 251  TRP C CH2 1 
ATOM   7797  N N   . LEU C 1 241 ? -1.201  6.964   0.679   1.00 29.88  ? 252  LEU C N   1 
ATOM   7798  C CA  . LEU C 1 241 ? -1.213  8.245   1.389   1.00 29.88  ? 252  LEU C CA  1 
ATOM   7799  C C   . LEU C 1 241 ? -0.706  9.366   0.487   1.00 29.88  ? 252  LEU C C   1 
ATOM   7800  O O   . LEU C 1 241 ? -1.282  10.447  0.444   1.00 29.88  ? 252  LEU C O   1 
ATOM   7801  C CB  . LEU C 1 241 ? -0.357  8.156   2.652   1.00 41.51  ? 252  LEU C CB  1 
ATOM   7802  C CG  . LEU C 1 241 ? -0.384  9.309   3.676   1.00 41.51  ? 252  LEU C CG  1 
ATOM   7803  C CD1 . LEU C 1 241 ? 0.473   10.464  3.192   1.00 41.51  ? 252  LEU C CD1 1 
ATOM   7804  C CD2 . LEU C 1 241 ? -1.818  9.762   3.952   1.00 41.51  ? 252  LEU C CD2 1 
ATOM   7805  N N   . ASP C 1 242 ? 0.361   9.088   -0.255  1.00 70.68  ? 253  ASP C N   1 
ATOM   7806  C CA  . ASP C 1 242 ? 0.941   10.074  -1.161  1.00 70.68  ? 253  ASP C CA  1 
ATOM   7807  C C   . ASP C 1 242 ? -0.018  10.448  -2.279  1.00 70.68  ? 253  ASP C C   1 
ATOM   7808  O O   . ASP C 1 242 ? -0.180  11.623  -2.594  1.00 70.68  ? 253  ASP C O   1 
ATOM   7809  C CB  . ASP C 1 242 ? 2.235   9.537   -1.771  1.00 201.99 ? 253  ASP C CB  1 
ATOM   7810  C CG  . ASP C 1 242 ? 3.199   9.019   -0.725  1.00 201.99 ? 253  ASP C CG  1 
ATOM   7811  O OD1 . ASP C 1 242 ? 3.503   9.767   0.230   1.00 201.99 ? 253  ASP C OD1 1 
ATOM   7812  O OD2 . ASP C 1 242 ? 3.656   7.864   -0.860  1.00 201.99 ? 253  ASP C OD2 1 
ATOM   7813  N N   . PHE C 1 243 ? -0.665  9.448   -2.873  1.00 56.06  ? 254  PHE C N   1 
ATOM   7814  C CA  . PHE C 1 243 ? -1.582  9.717   -3.968  1.00 56.06  ? 254  PHE C CA  1 
ATOM   7815  C C   . PHE C 1 243 ? -2.741  10.595  -3.529  1.00 56.06  ? 254  PHE C C   1 
ATOM   7816  O O   . PHE C 1 243 ? -3.102  11.554  -4.211  1.00 56.06  ? 254  PHE C O   1 
ATOM   7817  C CB  . PHE C 1 243 ? -2.112  8.419   -4.583  1.00 64.09  ? 254  PHE C CB  1 
ATOM   7818  C CG  . PHE C 1 243 ? -3.008  8.651   -5.769  1.00 64.09  ? 254  PHE C CG  1 
ATOM   7819  C CD1 . PHE C 1 243 ? -2.591  9.460   -6.814  1.00 64.09  ? 254  PHE C CD1 1 
ATOM   7820  C CD2 . PHE C 1 243 ? -4.300  8.129   -5.807  1.00 64.09  ? 254  PHE C CD2 1 
ATOM   7821  C CE1 . PHE C 1 243 ? -3.440  9.753   -7.863  1.00 64.09  ? 254  PHE C CE1 1 
ATOM   7822  C CE2 . PHE C 1 243 ? -5.158  8.423   -6.866  1.00 64.09  ? 254  PHE C CE2 1 
ATOM   7823  C CZ  . PHE C 1 243 ? -4.724  9.237   -7.890  1.00 64.09  ? 254  PHE C CZ  1 
ATOM   7824  N N   . TRP C 1 244 ? -3.324  10.275  -2.382  1.00 63.24  ? 255  TRP C N   1 
ATOM   7825  C CA  . TRP C 1 244 ? -4.432  11.069  -1.886  1.00 63.24  ? 255  TRP C CA  1 
ATOM   7826  C C   . TRP C 1 244 ? -4.033  12.524  -1.698  1.00 63.24  ? 255  TRP C C   1 
ATOM   7827  O O   . TRP C 1 244 ? -4.688  13.412  -2.228  1.00 63.24  ? 255  TRP C O   1 
ATOM   7828  C CB  . TRP C 1 244 ? -4.989  10.450  -0.599  1.00 42.56  ? 255  TRP C CB  1 
ATOM   7829  C CG  . TRP C 1 244 ? -5.804  9.234   -0.924  1.00 42.56  ? 255  TRP C CG  1 
ATOM   7830  C CD1 . TRP C 1 244 ? -5.515  7.924   -0.624  1.00 42.56  ? 255  TRP C CD1 1 
ATOM   7831  C CD2 . TRP C 1 244 ? -6.966  9.202   -1.756  1.00 42.56  ? 255  TRP C CD2 1 
ATOM   7832  N NE1 . TRP C 1 244 ? -6.423  7.083   -1.231  1.00 42.56  ? 255  TRP C NE1 1 
ATOM   7833  C CE2 . TRP C 1 244 ? -7.322  7.842   -1.932  1.00 42.56  ? 255  TRP C CE2 1 
ATOM   7834  C CE3 . TRP C 1 244 ? -7.740  10.195  -2.379  1.00 42.56  ? 255  TRP C CE3 1 
ATOM   7835  C CZ2 . TRP C 1 244 ? -8.414  7.454   -2.704  1.00 42.56  ? 255  TRP C CZ2 1 
ATOM   7836  C CZ3 . TRP C 1 244 ? -8.823  9.811   -3.147  1.00 42.56  ? 255  TRP C CZ3 1 
ATOM   7837  C CH2 . TRP C 1 244 ? -9.152  8.452   -3.306  1.00 42.56  ? 255  TRP C CH2 1 
ATOM   7838  N N   . LEU C 1 245 ? -2.948  12.773  -0.975  1.00 61.15  ? 256  LEU C N   1 
ATOM   7839  C CA  . LEU C 1 245 ? -2.486  14.141  -0.761  1.00 61.15  ? 256  LEU C CA  1 
ATOM   7840  C C   . LEU C 1 245 ? -2.418  14.905  -2.068  1.00 61.15  ? 256  LEU C C   1 
ATOM   7841  O O   . LEU C 1 245 ? -2.931  16.020  -2.173  1.00 61.15  ? 256  LEU C O   1 
ATOM   7842  C CB  . LEU C 1 245 ? -1.100  14.154  -0.134  1.00 72.07  ? 256  LEU C CB  1 
ATOM   7843  C CG  . LEU C 1 245 ? -0.342  15.462  -0.374  1.00 72.07  ? 256  LEU C CG  1 
ATOM   7844  C CD1 . LEU C 1 245 ? -1.048  16.615  0.297   1.00 72.07  ? 256  LEU C CD1 1 
ATOM   7845  C CD2 . LEU C 1 245 ? 1.068   15.320  0.153   1.00 72.07  ? 256  LEU C CD2 1 
ATOM   7846  N N   . ARG C 1 246 ? -1.757  14.307  -3.055  1.00 97.38  ? 257  ARG C N   1 
ATOM   7847  C CA  . ARG C 1 246 ? -1.625  14.929  -4.367  1.00 97.38  ? 257  ARG C CA  1 
ATOM   7848  C C   . ARG C 1 246 ? -3.016  15.058  -5.000  1.00 97.38  ? 257  ARG C C   1 
ATOM   7849  O O   . ARG C 1 246 ? -3.375  16.117  -5.532  1.00 97.38  ? 257  ARG C O   1 
ATOM   7850  C CB  . ARG C 1 246 ? -0.684  14.094  -5.252  1.00 111.01 ? 257  ARG C CB  1 
ATOM   7851  C CG  . ARG C 1 246 ? -0.873  12.589  -5.103  1.00 111.01 ? 257  ARG C CG  1 
ATOM   7852  C CD  . ARG C 1 246 ? -0.066  11.723  -6.091  1.00 111.01 ? 257  ARG C CD  1 
ATOM   7853  N NE  . ARG C 1 246 ? 1.346   11.598  -5.748  1.00 111.01 ? 257  ARG C NE  1 
ATOM   7854  C CZ  . ARG C 1 246 ? 2.253   12.533  -5.993  1.00 111.01 ? 257  ARG C CZ  1 
ATOM   7855  N NH1 . ARG C 1 246 ? 3.515   12.335  -5.644  1.00 111.01 ? 257  ARG C NH1 1 
ATOM   7856  N NH2 . ARG C 1 246 ? 1.900   13.658  -6.600  1.00 111.01 ? 257  ARG C NH2 1 
ATOM   7857  N N   . HIS C 1 247 ? -3.800  13.981  -4.922  1.00 57.67  ? 258  HIS C N   1 
ATOM   7858  C CA  . HIS C 1 247 ? -5.151  13.979  -5.463  1.00 57.67  ? 258  HIS C CA  1 
ATOM   7859  C C   . HIS C 1 247 ? -5.897  15.131  -4.824  1.00 57.67  ? 258  HIS C C   1 
ATOM   7860  O O   . HIS C 1 247 ? -6.165  16.136  -5.471  1.00 57.67  ? 258  HIS C O   1 
ATOM   7861  C CB  . HIS C 1 247 ? -5.852  12.663  -5.139  1.00 63.52  ? 258  HIS C CB  1 
ATOM   7862  C CG  . HIS C 1 247 ? -7.273  12.601  -5.612  1.00 63.52  ? 258  HIS C CG  1 
ATOM   7863  N ND1 . HIS C 1 247 ? -8.279  13.361  -5.055  1.00 63.52  ? 258  HIS C ND1 1 
ATOM   7864  C CD2 . HIS C 1 247 ? -7.858  11.861  -6.586  1.00 63.52  ? 258  HIS C CD2 1 
ATOM   7865  C CE1 . HIS C 1 247 ? -9.421  13.090  -5.663  1.00 63.52  ? 258  HIS C CE1 1 
ATOM   7866  N NE2 . HIS C 1 247 ? -9.193  12.182  -6.595  1.00 63.52  ? 258  HIS C NE2 1 
ATOM   7867  N N   . ARG C 1 248 ? -6.204  14.981  -3.541  1.00 55.95  ? 259  ARG C N   1 
ATOM   7868  C CA  . ARG C 1 248 ? -6.921  16.001  -2.785  1.00 55.95  ? 259  ARG C CA  1 
ATOM   7869  C C   . ARG C 1 248 ? -6.415  17.407  -3.088  1.00 55.95  ? 259  ARG C C   1 
ATOM   7870  O O   . ARG C 1 248 ? -7.167  18.259  -3.552  1.00 55.95  ? 259  ARG C O   1 
ATOM   7871  C CB  . ARG C 1 248 ? -6.800  15.746  -1.275  1.00 50.44  ? 259  ARG C CB  1 
ATOM   7872  C CG  . ARG C 1 248 ? -7.368  14.403  -0.770  1.00 50.44  ? 259  ARG C CG  1 
ATOM   7873  C CD  . ARG C 1 248 ? -8.891  14.292  -0.841  1.00 50.44  ? 259  ARG C CD  1 
ATOM   7874  N NE  . ARG C 1 248 ? -9.530  15.513  -0.373  1.00 50.44  ? 259  ARG C NE  1 
ATOM   7875  C CZ  . ARG C 1 248 ? -10.316 16.263  -1.135  1.00 50.44  ? 259  ARG C CZ  1 
ATOM   7876  N NH1 . ARG C 1 248 ? -10.561 15.897  -2.386  1.00 50.44  ? 259  ARG C NH1 1 
ATOM   7877  N NH2 . ARG C 1 248 ? -10.826 17.395  -0.670  1.00 50.44  ? 259  ARG C NH2 1 
ATOM   7878  N N   . LEU C 1 249 ? -5.135  17.644  -2.839  1.00 57.87  ? 260  LEU C N   1 
ATOM   7879  C CA  . LEU C 1 249 ? -4.551  18.962  -3.061  1.00 57.87  ? 260  LEU C CA  1 
ATOM   7880  C C   . LEU C 1 249 ? -4.812  19.558  -4.444  1.00 57.87  ? 260  LEU C C   1 
ATOM   7881  O O   . LEU C 1 249 ? -5.022  20.771  -4.574  1.00 57.87  ? 260  LEU C O   1 
ATOM   7882  C CB  . LEU C 1 249 ? -3.051  18.907  -2.787  1.00 42.39  ? 260  LEU C CB  1 
ATOM   7883  C CG  . LEU C 1 249 ? -2.336  20.247  -2.687  1.00 42.39  ? 260  LEU C CG  1 
ATOM   7884  C CD1 . LEU C 1 249 ? -3.025  21.154  -1.705  1.00 42.39  ? 260  LEU C CD1 1 
ATOM   7885  C CD2 . LEU C 1 249 ? -0.931  19.984  -2.241  1.00 42.39  ? 260  LEU C CD2 1 
ATOM   7886  N N   . GLN C 1 250 ? -4.793  18.713  -5.475  1.00 82.19  ? 261  GLN C N   1 
ATOM   7887  C CA  . GLN C 1 250 ? -5.047  19.171  -6.844  1.00 82.19  ? 261  GLN C CA  1 
ATOM   7888  C C   . GLN C 1 250 ? -6.493  19.637  -6.939  1.00 82.19  ? 261  GLN C C   1 
ATOM   7889  O O   . GLN C 1 250 ? -6.797  20.666  -7.544  1.00 82.19  ? 261  GLN C O   1 
ATOM   7890  C CB  . GLN C 1 250 ? -4.815  18.036  -7.846  1.00 201.99 ? 261  GLN C CB  1 
ATOM   7891  C CG  . GLN C 1 250 ? -5.123  18.419  -9.291  1.00 201.99 ? 261  GLN C CG  1 
ATOM   7892  C CD  . GLN C 1 250 ? -5.019  17.246  -10.250 1.00 201.99 ? 261  GLN C CD  1 
ATOM   7893  O OE1 . GLN C 1 250 ? -3.957  16.642  -10.405 1.00 201.99 ? 261  GLN C OE1 1 
ATOM   7894  N NE2 . GLN C 1 250 ? -6.127  16.921  -10.902 1.00 201.99 ? 261  GLN C NE2 1 
ATOM   7895  N N   . TRP C 1 251 ? -7.372  18.851  -6.319  1.00 55.61  ? 262  TRP C N   1 
ATOM   7896  C CA  . TRP C 1 251 ? -8.798  19.112  -6.284  1.00 55.61  ? 262  TRP C CA  1 
ATOM   7897  C C   . TRP C 1 251 ? -9.087  20.521  -5.784  1.00 55.61  ? 262  TRP C C   1 
ATOM   7898  O O   . TRP C 1 251 ? -9.740  21.286  -6.477  1.00 55.61  ? 262  TRP C O   1 
ATOM   7899  C CB  . TRP C 1 251 ? -9.489  18.075  -5.400  1.00 52.64  ? 262  TRP C CB  1 
ATOM   7900  C CG  . TRP C 1 251 ? -10.982 18.152  -5.463  1.00 52.64  ? 262  TRP C CG  1 
ATOM   7901  C CD1 . TRP C 1 251 ? -11.778 17.764  -6.496  1.00 52.64  ? 262  TRP C CD1 1 
ATOM   7902  C CD2 . TRP C 1 251 ? -11.849 18.748  -4.492  1.00 52.64  ? 262  TRP C CD2 1 
ATOM   7903  N NE1 . TRP C 1 251 ? -13.080 18.091  -6.237  1.00 52.64  ? 262  TRP C NE1 1 
ATOM   7904  C CE2 . TRP C 1 251 ? -13.150 18.697  -5.013  1.00 52.64  ? 262  TRP C CE2 1 
ATOM   7905  C CE3 . TRP C 1 251 ? -11.644 19.327  -3.233  1.00 52.64  ? 262  TRP C CE3 1 
ATOM   7906  C CZ2 . TRP C 1 251 ? -14.241 19.200  -4.328  1.00 52.64  ? 262  TRP C CZ2 1 
ATOM   7907  C CZ3 . TRP C 1 251 ? -12.722 19.825  -2.556  1.00 52.64  ? 262  TRP C CZ3 1 
ATOM   7908  C CH2 . TRP C 1 251 ? -14.010 19.760  -3.104  1.00 52.64  ? 262  TRP C CH2 1 
ATOM   7909  N N   . TRP C 1 252 ? -8.599  20.885  -4.600  1.00 37.87  ? 263  TRP C N   1 
ATOM   7910  C CA  . TRP C 1 252 ? -8.853  22.236  -4.092  1.00 37.87  ? 263  TRP C CA  1 
ATOM   7911  C C   . TRP C 1 252 ? -8.365  23.283  -5.074  1.00 37.87  ? 263  TRP C C   1 
ATOM   7912  O O   . TRP C 1 252 ? -9.102  24.209  -5.415  1.00 37.87  ? 263  TRP C O   1 
ATOM   7913  C CB  . TRP C 1 252 ? -8.164  22.490  -2.755  1.00 35.99  ? 263  TRP C CB  1 
ATOM   7914  C CG  . TRP C 1 252 ? -8.649  21.658  -1.622  1.00 35.99  ? 263  TRP C CG  1 
ATOM   7915  C CD1 . TRP C 1 252 ? -8.159  20.442  -1.227  1.00 35.99  ? 263  TRP C CD1 1 
ATOM   7916  C CD2 . TRP C 1 252 ? -9.669  22.003  -0.683  1.00 35.99  ? 263  TRP C CD2 1 
ATOM   7917  N NE1 . TRP C 1 252 ? -8.806  20.019  -0.092  1.00 35.99  ? 263  TRP C NE1 1 
ATOM   7918  C CE2 . TRP C 1 252 ? -9.736  20.958  0.263   1.00 35.99  ? 263  TRP C CE2 1 
ATOM   7919  C CE3 . TRP C 1 252 ? -10.528 23.093  -0.545  1.00 35.99  ? 263  TRP C CE3 1 
ATOM   7920  C CZ2 . TRP C 1 252 ? -10.629 20.978  1.336   1.00 35.99  ? 263  TRP C CZ2 1 
ATOM   7921  C CZ3 . TRP C 1 252 ? -11.417 23.114  0.527   1.00 35.99  ? 263  TRP C CZ3 1 
ATOM   7922  C CH2 . TRP C 1 252 ? -11.458 22.064  1.452   1.00 35.99  ? 263  TRP C CH2 1 
ATOM   7923  N N   . ARG C 1 253 ? -7.119  23.129  -5.525  1.00 75.25  ? 264  ARG C N   1 
ATOM   7924  C CA  . ARG C 1 253 ? -6.503  24.061  -6.470  1.00 75.25  ? 264  ARG C CA  1 
ATOM   7925  C C   . ARG C 1 253 ? -7.343  24.251  -7.734  1.00 75.25  ? 264  ARG C C   1 
ATOM   7926  O O   . ARG C 1 253 ? -7.462  25.363  -8.255  1.00 75.25  ? 264  ARG C O   1 
ATOM   7927  C CB  . ARG C 1 253 ? -5.119  23.560  -6.880  1.00 86.55  ? 264  ARG C CB  1 
ATOM   7928  C CG  . ARG C 1 253 ? -4.081  23.508  -5.784  1.00 86.55  ? 264  ARG C CG  1 
ATOM   7929  C CD  . ARG C 1 253 ? -2.797  22.924  -6.361  1.00 86.55  ? 264  ARG C CD  1 
ATOM   7930  N NE  . ARG C 1 253 ? -1.702  22.830  -5.401  1.00 86.55  ? 264  ARG C NE  1 
ATOM   7931  C CZ  . ARG C 1 253 ? -1.211  23.868  -4.736  1.00 86.55  ? 264  ARG C CZ  1 
ATOM   7932  N NH1 . ARG C 1 253 ? -1.729  25.074  -4.929  1.00 86.55  ? 264  ARG C NH1 1 
ATOM   7933  N NH2 . ARG C 1 253 ? -0.193  23.707  -3.899  1.00 86.55  ? 264  ARG C NH2 1 
ATOM   7934  N N   . LYS C 1 254 ? -7.911  23.145  -8.211  1.00 72.14  ? 265  LYS C N   1 
ATOM   7935  C CA  . LYS C 1 254 ? -8.726  23.113  -9.421  1.00 72.14  ? 265  LYS C CA  1 
ATOM   7936  C C   . LYS C 1 254 ? -9.810  24.173  -9.488  1.00 72.14  ? 265  LYS C C   1 
ATOM   7937  O O   . LYS C 1 254 ? -9.985  24.819  -10.523 1.00 72.14  ? 265  LYS C O   1 
ATOM   7938  C CB  . LYS C 1 254 ? -9.361  21.738  -9.577  1.00 79.02  ? 265  LYS C CB  1 
ATOM   7939  C CG  . LYS C 1 254 ? -10.234 21.612  -10.798 1.00 79.02  ? 265  LYS C CG  1 
ATOM   7940  C CD  . LYS C 1 254 ? -11.032 20.318  -10.777 1.00 79.02  ? 265  LYS C CD  1 
ATOM   7941  C CE  . LYS C 1 254 ? -10.120 19.100  -10.752 1.00 79.02  ? 265  LYS C CE  1 
ATOM   7942  N NZ  . LYS C 1 254 ? -10.901 17.833  -10.682 1.00 79.02  ? 265  LYS C NZ  1 
ATOM   7943  N N   . PHE C 1 255 ? -10.537 24.343  -8.387  1.00 50.07  ? 266  PHE C N   1 
ATOM   7944  C CA  . PHE C 1 255 ? -11.620 25.323  -8.305  1.00 50.07  ? 266  PHE C CA  1 
ATOM   7945  C C   . PHE C 1 255 ? -11.160 26.642  -7.683  1.00 50.07  ? 266  PHE C C   1 
ATOM   7946  O O   . PHE C 1 255 ? -11.973 27.411  -7.179  1.00 50.07  ? 266  PHE C O   1 
ATOM   7947  C CB  . PHE C 1 255 ? -12.772 24.758  -7.467  1.00 36.60  ? 266  PHE C CB  1 
ATOM   7948  C CG  . PHE C 1 255 ? -13.250 23.420  -7.924  1.00 36.60  ? 266  PHE C CG  1 
ATOM   7949  C CD1 . PHE C 1 255 ? -14.053 23.299  -9.040  1.00 36.60  ? 266  PHE C CD1 1 
ATOM   7950  C CD2 . PHE C 1 255 ? -12.851 22.264  -7.262  1.00 36.60  ? 266  PHE C CD2 1 
ATOM   7951  C CE1 . PHE C 1 255 ? -14.449 22.046  -9.495  1.00 36.60  ? 266  PHE C CE1 1 
ATOM   7952  C CE2 . PHE C 1 255 ? -13.241 20.993  -7.710  1.00 36.60  ? 266  PHE C CE2 1 
ATOM   7953  C CZ  . PHE C 1 255 ? -14.034 20.886  -8.823  1.00 36.60  ? 266  PHE C CZ  1 
ATOM   7954  N N   . ALA C 1 256 ? -9.861  26.915  -7.725  1.00 61.12  ? 267  ALA C N   1 
ATOM   7955  C CA  . ALA C 1 256 ? -9.342  28.137  -7.125  1.00 61.12  ? 267  ALA C CA  1 
ATOM   7956  C C   . ALA C 1 256 ? -8.855  29.177  -8.115  1.00 61.12  ? 267  ALA C C   1 
ATOM   7957  O O   . ALA C 1 256 ? -8.394  28.845  -9.200  1.00 61.12  ? 267  ALA C O   1 
ATOM   7958  C CB  . ALA C 1 256 ? -8.214  27.788  -6.163  1.00 82.02  ? 267  ALA C CB  1 
ATOM   7959  N N   . MET C 1 257 ? -8.973  30.445  -7.737  1.00 63.15  ? 268  MET C N   1 
ATOM   7960  C CA  . MET C 1 257 ? -8.480  31.530  -8.577  1.00 63.15  ? 268  MET C CA  1 
ATOM   7961  C C   . MET C 1 257 ? -6.971  31.548  -8.328  1.00 63.15  ? 268  MET C C   1 
ATOM   7962  O O   . MET C 1 257 ? -6.161  31.431  -9.246  1.00 63.15  ? 268  MET C O   1 
ATOM   7963  C CB  . MET C 1 257 ? -9.083  32.872  -8.147  1.00 98.91  ? 268  MET C CB  1 
ATOM   7964  C CG  . MET C 1 257 ? -10.397 33.249  -8.823  1.00 98.91  ? 268  MET C CG  1 
ATOM   7965  S SD  . MET C 1 257 ? -10.229 34.044  -10.443 1.00 98.91  ? 268  MET C SD  1 
ATOM   7966  C CE  . MET C 1 257 ? -10.477 32.648  -11.540 1.00 98.91  ? 268  MET C CE  1 
ATOM   7967  N N   . SER C 1 258 ? -6.612  31.665  -7.056  1.00 54.19  ? 269  SER C N   1 
ATOM   7968  C CA  . SER C 1 258 ? -5.220  31.705  -6.635  1.00 54.19  ? 269  SER C CA  1 
ATOM   7969  C C   . SER C 1 258 ? -4.755  30.393  -5.989  1.00 54.19  ? 269  SER C C   1 
ATOM   7970  O O   . SER C 1 258 ? -4.524  30.333  -4.779  1.00 54.19  ? 269  SER C O   1 
ATOM   7971  C CB  . SER C 1 258 ? -5.026  32.855  -5.647  1.00 49.15  ? 269  SER C CB  1 
ATOM   7972  O OG  . SER C 1 258 ? -5.519  34.065  -6.190  1.00 49.15  ? 269  SER C OG  1 
ATOM   7973  N N   . PRO C 1 259 ? -4.610  29.322  -6.786  1.00 65.29  ? 270  PRO C N   1 
ATOM   7974  C CA  . PRO C 1 259 ? -4.164  28.066  -6.182  1.00 65.29  ? 270  PRO C CA  1 
ATOM   7975  C C   . PRO C 1 259 ? -2.921  28.264  -5.344  1.00 65.29  ? 270  PRO C C   1 
ATOM   7976  O O   . PRO C 1 259 ? -2.631  27.463  -4.465  1.00 65.29  ? 270  PRO C O   1 
ATOM   7977  C CB  . PRO C 1 259 ? -3.934  27.147  -7.390  1.00 39.18  ? 270  PRO C CB  1 
ATOM   7978  C CG  . PRO C 1 259 ? -3.794  28.083  -8.537  1.00 39.18  ? 270  PRO C CG  1 
ATOM   7979  C CD  . PRO C 1 259 ? -4.783  29.171  -8.236  1.00 39.18  ? 270  PRO C CD  1 
ATOM   7980  N N   . SER C 1 260 ? -2.200  29.347  -5.609  1.00 103.64 ? 271  SER C N   1 
ATOM   7981  C CA  . SER C 1 260 ? -0.987  29.661  -4.869  1.00 103.64 ? 271  SER C CA  1 
ATOM   7982  C C   . SER C 1 260 ? -1.299  29.949  -3.399  1.00 103.64 ? 271  SER C C   1 
ATOM   7983  O O   . SER C 1 260 ? -0.417  30.343  -2.638  1.00 103.64 ? 271  SER C O   1 
ATOM   7984  C CB  . SER C 1 260 ? -0.296  30.864  -5.506  1.00 118.29 ? 271  SER C CB  1 
ATOM   7985  O OG  . SER C 1 260 ? -0.145  30.664  -6.902  1.00 118.29 ? 271  SER C OG  1 
ATOM   7986  N N   . ASN C 1 261 ? -2.559  29.759  -3.011  1.00 76.52  ? 272  ASN C N   1 
ATOM   7987  C CA  . ASN C 1 261 ? -2.988  29.968  -1.632  1.00 76.52  ? 272  ASN C CA  1 
ATOM   7988  C C   . ASN C 1 261 ? -3.277  28.628  -0.962  1.00 76.52  ? 272  ASN C C   1 
ATOM   7989  O O   . ASN C 1 261 ? -3.328  28.537  0.264   1.00 76.52  ? 272  ASN C O   1 
ATOM   7990  C CB  . ASN C 1 261 ? -4.247  30.829  -1.567  1.00 85.96  ? 272  ASN C CB  1 
ATOM   7991  C CG  . ASN C 1 261 ? -3.968  32.296  -1.778  1.00 85.96  ? 272  ASN C CG  1 
ATOM   7992  O OD1 . ASN C 1 261 ? -2.816  32.732  -1.754  1.00 85.96  ? 272  ASN C OD1 1 
ATOM   7993  N ND2 . ASN C 1 261 ? -5.033  33.077  -1.973  1.00 85.96  ? 272  ASN C ND2 1 
ATOM   7994  N N   . PHE C 1 262 ? -3.484  27.594  -1.771  1.00 69.69  ? 273  PHE C N   1 
ATOM   7995  C CA  . PHE C 1 262 ? -3.752  26.251  -1.261  1.00 69.69  ? 273  PHE C CA  1 
ATOM   7996  C C   . PHE C 1 262 ? -2.439  25.481  -1.142  1.00 69.69  ? 273  PHE C C   1 
ATOM   7997  O O   . PHE C 1 262 ? -1.826  25.128  -2.147  1.00 69.69  ? 273  PHE C O   1 
ATOM   7998  C CB  . PHE C 1 262 ? -4.715  25.525  -2.202  1.00 53.66  ? 273  PHE C CB  1 
ATOM   7999  C CG  . PHE C 1 262 ? -6.160  25.806  -1.915  1.00 53.66  ? 273  PHE C CG  1 
ATOM   8000  C CD1 . PHE C 1 262 ? -6.867  25.013  -1.010  1.00 53.66  ? 273  PHE C CD1 1 
ATOM   8001  C CD2 . PHE C 1 262 ? -6.799  26.897  -2.501  1.00 53.66  ? 273  PHE C CD2 1 
ATOM   8002  C CE1 . PHE C 1 262 ? -8.180  25.302  -0.687  1.00 53.66  ? 273  PHE C CE1 1 
ATOM   8003  C CE2 . PHE C 1 262 ? -8.118  27.199  -2.186  1.00 53.66  ? 273  PHE C CE2 1 
ATOM   8004  C CZ  . PHE C 1 262 ? -8.811  26.398  -1.272  1.00 53.66  ? 273  PHE C CZ  1 
ATOM   8005  N N   . SER C 1 263 ? -2.018  25.203  0.085   1.00 73.96  ? 274  SER C N   1 
ATOM   8006  C CA  . SER C 1 263 ? -0.753  24.516  0.307   1.00 73.96  ? 274  SER C CA  1 
ATOM   8007  C C   . SER C 1 263 ? -0.811  23.224  1.137   1.00 73.96  ? 274  SER C C   1 
ATOM   8008  O O   . SER C 1 263 ? -1.736  23.019  1.928   1.00 73.96  ? 274  SER C O   1 
ATOM   8009  C CB  . SER C 1 263 ? 0.210   25.512  0.950   1.00 49.72  ? 274  SER C CB  1 
ATOM   8010  O OG  . SER C 1 263 ? -0.514  26.407  1.788   1.00 49.72  ? 274  SER C OG  1 
ATOM   8011  N N   . SER C 1 264 ? 0.189   22.361  0.948   1.00 64.73  ? 275  SER C N   1 
ATOM   8012  C CA  . SER C 1 264 ? 0.286   21.092  1.674   1.00 64.73  ? 275  SER C CA  1 
ATOM   8013  C C   . SER C 1 264 ? 1.448   21.131  2.664   1.00 64.73  ? 275  SER C C   1 
ATOM   8014  O O   . SER C 1 264 ? 2.032   22.190  2.880   1.00 64.73  ? 275  SER C O   1 
ATOM   8015  C CB  . SER C 1 264 ? 0.493   19.934  0.701   1.00 85.43  ? 275  SER C CB  1 
ATOM   8016  O OG  . SER C 1 264 ? 1.677   20.113  -0.047  1.00 85.43  ? 275  SER C OG  1 
ATOM   8017  N N   . SER C 1 265 ? 1.780   19.988  3.263   1.00 81.66  ? 276  SER C N   1 
ATOM   8018  C CA  . SER C 1 265 ? 2.877   19.915  4.232   1.00 81.66  ? 276  SER C CA  1 
ATOM   8019  C C   . SER C 1 265 ? 2.868   18.584  4.982   1.00 81.66  ? 276  SER C C   1 
ATOM   8020  O O   . SER C 1 265 ? 1.804   18.046  5.281   1.00 81.66  ? 276  SER C O   1 
ATOM   8021  C CB  . SER C 1 265 ? 2.782   21.061  5.250   1.00 77.95  ? 276  SER C CB  1 
ATOM   8022  O OG  . SER C 1 265 ? 1.718   20.852  6.161   1.00 77.95  ? 276  SER C OG  1 
ATOM   8023  N N   . ASP C 1 266 ? 4.054   18.066  5.299   1.00 77.89  ? 277  ASP C N   1 
ATOM   8024  C CA  . ASP C 1 266 ? 4.170   16.790  6.001   1.00 77.89  ? 277  ASP C CA  1 
ATOM   8025  C C   . ASP C 1 266 ? 4.296   16.967  7.522   1.00 77.89  ? 277  ASP C C   1 
ATOM   8026  O O   . ASP C 1 266 ? 4.409   18.090  8.022   1.00 77.89  ? 277  ASP C O   1 
ATOM   8027  C CB  . ASP C 1 266 ? 5.385   15.996  5.482   1.00 103.64 ? 277  ASP C CB  1 
ATOM   8028  C CG  . ASP C 1 266 ? 5.427   15.889  3.958   1.00 103.64 ? 277  ASP C CG  1 
ATOM   8029  O OD1 . ASP C 1 266 ? 6.072   14.944  3.447   1.00 103.64 ? 277  ASP C OD1 1 
ATOM   8030  O OD2 . ASP C 1 266 ? 4.837   16.749  3.267   1.00 103.64 ? 277  ASP C OD2 1 
ATOM   8031  N N   . CYS C 1 267 ? 4.269   15.838  8.236   1.00 82.28  ? 278  CYS C N   1 
ATOM   8032  C CA  . CYS C 1 267 ? 4.393   15.775  9.698   1.00 82.28  ? 278  CYS C CA  1 
ATOM   8033  C C   . CYS C 1 267 ? 3.966   14.398  10.248  1.00 82.28  ? 278  CYS C C   1 
ATOM   8034  O O   . CYS C 1 267 ? 3.433   13.563  9.516   1.00 82.28  ? 278  CYS C O   1 
ATOM   8035  C CB  . CYS C 1 267 ? 3.586   16.894  10.357  1.00 75.68  ? 278  CYS C CB  1 
ATOM   8036  S SG  . CYS C 1 267 ? 1.907   17.007  9.786   1.00 75.68  ? 278  CYS C SG  1 
ATOM   8037  N N   . GLN C 1 268 ? 4.187   14.162  11.541  1.00 61.59  ? 279  GLN C N   1 
ATOM   8038  C CA  . GLN C 1 268 ? 3.869   12.854  12.114  1.00 61.59  ? 279  GLN C CA  1 
ATOM   8039  C C   . GLN C 1 268 ? 3.539   12.767  13.610  1.00 61.59  ? 279  GLN C C   1 
ATOM   8040  O O   . GLN C 1 268 ? 3.256   13.762  14.274  1.00 61.59  ? 279  GLN C O   1 
ATOM   8041  C CB  . GLN C 1 268 ? 5.037   11.901  11.825  1.00 104.59 ? 279  GLN C CB  1 
ATOM   8042  C CG  . GLN C 1 268 ? 6.411   12.513  12.133  1.00 104.59 ? 279  GLN C CG  1 
ATOM   8043  C CD  . GLN C 1 268 ? 7.550   11.511  12.067  1.00 104.59 ? 279  GLN C CD  1 
ATOM   8044  O OE1 . GLN C 1 268 ? 7.685   10.649  12.938  1.00 104.59 ? 279  GLN C OE1 1 
ATOM   8045  N NE2 . GLN C 1 268 ? 8.377   11.619  11.032  1.00 104.59 ? 279  GLN C NE2 1 
ATOM   8046  N N   . ASP C 1 269 ? 3.579   11.525  14.096  1.00 165.67 ? 280  ASP C N   1 
ATOM   8047  C CA  . ASP C 1 269 ? 3.341   11.145  15.487  1.00 165.67 ? 280  ASP C CA  1 
ATOM   8048  C C   . ASP C 1 269 ? 1.905   11.247  16.006  1.00 165.67 ? 280  ASP C C   1 
ATOM   8049  O O   . ASP C 1 269 ? 1.489   12.291  16.505  1.00 165.67 ? 280  ASP C O   1 
ATOM   8050  C CB  . ASP C 1 269 ? 4.283   11.930  16.410  1.00 119.19 ? 280  ASP C CB  1 
ATOM   8051  C CG  . ASP C 1 269 ? 4.345   11.348  17.812  1.00 119.19 ? 280  ASP C CG  1 
ATOM   8052  O OD1 . ASP C 1 269 ? 3.295   11.315  18.487  1.00 119.19 ? 280  ASP C OD1 1 
ATOM   8053  O OD2 . ASP C 1 269 ? 5.440   10.921  18.239  1.00 119.19 ? 280  ASP C OD2 1 
ATOM   8054  N N   . GLU C 1 270 ? 1.161   10.146  15.892  1.00 153.12 ? 281  GLU C N   1 
ATOM   8055  C CA  . GLU C 1 270 ? -0.220  10.074  16.373  1.00 153.12 ? 281  GLU C CA  1 
ATOM   8056  C C   . GLU C 1 270 ? -0.588  8.621   16.702  1.00 153.12 ? 281  GLU C C   1 
ATOM   8057  O O   . GLU C 1 270 ? 0.204   7.903   17.318  1.00 153.12 ? 281  GLU C O   1 
ATOM   8058  C CB  . GLU C 1 270 ? -1.197  10.624  15.328  1.00 122.96 ? 281  GLU C CB  1 
ATOM   8059  C CG  . GLU C 1 270 ? -2.591  10.883  15.898  1.00 122.96 ? 281  GLU C CG  1 
ATOM   8060  C CD  . GLU C 1 270 ? -3.627  11.189  14.836  1.00 122.96 ? 281  GLU C CD  1 
ATOM   8061  O OE1 . GLU C 1 270 ? -3.395  12.111  14.027  1.00 122.96 ? 281  GLU C OE1 1 
ATOM   8062  O OE2 . GLU C 1 270 ? -4.679  10.509  14.819  1.00 122.96 ? 281  GLU C OE2 1 
ATOM   8063  N N   . GLU C 1 271 ? -1.787  8.197   16.298  1.00 164.23 ? 282  GLU C N   1 
ATOM   8064  C CA  . GLU C 1 271 ? -2.257  6.827   16.533  1.00 164.23 ? 282  GLU C CA  1 
ATOM   8065  C C   . GLU C 1 271 ? -1.678  5.971   15.412  1.00 164.23 ? 282  GLU C C   1 
ATOM   8066  O O   . GLU C 1 271 ? -2.098  4.843   15.157  1.00 164.23 ? 282  GLU C O   1 
ATOM   8067  C CB  . GLU C 1 271 ? -3.788  6.776   16.510  1.00 103.19 ? 282  GLU C CB  1 
ATOM   8068  C CG  . GLU C 1 271 ? -4.450  7.867   17.354  1.00 103.19 ? 282  GLU C CG  1 
ATOM   8069  C CD  . GLU C 1 271 ? -5.931  7.631   17.576  1.00 103.19 ? 282  GLU C CD  1 
ATOM   8070  O OE1 . GLU C 1 271 ? -6.274  6.756   18.401  1.00 103.19 ? 282  GLU C OE1 1 
ATOM   8071  O OE2 . GLU C 1 271 ? -6.747  8.319   16.922  1.00 103.19 ? 282  GLU C OE2 1 
ATOM   8072  N N   . GLY C 1 272 ? -0.697  6.566   14.753  1.00 59.08  ? 283  GLY C N   1 
ATOM   8073  C CA  . GLY C 1 272 ? 0.025   5.969   13.655  1.00 59.08  ? 283  GLY C CA  1 
ATOM   8074  C C   . GLY C 1 272 ? 1.043   7.063   13.434  1.00 59.08  ? 283  GLY C C   1 
ATOM   8075  O O   . GLY C 1 272 ? 1.094   8.006   14.226  1.00 59.08  ? 283  GLY C O   1 
ATOM   8076  N N   . ARG C 1 273 ? 1.844   6.990   12.385  1.00 93.50  ? 284  ARG C N   1 
ATOM   8077  C CA  . ARG C 1 273 ? 2.826   8.042   12.188  1.00 93.50  ? 284  ARG C CA  1 
ATOM   8078  C C   . ARG C 1 273 ? 2.837   8.551   10.753  1.00 93.50  ? 284  ARG C C   1 
ATOM   8079  O O   . ARG C 1 273 ? 2.681   7.772   9.809   1.00 93.50  ? 284  ARG C O   1 
ATOM   8080  C CB  . ARG C 1 273 ? 4.205   7.517   12.592  1.00 108.75 ? 284  ARG C CB  1 
ATOM   8081  C CG  . ARG C 1 273 ? 5.274   8.576   12.696  1.00 108.75 ? 284  ARG C CG  1 
ATOM   8082  C CD  . ARG C 1 273 ? 6.124   8.386   13.950  1.00 108.75 ? 284  ARG C CD  1 
ATOM   8083  N NE  . ARG C 1 273 ? 5.434   8.774   15.187  1.00 108.75 ? 284  ARG C NE  1 
ATOM   8084  C CZ  . ARG C 1 273 ? 4.791   7.937   16.004  1.00 108.75 ? 284  ARG C CZ  1 
ATOM   8085  N NH1 . ARG C 1 273 ? 4.731   6.636   15.735  1.00 108.75 ? 284  ARG C NH1 1 
ATOM   8086  N NH2 . ARG C 1 273 ? 4.216   8.404   17.106  1.00 108.75 ? 284  ARG C NH2 1 
ATOM   8087  N N   . LYS C 1 274 ? 2.989   9.865   10.597  1.00 63.01  ? 285  LYS C N   1 
ATOM   8088  C CA  . LYS C 1 274 ? 3.055   10.493  9.275   1.00 63.01  ? 285  LYS C CA  1 
ATOM   8089  C C   . LYS C 1 274 ? 1.728   10.743  8.573   1.00 63.01  ? 285  LYS C C   1 
ATOM   8090  O O   . LYS C 1 274 ? 0.906   9.846   8.407   1.00 63.01  ? 285  LYS C O   1 
ATOM   8091  C CB  . LYS C 1 274 ? 3.965   9.678   8.342   1.00 131.77 ? 285  LYS C CB  1 
ATOM   8092  C CG  . LYS C 1 274 ? 5.431   9.663   8.759   1.00 131.77 ? 285  LYS C CG  1 
ATOM   8093  C CD  . LYS C 1 274 ? 6.239   8.624   7.990   1.00 131.77 ? 285  LYS C CD  1 
ATOM   8094  C CE  . LYS C 1 274 ? 5.808   7.207   8.347   1.00 131.77 ? 285  LYS C CE  1 
ATOM   8095  N NZ  . LYS C 1 274 ? 6.682   6.179   7.720   1.00 131.77 ? 285  LYS C NZ  1 
ATOM   8096  N N   . GLY C 1 275 ? 1.544   11.987  8.155   1.00 58.62  ? 286  GLY C N   1 
ATOM   8097  C CA  . GLY C 1 275 ? 0.343   12.380  7.457   1.00 58.62  ? 286  GLY C CA  1 
ATOM   8098  C C   . GLY C 1 275 ? 0.457   13.843  7.085   1.00 58.62  ? 286  GLY C C   1 
ATOM   8099  O O   . GLY C 1 275 ? 1.062   14.615  7.815   1.00 58.62  ? 286  GLY C O   1 
ATOM   8100  N N   . ASN C 1 276 ? -0.125  14.224  5.956   1.00 41.29  ? 287  ASN C N   1 
ATOM   8101  C CA  . ASN C 1 276 ? -0.087  15.598  5.475   1.00 41.29  ? 287  ASN C CA  1 
ATOM   8102  C C   . ASN C 1 276 ? -1.225  16.435  6.021   1.00 41.29  ? 287  ASN C C   1 
ATOM   8103  O O   . ASN C 1 276 ? -2.186  15.902  6.565   1.00 41.29  ? 287  ASN C O   1 
ATOM   8104  C CB  . ASN C 1 276 ? -0.196  15.609  3.958   1.00 72.92  ? 287  ASN C CB  1 
ATOM   8105  C CG  . ASN C 1 276 ? 1.062   15.176  3.289   1.00 72.92  ? 287  ASN C CG  1 
ATOM   8106  O OD1 . ASN C 1 276 ? 1.881   16.010  2.908   1.00 72.92  ? 287  ASN C OD1 1 
ATOM   8107  N ND2 . ASN C 1 276 ? 1.242   13.867  3.145   1.00 72.92  ? 287  ASN C ND2 1 
ATOM   8108  N N   . LYS C 1 277 ? -1.102  17.749  5.848   1.00 57.33  ? 288  LYS C N   1 
ATOM   8109  C CA  . LYS C 1 277 ? -2.121  18.708  6.253   1.00 57.33  ? 288  LYS C CA  1 
ATOM   8110  C C   . LYS C 1 277 ? -2.250  19.779  5.167   1.00 57.33  ? 288  LYS C C   1 
ATOM   8111  O O   . LYS C 1 277 ? -1.253  20.278  4.652   1.00 57.33  ? 288  LYS C O   1 
ATOM   8112  C CB  . LYS C 1 277 ? -1.771  19.349  7.598   1.00 65.56  ? 288  LYS C CB  1 
ATOM   8113  C CG  . LYS C 1 277 ? -2.079  18.451  8.789   1.00 65.56  ? 288  LYS C CG  1 
ATOM   8114  C CD  . LYS C 1 277 ? -1.775  19.119  10.125  1.00 65.56  ? 288  LYS C CD  1 
ATOM   8115  C CE  . LYS C 1 277 ? -1.949  18.135  11.272  1.00 65.56  ? 288  LYS C CE  1 
ATOM   8116  N NZ  . LYS C 1 277 ? -1.534  18.716  12.569  1.00 65.56  ? 288  LYS C NZ  1 
ATOM   8117  N N   . LEU C 1 278 ? -3.484  20.121  4.814   1.00 62.39  ? 289  LEU C N   1 
ATOM   8118  C CA  . LEU C 1 278 ? -3.745  21.117  3.776   1.00 62.39  ? 289  LEU C CA  1 
ATOM   8119  C C   . LEU C 1 278 ? -4.268  22.388  4.413   1.00 62.39  ? 289  LEU C C   1 
ATOM   8120  O O   . LEU C 1 278 ? -5.050  22.329  5.354   1.00 62.39  ? 289  LEU C O   1 
ATOM   8121  C CB  . LEU C 1 278 ? -4.764  20.555  2.778   1.00 48.82  ? 289  LEU C CB  1 
ATOM   8122  C CG  . LEU C 1 278 ? -4.314  19.230  2.150   1.00 48.82  ? 289  LEU C CG  1 
ATOM   8123  C CD1 . LEU C 1 278 ? -5.497  18.442  1.636   1.00 48.82  ? 289  LEU C CD1 1 
ATOM   8124  C CD2 . LEU C 1 278 ? -3.343  19.525  1.034   1.00 48.82  ? 289  LEU C CD2 1 
ATOM   8125  N N   . TYR C 1 279 ? -3.834  23.533  3.903   1.00 61.61  ? 290  TYR C N   1 
ATOM   8126  C CA  . TYR C 1 279 ? -4.255  24.828  4.447   1.00 61.61  ? 290  TYR C CA  1 
ATOM   8127  C C   . TYR C 1 279 ? -4.736  25.758  3.343   1.00 61.61  ? 290  TYR C C   1 
ATOM   8128  O O   . TYR C 1 279 ? -4.533  25.490  2.160   1.00 61.61  ? 290  TYR C O   1 
ATOM   8129  C CB  . TYR C 1 279 ? -3.078  25.533  5.145   1.00 51.95  ? 290  TYR C CB  1 
ATOM   8130  C CG  . TYR C 1 279 ? -2.480  24.812  6.326   1.00 51.95  ? 290  TYR C CG  1 
ATOM   8131  C CD1 . TYR C 1 279 ? -3.047  24.920  7.591   1.00 51.95  ? 290  TYR C CD1 1 
ATOM   8132  C CD2 . TYR C 1 279 ? -1.352  24.007  6.177   1.00 51.95  ? 290  TYR C CD2 1 
ATOM   8133  C CE1 . TYR C 1 279 ? -2.510  24.243  8.679   1.00 51.95  ? 290  TYR C CE1 1 
ATOM   8134  C CE2 . TYR C 1 279 ? -0.806  23.322  7.259   1.00 51.95  ? 290  TYR C CE2 1 
ATOM   8135  C CZ  . TYR C 1 279 ? -1.391  23.447  8.506   1.00 51.95  ? 290  TYR C CZ  1 
ATOM   8136  O OH  . TYR C 1 279 ? -0.858  22.782  9.583   1.00 51.95  ? 290  TYR C OH  1 
ATOM   8137  N N   . TYR C 1 280 ? -5.381  26.849  3.737   1.00 54.53  ? 291  TYR C N   1 
ATOM   8138  C CA  . TYR C 1 280 ? -5.790  27.847  2.765   1.00 54.53  ? 291  TYR C CA  1 
ATOM   8139  C C   . TYR C 1 280 ? -5.228  29.178  3.241   1.00 54.53  ? 291  TYR C C   1 
ATOM   8140  O O   . TYR C 1 280 ? -5.372  29.532  4.414   1.00 54.53  ? 291  TYR C O   1 
ATOM   8141  C CB  . TYR C 1 280 ? -7.305  27.985  2.641   1.00 62.26  ? 291  TYR C CB  1 
ATOM   8142  C CG  . TYR C 1 280 ? -7.667  29.116  1.701   1.00 62.26  ? 291  TYR C CG  1 
ATOM   8143  C CD1 . TYR C 1 280 ? -7.256  29.078  0.378   1.00 62.26  ? 291  TYR C CD1 1 
ATOM   8144  C CD2 . TYR C 1 280 ? -8.294  30.276  2.163   1.00 62.26  ? 291  TYR C CD2 1 
ATOM   8145  C CE1 . TYR C 1 280 ? -7.434  30.156  -0.463  1.00 62.26  ? 291  TYR C CE1 1 
ATOM   8146  C CE2 . TYR C 1 280 ? -8.480  31.373  1.325   1.00 62.26  ? 291  TYR C CE2 1 
ATOM   8147  C CZ  . TYR C 1 280 ? -8.036  31.304  0.007   1.00 62.26  ? 291  TYR C CZ  1 
ATOM   8148  O OH  . TYR C 1 280 ? -8.125  32.383  -0.848  1.00 62.26  ? 291  TYR C OH  1 
ATOM   8149  N N   . ASN C 1 281 ? -4.577  29.905  2.336   1.00 58.87  ? 292  ASN C N   1 
ATOM   8150  C CA  . ASN C 1 281 ? -4.005  31.210  2.656   1.00 58.87  ? 292  ASN C CA  1 
ATOM   8151  C C   . ASN C 1 281 ? -5.090  32.296  2.702   1.00 58.87  ? 292  ASN C C   1 
ATOM   8152  O O   . ASN C 1 281 ? -5.333  33.009  1.728   1.00 58.87  ? 292  ASN C O   1 
ATOM   8153  C CB  . ASN C 1 281 ? -2.931  31.592  1.626   1.00 69.90  ? 292  ASN C CB  1 
ATOM   8154  C CG  . ASN C 1 281 ? -1.535  31.610  2.216   1.00 69.90  ? 292  ASN C CG  1 
ATOM   8155  O OD1 . ASN C 1 281 ? -1.286  32.282  3.217   1.00 69.90  ? 292  ASN C OD1 1 
ATOM   8156  N ND2 . ASN C 1 281 ? -0.614  30.878  1.594   1.00 69.90  ? 292  ASN C ND2 1 
ATOM   8157  N N   . PHE C 1 282 ? -5.752  32.398  3.841   1.00 78.27  ? 293  PHE C N   1 
ATOM   8158  C CA  . PHE C 1 282 ? -6.779  33.401  4.013   1.00 78.27  ? 293  PHE C CA  1 
ATOM   8159  C C   . PHE C 1 282 ? -6.048  34.750  4.057   1.00 78.27  ? 293  PHE C C   1 
ATOM   8160  O O   . PHE C 1 282 ? -4.817  34.789  3.951   1.00 78.27  ? 293  PHE C O   1 
ATOM   8161  C CB  . PHE C 1 282 ? -7.542  33.128  5.319   1.00 69.85  ? 293  PHE C CB  1 
ATOM   8162  C CG  . PHE C 1 282 ? -8.617  32.064  5.196   1.00 69.85  ? 293  PHE C CG  1 
ATOM   8163  C CD1 . PHE C 1 282 ? -9.885  32.390  4.727   1.00 69.85  ? 293  PHE C CD1 1 
ATOM   8164  C CD2 . PHE C 1 282 ? -8.351  30.737  5.534   1.00 69.85  ? 293  PHE C CD2 1 
ATOM   8165  C CE1 . PHE C 1 282 ? -10.865 31.419  4.600   1.00 69.85  ? 293  PHE C CE1 1 
ATOM   8166  C CE2 . PHE C 1 282 ? -9.329  29.759  5.409   1.00 69.85  ? 293  PHE C CE2 1 
ATOM   8167  C CZ  . PHE C 1 282 ? -10.588 30.100  4.941   1.00 69.85  ? 293  PHE C CZ  1 
ATOM   8168  N N   . PRO C 1 283 ? -6.788  35.871  4.176   1.00 86.37  ? 294  PRO C N   1 
ATOM   8169  C CA  . PRO C 1 283 ? -6.166  37.200  4.231   1.00 86.37  ? 294  PRO C CA  1 
ATOM   8170  C C   . PRO C 1 283 ? -5.289  37.382  5.466   1.00 86.37  ? 294  PRO C C   1 
ATOM   8171  O O   . PRO C 1 283 ? -4.258  38.058  5.421   1.00 86.37  ? 294  PRO C O   1 
ATOM   8172  C CB  . PRO C 1 283 ? -7.367  38.137  4.248   1.00 114.13 ? 294  PRO C CB  1 
ATOM   8173  C CG  . PRO C 1 283 ? -8.363  37.401  3.420   1.00 114.13 ? 294  PRO C CG  1 
ATOM   8174  C CD  . PRO C 1 283 ? -8.240  35.997  3.957   1.00 114.13 ? 294  PRO C CD  1 
ATOM   8175  N N   . TRP C 1 284 ? -5.708  36.764  6.565   1.00 65.69  ? 295  TRP C N   1 
ATOM   8176  C CA  . TRP C 1 284 ? -4.990  36.852  7.834   1.00 65.69  ? 295  TRP C CA  1 
ATOM   8177  C C   . TRP C 1 284 ? -4.056  35.683  8.129   1.00 65.69  ? 295  TRP C C   1 
ATOM   8178  O O   . TRP C 1 284 ? -3.696  35.465  9.281   1.00 65.69  ? 295  TRP C O   1 
ATOM   8179  C CB  . TRP C 1 284 ? -5.996  36.986  8.984   1.00 98.83  ? 295  TRP C CB  1 
ATOM   8180  C CG  . TRP C 1 284 ? -6.872  35.770  9.183   1.00 98.83  ? 295  TRP C CG  1 
ATOM   8181  C CD1 . TRP C 1 284 ? -6.574  34.642  9.902   1.00 98.83  ? 295  TRP C CD1 1 
ATOM   8182  C CD2 . TRP C 1 284 ? -8.169  35.556  8.627   1.00 98.83  ? 295  TRP C CD2 1 
ATOM   8183  N NE1 . TRP C 1 284 ? -7.606  33.743  9.825   1.00 98.83  ? 295  TRP C NE1 1 
ATOM   8184  C CE2 . TRP C 1 284 ? -8.598  34.279  9.046   1.00 98.83  ? 295  TRP C CE2 1 
ATOM   8185  C CE3 . TRP C 1 284 ? -9.013  36.320  7.810   1.00 98.83  ? 295  TRP C CE3 1 
ATOM   8186  C CZ2 . TRP C 1 284 ? -9.835  33.749  8.673   1.00 98.83  ? 295  TRP C CZ2 1 
ATOM   8187  C CZ3 . TRP C 1 284 ? -10.244 35.792  7.439   1.00 98.83  ? 295  TRP C CZ3 1 
ATOM   8188  C CH2 . TRP C 1 284 ? -10.641 34.519  7.871   1.00 98.83  ? 295  TRP C CH2 1 
ATOM   8189  N N   . GLY C 1 285 ? -3.665  34.926  7.110   1.00 109.06 ? 296  GLY C N   1 
ATOM   8190  C CA  . GLY C 1 285 ? -2.769  33.811  7.358   1.00 109.06 ? 296  GLY C CA  1 
ATOM   8191  C C   . GLY C 1 285 ? -3.400  32.431  7.291   1.00 109.06 ? 296  GLY C C   1 
ATOM   8192  O O   . GLY C 1 285 ? -4.548  32.225  7.680   1.00 109.06 ? 296  GLY C O   1 
ATOM   8193  N N   . LYS C 1 286 ? -2.607  31.482  6.808   1.00 68.35  ? 297  LYS C N   1 
ATOM   8194  C CA  . LYS C 1 286 ? -2.999  30.088  6.626   1.00 68.35  ? 297  LYS C CA  1 
ATOM   8195  C C   . LYS C 1 286 ? -3.891  29.496  7.702   1.00 68.35  ? 297  LYS C C   1 
ATOM   8196  O O   . LYS C 1 286 ? -3.785  29.832  8.874   1.00 68.35  ? 297  LYS C O   1 
ATOM   8197  C CB  . LYS C 1 286 ? -1.739  29.225  6.440   1.00 83.01  ? 297  LYS C CB  1 
ATOM   8198  C CG  . LYS C 1 286 ? -1.045  29.456  5.091   1.00 83.01  ? 297  LYS C CG  1 
ATOM   8199  C CD  . LYS C 1 286 ? 0.300   28.749  4.976   1.00 83.01  ? 297  LYS C CD  1 
ATOM   8200  C CE  . LYS C 1 286 ? 0.897   28.950  3.583   1.00 83.01  ? 297  LYS C CE  1 
ATOM   8201  N NZ  . LYS C 1 286 ? 2.246   28.332  3.429   1.00 83.01  ? 297  LYS C NZ  1 
ATOM   8202  N N   . GLU C 1 287 ? -4.775  28.606  7.264   1.00 74.46  ? 298  GLU C N   1 
ATOM   8203  C CA  . GLU C 1 287 ? -5.716  27.934  8.141   1.00 74.46  ? 298  GLU C CA  1 
ATOM   8204  C C   . GLU C 1 287 ? -5.910  26.500  7.657   1.00 74.46  ? 298  GLU C C   1 
ATOM   8205  O O   . GLU C 1 287 ? -5.919  26.245  6.447   1.00 74.46  ? 298  GLU C O   1 
ATOM   8206  C CB  . GLU C 1 287 ? -7.047  28.670  8.119   1.00 120.35 ? 298  GLU C CB  1 
ATOM   8207  C CG  . GLU C 1 287 ? -7.948  28.318  9.267   1.00 120.35 ? 298  GLU C CG  1 
ATOM   8208  C CD  . GLU C 1 287 ? -7.281  28.561  10.599  1.00 120.35 ? 298  GLU C CD  1 
ATOM   8209  O OE1 . GLU C 1 287 ? -6.717  27.598  11.168  1.00 120.35 ? 298  GLU C OE1 1 
ATOM   8210  O OE2 . GLU C 1 287 ? -7.309  29.721  11.065  1.00 120.35 ? 298  GLU C OE2 1 
ATOM   8211  N N   . LEU C 1 288 ? -6.069  25.580  8.611   1.00 57.73  ? 299  LEU C N   1 
ATOM   8212  C CA  . LEU C 1 288 ? -6.249  24.149  8.335   1.00 57.73  ? 299  LEU C CA  1 
ATOM   8213  C C   . LEU C 1 288 ? -7.610  23.877  7.730   1.00 57.73  ? 299  LEU C C   1 
ATOM   8214  O O   . LEU C 1 288 ? -8.619  24.249  8.311   1.00 57.73  ? 299  LEU C O   1 
ATOM   8215  C CB  . LEU C 1 288 ? -6.088  23.338  9.633   1.00 39.84  ? 299  LEU C CB  1 
ATOM   8216  C CG  . LEU C 1 288 ? -6.039  21.801  9.647   1.00 39.84  ? 299  LEU C CG  1 
ATOM   8217  C CD1 . LEU C 1 288 ? -7.398  21.219  9.347   1.00 39.84  ? 299  LEU C CD1 1 
ATOM   8218  C CD2 . LEU C 1 288 ? -5.011  21.309  8.641   1.00 39.84  ? 299  LEU C CD2 1 
ATOM   8219  N N   . ILE C 1 289 ? -7.632  23.229  6.565   1.00 48.09  ? 300  ILE C N   1 
ATOM   8220  C CA  . ILE C 1 289 ? -8.884  22.909  5.889   1.00 48.09  ? 300  ILE C CA  1 
ATOM   8221  C C   . ILE C 1 289 ? -9.069  21.415  5.718   1.00 48.09  ? 300  ILE C C   1 
ATOM   8222  O O   . ILE C 1 289 ? -10.188 20.948  5.543   1.00 48.09  ? 300  ILE C O   1 
ATOM   8223  C CB  . ILE C 1 289 ? -8.976  23.517  4.467   1.00 40.41  ? 300  ILE C CB  1 
ATOM   8224  C CG1 . ILE C 1 289 ? -7.979  22.826  3.538   1.00 40.41  ? 300  ILE C CG1 1 
ATOM   8225  C CG2 . ILE C 1 289 ? -8.739  25.003  4.510   1.00 40.41  ? 300  ILE C CG2 1 
ATOM   8226  C CD1 . ILE C 1 289 ? -8.047  23.305  2.111   1.00 40.41  ? 300  ILE C CD1 1 
ATOM   8227  N N   . GLU C 1 290 ? -7.982  20.660  5.758   1.00 65.62  ? 301  GLU C N   1 
ATOM   8228  C CA  . GLU C 1 290 ? -8.074  19.217  5.567   1.00 65.62  ? 301  GLU C CA  1 
ATOM   8229  C C   . GLU C 1 290 ? -6.840  18.511  6.104   1.00 65.62  ? 301  GLU C C   1 
ATOM   8230  O O   . GLU C 1 290 ? -5.796  19.135  6.277   1.00 65.62  ? 301  GLU C O   1 
ATOM   8231  C CB  . GLU C 1 290 ? -8.262  18.919  4.077   1.00 66.64  ? 301  GLU C CB  1 
ATOM   8232  C CG  . GLU C 1 290 ? -8.078  17.474  3.679   1.00 66.64  ? 301  GLU C CG  1 
ATOM   8233  C CD  . GLU C 1 290 ? -8.620  17.179  2.295   1.00 66.64  ? 301  GLU C CD  1 
ATOM   8234  O OE1 . GLU C 1 290 ? -8.236  16.143  1.713   1.00 66.64  ? 301  GLU C OE1 1 
ATOM   8235  O OE2 . GLU C 1 290 ? -9.440  17.974  1.791   1.00 66.64  ? 301  GLU C OE2 1 
ATOM   8236  N N   . THR C 1 291 ? -6.956  17.209  6.361   1.00 45.07  ? 302  THR C N   1 
ATOM   8237  C CA  . THR C 1 291 ? -5.845  16.438  6.913   1.00 45.07  ? 302  THR C CA  1 
ATOM   8238  C C   . THR C 1 291 ? -5.849  14.956  6.523   1.00 45.07  ? 302  THR C C   1 
ATOM   8239  O O   . THR C 1 291 ? -6.838  14.262  6.759   1.00 45.07  ? 302  THR C O   1 
ATOM   8240  C CB  . THR C 1 291 ? -5.872  16.484  8.450   1.00 36.94  ? 302  THR C CB  1 
ATOM   8241  O OG1 . THR C 1 291 ? -7.076  15.861  8.912   1.00 36.94  ? 302  THR C OG1 1 
ATOM   8242  C CG2 . THR C 1 291 ? -5.828  17.928  8.968   1.00 36.94  ? 302  THR C CG2 1 
ATOM   8243  N N   . LEU C 1 292 ? -4.748  14.469  5.940   1.00 36.93  ? 303  LEU C N   1 
ATOM   8244  C CA  . LEU C 1 292 ? -4.633  13.047  5.580   1.00 36.93  ? 303  LEU C CA  1 
ATOM   8245  C C   . LEU C 1 292 ? -3.783  12.341  6.641   1.00 36.93  ? 303  LEU C C   1 
ATOM   8246  O O   . LEU C 1 292 ? -2.842  12.923  7.157   1.00 36.93  ? 303  LEU C O   1 
ATOM   8247  C CB  . LEU C 1 292 ? -3.992  12.876  4.200   1.00 42.22  ? 303  LEU C CB  1 
ATOM   8248  C CG  . LEU C 1 292 ? -4.741  13.510  3.027   1.00 42.22  ? 303  LEU C CG  1 
ATOM   8249  C CD1 . LEU C 1 292 ? -4.317  14.957  2.901   1.00 42.22  ? 303  LEU C CD1 1 
ATOM   8250  C CD2 . LEU C 1 292 ? -4.435  12.762  1.747   1.00 42.22  ? 303  LEU C CD2 1 
ATOM   8251  N N   . TRP C 1 293 ? -4.116  11.100  6.971   1.00 45.97  ? 304  TRP C N   1 
ATOM   8252  C CA  . TRP C 1 293 ? -3.375  10.377  7.998   1.00 45.97  ? 304  TRP C CA  1 
ATOM   8253  C C   . TRP C 1 293 ? -3.190  8.890   7.744   1.00 45.97  ? 304  TRP C C   1 
ATOM   8254  O O   . TRP C 1 293 ? -4.060  8.231   7.178   1.00 45.97  ? 304  TRP C O   1 
ATOM   8255  C CB  . TRP C 1 293 ? -4.065  10.535  9.349   1.00 71.81  ? 304  TRP C CB  1 
ATOM   8256  C CG  . TRP C 1 293 ? -3.578  11.676  10.129  1.00 71.81  ? 304  TRP C CG  1 
ATOM   8257  C CD1 . TRP C 1 293 ? -4.302  12.746  10.551  1.00 71.81  ? 304  TRP C CD1 1 
ATOM   8258  C CD2 . TRP C 1 293 ? -2.235  11.897  10.566  1.00 71.81  ? 304  TRP C CD2 1 
ATOM   8259  N NE1 . TRP C 1 293 ? -3.492  13.631  11.224  1.00 71.81  ? 304  TRP C NE1 1 
ATOM   8260  C CE2 . TRP C 1 293 ? -2.217  13.133  11.248  1.00 71.81  ? 304  TRP C CE2 1 
ATOM   8261  C CE3 . TRP C 1 293 ? -1.041  11.172  10.445  1.00 71.81  ? 304  TRP C CE3 1 
ATOM   8262  C CZ2 . TRP C 1 293 ? -1.050  13.664  11.806  1.00 71.81  ? 304  TRP C CZ2 1 
ATOM   8263  C CZ3 . TRP C 1 293 ? 0.121   11.704  11.001  1.00 71.81  ? 304  TRP C CZ3 1 
ATOM   8264  C CH2 . TRP C 1 293 ? 0.105   12.938  11.671  1.00 71.81  ? 304  TRP C CH2 1 
ATOM   8265  N N   . ASN C 1 294 ? -2.054  8.356   8.181   1.00 45.37  ? 305  ASN C N   1 
ATOM   8266  C CA  . ASN C 1 294 ? -1.790  6.932   8.032   1.00 45.37  ? 305  ASN C CA  1 
ATOM   8267  C C   . ASN C 1 294 ? -1.818  6.348   9.443   1.00 45.37  ? 305  ASN C C   1 
ATOM   8268  O O   . ASN C 1 294 ? -0.784  6.191   10.087  1.00 45.37  ? 305  ASN C O   1 
ATOM   8269  C CB  . ASN C 1 294 ? -0.419  6.692   7.390   1.00 68.04  ? 305  ASN C CB  1 
ATOM   8270  C CG  . ASN C 1 294 ? -0.251  5.262   6.854   1.00 68.04  ? 305  ASN C CG  1 
ATOM   8271  O OD1 . ASN C 1 294 ? -0.725  4.288   7.446   1.00 68.04  ? 305  ASN C OD1 1 
ATOM   8272  N ND2 . ASN C 1 294 ? 0.448   5.139   5.734   1.00 68.04  ? 305  ASN C ND2 1 
ATOM   8273  N N   . LEU C 1 295 ? -3.014  6.043   9.929   1.00 42.39  ? 306  LEU C N   1 
ATOM   8274  C CA  . LEU C 1 295 ? -3.154  5.476   11.264  1.00 42.39  ? 306  LEU C CA  1 
ATOM   8275  C C   . LEU C 1 295 ? -2.545  4.070   11.333  1.00 42.39  ? 306  LEU C C   1 
ATOM   8276  O O   . LEU C 1 295 ? -2.281  3.536   12.412  1.00 42.39  ? 306  LEU C O   1 
ATOM   8277  C CB  . LEU C 1 295 ? -4.634  5.408   11.653  1.00 34.02  ? 306  LEU C CB  1 
ATOM   8278  C CG  . LEU C 1 295 ? -5.482  6.620   11.290  1.00 34.02  ? 306  LEU C CG  1 
ATOM   8279  C CD1 . LEU C 1 295 ? -6.858  6.487   11.923  1.00 34.02  ? 306  LEU C CD1 1 
ATOM   8280  C CD2 . LEU C 1 295 ? -4.790  7.885   11.768  1.00 34.02  ? 306  LEU C CD2 1 
ATOM   8281  N N   . GLY C 1 296 ? -2.320  3.477   10.172  1.00 48.35  ? 307  GLY C N   1 
ATOM   8282  C CA  . GLY C 1 296 ? -1.767  2.147   10.149  1.00 48.35  ? 307  GLY C CA  1 
ATOM   8283  C C   . GLY C 1 296 ? -2.829  1.209   10.663  1.00 48.35  ? 307  GLY C C   1 
ATOM   8284  O O   . GLY C 1 296 ? -3.986  1.589   10.701  1.00 48.35  ? 307  GLY C O   1 
ATOM   8285  N N   . ASP C 1 297 ? -2.440  0.002   11.067  1.00 50.68  ? 308  ASP C N   1 
ATOM   8286  C CA  . ASP C 1 297 ? -3.382  -0.989  11.584  1.00 50.68  ? 308  ASP C CA  1 
ATOM   8287  C C   . ASP C 1 297 ? -3.829  -0.760  13.032  1.00 50.68  ? 308  ASP C C   1 
ATOM   8288  O O   . ASP C 1 297 ? -4.744  -1.425  13.505  1.00 50.68  ? 308  ASP C O   1 
ATOM   8289  C CB  . ASP C 1 297 ? -2.787  -2.395  11.455  1.00 122.48 ? 308  ASP C CB  1 
ATOM   8290  C CG  . ASP C 1 297 ? -1.364  -2.484  11.986  1.00 122.48 ? 308  ASP C CG  1 
ATOM   8291  O OD1 . ASP C 1 297 ? -0.832  -3.612  12.066  1.00 122.48 ? 308  ASP C OD1 1 
ATOM   8292  O OD2 . ASP C 1 297 ? -0.774  -1.433  12.313  1.00 122.48 ? 308  ASP C OD2 1 
ATOM   8293  N N   . HIS C 1 298 ? -3.193  0.179   13.726  1.00 80.88  ? 309  HIS C N   1 
ATOM   8294  C CA  . HIS C 1 298 ? -3.540  0.476   15.115  1.00 80.88  ? 309  HIS C CA  1 
ATOM   8295  C C   . HIS C 1 298 ? -5.049  0.511   15.312  1.00 80.88  ? 309  HIS C C   1 
ATOM   8296  O O   . HIS C 1 298 ? -5.651  -0.469  15.745  1.00 80.88  ? 309  HIS C O   1 
ATOM   8297  C CB  . HIS C 1 298 ? -2.958  1.827   15.536  1.00 97.57  ? 309  HIS C CB  1 
ATOM   8298  C CG  . HIS C 1 298 ? -3.245  2.195   16.961  1.00 97.57  ? 309  HIS C CG  1 
ATOM   8299  N ND1 . HIS C 1 298 ? -2.560  1.648   18.024  1.00 97.57  ? 309  HIS C ND1 1 
ATOM   8300  C CD2 . HIS C 1 298 ? -4.143  3.056   17.496  1.00 97.57  ? 309  HIS C CD2 1 
ATOM   8301  C CE1 . HIS C 1 298 ? -3.023  2.158   19.152  1.00 97.57  ? 309  HIS C CE1 1 
ATOM   8302  N NE2 . HIS C 1 298 ? -3.984  3.015   18.860  1.00 97.57  ? 309  HIS C NE2 1 
ATOM   8303  N N   . GLU C 1 299 ? -5.643  1.656   14.992  1.00 98.05  ? 310  GLU C N   1 
ATOM   8304  C CA  . GLU C 1 299 ? -7.078  1.875   15.112  1.00 98.05  ? 310  GLU C CA  1 
ATOM   8305  C C   . GLU C 1 299 ? -7.925  0.629   14.894  1.00 98.05  ? 310  GLU C C   1 
ATOM   8306  O O   . GLU C 1 299 ? -8.752  0.276   15.736  1.00 98.05  ? 310  GLU C O   1 
ATOM   8307  C CB  . GLU C 1 299 ? -7.518  2.933   14.107  1.00 71.23  ? 310  GLU C CB  1 
ATOM   8308  C CG  . GLU C 1 299 ? -7.947  4.224   14.732  1.00 71.23  ? 310  GLU C CG  1 
ATOM   8309  C CD  . GLU C 1 299 ? -6.831  4.880   15.492  1.00 71.23  ? 310  GLU C CD  1 
ATOM   8310  O OE1 . GLU C 1 299 ? -5.796  5.198   14.870  1.00 71.23  ? 310  GLU C OE1 1 
ATOM   8311  O OE2 . GLU C 1 299 ? -6.989  5.074   16.713  1.00 71.23  ? 310  GLU C OE2 1 
ATOM   8312  N N   . LEU C 1 300 ? -7.709  -0.025  13.754  1.00 74.13  ? 311  LEU C N   1 
ATOM   8313  C CA  . LEU C 1 300 ? -8.464  -1.214  13.359  1.00 74.13  ? 311  LEU C CA  1 
ATOM   8314  C C   . LEU C 1 300 ? -8.246  -2.421  14.267  1.00 74.13  ? 311  LEU C C   1 
ATOM   8315  O O   . LEU C 1 300 ? -9.153  -3.228  14.451  1.00 74.13  ? 311  LEU C O   1 
ATOM   8316  C CB  . LEU C 1 300 ? -8.142  -1.555  11.888  1.00 39.32  ? 311  LEU C CB  1 
ATOM   8317  C CG  . LEU C 1 300 ? -9.181  -2.270  11.024  1.00 39.32  ? 311  LEU C CG  1 
ATOM   8318  C CD1 . LEU C 1 300 ? -9.156  -3.744  11.303  1.00 39.32  ? 311  LEU C CD1 1 
ATOM   8319  C CD2 . LEU C 1 300 ? -10.551 -1.692  11.304  1.00 39.32  ? 311  LEU C CD2 1 
ATOM   8320  N N   . LEU C 1 301 ? -7.053  -2.546  14.839  1.00 51.56  ? 312  LEU C N   1 
ATOM   8321  C CA  . LEU C 1 301 ? -6.773  -3.663  15.743  1.00 51.56  ? 312  LEU C CA  1 
ATOM   8322  C C   . LEU C 1 301 ? -7.483  -3.463  17.080  1.00 51.56  ? 312  LEU C C   1 
ATOM   8323  O O   . LEU C 1 301 ? -8.263  -4.318  17.514  1.00 51.56  ? 312  LEU C O   1 
ATOM   8324  C CB  . LEU C 1 301 ? -5.257  -3.837  15.950  1.00 40.17  ? 312  LEU C CB  1 
ATOM   8325  C CG  . LEU C 1 301 ? -4.624  -4.852  14.975  1.00 40.17  ? 312  LEU C CG  1 
ATOM   8326  C CD1 . LEU C 1 301 ? -3.572  -4.189  14.080  1.00 40.17  ? 312  LEU C CD1 1 
ATOM   8327  C CD2 . LEU C 1 301 ? -4.041  -6.006  15.775  1.00 40.17  ? 312  LEU C CD2 1 
ATOM   8328  N N   . HIS C 1 302 ? -7.220  -2.325  17.720  1.00 53.56  ? 313  HIS C N   1 
ATOM   8329  C CA  . HIS C 1 302 ? -7.858  -1.988  18.990  1.00 53.56  ? 313  HIS C CA  1 
ATOM   8330  C C   . HIS C 1 302 ? -9.375  -2.082  18.845  1.00 53.56  ? 313  HIS C C   1 
ATOM   8331  O O   . HIS C 1 302 ? -10.077 -2.482  19.770  1.00 53.56  ? 313  HIS C O   1 
ATOM   8332  C CB  . HIS C 1 302 ? -7.472  -0.564  19.417  1.00 67.20  ? 313  HIS C CB  1 
ATOM   8333  C CG  . HIS C 1 302 ? -8.113  -0.115  20.697  1.00 67.20  ? 313  HIS C CG  1 
ATOM   8334  N ND1 . HIS C 1 302 ? -7.903  1.138   21.230  1.00 67.20  ? 313  HIS C ND1 1 
ATOM   8335  C CD2 . HIS C 1 302 ? -8.958  -0.748  21.547  1.00 67.20  ? 313  HIS C CD2 1 
ATOM   8336  C CE1 . HIS C 1 302 ? -8.592  1.258   22.351  1.00 67.20  ? 313  HIS C CE1 1 
ATOM   8337  N NE2 . HIS C 1 302 ? -9.241  0.127   22.566  1.00 67.20  ? 313  HIS C NE2 1 
ATOM   8338  N N   . MET C 1 303 ? -9.881  -1.714  17.679  1.00 62.11  ? 314  MET C N   1 
ATOM   8339  C CA  . MET C 1 303 ? -11.315 -1.757  17.455  1.00 62.11  ? 314  MET C CA  1 
ATOM   8340  C C   . MET C 1 303 ? -11.861 -3.150  17.683  1.00 62.11  ? 314  MET C C   1 
ATOM   8341  O O   . MET C 1 303 ? -12.923 -3.319  18.276  1.00 62.11  ? 314  MET C O   1 
ATOM   8342  C CB  . MET C 1 303 ? -11.643 -1.288  16.033  1.00 91.13  ? 314  MET C CB  1 
ATOM   8343  C CG  . MET C 1 303 ? -12.393 0.045   15.954  1.00 91.13  ? 314  MET C CG  1 
ATOM   8344  S SD  . MET C 1 303 ? -14.180 -0.140  16.104  1.00 91.13  ? 314  MET C SD  1 
ATOM   8345  C CE  . MET C 1 303 ? -14.590 -0.515  14.455  1.00 91.13  ? 314  MET C CE  1 
ATOM   8346  N N   . TYR C 1 304 ? -11.122 -4.156  17.243  1.00 57.80  ? 315  TYR C N   1 
ATOM   8347  C CA  . TYR C 1 304 ? -11.590 -5.523  17.397  1.00 57.80  ? 315  TYR C CA  1 
ATOM   8348  C C   . TYR C 1 304 ? -10.514 -6.444  17.961  1.00 57.80  ? 315  TYR C C   1 
ATOM   8349  O O   . TYR C 1 304 ? -10.088 -7.381  17.296  1.00 57.80  ? 315  TYR C O   1 
ATOM   8350  C CB  . TYR C 1 304 ? -12.048 -6.051  16.036  1.00 81.42  ? 315  TYR C CB  1 
ATOM   8351  C CG  . TYR C 1 304 ? -13.053 -5.177  15.307  1.00 81.42  ? 315  TYR C CG  1 
ATOM   8352  C CD1 . TYR C 1 304 ? -14.413 -5.229  15.620  1.00 81.42  ? 315  TYR C CD1 1 
ATOM   8353  C CD2 . TYR C 1 304 ? -12.654 -4.364  14.248  1.00 81.42  ? 315  TYR C CD2 1 
ATOM   8354  C CE1 . TYR C 1 304 ? -15.353 -4.506  14.885  1.00 81.42  ? 315  TYR C CE1 1 
ATOM   8355  C CE2 . TYR C 1 304 ? -13.582 -3.635  13.509  1.00 81.42  ? 315  TYR C CE2 1 
ATOM   8356  C CZ  . TYR C 1 304 ? -14.931 -3.715  13.827  1.00 81.42  ? 315  TYR C CZ  1 
ATOM   8357  O OH  . TYR C 1 304 ? -15.856 -3.035  13.060  1.00 81.42  ? 315  TYR C OH  1 
ATOM   8358  N N   . PRO C 1 305 ? -10.081 -6.205  19.203  1.00 79.73  ? 316  PRO C N   1 
ATOM   8359  C CA  . PRO C 1 305 ? -9.042  -7.028  19.838  1.00 79.73  ? 316  PRO C CA  1 
ATOM   8360  C C   . PRO C 1 305 ? -9.312  -8.512  19.693  1.00 79.73  ? 316  PRO C C   1 
ATOM   8361  O O   . PRO C 1 305 ? -10.421 -8.906  19.344  1.00 79.73  ? 316  PRO C O   1 
ATOM   8362  C CB  . PRO C 1 305 ? -9.082  -6.574  21.289  1.00 79.54  ? 316  PRO C CB  1 
ATOM   8363  C CG  . PRO C 1 305 ? -10.505 -6.169  21.468  1.00 79.54  ? 316  PRO C CG  1 
ATOM   8364  C CD  . PRO C 1 305 ? -10.792 -5.402  20.208  1.00 79.54  ? 316  PRO C CD  1 
ATOM   8365  N N   . GLY C 1 306 ? -8.298  -9.332  19.948  1.00 183.80 ? 317  GLY C N   1 
ATOM   8366  C CA  . GLY C 1 306 ? -8.466  -10.769 19.825  1.00 183.80 ? 317  GLY C CA  1 
ATOM   8367  C C   . GLY C 1 306 ? -8.791  -11.196 18.405  1.00 183.80 ? 317  GLY C C   1 
ATOM   8368  O O   . GLY C 1 306 ? -7.896  -11.342 17.572  1.00 183.80 ? 317  GLY C O   1 
ATOM   8369  N N   . ASN C 1 307 ? -10.077 -11.401 18.135  1.00 160.82 ? 318  ASN C N   1 
ATOM   8370  C CA  . ASN C 1 307 ? -10.548 -11.803 16.814  1.00 160.82 ? 318  ASN C CA  1 
ATOM   8371  C C   . ASN C 1 307 ? -9.877  -10.982 15.716  1.00 160.82 ? 318  ASN C C   1 
ATOM   8372  O O   . ASN C 1 307 ? -10.397 -9.943  15.303  1.00 160.82 ? 318  ASN C O   1 
ATOM   8373  C CB  . ASN C 1 307 ? -12.063 -11.616 16.737  1.00 113.81 ? 318  ASN C CB  1 
ATOM   8374  C CG  . ASN C 1 307 ? -12.811 -12.929 16.671  1.00 113.81 ? 318  ASN C CG  1 
ATOM   8375  O OD1 . ASN C 1 307 ? -14.038 -12.960 16.770  1.00 113.81 ? 318  ASN C OD1 1 
ATOM   8376  N ND2 . ASN C 1 307 ? -12.078 -14.022 16.494  1.00 113.81 ? 318  ASN C ND2 1 
ATOM   8377  N N   . VAL C 1 308 ? -8.730  -11.452 15.234  1.00 66.81  ? 319  VAL C N   1 
ATOM   8378  C CA  . VAL C 1 308 ? -8.003  -10.727 14.198  1.00 66.81  ? 319  VAL C CA  1 
ATOM   8379  C C   . VAL C 1 308 ? -8.189  -11.359 12.821  1.00 66.81  ? 319  VAL C C   1 
ATOM   8380  O O   . VAL C 1 308 ? -8.022  -10.701 11.793  1.00 66.81  ? 319  VAL C O   1 
ATOM   8381  C CB  . VAL C 1 308 ? -6.485  -10.650 14.535  1.00 110.89 ? 319  VAL C CB  1 
ATOM   8382  C CG1 . VAL C 1 308 ? -5.842  -12.019 14.369  1.00 110.89 ? 319  VAL C CG1 1 
ATOM   8383  C CG2 . VAL C 1 308 ? -5.798  -9.613  13.657  1.00 110.89 ? 319  VAL C CG2 1 
ATOM   8384  N N   . SER C 1 309 ? -8.540  -12.639 12.806  1.00 114.14 ? 320  SER C N   1 
ATOM   8385  C CA  . SER C 1 309 ? -8.747  -13.371 11.559  1.00 114.14 ? 320  SER C CA  1 
ATOM   8386  C C   . SER C 1 309 ? -9.811  -12.679 10.700  1.00 114.14 ? 320  SER C C   1 
ATOM   8387  O O   . SER C 1 309 ? -9.640  -12.466 9.496   1.00 114.14 ? 320  SER C O   1 
ATOM   8388  C CB  . SER C 1 309 ? -9.195  -14.802 11.880  1.00 115.37 ? 320  SER C CB  1 
ATOM   8389  O OG  . SER C 1 309 ? -8.417  -15.365 12.926  1.00 115.37 ? 320  SER C OG  1 
ATOM   8390  N N   . LYS C 1 310 ? -10.909 -12.332 11.360  1.00 167.61 ? 321  LYS C N   1 
ATOM   8391  C CA  . LYS C 1 310 ? -12.066 -11.677 10.761  1.00 167.61 ? 321  LYS C CA  1 
ATOM   8392  C C   . LYS C 1 310 ? -11.708 -10.378 10.030  1.00 167.61 ? 321  LYS C C   1 
ATOM   8393  O O   . LYS C 1 310 ? -12.573 -9.748  9.423   1.00 167.61 ? 321  LYS C O   1 
ATOM   8394  C CB  . LYS C 1 310 ? -13.079 -11.399 11.887  1.00 81.83  ? 321  LYS C CB  1 
ATOM   8395  C CG  . LYS C 1 310 ? -14.527 -11.126 11.481  1.00 81.83  ? 321  LYS C CG  1 
ATOM   8396  C CD  . LYS C 1 310 ? -15.389 -10.891 12.722  1.00 81.83  ? 321  LYS C CD  1 
ATOM   8397  C CE  . LYS C 1 310 ? -14.830 -9.736  13.558  1.00 81.83  ? 321  LYS C CE  1 
ATOM   8398  N NZ  . LYS C 1 310 ? -15.460 -9.581  14.907  1.00 81.83  ? 321  LYS C NZ  1 
ATOM   8399  N N   . LEU C 1 311 ? -10.435 -9.990  10.065  1.00 82.32  ? 322  LEU C N   1 
ATOM   8400  C CA  . LEU C 1 311 ? -10.005 -8.743  9.433   1.00 82.32  ? 322  LEU C CA  1 
ATOM   8401  C C   . LEU C 1 311 ? -9.151  -8.861  8.172   1.00 82.32  ? 322  LEU C C   1 
ATOM   8402  O O   . LEU C 1 311 ? -8.973  -7.881  7.448   1.00 82.32  ? 322  LEU C O   1 
ATOM   8403  C CB  . LEU C 1 311 ? -9.223  -7.898  10.435  1.00 63.22  ? 322  LEU C CB  1 
ATOM   8404  C CG  . LEU C 1 311 ? -9.828  -7.656  11.807  1.00 63.22  ? 322  LEU C CG  1 
ATOM   8405  C CD1 . LEU C 1 311 ? -8.822  -6.879  12.657  1.00 63.22  ? 322  LEU C CD1 1 
ATOM   8406  C CD2 . LEU C 1 311 ? -11.133 -6.899  11.661  1.00 63.22  ? 322  LEU C CD2 1 
ATOM   8407  N N   . HIS C 1 312 ? -8.614  -10.041 7.904   1.00 62.18  ? 323  HIS C N   1 
ATOM   8408  C CA  . HIS C 1 312 ? -7.753  -10.205 6.745   1.00 62.18  ? 323  HIS C CA  1 
ATOM   8409  C C   . HIS C 1 312 ? -8.346  -9.742  5.436   1.00 62.18  ? 323  HIS C C   1 
ATOM   8410  O O   . HIS C 1 312 ? -9.473  -10.079 5.081   1.00 62.18  ? 323  HIS C O   1 
ATOM   8411  C CB  . HIS C 1 312 ? -7.302  -11.655 6.642   1.00 101.72 ? 323  HIS C CB  1 
ATOM   8412  C CG  . HIS C 1 312 ? -6.562  -12.117 7.851   1.00 101.72 ? 323  HIS C CG  1 
ATOM   8413  N ND1 . HIS C 1 312 ? -5.388  -11.528 8.266   1.00 101.72 ? 323  HIS C ND1 1 
ATOM   8414  C CD2 . HIS C 1 312 ? -6.870  -13.045 8.787   1.00 101.72 ? 323  HIS C CD2 1 
ATOM   8415  C CE1 . HIS C 1 312 ? -5.007  -12.070 9.409   1.00 101.72 ? 323  HIS C CE1 1 
ATOM   8416  N NE2 . HIS C 1 312 ? -5.890  -12.993 9.747   1.00 101.72 ? 323  HIS C NE2 1 
ATOM   8417  N N   . GLY C 1 313 ? -7.559  -8.938  4.736   1.00 56.03  ? 324  GLY C N   1 
ATOM   8418  C CA  . GLY C 1 313 ? -7.955  -8.412  3.446   1.00 56.03  ? 324  GLY C CA  1 
ATOM   8419  C C   . GLY C 1 313 ? -6.979  -8.965  2.432   1.00 56.03  ? 324  GLY C C   1 
ATOM   8420  O O   . GLY C 1 313 ? -5.769  -8.940  2.650   1.00 56.03  ? 324  GLY C O   1 
ATOM   8421  N N   . ARG C 1 314 ? -7.498  -9.478  1.327   1.00 93.31  ? 325  ARG C N   1 
ATOM   8422  C CA  . ARG C 1 314 ? -6.649  -10.054 0.305   1.00 93.31  ? 325  ARG C CA  1 
ATOM   8423  C C   . ARG C 1 314 ? -5.857  -9.035  -0.498  1.00 93.31  ? 325  ARG C C   1 
ATOM   8424  O O   . ARG C 1 314 ? -6.419  -8.101  -1.071  1.00 93.31  ? 325  ARG C O   1 
ATOM   8425  C CB  . ARG C 1 314 ? -7.481  -10.932 -0.638  1.00 110.04 ? 325  ARG C CB  1 
ATOM   8426  C CG  . ARG C 1 314 ? -7.881  -12.265 -0.026  1.00 110.04 ? 325  ARG C CG  1 
ATOM   8427  C CD  . ARG C 1 314 ? -8.545  -13.190 -1.039  1.00 110.04 ? 325  ARG C CD  1 
ATOM   8428  N NE  . ARG C 1 314 ? -8.595  -14.571 -0.556  1.00 110.04 ? 325  ARG C NE  1 
ATOM   8429  C CZ  . ARG C 1 314 ? -7.521  -15.323 -0.309  1.00 110.04 ? 325  ARG C CZ  1 
ATOM   8430  N NH1 . ARG C 1 314 ? -6.301  -14.836 -0.499  1.00 110.04 ? 325  ARG C NH1 1 
ATOM   8431  N NH2 . ARG C 1 314 ? -7.666  -16.564 0.135   1.00 110.04 ? 325  ARG C NH2 1 
ATOM   8432  N N   . ASP C 1 315 ? -4.539  -9.215  -0.501  1.00 95.31  ? 326  ASP C N   1 
ATOM   8433  C CA  . ASP C 1 315 ? -3.622  -8.377  -1.267  1.00 95.31  ? 326  ASP C CA  1 
ATOM   8434  C C   . ASP C 1 315 ? -2.990  -9.387  -2.208  1.00 95.31  ? 326  ASP C C   1 
ATOM   8435  O O   . ASP C 1 315 ? -1.992  -10.021 -1.867  1.00 95.31  ? 326  ASP C O   1 
ATOM   8436  C CB  . ASP C 1 315 ? -2.543  -7.763  -0.375  1.00 97.58  ? 326  ASP C CB  1 
ATOM   8437  C CG  . ASP C 1 315 ? -1.442  -7.090  -1.179  1.00 97.58  ? 326  ASP C CG  1 
ATOM   8438  O OD1 . ASP C 1 315 ? -1.770  -6.255  -2.044  1.00 97.58  ? 326  ASP C OD1 1 
ATOM   8439  O OD2 . ASP C 1 315 ? -0.250  -7.391  -0.950  1.00 97.58  ? 326  ASP C OD2 1 
ATOM   8440  N N   . GLY C 1 316 ? -3.572  -9.541  -3.392  1.00 65.38  ? 327  GLY C N   1 
ATOM   8441  C CA  . GLY C 1 316 ? -3.061  -10.538 -4.302  1.00 65.38  ? 327  GLY C CA  1 
ATOM   8442  C C   . GLY C 1 316 ? -3.377  -11.848 -3.601  1.00 65.38  ? 327  GLY C C   1 
ATOM   8443  O O   . GLY C 1 316 ? -4.519  -12.060 -3.181  1.00 65.38  ? 327  GLY C O   1 
ATOM   8444  N N   . ARG C 1 317 ? -2.371  -12.710 -3.445  1.00 110.34 ? 328  ARG C N   1 
ATOM   8445  C CA  . ARG C 1 317 ? -2.536  -14.010 -2.783  1.00 110.34 ? 328  ARG C CA  1 
ATOM   8446  C C   . ARG C 1 317 ? -1.963  -13.964 -1.367  1.00 110.34 ? 328  ARG C C   1 
ATOM   8447  O O   . ARG C 1 317 ? -1.427  -14.955 -0.864  1.00 110.34 ? 328  ARG C O   1 
ATOM   8448  C CB  . ARG C 1 317 ? -1.823  -15.101 -3.594  1.00 199.89 ? 328  ARG C CB  1 
ATOM   8449  C CG  . ARG C 1 317 ? -2.398  -15.306 -4.990  1.00 199.89 ? 328  ARG C CG  1 
ATOM   8450  C CD  . ARG C 1 317 ? -1.444  -16.065 -5.902  1.00 199.89 ? 328  ARG C CD  1 
ATOM   8451  N NE  . ARG C 1 317 ? -2.003  -16.237 -7.242  1.00 199.89 ? 328  ARG C NE  1 
ATOM   8452  C CZ  . ARG C 1 317 ? -1.318  -16.687 -8.289  1.00 199.89 ? 328  ARG C CZ  1 
ATOM   8453  N NH1 . ARG C 1 317 ? -0.039  -17.013 -8.157  1.00 199.89 ? 328  ARG C NH1 1 
ATOM   8454  N NH2 . ARG C 1 317 ? -1.912  -16.815 -9.468  1.00 199.89 ? 328  ARG C NH2 1 
ATOM   8455  N N   . LYS C 1 318 ? -2.104  -12.807 -0.725  1.00 140.91 ? 329  LYS C N   1 
ATOM   8456  C CA  . LYS C 1 318 ? -1.578  -12.592 0.618   1.00 140.91 ? 329  LYS C CA  1 
ATOM   8457  C C   . LYS C 1 318 ? -2.637  -12.053 1.592   1.00 140.91 ? 329  LYS C C   1 
ATOM   8458  O O   . LYS C 1 318 ? -3.220  -10.992 1.368   1.00 140.91 ? 329  LYS C O   1 
ATOM   8459  C CB  . LYS C 1 318 ? -0.394  -11.620 0.530   1.00 100.28 ? 329  LYS C CB  1 
ATOM   8460  C CG  . LYS C 1 318 ? 0.514   -11.885 -0.679  1.00 100.28 ? 329  LYS C CG  1 
ATOM   8461  C CD  . LYS C 1 318 ? 1.595   -10.821 -0.850  1.00 100.28 ? 329  LYS C CD  1 
ATOM   8462  C CE  . LYS C 1 318 ? 2.366   -10.992 -2.166  1.00 100.28 ? 329  LYS C CE  1 
ATOM   8463  N NZ  . LYS C 1 318 ? 1.510   -10.791 -3.373  1.00 100.28 ? 329  LYS C NZ  1 
ATOM   8464  N N   . ASN C 1 319 ? -2.871  -12.795 2.673   1.00 118.52 ? 330  ASN C N   1 
ATOM   8465  C CA  . ASN C 1 319 ? -3.847  -12.416 3.696   1.00 118.52 ? 330  ASN C CA  1 
ATOM   8466  C C   . ASN C 1 319 ? -3.218  -11.456 4.698   1.00 118.52 ? 330  ASN C C   1 
ATOM   8467  O O   . ASN C 1 319 ? -2.262  -11.808 5.388   1.00 118.52 ? 330  ASN C O   1 
ATOM   8468  C CB  . ASN C 1 319 ? -4.338  -13.655 4.447   1.00 159.39 ? 330  ASN C CB  1 
ATOM   8469  C CG  . ASN C 1 319 ? -4.882  -14.719 3.523   1.00 159.39 ? 330  ASN C CG  1 
ATOM   8470  O OD1 . ASN C 1 319 ? -5.849  -14.490 2.795   1.00 159.39 ? 330  ASN C OD1 1 
ATOM   8471  N ND2 . ASN C 1 319 ? -4.263  -15.894 3.546   1.00 159.39 ? 330  ASN C ND2 1 
ATOM   8472  N N   . VAL C 1 320 ? -3.765  -10.250 4.794   1.00 89.79  ? 331  VAL C N   1 
ATOM   8473  C CA  . VAL C 1 320 ? -3.219  -9.265  5.714   1.00 89.79  ? 331  VAL C CA  1 
ATOM   8474  C C   . VAL C 1 320 ? -4.290  -8.399  6.392   1.00 89.79  ? 331  VAL C C   1 
ATOM   8475  O O   . VAL C 1 320 ? -5.473  -8.485  6.066   1.00 89.79  ? 331  VAL C O   1 
ATOM   8476  C CB  . VAL C 1 320 ? -2.192  -8.356  4.969   1.00 78.90  ? 331  VAL C CB  1 
ATOM   8477  C CG1 . VAL C 1 320 ? -2.901  -7.454  3.982   1.00 78.90  ? 331  VAL C CG1 1 
ATOM   8478  C CG2 . VAL C 1 320 ? -1.384  -7.547  5.961   1.00 78.90  ? 331  VAL C CG2 1 
ATOM   8479  N N   . VAL C 1 321 ? -3.857  -7.601  7.367   1.00 71.17  ? 332  VAL C N   1 
ATOM   8480  C CA  . VAL C 1 321 ? -4.718  -6.674  8.101   1.00 71.17  ? 332  VAL C CA  1 
ATOM   8481  C C   . VAL C 1 321 ? -4.328  -5.317  7.543   1.00 71.17  ? 332  VAL C C   1 
ATOM   8482  O O   . VAL C 1 321 ? -3.197  -4.869  7.705   1.00 71.17  ? 332  VAL C O   1 
ATOM   8483  C CB  . VAL C 1 321 ? -4.439  -6.698  9.620   1.00 96.93  ? 332  VAL C CB  1 
ATOM   8484  C CG1 . VAL C 1 321 ? -4.993  -5.448  10.262  1.00 96.93  ? 332  VAL C CG1 1 
ATOM   8485  C CG2 . VAL C 1 321 ? -5.083  -7.923  10.255  1.00 96.93  ? 332  VAL C CG2 1 
ATOM   8486  N N   . PRO C 1 322 ? -5.269  -4.643  6.882   1.00 56.04  ? 333  PRO C N   1 
ATOM   8487  C CA  . PRO C 1 322 ? -5.050  -3.330  6.269   1.00 56.04  ? 333  PRO C CA  1 
ATOM   8488  C C   . PRO C 1 322 ? -4.626  -2.158  7.153   1.00 56.04  ? 333  PRO C C   1 
ATOM   8489  O O   . PRO C 1 322 ? -4.565  -2.249  8.383   1.00 56.04  ? 333  PRO C O   1 
ATOM   8490  C CB  . PRO C 1 322 ? -6.371  -3.062  5.568   1.00 43.63  ? 333  PRO C CB  1 
ATOM   8491  C CG  . PRO C 1 322 ? -7.365  -3.720  6.496   1.00 43.63  ? 333  PRO C CG  1 
ATOM   8492  C CD  . PRO C 1 322 ? -6.695  -5.019  6.844   1.00 43.63  ? 333  PRO C CD  1 
ATOM   8493  N N   . CYS C 1 323 ? -4.323  -1.050  6.488   1.00 69.33  ? 334  CYS C N   1 
ATOM   8494  C CA  . CYS C 1 323 ? -3.913  0.174   7.149   1.00 69.33  ? 334  CYS C CA  1 
ATOM   8495  C C   . CYS C 1 323 ? -4.985  1.215   6.919   1.00 69.33  ? 334  CYS C C   1 
ATOM   8496  O O   . CYS C 1 323 ? -5.381  1.477   5.782   1.00 69.33  ? 334  CYS C O   1 
ATOM   8497  C CB  . CYS C 1 323 ? -2.590  0.689   6.579   1.00 98.37  ? 334  CYS C CB  1 
ATOM   8498  S SG  . CYS C 1 323 ? -1.142  0.278   7.562   1.00 98.37  ? 334  CYS C SG  1 
ATOM   8499  N N   . VAL C 1 324 ? -5.464  1.801   8.006   1.00 49.62  ? 335  VAL C N   1 
ATOM   8500  C CA  . VAL C 1 324 ? -6.482  2.825   7.906   1.00 49.62  ? 335  VAL C CA  1 
ATOM   8501  C C   . VAL C 1 324 ? -5.791  4.139   7.564   1.00 49.62  ? 335  VAL C C   1 
ATOM   8502  O O   . VAL C 1 324 ? -4.966  4.665   8.311   1.00 49.62  ? 335  VAL C O   1 
ATOM   8503  C CB  . VAL C 1 324 ? -7.329  2.954   9.224   1.00 73.35  ? 335  VAL C CB  1 
ATOM   8504  C CG1 . VAL C 1 324 ? -8.205  1.726   9.403   1.00 73.35  ? 335  VAL C CG1 1 
ATOM   8505  C CG2 . VAL C 1 324 ? -6.422  3.113   10.437  1.00 73.35  ? 335  VAL C CG2 1 
ATOM   8506  N N   . LEU C 1 325 ? -6.117  4.626   6.379   1.00 39.66  ? 336  LEU C N   1 
ATOM   8507  C CA  . LEU C 1 325 ? -5.592  5.869   5.859   1.00 39.66  ? 336  LEU C CA  1 
ATOM   8508  C C   . LEU C 1 325 ? -6.807  6.798   5.833   1.00 39.66  ? 336  LEU C C   1 
ATOM   8509  O O   . LEU C 1 325 ? -7.635  6.751   4.933   1.00 39.66  ? 336  LEU C O   1 
ATOM   8510  C CB  . LEU C 1 325 ? -5.027  5.622   4.459   1.00 68.85  ? 336  LEU C CB  1 
ATOM   8511  C CG  . LEU C 1 325 ? -4.273  6.746   3.761   1.00 68.85  ? 336  LEU C CG  1 
ATOM   8512  C CD1 . LEU C 1 325 ? -3.540  6.161   2.583   1.00 68.85  ? 336  LEU C CD1 1 
ATOM   8513  C CD2 . LEU C 1 325 ? -5.225  7.838   3.316   1.00 68.85  ? 336  LEU C CD2 1 
ATOM   8514  N N   . SER C 1 326 ? -6.904  7.630   6.854   1.00 34.69  ? 337  SER C N   1 
ATOM   8515  C CA  . SER C 1 326 ? -8.017  8.550   7.011   1.00 34.69  ? 337  SER C CA  1 
ATOM   8516  C C   . SER C 1 326 ? -7.820  9.911   6.359   1.00 34.69  ? 337  SER C C   1 
ATOM   8517  O O   . SER C 1 326 ? -6.818  10.567  6.591   1.00 34.69  ? 337  SER C O   1 
ATOM   8518  C CB  . SER C 1 326 ? -8.292  8.733   8.515   1.00 68.94  ? 337  SER C CB  1 
ATOM   8519  O OG  . SER C 1 326 ? -9.350  9.641   8.764   1.00 68.94  ? 337  SER C OG  1 
ATOM   8520  N N   . VAL C 1 327 ? -8.766  10.328  5.528   1.00 52.60  ? 338  VAL C N   1 
ATOM   8521  C CA  . VAL C 1 327 ? -8.672  11.647  4.917   1.00 52.60  ? 338  VAL C CA  1 
ATOM   8522  C C   . VAL C 1 327 ? -9.875  12.392  5.463   1.00 52.60  ? 338  VAL C C   1 
ATOM   8523  O O   . VAL C 1 327 ? -10.965 11.826  5.541   1.00 52.60  ? 338  VAL C O   1 
ATOM   8524  C CB  . VAL C 1 327 ? -8.785  11.624  3.376   1.00 34.92  ? 338  VAL C CB  1 
ATOM   8525  C CG1 . VAL C 1 327 ? -8.417  12.979  2.820   1.00 34.92  ? 338  VAL C CG1 1 
ATOM   8526  C CG2 . VAL C 1 327 ? -7.875  10.581  2.789   1.00 34.92  ? 338  VAL C CG2 1 
ATOM   8527  N N   . ASN C 1 328 ? -9.692  13.647  5.857   1.00 55.26  ? 339  ASN C N   1 
ATOM   8528  C CA  . ASN C 1 328 ? -10.810 14.405  6.390   1.00 55.26  ? 339  ASN C CA  1 
ATOM   8529  C C   . ASN C 1 328 ? -10.703 15.893  6.105   1.00 55.26  ? 339  ASN C C   1 
ATOM   8530  O O   . ASN C 1 328 ? -9.813  16.557  6.625   1.00 55.26  ? 339  ASN C O   1 
ATOM   8531  C CB  . ASN C 1 328 ? -10.918 14.174  7.887   1.00 64.40  ? 339  ASN C CB  1 
ATOM   8532  C CG  . ASN C 1 328 ? -12.208 14.700  8.454   1.00 64.40  ? 339  ASN C CG  1 
ATOM   8533  O OD1 . ASN C 1 328 ? -12.460 15.902  8.424   1.00 64.40  ? 339  ASN C OD1 1 
ATOM   8534  N ND2 . ASN C 1 328 ? -13.044 13.798  8.972   1.00 64.40  ? 339  ASN C ND2 1 
ATOM   8535  N N   . GLY C 1 329 ? -11.610 16.410  5.275   1.00 38.25  ? 340  GLY C N   1 
ATOM   8536  C CA  . GLY C 1 329 ? -11.592 17.822  4.942   1.00 38.25  ? 340  GLY C CA  1 
ATOM   8537  C C   . GLY C 1 329 ? -12.782 18.557  5.522   1.00 38.25  ? 340  GLY C C   1 
ATOM   8538  O O   . GLY C 1 329 ? -13.836 17.949  5.749   1.00 38.25  ? 340  GLY C O   1 
ATOM   8539  N N   . ASP C 1 330 ? -12.615 19.860  5.754   1.00 59.04  ? 341  ASP C N   1 
ATOM   8540  C CA  . ASP C 1 330 ? -13.660 20.720  6.319   1.00 59.04  ? 341  ASP C CA  1 
ATOM   8541  C C   . ASP C 1 330 ? -14.428 21.461  5.208   1.00 59.04  ? 341  ASP C C   1 
ATOM   8542  O O   . ASP C 1 330 ? -14.018 22.543  4.783   1.00 59.04  ? 341  ASP C O   1 
ATOM   8543  C CB  . ASP C 1 330 ? -13.021 21.743  7.258   1.00 83.79  ? 341  ASP C CB  1 
ATOM   8544  C CG  . ASP C 1 330 ? -14.009 22.343  8.233   1.00 83.79  ? 341  ASP C CG  1 
ATOM   8545  O OD1 . ASP C 1 330 ? -15.184 22.551  7.848   1.00 83.79  ? 341  ASP C OD1 1 
ATOM   8546  O OD2 . ASP C 1 330 ? -13.595 22.617  9.384   1.00 83.79  ? 341  ASP C OD2 1 
ATOM   8547  N N   . LEU C 1 331 ? -15.542 20.888  4.750   1.00 35.18  ? 342  LEU C N   1 
ATOM   8548  C CA  . LEU C 1 331 ? -16.320 21.501  3.686   1.00 35.18  ? 342  LEU C CA  1 
ATOM   8549  C C   . LEU C 1 331 ? -16.754 22.928  3.944   1.00 35.18  ? 342  LEU C C   1 
ATOM   8550  O O   . LEU C 1 331 ? -16.819 23.722  3.015   1.00 35.18  ? 342  LEU C O   1 
ATOM   8551  C CB  . LEU C 1 331 ? -17.559 20.664  3.374   1.00 35.08  ? 342  LEU C CB  1 
ATOM   8552  C CG  . LEU C 1 331 ? -17.394 19.521  2.376   1.00 35.08  ? 342  LEU C CG  1 
ATOM   8553  C CD1 . LEU C 1 331 ? -18.724 18.849  2.243   1.00 35.08  ? 342  LEU C CD1 1 
ATOM   8554  C CD2 . LEU C 1 331 ? -16.915 20.017  1.015   1.00 35.08  ? 342  LEU C CD2 1 
ATOM   8555  N N   . ASP C 1 332 ? -17.067 23.251  5.196   1.00 46.58  ? 343  ASP C N   1 
ATOM   8556  C CA  . ASP C 1 332 ? -17.517 24.603  5.541   1.00 46.58  ? 343  ASP C CA  1 
ATOM   8557  C C   . ASP C 1 332 ? -16.399 25.626  5.452   1.00 46.58  ? 343  ASP C C   1 
ATOM   8558  O O   . ASP C 1 332 ? -16.569 26.721  4.931   1.00 46.58  ? 343  ASP C O   1 
ATOM   8559  C CB  . ASP C 1 332 ? -18.129 24.622  6.945   1.00 80.10  ? 343  ASP C CB  1 
ATOM   8560  C CG  . ASP C 1 332 ? -19.457 23.891  7.007   1.00 80.10  ? 343  ASP C CG  1 
ATOM   8561  O OD1 . ASP C 1 332 ? -20.328 24.166  6.159   1.00 80.10  ? 343  ASP C OD1 1 
ATOM   8562  O OD2 . ASP C 1 332 ? -19.642 23.046  7.905   1.00 80.10  ? 343  ASP C OD2 1 
ATOM   8563  N N   . ARG C 1 333 ? -15.243 25.258  5.965   1.00 62.37  ? 344  ARG C N   1 
ATOM   8564  C CA  . ARG C 1 333 ? -14.117 26.159  5.919   1.00 62.37  ? 344  ARG C CA  1 
ATOM   8565  C C   . ARG C 1 333 ? -13.736 26.336  4.448   1.00 62.37  ? 344  ARG C C   1 
ATOM   8566  O O   . ARG C 1 333 ? -13.238 27.399  4.050   1.00 62.37  ? 344  ARG C O   1 
ATOM   8567  C CB  . ARG C 1 333 ? -12.960 25.577  6.744   1.00 70.95  ? 344  ARG C CB  1 
ATOM   8568  C CG  . ARG C 1 333 ? -11.838 26.557  6.987   1.00 70.95  ? 344  ARG C CG  1 
ATOM   8569  C CD  . ARG C 1 333 ? -10.979 26.176  8.179   1.00 70.95  ? 344  ARG C CD  1 
ATOM   8570  N NE  . ARG C 1 333 ? -11.570 26.577  9.454   1.00 70.95  ? 344  ARG C NE  1 
ATOM   8571  C CZ  . ARG C 1 333 ? -11.038 26.292  10.640  1.00 70.95  ? 344  ARG C CZ  1 
ATOM   8572  N NH1 . ARG C 1 333 ? -9.909  25.605  10.710  1.00 70.95  ? 344  ARG C NH1 1 
ATOM   8573  N NH2 . ARG C 1 333 ? -11.630 26.691  11.756  1.00 70.95  ? 344  ARG C NH2 1 
ATOM   8574  N N   . GLY C 1 334 ? -14.008 25.294  3.651   1.00 28.93  ? 345  GLY C N   1 
ATOM   8575  C CA  . GLY C 1 334 ? -13.694 25.295  2.222   1.00 28.93  ? 345  GLY C CA  1 
ATOM   8576  C C   . GLY C 1 334 ? -14.647 26.172  1.437   1.00 28.93  ? 345  GLY C C   1 
ATOM   8577  O O   . GLY C 1 334 ? -14.308 26.691  0.373   1.00 28.93  ? 345  GLY C O   1 
ATOM   8578  N N   . MET C 1 335 ? -15.845 26.334  1.996   1.00 36.59  ? 346  MET C N   1 
ATOM   8579  C CA  . MET C 1 335 ? -16.897 27.140  1.413   1.00 36.59  ? 346  MET C CA  1 
ATOM   8580  C C   . MET C 1 335 ? -16.542 28.619  1.648   1.00 36.59  ? 346  MET C C   1 
ATOM   8581  O O   . MET C 1 335 ? -16.904 29.487  0.850   1.00 36.59  ? 346  MET C O   1 
ATOM   8582  C CB  . MET C 1 335 ? -18.224 26.762  2.068   1.00 98.50  ? 346  MET C CB  1 
ATOM   8583  C CG  . MET C 1 335 ? -19.459 27.054  1.240   1.00 98.50  ? 346  MET C CG  1 
ATOM   8584  S SD  . MET C 1 335 ? -19.986 28.757  1.381   1.00 98.50  ? 346  MET C SD  1 
ATOM   8585  C CE  . MET C 1 335 ? -20.934 28.686  2.888   1.00 98.50  ? 346  MET C CE  1 
ATOM   8586  N N   . LEU C 1 336 ? -15.825 28.899  2.741   1.00 56.17  ? 347  LEU C N   1 
ATOM   8587  C CA  . LEU C 1 336 ? -15.382 30.267  3.054   1.00 56.17  ? 347  LEU C CA  1 
ATOM   8588  C C   . LEU C 1 336 ? -14.052 30.485  2.342   1.00 56.17  ? 347  LEU C C   1 
ATOM   8589  O O   . LEU C 1 336 ? -13.732 31.579  1.904   1.00 56.17  ? 347  LEU C O   1 
ATOM   8590  C CB  . LEU C 1 336 ? -15.126 30.461  4.548   1.00 59.75  ? 347  LEU C CB  1 
ATOM   8591  C CG  . LEU C 1 336 ? -16.034 29.853  5.598   1.00 59.75  ? 347  LEU C CG  1 
ATOM   8592  C CD1 . LEU C 1 336 ? -15.585 30.380  6.938   1.00 59.75  ? 347  LEU C CD1 1 
ATOM   8593  C CD2 . LEU C 1 336 ? -17.470 30.216  5.355   1.00 59.75  ? 347  LEU C CD2 1 
ATOM   8594  N N   . ALA C 1 337 ? -13.263 29.427  2.271   1.00 52.21  ? 348  ALA C N   1 
ATOM   8595  C CA  . ALA C 1 337 ? -11.991 29.507  1.612   1.00 52.21  ? 348  ALA C CA  1 
ATOM   8596  C C   . ALA C 1 337 ? -12.244 30.067  0.220   1.00 52.21  ? 348  ALA C C   1 
ATOM   8597  O O   . ALA C 1 337 ? -11.599 31.029  -0.206  1.00 52.21  ? 348  ALA C O   1 
ATOM   8598  C CB  . ALA C 1 337 ? -11.374 28.126  1.524   1.00 28.62  ? 348  ALA C CB  1 
ATOM   8599  N N   . TYR C 1 338 ? -13.212 29.484  -0.479  1.00 49.75  ? 349  TYR C N   1 
ATOM   8600  C CA  . TYR C 1 338 ? -13.516 29.914  -1.835  1.00 49.75  ? 349  TYR C CA  1 
ATOM   8601  C C   . TYR C 1 338 ? -14.122 31.297  -1.985  1.00 49.75  ? 349  TYR C C   1 
ATOM   8602  O O   . TYR C 1 338 ? -13.761 32.020  -2.912  1.00 49.75  ? 349  TYR C O   1 
ATOM   8603  C CB  . TYR C 1 338 ? -14.393 28.872  -2.530  1.00 50.03  ? 349  TYR C CB  1 
ATOM   8604  C CG  . TYR C 1 338 ? -13.615 27.636  -2.931  1.00 50.03  ? 349  TYR C CG  1 
ATOM   8605  C CD1 . TYR C 1 338 ? -12.475 27.737  -3.739  1.00 50.03  ? 349  TYR C CD1 1 
ATOM   8606  C CD2 . TYR C 1 338 ? -14.008 26.368  -2.505  1.00 50.03  ? 349  TYR C CD2 1 
ATOM   8607  C CE1 . TYR C 1 338 ? -11.757 26.615  -4.105  1.00 50.03  ? 349  TYR C CE1 1 
ATOM   8608  C CE2 . TYR C 1 338 ? -13.295 25.242  -2.866  1.00 50.03  ? 349  TYR C CE2 1 
ATOM   8609  C CZ  . TYR C 1 338 ? -12.175 25.376  -3.665  1.00 50.03  ? 349  TYR C CZ  1 
ATOM   8610  O OH  . TYR C 1 338 ? -11.475 24.260  -4.030  1.00 50.03  ? 349  TYR C OH  1 
ATOM   8611  N N   . LEU C 1 339 ? -15.037 31.678  -1.099  1.00 63.12  ? 350  LEU C N   1 
ATOM   8612  C CA  . LEU C 1 339 ? -15.632 33.004  -1.206  1.00 63.12  ? 350  LEU C CA  1 
ATOM   8613  C C   . LEU C 1 339 ? -14.518 34.043  -1.222  1.00 63.12  ? 350  LEU C C   1 
ATOM   8614  O O   . LEU C 1 339 ? -14.540 34.978  -2.019  1.00 63.12  ? 350  LEU C O   1 
ATOM   8615  C CB  . LEU C 1 339 ? -16.599 33.264  -0.053  1.00 32.68  ? 350  LEU C CB  1 
ATOM   8616  C CG  . LEU C 1 339 ? -17.952 32.597  -0.278  1.00 32.68  ? 350  LEU C CG  1 
ATOM   8617  C CD1 . LEU C 1 339 ? -18.454 31.954  1.002   1.00 32.68  ? 350  LEU C CD1 1 
ATOM   8618  C CD2 . LEU C 1 339 ? -18.928 33.621  -0.776  1.00 32.68  ? 350  LEU C CD2 1 
ATOM   8619  N N   . TYR C 1 340 ? -13.533 33.870  -0.349  1.00 66.62  ? 351  TYR C N   1 
ATOM   8620  C CA  . TYR C 1 340 ? -12.415 34.788  -0.310  1.00 66.62  ? 351  TYR C CA  1 
ATOM   8621  C C   . TYR C 1 340 ? -11.633 34.636  -1.606  1.00 66.62  ? 351  TYR C C   1 
ATOM   8622  O O   . TYR C 1 340 ? -11.465 35.607  -2.335  1.00 66.62  ? 351  TYR C O   1 
ATOM   8623  C CB  . TYR C 1 340 ? -11.537 34.497  0.898   1.00 76.80  ? 351  TYR C CB  1 
ATOM   8624  C CG  . TYR C 1 340 ? -12.003 35.180  2.173   1.00 76.80  ? 351  TYR C CG  1 
ATOM   8625  C CD1 . TYR C 1 340 ? -11.540 36.450  2.515   1.00 76.80  ? 351  TYR C CD1 1 
ATOM   8626  C CD2 . TYR C 1 340 ? -12.875 34.543  3.056   1.00 76.80  ? 351  TYR C CD2 1 
ATOM   8627  C CE1 . TYR C 1 340 ? -11.923 37.064  3.709   1.00 76.80  ? 351  TYR C CE1 1 
ATOM   8628  C CE2 . TYR C 1 340 ? -13.266 35.151  4.251   1.00 76.80  ? 351  TYR C CE2 1 
ATOM   8629  C CZ  . TYR C 1 340 ? -12.783 36.410  4.573   1.00 76.80  ? 351  TYR C CZ  1 
ATOM   8630  O OH  . TYR C 1 340 ? -13.140 37.002  5.766   1.00 76.80  ? 351  TYR C OH  1 
ATOM   8631  N N   . ASP C 1 341 ? -11.181 33.424  -1.919  1.00 72.22  ? 352  ASP C N   1 
ATOM   8632  C CA  . ASP C 1 341 ? -10.428 33.192  -3.163  1.00 72.22  ? 352  ASP C CA  1 
ATOM   8633  C C   . ASP C 1 341 ? -11.081 33.804  -4.406  1.00 72.22  ? 352  ASP C C   1 
ATOM   8634  O O   . ASP C 1 341 ? -10.478 33.835  -5.480  1.00 72.22  ? 352  ASP C O   1 
ATOM   8635  C CB  . ASP C 1 341 ? -10.236 31.688  -3.425  1.00 78.25  ? 352  ASP C CB  1 
ATOM   8636  C CG  . ASP C 1 341 ? -9.841  31.385  -4.881  1.00 78.25  ? 352  ASP C CG  1 
ATOM   8637  O OD1 . ASP C 1 341 ? -8.733  31.778  -5.288  1.00 78.25  ? 352  ASP C OD1 1 
ATOM   8638  O OD2 . ASP C 1 341 ? -10.640 30.766  -5.624  1.00 78.25  ? 352  ASP C OD2 1 
ATOM   8639  N N   . SER C 1 342 ? -12.307 34.287  -4.274  1.00 80.20  ? 353  SER C N   1 
ATOM   8640  C CA  . SER C 1 342 ? -12.978 34.859  -5.422  1.00 80.20  ? 353  SER C CA  1 
ATOM   8641  C C   . SER C 1 342 ? -13.454 36.295  -5.216  1.00 80.20  ? 353  SER C C   1 
ATOM   8642  O O   . SER C 1 342 ? -14.406 36.733  -5.871  1.00 80.20  ? 353  SER C O   1 
ATOM   8643  C CB  . SER C 1 342 ? -14.165 33.990  -5.792  1.00 55.44  ? 353  SER C CB  1 
ATOM   8644  O OG  . SER C 1 342 ? -15.126 34.026  -4.755  1.00 55.44  ? 353  SER C OG  1 
ATOM   8645  N N   . PHE C 1 343 ? -12.807 37.034  -4.320  1.00 70.79  ? 354  PHE C N   1 
ATOM   8646  C CA  . PHE C 1 343 ? -13.208 38.416  -4.089  1.00 70.79  ? 354  PHE C CA  1 
ATOM   8647  C C   . PHE C 1 343 ? -12.145 39.438  -4.488  1.00 70.79  ? 354  PHE C C   1 
ATOM   8648  O O   . PHE C 1 343 ? -12.376 40.288  -5.354  1.00 70.79  ? 354  PHE C O   1 
ATOM   8649  C CB  . PHE C 1 343 ? -13.578 38.617  -2.633  1.00 86.17  ? 354  PHE C CB  1 
ATOM   8650  C CG  . PHE C 1 343 ? -14.215 39.935  -2.365  1.00 86.17  ? 354  PHE C CG  1 
ATOM   8651  C CD1 . PHE C 1 343 ? -15.197 40.425  -3.224  1.00 86.17  ? 354  PHE C CD1 1 
ATOM   8652  C CD2 . PHE C 1 343 ? -13.868 40.674  -1.245  1.00 86.17  ? 354  PHE C CD2 1 
ATOM   8653  C CE1 . PHE C 1 343 ? -15.826 41.627  -2.972  1.00 86.17  ? 354  PHE C CE1 1 
ATOM   8654  C CE2 . PHE C 1 343 ? -14.491 41.881  -0.981  1.00 86.17  ? 354  PHE C CE2 1 
ATOM   8655  C CZ  . PHE C 1 343 ? -15.476 42.359  -1.848  1.00 86.17  ? 354  PHE C CZ  1 
ATOM   8656  N N   . GLN C 1 344 ? -10.982 39.359  -3.852  1.00 132.93 ? 355  GLN C N   1 
ATOM   8657  C CA  . GLN C 1 344 ? -9.893  40.278  -4.155  1.00 132.93 ? 355  GLN C CA  1 
ATOM   8658  C C   . GLN C 1 344 ? -8.947  39.637  -5.165  1.00 132.93 ? 355  GLN C C   1 
ATOM   8659  O O   . GLN C 1 344 ? -9.393  39.039  -6.149  1.00 132.93 ? 355  GLN C O   1 
ATOM   8660  C CB  . GLN C 1 344 ? -9.142  40.650  -2.869  1.00 124.40 ? 355  GLN C CB  1 
ATOM   8661  C CG  . GLN C 1 344 ? -10.011 41.387  -1.850  1.00 124.40 ? 355  GLN C CG  1 
ATOM   8662  C CD  . GLN C 1 344 ? -9.274  41.734  -0.571  1.00 124.40 ? 355  GLN C CD  1 
ATOM   8663  O OE1 . GLN C 1 344 ? -8.821  40.851  0.159   1.00 124.40 ? 355  GLN C OE1 1 
ATOM   8664  N NE2 . GLN C 1 344 ? -9.153  43.026  -0.293  1.00 124.40 ? 355  GLN C NE2 1 
ATOM   8665  N N   . HIS C 1 357 ? -19.123 48.551  -7.085  1.00 201.84 ? 368  HIS C N   1 
ATOM   8666  C CA  . HIS C 1 357 ? -17.866 49.245  -7.335  1.00 201.84 ? 368  HIS C CA  1 
ATOM   8667  C C   . HIS C 1 357 ? -16.760 48.230  -7.633  1.00 201.84 ? 368  HIS C C   1 
ATOM   8668  O O   . HIS C 1 357 ? -15.768 48.150  -6.907  1.00 201.84 ? 368  HIS C O   1 
ATOM   8669  C CB  . HIS C 1 357 ? -17.489 50.103  -6.118  1.00 163.91 ? 368  HIS C CB  1 
ATOM   8670  C CG  . HIS C 1 357 ? -16.397 51.096  -6.382  1.00 163.91 ? 368  HIS C CG  1 
ATOM   8671  N ND1 . HIS C 1 357 ? -15.109 50.723  -6.702  1.00 163.91 ? 368  HIS C ND1 1 
ATOM   8672  C CD2 . HIS C 1 357 ? -16.402 52.450  -6.364  1.00 163.91 ? 368  HIS C CD2 1 
ATOM   8673  C CE1 . HIS C 1 357 ? -14.367 51.805  -6.869  1.00 163.91 ? 368  HIS C CE1 1 
ATOM   8674  N NE2 . HIS C 1 357 ? -15.128 52.866  -6.670  1.00 163.91 ? 368  HIS C NE2 1 
ATOM   8675  N N   . ARG C 1 358 ? -16.947 47.454  -8.700  1.00 129.29 ? 369  ARG C N   1 
ATOM   8676  C CA  . ARG C 1 358 ? -15.979 46.438  -9.123  1.00 129.29 ? 369  ARG C CA  1 
ATOM   8677  C C   . ARG C 1 358 ? -15.806 45.322  -8.099  1.00 129.29 ? 369  ARG C C   1 
ATOM   8678  O O   . ARG C 1 358 ? -14.705 44.795  -7.921  1.00 129.29 ? 369  ARG C O   1 
ATOM   8679  C CB  . ARG C 1 358 ? -14.617 47.085  -9.403  1.00 158.37 ? 369  ARG C CB  1 
ATOM   8680  C CG  . ARG C 1 358 ? -14.645 48.131  -10.498 1.00 158.37 ? 369  ARG C CG  1 
ATOM   8681  C CD  . ARG C 1 358 ? -13.295 48.797  -10.667 1.00 158.37 ? 369  ARG C CD  1 
ATOM   8682  N NE  . ARG C 1 358 ? -13.325 49.797  -11.728 1.00 158.37 ? 369  ARG C NE  1 
ATOM   8683  C CZ  . ARG C 1 358 ? -14.106 50.872  -11.721 1.00 158.37 ? 369  ARG C CZ  1 
ATOM   8684  N NH1 . ARG C 1 358 ? -14.927 51.093  -10.704 1.00 158.37 ? 369  ARG C NH1 1 
ATOM   8685  N NH2 . ARG C 1 358 ? -14.069 51.725  -12.736 1.00 158.37 ? 369  ARG C NH2 1 
ATOM   8686  N N   . LYS C 1 359 ? -16.899 44.964  -7.432  1.00 86.60  ? 370  LYS C N   1 
ATOM   8687  C CA  . LYS C 1 359 ? -16.885 43.913  -6.421  1.00 86.60  ? 370  LYS C CA  1 
ATOM   8688  C C   . LYS C 1 359 ? -16.704 42.550  -7.085  1.00 86.60  ? 370  LYS C C   1 
ATOM   8689  O O   . LYS C 1 359 ? -15.580 42.106  -7.322  1.00 86.60  ? 370  LYS C O   1 
ATOM   8690  C CB  . LYS C 1 359 ? -18.200 43.929  -5.632  1.00 162.42 ? 370  LYS C CB  1 
ATOM   8691  C CG  . LYS C 1 359 ? -18.566 45.272  -4.993  1.00 162.42 ? 370  LYS C CG  1 
ATOM   8692  C CD  . LYS C 1 359 ? -17.659 45.630  -3.819  1.00 162.42 ? 370  LYS C CD  1 
ATOM   8693  C CE  . LYS C 1 359 ? -18.141 46.896  -3.111  1.00 162.42 ? 370  LYS C CE  1 
ATOM   8694  N NZ  . LYS C 1 359 ? -17.288 47.270  -1.944  1.00 162.42 ? 370  LYS C NZ  1 
ATOM   8695  N N   . VAL C 1 360 ? -17.827 41.898  -7.374  1.00 86.72  ? 371  VAL C N   1 
ATOM   8696  C CA  . VAL C 1 360 ? -17.870 40.582  -8.014  1.00 86.72  ? 371  VAL C CA  1 
ATOM   8697  C C   . VAL C 1 360 ? -17.120 39.413  -7.351  1.00 86.72  ? 371  VAL C C   1 
ATOM   8698  O O   . VAL C 1 360 ? -15.899 39.452  -7.156  1.00 86.72  ? 371  VAL C O   1 
ATOM   8699  C CB  . VAL C 1 360 ? -17.404 40.656  -9.500  1.00 102.83 ? 371  VAL C CB  1 
ATOM   8700  C CG1 . VAL C 1 360 ? -15.882 40.570  -9.597  1.00 102.83 ? 371  VAL C CG1 1 
ATOM   8701  C CG2 . VAL C 1 360 ? -18.050 39.533  -10.300 1.00 102.83 ? 371  VAL C CG2 1 
ATOM   8702  N N   . LEU C 1 361 ? -17.871 38.373  -6.998  1.00 52.57  ? 372  LEU C N   1 
ATOM   8703  C CA  . LEU C 1 361 ? -17.281 37.174  -6.425  1.00 52.57  ? 372  LEU C CA  1 
ATOM   8704  C C   . LEU C 1 361 ? -17.115 36.327  -7.678  1.00 52.57  ? 372  LEU C C   1 
ATOM   8705  O O   . LEU C 1 361 ? -18.081 36.095  -8.397  1.00 52.57  ? 372  LEU C O   1 
ATOM   8706  C CB  . LEU C 1 361 ? -18.249 36.487  -5.456  1.00 61.93  ? 372  LEU C CB  1 
ATOM   8707  C CG  . LEU C 1 361 ? -18.562 37.051  -4.069  1.00 61.93  ? 372  LEU C CG  1 
ATOM   8708  C CD1 . LEU C 1 361 ? -18.743 38.563  -4.097  1.00 61.93  ? 372  LEU C CD1 1 
ATOM   8709  C CD2 . LEU C 1 361 ? -19.826 36.375  -3.579  1.00 61.93  ? 372  LEU C CD2 1 
ATOM   8710  N N   . LYS C 1 362 ? -15.900 35.883  -7.959  1.00 50.98  ? 373  LYS C N   1 
ATOM   8711  C CA  . LYS C 1 362 ? -15.681 35.093  -9.157  1.00 50.98  ? 373  LYS C CA  1 
ATOM   8712  C C   . LYS C 1 362 ? -15.581 33.597  -8.896  1.00 50.98  ? 373  LYS C C   1 
ATOM   8713  O O   . LYS C 1 362 ? -14.631 32.938  -9.331  1.00 50.98  ? 373  LYS C O   1 
ATOM   8714  C CB  . LYS C 1 362 ? -14.420 35.578  -9.877  1.00 106.44 ? 373  LYS C CB  1 
ATOM   8715  C CG  . LYS C 1 362 ? -14.467 37.035  -10.323 1.00 106.44 ? 373  LYS C CG  1 
ATOM   8716  C CD  . LYS C 1 362 ? -13.206 37.393  -11.093 1.00 106.44 ? 373  LYS C CD  1 
ATOM   8717  C CE  . LYS C 1 362 ? -13.191 38.846  -11.535 1.00 106.44 ? 373  LYS C CE  1 
ATOM   8718  N NZ  . LYS C 1 362 ? -11.928 39.175  -12.255 1.00 106.44 ? 373  LYS C NZ  1 
ATOM   8719  N N   . LEU C 1 363 ? -16.573 33.059  -8.199  1.00 28.52  ? 374  LEU C N   1 
ATOM   8720  C CA  . LEU C 1 363 ? -16.588 31.634  -7.893  1.00 28.52  ? 374  LEU C CA  1 
ATOM   8721  C C   . LEU C 1 363 ? -16.327 30.794  -9.130  1.00 28.52  ? 374  LEU C C   1 
ATOM   8722  O O   . LEU C 1 363 ? -16.609 31.219  -10.240 1.00 28.52  ? 374  LEU C O   1 
ATOM   8723  C CB  . LEU C 1 363 ? -17.934 31.247  -7.288  1.00 37.72  ? 374  LEU C CB  1 
ATOM   8724  C CG  . LEU C 1 363 ? -18.050 31.489  -5.793  1.00 37.72  ? 374  LEU C CG  1 
ATOM   8725  C CD1 . LEU C 1 363 ? -19.472 31.325  -5.369  1.00 37.72  ? 374  LEU C CD1 1 
ATOM   8726  C CD2 . LEU C 1 363 ? -17.155 30.513  -5.067  1.00 37.72  ? 374  LEU C CD2 1 
ATOM   8727  N N   . HIS C 1 364 ? -15.780 29.601  -8.950  1.00 62.17  ? 375  HIS C N   1 
ATOM   8728  C CA  . HIS C 1 364 ? -15.532 28.747  -10.101 1.00 62.17  ? 375  HIS C CA  1 
ATOM   8729  C C   . HIS C 1 364 ? -16.869 28.245  -10.655 1.00 62.17  ? 375  HIS C C   1 
ATOM   8730  O O   . HIS C 1 364 ? -17.790 27.971  -9.892  1.00 62.17  ? 375  HIS C O   1 
ATOM   8731  C CB  . HIS C 1 364 ? -14.662 27.562  -9.705  1.00 52.43  ? 375  HIS C CB  1 
ATOM   8732  C CG  . HIS C 1 364 ? -14.331 26.662  -10.848 1.00 52.43  ? 375  HIS C CG  1 
ATOM   8733  N ND1 . HIS C 1 364 ? -15.295 25.975  -11.554 1.00 52.43  ? 375  HIS C ND1 1 
ATOM   8734  C CD2 . HIS C 1 364 ? -13.149 26.372  -11.441 1.00 52.43  ? 375  HIS C CD2 1 
ATOM   8735  C CE1 . HIS C 1 364 ? -14.719 25.303  -12.536 1.00 52.43  ? 375  HIS C CE1 1 
ATOM   8736  N NE2 . HIS C 1 364 ? -13.418 25.526  -12.489 1.00 52.43  ? 375  HIS C NE2 1 
ATOM   8737  N N   . PRO C 1 365 ? -16.992 28.129  -11.990 1.00 80.43  ? 376  PRO C N   1 
ATOM   8738  C CA  . PRO C 1 365 ? -18.201 27.667  -12.674 1.00 80.43  ? 376  PRO C CA  1 
ATOM   8739  C C   . PRO C 1 365 ? -19.004 26.581  -11.974 1.00 80.43  ? 376  PRO C C   1 
ATOM   8740  O O   . PRO C 1 365 ? -20.175 26.784  -11.655 1.00 80.43  ? 376  PRO C O   1 
ATOM   8741  C CB  . PRO C 1 365 ? -17.665 27.209  -14.014 1.00 79.41  ? 376  PRO C CB  1 
ATOM   8742  C CG  . PRO C 1 365 ? -16.686 28.256  -14.304 1.00 79.41  ? 376  PRO C CG  1 
ATOM   8743  C CD  . PRO C 1 365 ? -15.952 28.447  -12.982 1.00 79.41  ? 376  PRO C CD  1 
ATOM   8744  N N   . CYS C 1 366 ? -18.388 25.428  -11.736 1.00 80.29  ? 377  CYS C N   1 
ATOM   8745  C CA  . CYS C 1 366 ? -19.093 24.329  -11.082 1.00 80.29  ? 377  CYS C CA  1 
ATOM   8746  C C   . CYS C 1 366 ? -19.115 24.415  -9.553  1.00 80.29  ? 377  CYS C C   1 
ATOM   8747  O O   . CYS C 1 366 ? -19.073 23.407  -8.858  1.00 80.29  ? 377  CYS C O   1 
ATOM   8748  C CB  . CYS C 1 366 ? -18.493 23.000  -11.537 1.00 82.34  ? 377  CYS C CB  1 
ATOM   8749  S SG  . CYS C 1 366 ? -16.712 23.045  -11.679 1.00 82.34  ? 377  CYS C SG  1 
ATOM   8750  N N   . LEU C 1 367 ? -19.193 25.632  -9.040  1.00 58.40  ? 378  LEU C N   1 
ATOM   8751  C CA  . LEU C 1 367 ? -19.230 25.860  -7.609  1.00 58.40  ? 378  LEU C CA  1 
ATOM   8752  C C   . LEU C 1 367 ? -20.173 27.021  -7.353  1.00 58.40  ? 378  LEU C C   1 
ATOM   8753  O O   . LEU C 1 367 ? -20.732 27.152  -6.262  1.00 58.40  ? 378  LEU C O   1 
ATOM   8754  C CB  . LEU C 1 367 ? -17.833 26.203  -7.075  1.00 45.18  ? 378  LEU C CB  1 
ATOM   8755  C CG  . LEU C 1 367 ? -17.014 25.212  -6.222  1.00 45.18  ? 378  LEU C CG  1 
ATOM   8756  C CD1 . LEU C 1 367 ? -16.822 23.858  -6.929  1.00 45.18  ? 378  LEU C CD1 1 
ATOM   8757  C CD2 . LEU C 1 367 ? -15.656 25.855  -5.923  1.00 45.18  ? 378  LEU C CD2 1 
ATOM   8758  N N   . ALA C 1 368 ? -20.347 27.868  -8.364  1.00 47.34  ? 379  ALA C N   1 
ATOM   8759  C CA  . ALA C 1 368 ? -21.238 29.020  -8.245  1.00 47.34  ? 379  ALA C CA  1 
ATOM   8760  C C   . ALA C 1 368 ? -22.579 28.501  -7.794  1.00 47.34  ? 379  ALA C C   1 
ATOM   8761  O O   . ALA C 1 368 ? -22.994 27.425  -8.185  1.00 47.34  ? 379  ALA C O   1 
ATOM   8762  C CB  . ALA C 1 368 ? -21.375 29.728  -9.585  1.00 118.66 ? 379  ALA C CB  1 
ATOM   8763  N N   . PRO C 1 369 ? -23.266 29.239  -6.939  1.00 44.60  ? 380  PRO C N   1 
ATOM   8764  C CA  . PRO C 1 369 ? -24.555 28.688  -6.539  1.00 44.60  ? 380  PRO C CA  1 
ATOM   8765  C C   . PRO C 1 369 ? -25.593 28.852  -7.629  1.00 44.60  ? 380  PRO C C   1 
ATOM   8766  O O   . PRO C 1 369 ? -26.454 27.983  -7.812  1.00 44.60  ? 380  PRO C O   1 
ATOM   8767  C CB  . PRO C 1 369 ? -24.885 29.457  -5.264  1.00 61.55  ? 380  PRO C CB  1 
ATOM   8768  C CG  . PRO C 1 369 ? -24.200 30.729  -5.463  1.00 61.55  ? 380  PRO C CG  1 
ATOM   8769  C CD  . PRO C 1 369 ? -22.876 30.348  -6.069  1.00 61.55  ? 380  PRO C CD  1 
ATOM   8770  N N   . ILE C 1 370 ? -25.495 29.950  -8.374  1.00 80.56  ? 381  ILE C N   1 
ATOM   8771  C CA  . ILE C 1 370 ? -26.434 30.211  -9.458  1.00 80.56  ? 381  ILE C CA  1 
ATOM   8772  C C   . ILE C 1 370 ? -25.749 30.519  -10.782 1.00 80.56  ? 381  ILE C C   1 
ATOM   8773  O O   . ILE C 1 370 ? -25.290 31.632  -11.020 1.00 80.56  ? 381  ILE C O   1 
ATOM   8774  C CB  . ILE C 1 370 ? -27.351 31.350  -9.103  1.00 37.60  ? 381  ILE C CB  1 
ATOM   8775  C CG1 . ILE C 1 370 ? -28.284 30.907  -7.977  1.00 37.60  ? 381  ILE C CG1 1 
ATOM   8776  C CG2 . ILE C 1 370 ? -28.103 31.796  -10.340 1.00 37.60  ? 381  ILE C CG2 1 
ATOM   8777  C CD1 . ILE C 1 370 ? -28.968 32.056  -7.234  1.00 37.60  ? 381  ILE C CD1 1 
ATOM   8778  N N   . LYS C 1 371 ? -25.720 29.515  -11.647 1.00 51.12  ? 382  LYS C N   1 
ATOM   8779  C CA  . LYS C 1 371 ? -25.080 29.599  -12.945 1.00 51.12  ? 382  LYS C CA  1 
ATOM   8780  C C   . LYS C 1 371 ? -25.646 30.564  -13.991 1.00 51.12  ? 382  LYS C C   1 
ATOM   8781  O O   . LYS C 1 371 ? -24.918 30.963  -14.893 1.00 51.12  ? 382  LYS C O   1 
ATOM   8782  C CB  . LYS C 1 371 ? -24.987 28.187  -13.534 1.00 57.92  ? 382  LYS C CB  1 
ATOM   8783  C CG  . LYS C 1 371 ? -24.094 27.282  -12.715 1.00 57.92  ? 382  LYS C CG  1 
ATOM   8784  C CD  . LYS C 1 371 ? -24.223 25.833  -13.127 1.00 57.92  ? 382  LYS C CD  1 
ATOM   8785  C CE  . LYS C 1 371 ? -23.059 24.983  -12.581 1.00 57.92  ? 382  LYS C CE  1 
ATOM   8786  N NZ  . LYS C 1 371 ? -22.931 24.984  -11.090 1.00 57.92  ? 382  LYS C NZ  1 
ATOM   8787  N N   . VAL C 1 372 ? -26.909 30.966  -13.888 1.00 43.37  ? 383  VAL C N   1 
ATOM   8788  C CA  . VAL C 1 372 ? -27.456 31.864  -14.911 1.00 43.37  ? 383  VAL C CA  1 
ATOM   8789  C C   . VAL C 1 372 ? -28.706 32.660  -14.558 1.00 43.37  ? 383  VAL C C   1 
ATOM   8790  O O   . VAL C 1 372 ? -29.745 32.090  -14.248 1.00 43.37  ? 383  VAL C O   1 
ATOM   8791  C CB  . VAL C 1 372 ? -27.760 31.075  -16.220 1.00 56.55  ? 383  VAL C CB  1 
ATOM   8792  C CG1 . VAL C 1 372 ? -28.551 29.814  -15.908 1.00 56.55  ? 383  VAL C CG1 1 
ATOM   8793  C CG2 . VAL C 1 372 ? -28.546 31.949  -17.185 1.00 56.55  ? 383  VAL C CG2 1 
ATOM   8794  N N   . ALA C 1 373 ? -28.614 33.980  -14.630 1.00 110.96 ? 384  ALA C N   1 
ATOM   8795  C CA  . ALA C 1 373 ? -29.764 34.832  -14.348 1.00 110.96 ? 384  ALA C CA  1 
ATOM   8796  C C   . ALA C 1 373 ? -30.461 35.093  -15.678 1.00 110.96 ? 384  ALA C C   1 
ATOM   8797  O O   . ALA C 1 373 ? -29.951 34.704  -16.729 1.00 110.96 ? 384  ALA C O   1 
ATOM   8798  C CB  . ALA C 1 373 ? -29.303 36.162  -13.736 1.00 47.60  ? 384  ALA C CB  1 
ATOM   8799  N N   . LEU C 1 374 ? -31.632 35.721  -15.634 1.00 49.40  ? 385  LEU C N   1 
ATOM   8800  C CA  . LEU C 1 374 ? -32.337 36.075  -16.856 1.00 49.40  ? 385  LEU C CA  1 
ATOM   8801  C C   . LEU C 1 374 ? -33.693 36.683  -16.622 1.00 49.40  ? 385  LEU C C   1 
ATOM   8802  O O   . LEU C 1 374 ? -34.577 36.049  -16.072 1.00 49.40  ? 385  LEU C O   1 
ATOM   8803  C CB  . LEU C 1 374 ? -32.446 34.879  -17.811 1.00 36.08  ? 385  LEU C CB  1 
ATOM   8804  C CG  . LEU C 1 374 ? -33.144 33.567  -17.482 1.00 36.08  ? 385  LEU C CG  1 
ATOM   8805  C CD1 . LEU C 1 374 ? -34.630 33.682  -17.737 1.00 36.08  ? 385  LEU C CD1 1 
ATOM   8806  C CD2 . LEU C 1 374 ? -32.557 32.461  -18.373 1.00 36.08  ? 385  LEU C CD2 1 
ATOM   8807  N N   . ASP C 1 375 ? -33.837 37.937  -17.037 1.00 120.84 ? 386  ASP C N   1 
ATOM   8808  C CA  . ASP C 1 375 ? -35.088 38.668  -16.900 1.00 120.84 ? 386  ASP C CA  1 
ATOM   8809  C C   . ASP C 1 375 ? -35.449 39.355  -18.215 1.00 120.84 ? 386  ASP C C   1 
ATOM   8810  O O   . ASP C 1 375 ? -34.690 39.294  -19.186 1.00 120.84 ? 386  ASP C O   1 
ATOM   8811  C CB  . ASP C 1 375 ? -35.003 39.695  -15.752 1.00 108.21 ? 386  ASP C CB  1 
ATOM   8812  C CG  . ASP C 1 375 ? -33.571 40.116  -15.426 1.00 108.21 ? 386  ASP C CG  1 
ATOM   8813  O OD1 . ASP C 1 375 ? -32.731 39.231  -15.164 1.00 108.21 ? 386  ASP C OD1 1 
ATOM   8814  O OD2 . ASP C 1 375 ? -33.286 41.333  -15.412 1.00 108.21 ? 386  ASP C OD2 1 
ATOM   8815  N N   . VAL C 1 376 ? -36.613 39.998  -18.244 1.00 109.07 ? 387  VAL C N   1 
ATOM   8816  C CA  . VAL C 1 376 ? -37.084 40.683  -19.445 1.00 109.07 ? 387  VAL C CA  1 
ATOM   8817  C C   . VAL C 1 376 ? -36.566 42.113  -19.561 1.00 109.07 ? 387  VAL C C   1 
ATOM   8818  O O   . VAL C 1 376 ? -36.026 42.676  -18.607 1.00 109.07 ? 387  VAL C O   1 
ATOM   8819  C CB  . VAL C 1 376 ? -38.623 40.724  -19.491 1.00 161.11 ? 387  VAL C CB  1 
ATOM   8820  C CG1 . VAL C 1 376 ? -39.178 39.310  -19.555 1.00 161.11 ? 387  VAL C CG1 1 
ATOM   8821  C CG2 . VAL C 1 376 ? -39.159 41.455  -18.270 1.00 161.11 ? 387  VAL C CG2 1 
ATOM   8822  N N   . GLY C 1 377 ? -36.747 42.698  -20.740 1.00 128.48 ? 388  GLY C N   1 
ATOM   8823  C CA  . GLY C 1 377 ? -36.288 44.054  -20.964 1.00 128.48 ? 388  GLY C CA  1 
ATOM   8824  C C   . GLY C 1 377 ? -37.227 44.889  -21.814 1.00 128.48 ? 388  GLY C C   1 
ATOM   8825  O O   . GLY C 1 377 ? -38.421 44.992  -21.514 1.00 128.48 ? 388  GLY C O   1 
ATOM   8826  N N   . ARG C 1 378 ? -36.681 45.487  -22.874 1.00 108.60 ? 389  ARG C N   1 
ATOM   8827  C CA  . ARG C 1 378 ? -37.453 46.331  -23.783 1.00 108.60 ? 389  ARG C CA  1 
ATOM   8828  C C   . ARG C 1 378 ? -38.526 45.556  -24.553 1.00 108.60 ? 389  ARG C C   1 
ATOM   8829  O O   . ARG C 1 378 ? -38.231 44.833  -25.508 1.00 108.60 ? 389  ARG C O   1 
ATOM   8830  C CB  . ARG C 1 378 ? -36.515 47.065  -24.762 1.00 132.47 ? 389  ARG C CB  1 
ATOM   8831  C CG  . ARG C 1 378 ? -35.466 46.195  -25.465 1.00 132.47 ? 389  ARG C CG  1 
ATOM   8832  C CD  . ARG C 1 378 ? -34.112 46.143  -24.722 1.00 132.47 ? 389  ARG C CD  1 
ATOM   8833  N NE  . ARG C 1 378 ? -33.350 47.394  -24.808 1.00 132.47 ? 389  ARG C NE  1 
ATOM   8834  C CZ  . ARG C 1 378 ? -32.071 47.528  -24.455 1.00 132.47 ? 389  ARG C CZ  1 
ATOM   8835  N NH1 . ARG C 1 378 ? -31.388 46.492  -23.988 1.00 132.47 ? 389  ARG C NH1 1 
ATOM   8836  N NH2 . ARG C 1 378 ? -31.470 48.705  -24.571 1.00 132.47 ? 389  ARG C NH2 1 
ATOM   8837  N N   . GLY C 1 379 ? -39.775 45.721  -24.117 1.00 68.86  ? 390  GLY C N   1 
ATOM   8838  C CA  . GLY C 1 379 ? -40.896 45.047  -24.749 1.00 68.86  ? 390  GLY C CA  1 
ATOM   8839  C C   . GLY C 1 379 ? -42.079 44.784  -23.819 1.00 68.86  ? 390  GLY C C   1 
ATOM   8840  O O   . GLY C 1 379 ? -42.295 45.528  -22.851 1.00 68.86  ? 390  GLY C O   1 
ATOM   8841  N N   . PRO C 1 380 ? -42.871 43.726  -24.099 1.00 201.99 ? 391  PRO C N   1 
ATOM   8842  C CA  . PRO C 1 380 ? -44.048 43.319  -23.319 1.00 201.99 ? 391  PRO C CA  1 
ATOM   8843  C C   . PRO C 1 380 ? -43.706 42.550  -22.043 1.00 201.99 ? 391  PRO C C   1 
ATOM   8844  O O   . PRO C 1 380 ? -42.537 42.287  -21.759 1.00 201.99 ? 391  PRO C O   1 
ATOM   8845  C CB  . PRO C 1 380 ? -44.831 42.465  -24.309 1.00 87.07  ? 391  PRO C CB  1 
ATOM   8846  C CG  . PRO C 1 380 ? -43.736 41.782  -25.067 1.00 87.07  ? 391  PRO C CG  1 
ATOM   8847  C CD  . PRO C 1 380 ? -42.770 42.920  -25.333 1.00 87.07  ? 391  PRO C CD  1 
ATOM   8848  N N   . THR C 1 381 ? -44.736 42.181  -21.285 1.00 126.31 ? 392  THR C N   1 
ATOM   8849  C CA  . THR C 1 381 ? -44.547 41.457  -20.030 1.00 126.31 ? 392  THR C CA  1 
ATOM   8850  C C   . THR C 1 381 ? -44.993 39.999  -20.106 1.00 126.31 ? 392  THR C C   1 
ATOM   8851  O O   . THR C 1 381 ? -44.183 39.112  -20.368 1.00 126.31 ? 392  THR C O   1 
ATOM   8852  C CB  . THR C 1 381 ? -45.313 42.143  -18.865 1.00 154.28 ? 392  THR C CB  1 
ATOM   8853  O OG1 . THR C 1 381 ? -44.856 43.493  -18.711 1.00 154.28 ? 392  THR C OG1 1 
ATOM   8854  C CG2 . THR C 1 381 ? -45.084 41.394  -17.560 1.00 154.28 ? 392  THR C CG2 1 
ATOM   8855  N N   . LEU C 1 382 ? -46.282 39.762  -19.876 1.00 156.84 ? 393  LEU C N   1 
ATOM   8856  C CA  . LEU C 1 382 ? -46.847 38.415  -19.898 1.00 156.84 ? 393  LEU C CA  1 
ATOM   8857  C C   . LEU C 1 382 ? -46.667 37.709  -21.246 1.00 156.84 ? 393  LEU C C   1 
ATOM   8858  O O   . LEU C 1 382 ? -47.189 36.610  -21.454 1.00 156.84 ? 393  LEU C O   1 
ATOM   8859  C CB  . LEU C 1 382 ? -48.338 38.464  -19.530 1.00 95.81  ? 393  LEU C CB  1 
ATOM   8860  C CG  . LEU C 1 382 ? -48.752 39.226  -18.259 1.00 95.81  ? 393  LEU C CG  1 
ATOM   8861  C CD1 . LEU C 1 382 ? -50.233 38.984  -17.960 1.00 95.81  ? 393  LEU C CD1 1 
ATOM   8862  C CD2 . LEU C 1 382 ? -47.900 38.774  -17.085 1.00 95.81  ? 393  LEU C CD2 1 
ATOM   8863  N N   . GLU C 1 383 ? -45.930 38.348  -22.155 1.00 98.69  ? 394  GLU C N   1 
ATOM   8864  C CA  . GLU C 1 383 ? -45.656 37.792  -23.480 1.00 98.69  ? 394  GLU C CA  1 
ATOM   8865  C C   . GLU C 1 383 ? -44.149 37.678  -23.698 1.00 98.69  ? 394  GLU C C   1 
ATOM   8866  O O   . GLU C 1 383 ? -43.691 36.996  -24.616 1.00 98.69  ? 394  GLU C O   1 
ATOM   8867  C CB  . GLU C 1 383 ? -46.271 38.670  -24.582 1.00 197.96 ? 394  GLU C CB  1 
ATOM   8868  C CG  . GLU C 1 383 ? -47.799 38.648  -24.645 1.00 197.96 ? 394  GLU C CG  1 
ATOM   8869  C CD  . GLU C 1 383 ? -48.349 39.323  -25.894 1.00 197.96 ? 394  GLU C CD  1 
ATOM   8870  O OE1 . GLU C 1 383 ? -48.067 40.523  -26.103 1.00 197.96 ? 394  GLU C OE1 1 
ATOM   8871  O OE2 . GLU C 1 383 ? -49.064 38.651  -26.668 1.00 197.96 ? 394  GLU C OE2 1 
ATOM   8872  N N   . LEU C 1 384 ? -43.385 38.360  -22.851 1.00 117.57 ? 395  LEU C N   1 
ATOM   8873  C CA  . LEU C 1 384 ? -41.930 38.325  -22.928 1.00 117.57 ? 395  LEU C CA  1 
ATOM   8874  C C   . LEU C 1 384 ? -41.390 37.542  -21.731 1.00 117.57 ? 395  LEU C C   1 
ATOM   8875  O O   . LEU C 1 384 ? -40.211 37.195  -21.675 1.00 117.57 ? 395  LEU C O   1 
ATOM   8876  C CB  . LEU C 1 384 ? -41.363 39.744  -22.929 1.00 100.75 ? 395  LEU C CB  1 
ATOM   8877  C CG  . LEU C 1 384 ? -39.853 39.812  -23.172 1.00 100.75 ? 395  LEU C CG  1 
ATOM   8878  C CD1 . LEU C 1 384 ? -39.508 39.175  -24.515 1.00 100.75 ? 395  LEU C CD1 1 
ATOM   8879  C CD2 . LEU C 1 384 ? -39.397 41.260  -23.137 1.00 100.75 ? 395  LEU C CD2 1 
ATOM   8880  N N   . ARG C 1 385 ? -42.274 37.281  -20.772 1.00 138.54 ? 396  ARG C N   1 
ATOM   8881  C CA  . ARG C 1 385 ? -41.935 36.518  -19.576 1.00 138.54 ? 396  ARG C CA  1 
ATOM   8882  C C   . ARG C 1 385 ? -42.147 35.040  -19.899 1.00 138.54 ? 396  ARG C C   1 
ATOM   8883  O O   . ARG C 1 385 ? -41.291 34.200  -19.626 1.00 138.54 ? 396  ARG C O   1 
ATOM   8884  C CB  . ARG C 1 385 ? -42.843 36.917  -18.398 1.00 116.89 ? 396  ARG C CB  1 
ATOM   8885  C CG  . ARG C 1 385 ? -42.472 38.215  -17.675 1.00 116.89 ? 396  ARG C CG  1 
ATOM   8886  C CD  . ARG C 1 385 ? -43.549 38.619  -16.658 1.00 116.89 ? 396  ARG C CD  1 
ATOM   8887  N NE  . ARG C 1 385 ? -43.893 37.543  -15.724 1.00 116.89 ? 396  ARG C NE  1 
ATOM   8888  C CZ  . ARG C 1 385 ? -44.890 37.598  -14.842 1.00 116.89 ? 396  ARG C CZ  1 
ATOM   8889  N NH1 . ARG C 1 385 ? -45.652 38.678  -14.764 1.00 116.89 ? 396  ARG C NH1 1 
ATOM   8890  N NH2 . ARG C 1 385 ? -45.134 36.569  -14.040 1.00 116.89 ? 396  ARG C NH2 1 
ATOM   8891  N N   . GLN C 1 386 ? -43.298 34.733  -20.488 1.00 127.48 ? 397  GLN C N   1 
ATOM   8892  C CA  . GLN C 1 386 ? -43.630 33.364  -20.845 1.00 127.48 ? 397  GLN C CA  1 
ATOM   8893  C C   . GLN C 1 386 ? -42.468 32.665  -21.543 1.00 127.48 ? 397  GLN C C   1 
ATOM   8894  O O   . GLN C 1 386 ? -42.261 31.471  -21.351 1.00 127.48 ? 397  GLN C O   1 
ATOM   8895  C CB  . GLN C 1 386 ? -44.885 33.334  -21.730 1.00 199.98 ? 397  GLN C CB  1 
ATOM   8896  C CG  . GLN C 1 386 ? -44.849 34.271  -22.933 1.00 199.98 ? 397  GLN C CG  1 
ATOM   8897  C CD  . GLN C 1 386 ? -46.138 34.237  -23.747 1.00 199.98 ? 397  GLN C CD  1 
ATOM   8898  O OE1 . GLN C 1 386 ? -47.229 34.462  -23.218 1.00 199.98 ? 397  GLN C OE1 1 
ATOM   8899  N NE2 . GLN C 1 386 ? -46.014 33.962  -25.043 1.00 199.98 ? 397  GLN C NE2 1 
ATOM   8900  N N   . VAL C 1 387 ? -41.706 33.403  -22.345 1.00 136.65 ? 398  VAL C N   1 
ATOM   8901  C CA  . VAL C 1 387 ? -40.569 32.811  -23.046 1.00 136.65 ? 398  VAL C CA  1 
ATOM   8902  C C   . VAL C 1 387 ? -39.463 32.458  -22.065 1.00 136.65 ? 398  VAL C C   1 
ATOM   8903  O O   . VAL C 1 387 ? -38.845 31.401  -22.176 1.00 136.65 ? 398  VAL C O   1 
ATOM   8904  C CB  . VAL C 1 387 ? -39.988 33.763  -24.116 1.00 84.68  ? 398  VAL C CB  1 
ATOM   8905  C CG1 . VAL C 1 387 ? -39.731 35.132  -23.501 1.00 84.68  ? 398  VAL C CG1 1 
ATOM   8906  C CG2 . VAL C 1 387 ? -38.686 33.180  -24.693 1.00 84.68  ? 398  VAL C CG2 1 
ATOM   8907  N N   . CYS C 1 388 ? -39.212 33.350  -21.111 1.00 90.81  ? 399  CYS C N   1 
ATOM   8908  C CA  . CYS C 1 388 ? -38.180 33.120  -20.105 1.00 90.81  ? 399  CYS C CA  1 
ATOM   8909  C C   . CYS C 1 388 ? -38.333 31.705  -19.542 1.00 90.81  ? 399  CYS C C   1 
ATOM   8910  O O   . CYS C 1 388 ? -37.394 30.899  -19.567 1.00 90.81  ? 399  CYS C O   1 
ATOM   8911  C CB  . CYS C 1 388 ? -38.308 34.140  -18.962 1.00 82.21  ? 399  CYS C CB  1 
ATOM   8912  S SG  . CYS C 1 388 ? -37.832 35.853  -19.340 1.00 82.21  ? 399  CYS C SG  1 
ATOM   8913  N N   . GLN C 1 389 ? -39.536 31.423  -19.043 1.00 85.30  ? 400  GLN C N   1 
ATOM   8914  C CA  . GLN C 1 389 ? -39.877 30.132  -18.460 1.00 85.30  ? 400  GLN C CA  1 
ATOM   8915  C C   . GLN C 1 389 ? -39.511 28.987  -19.405 1.00 85.30  ? 400  GLN C C   1 
ATOM   8916  O O   . GLN C 1 389 ? -39.275 27.859  -18.973 1.00 85.30  ? 400  GLN C O   1 
ATOM   8917  C CB  . GLN C 1 389 ? -41.375 30.110  -18.118 1.00 102.49 ? 400  GLN C CB  1 
ATOM   8918  C CG  . GLN C 1 389 ? -41.757 31.105  -17.012 1.00 102.49 ? 400  GLN C CG  1 
ATOM   8919  C CD  . GLN C 1 389 ? -43.251 31.418  -16.943 1.00 102.49 ? 400  GLN C CD  1 
ATOM   8920  O OE1 . GLN C 1 389 ? -43.703 32.167  -16.069 1.00 102.49 ? 400  GLN C OE1 1 
ATOM   8921  N NE2 . GLN C 1 389 ? -44.018 30.853  -17.868 1.00 102.49 ? 400  GLN C NE2 1 
ATOM   8922  N N   . GLY C 1 390 ? -39.451 29.288  -20.698 1.00 101.21 ? 401  GLY C N   1 
ATOM   8923  C CA  . GLY C 1 390 ? -39.104 28.274  -21.674 1.00 101.21 ? 401  GLY C CA  1 
ATOM   8924  C C   . GLY C 1 390 ? -37.663 27.852  -21.497 1.00 101.21 ? 401  GLY C C   1 
ATOM   8925  O O   . GLY C 1 390 ? -37.332 26.672  -21.639 1.00 101.21 ? 401  GLY C O   1 
ATOM   8926  N N   . LEU C 1 391 ? -36.808 28.827  -21.193 1.00 99.91  ? 402  LEU C N   1 
ATOM   8927  C CA  . LEU C 1 391 ? -35.384 28.580  -20.975 1.00 99.91  ? 402  LEU C CA  1 
ATOM   8928  C C   . LEU C 1 391 ? -35.192 28.132  -19.541 1.00 99.91  ? 402  LEU C C   1 
ATOM   8929  O O   . LEU C 1 391 ? -34.349 27.282  -19.232 1.00 99.91  ? 402  LEU C O   1 
ATOM   8930  C CB  . LEU C 1 391 ? -34.572 29.850  -21.206 1.00 75.95  ? 402  LEU C CB  1 
ATOM   8931  C CG  . LEU C 1 391 ? -34.464 30.338  -22.642 1.00 75.95  ? 402  LEU C CG  1 
ATOM   8932  C CD1 . LEU C 1 391 ? -33.728 31.661  -22.647 1.00 75.95  ? 402  LEU C CD1 1 
ATOM   8933  C CD2 . LEU C 1 391 ? -33.742 29.305  -23.497 1.00 75.95  ? 402  LEU C CD2 1 
ATOM   8934  N N   . PHE C 1 392 ? -35.976 28.736  -18.660 1.00 81.92  ? 403  PHE C N   1 
ATOM   8935  C CA  . PHE C 1 392 ? -35.915 28.392  -17.261 1.00 81.92  ? 403  PHE C CA  1 
ATOM   8936  C C   . PHE C 1 392 ? -36.016 26.879  -17.214 1.00 81.92  ? 403  PHE C C   1 
ATOM   8937  O O   . PHE C 1 392 ? -35.083 26.208  -16.778 1.00 81.92  ? 403  PHE C O   1 
ATOM   8938  C CB  . PHE C 1 392 ? -37.085 29.031  -16.532 1.00 64.33  ? 403  PHE C CB  1 
ATOM   8939  C CG  . PHE C 1 392 ? -37.026 28.893  -15.048 1.00 64.33  ? 403  PHE C CG  1 
ATOM   8940  C CD1 . PHE C 1 392 ? -35.939 29.375  -14.339 1.00 64.33  ? 403  PHE C CD1 1 
ATOM   8941  C CD2 . PHE C 1 392 ? -38.082 28.313  -14.353 1.00 64.33  ? 403  PHE C CD2 1 
ATOM   8942  C CE1 . PHE C 1 392 ? -35.905 29.282  -12.961 1.00 64.33  ? 403  PHE C CE1 1 
ATOM   8943  C CE2 . PHE C 1 392 ? -38.059 28.216  -12.974 1.00 64.33  ? 403  PHE C CE2 1 
ATOM   8944  C CZ  . PHE C 1 392 ? -36.969 28.701  -12.275 1.00 64.33  ? 403  PHE C CZ  1 
ATOM   8945  N N   . ASN C 1 393 ? -37.138 26.351  -17.705 1.00 58.20  ? 404  ASN C N   1 
ATOM   8946  C CA  . ASN C 1 393 ? -37.372 24.910  -17.720 1.00 58.20  ? 404  ASN C CA  1 
ATOM   8947  C C   . ASN C 1 393 ? -36.342 24.169  -18.561 1.00 58.20  ? 404  ASN C C   1 
ATOM   8948  O O   . ASN C 1 393 ? -35.781 23.163  -18.119 1.00 58.20  ? 404  ASN C O   1 
ATOM   8949  C CB  . ASN C 1 393 ? -38.771 24.581  -18.254 1.00 62.58  ? 404  ASN C CB  1 
ATOM   8950  C CG  . ASN C 1 393 ? -39.864 25.276  -17.491 1.00 62.58  ? 404  ASN C CG  1 
ATOM   8951  O OD1 . ASN C 1 393 ? -39.738 25.521  -16.293 1.00 62.58  ? 404  ASN C OD1 1 
ATOM   8952  N ND2 . ASN C 1 393 ? -40.957 25.589  -18.176 1.00 62.58  ? 404  ASN C ND2 1 
ATOM   8953  N N   . GLU C 1 394 ? -36.112 24.653  -19.779 1.00 65.71  ? 405  GLU C N   1 
ATOM   8954  C CA  . GLU C 1 394 ? -35.142 24.032  -20.676 1.00 65.71  ? 405  GLU C CA  1 
ATOM   8955  C C   . GLU C 1 394 ? -33.837 23.873  -19.895 1.00 65.71  ? 405  GLU C C   1 
ATOM   8956  O O   . GLU C 1 394 ? -33.216 22.806  -19.897 1.00 65.71  ? 405  GLU C O   1 
ATOM   8957  C CB  . GLU C 1 394 ? -34.926 24.919  -21.911 1.00 169.93 ? 405  GLU C CB  1 
ATOM   8958  C CG  . GLU C 1 394 ? -34.181 24.250  -23.065 1.00 169.93 ? 405  GLU C CG  1 
ATOM   8959  C CD  . GLU C 1 394 ? -34.057 25.148  -24.290 1.00 169.93 ? 405  GLU C CD  1 
ATOM   8960  O OE1 . GLU C 1 394 ? -33.374 26.192  -24.205 1.00 169.93 ? 405  GLU C OE1 1 
ATOM   8961  O OE2 . GLU C 1 394 ? -34.645 24.810  -25.341 1.00 169.93 ? 405  GLU C OE2 1 
ATOM   8962  N N   . LEU C 1 395 ? -33.447 24.944  -19.209 1.00 72.76  ? 406  LEU C N   1 
ATOM   8963  C CA  . LEU C 1 395 ? -32.238 24.953  -18.404 1.00 72.76  ? 406  LEU C CA  1 
ATOM   8964  C C   . LEU C 1 395 ? -32.345 24.015  -17.201 1.00 72.76  ? 406  LEU C C   1 
ATOM   8965  O O   . LEU C 1 395 ? -31.510 23.128  -17.026 1.00 72.76  ? 406  LEU C O   1 
ATOM   8966  C CB  . LEU C 1 395 ? -31.940 26.381  -17.953 1.00 63.05  ? 406  LEU C CB  1 
ATOM   8967  C CG  . LEU C 1 395 ? -31.033 27.221  -18.867 1.00 63.05  ? 406  LEU C CG  1 
ATOM   8968  C CD1 . LEU C 1 395 ? -30.924 26.612  -20.261 1.00 63.05  ? 406  LEU C CD1 1 
ATOM   8969  C CD2 . LEU C 1 395 ? -31.578 28.645  -18.921 1.00 63.05  ? 406  LEU C CD2 1 
ATOM   8970  N N   . LEU C 1 396 ? -33.370 24.207  -16.375 1.00 55.98  ? 407  LEU C N   1 
ATOM   8971  C CA  . LEU C 1 396 ? -33.565 23.355  -15.213 1.00 55.98  ? 407  LEU C CA  1 
ATOM   8972  C C   . LEU C 1 396 ? -33.521 21.886  -15.599 1.00 55.98  ? 407  LEU C C   1 
ATOM   8973  O O   . LEU C 1 396 ? -32.826 21.097  -14.959 1.00 55.98  ? 407  LEU C O   1 
ATOM   8974  C CB  . LEU C 1 396 ? -34.897 23.661  -14.528 1.00 105.19 ? 407  LEU C CB  1 
ATOM   8975  C CG  . LEU C 1 396 ? -34.957 24.966  -13.734 1.00 105.19 ? 407  LEU C CG  1 
ATOM   8976  C CD1 . LEU C 1 396 ? -36.268 25.029  -12.973 1.00 105.19 ? 407  LEU C CD1 1 
ATOM   8977  C CD2 . LEU C 1 396 ? -33.788 25.036  -12.762 1.00 105.19 ? 407  LEU C CD2 1 
ATOM   8978  N N   . GLU C 1 397 ? -34.248 21.520  -16.649 1.00 130.93 ? 408  GLU C N   1 
ATOM   8979  C CA  . GLU C 1 397 ? -34.281 20.132  -17.095 1.00 130.93 ? 408  GLU C CA  1 
ATOM   8980  C C   . GLU C 1 397 ? -32.901 19.627  -17.500 1.00 130.93 ? 408  GLU C C   1 
ATOM   8981  O O   . GLU C 1 397 ? -32.750 18.459  -17.858 1.00 130.93 ? 408  GLU C O   1 
ATOM   8982  C CB  . GLU C 1 397 ? -35.259 19.970  -18.266 1.00 121.19 ? 408  GLU C CB  1 
ATOM   8983  C CG  . GLU C 1 397 ? -36.693 20.358  -17.925 1.00 121.19 ? 408  GLU C CG  1 
ATOM   8984  C CD  . GLU C 1 397 ? -37.674 20.102  -19.057 1.00 121.19 ? 408  GLU C CD  1 
ATOM   8985  O OE1 . GLU C 1 397 ? -38.847 20.521  -18.935 1.00 121.19 ? 408  GLU C OE1 1 
ATOM   8986  O OE2 . GLU C 1 397 ? -37.278 19.479  -20.063 1.00 121.19 ? 408  GLU C OE2 1 
ATOM   8987  N N   . ASN C 1 398 ? -31.896 20.500  -17.434 1.00 127.07 ? 409  ASN C N   1 
ATOM   8988  C CA  . ASN C 1 398 ? -30.530 20.127  -17.799 1.00 127.07 ? 409  ASN C CA  1 
ATOM   8989  C C   . ASN C 1 398 ? -29.520 20.249  -16.665 1.00 127.07 ? 409  ASN C C   1 
ATOM   8990  O O   . ASN C 1 398 ? -28.342 19.937  -16.838 1.00 127.07 ? 409  ASN C O   1 
ATOM   8991  C CB  . ASN C 1 398 ? -30.056 20.954  -18.991 1.00 91.19  ? 409  ASN C CB  1 
ATOM   8992  C CG  . ASN C 1 398 ? -30.659 20.484  -20.297 1.00 91.19  ? 409  ASN C CG  1 
ATOM   8993  O OD1 . ASN C 1 398 ? -30.362 19.386  -20.778 1.00 91.19  ? 409  ASN C OD1 1 
ATOM   8994  N ND2 . ASN C 1 398 ? -31.519 21.311  -20.880 1.00 91.19  ? 409  ASN C ND2 1 
ATOM   8995  N N   . GLY C 1 399 ? -29.979 20.706  -15.507 1.00 66.76  ? 410  GLY C N   1 
ATOM   8996  C CA  . GLY C 1 399 ? -29.087 20.831  -14.375 1.00 66.76  ? 410  GLY C CA  1 
ATOM   8997  C C   . GLY C 1 399 ? -28.414 22.180  -14.322 1.00 66.76  ? 410  GLY C C   1 
ATOM   8998  O O   . GLY C 1 399 ? -27.366 22.344  -13.697 1.00 66.76  ? 410  GLY C O   1 
ATOM   8999  N N   . ILE C 1 400 ? -29.009 23.163  -14.977 1.00 54.50  ? 411  ILE C N   1 
ATOM   9000  C CA  . ILE C 1 400 ? -28.423 24.487  -14.957 1.00 54.50  ? 411  ILE C CA  1 
ATOM   9001  C C   . ILE C 1 400 ? -29.135 25.452  -14.013 1.00 54.50  ? 411  ILE C C   1 
ATOM   9002  O O   . ILE C 1 400 ? -30.235 25.920  -14.299 1.00 54.50  ? 411  ILE C O   1 
ATOM   9003  C CB  . ILE C 1 400 ? -28.384 25.089  -16.362 1.00 78.62  ? 411  ILE C CB  1 
ATOM   9004  C CG1 . ILE C 1 400 ? -27.515 24.209  -17.265 1.00 78.62  ? 411  ILE C CG1 1 
ATOM   9005  C CG2 . ILE C 1 400 ? -27.826 26.500  -16.301 1.00 78.62  ? 411  ILE C CG2 1 
ATOM   9006  C CD1 . ILE C 1 400 ? -27.342 24.738  -18.670 1.00 78.62  ? 411  ILE C CD1 1 
ATOM   9007  N N   . SER C 1 401 ? -28.496 25.732  -12.881 1.00 48.53  ? 412  SER C N   1 
ATOM   9008  C CA  . SER C 1 401 ? -29.028 26.664  -11.890 1.00 48.53  ? 412  SER C CA  1 
ATOM   9009  C C   . SER C 1 401 ? -29.351 28.036  -12.512 1.00 48.53  ? 412  SER C C   1 
ATOM   9010  O O   . SER C 1 401 ? -28.470 28.734  -13.020 1.00 48.53  ? 412  SER C O   1 
ATOM   9011  C CB  . SER C 1 401 ? -28.016 26.827  -10.755 1.00 115.90 ? 412  SER C CB  1 
ATOM   9012  O OG  . SER C 1 401 ? -26.701 26.979  -11.264 1.00 115.90 ? 412  SER C OG  1 
ATOM   9013  N N   . VAL C 1 402 ? -30.623 28.420  -12.454 1.00 44.85  ? 413  VAL C N   1 
ATOM   9014  C CA  . VAL C 1 402 ? -31.079 29.683  -13.033 1.00 44.85  ? 413  VAL C CA  1 
ATOM   9015  C C   . VAL C 1 402 ? -31.700 30.626  -12.016 1.00 44.85  ? 413  VAL C C   1 
ATOM   9016  O O   . VAL C 1 402 ? -32.321 30.194  -11.060 1.00 44.85  ? 413  VAL C O   1 
ATOM   9017  C CB  . VAL C 1 402 ? -32.130 29.431  -14.137 1.00 67.83  ? 413  VAL C CB  1 
ATOM   9018  C CG1 . VAL C 1 402 ? -32.712 30.754  -14.626 1.00 67.83  ? 413  VAL C CG1 1 
ATOM   9019  C CG2 . VAL C 1 402 ? -31.503 28.653  -15.277 1.00 67.83  ? 413  VAL C CG2 1 
ATOM   9020  N N   . TRP C 1 403 ? -31.536 31.921  -12.234 1.00 57.52  ? 414  TRP C N   1 
ATOM   9021  C CA  . TRP C 1 403 ? -32.118 32.891  -11.333 1.00 57.52  ? 414  TRP C CA  1 
ATOM   9022  C C   . TRP C 1 403 ? -33.281 33.605  -12.018 1.00 57.52  ? 414  TRP C C   1 
ATOM   9023  O O   . TRP C 1 403 ? -33.087 34.373  -12.974 1.00 57.52  ? 414  TRP C O   1 
ATOM   9024  C CB  . TRP C 1 403 ? -31.076 33.903  -10.876 1.00 89.62  ? 414  TRP C CB  1 
ATOM   9025  C CG  . TRP C 1 403 ? -31.677 34.982  -10.059 1.00 89.62  ? 414  TRP C CG  1 
ATOM   9026  C CD1 . TRP C 1 403 ? -32.119 36.191  -10.501 1.00 89.62  ? 414  TRP C CD1 1 
ATOM   9027  C CD2 . TRP C 1 403 ? -31.959 34.936  -8.663  1.00 89.62  ? 414  TRP C CD2 1 
ATOM   9028  N NE1 . TRP C 1 403 ? -32.662 36.905  -9.463  1.00 89.62  ? 414  TRP C NE1 1 
ATOM   9029  C CE2 . TRP C 1 403 ? -32.576 36.155  -8.322  1.00 89.62  ? 414  TRP C CE2 1 
ATOM   9030  C CE3 . TRP C 1 403 ? -31.752 33.983  -7.666  1.00 89.62  ? 414  TRP C CE3 1 
ATOM   9031  C CZ2 . TRP C 1 403 ? -32.988 36.448  -7.023  1.00 89.62  ? 414  TRP C CZ2 1 
ATOM   9032  C CZ3 . TRP C 1 403 ? -32.163 34.274  -6.374  1.00 89.62  ? 414  TRP C CZ3 1 
ATOM   9033  C CH2 . TRP C 1 403 ? -32.774 35.498  -6.064  1.00 89.62  ? 414  TRP C CH2 1 
ATOM   9034  N N   . PRO C 1 404 ? -34.512 33.343  -11.536 1.00 52.11  ? 415  PRO C N   1 
ATOM   9035  C CA  . PRO C 1 404 ? -35.788 33.889  -12.011 1.00 52.11  ? 415  PRO C CA  1 
ATOM   9036  C C   . PRO C 1 404 ? -35.992 35.386  -11.775 1.00 52.11  ? 415  PRO C C   1 
ATOM   9037  O O   . PRO C 1 404 ? -36.739 35.800  -10.886 1.00 52.11  ? 415  PRO C O   1 
ATOM   9038  C CB  . PRO C 1 404 ? -36.808 33.043  -11.269 1.00 61.16  ? 415  PRO C CB  1 
ATOM   9039  C CG  . PRO C 1 404 ? -36.098 32.741  -9.978  1.00 61.16  ? 415  PRO C CG  1 
ATOM   9040  C CD  . PRO C 1 404 ? -34.744 32.359  -10.464 1.00 61.16  ? 415  PRO C CD  1 
ATOM   9041  N N   . GLY C 1 405 ? -35.324 36.192  -12.585 1.00 77.82  ? 416  GLY C N   1 
ATOM   9042  C CA  . GLY C 1 405 ? -35.464 37.622  -12.449 1.00 77.82  ? 416  GLY C CA  1 
ATOM   9043  C C   . GLY C 1 405 ? -36.655 38.118  -13.238 1.00 77.82  ? 416  GLY C C   1 
ATOM   9044  O O   . GLY C 1 405 ? -37.170 39.199  -12.973 1.00 77.82  ? 416  GLY C O   1 
ATOM   9045  N N   . TYR C 1 406 ? -37.106 37.319  -14.199 1.00 93.07  ? 417  TYR C N   1 
ATOM   9046  C CA  . TYR C 1 406 ? -38.232 37.703  -15.038 1.00 93.07  ? 417  TYR C CA  1 
ATOM   9047  C C   . TYR C 1 406 ? -39.546 37.845  -14.260 1.00 93.07  ? 417  TYR C C   1 
ATOM   9048  O O   . TYR C 1 406 ? -40.633 37.848  -14.838 1.00 93.07  ? 417  TYR C O   1 
ATOM   9049  C CB  . TYR C 1 406 ? -38.379 36.704  -16.203 1.00 104.89 ? 417  TYR C CB  1 
ATOM   9050  C CG  . TYR C 1 406 ? -38.813 35.317  -15.805 1.00 104.89 ? 417  TYR C CG  1 
ATOM   9051  C CD1 . TYR C 1 406 ? -40.143 35.053  -15.475 1.00 104.89 ? 417  TYR C CD1 1 
ATOM   9052  C CD2 . TYR C 1 406 ? -37.892 34.274  -15.722 1.00 104.89 ? 417  TYR C CD2 1 
ATOM   9053  C CE1 . TYR C 1 406 ? -40.550 33.791  -15.063 1.00 104.89 ? 417  TYR C CE1 1 
ATOM   9054  C CE2 . TYR C 1 406 ? -38.287 33.001  -15.312 1.00 104.89 ? 417  TYR C CE2 1 
ATOM   9055  C CZ  . TYR C 1 406 ? -39.621 32.769  -14.979 1.00 104.89 ? 417  TYR C CZ  1 
ATOM   9056  O OH  . TYR C 1 406 ? -40.030 31.530  -14.533 1.00 104.89 ? 417  TYR C OH  1 
ATOM   9057  N N   . LEU C 1 407 ? -39.446 37.983  -12.945 1.00 94.54  ? 418  LEU C N   1 
ATOM   9058  C CA  . LEU C 1 407 ? -40.634 38.136  -12.121 1.00 94.54  ? 418  LEU C CA  1 
ATOM   9059  C C   . LEU C 1 407 ? -40.397 39.268  -11.129 1.00 94.54  ? 418  LEU C C   1 
ATOM   9060  O O   . LEU C 1 407 ? -40.811 39.195  -9.979  1.00 94.54  ? 418  LEU C O   1 
ATOM   9061  C CB  . LEU C 1 407 ? -40.937 36.829  -11.373 1.00 79.49  ? 418  LEU C CB  1 
ATOM   9062  C CG  . LEU C 1 407 ? -40.848 35.523  -12.178 1.00 79.49  ? 418  LEU C CG  1 
ATOM   9063  C CD1 . LEU C 1 407 ? -39.405 35.058  -12.229 1.00 79.49  ? 418  LEU C CD1 1 
ATOM   9064  C CD2 . LEU C 1 407 ? -41.693 34.444  -11.534 1.00 79.49  ? 418  LEU C CD2 1 
ATOM   9065  N N   . GLU C 1 408 ? -39.734 40.322  -11.587 1.00 101.81 ? 419  GLU C N   1 
ATOM   9066  C CA  . GLU C 1 408 ? -39.428 41.464  -10.736 1.00 101.81 ? 419  GLU C CA  1 
ATOM   9067  C C   . GLU C 1 408 ? -40.274 42.705  -11.058 1.00 101.81 ? 419  GLU C C   1 
ATOM   9068  O O   . GLU C 1 408 ? -40.865 42.813  -12.139 1.00 101.81 ? 419  GLU C O   1 
ATOM   9069  C CB  . GLU C 1 408 ? -37.942 41.793  -10.866 1.00 161.82 ? 419  GLU C CB  1 
ATOM   9070  C CG  . GLU C 1 408 ? -37.026 40.658  -10.419 1.00 161.82 ? 419  GLU C CG  1 
ATOM   9071  C CD  . GLU C 1 408 ? -35.614 40.777  -10.974 1.00 161.82 ? 419  GLU C CD  1 
ATOM   9072  O OE1 . GLU C 1 408 ? -34.737 39.996  -10.543 1.00 161.82 ? 419  GLU C OE1 1 
ATOM   9073  O OE2 . GLU C 1 408 ? -35.381 41.641  -11.846 1.00 161.82 ? 419  GLU C OE2 1 
ATOM   9074  N N   . THR C 1 409 ? -40.313 43.643  -10.113 1.00 194.49 ? 420  THR C N   1 
ATOM   9075  C CA  . THR C 1 409 ? -41.081 44.881  -10.263 1.00 194.49 ? 420  THR C CA  1 
ATOM   9076  C C   . THR C 1 409 ? -40.273 46.026  -10.881 1.00 194.49 ? 420  THR C C   1 
ATOM   9077  O O   . THR C 1 409 ? -39.628 45.860  -11.917 1.00 194.49 ? 420  THR C O   1 
ATOM   9078  C CB  . THR C 1 409 ? -41.646 45.360  -8.891  1.00 128.86 ? 420  THR C CB  1 
ATOM   9079  O OG1 . THR C 1 409 ? -42.398 46.568  -9.072  1.00 128.86 ? 420  THR C OG1 1 
ATOM   9080  C CG2 . THR C 1 409 ? -40.515 45.613  -7.894  1.00 128.86 ? 420  THR C CG2 1 
ATOM   9081  N N   . MET C 1 410 ? -40.330 47.185  -10.229 1.00 198.11 ? 421  MET C N   1 
ATOM   9082  C CA  . MET C 1 410 ? -39.637 48.396  -10.656 1.00 198.11 ? 421  MET C CA  1 
ATOM   9083  C C   . MET C 1 410 ? -38.243 48.104  -11.219 1.00 198.11 ? 421  MET C C   1 
ATOM   9084  O O   . MET C 1 410 ? -37.373 47.589  -10.518 1.00 198.11 ? 421  MET C O   1 
ATOM   9085  C CB  . MET C 1 410 ? -39.553 49.369  -9.469  1.00 167.23 ? 421  MET C CB  1 
ATOM   9086  C CG  . MET C 1 410 ? -40.920 49.660  -8.817  1.00 167.23 ? 421  MET C CG  1 
ATOM   9087  S SD  . MET C 1 410 ? -40.888 50.665  -7.295  1.00 167.23 ? 421  MET C SD  1 
ATOM   9088  C CE  . MET C 1 410 ? -41.565 52.215  -7.870  1.00 167.23 ? 421  MET C CE  1 
ATOM   9089  N N   . GLN C 1 411 ? -38.050 48.440  -12.494 1.00 131.26 ? 422  GLN C N   1 
ATOM   9090  C CA  . GLN C 1 411 ? -36.787 48.218  -13.203 1.00 131.26 ? 422  GLN C CA  1 
ATOM   9091  C C   . GLN C 1 411 ? -35.538 48.408  -12.349 1.00 131.26 ? 422  GLN C C   1 
ATOM   9092  O O   . GLN C 1 411 ? -34.702 47.511  -12.249 1.00 131.26 ? 422  GLN C O   1 
ATOM   9093  C CB  . GLN C 1 411 ? -36.700 49.140  -14.429 1.00 171.82 ? 422  GLN C CB  1 
ATOM   9094  C CG  . GLN C 1 411 ? -36.766 50.635  -14.115 1.00 171.82 ? 422  GLN C CG  1 
ATOM   9095  C CD  . GLN C 1 411 ? -36.461 51.505  -15.324 1.00 171.82 ? 422  GLN C CD  1 
ATOM   9096  O OE1 . GLN C 1 411 ? -37.163 51.455  -16.333 1.00 171.82 ? 422  GLN C OE1 1 
ATOM   9097  N NE2 . GLN C 1 411 ? -35.407 52.306  -15.224 1.00 171.82 ? 422  GLN C NE2 1 
ATOM   9098  N N   . SER C 1 412 ? -35.413 49.587  -11.751 1.00 169.00 ? 423  SER C N   1 
ATOM   9099  C CA  . SER C 1 412 ? -34.275 49.918  -10.904 1.00 169.00 ? 423  SER C CA  1 
ATOM   9100  C C   . SER C 1 412 ? -32.911 49.808  -11.594 1.00 169.00 ? 423  SER C C   1 
ATOM   9101  O O   . SER C 1 412 ? -31.892 49.611  -10.931 1.00 169.00 ? 423  SER C O   1 
ATOM   9102  C CB  . SER C 1 412 ? -34.299 49.055  -9.642  1.00 173.24 ? 423  SER C CB  1 
ATOM   9103  O OG  . SER C 1 412 ? -35.451 49.343  -8.866  1.00 173.24 ? 423  SER C OG  1 
ATOM   9104  N N   . SER C 1 413 ? -32.910 49.930  -12.922 1.00 131.90 ? 424  SER C N   1 
ATOM   9105  C CA  . SER C 1 413 ? -31.693 49.902  -13.747 1.00 131.90 ? 424  SER C CA  1 
ATOM   9106  C C   . SER C 1 413 ? -31.182 48.552  -14.241 1.00 131.90 ? 424  SER C C   1 
ATOM   9107  O O   . SER C 1 413 ? -31.722 47.496  -13.913 1.00 131.90 ? 424  SER C O   1 
ATOM   9108  C CB  . SER C 1 413 ? -30.543 50.634  -13.028 1.00 70.62  ? 424  SER C CB  1 
ATOM   9109  O OG  . SER C 1 413 ? -29.356 50.663  -13.811 1.00 70.62  ? 424  SER C OG  1 
ATOM   9110  N N   . LEU C 1 414 ? -30.134 48.628  -15.057 1.00 72.87  ? 425  LEU C N   1 
ATOM   9111  C CA  . LEU C 1 414 ? -29.470 47.472  -15.632 1.00 72.87  ? 425  LEU C CA  1 
ATOM   9112  C C   . LEU C 1 414 ? -28.142 47.329  -14.911 1.00 72.87  ? 425  LEU C C   1 
ATOM   9113  O O   . LEU C 1 414 ? -27.684 46.218  -14.656 1.00 72.87  ? 425  LEU C O   1 
ATOM   9114  C CB  . LEU C 1 414 ? -29.203 47.686  -17.120 1.00 147.43 ? 425  LEU C CB  1 
ATOM   9115  C CG  . LEU C 1 414 ? -28.420 46.555  -17.794 1.00 147.43 ? 425  LEU C CG  1 
ATOM   9116  C CD1 . LEU C 1 414 ? -29.312 45.325  -17.916 1.00 147.43 ? 425  LEU C CD1 1 
ATOM   9117  C CD2 . LEU C 1 414 ? -27.940 46.998  -19.164 1.00 147.43 ? 425  LEU C CD2 1 
ATOM   9118  N N   . GLU C 1 415 ? -27.517 48.459  -14.594 1.00 100.89 ? 426  GLU C N   1 
ATOM   9119  C CA  . GLU C 1 415 ? -26.246 48.436  -13.879 1.00 100.89 ? 426  GLU C CA  1 
ATOM   9120  C C   . GLU C 1 415 ? -26.488 48.057  -12.420 1.00 100.89 ? 426  GLU C C   1 
ATOM   9121  O O   . GLU C 1 415 ? -25.716 47.301  -11.830 1.00 100.89 ? 426  GLU C O   1 
ATOM   9122  C CB  . GLU C 1 415 ? -25.554 49.801  -13.949 1.00 136.66 ? 426  GLU C CB  1 
ATOM   9123  C CG  . GLU C 1 415 ? -24.776 50.052  -15.231 1.00 136.66 ? 426  GLU C CG  1 
ATOM   9124  C CD  . GLU C 1 415 ? -25.665 50.115  -16.446 1.00 136.66 ? 426  GLU C CD  1 
ATOM   9125  O OE1 . GLU C 1 415 ? -26.296 49.088  -16.778 1.00 136.66 ? 426  GLU C OE1 1 
ATOM   9126  O OE2 . GLU C 1 415 ? -25.735 51.198  -17.065 1.00 136.66 ? 426  GLU C OE2 1 
ATOM   9127  N N   . GLN C 1 416 ? -27.560 48.591  -11.841 1.00 142.69 ? 427  GLN C N   1 
ATOM   9128  C CA  . GLN C 1 416 ? -27.900 48.280  -10.458 1.00 142.69 ? 427  GLN C CA  1 
ATOM   9129  C C   . GLN C 1 416 ? -28.137 46.770  -10.368 1.00 142.69 ? 427  GLN C C   1 
ATOM   9130  O O   . GLN C 1 416 ? -27.898 46.154  -9.329  1.00 142.69 ? 427  GLN C O   1 
ATOM   9131  C CB  . GLN C 1 416 ? -29.174 49.026  -10.031 1.00 146.30 ? 427  GLN C CB  1 
ATOM   9132  C CG  . GLN C 1 416 ? -29.088 50.556  -10.033 1.00 146.30 ? 427  GLN C CG  1 
ATOM   9133  C CD  . GLN C 1 416 ? -28.274 51.117  -8.879  1.00 146.30 ? 427  GLN C CD  1 
ATOM   9134  O OE1 . GLN C 1 416 ? -28.501 50.772  -7.719  1.00 146.30 ? 427  GLN C OE1 1 
ATOM   9135  N NE2 . GLN C 1 416 ? -27.329 51.999  -9.193  1.00 146.30 ? 427  GLN C NE2 1 
ATOM   9136  N N   . LEU C 1 417 ? -28.603 46.187  -11.472 1.00 157.43 ? 428  LEU C N   1 
ATOM   9137  C CA  . LEU C 1 417 ? -28.883 44.754  -11.550 1.00 157.43 ? 428  LEU C CA  1 
ATOM   9138  C C   . LEU C 1 417 ? -27.744 43.948  -12.164 1.00 157.43 ? 428  LEU C C   1 
ATOM   9139  O O   . LEU C 1 417 ? -27.703 42.728  -12.026 1.00 157.43 ? 428  LEU C O   1 
ATOM   9140  C CB  . LEU C 1 417 ? -30.168 44.499  -12.351 1.00 124.78 ? 428  LEU C CB  1 
ATOM   9141  C CG  . LEU C 1 417 ? -31.501 44.415  -11.591 1.00 124.78 ? 428  LEU C CG  1 
ATOM   9142  C CD1 . LEU C 1 417 ? -31.704 45.652  -10.724 1.00 124.78 ? 428  LEU C CD1 1 
ATOM   9143  C CD2 . LEU C 1 417 ? -32.643 44.256  -12.591 1.00 124.78 ? 428  LEU C CD2 1 
ATOM   9144  N N   . TYR C 1 418 ? -26.825 44.621  -12.849 1.00 90.30  ? 429  TYR C N   1 
ATOM   9145  C CA  . TYR C 1 418 ? -25.696 43.933  -13.465 1.00 90.30  ? 429  TYR C CA  1 
ATOM   9146  C C   . TYR C 1 418 ? -24.603 43.698  -12.437 1.00 90.30  ? 429  TYR C C   1 
ATOM   9147  O O   . TYR C 1 418 ? -23.878 42.704  -12.509 1.00 90.30  ? 429  TYR C O   1 
ATOM   9148  C CB  . TYR C 1 418 ? -25.134 44.747  -14.635 1.00 142.05 ? 429  TYR C CB  1 
ATOM   9149  C CG  . TYR C 1 418 ? -25.593 44.271  -15.994 1.00 142.05 ? 429  TYR C CG  1 
ATOM   9150  C CD1 . TYR C 1 418 ? -25.271 44.980  -17.149 1.00 142.05 ? 429  TYR C CD1 1 
ATOM   9151  C CD2 . TYR C 1 418 ? -26.349 43.109  -16.129 1.00 142.05 ? 429  TYR C CD2 1 
ATOM   9152  C CE1 . TYR C 1 418 ? -25.693 44.542  -18.409 1.00 142.05 ? 429  TYR C CE1 1 
ATOM   9153  C CE2 . TYR C 1 418 ? -26.776 42.662  -17.382 1.00 142.05 ? 429  TYR C CE2 1 
ATOM   9154  C CZ  . TYR C 1 418 ? -26.446 43.383  -18.515 1.00 142.05 ? 429  TYR C CZ  1 
ATOM   9155  O OH  . TYR C 1 418 ? -26.882 42.945  -19.746 1.00 142.05 ? 429  TYR C OH  1 
ATOM   9156  N N   . SER C 1 419 ? -24.493 44.622  -11.484 1.00 107.31 ? 430  SER C N   1 
ATOM   9157  C CA  . SER C 1 419 ? -23.494 44.538  -10.423 1.00 107.31 ? 430  SER C CA  1 
ATOM   9158  C C   . SER C 1 419 ? -24.093 43.776  -9.256  1.00 107.31 ? 430  SER C C   1 
ATOM   9159  O O   . SER C 1 419 ? -23.381 43.280  -8.386  1.00 107.31 ? 430  SER C O   1 
ATOM   9160  C CB  . SER C 1 419 ? -23.087 45.938  -9.957  1.00 149.54 ? 430  SER C CB  1 
ATOM   9161  O OG  . SER C 1 419 ? -24.177 46.613  -9.352  1.00 149.54 ? 430  SER C OG  1 
ATOM   9162  N N   . LYS C 1 420 ? -25.417 43.692  -9.249  1.00 107.72 ? 431  LYS C N   1 
ATOM   9163  C CA  . LYS C 1 420 ? -26.132 42.997  -8.196  1.00 107.72 ? 431  LYS C CA  1 
ATOM   9164  C C   . LYS C 1 420 ? -25.937 41.503  -8.386  1.00 107.72 ? 431  LYS C C   1 
ATOM   9165  O O   . LYS C 1 420 ? -25.788 40.761  -7.416  1.00 107.72 ? 431  LYS C O   1 
ATOM   9166  C CB  . LYS C 1 420 ? -27.617 43.358  -8.257  1.00 117.61 ? 431  LYS C CB  1 
ATOM   9167  C CG  . LYS C 1 420 ? -28.415 43.044  -7.002  1.00 117.61 ? 431  LYS C CG  1 
ATOM   9168  C CD  . LYS C 1 420 ? -29.748 43.806  -7.005  1.00 117.61 ? 431  LYS C CD  1 
ATOM   9169  C CE  . LYS C 1 420 ? -29.540 45.329  -7.000  1.00 117.61 ? 431  LYS C CE  1 
ATOM   9170  N NZ  . LYS C 1 420 ? -30.819 46.092  -7.114  1.00 117.61 ? 431  LYS C NZ  1 
ATOM   9171  N N   . TYR C 1 421 ? -25.924 41.068  -9.642  1.00 104.83 ? 432  TYR C N   1 
ATOM   9172  C CA  . TYR C 1 421 ? -25.744 39.653  -9.951  1.00 104.83 ? 432  TYR C CA  1 
ATOM   9173  C C   . TYR C 1 421 ? -24.298 39.200  -9.765  1.00 104.83 ? 432  TYR C C   1 
ATOM   9174  O O   . TYR C 1 421 ? -24.035 38.031  -9.482  1.00 104.83 ? 432  TYR C O   1 
ATOM   9175  C CB  . TYR C 1 421 ? -26.211 39.342  -11.386 1.00 80.85  ? 432  TYR C CB  1 
ATOM   9176  C CG  . TYR C 1 421 ? -27.717 39.324  -11.557 1.00 80.85  ? 432  TYR C CG  1 
ATOM   9177  C CD1 . TYR C 1 421 ? -28.539 38.855  -10.539 1.00 80.85  ? 432  TYR C CD1 1 
ATOM   9178  C CD2 . TYR C 1 421 ? -28.322 39.770  -12.732 1.00 80.85  ? 432  TYR C CD2 1 
ATOM   9179  C CE1 . TYR C 1 421 ? -29.921 38.829  -10.674 1.00 80.85  ? 432  TYR C CE1 1 
ATOM   9180  C CE2 . TYR C 1 421 ? -29.715 39.746  -12.881 1.00 80.85  ? 432  TYR C CE2 1 
ATOM   9181  C CZ  . TYR C 1 421 ? -30.505 39.275  -11.837 1.00 80.85  ? 432  TYR C CZ  1 
ATOM   9182  O OH  . TYR C 1 421 ? -31.879 39.267  -11.918 1.00 80.85  ? 432  TYR C OH  1 
ATOM   9183  N N   . ASP C 1 422 ? -23.361 40.125  -9.925  1.00 69.93  ? 433  ASP C N   1 
ATOM   9184  C CA  . ASP C 1 422 ? -21.953 39.804  -9.767  1.00 69.93  ? 433  ASP C CA  1 
ATOM   9185  C C   . ASP C 1 422 ? -21.680 39.339  -8.340  1.00 69.93  ? 433  ASP C C   1 
ATOM   9186  O O   . ASP C 1 422 ? -20.902 38.399  -8.115  1.00 69.93  ? 433  ASP C O   1 
ATOM   9187  C CB  . ASP C 1 422 ? -21.102 41.036  -10.065 1.00 90.81  ? 433  ASP C CB  1 
ATOM   9188  C CG  . ASP C 1 422 ? -20.968 41.312  -11.542 1.00 90.81  ? 433  ASP C CG  1 
ATOM   9189  O OD1 . ASP C 1 422 ? -20.267 40.539  -12.222 1.00 90.81  ? 433  ASP C OD1 1 
ATOM   9190  O OD2 . ASP C 1 422 ? -21.557 42.299  -12.023 1.00 90.81  ? 433  ASP C OD2 1 
ATOM   9191  N N   . GLU C 1 423 ? -22.330 40.014  -7.386  1.00 61.90  ? 434  GLU C N   1 
ATOM   9192  C CA  . GLU C 1 423 ? -22.177 39.729  -5.958  1.00 61.90  ? 434  GLU C CA  1 
ATOM   9193  C C   . GLU C 1 423 ? -22.669 38.339  -5.621  1.00 61.90  ? 434  GLU C C   1 
ATOM   9194  O O   . GLU C 1 423 ? -22.132 37.678  -4.741  1.00 61.90  ? 434  GLU C O   1 
ATOM   9195  C CB  . GLU C 1 423 ? -22.919 40.785  -5.126  1.00 82.31  ? 434  GLU C CB  1 
ATOM   9196  C CG  . GLU C 1 423 ? -22.322 42.200  -5.239  1.00 82.31  ? 434  GLU C CG  1 
ATOM   9197  C CD  . GLU C 1 423 ? -22.888 43.181  -4.222  1.00 82.31  ? 434  GLU C CD  1 
ATOM   9198  O OE1 . GLU C 1 423 ? -22.719 42.954  -3.005  1.00 82.31  ? 434  GLU C OE1 1 
ATOM   9199  O OE2 . GLU C 1 423 ? -23.499 44.185  -4.641  1.00 82.31  ? 434  GLU C OE2 1 
ATOM   9200  N N   . MET C 1 424 ? -23.694 37.906  -6.340  1.00 60.09  ? 435  MET C N   1 
ATOM   9201  C CA  . MET C 1 424 ? -24.246 36.569  -6.168  1.00 60.09  ? 435  MET C CA  1 
ATOM   9202  C C   . MET C 1 424 ? -23.390 35.621  -7.004  1.00 60.09  ? 435  MET C C   1 
ATOM   9203  O O   . MET C 1 424 ? -23.553 34.407  -6.948  1.00 60.09  ? 435  MET C O   1 
ATOM   9204  C CB  . MET C 1 424 ? -25.696 36.524  -6.662  1.00 77.24  ? 435  MET C CB  1 
ATOM   9205  C CG  . MET C 1 424 ? -26.643 37.416  -5.881  1.00 77.24  ? 435  MET C CG  1 
ATOM   9206  S SD  . MET C 1 424 ? -28.288 37.493  -6.586  1.00 77.24  ? 435  MET C SD  1 
ATOM   9207  C CE  . MET C 1 424 ? -28.725 35.757  -6.663  1.00 77.24  ? 435  MET C CE  1 
ATOM   9208  N N   . SER C 1 425 ? -22.492 36.208  -7.791  1.00 46.81  ? 436  SER C N   1 
ATOM   9209  C CA  . SER C 1 425 ? -21.575 35.487  -8.666  1.00 46.81  ? 436  SER C CA  1 
ATOM   9210  C C   . SER C 1 425 ? -22.231 34.648  -9.760  1.00 46.81  ? 436  SER C C   1 
ATOM   9211  O O   . SER C 1 425 ? -21.775 33.540  -10.056 1.00 46.81  ? 436  SER C O   1 
ATOM   9212  C CB  . SER C 1 425 ? -20.634 34.601  -7.843  1.00 66.12  ? 436  SER C CB  1 
ATOM   9213  O OG  . SER C 1 425 ? -21.340 33.617  -7.117  1.00 66.12  ? 436  SER C OG  1 
ATOM   9214  N N   . ILE C 1 426 ? -23.287 35.171  -10.371 1.00 62.66  ? 437  ILE C N   1 
ATOM   9215  C CA  . ILE C 1 426 ? -23.957 34.437  -11.441 1.00 62.66  ? 437  ILE C CA  1 
ATOM   9216  C C   . ILE C 1 426 ? -23.045 34.477  -12.668 1.00 62.66  ? 437  ILE C C   1 
ATOM   9217  O O   . ILE C 1 426 ? -22.526 35.537  -13.014 1.00 62.66  ? 437  ILE C O   1 
ATOM   9218  C CB  . ILE C 1 426 ? -25.319 35.073  -11.813 1.00 56.75  ? 437  ILE C CB  1 
ATOM   9219  C CG1 . ILE C 1 426 ? -26.122 35.387  -10.554 1.00 56.75  ? 437  ILE C CG1 1 
ATOM   9220  C CG2 . ILE C 1 426 ? -26.121 34.106  -12.665 1.00 56.75  ? 437  ILE C CG2 1 
ATOM   9221  C CD1 . ILE C 1 426 ? -27.507 35.889  -10.839 1.00 56.75  ? 437  ILE C CD1 1 
ATOM   9222  N N   . LEU C 1 427 ? -22.851 33.335  -13.321 1.00 126.65 ? 438  LEU C N   1 
ATOM   9223  C CA  . LEU C 1 427 ? -21.981 33.271  -14.493 1.00 126.65 ? 438  LEU C CA  1 
ATOM   9224  C C   . LEU C 1 427 ? -22.416 34.153  -15.665 1.00 126.65 ? 438  LEU C C   1 
ATOM   9225  O O   . LEU C 1 427 ? -21.657 35.014  -16.110 1.00 126.65 ? 438  LEU C O   1 
ATOM   9226  C CB  . LEU C 1 427 ? -21.840 31.824  -14.970 1.00 59.76  ? 438  LEU C CB  1 
ATOM   9227  C CG  . LEU C 1 427 ? -21.167 30.853  -13.993 1.00 59.76  ? 438  LEU C CG  1 
ATOM   9228  C CD1 . LEU C 1 427 ? -21.027 29.459  -14.612 1.00 59.76  ? 438  LEU C CD1 1 
ATOM   9229  C CD2 . LEU C 1 427 ? -19.806 31.408  -13.623 1.00 59.76  ? 438  LEU C CD2 1 
ATOM   9230  N N   . PHE C 1 428 ? -23.630 33.937  -16.163 1.00 79.06  ? 439  PHE C N   1 
ATOM   9231  C CA  . PHE C 1 428 ? -24.155 34.704  -17.293 1.00 79.06  ? 439  PHE C CA  1 
ATOM   9232  C C   . PHE C 1 428 ? -25.450 35.385  -16.936 1.00 79.06  ? 439  PHE C C   1 
ATOM   9233  O O   . PHE C 1 428 ? -26.183 34.911  -16.074 1.00 79.06  ? 439  PHE C O   1 
ATOM   9234  C CB  . PHE C 1 428 ? -24.398 33.775  -18.472 1.00 92.97  ? 439  PHE C CB  1 
ATOM   9235  C CG  . PHE C 1 428 ? -23.149 33.197  -19.031 1.00 92.97  ? 439  PHE C CG  1 
ATOM   9236  C CD1 . PHE C 1 428 ? -22.346 33.950  -19.891 1.00 92.97  ? 439  PHE C CD1 1 
ATOM   9237  C CD2 . PHE C 1 428 ? -22.731 31.926  -18.653 1.00 92.97  ? 439  PHE C CD2 1 
ATOM   9238  C CE1 . PHE C 1 428 ? -21.136 33.450  -20.368 1.00 92.97  ? 439  PHE C CE1 1 
ATOM   9239  C CE2 . PHE C 1 428 ? -21.522 31.410  -19.121 1.00 92.97  ? 439  PHE C CE2 1 
ATOM   9240  C CZ  . PHE C 1 428 ? -20.719 32.179  -19.983 1.00 92.97  ? 439  PHE C CZ  1 
ATOM   9241  N N   . THR C 1 429 ? -25.743 36.492  -17.607 1.00 92.51  ? 440  THR C N   1 
ATOM   9242  C CA  . THR C 1 429 ? -26.980 37.224  -17.347 1.00 92.51  ? 440  THR C CA  1 
ATOM   9243  C C   . THR C 1 429 ? -27.696 37.483  -18.662 1.00 92.51  ? 440  THR C C   1 
ATOM   9244  O O   . THR C 1 429 ? -27.481 38.517  -19.293 1.00 92.51  ? 440  THR C O   1 
ATOM   9245  C CB  . THR C 1 429 ? -26.696 38.567  -16.685 1.00 67.97  ? 440  THR C CB  1 
ATOM   9246  O OG1 . THR C 1 429 ? -25.420 38.515  -16.035 1.00 67.97  ? 440  THR C OG1 1 
ATOM   9247  C CG2 . THR C 1 429 ? -27.772 38.877  -15.663 1.00 67.97  ? 440  THR C CG2 1 
ATOM   9248  N N   . VAL C 1 430 ? -28.558 36.554  -19.063 1.00 52.33  ? 441  VAL C N   1 
ATOM   9249  C CA  . VAL C 1 430 ? -29.267 36.682  -20.325 1.00 52.33  ? 441  VAL C CA  1 
ATOM   9250  C C   . VAL C 1 430 ? -30.562 37.513  -20.283 1.00 52.33  ? 441  VAL C C   1 
ATOM   9251  O O   . VAL C 1 430 ? -31.401 37.371  -19.393 1.00 52.33  ? 441  VAL C O   1 
ATOM   9252  C CB  . VAL C 1 430 ? -29.551 35.281  -20.932 1.00 40.05  ? 441  VAL C CB  1 
ATOM   9253  C CG1 . VAL C 1 430 ? -28.430 34.312  -20.545 1.00 40.05  ? 441  VAL C CG1 1 
ATOM   9254  C CG2 . VAL C 1 430 ? -30.915 34.771  -20.502 1.00 40.05  ? 441  VAL C CG2 1 
ATOM   9255  N N   . LEU C 1 431 ? -30.698 38.404  -21.259 1.00 119.69 ? 442  LEU C N   1 
ATOM   9256  C CA  . LEU C 1 431 ? -31.862 39.267  -21.369 1.00 119.69 ? 442  LEU C CA  1 
ATOM   9257  C C   . LEU C 1 431 ? -32.701 38.837  -22.547 1.00 119.69 ? 442  LEU C C   1 
ATOM   9258  O O   . LEU C 1 431 ? -32.224 38.782  -23.680 1.00 119.69 ? 442  LEU C O   1 
ATOM   9259  C CB  . LEU C 1 431 ? -31.431 40.714  -21.561 1.00 55.97  ? 442  LEU C CB  1 
ATOM   9260  C CG  . LEU C 1 431 ? -31.047 41.422  -20.270 1.00 55.97  ? 442  LEU C CG  1 
ATOM   9261  C CD1 . LEU C 1 431 ? -29.856 42.351  -20.485 1.00 55.97  ? 442  LEU C CD1 1 
ATOM   9262  C CD2 . LEU C 1 431 ? -32.269 42.170  -19.777 1.00 55.97  ? 442  LEU C CD2 1 
ATOM   9263  N N   . VAL C 1 432 ? -33.955 38.521  -22.267 1.00 113.22 ? 443  VAL C N   1 
ATOM   9264  C CA  . VAL C 1 432 ? -34.880 38.101  -23.297 1.00 113.22 ? 443  VAL C CA  1 
ATOM   9265  C C   . VAL C 1 432 ? -35.830 39.265  -23.546 1.00 113.22 ? 443  VAL C C   1 
ATOM   9266  O O   . VAL C 1 432 ? -36.724 39.528  -22.741 1.00 113.22 ? 443  VAL C O   1 
ATOM   9267  C CB  . VAL C 1 432 ? -35.661 36.862  -22.838 1.00 85.69  ? 443  VAL C CB  1 
ATOM   9268  C CG1 . VAL C 1 432 ? -36.731 36.515  -23.854 1.00 85.69  ? 443  VAL C CG1 1 
ATOM   9269  C CG2 . VAL C 1 432 ? -34.703 35.692  -22.649 1.00 85.69  ? 443  VAL C CG2 1 
ATOM   9270  N N   . THR C 1 433 ? -35.616 39.967  -24.660 1.00 201.23 ? 444  THR C N   1 
ATOM   9271  C CA  . THR C 1 433 ? -36.428 41.128  -25.025 1.00 201.23 ? 444  THR C CA  1 
ATOM   9272  C C   . THR C 1 433 ? -37.265 40.935  -26.288 1.00 201.23 ? 444  THR C C   1 
ATOM   9273  O O   . THR C 1 433 ? -37.384 39.828  -26.816 1.00 201.23 ? 444  THR C O   1 
ATOM   9274  C CB  . THR C 1 433 ? -35.543 42.388  -25.242 1.00 102.82 ? 444  THR C CB  1 
ATOM   9275  O OG1 . THR C 1 433 ? -34.531 42.104  -26.219 1.00 102.82 ? 444  THR C OG1 1 
ATOM   9276  C CG2 . THR C 1 433 ? -34.886 42.816  -23.940 1.00 102.82 ? 444  THR C CG2 1 
ATOM   9277  N N   . GLU C 1 434 ? -37.844 42.037  -26.757 1.00 156.12 ? 445  GLU C N   1 
ATOM   9278  C CA  . GLU C 1 434 ? -38.667 42.050  -27.960 1.00 156.12 ? 445  GLU C CA  1 
ATOM   9279  C C   . GLU C 1 434 ? -37.778 41.721  -29.156 1.00 156.12 ? 445  GLU C C   1 
ATOM   9280  O O   . GLU C 1 434 ? -38.168 40.969  -30.054 1.00 156.12 ? 445  GLU C O   1 
ATOM   9281  C CB  . GLU C 1 434 ? -39.290 43.437  -28.141 1.00 193.79 ? 445  GLU C CB  1 
ATOM   9282  C CG  . GLU C 1 434 ? -40.205 43.569  -29.344 1.00 193.79 ? 445  GLU C CG  1 
ATOM   9283  C CD  . GLU C 1 434 ? -41.485 42.776  -29.192 1.00 193.79 ? 445  GLU C CD  1 
ATOM   9284  O OE1 . GLU C 1 434 ? -42.251 43.063  -28.249 1.00 193.79 ? 445  GLU C OE1 1 
ATOM   9285  O OE2 . GLU C 1 434 ? -41.725 41.866  -30.013 1.00 193.79 ? 445  GLU C OE2 1 
ATOM   9286  N N   . THR C 1 435 ? -36.576 42.291  -29.148 1.00 104.06 ? 446  THR C N   1 
ATOM   9287  C CA  . THR C 1 435 ? -35.595 42.085  -30.209 1.00 104.06 ? 446  THR C CA  1 
ATOM   9288  C C   . THR C 1 435 ? -35.225 40.606  -30.307 1.00 104.06 ? 446  THR C C   1 
ATOM   9289  O O   . THR C 1 435 ? -34.293 40.234  -31.028 1.00 104.06 ? 446  THR C O   1 
ATOM   9290  C CB  . THR C 1 435 ? -34.311 42.901  -29.933 1.00 169.66 ? 446  THR C CB  1 
ATOM   9291  O OG1 . THR C 1 435 ? -33.631 42.358  -28.794 1.00 169.66 ? 446  THR C OG1 1 
ATOM   9292  C CG2 . THR C 1 435 ? -34.656 44.358  -29.645 1.00 169.66 ? 446  THR C CG2 1 
ATOM   9293  N N   . THR C 1 436 ? -35.960 39.776  -29.569 1.00 166.08 ? 447  THR C N   1 
ATOM   9294  C CA  . THR C 1 436 ? -35.744 38.332  -29.538 1.00 166.08 ? 447  THR C CA  1 
ATOM   9295  C C   . THR C 1 436 ? -37.040 37.582  -29.831 1.00 166.08 ? 447  THR C C   1 
ATOM   9296  O O   . THR C 1 436 ? -37.015 36.479  -30.376 1.00 166.08 ? 447  THR C O   1 
ATOM   9297  C CB  . THR C 1 436 ? -35.242 37.860  -28.152 1.00 106.74 ? 447  THR C CB  1 
ATOM   9298  O OG1 . THR C 1 436 ? -34.018 38.527  -27.823 1.00 106.74 ? 447  THR C OG1 1 
ATOM   9299  C CG2 . THR C 1 436 ? -35.009 36.356  -28.157 1.00 106.74 ? 447  THR C CG2 1 
ATOM   9300  N N   . LEU C 1 437 ? -38.168 38.182  -29.459 1.00 151.58 ? 448  LEU C N   1 
ATOM   9301  C CA  . LEU C 1 437 ? -39.474 37.560  -29.665 1.00 151.58 ? 448  LEU C CA  1 
ATOM   9302  C C   . LEU C 1 437 ? -39.885 37.612  -31.135 1.00 151.58 ? 448  LEU C C   1 
ATOM   9303  O O   . LEU C 1 437 ? -40.483 36.668  -31.660 1.00 151.58 ? 448  LEU C O   1 
ATOM   9304  C CB  . LEU C 1 437 ? -40.531 38.265  -28.799 1.00 123.31 ? 448  LEU C CB  1 
ATOM   9305  C CG  . LEU C 1 437 ? -41.818 37.505  -28.432 1.00 123.31 ? 448  LEU C CG  1 
ATOM   9306  C CD1 . LEU C 1 437 ? -42.615 38.301  -27.412 1.00 123.31 ? 448  LEU C CD1 1 
ATOM   9307  C CD2 . LEU C 1 437 ? -42.658 37.247  -29.666 1.00 123.31 ? 448  LEU C CD2 1 
ATOM   9308  N N   . GLU C 1 438 ? -39.547 38.715  -31.794 1.00 184.60 ? 449  GLU C N   1 
ATOM   9309  C CA  . GLU C 1 438 ? -39.887 38.915  -33.199 1.00 184.60 ? 449  GLU C CA  1 
ATOM   9310  C C   . GLU C 1 438 ? -39.159 37.968  -34.156 1.00 184.60 ? 449  GLU C C   1 
ATOM   9311  O O   . GLU C 1 438 ? -39.694 37.614  -35.208 1.00 184.60 ? 449  GLU C O   1 
ATOM   9312  C CB  . GLU C 1 438 ? -39.621 40.375  -33.586 1.00 143.31 ? 449  GLU C CB  1 
ATOM   9313  C CG  . GLU C 1 438 ? -40.470 41.376  -32.798 1.00 143.31 ? 449  GLU C CG  1 
ATOM   9314  C CD  . GLU C 1 438 ? -40.185 42.821  -33.164 1.00 143.31 ? 449  GLU C CD  1 
ATOM   9315  O OE1 . GLU C 1 438 ? -39.032 43.265  -32.982 1.00 143.31 ? 449  GLU C OE1 1 
ATOM   9316  O OE2 . GLU C 1 438 ? -41.116 43.513  -33.630 1.00 143.31 ? 449  GLU C OE2 1 
ATOM   9317  N N   . ASN C 1 439 ? -37.946 37.561  -33.793 1.00 133.11 ? 450  ASN C N   1 
ATOM   9318  C CA  . ASN C 1 439 ? -37.164 36.649  -34.624 1.00 133.11 ? 450  ASN C CA  1 
ATOM   9319  C C   . ASN C 1 439 ? -36.611 35.448  -33.846 1.00 133.11 ? 450  ASN C C   1 
ATOM   9320  O O   . ASN C 1 439 ? -37.064 34.315  -34.037 1.00 133.11 ? 450  ASN C O   1 
ATOM   9321  C CB  . ASN C 1 439 ? -36.023 37.409  -35.319 1.00 135.50 ? 450  ASN C CB  1 
ATOM   9322  C CG  . ASN C 1 439 ? -35.355 38.435  -34.415 1.00 135.50 ? 450  ASN C CG  1 
ATOM   9323  O OD1 . ASN C 1 439 ? -34.798 38.097  -33.370 1.00 135.50 ? 450  ASN C OD1 1 
ATOM   9324  N ND2 . ASN C 1 439 ? -35.405 39.699  -34.821 1.00 135.50 ? 450  ASN C ND2 1 
ATOM   9325  N N   . GLY C 1 440 ? -35.635 35.694  -32.974 1.00 123.48 ? 451  GLY C N   1 
ATOM   9326  C CA  . GLY C 1 440 ? -35.058 34.619  -32.186 1.00 123.48 ? 451  GLY C CA  1 
ATOM   9327  C C   . GLY C 1 440 ? -33.605 34.848  -31.814 1.00 123.48 ? 451  GLY C C   1 
ATOM   9328  O O   . GLY C 1 440 ? -32.765 33.983  -32.049 1.00 123.48 ? 451  GLY C O   1 
ATOM   9329  N N   . LEU C 1 441 ? -33.306 36.008  -31.234 1.00 187.77 ? 452  LEU C N   1 
ATOM   9330  C CA  . LEU C 1 441 ? -31.938 36.336  -30.835 1.00 187.77 ? 452  LEU C CA  1 
ATOM   9331  C C   . LEU C 1 441 ? -31.879 37.074  -29.499 1.00 187.77 ? 452  LEU C C   1 
ATOM   9332  O O   . LEU C 1 441 ? -32.181 38.265  -29.432 1.00 187.77 ? 452  LEU C O   1 
ATOM   9333  C CB  . LEU C 1 441 ? -31.258 37.203  -31.902 1.00 133.42 ? 452  LEU C CB  1 
ATOM   9334  C CG  . LEU C 1 441 ? -30.991 36.640  -33.301 1.00 133.42 ? 452  LEU C CG  1 
ATOM   9335  C CD1 . LEU C 1 441 ? -30.227 35.334  -33.169 1.00 133.42 ? 452  LEU C CD1 1 
ATOM   9336  C CD2 . LEU C 1 441 ? -32.298 36.438  -34.061 1.00 133.42 ? 452  LEU C CD2 1 
ATOM   9337  N N   . ILE C 1 442 ? -31.477 36.371  -28.444 1.00 151.84 ? 453  ILE C N   1 
ATOM   9338  C CA  . ILE C 1 442 ? -31.372 36.972  -27.116 1.00 151.84 ? 453  ILE C CA  1 
ATOM   9339  C C   . ILE C 1 442 ? -30.056 37.731  -26.940 1.00 151.84 ? 453  ILE C C   1 
ATOM   9340  O O   . ILE C 1 442 ? -29.238 37.794  -27.860 1.00 151.84 ? 453  ILE C O   1 
ATOM   9341  C CB  . ILE C 1 442 ? -31.486 35.899  -25.998 1.00 98.23  ? 453  ILE C CB  1 
ATOM   9342  C CG1 . ILE C 1 442 ? -30.498 34.753  -26.254 1.00 98.23  ? 453  ILE C CG1 1 
ATOM   9343  C CG2 . ILE C 1 442 ? -32.914 35.380  -25.915 1.00 98.23  ? 453  ILE C CG2 1 
ATOM   9344  C CD1 . ILE C 1 442 ? -29.050 35.072  -25.921 1.00 98.23  ? 453  ILE C CD1 1 
ATOM   9345  N N   . HIS C 1 443 ? -29.859 38.302  -25.753 1.00 126.53 ? 454  HIS C N   1 
ATOM   9346  C CA  . HIS C 1 443 ? -28.645 39.053  -25.449 1.00 126.53 ? 454  HIS C CA  1 
ATOM   9347  C C   . HIS C 1 443 ? -28.076 38.757  -24.072 1.00 126.53 ? 454  HIS C C   1 
ATOM   9348  O O   . HIS C 1 443 ? -28.580 39.262  -23.071 1.00 126.53 ? 454  HIS C O   1 
ATOM   9349  C CB  . HIS C 1 443 ? -28.906 40.552  -25.566 1.00 118.28 ? 454  HIS C CB  1 
ATOM   9350  C CG  . HIS C 1 443 ? -28.686 41.088  -26.942 1.00 118.28 ? 454  HIS C CG  1 
ATOM   9351  N ND1 . HIS C 1 443 ? -27.511 40.890  -27.634 1.00 118.28 ? 454  HIS C ND1 1 
ATOM   9352  C CD2 . HIS C 1 443 ? -29.491 41.803  -27.762 1.00 118.28 ? 454  HIS C CD2 1 
ATOM   9353  C CE1 . HIS C 1 443 ? -27.601 41.458  -28.823 1.00 118.28 ? 454  HIS C CE1 1 
ATOM   9354  N NE2 . HIS C 1 443 ? -28.792 42.019  -28.926 1.00 118.28 ? 454  HIS C NE2 1 
ATOM   9355  N N   . LEU C 1 444 ? -27.016 37.953  -24.023 1.00 89.81  ? 455  LEU C N   1 
ATOM   9356  C CA  . LEU C 1 444 ? -26.389 37.606  -22.753 1.00 89.81  ? 455  LEU C CA  1 
ATOM   9357  C C   . LEU C 1 444 ? -25.201 38.508  -22.467 1.00 89.81  ? 455  LEU C C   1 
ATOM   9358  O O   . LEU C 1 444 ? -24.620 39.097  -23.378 1.00 89.81  ? 455  LEU C O   1 
ATOM   9359  C CB  . LEU C 1 444 ? -25.925 36.146  -22.756 1.00 69.38  ? 455  LEU C CB  1 
ATOM   9360  C CG  . LEU C 1 444 ? -24.780 35.707  -23.677 1.00 69.38  ? 455  LEU C CG  1 
ATOM   9361  C CD1 . LEU C 1 444 ? -23.479 36.367  -23.261 1.00 69.38  ? 455  LEU C CD1 1 
ATOM   9362  C CD2 . LEU C 1 444 ? -24.624 34.195  -23.606 1.00 69.38  ? 455  LEU C CD2 1 
ATOM   9363  N N   . ARG C 1 445 ? -24.840 38.601  -21.193 1.00 83.42  ? 456  ARG C N   1 
ATOM   9364  C CA  . ARG C 1 445 ? -23.716 39.417  -20.759 1.00 83.42  ? 456  ARG C CA  1 
ATOM   9365  C C   . ARG C 1 445 ? -22.686 38.454  -20.183 1.00 83.42  ? 456  ARG C C   1 
ATOM   9366  O O   . ARG C 1 445 ? -22.546 37.340  -20.678 1.00 83.42  ? 456  ARG C O   1 
ATOM   9367  C CB  . ARG C 1 445 ? -24.174 40.397  -19.686 1.00 78.34  ? 456  ARG C CB  1 
ATOM   9368  C CG  . ARG C 1 445 ? -23.135 41.411  -19.325 1.00 78.34  ? 456  ARG C CG  1 
ATOM   9369  C CD  . ARG C 1 445 ? -23.240 41.796  -17.874 1.00 78.34  ? 456  ARG C CD  1 
ATOM   9370  N NE  . ARG C 1 445 ? -22.167 42.707  -17.501 1.00 78.34  ? 456  ARG C NE  1 
ATOM   9371  C CZ  . ARG C 1 445 ? -21.759 42.911  -16.255 1.00 78.34  ? 456  ARG C CZ  1 
ATOM   9372  N NH1 . ARG C 1 445 ? -22.337 42.261  -15.250 1.00 78.34  ? 456  ARG C NH1 1 
ATOM   9373  N NH2 . ARG C 1 445 ? -20.774 43.772  -16.019 1.00 78.34  ? 456  ARG C NH2 1 
ATOM   9374  N N   . SER C 1 446 ? -21.972 38.865  -19.140 1.00 108.15 ? 457  SER C N   1 
ATOM   9375  C CA  . SER C 1 446 ? -20.979 37.992  -18.523 1.00 108.15 ? 457  SER C CA  1 
ATOM   9376  C C   . SER C 1 446 ? -20.506 38.490  -17.160 1.00 108.15 ? 457  SER C C   1 
ATOM   9377  O O   . SER C 1 446 ? -20.943 39.535  -16.667 1.00 108.15 ? 457  SER C O   1 
ATOM   9378  C CB  . SER C 1 446 ? -19.777 37.811  -19.451 1.00 56.60  ? 457  SER C CB  1 
ATOM   9379  O OG  . SER C 1 446 ? -18.842 36.888  -18.915 1.00 56.60  ? 457  SER C OG  1 
ATOM   9380  N N   . ARG C 1 447 ? -19.603 37.729  -16.557 1.00 87.87  ? 458  ARG C N   1 
ATOM   9381  C CA  . ARG C 1 447 ? -19.076 38.062  -15.247 1.00 87.87  ? 458  ARG C CA  1 
ATOM   9382  C C   . ARG C 1 447 ? -17.572 38.257  -15.331 1.00 87.87  ? 458  ARG C C   1 
ATOM   9383  O O   . ARG C 1 447 ? -17.037 39.265  -14.865 1.00 87.87  ? 458  ARG C O   1 
ATOM   9384  C CB  . ARG C 1 447 ? -19.396 36.929  -14.277 1.00 75.65  ? 458  ARG C CB  1 
ATOM   9385  C CG  . ARG C 1 447 ? -19.046 37.225  -12.840 1.00 75.65  ? 458  ARG C CG  1 
ATOM   9386  C CD  . ARG C 1 447 ? -18.978 35.946  -12.025 1.00 75.65  ? 458  ARG C CD  1 
ATOM   9387  N NE  . ARG C 1 447 ? -17.946 35.047  -12.525 1.00 75.65  ? 458  ARG C NE  1 
ATOM   9388  C CZ  . ARG C 1 447 ? -17.562 33.939  -11.910 1.00 75.65  ? 458  ARG C CZ  1 
ATOM   9389  N NH1 . ARG C 1 447 ? -18.129 33.592  -10.767 1.00 75.65  ? 458  ARG C NH1 1 
ATOM   9390  N NH2 . ARG C 1 447 ? -16.604 33.187  -12.434 1.00 75.65  ? 458  ARG C NH2 1 
ATOM   9391  N N   . ASP C 1 448 ? -16.900 37.282  -15.933 1.00 153.69 ? 459  ASP C N   1 
ATOM   9392  C CA  . ASP C 1 448 ? -15.452 37.316  -16.088 1.00 153.69 ? 459  ASP C CA  1 
ATOM   9393  C C   . ASP C 1 448 ? -15.017 38.355  -17.125 1.00 153.69 ? 459  ASP C C   1 
ATOM   9394  O O   . ASP C 1 448 ? -14.617 39.469  -16.780 1.00 153.69 ? 459  ASP C O   1 
ATOM   9395  C CB  . ASP C 1 448 ? -14.941 35.930  -16.505 1.00 195.65 ? 459  ASP C CB  1 
ATOM   9396  C CG  . ASP C 1 448 ? -15.341 34.834  -15.529 1.00 195.65 ? 459  ASP C CG  1 
ATOM   9397  O OD1 . ASP C 1 448 ? -14.916 34.892  -14.356 1.00 195.65 ? 459  ASP C OD1 1 
ATOM   9398  O OD2 . ASP C 1 448 ? -16.080 33.912  -15.936 1.00 195.65 ? 459  ASP C OD2 1 
ATOM   9399  N N   . THR C 1 449 ? -15.104 37.976  -18.397 1.00 154.39 ? 460  THR C N   1 
ATOM   9400  C CA  . THR C 1 449 ? -14.715 38.845  -19.504 1.00 154.39 ? 460  THR C CA  1 
ATOM   9401  C C   . THR C 1 449 ? -15.652 40.035  -19.673 1.00 154.39 ? 460  THR C C   1 
ATOM   9402  O O   . THR C 1 449 ? -15.500 40.818  -20.609 1.00 154.39 ? 460  THR C O   1 
ATOM   9403  C CB  . THR C 1 449 ? -14.696 38.066  -20.840 1.00 101.90 ? 460  THR C CB  1 
ATOM   9404  O OG1 . THR C 1 449 ? -16.033 37.695  -21.199 1.00 101.90 ? 460  THR C OG1 1 
ATOM   9405  C CG2 . THR C 1 449 ? -13.849 36.806  -20.715 1.00 101.90 ? 460  THR C CG2 1 
ATOM   9406  N N   . THR C 1 450 ? -16.614 40.164  -18.762 1.00 66.97  ? 461  THR C N   1 
ATOM   9407  C CA  . THR C 1 450 ? -17.610 41.236  -18.789 1.00 66.97  ? 461  THR C CA  1 
ATOM   9408  C C   . THR C 1 450 ? -18.188 41.518  -20.199 1.00 66.97  ? 461  THR C C   1 
ATOM   9409  O O   . THR C 1 450 ? -18.847 42.543  -20.436 1.00 66.97  ? 461  THR C O   1 
ATOM   9410  C CB  . THR C 1 450 ? -17.044 42.545  -18.147 1.00 93.31  ? 461  THR C CB  1 
ATOM   9411  O OG1 . THR C 1 450 ? -18.033 43.585  -18.208 1.00 93.31  ? 461  THR C OG1 1 
ATOM   9412  C CG2 . THR C 1 450 ? -15.771 42.994  -18.846 1.00 93.31  ? 461  THR C CG2 1 
ATOM   9413  N N   . MET C 1 451 ? -17.968 40.565  -21.108 1.00 123.46 ? 462  MET C N   1 
ATOM   9414  C CA  . MET C 1 451 ? -18.417 40.629  -22.503 1.00 123.46 ? 462  MET C CA  1 
ATOM   9415  C C   . MET C 1 451 ? -19.911 40.902  -22.684 1.00 123.46 ? 462  MET C C   1 
ATOM   9416  O O   . MET C 1 451 ? -20.641 41.110  -21.717 1.00 123.46 ? 462  MET C O   1 
ATOM   9417  C CB  . MET C 1 451 ? -18.080 39.309  -23.210 1.00 201.99 ? 462  MET C CB  1 
ATOM   9418  C CG  . MET C 1 451 ? -18.914 38.113  -22.723 1.00 201.99 ? 462  MET C CG  1 
ATOM   9419  S SD  . MET C 1 451 ? -18.563 36.514  -23.520 1.00 201.99 ? 462  MET C SD  1 
ATOM   9420  C CE  . MET C 1 451 ? -17.889 35.567  -22.139 1.00 201.99 ? 462  MET C CE  1 
ATOM   9421  N N   . LYS C 1 452 ? -20.342 40.887  -23.945 1.00 105.74 ? 463  LYS C N   1 
ATOM   9422  C CA  . LYS C 1 452 ? -21.737 41.099  -24.346 1.00 105.74 ? 463  LYS C CA  1 
ATOM   9423  C C   . LYS C 1 452 ? -21.846 40.755  -25.827 1.00 105.74 ? 463  LYS C C   1 
ATOM   9424  O O   . LYS C 1 452 ? -21.625 41.611  -26.679 1.00 105.74 ? 463  LYS C O   1 
ATOM   9425  C CB  . LYS C 1 452 ? -22.176 42.562  -24.147 1.00 106.41 ? 463  LYS C CB  1 
ATOM   9426  C CG  . LYS C 1 452 ? -22.405 42.986  -22.698 1.00 106.41 ? 463  LYS C CG  1 
ATOM   9427  C CD  . LYS C 1 452 ? -22.860 44.441  -22.578 1.00 106.41 ? 463  LYS C CD  1 
ATOM   9428  C CE  . LYS C 1 452 ? -22.943 44.872  -21.112 1.00 106.41 ? 463  LYS C CE  1 
ATOM   9429  N NZ  . LYS C 1 452 ? -23.412 46.275  -20.921 1.00 106.41 ? 463  LYS C NZ  1 
ATOM   9430  N N   . GLU C 1 453 ? -22.178 39.506  -26.137 1.00 92.28  ? 464  GLU C N   1 
ATOM   9431  C CA  . GLU C 1 453 ? -22.303 39.096  -27.532 1.00 92.28  ? 464  GLU C CA  1 
ATOM   9432  C C   . GLU C 1 453 ? -23.717 38.693  -27.958 1.00 92.28  ? 464  GLU C C   1 
ATOM   9433  O O   . GLU C 1 453 ? -24.672 38.796  -27.184 1.00 92.28  ? 464  GLU C O   1 
ATOM   9434  C CB  . GLU C 1 453 ? -21.321 37.956  -27.840 1.00 100.12 ? 464  GLU C CB  1 
ATOM   9435  C CG  . GLU C 1 453 ? -21.443 36.723  -26.959 1.00 100.12 ? 464  GLU C CG  1 
ATOM   9436  C CD  . GLU C 1 453 ? -20.451 35.634  -27.352 1.00 100.12 ? 464  GLU C CD  1 
ATOM   9437  O OE1 . GLU C 1 453 ? -19.229 35.907  -27.348 1.00 100.12 ? 464  GLU C OE1 1 
ATOM   9438  O OE2 . GLU C 1 453 ? -20.893 34.506  -27.666 1.00 100.12 ? 464  GLU C OE2 1 
ATOM   9439  N N   . MET C 1 454 ? -23.838 38.247  -29.207 1.00 101.17 ? 465  MET C N   1 
ATOM   9440  C CA  . MET C 1 454 ? -25.116 37.826  -29.768 1.00 101.17 ? 465  MET C CA  1 
ATOM   9441  C C   . MET C 1 454 ? -25.234 36.304  -29.718 1.00 101.17 ? 465  MET C C   1 
ATOM   9442  O O   . MET C 1 454 ? -24.309 35.589  -30.106 1.00 101.17 ? 465  MET C O   1 
ATOM   9443  C CB  . MET C 1 454 ? -25.238 38.325  -31.208 1.00 168.94 ? 465  MET C CB  1 
ATOM   9444  C CG  . MET C 1 454 ? -25.134 39.838  -31.337 1.00 168.94 ? 465  MET C CG  1 
ATOM   9445  S SD  . MET C 1 454 ? -25.300 40.421  -33.035 1.00 168.94 ? 465  MET C SD  1 
ATOM   9446  C CE  . MET C 1 454 ? -27.061 40.834  -33.102 1.00 168.94 ? 465  MET C CE  1 
ATOM   9447  N N   . MET C 1 455 ? -26.380 35.818  -29.243 1.00 76.44  ? 466  MET C N   1 
ATOM   9448  C CA  . MET C 1 455 ? -26.614 34.385  -29.102 1.00 76.44  ? 466  MET C CA  1 
ATOM   9449  C C   . MET C 1 455 ? -28.058 34.007  -29.393 1.00 76.44  ? 466  MET C C   1 
ATOM   9450  O O   . MET C 1 455 ? -28.990 34.638  -28.890 1.00 76.44  ? 466  MET C O   1 
ATOM   9451  C CB  . MET C 1 455 ? -26.266 33.955  -27.675 1.00 102.45 ? 466  MET C CB  1 
ATOM   9452  C CG  . MET C 1 455 ? -26.521 32.490  -27.357 1.00 102.45 ? 466  MET C CG  1 
ATOM   9453  S SD  . MET C 1 455 ? -25.241 31.374  -27.957 1.00 102.45 ? 466  MET C SD  1 
ATOM   9454  C CE  . MET C 1 455 ? -24.084 31.465  -26.609 1.00 102.45 ? 466  MET C CE  1 
ATOM   9455  N N   . HIS C 1 456 ? -28.236 32.969  -30.202 1.00 199.38 ? 467  HIS C N   1 
ATOM   9456  C CA  . HIS C 1 456 ? -29.566 32.486  -30.547 1.00 199.38 ? 467  HIS C CA  1 
ATOM   9457  C C   . HIS C 1 456 ? -30.124 31.885  -29.257 1.00 199.38 ? 467  HIS C C   1 
ATOM   9458  O O   . HIS C 1 456 ? -29.459 31.075  -28.612 1.00 199.38 ? 467  HIS C O   1 
ATOM   9459  C CB  . HIS C 1 456 ? -29.465 31.411  -31.642 1.00 148.03 ? 467  HIS C CB  1 
ATOM   9460  C CG  . HIS C 1 456 ? -30.713 31.242  -32.458 1.00 148.03 ? 467  HIS C CG  1 
ATOM   9461  N ND1 . HIS C 1 456 ? -31.922 30.866  -31.911 1.00 148.03 ? 467  HIS C ND1 1 
ATOM   9462  C CD2 . HIS C 1 456 ? -30.933 31.383  -33.787 1.00 148.03 ? 467  HIS C CD2 1 
ATOM   9463  C CE1 . HIS C 1 456 ? -32.831 30.783  -32.867 1.00 148.03 ? 467  HIS C CE1 1 
ATOM   9464  N NE2 . HIS C 1 456 ? -32.257 31.092  -34.015 1.00 148.03 ? 467  HIS C NE2 1 
ATOM   9465  N N   . ILE C 1 457 ? -31.330 32.297  -28.875 1.00 86.42  ? 468  ILE C N   1 
ATOM   9466  C CA  . ILE C 1 457 ? -31.977 31.801  -27.663 1.00 86.42  ? 468  ILE C CA  1 
ATOM   9467  C C   . ILE C 1 457 ? -32.113 30.283  -27.677 1.00 86.42  ? 468  ILE C C   1 
ATOM   9468  O O   . ILE C 1 457 ? -32.816 29.717  -26.845 1.00 86.42  ? 468  ILE C O   1 
ATOM   9469  C CB  . ILE C 1 457 ? -33.388 32.378  -27.511 1.00 72.42  ? 468  ILE C CB  1 
ATOM   9470  C CG1 . ILE C 1 457 ? -33.881 32.207  -26.078 1.00 72.42  ? 468  ILE C CG1 1 
ATOM   9471  C CG2 . ILE C 1 457 ? -34.344 31.646  -28.454 1.00 72.42  ? 468  ILE C CG2 1 
ATOM   9472  C CD1 . ILE C 1 457 ? -35.296 32.718  -25.864 1.00 72.42  ? 468  ILE C CD1 1 
ATOM   9473  N N   . SER C 1 458 ? -31.455 29.631  -28.629 1.00 88.97  ? 469  SER C N   1 
ATOM   9474  C CA  . SER C 1 458 ? -31.510 28.177  -28.746 1.00 88.97  ? 469  SER C CA  1 
ATOM   9475  C C   . SER C 1 458 ? -30.117 27.556  -28.673 1.00 88.97  ? 469  SER C C   1 
ATOM   9476  O O   . SER C 1 458 ? -29.973 26.337  -28.746 1.00 88.97  ? 469  SER C O   1 
ATOM   9477  C CB  . SER C 1 458 ? -32.189 27.777  -30.063 1.00 91.95  ? 469  SER C CB  1 
ATOM   9478  O OG  . SER C 1 458 ? -32.271 26.369  -30.199 1.00 91.95  ? 469  SER C OG  1 
ATOM   9479  N N   . LYS C 1 459 ? -29.094 28.397  -28.541 1.00 201.99 ? 470  LYS C N   1 
ATOM   9480  C CA  . LYS C 1 459 ? -27.716 27.921  -28.439 1.00 201.99 ? 470  LYS C CA  1 
ATOM   9481  C C   . LYS C 1 459 ? -27.080 28.429  -27.147 1.00 201.99 ? 470  LYS C C   1 
ATOM   9482  O O   . LYS C 1 459 ? -25.857 28.542  -27.036 1.00 201.99 ? 470  LYS C O   1 
ATOM   9483  C CB  . LYS C 1 459 ? -26.892 28.376  -29.652 1.00 128.25 ? 470  LYS C CB  1 
ATOM   9484  C CG  . LYS C 1 459 ? -27.242 27.656  -30.956 1.00 128.25 ? 470  LYS C CG  1 
ATOM   9485  C CD  . LYS C 1 459 ? -26.261 27.996  -32.079 1.00 128.25 ? 470  LYS C CD  1 
ATOM   9486  C CE  . LYS C 1 459 ? -26.311 29.474  -32.453 1.00 128.25 ? 470  LYS C CE  1 
ATOM   9487  N NZ  . LYS C 1 459 ? -25.389 29.816  -33.575 1.00 128.25 ? 470  LYS C NZ  1 
ATOM   9488  N N   . LEU C 1 460 ? -27.935 28.728  -26.174 1.00 107.79 ? 471  LEU C N   1 
ATOM   9489  C CA  . LEU C 1 460 ? -27.514 29.221  -24.869 1.00 107.79 ? 471  LEU C CA  1 
ATOM   9490  C C   . LEU C 1 460 ? -27.220 28.043  -23.937 1.00 107.79 ? 471  LEU C C   1 
ATOM   9491  O O   . LEU C 1 460 ? -26.192 28.019  -23.257 1.00 107.79 ? 471  LEU C O   1 
ATOM   9492  C CB  . LEU C 1 460 ? -28.620 30.092  -24.266 1.00 70.69  ? 471  LEU C CB  1 
ATOM   9493  C CG  . LEU C 1 460 ? -28.319 30.846  -22.970 1.00 70.69  ? 471  LEU C CG  1 
ATOM   9494  C CD1 . LEU C 1 460 ? -27.368 31.989  -23.266 1.00 70.69  ? 471  LEU C CD1 1 
ATOM   9495  C CD2 . LEU C 1 460 ? -29.608 31.383  -22.371 1.00 70.69  ? 471  LEU C CD2 1 
ATOM   9496  N N   . LYS C 1 461 ? -28.132 27.072  -23.911 1.00 127.04 ? 472  LYS C N   1 
ATOM   9497  C CA  . LYS C 1 461 ? -27.979 25.889  -23.066 1.00 127.04 ? 472  LYS C CA  1 
ATOM   9498  C C   . LYS C 1 461 ? -26.818 25.025  -23.548 1.00 127.04 ? 472  LYS C C   1 
ATOM   9499  O O   . LYS C 1 461 ? -26.017 24.549  -22.743 1.00 127.04 ? 472  LYS C O   1 
ATOM   9500  C CB  . LYS C 1 461 ? -29.284 25.081  -23.046 1.00 87.26  ? 472  LYS C CB  1 
ATOM   9501  C CG  . LYS C 1 461 ? -29.780 24.665  -24.411 1.00 87.26  ? 472  LYS C CG  1 
ATOM   9502  C CD  . LYS C 1 461 ? -29.271 23.291  -24.795 1.00 87.26  ? 472  LYS C CD  1 
ATOM   9503  C CE  . LYS C 1 461 ? -29.926 22.219  -23.946 1.00 87.26  ? 472  LYS C CE  1 
ATOM   9504  N NZ  . LYS C 1 461 ? -29.731 20.857  -24.520 1.00 87.26  ? 472  LYS C NZ  1 
ATOM   9505  N N   . ASP C 1 462 ? -26.729 24.822  -24.859 1.00 58.89  ? 473  ASP C N   1 
ATOM   9506  C CA  . ASP C 1 462 ? -25.635 24.042  -25.429 1.00 58.89  ? 473  ASP C CA  1 
ATOM   9507  C C   . ASP C 1 462 ? -24.326 24.692  -24.969 1.00 58.89  ? 473  ASP C C   1 
ATOM   9508  O O   . ASP C 1 462 ? -23.427 24.026  -24.443 1.00 58.89  ? 473  ASP C O   1 
ATOM   9509  C CB  . ASP C 1 462 ? -25.725 24.058  -26.959 1.00 190.68 ? 473  ASP C CB  1 
ATOM   9510  C CG  . ASP C 1 462 ? -24.497 23.459  -27.629 1.00 190.68 ? 473  ASP C CG  1 
ATOM   9511  O OD1 . ASP C 1 462 ? -23.404 24.062  -27.540 1.00 190.68 ? 473  ASP C OD1 1 
ATOM   9512  O OD2 . ASP C 1 462 ? -24.627 22.383  -28.249 1.00 190.68 ? 473  ASP C OD2 1 
ATOM   9513  N N   . PHE C 1 463 ? -24.242 26.004  -25.177 1.00 67.68  ? 474  PHE C N   1 
ATOM   9514  C CA  . PHE C 1 463 ? -23.080 26.789  -24.787 1.00 67.68  ? 474  PHE C CA  1 
ATOM   9515  C C   . PHE C 1 463 ? -22.790 26.570  -23.314 1.00 67.68  ? 474  PHE C C   1 
ATOM   9516  O O   . PHE C 1 463 ? -21.716 26.084  -22.952 1.00 67.68  ? 474  PHE C O   1 
ATOM   9517  C CB  . PHE C 1 463 ? -23.352 28.271  -25.041 1.00 93.54  ? 474  PHE C CB  1 
ATOM   9518  C CG  . PHE C 1 463 ? -22.387 29.198  -24.352 1.00 93.54  ? 474  PHE C CG  1 
ATOM   9519  C CD1 . PHE C 1 463 ? -21.028 29.167  -24.656 1.00 93.54  ? 474  PHE C CD1 1 
ATOM   9520  C CD2 . PHE C 1 463 ? -22.843 30.121  -23.417 1.00 93.54  ? 474  PHE C CD2 1 
ATOM   9521  C CE1 . PHE C 1 463 ? -20.137 30.050  -24.039 1.00 93.54  ? 474  PHE C CE1 1 
ATOM   9522  C CE2 . PHE C 1 463 ? -21.963 31.002  -22.799 1.00 93.54  ? 474  PHE C CE2 1 
ATOM   9523  C CZ  . PHE C 1 463 ? -20.606 30.967  -23.110 1.00 93.54  ? 474  PHE C CZ  1 
ATOM   9524  N N   . LEU C 1 464 ? -23.765 26.937  -22.479 1.00 84.52  ? 475  LEU C N   1 
ATOM   9525  C CA  . LEU C 1 464 ? -23.670 26.808  -21.027 1.00 84.52  ? 475  LEU C CA  1 
ATOM   9526  C C   . LEU C 1 464 ? -23.113 25.459  -20.595 1.00 84.52  ? 475  LEU C C   1 
ATOM   9527  O O   . LEU C 1 464 ? -22.155 25.398  -19.825 1.00 84.52  ? 475  LEU C O   1 
ATOM   9528  C CB  . LEU C 1 464 ? -25.047 27.023  -20.386 1.00 53.17  ? 475  LEU C CB  1 
ATOM   9529  C CG  . LEU C 1 464 ? -25.625 28.443  -20.476 1.00 53.17  ? 475  LEU C CG  1 
ATOM   9530  C CD1 . LEU C 1 464 ? -27.044 28.501  -19.904 1.00 53.17  ? 475  LEU C CD1 1 
ATOM   9531  C CD2 . LEU C 1 464 ? -24.709 29.391  -19.718 1.00 53.17  ? 475  LEU C CD2 1 
ATOM   9532  N N   . ILE C 1 465 ? -23.709 24.379  -21.098 1.00 79.57  ? 476  ILE C N   1 
ATOM   9533  C CA  . ILE C 1 465 ? -23.273 23.026  -20.747 1.00 79.57  ? 476  ILE C CA  1 
ATOM   9534  C C   . ILE C 1 465 ? -21.895 22.670  -21.302 1.00 79.57  ? 476  ILE C C   1 
ATOM   9535  O O   . ILE C 1 465 ? -21.276 21.699  -20.869 1.00 79.57  ? 476  ILE C O   1 
ATOM   9536  C CB  . ILE C 1 465 ? -24.313 21.979  -21.203 1.00 65.96  ? 476  ILE C CB  1 
ATOM   9537  C CG1 . ILE C 1 465 ? -25.608 22.180  -20.419 1.00 65.96  ? 476  ILE C CG1 1 
ATOM   9538  C CG2 . ILE C 1 465 ? -23.794 20.562  -20.971 1.00 65.96  ? 476  ILE C CG2 1 
ATOM   9539  C CD1 . ILE C 1 465 ? -26.709 21.252  -20.837 1.00 65.96  ? 476  ILE C CD1 1 
ATOM   9540  N N   . LYS C 1 466 ? -21.420 23.456  -22.263 1.00 67.81  ? 477  LYS C N   1 
ATOM   9541  C CA  . LYS C 1 466 ? -20.099 23.233  -22.835 1.00 67.81  ? 477  LYS C CA  1 
ATOM   9542  C C   . LYS C 1 466 ? -19.112 24.100  -22.070 1.00 67.81  ? 477  LYS C C   1 
ATOM   9543  O O   . LYS C 1 466 ? -17.944 23.749  -21.910 1.00 67.81  ? 477  LYS C O   1 
ATOM   9544  C CB  . LYS C 1 466 ? -20.082 23.590  -24.325 1.00 151.87 ? 477  LYS C CB  1 
ATOM   9545  C CG  . LYS C 1 466 ? -20.432 22.419  -25.239 1.00 151.87 ? 477  LYS C CG  1 
ATOM   9546  C CD  . LYS C 1 466 ? -19.430 21.281  -25.071 1.00 151.87 ? 477  LYS C CD  1 
ATOM   9547  C CE  . LYS C 1 466 ? -19.792 20.076  -25.920 1.00 151.87 ? 477  LYS C CE  1 
ATOM   9548  N NZ  . LYS C 1 466 ? -18.856 18.945  -25.676 1.00 151.87 ? 477  LYS C NZ  1 
ATOM   9549  N N   . TYR C 1 467 ? -19.601 25.236  -21.588 1.00 106.60 ? 478  TYR C N   1 
ATOM   9550  C CA  . TYR C 1 467 ? -18.775 26.149  -20.820 1.00 106.60 ? 478  TYR C CA  1 
ATOM   9551  C C   . TYR C 1 467 ? -18.400 25.446  -19.530 1.00 106.60 ? 478  TYR C C   1 
ATOM   9552  O O   . TYR C 1 467 ? -17.257 25.514  -19.093 1.00 106.60 ? 478  TYR C O   1 
ATOM   9553  C CB  . TYR C 1 467 ? -19.547 27.435  -20.505 1.00 62.35  ? 478  TYR C CB  1 
ATOM   9554  C CG  . TYR C 1 467 ? -18.748 28.484  -19.766 1.00 62.35  ? 478  TYR C CG  1 
ATOM   9555  C CD1 . TYR C 1 467 ? -18.273 28.250  -18.482 1.00 62.35  ? 478  TYR C CD1 1 
ATOM   9556  C CD2 . TYR C 1 467 ? -18.465 29.716  -20.355 1.00 62.35  ? 478  TYR C CD2 1 
ATOM   9557  C CE1 . TYR C 1 467 ? -17.533 29.212  -17.795 1.00 62.35  ? 478  TYR C CE1 1 
ATOM   9558  C CE2 . TYR C 1 467 ? -17.723 30.692  -19.677 1.00 62.35  ? 478  TYR C CE2 1 
ATOM   9559  C CZ  . TYR C 1 467 ? -17.260 30.429  -18.393 1.00 62.35  ? 478  TYR C CZ  1 
ATOM   9560  O OH  . TYR C 1 467 ? -16.532 31.376  -17.701 1.00 62.35  ? 478  TYR C OH  1 
ATOM   9561  N N   . ILE C 1 468 ? -19.371 24.760  -18.932 1.00 120.47 ? 479  ILE C N   1 
ATOM   9562  C CA  . ILE C 1 468 ? -19.154 24.052  -17.674 1.00 120.47 ? 479  ILE C CA  1 
ATOM   9563  C C   . ILE C 1 468 ? -18.460 22.704  -17.875 1.00 120.47 ? 479  ILE C C   1 
ATOM   9564  O O   . ILE C 1 468 ? -17.530 22.368  -17.144 1.00 120.47 ? 479  ILE C O   1 
ATOM   9565  C CB  . ILE C 1 468 ? -20.497 23.833  -16.910 1.00 63.63  ? 479  ILE C CB  1 
ATOM   9566  C CG1 . ILE C 1 468 ? -21.218 25.170  -16.717 1.00 63.63  ? 479  ILE C CG1 1 
ATOM   9567  C CG2 . ILE C 1 468 ? -20.228 23.225  -15.539 1.00 63.63  ? 479  ILE C CG2 1 
ATOM   9568  C CD1 . ILE C 1 468 ? -22.476 25.065  -15.920 1.00 63.63  ? 479  ILE C CD1 1 
ATOM   9569  N N   . SER C 1 469 ? -18.905 21.936  -18.866 1.00 113.77 ? 480  SER C N   1 
ATOM   9570  C CA  . SER C 1 469 ? -18.303 20.633  -19.141 1.00 113.77 ? 480  SER C CA  1 
ATOM   9571  C C   . SER C 1 469 ? -16.898 20.836  -19.713 1.00 113.77 ? 480  SER C C   1 
ATOM   9572  O O   . SER C 1 469 ? -16.344 19.956  -20.376 1.00 113.77 ? 480  SER C O   1 
ATOM   9573  C CB  . SER C 1 469 ? -19.174 19.842  -20.128 1.00 153.43 ? 480  SER C CB  1 
ATOM   9574  O OG  . SER C 1 469 ? -18.713 18.508  -20.286 1.00 153.43 ? 480  SER C OG  1 
ATOM   9575  N N   . SER C 1 470 ? -16.338 22.015  -19.451 1.00 75.97  ? 481  SER C N   1 
ATOM   9576  C CA  . SER C 1 470 ? -14.999 22.375  -19.905 1.00 75.97  ? 481  SER C CA  1 
ATOM   9577  C C   . SER C 1 470 ? -14.205 22.898  -18.718 1.00 75.97  ? 481  SER C C   1 
ATOM   9578  O O   . SER C 1 470 ? -13.325 22.216  -18.215 1.00 75.97  ? 481  SER C O   1 
ATOM   9579  C CB  . SER C 1 470 ? -15.064 23.448  -21.000 1.00 144.17 ? 481  SER C CB  1 
ATOM   9580  O OG  . SER C 1 470 ? -15.571 22.920  -22.215 1.00 144.17 ? 481  SER C OG  1 
ATOM   9581  N N   . ALA C 1 471 ? -14.519 24.107  -18.267 1.00 92.49  ? 482  ALA C N   1 
ATOM   9582  C CA  . ALA C 1 471 ? -13.826 24.689  -17.124 1.00 92.49  ? 482  ALA C CA  1 
ATOM   9583  C C   . ALA C 1 471 ? -13.754 23.661  -16.003 1.00 92.49  ? 482  ALA C C   1 
ATOM   9584  O O   . ALA C 1 471 ? -12.851 23.695  -15.167 1.00 92.49  ? 482  ALA C O   1 
ATOM   9585  C CB  . ALA C 1 471 ? -14.561 25.939  -16.639 1.00 48.06  ? 482  ALA C CB  1 
ATOM   9586  N N   . LYS C 1 472 ? -14.713 22.740  -15.999 1.00 109.43 ? 483  LYS C N   1 
ATOM   9587  C CA  . LYS C 1 472 ? -14.774 21.699  -14.982 1.00 109.43 ? 483  LYS C CA  1 
ATOM   9588  C C   . LYS C 1 472 ? -13.636 20.695  -15.146 1.00 109.43 ? 483  LYS C C   1 
ATOM   9589  O O   . LYS C 1 472 ? -12.973 20.331  -14.173 1.00 109.43 ? 483  LYS C O   1 
ATOM   9590  C CB  . LYS C 1 472 ? -16.126 20.973  -15.055 1.00 92.74  ? 483  LYS C CB  1 
ATOM   9591  C CG  . LYS C 1 472 ? -16.477 20.179  -13.800 1.00 92.74  ? 483  LYS C CG  1 
ATOM   9592  C CD  . LYS C 1 472 ? -16.228 18.687  -13.944 1.00 92.74  ? 483  LYS C CD  1 
ATOM   9593  C CE  . LYS C 1 472 ? -17.357 18.013  -14.702 1.00 92.74  ? 483  LYS C CE  1 
ATOM   9594  N NZ  . LYS C 1 472 ? -17.277 16.530  -14.604 1.00 92.74  ? 483  LYS C NZ  1 
ATOM   9595  N N   . ASN C 1 473 ? -13.412 20.264  -16.385 1.00 109.21 ? 484  ASN C N   1 
ATOM   9596  C CA  . ASN C 1 473 ? -12.367 19.292  -16.707 1.00 109.21 ? 484  ASN C CA  1 
ATOM   9597  C C   . ASN C 1 473 ? -11.068 19.944  -17.209 1.00 109.21 ? 484  ASN C C   1 
ATOM   9598  O O   . ASN C 1 473 ? -10.684 19.775  -18.366 1.00 109.21 ? 484  ASN C O   1 
ATOM   9599  C CB  . ASN C 1 473 ? -12.904 18.299  -17.751 1.00 78.84  ? 484  ASN C CB  1 
ATOM   9600  C CG  . ASN C 1 473 ? -14.067 17.467  -17.223 1.00 78.84  ? 484  ASN C CG  1 
ATOM   9601  O OD1 . ASN C 1 473 ? -14.913 17.975  -16.490 1.00 78.84  ? 484  ASN C OD1 1 
ATOM   9602  N ND2 . ASN C 1 473 ? -14.118 16.191  -17.603 1.00 78.84  ? 484  ASN C ND2 1 
ATOM   9603  N N   . VAL C 1 474 ? -10.400 20.683  -16.325 1.00 190.07 ? 485  VAL C N   1 
ATOM   9604  C CA  . VAL C 1 474 ? -9.144  21.363  -16.650 1.00 190.07 ? 485  VAL C CA  1 
ATOM   9605  C C   . VAL C 1 474 ? -8.284  21.535  -15.392 1.00 190.07 ? 485  VAL C C   1 
ATOM   9606  O O   . VAL C 1 474 ? -7.112  21.099  -15.416 1.00 190.07 ? 485  VAL C O   1 
ATOM   9607  C CB  . VAL C 1 474 ? -9.406  22.759  -17.307 1.00 100.72 ? 485  VAL C CB  1 
ATOM   9608  C CG1 . VAL C 1 474 ? -8.135  23.611  -17.289 1.00 100.72 ? 485  VAL C CG1 1 
ATOM   9609  C CG2 . VAL C 1 474 ? -9.876  22.575  -18.750 1.00 100.72 ? 485  VAL C CG2 1 
ATOM   9610  O OXT . VAL C 1 474 ? -8.789  22.096  -14.395 1.00 100.72 ? 485  VAL C OXT 1 
ATOM   9611  N N   . GLU D 1 56  ? 28.504  -24.635 34.111  1.00 104.87 ? 67   GLU D N   1 
ATOM   9612  C CA  . GLU D 1 56  ? 29.696  -23.752 33.966  1.00 104.87 ? 67   GLU D CA  1 
ATOM   9613  C C   . GLU D 1 56  ? 29.487  -22.825 32.775  1.00 104.87 ? 67   GLU D C   1 
ATOM   9614  O O   . GLU D 1 56  ? 28.823  -21.792 32.885  1.00 104.87 ? 67   GLU D O   1 
ATOM   9615  C CB  . GLU D 1 56  ? 30.956  -24.590 33.734  1.00 120.30 ? 67   GLU D CB  1 
ATOM   9616  C CG  . GLU D 1 56  ? 30.829  -26.050 34.136  1.00 120.30 ? 67   GLU D CG  1 
ATOM   9617  C CD  . GLU D 1 56  ? 29.824  -26.805 33.283  1.00 120.30 ? 67   GLU D CD  1 
ATOM   9618  O OE1 . GLU D 1 56  ? 30.013  -26.863 32.048  1.00 120.30 ? 67   GLU D OE1 1 
ATOM   9619  O OE2 . GLU D 1 56  ? 28.847  -27.337 33.852  1.00 120.30 ? 67   GLU D OE2 1 
ATOM   9620  N N   . ALA D 1 57  ? 30.061  -23.210 31.637  1.00 125.49 ? 68   ALA D N   1 
ATOM   9621  C CA  . ALA D 1 57  ? 29.948  -22.439 30.402  1.00 125.49 ? 68   ALA D CA  1 
ATOM   9622  C C   . ALA D 1 57  ? 28.562  -22.642 29.814  1.00 125.49 ? 68   ALA D C   1 
ATOM   9623  O O   . ALA D 1 57  ? 28.051  -21.790 29.090  1.00 125.49 ? 68   ALA D O   1 
ATOM   9624  C CB  . ALA D 1 57  ? 31.003  -22.890 29.406  1.00 76.28  ? 68   ALA D CB  1 
ATOM   9625  N N   . LEU D 1 58  ? 27.969  -23.789 30.127  1.00 94.49  ? 69   LEU D N   1 
ATOM   9626  C CA  . LEU D 1 58  ? 26.633  -24.128 29.661  1.00 94.49  ? 69   LEU D CA  1 
ATOM   9627  C C   . LEU D 1 58  ? 25.654  -23.462 30.616  1.00 94.49  ? 69   LEU D C   1 
ATOM   9628  O O   . LEU D 1 58  ? 24.658  -22.872 30.203  1.00 94.49  ? 69   LEU D O   1 
ATOM   9629  C CB  . LEU D 1 58  ? 26.439  -25.653 29.669  1.00 54.90  ? 69   LEU D CB  1 
ATOM   9630  C CG  . LEU D 1 58  ? 25.088  -26.250 29.247  1.00 54.90  ? 69   LEU D CG  1 
ATOM   9631  C CD1 . LEU D 1 58  ? 24.659  -25.708 27.885  1.00 54.90  ? 69   LEU D CD1 1 
ATOM   9632  C CD2 . LEU D 1 58  ? 25.203  -27.765 29.211  1.00 54.90  ? 69   LEU D CD2 1 
ATOM   9633  N N   . LEU D 1 59  ? 25.964  -23.543 31.901  1.00 55.65  ? 70   LEU D N   1 
ATOM   9634  C CA  . LEU D 1 59  ? 25.121  -22.954 32.919  1.00 55.65  ? 70   LEU D CA  1 
ATOM   9635  C C   . LEU D 1 59  ? 25.032  -21.445 32.734  1.00 55.65  ? 70   LEU D C   1 
ATOM   9636  O O   . LEU D 1 59  ? 23.942  -20.876 32.732  1.00 55.65  ? 70   LEU D O   1 
ATOM   9637  C CB  . LEU D 1 59  ? 25.679  -23.274 34.300  1.00 87.73  ? 70   LEU D CB  1 
ATOM   9638  C CG  . LEU D 1 59  ? 24.668  -23.217 35.444  1.00 87.73  ? 70   LEU D CG  1 
ATOM   9639  C CD1 . LEU D 1 59  ? 24.143  -21.795 35.646  1.00 87.73  ? 70   LEU D CD1 1 
ATOM   9640  C CD2 . LEU D 1 59  ? 23.532  -24.179 35.125  1.00 87.73  ? 70   LEU D CD2 1 
ATOM   9641  N N   . GLU D 1 60  ? 26.178  -20.794 32.579  1.00 80.92  ? 71   GLU D N   1 
ATOM   9642  C CA  . GLU D 1 60  ? 26.198  -19.347 32.397  1.00 80.92  ? 71   GLU D CA  1 
ATOM   9643  C C   . GLU D 1 60  ? 25.301  -18.994 31.217  1.00 80.92  ? 71   GLU D C   1 
ATOM   9644  O O   . GLU D 1 60  ? 24.409  -18.159 31.338  1.00 80.92  ? 71   GLU D O   1 
ATOM   9645  C CB  . GLU D 1 60  ? 27.629  -18.867 32.135  1.00 186.37 ? 71   GLU D CB  1 
ATOM   9646  C CG  . GLU D 1 60  ? 27.953  -17.499 32.724  1.00 186.37 ? 71   GLU D CG  1 
ATOM   9647  C CD  . GLU D 1 60  ? 27.149  -16.375 32.101  1.00 186.37 ? 71   GLU D CD  1 
ATOM   9648  O OE1 . GLU D 1 60  ? 27.337  -16.105 30.897  1.00 186.37 ? 71   GLU D OE1 1 
ATOM   9649  O OE2 . GLU D 1 60  ? 26.330  -15.759 32.815  1.00 186.37 ? 71   GLU D OE2 1 
ATOM   9650  N N   . ILE D 1 61  ? 25.537  -19.654 30.084  1.00 85.94  ? 72   ILE D N   1 
ATOM   9651  C CA  . ILE D 1 61  ? 24.755  -19.431 28.868  1.00 85.94  ? 72   ILE D CA  1 
ATOM   9652  C C   . ILE D 1 61  ? 23.271  -19.602 29.162  1.00 85.94  ? 72   ILE D C   1 
ATOM   9653  O O   . ILE D 1 61  ? 22.471  -18.698 28.907  1.00 85.94  ? 72   ILE D O   1 
ATOM   9654  C CB  . ILE D 1 61  ? 25.162  -20.425 27.738  1.00 54.22  ? 72   ILE D CB  1 
ATOM   9655  C CG1 . ILE D 1 61  ? 26.544  -20.058 27.181  1.00 54.22  ? 72   ILE D CG1 1 
ATOM   9656  C CG2 . ILE D 1 61  ? 24.144  -20.400 26.619  1.00 54.22  ? 72   ILE D CG2 1 
ATOM   9657  C CD1 . ILE D 1 61  ? 27.126  -21.076 26.218  1.00 54.22  ? 72   ILE D CD1 1 
ATOM   9658  N N   . CYS D 1 62  ? 22.917  -20.766 29.705  1.00 54.32  ? 73   CYS D N   1 
ATOM   9659  C CA  . CYS D 1 62  ? 21.533  -21.084 30.046  1.00 54.32  ? 73   CYS D CA  1 
ATOM   9660  C C   . CYS D 1 62  ? 20.938  -19.944 30.845  1.00 54.32  ? 73   CYS D C   1 
ATOM   9661  O O   . CYS D 1 62  ? 19.725  -19.731 30.851  1.00 54.32  ? 73   CYS D O   1 
ATOM   9662  C CB  . CYS D 1 62  ? 21.472  -22.375 30.868  1.00 46.61  ? 73   CYS D CB  1 
ATOM   9663  S SG  . CYS D 1 62  ? 21.603  -23.905 29.912  1.00 46.61  ? 73   CYS D SG  1 
ATOM   9664  N N   . GLN D 1 63  ? 21.808  -19.215 31.531  1.00 66.83  ? 74   GLN D N   1 
ATOM   9665  C CA  . GLN D 1 63  ? 21.370  -18.091 32.320  1.00 66.83  ? 74   GLN D CA  1 
ATOM   9666  C C   . GLN D 1 63  ? 21.199  -16.894 31.406  1.00 66.83  ? 74   GLN D C   1 
ATOM   9667  O O   . GLN D 1 63  ? 20.078  -16.436 31.195  1.00 66.83  ? 74   GLN D O   1 
ATOM   9668  C CB  . GLN D 1 63  ? 22.387  -17.765 33.393  1.00 89.28  ? 74   GLN D CB  1 
ATOM   9669  C CG  . GLN D 1 63  ? 21.870  -16.763 34.383  1.00 89.28  ? 74   GLN D CG  1 
ATOM   9670  C CD  . GLN D 1 63  ? 22.958  -16.268 35.289  1.00 89.28  ? 74   GLN D CD  1 
ATOM   9671  O OE1 . GLN D 1 63  ? 23.838  -17.037 35.686  1.00 89.28  ? 74   GLN D OE1 1 
ATOM   9672  N NE2 . GLN D 1 63  ? 22.910  -14.981 35.635  1.00 89.28  ? 74   GLN D NE2 1 
ATOM   9673  N N   . ARG D 1 64  ? 22.308  -16.401 30.855  1.00 86.91  ? 75   ARG D N   1 
ATOM   9674  C CA  . ARG D 1 64  ? 22.291  -15.239 29.960  1.00 86.91  ? 75   ARG D CA  1 
ATOM   9675  C C   . ARG D 1 64  ? 21.257  -15.343 28.854  1.00 86.91  ? 75   ARG D C   1 
ATOM   9676  O O   . ARG D 1 64  ? 20.619  -14.343 28.500  1.00 86.91  ? 75   ARG D O   1 
ATOM   9677  C CB  . ARG D 1 64  ? 23.666  -15.014 29.316  1.00 109.85 ? 75   ARG D CB  1 
ATOM   9678  C CG  . ARG D 1 64  ? 24.707  -14.366 30.220  1.00 109.85 ? 75   ARG D CG  1 
ATOM   9679  C CD  . ARG D 1 64  ? 25.941  -13.948 29.429  1.00 109.85 ? 75   ARG D CD  1 
ATOM   9680  N NE  . ARG D 1 64  ? 26.484  -15.048 28.635  1.00 109.85 ? 75   ARG D NE  1 
ATOM   9681  C CZ  . ARG D 1 64  ? 27.618  -14.986 27.941  1.00 109.85 ? 75   ARG D CZ  1 
ATOM   9682  N NH1 . ARG D 1 64  ? 28.338  -13.871 27.941  1.00 109.85 ? 75   ARG D NH1 1 
ATOM   9683  N NH2 . ARG D 1 64  ? 28.035  -16.037 27.244  1.00 109.85 ? 75   ARG D NH2 1 
ATOM   9684  N N   . ARG D 1 65  ? 21.101  -16.548 28.304  1.00 50.26  ? 76   ARG D N   1 
ATOM   9685  C CA  . ARG D 1 65  ? 20.143  -16.773 27.225  1.00 50.26  ? 76   ARG D CA  1 
ATOM   9686  C C   . ARG D 1 65  ? 18.718  -17.177 27.657  1.00 50.26  ? 76   ARG D C   1 
ATOM   9687  O O   . ARG D 1 65  ? 17.946  -17.715 26.872  1.00 50.26  ? 76   ARG D O   1 
ATOM   9688  C CB  . ARG D 1 65  ? 20.732  -17.770 26.229  1.00 87.00  ? 76   ARG D CB  1 
ATOM   9689  C CG  . ARG D 1 65  ? 21.909  -17.170 25.470  1.00 87.00  ? 76   ARG D CG  1 
ATOM   9690  C CD  . ARG D 1 65  ? 21.491  -15.872 24.763  1.00 87.00  ? 76   ARG D CD  1 
ATOM   9691  N NE  . ARG D 1 65  ? 22.578  -15.175 24.065  1.00 87.00  ? 76   ARG D NE  1 
ATOM   9692  C CZ  . ARG D 1 65  ? 23.415  -14.308 24.634  1.00 87.00  ? 76   ARG D CZ  1 
ATOM   9693  N NH1 . ARG D 1 65  ? 23.310  -14.012 25.923  1.00 87.00  ? 76   ARG D NH1 1 
ATOM   9694  N NH2 . ARG D 1 65  ? 24.357  -13.727 23.905  1.00 87.00  ? 76   ARG D NH2 1 
ATOM   9695  N N   . HIS D 1 66  ? 18.385  -16.897 28.911  1.00 51.30  ? 77   HIS D N   1 
ATOM   9696  C CA  . HIS D 1 66  ? 17.067  -17.164 29.450  1.00 51.30  ? 77   HIS D CA  1 
ATOM   9697  C C   . HIS D 1 66  ? 16.546  -18.591 29.355  1.00 51.30  ? 77   HIS D C   1 
ATOM   9698  O O   . HIS D 1 66  ? 15.469  -18.839 28.804  1.00 51.30  ? 77   HIS D O   1 
ATOM   9699  C CB  . HIS D 1 66  ? 16.079  -16.206 28.801  1.00 76.46  ? 77   HIS D CB  1 
ATOM   9700  C CG  . HIS D 1 66  ? 16.429  -14.769 29.010  1.00 76.46  ? 77   HIS D CG  1 
ATOM   9701  N ND1 . HIS D 1 66  ? 16.067  -14.074 30.141  1.00 76.46  ? 77   HIS D ND1 1 
ATOM   9702  C CD2 . HIS D 1 66  ? 17.157  -13.910 28.257  1.00 76.46  ? 77   HIS D CD2 1 
ATOM   9703  C CE1 . HIS D 1 66  ? 16.556  -12.847 30.076  1.00 76.46  ? 77   HIS D CE1 1 
ATOM   9704  N NE2 . HIS D 1 66  ? 17.223  -12.722 28.943  1.00 76.46  ? 77   HIS D NE2 1 
ATOM   9705  N N   . PHE D 1 67  ? 17.310  -19.529 29.907  1.00 77.44  ? 78   PHE D N   1 
ATOM   9706  C CA  . PHE D 1 67  ? 16.912  -20.929 29.931  1.00 77.44  ? 78   PHE D CA  1 
ATOM   9707  C C   . PHE D 1 67  ? 16.632  -21.260 31.389  1.00 77.44  ? 78   PHE D C   1 
ATOM   9708  O O   . PHE D 1 67  ? 15.562  -21.762 31.729  1.00 77.44  ? 78   PHE D O   1 
ATOM   9709  C CB  . PHE D 1 67  ? 18.033  -21.823 29.400  1.00 64.97  ? 78   PHE D CB  1 
ATOM   9710  C CG  . PHE D 1 67  ? 17.940  -22.109 27.926  1.00 64.97  ? 78   PHE D CG  1 
ATOM   9711  C CD1 . PHE D 1 67  ? 16.873  -22.839 27.409  1.00 64.97  ? 78   PHE D CD1 1 
ATOM   9712  C CD2 . PHE D 1 67  ? 18.918  -21.648 27.049  1.00 64.97  ? 78   PHE D CD2 1 
ATOM   9713  C CE1 . PHE D 1 67  ? 16.777  -23.106 26.038  1.00 64.97  ? 78   PHE D CE1 1 
ATOM   9714  C CE2 . PHE D 1 67  ? 18.828  -21.912 25.671  1.00 64.97  ? 78   PHE D CE2 1 
ATOM   9715  C CZ  . PHE D 1 67  ? 17.754  -22.641 25.169  1.00 64.97  ? 78   PHE D CZ  1 
ATOM   9716  N N   . LEU D 1 68  ? 17.600  -20.953 32.247  1.00 50.72  ? 79   LEU D N   1 
ATOM   9717  C CA  . LEU D 1 68  ? 17.479  -21.199 33.674  1.00 50.72  ? 79   LEU D CA  1 
ATOM   9718  C C   . LEU D 1 68  ? 17.455  -19.891 34.454  1.00 50.72  ? 79   LEU D C   1 
ATOM   9719  O O   . LEU D 1 68  ? 18.426  -19.144 34.446  1.00 50.72  ? 79   LEU D O   1 
ATOM   9720  C CB  . LEU D 1 68  ? 18.643  -22.054 34.149  1.00 51.45  ? 79   LEU D CB  1 
ATOM   9721  C CG  . LEU D 1 68  ? 18.582  -23.521 33.730  1.00 51.45  ? 79   LEU D CG  1 
ATOM   9722  C CD1 . LEU D 1 68  ? 17.190  -24.032 34.039  1.00 51.45  ? 79   LEU D CD1 1 
ATOM   9723  C CD2 . LEU D 1 68  ? 18.875  -23.702 32.261  1.00 51.45  ? 79   LEU D CD2 1 
ATOM   9724  N N   . SER D 1 69  ? 16.348  -19.618 35.137  1.00 85.44  ? 80   SER D N   1 
ATOM   9725  C CA  . SER D 1 69  ? 16.213  -18.380 35.904  1.00 85.44  ? 80   SER D CA  1 
ATOM   9726  C C   . SER D 1 69  ? 16.889  -18.509 37.261  1.00 85.44  ? 80   SER D C   1 
ATOM   9727  O O   . SER D 1 69  ? 16.998  -19.611 37.798  1.00 85.44  ? 80   SER D O   1 
ATOM   9728  C CB  . SER D 1 69  ? 14.726  -18.041 36.090  1.00 52.29  ? 80   SER D CB  1 
ATOM   9729  O OG  . SER D 1 69  ? 14.541  -16.741 36.618  1.00 52.29  ? 80   SER D OG  1 
ATOM   9730  N N   . GLY D 1 70  ? 17.359  -17.386 37.805  1.00 115.30 ? 81   GLY D N   1 
ATOM   9731  C CA  . GLY D 1 70  ? 17.994  -17.410 39.114  1.00 115.30 ? 81   GLY D CA  1 
ATOM   9732  C C   . GLY D 1 70  ? 19.377  -16.800 39.247  1.00 115.30 ? 81   GLY D C   1 
ATOM   9733  O O   . GLY D 1 70  ? 19.868  -16.130 38.344  1.00 115.30 ? 81   GLY D O   1 
ATOM   9734  N N   . SER D 1 71  ? 19.994  -17.033 40.402  1.00 123.12 ? 82   SER D N   1 
ATOM   9735  C CA  . SER D 1 71  ? 21.334  -16.542 40.704  1.00 123.12 ? 82   SER D CA  1 
ATOM   9736  C C   . SER D 1 71  ? 22.316  -17.694 40.541  1.00 123.12 ? 82   SER D C   1 
ATOM   9737  O O   . SER D 1 71  ? 21.975  -18.847 40.813  1.00 123.12 ? 82   SER D O   1 
ATOM   9738  C CB  . SER D 1 71  ? 21.402  -16.020 42.142  1.00 125.49 ? 82   SER D CB  1 
ATOM   9739  O OG  . SER D 1 71  ? 22.733  -15.696 42.507  1.00 125.49 ? 82   SER D OG  1 
ATOM   9740  N N   . LYS D 1 72  ? 23.533  -17.385 40.102  1.00 160.31 ? 83   LYS D N   1 
ATOM   9741  C CA  . LYS D 1 72  ? 24.548  -18.412 39.906  1.00 160.31 ? 83   LYS D CA  1 
ATOM   9742  C C   . LYS D 1 72  ? 24.931  -19.040 41.243  1.00 160.31 ? 83   LYS D C   1 
ATOM   9743  O O   . LYS D 1 72  ? 26.098  -19.345 41.490  1.00 160.31 ? 83   LYS D O   1 
ATOM   9744  C CB  . LYS D 1 72  ? 25.784  -17.816 39.226  1.00 128.64 ? 83   LYS D CB  1 
ATOM   9745  C CG  . LYS D 1 72  ? 26.778  -18.862 38.734  1.00 128.64 ? 83   LYS D CG  1 
ATOM   9746  C CD  . LYS D 1 72  ? 27.888  -18.242 37.897  1.00 128.64 ? 83   LYS D CD  1 
ATOM   9747  C CE  . LYS D 1 72  ? 27.335  -17.567 36.650  1.00 128.64 ? 83   LYS D CE  1 
ATOM   9748  N NZ  . LYS D 1 72  ? 28.407  -16.928 35.840  1.00 128.64 ? 83   LYS D NZ  1 
ATOM   9749  N N   . GLN D 1 73  ? 23.929  -19.224 42.100  1.00 118.45 ? 84   GLN D N   1 
ATOM   9750  C CA  . GLN D 1 73  ? 24.112  -19.819 43.417  1.00 118.45 ? 84   GLN D CA  1 
ATOM   9751  C C   . GLN D 1 73  ? 22.873  -20.625 43.807  1.00 118.45 ? 84   GLN D C   1 
ATOM   9752  O O   . GLN D 1 73  ? 22.982  -21.708 44.389  1.00 118.45 ? 84   GLN D O   1 
ATOM   9753  C CB  . GLN D 1 73  ? 24.384  -18.730 44.461  1.00 201.99 ? 84   GLN D CB  1 
ATOM   9754  C CG  . GLN D 1 73  ? 25.750  -18.060 44.326  1.00 201.99 ? 84   GLN D CG  1 
ATOM   9755  C CD  . GLN D 1 73  ? 26.909  -19.023 44.549  1.00 201.99 ? 84   GLN D CD  1 
ATOM   9756  O OE1 . GLN D 1 73  ? 27.082  -19.992 43.808  1.00 201.99 ? 84   GLN D OE1 1 
ATOM   9757  N NE2 . GLN D 1 73  ? 27.708  -18.758 45.577  1.00 201.99 ? 84   GLN D NE2 1 
ATOM   9758  N N   . GLN D 1 74  ? 21.697  -20.092 43.490  1.00 165.91 ? 85   GLN D N   1 
ATOM   9759  C CA  . GLN D 1 74  ? 20.451  -20.787 43.792  1.00 165.91 ? 85   GLN D CA  1 
ATOM   9760  C C   . GLN D 1 74  ? 20.132  -21.705 42.619  1.00 165.91 ? 85   GLN D C   1 
ATOM   9761  O O   . GLN D 1 74  ? 19.315  -22.621 42.725  1.00 165.91 ? 85   GLN D O   1 
ATOM   9762  C CB  . GLN D 1 74  ? 19.315  -19.785 44.018  1.00 80.50  ? 85   GLN D CB  1 
ATOM   9763  C CG  . GLN D 1 74  ? 19.095  -18.800 42.884  1.00 80.50  ? 85   GLN D CG  1 
ATOM   9764  C CD  . GLN D 1 74  ? 17.989  -17.800 43.193  1.00 80.50  ? 85   GLN D CD  1 
ATOM   9765  O OE1 . GLN D 1 74  ? 17.639  -16.961 42.362  1.00 80.50  ? 85   GLN D OE1 1 
ATOM   9766  N NE2 . GLN D 1 74  ? 17.435  -17.888 44.397  1.00 80.50  ? 85   GLN D NE2 1 
ATOM   9767  N N   . LEU D 1 75  ? 20.801  -21.442 41.500  1.00 87.22  ? 86   LEU D N   1 
ATOM   9768  C CA  . LEU D 1 75  ? 20.649  -22.229 40.281  1.00 87.22  ? 86   LEU D CA  1 
ATOM   9769  C C   . LEU D 1 75  ? 21.920  -23.070 40.183  1.00 87.22  ? 86   LEU D C   1 
ATOM   9770  O O   . LEU D 1 75  ? 22.772  -22.847 39.325  1.00 87.22  ? 86   LEU D O   1 
ATOM   9771  C CB  . LEU D 1 75  ? 20.537  -21.298 39.067  1.00 149.42 ? 86   LEU D CB  1 
ATOM   9772  C CG  . LEU D 1 75  ? 19.960  -21.843 37.757  1.00 149.42 ? 86   LEU D CG  1 
ATOM   9773  C CD1 . LEU D 1 75  ? 20.817  -22.972 37.216  1.00 149.42 ? 86   LEU D CD1 1 
ATOM   9774  C CD2 . LEU D 1 75  ? 18.545  -22.319 38.006  1.00 149.42 ? 86   LEU D CD2 1 
ATOM   9775  N N   . SER D 1 76  ? 22.043  -24.037 41.085  1.00 156.27 ? 87   SER D N   1 
ATOM   9776  C CA  . SER D 1 76  ? 23.218  -24.889 41.118  1.00 156.27 ? 87   SER D CA  1 
ATOM   9777  C C   . SER D 1 76  ? 22.942  -26.354 40.819  1.00 156.27 ? 87   SER D C   1 
ATOM   9778  O O   . SER D 1 76  ? 21.799  -26.788 40.681  1.00 156.27 ? 87   SER D O   1 
ATOM   9779  C CB  . SER D 1 76  ? 23.906  -24.777 42.484  1.00 107.94 ? 87   SER D CB  1 
ATOM   9780  O OG  . SER D 1 76  ? 23.048  -25.206 43.531  1.00 107.94 ? 87   SER D OG  1 
ATOM   9781  N N   . ARG D 1 77  ? 24.032  -27.099 40.723  1.00 83.50  ? 88   ARG D N   1 
ATOM   9782  C CA  . ARG D 1 77  ? 24.027  -28.527 40.460  1.00 83.50  ? 88   ARG D CA  1 
ATOM   9783  C C   . ARG D 1 77  ? 22.996  -29.305 41.273  1.00 83.50  ? 88   ARG D C   1 
ATOM   9784  O O   . ARG D 1 77  ? 22.223  -30.079 40.716  1.00 83.50  ? 88   ARG D O   1 
ATOM   9785  C CB  . ARG D 1 77  ? 25.426  -29.093 40.742  1.00 201.95 ? 88   ARG D CB  1 
ATOM   9786  C CG  . ARG D 1 77  ? 26.278  -28.266 41.738  1.00 201.95 ? 88   ARG D CG  1 
ATOM   9787  C CD  . ARG D 1 77  ? 25.596  -28.026 43.103  1.00 201.95 ? 88   ARG D CD  1 
ATOM   9788  N NE  . ARG D 1 77  ? 26.406  -27.198 44.004  1.00 201.95 ? 88   ARG D NE  1 
ATOM   9789  C CZ  . ARG D 1 77  ? 25.993  -26.727 45.182  1.00 201.95 ? 88   ARG D CZ  1 
ATOM   9790  N NH1 . ARG D 1 77  ? 24.771  -26.994 45.622  1.00 201.95 ? 88   ARG D NH1 1 
ATOM   9791  N NH2 . ARG D 1 77  ? 26.804  -25.984 45.923  1.00 201.95 ? 88   ARG D NH2 1 
ATOM   9792  N N   . ASP D 1 78  ? 22.997  -29.099 42.590  1.00 116.86 ? 89   ASP D N   1 
ATOM   9793  C CA  . ASP D 1 78  ? 22.089  -29.796 43.503  1.00 116.86 ? 89   ASP D CA  1 
ATOM   9794  C C   . ASP D 1 78  ? 20.631  -29.346 43.416  1.00 116.86 ? 89   ASP D C   1 
ATOM   9795  O O   . ASP D 1 78  ? 19.730  -30.180 43.313  1.00 116.86 ? 89   ASP D O   1 
ATOM   9796  C CB  . ASP D 1 78  ? 22.584  -29.657 44.953  1.00 132.86 ? 89   ASP D CB  1 
ATOM   9797  C CG  . ASP D 1 78  ? 23.887  -30.417 45.215  1.00 132.86 ? 89   ASP D CG  1 
ATOM   9798  O OD1 . ASP D 1 78  ? 24.402  -30.336 46.351  1.00 132.86 ? 89   ASP D OD1 1 
ATOM   9799  O OD2 . ASP D 1 78  ? 24.396  -31.095 44.295  1.00 132.86 ? 89   ASP D OD2 1 
ATOM   9800  N N   . SER D 1 79  ? 20.394  -28.038 43.467  1.00 69.50  ? 90   SER D N   1 
ATOM   9801  C CA  . SER D 1 79  ? 19.031  -27.523 43.385  1.00 69.50  ? 90   SER D CA  1 
ATOM   9802  C C   . SER D 1 79  ? 18.343  -27.968 42.091  1.00 69.50  ? 90   SER D C   1 
ATOM   9803  O O   . SER D 1 79  ? 17.232  -28.495 42.119  1.00 69.50  ? 90   SER D O   1 
ATOM   9804  C CB  . SER D 1 79  ? 19.037  -25.993 43.487  1.00 93.50  ? 90   SER D CB  1 
ATOM   9805  O OG  . SER D 1 79  ? 19.277  -25.577 44.821  1.00 93.50  ? 90   SER D OG  1 
ATOM   9806  N N   . LEU D 1 80  ? 19.019  -27.766 40.965  1.00 80.48  ? 91   LEU D N   1 
ATOM   9807  C CA  . LEU D 1 80  ? 18.502  -28.140 39.646  1.00 80.48  ? 91   LEU D CA  1 
ATOM   9808  C C   . LEU D 1 80  ? 18.053  -29.618 39.539  1.00 80.48  ? 91   LEU D C   1 
ATOM   9809  O O   . LEU D 1 80  ? 17.000  -29.920 38.974  1.00 80.48  ? 91   LEU D O   1 
ATOM   9810  C CB  . LEU D 1 80  ? 19.573  -27.824 38.597  1.00 34.72  ? 91   LEU D CB  1 
ATOM   9811  C CG  . LEU D 1 80  ? 19.284  -26.847 37.446  1.00 34.72  ? 91   LEU D CG  1 
ATOM   9812  C CD1 . LEU D 1 80  ? 18.467  -25.644 37.899  1.00 34.72  ? 91   LEU D CD1 1 
ATOM   9813  C CD2 . LEU D 1 80  ? 20.640  -26.412 36.863  1.00 34.72  ? 91   LEU D CD2 1 
ATOM   9814  N N   . LEU D 1 81  ? 18.851  -30.538 40.068  1.00 82.01  ? 92   LEU D N   1 
ATOM   9815  C CA  . LEU D 1 81  ? 18.487  -31.946 40.029  1.00 82.01  ? 92   LEU D CA  1 
ATOM   9816  C C   . LEU D 1 81  ? 17.448  -32.203 41.106  1.00 82.01  ? 92   LEU D C   1 
ATOM   9817  O O   . LEU D 1 81  ? 16.394  -32.760 40.838  1.00 82.01  ? 92   LEU D O   1 
ATOM   9818  C CB  . LEU D 1 81  ? 19.709  -32.843 40.260  1.00 49.35  ? 92   LEU D CB  1 
ATOM   9819  C CG  . LEU D 1 81  ? 20.688  -32.998 39.090  1.00 49.35  ? 92   LEU D CG  1 
ATOM   9820  C CD1 . LEU D 1 81  ? 21.835  -33.909 39.494  1.00 49.35  ? 92   LEU D CD1 1 
ATOM   9821  C CD2 . LEU D 1 81  ? 19.959  -33.576 37.884  1.00 49.35  ? 92   LEU D CD2 1 
ATOM   9822  N N   . SER D 1 82  ? 17.737  -31.780 42.326  1.00 36.74  ? 93   SER D N   1 
ATOM   9823  C CA  . SER D 1 82  ? 16.801  -31.982 43.421  1.00 36.74  ? 93   SER D CA  1 
ATOM   9824  C C   . SER D 1 82  ? 15.487  -31.332 43.036  1.00 36.74  ? 93   SER D C   1 
ATOM   9825  O O   . SER D 1 82  ? 14.475  -31.487 43.723  1.00 36.74  ? 93   SER D O   1 
ATOM   9826  C CB  . SER D 1 82  ? 17.322  -31.338 44.715  1.00 53.18  ? 93   SER D CB  1 
ATOM   9827  O OG  . SER D 1 82  ? 17.237  -29.918 44.679  1.00 53.18  ? 93   SER D OG  1 
ATOM   9828  N N   . GLY D 1 83  ? 15.511  -30.591 41.932  1.00 40.42  ? 94   GLY D N   1 
ATOM   9829  C CA  . GLY D 1 83  ? 14.311  -29.912 41.480  1.00 40.42  ? 94   GLY D CA  1 
ATOM   9830  C C   . GLY D 1 83  ? 13.896  -28.856 42.475  1.00 40.42  ? 94   GLY D C   1 
ATOM   9831  O O   . GLY D 1 83  ? 12.732  -28.497 42.551  1.00 40.42  ? 94   GLY D O   1 
ATOM   9832  N N   . CYS D 1 84  ? 14.861  -28.354 43.236  1.00 77.78  ? 95   CYS D N   1 
ATOM   9833  C CA  . CYS D 1 84  ? 14.599  -27.331 44.239  1.00 77.78  ? 95   CYS D CA  1 
ATOM   9834  C C   . CYS D 1 84  ? 15.184  -25.986 43.805  1.00 77.78  ? 95   CYS D C   1 
ATOM   9835  O O   . CYS D 1 84  ? 15.890  -25.325 44.571  1.00 77.78  ? 95   CYS D O   1 
ATOM   9836  C CB  . CYS D 1 84  ? 15.199  -27.758 45.575  1.00 86.67  ? 95   CYS D CB  1 
ATOM   9837  S SG  . CYS D 1 84  ? 14.682  -26.737 46.944  1.00 86.67  ? 95   CYS D SG  1 
ATOM   9838  N N   . HIS D 1 85  ? 14.887  -25.594 42.567  1.00 74.12  ? 96   HIS D N   1 
ATOM   9839  C CA  . HIS D 1 85  ? 15.379  -24.338 42.021  1.00 74.12  ? 96   HIS D CA  1 
ATOM   9840  C C   . HIS D 1 85  ? 14.351  -23.211 41.994  1.00 74.12  ? 96   HIS D C   1 
ATOM   9841  O O   . HIS D 1 85  ? 13.211  -23.383 42.422  1.00 74.12  ? 96   HIS D O   1 
ATOM   9842  C CB  . HIS D 1 85  ? 15.969  -24.548 40.615  1.00 69.40  ? 96   HIS D CB  1 
ATOM   9843  C CG  . HIS D 1 85  ? 15.123  -25.368 39.689  1.00 69.40  ? 96   HIS D CG  1 
ATOM   9844  N ND1 . HIS D 1 85  ? 15.303  -26.725 39.523  1.00 69.40  ? 96   HIS D ND1 1 
ATOM   9845  C CD2 . HIS D 1 85  ? 14.149  -25.009 38.819  1.00 69.40  ? 96   HIS D CD2 1 
ATOM   9846  C CE1 . HIS D 1 85  ? 14.481  -27.166 38.587  1.00 69.40  ? 96   HIS D CE1 1 
ATOM   9847  N NE2 . HIS D 1 85  ? 13.770  -26.146 38.143  1.00 69.40  ? 96   HIS D NE2 1 
ATOM   9848  N N   . PRO D 1 86  ? 14.759  -22.026 41.511  1.00 162.60 ? 97   PRO D N   1 
ATOM   9849  C CA  . PRO D 1 86  ? 13.878  -20.858 41.431  1.00 162.60 ? 97   PRO D CA  1 
ATOM   9850  C C   . PRO D 1 86  ? 12.890  -20.836 40.269  1.00 162.60 ? 97   PRO D C   1 
ATOM   9851  O O   . PRO D 1 86  ? 11.878  -20.138 40.331  1.00 162.60 ? 97   PRO D O   1 
ATOM   9852  C CB  . PRO D 1 86  ? 14.861  -19.697 41.363  1.00 72.28  ? 97   PRO D CB  1 
ATOM   9853  C CG  . PRO D 1 86  ? 16.002  -20.290 40.597  1.00 72.28  ? 97   PRO D CG  1 
ATOM   9854  C CD  . PRO D 1 86  ? 16.157  -21.636 41.247  1.00 72.28  ? 97   PRO D CD  1 
ATOM   9855  N N   . GLY D 1 87  ? 13.177  -21.579 39.206  1.00 99.33  ? 98   GLY D N   1 
ATOM   9856  C CA  . GLY D 1 87  ? 12.261  -21.581 38.079  1.00 99.33  ? 98   GLY D CA  1 
ATOM   9857  C C   . GLY D 1 87  ? 12.918  -21.654 36.716  1.00 99.33  ? 98   GLY D C   1 
ATOM   9858  O O   . GLY D 1 87  ? 14.117  -21.904 36.604  1.00 99.33  ? 98   GLY D O   1 
ATOM   9859  N N   . PHE D 1 88  ? 12.123  -21.431 35.673  1.00 61.81  ? 99   PHE D N   1 
ATOM   9860  C CA  . PHE D 1 88  ? 12.620  -21.486 34.302  1.00 61.81  ? 99   PHE D CA  1 
ATOM   9861  C C   . PHE D 1 88  ? 12.287  -20.222 33.546  1.00 61.81  ? 99   PHE D C   1 
ATOM   9862  O O   . PHE D 1 88  ? 11.150  -19.746 33.597  1.00 61.81  ? 99   PHE D O   1 
ATOM   9863  C CB  . PHE D 1 88  ? 11.991  -22.647 33.517  1.00 65.94  ? 99   PHE D CB  1 
ATOM   9864  C CG  . PHE D 1 88  ? 12.483  -24.000 33.911  1.00 65.94  ? 99   PHE D CG  1 
ATOM   9865  C CD1 . PHE D 1 88  ? 13.818  -24.209 34.226  1.00 65.94  ? 99   PHE D CD1 1 
ATOM   9866  C CD2 . PHE D 1 88  ? 11.618  -25.080 33.908  1.00 65.94  ? 99   PHE D CD2 1 
ATOM   9867  C CE1 . PHE D 1 88  ? 14.289  -25.481 34.532  1.00 65.94  ? 99   PHE D CE1 1 
ATOM   9868  C CE2 . PHE D 1 88  ? 12.074  -26.354 34.209  1.00 65.94  ? 99   PHE D CE2 1 
ATOM   9869  C CZ  . PHE D 1 88  ? 13.417  -26.559 34.524  1.00 65.94  ? 99   PHE D CZ  1 
ATOM   9870  N N   . GLY D 1 89  ? 13.272  -19.697 32.825  1.00 51.08  ? 100  GLY D N   1 
ATOM   9871  C CA  . GLY D 1 89  ? 13.041  -18.509 32.027  1.00 51.08  ? 100  GLY D CA  1 
ATOM   9872  C C   . GLY D 1 89  ? 12.239  -18.923 30.808  1.00 51.08  ? 100  GLY D C   1 
ATOM   9873  O O   . GLY D 1 89  ? 12.045  -20.115 30.579  1.00 51.08  ? 100  GLY D O   1 
ATOM   9874  N N   . PRO D 1 90  ? 11.756  -17.972 30.004  1.00 38.63  ? 101  PRO D N   1 
ATOM   9875  C CA  . PRO D 1 90  ? 10.967  -18.262 28.797  1.00 38.63  ? 101  PRO D CA  1 
ATOM   9876  C C   . PRO D 1 90  ? 11.515  -19.400 27.909  1.00 38.63  ? 101  PRO D C   1 
ATOM   9877  O O   . PRO D 1 90  ? 10.778  -20.310 27.526  1.00 38.63  ? 101  PRO D O   1 
ATOM   9878  C CB  . PRO D 1 90  ? 10.946  -16.918 28.071  1.00 26.99  ? 101  PRO D CB  1 
ATOM   9879  C CG  . PRO D 1 90  ? 10.931  -15.958 29.211  1.00 26.99  ? 101  PRO D CG  1 
ATOM   9880  C CD  . PRO D 1 90  ? 11.957  -16.525 30.165  1.00 26.99  ? 101  PRO D CD  1 
ATOM   9881  N N   . LEU D 1 91  ? 12.802  -19.347 27.576  1.00 42.77  ? 102  LEU D N   1 
ATOM   9882  C CA  . LEU D 1 91  ? 13.364  -20.384 26.744  1.00 42.77  ? 102  LEU D CA  1 
ATOM   9883  C C   . LEU D 1 91  ? 13.168  -21.730 27.396  1.00 42.77  ? 102  LEU D C   1 
ATOM   9884  O O   . LEU D 1 91  ? 12.680  -22.660 26.751  1.00 42.77  ? 102  LEU D O   1 
ATOM   9885  C CB  . LEU D 1 91  ? 14.844  -20.133 26.466  1.00 56.92  ? 102  LEU D CB  1 
ATOM   9886  C CG  . LEU D 1 91  ? 15.066  -19.392 25.142  1.00 56.92  ? 102  LEU D CG  1 
ATOM   9887  C CD1 . LEU D 1 91  ? 14.525  -17.966 25.274  1.00 56.92  ? 102  LEU D CD1 1 
ATOM   9888  C CD2 . LEU D 1 91  ? 16.537  -19.394 24.754  1.00 56.92  ? 102  LEU D CD2 1 
ATOM   9889  N N   . GLY D 1 92  ? 13.527  -21.842 28.674  1.00 37.71  ? 103  GLY D N   1 
ATOM   9890  C CA  . GLY D 1 92  ? 13.362  -23.111 29.374  1.00 37.71  ? 103  GLY D CA  1 
ATOM   9891  C C   . GLY D 1 92  ? 11.938  -23.634 29.289  1.00 37.71  ? 103  GLY D C   1 
ATOM   9892  O O   . GLY D 1 92  ? 11.674  -24.778 28.891  1.00 37.71  ? 103  GLY D O   1 
ATOM   9893  N N   . VAL D 1 93  ? 11.012  -22.769 29.669  1.00 47.18  ? 104  VAL D N   1 
ATOM   9894  C CA  . VAL D 1 93  ? 9.606   -23.096 29.639  1.00 47.18  ? 104  VAL D CA  1 
ATOM   9895  C C   . VAL D 1 93  ? 9.153   -23.501 28.249  1.00 47.18  ? 104  VAL D C   1 
ATOM   9896  O O   . VAL D 1 93  ? 8.239   -24.315 28.106  1.00 47.18  ? 104  VAL D O   1 
ATOM   9897  C CB  . VAL D 1 93  ? 8.772   -21.911 30.084  1.00 57.36  ? 104  VAL D CB  1 
ATOM   9898  C CG1 . VAL D 1 93  ? 7.303   -22.239 29.986  1.00 57.36  ? 104  VAL D CG1 1 
ATOM   9899  C CG2 . VAL D 1 93  ? 9.153   -21.541 31.493  1.00 57.36  ? 104  VAL D CG2 1 
ATOM   9900  N N   . GLU D 1 94  ? 9.765   -22.933 27.217  1.00 35.87  ? 105  GLU D N   1 
ATOM   9901  C CA  . GLU D 1 94  ? 9.351   -23.299 25.876  1.00 35.87  ? 105  GLU D CA  1 
ATOM   9902  C C   . GLU D 1 94  ? 10.017  -24.590 25.483  1.00 35.87  ? 105  GLU D C   1 
ATOM   9903  O O   . GLU D 1 94  ? 9.481   -25.331 24.664  1.00 35.87  ? 105  GLU D O   1 
ATOM   9904  C CB  . GLU D 1 94  ? 9.686   -22.204 24.860  1.00 66.52  ? 105  GLU D CB  1 
ATOM   9905  C CG  . GLU D 1 94  ? 8.557   -21.204 24.595  1.00 66.52  ? 105  GLU D CG  1 
ATOM   9906  C CD  . GLU D 1 94  ? 7.273   -21.876 24.135  1.00 66.52  ? 105  GLU D CD  1 
ATOM   9907  O OE1 . GLU D 1 94  ? 7.344   -22.735 23.232  1.00 66.52  ? 105  GLU D OE1 1 
ATOM   9908  O OE2 . GLU D 1 94  ? 6.188   -21.545 24.667  1.00 66.52  ? 105  GLU D OE2 1 
ATOM   9909  N N   . LEU D 1 95  ? 11.179  -24.873 26.074  1.00 35.49  ? 106  LEU D N   1 
ATOM   9910  C CA  . LEU D 1 95  ? 11.910  -26.105 25.752  1.00 35.49  ? 106  LEU D CA  1 
ATOM   9911  C C   . LEU D 1 95  ? 11.179  -27.272 26.366  1.00 35.49  ? 106  LEU D C   1 
ATOM   9912  O O   . LEU D 1 95  ? 10.866  -28.250 25.684  1.00 35.49  ? 106  LEU D O   1 
ATOM   9913  C CB  . LEU D 1 95  ? 13.352  -26.050 26.279  1.00 18.96  ? 106  LEU D CB  1 
ATOM   9914  C CG  . LEU D 1 95  ? 14.216  -27.306 26.114  1.00 18.96  ? 106  LEU D CG  1 
ATOM   9915  C CD1 . LEU D 1 95  ? 14.156  -27.818 24.671  1.00 18.96  ? 106  LEU D CD1 1 
ATOM   9916  C CD2 . LEU D 1 95  ? 15.631  -26.979 26.551  1.00 18.96  ? 106  LEU D CD2 1 
ATOM   9917  N N   . ARG D 1 96  ? 10.913  -27.169 27.663  1.00 33.08  ? 107  ARG D N   1 
ATOM   9918  C CA  . ARG D 1 96  ? 10.174  -28.217 28.329  1.00 33.08  ? 107  ARG D CA  1 
ATOM   9919  C C   . ARG D 1 96  ? 8.825   -28.383 27.622  1.00 33.08  ? 107  ARG D C   1 
ATOM   9920  O O   . ARG D 1 96  ? 8.356   -29.498 27.391  1.00 33.08  ? 107  ARG D O   1 
ATOM   9921  C CB  . ARG D 1 96  ? 9.942   -27.851 29.786  1.00 55.52  ? 107  ARG D CB  1 
ATOM   9922  C CG  . ARG D 1 96  ? 8.796   -28.626 30.399  1.00 55.52  ? 107  ARG D CG  1 
ATOM   9923  C CD  . ARG D 1 96  ? 8.991   -28.801 31.878  1.00 55.52  ? 107  ARG D CD  1 
ATOM   9924  N NE  . ARG D 1 96  ? 9.036   -27.529 32.596  1.00 55.52  ? 107  ARG D NE  1 
ATOM   9925  C CZ  . ARG D 1 96  ? 8.034   -27.063 33.323  1.00 55.52  ? 107  ARG D CZ  1 
ATOM   9926  N NH1 . ARG D 1 96  ? 6.915   -27.766 33.418  1.00 55.52  ? 107  ARG D NH1 1 
ATOM   9927  N NH2 . ARG D 1 96  ? 8.157   -25.914 33.968  1.00 55.52  ? 107  ARG D NH2 1 
ATOM   9928  N N   . LYS D 1 97  ? 8.218   -27.251 27.276  1.00 50.76  ? 108  LYS D N   1 
ATOM   9929  C CA  . LYS D 1 97  ? 6.930   -27.219 26.603  1.00 50.76  ? 108  LYS D CA  1 
ATOM   9930  C C   . LYS D 1 97  ? 6.911   -28.147 25.388  1.00 50.76  ? 108  LYS D C   1 
ATOM   9931  O O   . LYS D 1 97  ? 5.987   -28.945 25.216  1.00 50.76  ? 108  LYS D O   1 
ATOM   9932  C CB  . LYS D 1 97  ? 6.615   -25.786 26.191  1.00 73.88  ? 108  LYS D CB  1 
ATOM   9933  C CG  . LYS D 1 97  ? 5.146   -25.504 25.969  1.00 73.88  ? 108  LYS D CG  1 
ATOM   9934  C CD  . LYS D 1 97  ? 4.924   -24.010 25.756  1.00 73.88  ? 108  LYS D CD  1 
ATOM   9935  C CE  . LYS D 1 97  ? 3.463   -23.667 25.487  1.00 73.88  ? 108  LYS D CE  1 
ATOM   9936  N NZ  . LYS D 1 97  ? 3.291   -22.231 25.123  1.00 73.88  ? 108  LYS D NZ  1 
ATOM   9937  N N   . ASN D 1 98  ? 7.930   -28.052 24.543  1.00 55.43  ? 109  ASN D N   1 
ATOM   9938  C CA  . ASN D 1 98  ? 7.991   -28.916 23.377  1.00 55.43  ? 109  ASN D CA  1 
ATOM   9939  C C   . ASN D 1 98  ? 8.285   -30.338 23.821  1.00 55.43  ? 109  ASN D C   1 
ATOM   9940  O O   . ASN D 1 98  ? 7.694   -31.284 23.316  1.00 55.43  ? 109  ASN D O   1 
ATOM   9941  C CB  . ASN D 1 98  ? 9.054   -28.425 22.405  1.00 51.87  ? 109  ASN D CB  1 
ATOM   9942  C CG  . ASN D 1 98  ? 8.725   -27.066 21.848  1.00 51.87  ? 109  ASN D CG  1 
ATOM   9943  O OD1 . ASN D 1 98  ? 7.552   -26.760 21.629  1.00 51.87  ? 109  ASN D OD1 1 
ATOM   9944  N ND2 . ASN D 1 98  ? 9.747   -26.242 21.607  1.00 51.87  ? 109  ASN D ND2 1 
ATOM   9945  N N   . LEU D 1 99  ? 9.188   -30.496 24.779  1.00 26.65  ? 110  LEU D N   1 
ATOM   9946  C CA  . LEU D 1 99  ? 9.500   -31.826 25.266  1.00 26.65  ? 110  LEU D CA  1 
ATOM   9947  C C   . LEU D 1 99  ? 8.191   -32.500 25.642  1.00 26.65  ? 110  LEU D C   1 
ATOM   9948  O O   . LEU D 1 99  ? 7.922   -33.613 25.215  1.00 26.65  ? 110  LEU D O   1 
ATOM   9949  C CB  . LEU D 1 99  ? 10.426  -31.745 26.472  1.00 25.94  ? 110  LEU D CB  1 
ATOM   9950  C CG  . LEU D 1 99  ? 11.176  -33.036 26.797  1.00 25.94  ? 110  LEU D CG  1 
ATOM   9951  C CD1 . LEU D 1 99  ? 11.833  -33.575 25.551  1.00 25.94  ? 110  LEU D CD1 1 
ATOM   9952  C CD2 . LEU D 1 99  ? 12.213  -32.761 27.860  1.00 25.94  ? 110  LEU D CD2 1 
ATOM   9953  N N   . ALA D 1 100 ? 7.362   -31.813 26.420  1.00 40.48  ? 111  ALA D N   1 
ATOM   9954  C CA  . ALA D 1 100 ? 6.063   -32.361 26.832  1.00 40.48  ? 111  ALA D CA  1 
ATOM   9955  C C   . ALA D 1 100 ? 5.135   -32.529 25.615  1.00 40.48  ? 111  ALA D C   1 
ATOM   9956  O O   . ALA D 1 100 ? 4.437   -33.544 25.463  1.00 40.48  ? 111  ALA D O   1 
ATOM   9957  C CB  . ALA D 1 100 ? 5.407   -31.433 27.888  1.00 6.78   ? 111  ALA D CB  1 
ATOM   9958  N N   . ALA D 1 101 ? 5.146   -31.518 24.749  1.00 60.85  ? 112  ALA D N   1 
ATOM   9959  C CA  . ALA D 1 101 ? 4.322   -31.515 23.550  1.00 60.85  ? 112  ALA D CA  1 
ATOM   9960  C C   . ALA D 1 101 ? 4.639   -32.697 22.655  1.00 60.85  ? 112  ALA D C   1 
ATOM   9961  O O   . ALA D 1 101 ? 3.753   -33.240 21.999  1.00 60.85  ? 112  ALA D O   1 
ATOM   9962  C CB  . ALA D 1 101 ? 4.532   -30.223 22.788  1.00 76.33  ? 112  ALA D CB  1 
ATOM   9963  N N   . GLU D 1 102 ? 5.914   -33.084 22.633  1.00 73.86  ? 113  GLU D N   1 
ATOM   9964  C CA  . GLU D 1 102 ? 6.388   -34.198 21.815  1.00 73.86  ? 113  GLU D CA  1 
ATOM   9965  C C   . GLU D 1 102 ? 6.068   -35.505 22.514  1.00 73.86  ? 113  GLU D C   1 
ATOM   9966  O O   . GLU D 1 102 ? 5.642   -36.479 21.893  1.00 73.86  ? 113  GLU D O   1 
ATOM   9967  C CB  . GLU D 1 102 ? 7.891   -34.081 21.600  1.00 81.07  ? 113  GLU D CB  1 
ATOM   9968  C CG  . GLU D 1 102 ? 8.379   -34.836 20.393  1.00 81.07  ? 113  GLU D CG  1 
ATOM   9969  C CD  . GLU D 1 102 ? 7.793   -34.304 19.087  1.00 81.07  ? 113  GLU D CD  1 
ATOM   9970  O OE1 . GLU D 1 102 ? 7.867   -33.071 18.848  1.00 81.07  ? 113  GLU D OE1 1 
ATOM   9971  O OE2 . GLU D 1 102 ? 7.266   -35.125 18.296  1.00 81.07  ? 113  GLU D OE2 1 
ATOM   9972  N N   . TRP D 1 103 ? 6.288   -35.511 23.819  1.00 48.89  ? 114  TRP D N   1 
ATOM   9973  C CA  . TRP D 1 103 ? 6.001   -36.676 24.629  1.00 48.89  ? 114  TRP D CA  1 
ATOM   9974  C C   . TRP D 1 103 ? 4.578   -37.064 24.286  1.00 48.89  ? 114  TRP D C   1 
ATOM   9975  O O   . TRP D 1 103 ? 4.317   -38.168 23.842  1.00 48.89  ? 114  TRP D O   1 
ATOM   9976  C CB  . TRP D 1 103 ? 6.063   -36.327 26.124  1.00 47.00  ? 114  TRP D CB  1 
ATOM   9977  C CG  . TRP D 1 103 ? 5.906   -37.499 27.044  1.00 47.00  ? 114  TRP D CG  1 
ATOM   9978  C CD1 . TRP D 1 103 ? 6.898   -38.272 27.537  1.00 47.00  ? 114  TRP D CD1 1 
ATOM   9979  C CD2 . TRP D 1 103 ? 4.683   -38.037 27.562  1.00 47.00  ? 114  TRP D CD2 1 
ATOM   9980  N NE1 . TRP D 1 103 ? 6.384   -39.263 28.333  1.00 47.00  ? 114  TRP D NE1 1 
ATOM   9981  C CE2 . TRP D 1 103 ? 5.023   -39.145 28.367  1.00 47.00  ? 114  TRP D CE2 1 
ATOM   9982  C CE3 . TRP D 1 103 ? 3.331   -37.693 27.424  1.00 47.00  ? 114  TRP D CE3 1 
ATOM   9983  C CZ2 . TRP D 1 103 ? 4.061   -39.924 29.041  1.00 47.00  ? 114  TRP D CZ2 1 
ATOM   9984  C CZ3 . TRP D 1 103 ? 2.364   -38.476 28.101  1.00 47.00  ? 114  TRP D CZ3 1 
ATOM   9985  C CH2 . TRP D 1 103 ? 2.744   -39.577 28.896  1.00 47.00  ? 114  TRP D CH2 1 
ATOM   9986  N N   . TRP D 1 104 ? 3.660   -36.128 24.467  1.00 34.78  ? 115  TRP D N   1 
ATOM   9987  C CA  . TRP D 1 104 ? 2.270   -36.411 24.221  1.00 34.78  ? 115  TRP D CA  1 
ATOM   9988  C C   . TRP D 1 104 ? 1.942   -37.222 22.962  1.00 34.78  ? 115  TRP D C   1 
ATOM   9989  O O   . TRP D 1 104 ? 1.373   -38.311 23.067  1.00 34.78  ? 115  TRP D O   1 
ATOM   9990  C CB  . TRP D 1 104 ? 1.467   -35.112 24.231  1.00 65.89  ? 115  TRP D CB  1 
ATOM   9991  C CG  . TRP D 1 104 ? 0.032   -35.348 24.573  1.00 65.89  ? 115  TRP D CG  1 
ATOM   9992  C CD1 . TRP D 1 104 ? -1.036  -35.254 23.736  1.00 65.89  ? 115  TRP D CD1 1 
ATOM   9993  C CD2 . TRP D 1 104 ? -0.485  -35.775 25.842  1.00 65.89  ? 115  TRP D CD2 1 
ATOM   9994  N NE1 . TRP D 1 104 ? -2.192  -35.598 24.400  1.00 65.89  ? 115  TRP D NE1 1 
ATOM   9995  C CE2 . TRP D 1 104 ? -1.881  -35.922 25.695  1.00 65.89  ? 115  TRP D CE2 1 
ATOM   9996  C CE3 . TRP D 1 104 ? 0.096   -36.050 27.087  1.00 65.89  ? 115  TRP D CE3 1 
ATOM   9997  C CZ2 . TRP D 1 104 ? -2.706  -36.333 26.749  1.00 65.89  ? 115  TRP D CZ2 1 
ATOM   9998  C CZ3 . TRP D 1 104 ? -0.723  -36.458 28.127  1.00 65.89  ? 115  TRP D CZ3 1 
ATOM   9999  C CH2 . TRP D 1 104 ? -2.109  -36.595 27.952  1.00 65.89  ? 115  TRP D CH2 1 
ATOM   10000 N N   . THR D 1 105 ? 2.302   -36.726 21.779  1.00 51.04  ? 116  THR D N   1 
ATOM   10001 C CA  . THR D 1 105 ? 1.964   -37.451 20.550  1.00 51.04  ? 116  THR D CA  1 
ATOM   10002 C C   . THR D 1 105 ? 2.628   -38.824 20.460  1.00 51.04  ? 116  THR D C   1 
ATOM   10003 O O   . THR D 1 105 ? 2.049   -39.761 19.925  1.00 51.04  ? 116  THR D O   1 
ATOM   10004 C CB  . THR D 1 105 ? 2.305   -36.631 19.272  1.00 54.61  ? 116  THR D CB  1 
ATOM   10005 O OG1 . THR D 1 105 ? 3.609   -36.977 18.804  1.00 54.61  ? 116  THR D OG1 1 
ATOM   10006 C CG2 . THR D 1 105 ? 2.293   -35.160 19.567  1.00 54.61  ? 116  THR D CG2 1 
ATOM   10007 N N   . SER D 1 106 ? 3.834   -38.939 21.007  1.00 40.41  ? 117  SER D N   1 
ATOM   10008 C CA  . SER D 1 106 ? 4.591   -40.191 20.996  1.00 40.41  ? 117  SER D CA  1 
ATOM   10009 C C   . SER D 1 106 ? 3.932   -41.351 21.730  1.00 40.41  ? 117  SER D C   1 
ATOM   10010 O O   . SER D 1 106 ? 4.122   -42.499 21.365  1.00 40.41  ? 117  SER D O   1 
ATOM   10011 C CB  . SER D 1 106 ? 5.983   -39.955 21.584  1.00 55.82  ? 117  SER D CB  1 
ATOM   10012 O OG  . SER D 1 106 ? 6.706   -41.166 21.696  1.00 55.82  ? 117  SER D OG  1 
ATOM   10013 N N   . VAL D 1 107 ? 3.142   -41.058 22.752  1.00 59.82  ? 118  VAL D N   1 
ATOM   10014 C CA  . VAL D 1 107 ? 2.497   -42.114 23.527  1.00 59.82  ? 118  VAL D CA  1 
ATOM   10015 C C   . VAL D 1 107 ? 0.987   -42.005 23.628  1.00 59.82  ? 118  VAL D C   1 
ATOM   10016 O O   . VAL D 1 107 ? 0.333   -42.939 24.076  1.00 59.82  ? 118  VAL D O   1 
ATOM   10017 C CB  . VAL D 1 107 ? 3.101   -42.175 24.975  1.00 60.89  ? 118  VAL D CB  1 
ATOM   10018 C CG1 . VAL D 1 107 ? 3.740   -40.859 25.329  1.00 60.89  ? 118  VAL D CG1 1 
ATOM   10019 C CG2 . VAL D 1 107 ? 2.030   -42.487 26.004  1.00 60.89  ? 118  VAL D CG2 1 
ATOM   10020 N N   . VAL D 1 108 ? 0.418   -40.889 23.193  1.00 79.22  ? 119  VAL D N   1 
ATOM   10021 C CA  . VAL D 1 108 ? -1.023  -40.733 23.323  1.00 79.22  ? 119  VAL D CA  1 
ATOM   10022 C C   . VAL D 1 108 ? -1.818  -40.416 22.056  1.00 79.22  ? 119  VAL D C   1 
ATOM   10023 O O   . VAL D 1 108 ? -2.710  -41.173 21.684  1.00 79.22  ? 119  VAL D O   1 
ATOM   10024 C CB  . VAL D 1 108 ? -1.350  -39.654 24.388  1.00 90.30  ? 119  VAL D CB  1 
ATOM   10025 C CG1 . VAL D 1 108 ? -2.795  -39.777 24.844  1.00 90.30  ? 119  VAL D CG1 1 
ATOM   10026 C CG2 . VAL D 1 108 ? -0.410  -39.794 25.566  1.00 90.30  ? 119  VAL D CG2 1 
ATOM   10027 N N   . VAL D 1 109 ? -1.497  -39.301 21.405  1.00 75.03  ? 120  VAL D N   1 
ATOM   10028 C CA  . VAL D 1 109 ? -2.216  -38.852 20.212  1.00 75.03  ? 120  VAL D CA  1 
ATOM   10029 C C   . VAL D 1 109 ? -2.665  -39.938 19.251  1.00 75.03  ? 120  VAL D C   1 
ATOM   10030 O O   . VAL D 1 109 ? -3.526  -39.703 18.405  1.00 75.03  ? 120  VAL D O   1 
ATOM   10031 C CB  . VAL D 1 109 ? -1.400  -37.813 19.420  1.00 81.19  ? 120  VAL D CB  1 
ATOM   10032 C CG1 . VAL D 1 109 ? -2.178  -37.365 18.189  1.00 81.19  ? 120  VAL D CG1 1 
ATOM   10033 C CG2 . VAL D 1 109 ? -1.104  -36.616 20.299  1.00 81.19  ? 120  VAL D CG2 1 
ATOM   10034 N N   . PHE D 1 110 ? -2.092  -41.127 19.372  1.00 92.50  ? 121  PHE D N   1 
ATOM   10035 C CA  . PHE D 1 110 ? -2.471  -42.228 18.501  1.00 92.50  ? 121  PHE D CA  1 
ATOM   10036 C C   . PHE D 1 110 ? -3.073  -43.338 19.352  1.00 92.50  ? 121  PHE D C   1 
ATOM   10037 O O   . PHE D 1 110 ? -3.568  -43.076 20.448  1.00 92.50  ? 121  PHE D O   1 
ATOM   10038 C CB  . PHE D 1 110 ? -1.236  -42.712 17.754  1.00 79.81  ? 121  PHE D CB  1 
ATOM   10039 C CG  . PHE D 1 110 ? -0.496  -41.610 17.066  1.00 79.81  ? 121  PHE D CG  1 
ATOM   10040 C CD1 . PHE D 1 110 ? 0.888   -41.528 17.142  1.00 79.81  ? 121  PHE D CD1 1 
ATOM   10041 C CD2 . PHE D 1 110 ? -1.185  -40.632 16.360  1.00 79.81  ? 121  PHE D CD2 1 
ATOM   10042 C CE1 . PHE D 1 110 ? 1.578   -40.478 16.522  1.00 79.81  ? 121  PHE D CE1 1 
ATOM   10043 C CE2 . PHE D 1 110 ? -0.509  -39.580 15.737  1.00 79.81  ? 121  PHE D CE2 1 
ATOM   10044 C CZ  . PHE D 1 110 ? 0.871   -39.502 15.818  1.00 79.81  ? 121  PHE D CZ  1 
ATOM   10045 N N   . ARG D 1 111 ? -3.043  -44.567 18.849  1.00 126.41 ? 122  ARG D N   1 
ATOM   10046 C CA  . ARG D 1 111 ? -3.578  -45.707 19.590  1.00 126.41 ? 122  ARG D CA  1 
ATOM   10047 C C   . ARG D 1 111 ? -4.638  -45.256 20.603  1.00 126.41 ? 122  ARG D C   1 
ATOM   10048 O O   . ARG D 1 111 ? -4.360  -45.189 21.799  1.00 126.41 ? 122  ARG D O   1 
ATOM   10049 C CB  . ARG D 1 111 ? -2.425  -46.422 20.315  1.00 130.05 ? 122  ARG D CB  1 
ATOM   10050 C CG  . ARG D 1 111 ? -1.572  -45.507 21.210  1.00 130.05 ? 122  ARG D CG  1 
ATOM   10051 C CD  . ARG D 1 111 ? -0.477  -46.258 21.975  1.00 130.05 ? 122  ARG D CD  1 
ATOM   10052 N NE  . ARG D 1 111 ? 0.782   -46.366 21.241  1.00 130.05 ? 122  ARG D NE  1 
ATOM   10053 C CZ  . ARG D 1 111 ? 1.005   -47.206 20.236  1.00 130.05 ? 122  ARG D CZ  1 
ATOM   10054 N NH1 . ARG D 1 111 ? 0.052   -48.030 19.829  1.00 130.05 ? 122  ARG D NH1 1 
ATOM   10055 N NH2 . ARG D 1 111 ? 2.188   -47.228 19.636  1.00 130.05 ? 122  ARG D NH2 1 
ATOM   10056 N N   . GLU D 1 112 ? -5.847  -44.946 20.133  1.00 98.85  ? 123  GLU D N   1 
ATOM   10057 C CA  . GLU D 1 112 ? -6.895  -44.474 21.040  1.00 98.85  ? 123  GLU D CA  1 
ATOM   10058 C C   . GLU D 1 112 ? -7.397  -45.489 22.055  1.00 98.85  ? 123  GLU D C   1 
ATOM   10059 O O   . GLU D 1 112 ? -8.551  -45.933 22.036  1.00 98.85  ? 123  GLU D O   1 
ATOM   10060 C CB  . GLU D 1 112 ? -8.079  -43.861 20.273  1.00 150.79 ? 123  GLU D CB  1 
ATOM   10061 C CG  . GLU D 1 112 ? -7.863  -42.395 19.797  1.00 150.79 ? 123  GLU D CG  1 
ATOM   10062 C CD  . GLU D 1 112 ? -7.964  -41.335 20.896  1.00 150.79 ? 123  GLU D CD  1 
ATOM   10063 O OE1 . GLU D 1 112 ? -9.038  -41.221 21.528  1.00 150.79 ? 123  GLU D OE1 1 
ATOM   10064 O OE2 . GLU D 1 112 ? -6.969  -40.604 21.113  1.00 150.79 ? 123  GLU D OE2 1 
ATOM   10065 N N   . GLN D 1 113 ? -6.479  -45.828 22.949  1.00 79.94  ? 124  GLN D N   1 
ATOM   10066 C CA  . GLN D 1 113 ? -6.707  -46.723 24.051  1.00 79.94  ? 124  GLN D CA  1 
ATOM   10067 C C   . GLN D 1 113 ? -6.400  -45.786 25.225  1.00 79.94  ? 124  GLN D C   1 
ATOM   10068 O O   . GLN D 1 113 ? -7.095  -45.787 26.231  1.00 79.94  ? 124  GLN D O   1 
ATOM   10069 C CB  . GLN D 1 113 ? -5.701  -47.867 24.001  1.00 72.78  ? 124  GLN D CB  1 
ATOM   10070 C CG  . GLN D 1 113 ? -5.329  -48.316 22.598  1.00 72.78  ? 124  GLN D CG  1 
ATOM   10071 C CD  . GLN D 1 113 ? -4.560  -49.638 22.585  1.00 72.78  ? 124  GLN D CD  1 
ATOM   10072 O OE1 . GLN D 1 113 ? -5.058  -50.658 23.067  1.00 72.78  ? 124  GLN D OE1 1 
ATOM   10073 N NE2 . GLN D 1 113 ? -3.344  -49.627 22.023  1.00 72.78  ? 124  GLN D NE2 1 
ATOM   10074 N N   . VAL D 1 114 ? -5.365  -44.962 25.047  1.00 42.27  ? 125  VAL D N   1 
ATOM   10075 C CA  . VAL D 1 114 ? -4.884  -43.967 26.026  1.00 42.27  ? 125  VAL D CA  1 
ATOM   10076 C C   . VAL D 1 114 ? -5.740  -42.693 26.113  1.00 42.27  ? 125  VAL D C   1 
ATOM   10077 O O   . VAL D 1 114 ? -5.978  -42.023 25.109  1.00 42.27  ? 125  VAL D O   1 
ATOM   10078 C CB  . VAL D 1 114 ? -3.448  -43.520 25.676  1.00 29.37  ? 125  VAL D CB  1 
ATOM   10079 C CG1 . VAL D 1 114 ? -2.887  -42.636 26.768  1.00 29.37  ? 125  VAL D CG1 1 
ATOM   10080 C CG2 . VAL D 1 114 ? -2.576  -44.727 25.461  1.00 29.37  ? 125  VAL D CG2 1 
ATOM   10081 N N   . PHE D 1 115 ? -6.158  -42.344 27.326  1.00 51.69  ? 126  PHE D N   1 
ATOM   10082 C CA  . PHE D 1 115 ? -6.987  -41.161 27.558  1.00 51.69  ? 126  PHE D CA  1 
ATOM   10083 C C   . PHE D 1 115 ? -6.399  -40.145 28.545  1.00 51.69  ? 126  PHE D C   1 
ATOM   10084 O O   . PHE D 1 115 ? -5.777  -40.514 29.535  1.00 51.69  ? 126  PHE D O   1 
ATOM   10085 C CB  . PHE D 1 115 ? -8.360  -41.597 28.059  1.00 61.01  ? 126  PHE D CB  1 
ATOM   10086 C CG  . PHE D 1 115 ? -9.156  -42.352 27.049  1.00 61.01  ? 126  PHE D CG  1 
ATOM   10087 C CD1 . PHE D 1 115 ? -10.112 -43.264 27.451  1.00 61.01  ? 126  PHE D CD1 1 
ATOM   10088 C CD2 . PHE D 1 115 ? -8.972  -42.135 25.695  1.00 61.01  ? 126  PHE D CD2 1 
ATOM   10089 C CE1 . PHE D 1 115 ? -10.881 -43.954 26.520  1.00 61.01  ? 126  PHE D CE1 1 
ATOM   10090 C CE2 . PHE D 1 115 ? -9.733  -42.816 24.753  1.00 61.01  ? 126  PHE D CE2 1 
ATOM   10091 C CZ  . PHE D 1 115 ? -10.689 -43.727 25.167  1.00 61.01  ? 126  PHE D CZ  1 
ATOM   10092 N N   . PRO D 1 116 ? -6.595  -38.842 28.288  1.00 45.88  ? 127  PRO D N   1 
ATOM   10093 C CA  . PRO D 1 116 ? -6.043  -37.875 29.229  1.00 45.88  ? 127  PRO D CA  1 
ATOM   10094 C C   . PRO D 1 116 ? -6.858  -37.999 30.495  1.00 45.88  ? 127  PRO D C   1 
ATOM   10095 O O   . PRO D 1 116 ? -8.081  -38.154 30.443  1.00 45.88  ? 127  PRO D O   1 
ATOM   10096 C CB  . PRO D 1 116 ? -6.274  -36.549 28.522  1.00 60.58  ? 127  PRO D CB  1 
ATOM   10097 C CG  . PRO D 1 116 ? -7.584  -36.777 27.847  1.00 60.58  ? 127  PRO D CG  1 
ATOM   10098 C CD  . PRO D 1 116 ? -7.398  -38.160 27.256  1.00 60.58  ? 127  PRO D CD  1 
ATOM   10099 N N   . VAL D 1 117 ? -6.174  -37.954 31.626  1.00 46.21  ? 128  VAL D N   1 
ATOM   10100 C CA  . VAL D 1 117 ? -6.828  -38.055 32.918  1.00 46.21  ? 128  VAL D CA  1 
ATOM   10101 C C   . VAL D 1 117 ? -6.393  -36.855 33.775  1.00 46.21  ? 128  VAL D C   1 
ATOM   10102 O O   . VAL D 1 117 ? -5.292  -36.327 33.608  1.00 46.21  ? 128  VAL D O   1 
ATOM   10103 C CB  . VAL D 1 117 ? -6.483  -39.416 33.594  1.00 24.70  ? 128  VAL D CB  1 
ATOM   10104 C CG1 . VAL D 1 117 ? -5.019  -39.537 33.815  1.00 24.70  ? 128  VAL D CG1 1 
ATOM   10105 C CG2 . VAL D 1 117 ? -7.190  -39.540 34.890  1.00 24.70  ? 128  VAL D CG2 1 
ATOM   10106 N N   . ASP D 1 118 ? -7.257  -36.417 34.686  1.00 81.26  ? 129  ASP D N   1 
ATOM   10107 C CA  . ASP D 1 118 ? -6.960  -35.248 35.520  1.00 81.26  ? 129  ASP D CA  1 
ATOM   10108 C C   . ASP D 1 118 ? -6.920  -35.454 37.040  1.00 81.26  ? 129  ASP D C   1 
ATOM   10109 O O   . ASP D 1 118 ? -7.934  -35.298 37.718  1.00 81.26  ? 129  ASP D O   1 
ATOM   10110 C CB  . ASP D 1 118 ? -7.970  -34.147 35.199  1.00 109.43 ? 129  ASP D CB  1 
ATOM   10111 C CG  . ASP D 1 118 ? -7.707  -32.881 35.970  1.00 109.43 ? 129  ASP D CG  1 
ATOM   10112 O OD1 . ASP D 1 118 ? -6.711  -32.195 35.655  1.00 109.43 ? 129  ASP D OD1 1 
ATOM   10113 O OD2 . ASP D 1 118 ? -8.493  -32.576 36.892  1.00 109.43 ? 129  ASP D OD2 1 
ATOM   10114 N N   . ALA D 1 119 ? -5.741  -35.765 37.572  1.00 71.53  ? 130  ALA D N   1 
ATOM   10115 C CA  . ALA D 1 119 ? -5.562  -35.982 39.014  1.00 71.53  ? 130  ALA D CA  1 
ATOM   10116 C C   . ALA D 1 119 ? -5.364  -34.684 39.796  1.00 71.53  ? 130  ALA D C   1 
ATOM   10117 O O   . ALA D 1 119 ? -4.578  -33.830 39.399  1.00 71.53  ? 130  ALA D O   1 
ATOM   10118 C CB  . ALA D 1 119 ? -4.367  -36.891 39.254  1.00 35.52  ? 130  ALA D CB  1 
ATOM   10119 N N   . LEU D 1 120 ? -6.060  -34.545 40.917  1.00 43.98  ? 131  LEU D N   1 
ATOM   10120 C CA  . LEU D 1 120 ? -5.931  -33.350 41.737  1.00 43.98  ? 131  LEU D CA  1 
ATOM   10121 C C   . LEU D 1 120 ? -4.546  -33.282 42.393  1.00 43.98  ? 131  LEU D C   1 
ATOM   10122 O O   . LEU D 1 120 ? -3.896  -34.309 42.583  1.00 43.98  ? 131  LEU D O   1 
ATOM   10123 C CB  . LEU D 1 120 ? -7.011  -33.340 42.808  1.00 41.52  ? 131  LEU D CB  1 
ATOM   10124 C CG  . LEU D 1 120 ? -8.459  -33.287 42.335  1.00 41.52  ? 131  LEU D CG  1 
ATOM   10125 C CD1 . LEU D 1 120 ? -9.337  -33.245 43.568  1.00 41.52  ? 131  LEU D CD1 1 
ATOM   10126 C CD2 . LEU D 1 120 ? -8.711  -32.068 41.458  1.00 41.52  ? 131  LEU D CD2 1 
ATOM   10127 N N   . HIS D 1 121 ? -4.096  -32.080 42.757  1.00 49.83  ? 132  HIS D N   1 
ATOM   10128 C CA  . HIS D 1 121 ? -2.773  -31.934 43.349  1.00 49.83  ? 132  HIS D CA  1 
ATOM   10129 C C   . HIS D 1 121 ? -2.649  -32.384 44.793  1.00 49.83  ? 132  HIS D C   1 
ATOM   10130 O O   . HIS D 1 121 ? -1.549  -32.731 45.233  1.00 49.83  ? 132  HIS D O   1 
ATOM   10131 C CB  . HIS D 1 121 ? -2.286  -30.495 43.211  1.00 53.64  ? 132  HIS D CB  1 
ATOM   10132 C CG  . HIS D 1 121 ? -1.983  -30.093 41.801  1.00 53.64  ? 132  HIS D CG  1 
ATOM   10133 N ND1 . HIS D 1 121 ? -2.966  -29.858 40.866  1.00 53.64  ? 132  HIS D ND1 1 
ATOM   10134 C CD2 . HIS D 1 121 ? -0.804  -29.911 41.157  1.00 53.64  ? 132  HIS D CD2 1 
ATOM   10135 C CE1 . HIS D 1 121 ? -2.408  -29.552 39.707  1.00 53.64  ? 132  HIS D CE1 1 
ATOM   10136 N NE2 . HIS D 1 121 ? -1.097  -29.576 39.857  1.00 53.64  ? 132  HIS D NE2 1 
ATOM   10137 N N   . HIS D 1 122 ? -3.760  -32.384 45.532  1.00 40.07  ? 133  HIS D N   1 
ATOM   10138 C CA  . HIS D 1 122 ? -3.749  -32.821 46.934  1.00 40.07  ? 133  HIS D CA  1 
ATOM   10139 C C   . HIS D 1 122 ? -4.943  -33.719 47.227  1.00 40.07  ? 133  HIS D C   1 
ATOM   10140 O O   . HIS D 1 122 ? -6.069  -33.374 46.882  1.00 40.07  ? 133  HIS D O   1 
ATOM   10141 C CB  . HIS D 1 122 ? -3.836  -31.639 47.885  1.00 69.99  ? 133  HIS D CB  1 
ATOM   10142 C CG  . HIS D 1 122 ? -5.238  -31.183 48.120  1.00 69.99  ? 133  HIS D CG  1 
ATOM   10143 N ND1 . HIS D 1 122 ? -6.002  -30.598 47.134  1.00 69.99  ? 133  HIS D ND1 1 
ATOM   10144 C CD2 . HIS D 1 122 ? -6.045  -31.312 49.197  1.00 69.99  ? 133  HIS D CD2 1 
ATOM   10145 C CE1 . HIS D 1 122 ? -7.222  -30.389 47.594  1.00 69.99  ? 133  HIS D CE1 1 
ATOM   10146 N NE2 . HIS D 1 122 ? -7.275  -30.814 48.843  1.00 69.99  ? 133  HIS D NE2 1 
ATOM   10147 N N   . LYS D 1 123 ? -4.697  -34.858 47.876  1.00 93.47  ? 134  LYS D N   1 
ATOM   10148 C CA  . LYS D 1 123 ? -5.763  -35.797 48.229  1.00 93.47  ? 134  LYS D CA  1 
ATOM   10149 C C   . LYS D 1 123 ? -6.150  -35.627 49.696  1.00 93.47  ? 134  LYS D C   1 
ATOM   10150 O O   . LYS D 1 123 ? -5.409  -36.026 50.595  1.00 93.47  ? 134  LYS D O   1 
ATOM   10151 C CB  . LYS D 1 123 ? -5.319  -37.244 47.970  1.00 179.25 ? 134  LYS D CB  1 
ATOM   10152 C CG  . LYS D 1 123 ? -5.781  -37.822 46.627  1.00 179.25 ? 134  LYS D CG  1 
ATOM   10153 C CD  . LYS D 1 123 ? -4.900  -37.410 45.449  1.00 179.25 ? 134  LYS D CD  1 
ATOM   10154 C CE  . LYS D 1 123 ? -3.580  -38.168 45.444  1.00 179.25 ? 134  LYS D CE  1 
ATOM   10155 N NZ  . LYS D 1 123 ? -2.796  -37.907 44.207  1.00 179.25 ? 134  LYS D NZ  1 
ATOM   10156 N N   . PRO D 1 124 ? -7.327  -35.030 49.950  1.00 72.15  ? 135  PRO D N   1 
ATOM   10157 C CA  . PRO D 1 124 ? -7.849  -34.784 51.301  1.00 72.15  ? 135  PRO D CA  1 
ATOM   10158 C C   . PRO D 1 124 ? -8.230  -36.030 52.107  1.00 72.15  ? 135  PRO D C   1 
ATOM   10159 O O   . PRO D 1 124 ? -7.510  -37.027 52.099  1.00 72.15  ? 135  PRO D O   1 
ATOM   10160 C CB  . PRO D 1 124 ? -9.045  -33.868 51.041  1.00 180.79 ? 135  PRO D CB  1 
ATOM   10161 C CG  . PRO D 1 124 ? -9.533  -34.332 49.706  1.00 180.79 ? 135  PRO D CG  1 
ATOM   10162 C CD  . PRO D 1 124 ? -8.246  -34.488 48.931  1.00 180.79 ? 135  PRO D CD  1 
ATOM   10163 N N   . GLY D 1 125 ? -9.357  -35.944 52.815  1.00 201.99 ? 136  GLY D N   1 
ATOM   10164 C CA  . GLY D 1 125 ? -9.853  -37.052 53.621  1.00 201.99 ? 136  GLY D CA  1 
ATOM   10165 C C   . GLY D 1 125 ? -8.841  -37.728 54.530  1.00 201.99 ? 136  GLY D C   1 
ATOM   10166 O O   . GLY D 1 125 ? -7.723  -37.238 54.683  1.00 201.99 ? 136  GLY D O   1 
ATOM   10167 N N   . PRO D 1 126 ? -9.209  -38.858 55.162  1.00 107.08 ? 137  PRO D N   1 
ATOM   10168 C CA  . PRO D 1 126 ? -8.291  -39.576 56.054  1.00 107.08 ? 137  PRO D CA  1 
ATOM   10169 C C   . PRO D 1 126 ? -7.116  -40.181 55.291  1.00 107.08 ? 137  PRO D C   1 
ATOM   10170 O O   . PRO D 1 126 ? -7.296  -40.775 54.228  1.00 107.08 ? 137  PRO D O   1 
ATOM   10171 C CB  . PRO D 1 126 ? -9.188  -40.641 56.687  1.00 138.41 ? 137  PRO D CB  1 
ATOM   10172 C CG  . PRO D 1 126 ? -10.194 -40.917 55.608  1.00 138.41 ? 137  PRO D CG  1 
ATOM   10173 C CD  . PRO D 1 126 ? -10.525 -39.524 55.121  1.00 138.41 ? 137  PRO D CD  1 
ATOM   10174 N N   . LEU D 1 127 ? -5.912  -40.022 55.828  1.00 95.78  ? 138  LEU D N   1 
ATOM   10175 C CA  . LEU D 1 127 ? -4.729  -40.566 55.175  1.00 95.78  ? 138  LEU D CA  1 
ATOM   10176 C C   . LEU D 1 127 ? -3.842  -41.392 56.089  1.00 95.78  ? 138  LEU D C   1 
ATOM   10177 O O   . LEU D 1 127 ? -3.651  -41.062 57.263  1.00 95.78  ? 138  LEU D O   1 
ATOM   10178 C CB  . LEU D 1 127 ? -3.886  -39.453 54.544  1.00 85.27  ? 138  LEU D CB  1 
ATOM   10179 C CG  . LEU D 1 127 ? -4.255  -39.003 53.130  1.00 85.27  ? 138  LEU D CG  1 
ATOM   10180 C CD1 . LEU D 1 127 ? -4.681  -40.208 52.284  1.00 85.27  ? 138  LEU D CD1 1 
ATOM   10181 C CD2 . LEU D 1 127 ? -5.362  -37.989 53.210  1.00 85.27  ? 138  LEU D CD2 1 
ATOM   10182 N N   . LEU D 1 128 ? -3.297  -42.466 55.520  1.00 122.29 ? 139  LEU D N   1 
ATOM   10183 C CA  . LEU D 1 128 ? -2.412  -43.383 56.228  1.00 122.29 ? 139  LEU D CA  1 
ATOM   10184 C C   . LEU D 1 128 ? -1.327  -42.625 56.993  1.00 122.29 ? 139  LEU D C   1 
ATOM   10185 O O   . LEU D 1 128 ? -0.349  -42.154 56.406  1.00 122.29 ? 139  LEU D O   1 
ATOM   10186 C CB  . LEU D 1 128 ? -1.769  -44.349 55.229  1.00 136.51 ? 139  LEU D CB  1 
ATOM   10187 C CG  . LEU D 1 128 ? -0.804  -45.411 55.760  1.00 136.51 ? 139  LEU D CG  1 
ATOM   10188 C CD1 . LEU D 1 128 ? -1.530  -46.349 56.714  1.00 136.51 ? 139  LEU D CD1 1 
ATOM   10189 C CD2 . LEU D 1 128 ? -0.221  -46.184 54.585  1.00 136.51 ? 139  LEU D CD2 1 
ATOM   10190 N N   . PRO D 1 129 ? -1.485  -42.506 58.321  1.00 147.59 ? 140  PRO D N   1 
ATOM   10191 C CA  . PRO D 1 129 ? -0.512  -41.799 59.156  1.00 147.59 ? 140  PRO D CA  1 
ATOM   10192 C C   . PRO D 1 129 ? 0.913   -42.304 58.967  1.00 147.59 ? 140  PRO D C   1 
ATOM   10193 O O   . PRO D 1 129 ? 1.138   -43.490 58.720  1.00 147.59 ? 140  PRO D O   1 
ATOM   10194 C CB  . PRO D 1 129 ? -1.038  -42.032 60.573  1.00 201.99 ? 140  PRO D CB  1 
ATOM   10195 C CG  . PRO D 1 129 ? -1.741  -43.351 60.463  1.00 201.99 ? 140  PRO D CG  1 
ATOM   10196 C CD  . PRO D 1 129 ? -2.481  -43.199 59.159  1.00 201.99 ? 140  PRO D CD  1 
ATOM   10197 N N   . GLY D 1 130 ? 1.871   -41.390 59.080  1.00 155.75 ? 141  GLY D N   1 
ATOM   10198 C CA  . GLY D 1 130 ? 3.262   -41.759 58.916  1.00 155.75 ? 141  GLY D CA  1 
ATOM   10199 C C   . GLY D 1 130 ? 3.704   -41.635 57.473  1.00 155.75 ? 141  GLY D C   1 
ATOM   10200 O O   . GLY D 1 130 ? 2.942   -41.164 56.623  1.00 155.75 ? 141  GLY D O   1 
ATOM   10201 N N   . ASP D 1 131 ? 4.936   -42.064 57.203  1.00 201.99 ? 142  ASP D N   1 
ATOM   10202 C CA  . ASP D 1 131 ? 5.528   -42.013 55.868  1.00 201.99 ? 142  ASP D CA  1 
ATOM   10203 C C   . ASP D 1 131 ? 6.127   -40.622 55.623  1.00 201.99 ? 142  ASP D C   1 
ATOM   10204 O O   . ASP D 1 131 ? 6.096   -39.770 56.514  1.00 201.99 ? 142  ASP D O   1 
ATOM   10205 C CB  . ASP D 1 131 ? 4.473   -42.346 54.808  1.00 162.60 ? 142  ASP D CB  1 
ATOM   10206 C CG  . ASP D 1 131 ? 5.084   -42.738 53.486  1.00 162.60 ? 142  ASP D CG  1 
ATOM   10207 O OD1 . ASP D 1 131 ? 5.952   -43.638 53.480  1.00 162.60 ? 142  ASP D OD1 1 
ATOM   10208 O OD2 . ASP D 1 131 ? 4.693   -42.154 52.454  1.00 162.60 ? 142  ASP D OD2 1 
ATOM   10209 N N   . SER D 1 132 ? 6.677   -40.391 54.431  1.00 132.99 ? 143  SER D N   1 
ATOM   10210 C CA  . SER D 1 132 ? 7.288   -39.097 54.115  1.00 132.99 ? 143  SER D CA  1 
ATOM   10211 C C   . SER D 1 132 ? 6.623   -38.375 52.948  1.00 132.99 ? 143  SER D C   1 
ATOM   10212 O O   . SER D 1 132 ? 6.791   -38.762 51.792  1.00 132.99 ? 143  SER D O   1 
ATOM   10213 C CB  . SER D 1 132 ? 8.782   -39.272 53.810  1.00 153.69 ? 143  SER D CB  1 
ATOM   10214 O OG  . SER D 1 132 ? 8.983   -39.991 52.605  1.00 153.69 ? 143  SER D OG  1 
ATOM   10215 N N   . ALA D 1 133 ? 5.881   -37.318 53.264  1.00 70.18  ? 144  ALA D N   1 
ATOM   10216 C CA  . ALA D 1 133 ? 5.181   -36.516 52.258  1.00 70.18  ? 144  ALA D CA  1 
ATOM   10217 C C   . ALA D 1 133 ? 4.970   -35.105 52.799  1.00 70.18  ? 144  ALA D C   1 
ATOM   10218 O O   . ALA D 1 133 ? 5.639   -34.703 53.753  1.00 70.18  ? 144  ALA D O   1 
ATOM   10219 C CB  . ALA D 1 133 ? 3.827   -37.155 51.913  1.00 79.74  ? 144  ALA D CB  1 
ATOM   10220 N N   . PHE D 1 134 ? 4.057   -34.353 52.181  1.00 53.35  ? 145  PHE D N   1 
ATOM   10221 C CA  . PHE D 1 134 ? 3.760   -33.002 52.648  1.00 53.35  ? 145  PHE D CA  1 
ATOM   10222 C C   . PHE D 1 134 ? 2.301   -32.851 53.034  1.00 53.35  ? 145  PHE D C   1 
ATOM   10223 O O   . PHE D 1 134 ? 1.414   -32.960 52.197  1.00 53.35  ? 145  PHE D O   1 
ATOM   10224 C CB  . PHE D 1 134 ? 4.159   -31.949 51.608  1.00 58.63  ? 145  PHE D CB  1 
ATOM   10225 C CG  . PHE D 1 134 ? 5.625   -31.604 51.645  1.00 58.63  ? 145  PHE D CG  1 
ATOM   10226 C CD1 . PHE D 1 134 ? 6.508   -32.133 50.710  1.00 58.63  ? 145  PHE D CD1 1 
ATOM   10227 C CD2 . PHE D 1 134 ? 6.139   -30.817 52.672  1.00 58.63  ? 145  PHE D CD2 1 
ATOM   10228 C CE1 . PHE D 1 134 ? 7.887   -31.886 50.805  1.00 58.63  ? 145  PHE D CE1 1 
ATOM   10229 C CE2 . PHE D 1 134 ? 7.510   -30.564 52.778  1.00 58.63  ? 145  PHE D CE2 1 
ATOM   10230 C CZ  . PHE D 1 134 ? 8.384   -31.099 51.847  1.00 58.63  ? 145  PHE D CZ  1 
ATOM   10231 N N   . ARG D 1 135 ? 2.082   -32.622 54.329  1.00 65.58  ? 146  ARG D N   1 
ATOM   10232 C CA  . ARG D 1 135 ? 0.754   -32.459 54.915  1.00 65.58  ? 146  ARG D CA  1 
ATOM   10233 C C   . ARG D 1 135 ? 0.258   -31.019 54.898  1.00 65.58  ? 146  ARG D C   1 
ATOM   10234 O O   . ARG D 1 135 ? 0.908   -30.118 55.442  1.00 65.58  ? 146  ARG D O   1 
ATOM   10235 C CB  . ARG D 1 135 ? 0.755   -32.936 56.369  1.00 98.81  ? 146  ARG D CB  1 
ATOM   10236 C CG  . ARG D 1 135 ? 0.808   -34.430 56.559  1.00 98.81  ? 146  ARG D CG  1 
ATOM   10237 C CD  . ARG D 1 135 ? -0.404  -35.108 55.956  1.00 98.81  ? 146  ARG D CD  1 
ATOM   10238 N NE  . ARG D 1 135 ? -0.445  -36.540 56.248  1.00 98.81  ? 146  ARG D NE  1 
ATOM   10239 C CZ  . ARG D 1 135 ? 0.557   -37.388 56.027  1.00 98.81  ? 146  ARG D CZ  1 
ATOM   10240 N NH1 . ARG D 1 135 ? 1.701   -36.962 55.512  1.00 98.81  ? 146  ARG D NH1 1 
ATOM   10241 N NH2 . ARG D 1 135 ? 0.411   -38.674 56.311  1.00 98.81  ? 146  ARG D NH2 1 
ATOM   10242 N N   . LEU D 1 136 ? -0.899  -30.799 54.281  1.00 38.85  ? 147  LEU D N   1 
ATOM   10243 C CA  . LEU D 1 136 ? -1.462  -29.459 54.248  1.00 38.85  ? 147  LEU D CA  1 
ATOM   10244 C C   . LEU D 1 136 ? -2.084  -29.235 55.613  1.00 38.85  ? 147  LEU D C   1 
ATOM   10245 O O   . LEU D 1 136 ? -3.183  -29.714 55.880  1.00 38.85  ? 147  LEU D O   1 
ATOM   10246 C CB  . LEU D 1 136 ? -2.544  -29.327 53.168  1.00 49.98  ? 147  LEU D CB  1 
ATOM   10247 C CG  . LEU D 1 136 ? -2.189  -29.554 51.697  1.00 49.98  ? 147  LEU D CG  1 
ATOM   10248 C CD1 . LEU D 1 136 ? -3.422  -29.252 50.858  1.00 49.98  ? 147  LEU D CD1 1 
ATOM   10249 C CD2 . LEU D 1 136 ? -1.037  -28.680 51.275  1.00 49.98  ? 147  LEU D CD2 1 
ATOM   10250 N N   . VAL D 1 137 ? -1.378  -28.521 56.481  1.00 60.64  ? 148  VAL D N   1 
ATOM   10251 C CA  . VAL D 1 137 ? -1.889  -28.261 57.818  1.00 60.64  ? 148  VAL D CA  1 
ATOM   10252 C C   . VAL D 1 137 ? -2.686  -26.971 57.859  1.00 60.64  ? 148  VAL D C   1 
ATOM   10253 O O   . VAL D 1 137 ? -2.287  -25.974 57.252  1.00 60.64  ? 148  VAL D O   1 
ATOM   10254 C CB  . VAL D 1 137 ? -0.749  -28.162 58.840  1.00 85.25  ? 148  VAL D CB  1 
ATOM   10255 C CG1 . VAL D 1 137 ? -1.314  -27.847 60.214  1.00 85.25  ? 148  VAL D CG1 1 
ATOM   10256 C CG2 . VAL D 1 137 ? 0.025   -29.467 58.875  1.00 85.25  ? 148  VAL D CG2 1 
ATOM   10257 N N   . SER D 1 138 ? -3.804  -26.997 58.584  1.00 117.75 ? 149  SER D N   1 
ATOM   10258 C CA  . SER D 1 138 ? -4.683  -25.836 58.730  1.00 117.75 ? 149  SER D CA  1 
ATOM   10259 C C   . SER D 1 138 ? -4.089  -24.841 59.726  1.00 117.75 ? 149  SER D C   1 
ATOM   10260 O O   . SER D 1 138 ? -3.366  -25.235 60.637  1.00 117.75 ? 149  SER D O   1 
ATOM   10261 C CB  . SER D 1 138 ? -6.059  -26.285 59.228  1.00 169.24 ? 149  SER D CB  1 
ATOM   10262 O OG  . SER D 1 138 ? -6.553  -27.373 58.467  1.00 169.24 ? 149  SER D OG  1 
ATOM   10263 N N   . ALA D 1 139 ? -4.383  -23.555 59.557  1.00 76.11  ? 150  ALA D N   1 
ATOM   10264 C CA  . ALA D 1 139 ? -3.864  -22.543 60.478  1.00 76.11  ? 150  ALA D CA  1 
ATOM   10265 C C   . ALA D 1 139 ? -5.019  -22.018 61.318  1.00 76.11  ? 150  ALA D C   1 
ATOM   10266 O O   . ALA D 1 139 ? -4.817  -21.383 62.352  1.00 76.11  ? 150  ALA D O   1 
ATOM   10267 C CB  . ALA D 1 139 ? -3.202  -21.399 59.713  1.00 31.66  ? 150  ALA D CB  1 
ATOM   10268 N N   . GLU D 1 140 ? -6.234  -22.292 60.859  1.00 144.52 ? 151  GLU D N   1 
ATOM   10269 C CA  . GLU D 1 140 ? -7.434  -21.876 61.566  1.00 144.52 ? 151  GLU D CA  1 
ATOM   10270 C C   . GLU D 1 140 ? -7.692  -22.943 62.622  1.00 144.52 ? 151  GLU D C   1 
ATOM   10271 O O   . GLU D 1 140 ? -8.600  -22.825 63.448  1.00 144.52 ? 151  GLU D O   1 
ATOM   10272 C CB  . GLU D 1 140 ? -8.618  -21.787 60.598  1.00 201.99 ? 151  GLU D CB  1 
ATOM   10273 C CG  . GLU D 1 140 ? -8.407  -20.825 59.431  1.00 201.99 ? 151  GLU D CG  1 
ATOM   10274 C CD  . GLU D 1 140 ? -7.628  -21.439 58.276  1.00 201.99 ? 151  GLU D CD  1 
ATOM   10275 O OE1 . GLU D 1 140 ? -6.559  -22.037 58.516  1.00 201.99 ? 151  GLU D OE1 1 
ATOM   10276 O OE2 . GLU D 1 140 ? -8.083  -21.313 57.119  1.00 201.99 ? 151  GLU D OE2 1 
ATOM   10277 N N   . THR D 1 141 ? -6.868  -23.987 62.573  1.00 127.58 ? 152  THR D N   1 
ATOM   10278 C CA  . THR D 1 141 ? -6.934  -25.116 63.497  1.00 127.58 ? 152  THR D CA  1 
ATOM   10279 C C   . THR D 1 141 ? -5.652  -25.115 64.327  1.00 127.58 ? 152  THR D C   1 
ATOM   10280 O O   . THR D 1 141 ? -5.617  -25.611 65.452  1.00 127.58 ? 152  THR D O   1 
ATOM   10281 C CB  . THR D 1 141 ? -7.018  -26.449 62.729  1.00 137.16 ? 152  THR D CB  1 
ATOM   10282 O OG1 . THR D 1 141 ? -8.117  -26.403 61.813  1.00 137.16 ? 152  THR D OG1 1 
ATOM   10283 C CG2 . THR D 1 141 ? -7.217  -27.604 63.687  1.00 137.16 ? 152  THR D CG2 1 
ATOM   10284 N N   . LEU D 1 142 ? -4.604  -24.544 63.746  1.00 87.29  ? 153  LEU D N   1 
ATOM   10285 C CA  . LEU D 1 142 ? -3.293  -24.446 64.376  1.00 87.29  ? 153  LEU D CA  1 
ATOM   10286 C C   . LEU D 1 142 ? -3.266  -23.172 65.215  1.00 87.29  ? 153  LEU D C   1 
ATOM   10287 O O   . LEU D 1 142 ? -2.384  -22.985 66.050  1.00 87.29  ? 153  LEU D O   1 
ATOM   10288 C CB  . LEU D 1 142 ? -2.208  -24.359 63.295  1.00 77.34  ? 153  LEU D CB  1 
ATOM   10289 C CG  . LEU D 1 142 ? -0.820  -24.966 63.511  1.00 77.34  ? 153  LEU D CG  1 
ATOM   10290 C CD1 . LEU D 1 142 ? -0.904  -26.468 63.348  1.00 77.34  ? 153  LEU D CD1 1 
ATOM   10291 C CD2 . LEU D 1 142 ? 0.157   -24.416 62.481  1.00 77.34  ? 153  LEU D CD2 1 
ATOM   10292 N N   . ARG D 1 143 ? -4.244  -22.300 64.982  1.00 175.46 ? 154  ARG D N   1 
ATOM   10293 C CA  . ARG D 1 143 ? -4.335  -21.026 65.689  1.00 175.46 ? 154  ARG D CA  1 
ATOM   10294 C C   . ARG D 1 143 ? -4.942  -21.145 67.085  1.00 175.46 ? 154  ARG D C   1 
ATOM   10295 O O   . ARG D 1 143 ? -4.314  -20.747 68.065  1.00 175.46 ? 154  ARG D O   1 
ATOM   10296 C CB  . ARG D 1 143 ? -5.147  -20.023 64.857  1.00 188.23 ? 154  ARG D CB  1 
ATOM   10297 C CG  . ARG D 1 143 ? -4.969  -18.559 65.259  1.00 188.23 ? 154  ARG D CG  1 
ATOM   10298 C CD  . ARG D 1 143 ? -5.590  -18.248 66.614  1.00 188.23 ? 154  ARG D CD  1 
ATOM   10299 N NE  . ARG D 1 143 ? -5.347  -16.870 67.038  1.00 188.23 ? 154  ARG D NE  1 
ATOM   10300 C CZ  . ARG D 1 143 ? -4.142  -16.353 67.258  1.00 188.23 ? 154  ARG D CZ  1 
ATOM   10301 N NH1 . ARG D 1 143 ? -3.056  -17.096 67.095  1.00 188.23 ? 154  ARG D NH1 1 
ATOM   10302 N NH2 . ARG D 1 143 ? -4.022  -15.091 67.648  1.00 188.23 ? 154  ARG D NH2 1 
ATOM   10303 N N   . GLU D 1 144 ? -6.159  -21.680 67.180  1.00 95.04  ? 155  GLU D N   1 
ATOM   10304 C CA  . GLU D 1 144 ? -6.819  -21.816 68.477  1.00 95.04  ? 155  GLU D CA  1 
ATOM   10305 C C   . GLU D 1 144 ? -6.134  -22.866 69.345  1.00 95.04  ? 155  GLU D C   1 
ATOM   10306 O O   . GLU D 1 144 ? -6.723  -23.879 69.721  1.00 95.04  ? 155  GLU D O   1 
ATOM   10307 C CB  . GLU D 1 144 ? -8.315  -22.135 68.297  1.00 107.56 ? 155  GLU D CB  1 
ATOM   10308 C CG  . GLU D 1 144 ? -8.634  -23.428 67.565  1.00 107.56 ? 155  GLU D CG  1 
ATOM   10309 C CD  . GLU D 1 144 ? -9.153  -24.519 68.489  1.00 107.56 ? 155  GLU D CD  1 
ATOM   10310 O OE1 . GLU D 1 144 ? -9.589  -25.570 67.973  1.00 107.56 ? 155  GLU D OE1 1 
ATOM   10311 O OE2 . GLU D 1 144 ? -9.127  -24.330 69.727  1.00 107.56 ? 155  GLU D OE2 1 
ATOM   10312 N N   . ILE D 1 145 ? -4.875  -22.591 69.665  1.00 176.57 ? 156  ILE D N   1 
ATOM   10313 C CA  . ILE D 1 145 ? -4.050  -23.472 70.476  1.00 176.57 ? 156  ILE D CA  1 
ATOM   10314 C C   . ILE D 1 145 ? -2.889  -22.663 71.048  1.00 176.57 ? 156  ILE D C   1 
ATOM   10315 O O   . ILE D 1 145 ? -2.642  -22.682 72.255  1.00 176.57 ? 156  ILE D O   1 
ATOM   10316 C CB  . ILE D 1 145 ? -3.502  -24.637 69.621  1.00 96.34  ? 156  ILE D CB  1 
ATOM   10317 C CG1 . ILE D 1 145 ? -4.651  -25.565 69.231  1.00 96.34  ? 156  ILE D CG1 1 
ATOM   10318 C CG2 . ILE D 1 145 ? -2.423  -25.395 70.378  1.00 96.34  ? 156  ILE D CG2 1 
ATOM   10319 C CD1 . ILE D 1 145 ? -4.255  -26.683 68.318  1.00 96.34  ? 156  ILE D CD1 1 
ATOM   10320 N N   . LEU D 1 146 ? -2.189  -21.946 70.172  1.00 183.86 ? 157  LEU D N   1 
ATOM   10321 C CA  . LEU D 1 146 ? -1.049  -21.123 70.570  1.00 183.86 ? 157  LEU D CA  1 
ATOM   10322 C C   . LEU D 1 146 ? -1.486  -19.845 71.282  1.00 183.86 ? 157  LEU D C   1 
ATOM   10323 O O   . LEU D 1 146 ? -1.506  -19.793 72.512  1.00 183.86 ? 157  LEU D O   1 
ATOM   10324 C CB  . LEU D 1 146 ? -0.201  -20.767 69.344  1.00 127.87 ? 157  LEU D CB  1 
ATOM   10325 C CG  . LEU D 1 146 ? 0.674   -21.867 68.729  1.00 127.87 ? 157  LEU D CG  1 
ATOM   10326 C CD1 . LEU D 1 146 ? 1.791   -22.236 69.689  1.00 127.87 ? 157  LEU D CD1 1 
ATOM   10327 C CD2 . LEU D 1 146 ? -0.169  -23.086 68.397  1.00 127.87 ? 157  LEU D CD2 1 
ATOM   10328 N N   . GLN D 1 147 ? -1.826  -18.815 70.509  1.00 163.50 ? 158  GLN D N   1 
ATOM   10329 C CA  . GLN D 1 147 ? -2.266  -17.546 71.084  1.00 163.50 ? 158  GLN D CA  1 
ATOM   10330 C C   . GLN D 1 147 ? -3.687  -17.665 71.634  1.00 163.50 ? 158  GLN D C   1 
ATOM   10331 O O   . GLN D 1 147 ? -4.549  -16.823 71.376  1.00 163.50 ? 158  GLN D O   1 
ATOM   10332 C CB  . GLN D 1 147 ? -2.195  -16.425 70.037  1.00 201.99 ? 158  GLN D CB  1 
ATOM   10333 C CG  . GLN D 1 147 ? -0.781  -16.116 69.546  1.00 201.99 ? 158  GLN D CG  1 
ATOM   10334 C CD  . GLN D 1 147 ? -0.693  -14.818 68.755  1.00 201.99 ? 158  GLN D CD  1 
ATOM   10335 O OE1 . GLN D 1 147 ? 0.376   -14.446 68.270  1.00 201.99 ? 158  GLN D OE1 1 
ATOM   10336 N NE2 . GLN D 1 147 ? -1.818  -14.121 68.630  1.00 201.99 ? 158  GLN D NE2 1 
ATOM   10337 N N   . ASP D 1 148 ? -3.913  -18.729 72.395  1.00 160.05 ? 159  ASP D N   1 
ATOM   10338 C CA  . ASP D 1 148 ? -5.204  -19.001 73.008  1.00 160.05 ? 159  ASP D CA  1 
ATOM   10339 C C   . ASP D 1 148 ? -4.947  -19.782 74.294  1.00 160.05 ? 159  ASP D C   1 
ATOM   10340 O O   . ASP D 1 148 ? -5.666  -19.632 75.287  1.00 160.05 ? 159  ASP D O   1 
ATOM   10341 C CB  . ASP D 1 148 ? -6.078  -19.824 72.056  1.00 185.56 ? 159  ASP D CB  1 
ATOM   10342 C CG  . ASP D 1 148 ? -7.469  -20.081 72.610  1.00 185.56 ? 159  ASP D CG  1 
ATOM   10343 O OD1 . ASP D 1 148 ? -7.584  -20.746 73.662  1.00 185.56 ? 159  ASP D OD1 1 
ATOM   10344 O OD2 . ASP D 1 148 ? -8.450  -19.617 71.991  1.00 185.56 ? 159  ASP D OD2 1 
ATOM   10345 N N   . LYS D 1 149 ? -3.907  -20.611 74.264  1.00 201.99 ? 160  LYS D N   1 
ATOM   10346 C CA  . LYS D 1 149 ? -3.527  -21.419 75.415  1.00 201.99 ? 160  LYS D CA  1 
ATOM   10347 C C   . LYS D 1 149 ? -4.725  -22.255 75.856  1.00 201.99 ? 160  LYS D C   1 
ATOM   10348 O O   . LYS D 1 149 ? -5.037  -22.355 77.044  1.00 201.99 ? 160  LYS D O   1 
ATOM   10349 C CB  . LYS D 1 149 ? -3.043  -20.498 76.542  1.00 117.65 ? 160  LYS D CB  1 
ATOM   10350 C CG  . LYS D 1 149 ? -2.045  -19.448 76.043  1.00 117.65 ? 160  LYS D CG  1 
ATOM   10351 C CD  . LYS D 1 149 ? -1.669  -18.418 77.095  1.00 117.65 ? 160  LYS D CD  1 
ATOM   10352 C CE  . LYS D 1 149 ? -0.971  -17.224 76.454  1.00 117.65 ? 160  LYS D CE  1 
ATOM   10353 N NZ  . LYS D 1 149 ? 0.187   -17.626 75.603  1.00 117.65 ? 160  LYS D NZ  1 
ATOM   10354 N N   . GLU D 1 150 ? -5.388  -22.850 74.867  1.00 184.84 ? 161  GLU D N   1 
ATOM   10355 C CA  . GLU D 1 150 ? -6.564  -23.688 75.077  1.00 184.84 ? 161  GLU D CA  1 
ATOM   10356 C C   . GLU D 1 150 ? -6.264  -24.856 76.010  1.00 184.84 ? 161  GLU D C   1 
ATOM   10357 O O   . GLU D 1 150 ? -5.985  -25.967 75.555  1.00 184.84 ? 161  GLU D O   1 
ATOM   10358 C CB  . GLU D 1 150 ? -7.063  -24.220 73.727  1.00 201.99 ? 161  GLU D CB  1 
ATOM   10359 C CG  . GLU D 1 150 ? -8.254  -25.169 73.804  1.00 201.99 ? 161  GLU D CG  1 
ATOM   10360 C CD  . GLU D 1 150 ? -9.532  -24.480 74.237  1.00 201.99 ? 161  GLU D CD  1 
ATOM   10361 O OE1 . GLU D 1 150 ? -9.964  -23.539 73.539  1.00 201.99 ? 161  GLU D OE1 1 
ATOM   10362 O OE2 . GLU D 1 150 ? -10.106 -24.882 75.272  1.00 201.99 ? 161  GLU D OE2 1 
ATOM   10363 N N   . LEU D 1 151 ? -6.327  -24.598 77.313  1.00 182.70 ? 162  LEU D N   1 
ATOM   10364 C CA  . LEU D 1 151 ? -6.068  -25.620 78.322  1.00 182.70 ? 162  LEU D CA  1 
ATOM   10365 C C   . LEU D 1 151 ? -4.599  -26.068 78.290  1.00 182.70 ? 162  LEU D C   1 
ATOM   10366 O O   . LEU D 1 151 ? -3.923  -26.067 79.320  1.00 182.70 ? 162  LEU D O   1 
ATOM   10367 C CB  . LEU D 1 151 ? -7.007  -26.819 78.104  1.00 136.15 ? 162  LEU D CB  1 
ATOM   10368 C CG  . LEU D 1 151 ? -8.518  -26.530 78.028  1.00 136.15 ? 162  LEU D CG  1 
ATOM   10369 C CD1 . LEU D 1 151 ? -9.276  -27.823 77.766  1.00 136.15 ? 162  LEU D CD1 1 
ATOM   10370 C CD2 . LEU D 1 151 ? -9.004  -25.886 79.323  1.00 136.15 ? 162  LEU D CD2 1 
ATOM   10371 N N   . SER D 1 152 ? -4.121  -26.440 77.102  1.00 201.77 ? 163  SER D N   1 
ATOM   10372 C CA  . SER D 1 152 ? -2.741  -26.886 76.883  1.00 201.77 ? 163  SER D CA  1 
ATOM   10373 C C   . SER D 1 152 ? -2.217  -27.901 77.898  1.00 201.77 ? 163  SER D C   1 
ATOM   10374 O O   . SER D 1 152 ? -2.783  -28.983 78.053  1.00 201.77 ? 163  SER D O   1 
ATOM   10375 C CB  . SER D 1 152 ? -1.793  -25.680 76.834  1.00 183.86 ? 163  SER D CB  1 
ATOM   10376 O OG  . SER D 1 152 ? -2.017  -24.895 75.674  1.00 183.86 ? 163  SER D OG  1 
ATOM   10377 N N   . LYS D 1 153 ? -1.125  -27.543 78.573  1.00 177.81 ? 164  LYS D N   1 
ATOM   10378 C CA  . LYS D 1 153 ? -0.491  -28.400 79.577  1.00 177.81 ? 164  LYS D CA  1 
ATOM   10379 C C   . LYS D 1 153 ? -0.501  -29.848 79.092  1.00 177.81 ? 164  LYS D C   1 
ATOM   10380 O O   . LYS D 1 153 ? 0.267   -30.232 78.206  1.00 177.81 ? 164  LYS D O   1 
ATOM   10381 C CB  . LYS D 1 153 ? -1.239  -28.303 80.919  1.00 94.42  ? 164  LYS D CB  1 
ATOM   10382 C CG  . LYS D 1 153 ? -1.596  -26.885 81.361  1.00 94.42  ? 164  LYS D CG  1 
ATOM   10383 C CD  . LYS D 1 153 ? -2.483  -26.901 82.600  1.00 94.42  ? 164  LYS D CD  1 
ATOM   10384 C CE  . LYS D 1 153 ? -3.100  -25.535 82.851  1.00 94.42  ? 164  LYS D CE  1 
ATOM   10385 N NZ  . LYS D 1 153 ? -2.065  -24.467 82.924  1.00 94.42  ? 164  LYS D NZ  1 
ATOM   10386 N N   . GLU D 1 154 ? -1.385  -30.643 79.686  1.00 157.65 ? 165  GLU D N   1 
ATOM   10387 C CA  . GLU D 1 154 ? -1.538  -32.044 79.326  1.00 157.65 ? 165  GLU D CA  1 
ATOM   10388 C C   . GLU D 1 154 ? -2.668  -32.171 78.318  1.00 157.65 ? 165  GLU D C   1 
ATOM   10389 O O   . GLU D 1 154 ? -3.809  -32.466 78.677  1.00 157.65 ? 165  GLU D O   1 
ATOM   10390 C CB  . GLU D 1 154 ? -1.864  -32.883 80.562  1.00 179.90 ? 165  GLU D CB  1 
ATOM   10391 C CG  . GLU D 1 154 ? -0.717  -33.029 81.541  1.00 179.90 ? 165  GLU D CG  1 
ATOM   10392 C CD  . GLU D 1 154 ? -1.152  -33.694 82.829  1.00 179.90 ? 165  GLU D CD  1 
ATOM   10393 O OE1 . GLU D 1 154 ? -1.730  -34.800 82.762  1.00 179.90 ? 165  GLU D OE1 1 
ATOM   10394 O OE2 . GLU D 1 154 ? -0.916  -33.112 83.909  1.00 179.90 ? 165  GLU D OE2 1 
ATOM   10395 N N   . GLN D 1 155 ? -2.336  -31.930 77.055  1.00 156.51 ? 166  GLN D N   1 
ATOM   10396 C CA  . GLN D 1 155 ? -3.296  -32.023 75.965  1.00 156.51 ? 166  GLN D CA  1 
ATOM   10397 C C   . GLN D 1 155 ? -2.578  -32.154 74.624  1.00 156.51 ? 166  GLN D C   1 
ATOM   10398 O O   . GLN D 1 155 ? -2.798  -33.118 73.887  1.00 156.51 ? 166  GLN D O   1 
ATOM   10399 C CB  . GLN D 1 155 ? -4.222  -30.795 75.946  1.00 120.83 ? 166  GLN D CB  1 
ATOM   10400 C CG  . GLN D 1 155 ? -5.470  -30.928 76.817  1.00 120.83 ? 166  GLN D CG  1 
ATOM   10401 C CD  . GLN D 1 155 ? -6.537  -29.891 76.493  1.00 120.83 ? 166  GLN D CD  1 
ATOM   10402 O OE1 . GLN D 1 155 ? -7.686  -30.012 76.920  1.00 120.83 ? 166  GLN D OE1 1 
ATOM   10403 N NE2 . GLN D 1 155 ? -6.159  -28.867 75.740  1.00 120.83 ? 166  GLN D NE2 1 
ATOM   10404 N N   . LEU D 1 156 ? -1.713  -31.188 74.319  1.00 201.79 ? 167  LEU D N   1 
ATOM   10405 C CA  . LEU D 1 156 ? -0.970  -31.182 73.061  1.00 201.79 ? 167  LEU D CA  1 
ATOM   10406 C C   . LEU D 1 156 ? -0.194  -32.464 72.813  1.00 201.79 ? 167  LEU D C   1 
ATOM   10407 O O   . LEU D 1 156 ? 0.796   -32.752 73.486  1.00 201.79 ? 167  LEU D O   1 
ATOM   10408 C CB  . LEU D 1 156 ? -0.014  -29.984 73.000  1.00 92.54  ? 167  LEU D CB  1 
ATOM   10409 C CG  . LEU D 1 156 ? -0.671  -28.626 72.717  1.00 92.54  ? 167  LEU D CG  1 
ATOM   10410 C CD1 . LEU D 1 156 ? -1.342  -28.665 71.354  1.00 92.54  ? 167  LEU D CD1 1 
ATOM   10411 C CD2 . LEU D 1 156 ? -1.703  -28.293 73.793  1.00 92.54  ? 167  LEU D CD2 1 
ATOM   10412 N N   . VAL D 1 157 ? -0.667  -33.219 71.829  1.00 102.89 ? 168  VAL D N   1 
ATOM   10413 C CA  . VAL D 1 157 ? -0.081  -34.491 71.419  1.00 102.89 ? 168  VAL D CA  1 
ATOM   10414 C C   . VAL D 1 157 ? -1.176  -35.261 70.682  1.00 102.89 ? 168  VAL D C   1 
ATOM   10415 O O   . VAL D 1 157 ? -0.921  -36.291 70.054  1.00 102.89 ? 168  VAL D O   1 
ATOM   10416 C CB  . VAL D 1 157 ? 0.420   -35.323 72.631  1.00 123.11 ? 168  VAL D CB  1 
ATOM   10417 C CG1 . VAL D 1 157 ? -0.756  -35.759 73.506  1.00 123.11 ? 168  VAL D CG1 1 
ATOM   10418 C CG2 . VAL D 1 157 ? 1.221   -36.519 72.140  1.00 123.11 ? 168  VAL D CG2 1 
ATOM   10419 N N   . THR D 1 158 ? -2.400  -34.743 70.775  1.00 201.99 ? 169  THR D N   1 
ATOM   10420 C CA  . THR D 1 158 ? -3.557  -35.334 70.108  1.00 201.99 ? 169  THR D CA  1 
ATOM   10421 C C   . THR D 1 158 ? -3.692  -34.595 68.784  1.00 201.99 ? 169  THR D C   1 
ATOM   10422 O O   . THR D 1 158 ? -4.222  -35.125 67.810  1.00 201.99 ? 169  THR D O   1 
ATOM   10423 C CB  . THR D 1 158 ? -4.856  -35.126 70.915  1.00 120.54 ? 169  THR D CB  1 
ATOM   10424 O OG1 . THR D 1 158 ? -4.642  -35.509 72.278  1.00 120.54 ? 169  THR D OG1 1 
ATOM   10425 C CG2 . THR D 1 158 ? -5.980  -35.972 70.340  1.00 120.54 ? 169  THR D CG2 1 
ATOM   10426 N N   . PHE D 1 159 ? -3.207  -33.356 68.773  1.00 201.99 ? 170  PHE D N   1 
ATOM   10427 C CA  . PHE D 1 159 ? -3.237  -32.517 67.583  1.00 201.99 ? 170  PHE D CA  1 
ATOM   10428 C C   . PHE D 1 159 ? -2.182  -33.066 66.629  1.00 201.99 ? 170  PHE D C   1 
ATOM   10429 O O   . PHE D 1 159 ? -2.517  -33.590 65.566  1.00 201.99 ? 170  PHE D O   1 
ATOM   10430 C CB  . PHE D 1 159 ? -2.917  -31.067 67.959  1.00 99.83  ? 170  PHE D CB  1 
ATOM   10431 C CG  . PHE D 1 159 ? -3.173  -30.074 66.855  1.00 99.83  ? 170  PHE D CG  1 
ATOM   10432 C CD1 . PHE D 1 159 ? -4.442  -29.935 66.302  1.00 99.83  ? 170  PHE D CD1 1 
ATOM   10433 C CD2 . PHE D 1 159 ? -2.148  -29.266 66.378  1.00 99.83  ? 170  PHE D CD2 1 
ATOM   10434 C CE1 . PHE D 1 159 ? -4.684  -29.005 65.289  1.00 99.83  ? 170  PHE D CE1 1 
ATOM   10435 C CE2 . PHE D 1 159 ? -2.386  -28.337 65.368  1.00 99.83  ? 170  PHE D CE2 1 
ATOM   10436 C CZ  . PHE D 1 159 ? -3.656  -28.207 64.824  1.00 99.83  ? 170  PHE D CZ  1 
ATOM   10437 N N   . LEU D 1 160 ? -0.910  -32.955 67.015  1.00 60.06  ? 171  LEU D N   1 
ATOM   10438 C CA  . LEU D 1 160 ? 0.189   -33.471 66.196  1.00 60.06  ? 171  LEU D CA  1 
ATOM   10439 C C   . LEU D 1 160 ? -0.092  -34.919 65.815  1.00 60.06  ? 171  LEU D C   1 
ATOM   10440 O O   . LEU D 1 160 ? 0.474   -35.437 64.859  1.00 60.06  ? 171  LEU D O   1 
ATOM   10441 C CB  . LEU D 1 160 ? 1.510   -33.384 66.959  1.00 79.95  ? 171  LEU D CB  1 
ATOM   10442 C CG  . LEU D 1 160 ? 2.205   -32.021 66.954  1.00 79.95  ? 171  LEU D CG  1 
ATOM   10443 C CD1 . LEU D 1 160 ? 2.804   -31.779 65.576  1.00 79.95  ? 171  LEU D CD1 1 
ATOM   10444 C CD2 . LEU D 1 160 ? 1.221   -30.909 67.327  1.00 79.95  ? 171  LEU D CD2 1 
ATOM   10445 N N   . GLU D 1 161 ? -0.974  -35.564 66.574  1.00 201.99 ? 172  GLU D N   1 
ATOM   10446 C CA  . GLU D 1 161 ? -1.361  -36.949 66.325  1.00 201.99 ? 172  GLU D CA  1 
ATOM   10447 C C   . GLU D 1 161 ? -2.483  -36.964 65.294  1.00 201.99 ? 172  GLU D C   1 
ATOM   10448 O O   . GLU D 1 161 ? -2.333  -37.494 64.194  1.00 201.99 ? 172  GLU D O   1 
ATOM   10449 C CB  . GLU D 1 161 ? -1.860  -37.597 67.618  1.00 177.34 ? 172  GLU D CB  1 
ATOM   10450 C CG  . GLU D 1 161 ? -2.401  -39.006 67.440  1.00 177.34 ? 172  GLU D CG  1 
ATOM   10451 C CD  . GLU D 1 161 ? -3.268  -39.451 68.602  1.00 177.34 ? 172  GLU D CD  1 
ATOM   10452 O OE1 . GLU D 1 161 ? -3.728  -40.613 68.590  1.00 177.34 ? 172  GLU D OE1 1 
ATOM   10453 O OE2 . GLU D 1 161 ? -3.495  -38.638 69.524  1.00 177.34 ? 172  GLU D OE2 1 
ATOM   10454 N N   . ASN D 1 162 ? -3.609  -36.372 65.673  1.00 163.19 ? 173  ASN D N   1 
ATOM   10455 C CA  . ASN D 1 162 ? -4.783  -36.288 64.816  1.00 163.19 ? 173  ASN D CA  1 
ATOM   10456 C C   . ASN D 1 162 ? -4.472  -35.612 63.478  1.00 163.19 ? 173  ASN D C   1 
ATOM   10457 O O   . ASN D 1 162 ? -5.238  -35.733 62.520  1.00 163.19 ? 173  ASN D O   1 
ATOM   10458 C CB  . ASN D 1 162 ? -5.888  -35.522 65.548  1.00 116.76 ? 173  ASN D CB  1 
ATOM   10459 C CG  . ASN D 1 162 ? -7.041  -35.145 64.642  1.00 116.76 ? 173  ASN D CG  1 
ATOM   10460 O OD1 . ASN D 1 162 ? -7.726  -36.007 64.095  1.00 116.76 ? 173  ASN D OD1 1 
ATOM   10461 N ND2 . ASN D 1 162 ? -7.261  -33.846 64.479  1.00 116.76 ? 173  ASN D ND2 1 
ATOM   10462 N N   . VAL D 1 163 ? -3.348  -34.904 63.413  1.00 134.39 ? 174  VAL D N   1 
ATOM   10463 C CA  . VAL D 1 163 ? -2.955  -34.215 62.189  1.00 134.39 ? 174  VAL D CA  1 
ATOM   10464 C C   . VAL D 1 163 ? -2.617  -35.165 61.053  1.00 134.39 ? 174  VAL D C   1 
ATOM   10465 O O   . VAL D 1 163 ? -3.223  -35.094 59.987  1.00 134.39 ? 174  VAL D O   1 
ATOM   10466 C CB  . VAL D 1 163 ? -1.753  -33.284 62.428  1.00 60.72  ? 174  VAL D CB  1 
ATOM   10467 C CG1 . VAL D 1 163 ? -1.033  -33.013 61.117  1.00 60.72  ? 174  VAL D CG1 1 
ATOM   10468 C CG2 . VAL D 1 163 ? -2.239  -31.966 63.032  1.00 60.72  ? 174  VAL D CG2 1 
ATOM   10469 N N   . LEU D 1 164 ? -1.649  -36.048 61.272  1.00 84.81  ? 175  LEU D N   1 
ATOM   10470 C CA  . LEU D 1 164 ? -1.264  -37.000 60.235  1.00 84.81  ? 175  LEU D CA  1 
ATOM   10471 C C   . LEU D 1 164 ? -2.470  -37.759 59.674  1.00 84.81  ? 175  LEU D C   1 
ATOM   10472 O O   . LEU D 1 164 ? -2.375  -38.391 58.618  1.00 84.81  ? 175  LEU D O   1 
ATOM   10473 C CB  . LEU D 1 164 ? -0.235  -37.994 60.774  1.00 124.02 ? 175  LEU D CB  1 
ATOM   10474 C CG  . LEU D 1 164 ? 1.185   -37.467 60.994  1.00 124.02 ? 175  LEU D CG  1 
ATOM   10475 C CD1 . LEU D 1 164 ? 1.744   -36.970 59.671  1.00 124.02 ? 175  LEU D CD1 1 
ATOM   10476 C CD2 . LEU D 1 164 ? 1.179   -36.355 62.027  1.00 124.02 ? 175  LEU D CD2 1 
ATOM   10477 N N   . LYS D 1 165 ? -3.600  -37.697 60.381  1.00 67.56  ? 176  LYS D N   1 
ATOM   10478 C CA  . LYS D 1 165 ? -4.831  -38.359 59.954  1.00 67.56  ? 176  LYS D CA  1 
ATOM   10479 C C   . LYS D 1 165 ? -5.743  -37.386 59.205  1.00 67.56  ? 176  LYS D C   1 
ATOM   10480 O O   . LYS D 1 165 ? -6.075  -37.600 58.040  1.00 67.56  ? 176  LYS D O   1 
ATOM   10481 C CB  . LYS D 1 165 ? -5.575  -38.933 61.165  1.00 111.37 ? 176  LYS D CB  1 
ATOM   10482 C CG  . LYS D 1 165 ? -5.350  -40.422 61.409  1.00 111.37 ? 176  LYS D CG  1 
ATOM   10483 C CD  . LYS D 1 165 ? -6.100  -41.288 60.389  1.00 111.37 ? 176  LYS D CD  1 
ATOM   10484 C CE  . LYS D 1 165 ? -5.880  -42.781 60.646  1.00 111.37 ? 176  LYS D CE  1 
ATOM   10485 N NZ  . LYS D 1 165 ? -6.646  -43.661 59.714  1.00 111.37 ? 176  LYS D NZ  1 
ATOM   10486 N N   . THR D 1 166 ? -6.132  -36.312 59.881  1.00 99.25  ? 177  THR D N   1 
ATOM   10487 C CA  . THR D 1 166 ? -7.012  -35.300 59.305  1.00 99.25  ? 177  THR D CA  1 
ATOM   10488 C C   . THR D 1 166 ? -6.383  -34.535 58.124  1.00 99.25  ? 177  THR D C   1 
ATOM   10489 O O   . THR D 1 166 ? -7.074  -34.159 57.163  1.00 99.25  ? 177  THR D O   1 
ATOM   10490 C CB  . THR D 1 166 ? -7.436  -34.287 60.404  1.00 136.42 ? 177  THR D CB  1 
ATOM   10491 O OG1 . THR D 1 166 ? -8.107  -34.988 61.458  1.00 136.42 ? 177  THR D OG1 1 
ATOM   10492 C CG2 . THR D 1 166 ? -8.371  -33.224 59.845  1.00 136.42 ? 177  THR D CG2 1 
ATOM   10493 N N   . SER D 1 167 ? -5.070  -34.330 58.201  1.00 96.59  ? 178  SER D N   1 
ATOM   10494 C CA  . SER D 1 167 ? -4.301  -33.588 57.199  1.00 96.59  ? 178  SER D CA  1 
ATOM   10495 C C   . SER D 1 167 ? -4.257  -34.130 55.763  1.00 96.59  ? 178  SER D C   1 
ATOM   10496 O O   . SER D 1 167 ? -4.187  -35.342 55.542  1.00 96.59  ? 178  SER D O   1 
ATOM   10497 C CB  . SER D 1 167 ? -2.867  -33.414 57.713  1.00 108.13 ? 178  SER D CB  1 
ATOM   10498 O OG  . SER D 1 167 ? -2.065  -32.719 56.780  1.00 108.13 ? 178  SER D OG  1 
ATOM   10499 N N   . GLY D 1 168 ? -4.289  -33.210 54.796  1.00 68.66  ? 179  GLY D N   1 
ATOM   10500 C CA  . GLY D 1 168 ? -4.222  -33.578 53.390  1.00 68.66  ? 179  GLY D CA  1 
ATOM   10501 C C   . GLY D 1 168 ? -2.772  -33.747 52.953  1.00 68.66  ? 179  GLY D C   1 
ATOM   10502 O O   . GLY D 1 168 ? -1.863  -33.470 53.734  1.00 68.66  ? 179  GLY D O   1 
ATOM   10503 N N   . LYS D 1 169 ? -2.538  -34.190 51.719  1.00 47.45  ? 180  LYS D N   1 
ATOM   10504 C CA  . LYS D 1 169 ? -1.169  -34.391 51.236  1.00 47.45  ? 180  LYS D CA  1 
ATOM   10505 C C   . LYS D 1 169 ? -0.990  -33.890 49.804  1.00 47.45  ? 180  LYS D C   1 
ATOM   10506 O O   . LYS D 1 169 ? -1.907  -33.984 49.001  1.00 47.45  ? 180  LYS D O   1 
ATOM   10507 C CB  . LYS D 1 169 ? -0.819  -35.874 51.285  1.00 65.79  ? 180  LYS D CB  1 
ATOM   10508 C CG  . LYS D 1 169 ? -1.588  -36.717 50.262  1.00 65.79  ? 180  LYS D CG  1 
ATOM   10509 C CD  . LYS D 1 169 ? -1.323  -38.197 50.453  1.00 65.79  ? 180  LYS D CD  1 
ATOM   10510 C CE  . LYS D 1 169 ? 0.171   -38.469 50.522  1.00 65.79  ? 180  LYS D CE  1 
ATOM   10511 N NZ  . LYS D 1 169 ? 0.481   -39.879 50.880  1.00 65.79  ? 180  LYS D NZ  1 
ATOM   10512 N N   . LEU D 1 170 ? 0.181   -33.346 49.484  1.00 61.45  ? 181  LEU D N   1 
ATOM   10513 C CA  . LEU D 1 170 ? 0.439   -32.871 48.124  1.00 61.45  ? 181  LEU D CA  1 
ATOM   10514 C C   . LEU D 1 170 ? 0.962   -34.088 47.393  1.00 61.45  ? 181  LEU D C   1 
ATOM   10515 O O   . LEU D 1 170 ? 1.899   -34.733 47.852  1.00 61.45  ? 181  LEU D O   1 
ATOM   10516 C CB  . LEU D 1 170 ? 1.485   -31.751 48.114  1.00 45.53  ? 181  LEU D CB  1 
ATOM   10517 C CG  . LEU D 1 170 ? 1.114   -30.432 48.799  1.00 45.53  ? 181  LEU D CG  1 
ATOM   10518 C CD1 . LEU D 1 170 ? 2.236   -29.439 48.606  1.00 45.53  ? 181  LEU D CD1 1 
ATOM   10519 C CD2 . LEU D 1 170 ? -0.174  -29.881 48.213  1.00 45.53  ? 181  LEU D CD2 1 
ATOM   10520 N N   . ARG D 1 171 ? 0.380   -34.403 46.249  1.00 40.36  ? 182  ARG D N   1 
ATOM   10521 C CA  . ARG D 1 171 ? 0.795   -35.604 45.552  1.00 40.36  ? 182  ARG D CA  1 
ATOM   10522 C C   . ARG D 1 171 ? 2.280   -35.819 45.337  1.00 40.36  ? 182  ARG D C   1 
ATOM   10523 O O   . ARG D 1 171 ? 3.010   -34.881 45.026  1.00 40.36  ? 182  ARG D O   1 
ATOM   10524 C CB  . ARG D 1 171 ? 0.029   -35.747 44.231  1.00 41.80  ? 182  ARG D CB  1 
ATOM   10525 C CG  . ARG D 1 171 ? 0.149   -34.628 43.277  1.00 41.80  ? 182  ARG D CG  1 
ATOM   10526 C CD  . ARG D 1 171 ? 0.885   -35.103 42.049  1.00 41.80  ? 182  ARG D CD  1 
ATOM   10527 N NE  . ARG D 1 171 ? 0.644   -34.244 40.888  1.00 41.80  ? 182  ARG D NE  1 
ATOM   10528 C CZ  . ARG D 1 171 ? -0.558  -33.968 40.401  1.00 41.80  ? 182  ARG D CZ  1 
ATOM   10529 N NH1 . ARG D 1 171 ? -1.638  -34.472 40.972  1.00 41.80  ? 182  ARG D NH1 1 
ATOM   10530 N NH2 . ARG D 1 171 ? -0.675  -33.218 39.328  1.00 41.80  ? 182  ARG D NH2 1 
ATOM   10531 N N   . GLU D 1 172 ? 2.703   -37.074 45.538  1.00 35.89  ? 183  GLU D N   1 
ATOM   10532 C CA  . GLU D 1 172 ? 4.093   -37.529 45.377  1.00 35.89  ? 183  GLU D CA  1 
ATOM   10533 C C   . GLU D 1 172 ? 4.318   -38.042 43.951  1.00 35.89  ? 183  GLU D C   1 
ATOM   10534 O O   . GLU D 1 172 ? 5.432   -37.978 43.429  1.00 35.89  ? 183  GLU D O   1 
ATOM   10535 C CB  . GLU D 1 172 ? 4.395   -38.657 46.371  1.00 156.31 ? 183  GLU D CB  1 
ATOM   10536 C CG  . GLU D 1 172 ? 5.847   -39.134 46.373  1.00 156.31 ? 183  GLU D CG  1 
ATOM   10537 C CD  . GLU D 1 172 ? 6.736   -38.323 47.304  1.00 156.31 ? 183  GLU D CD  1 
ATOM   10538 O OE1 . GLU D 1 172 ? 7.969   -38.541 47.301  1.00 156.31 ? 183  GLU D OE1 1 
ATOM   10539 O OE2 . GLU D 1 172 ? 6.199   -37.472 48.046  1.00 156.31 ? 183  GLU D OE2 1 
ATOM   10540 N N   . ASN D 1 173 ? 3.248   -38.552 43.339  1.00 89.90  ? 184  ASN D N   1 
ATOM   10541 C CA  . ASN D 1 173 ? 3.270   -39.069 41.969  1.00 89.90  ? 184  ASN D CA  1 
ATOM   10542 C C   . ASN D 1 173 ? 1.886   -38.936 41.322  1.00 89.90  ? 184  ASN D C   1 
ATOM   10543 O O   . ASN D 1 173 ? 0.934   -38.515 41.975  1.00 89.90  ? 184  ASN D O   1 
ATOM   10544 C CB  . ASN D 1 173 ? 3.708   -40.537 41.953  1.00 80.31  ? 184  ASN D CB  1 
ATOM   10545 C CG  . ASN D 1 173 ? 2.866   -41.411 42.857  1.00 80.31  ? 184  ASN D CG  1 
ATOM   10546 O OD1 . ASN D 1 173 ? 1.647   -41.483 42.717  1.00 80.31  ? 184  ASN D OD1 1 
ATOM   10547 N ND2 . ASN D 1 173 ? 3.517   -42.088 43.792  1.00 80.31  ? 184  ASN D ND2 1 
ATOM   10548 N N   . LEU D 1 174 ? 1.776   -39.292 40.042  1.00 44.29  ? 185  LEU D N   1 
ATOM   10549 C CA  . LEU D 1 174 ? 0.503   -39.203 39.325  1.00 44.29  ? 185  LEU D CA  1 
ATOM   10550 C C   . LEU D 1 174 ? -0.202  -40.551 39.231  1.00 44.29  ? 185  LEU D C   1 
ATOM   10551 O O   . LEU D 1 174 ? -1.355  -40.620 38.820  1.00 44.29  ? 185  LEU D O   1 
ATOM   10552 C CB  . LEU D 1 174 ? 0.724   -38.669 37.908  1.00 54.15  ? 185  LEU D CB  1 
ATOM   10553 C CG  . LEU D 1 174 ? 1.388   -37.311 37.695  1.00 54.15  ? 185  LEU D CG  1 
ATOM   10554 C CD1 . LEU D 1 174 ? 1.636   -37.100 36.221  1.00 54.15  ? 185  LEU D CD1 1 
ATOM   10555 C CD2 . LEU D 1 174 ? 0.505   -36.215 38.239  1.00 54.15  ? 185  LEU D CD2 1 
ATOM   10556 N N   . LEU D 1 175 ? 0.503   -41.614 39.606  1.00 32.69  ? 186  LEU D N   1 
ATOM   10557 C CA  . LEU D 1 175 ? -0.018  -42.991 39.573  1.00 32.69  ? 186  LEU D CA  1 
ATOM   10558 C C   . LEU D 1 175 ? -1.309  -43.219 40.361  1.00 32.69  ? 186  LEU D C   1 
ATOM   10559 O O   . LEU D 1 175 ? -2.249  -43.819 39.855  1.00 32.69  ? 186  LEU D O   1 
ATOM   10560 C CB  . LEU D 1 175 ? 1.035   -43.971 40.106  1.00 33.83  ? 186  LEU D CB  1 
ATOM   10561 C CG  . LEU D 1 175 ? 0.684   -45.443 39.907  1.00 33.83  ? 186  LEU D CG  1 
ATOM   10562 C CD1 . LEU D 1 175 ? 0.865   -45.809 38.445  1.00 33.83  ? 186  LEU D CD1 1 
ATOM   10563 C CD2 . LEU D 1 175 ? 1.580   -46.292 40.743  1.00 33.83  ? 186  LEU D CD2 1 
ATOM   10564 N N   . HIS D 1 176 ? -1.339  -42.760 41.609  1.00 49.08  ? 187  HIS D N   1 
ATOM   10565 C CA  . HIS D 1 176 ? -2.509  -42.931 42.463  1.00 49.08  ? 187  HIS D CA  1 
ATOM   10566 C C   . HIS D 1 176 ? -3.734  -42.272 41.829  1.00 49.08  ? 187  HIS D C   1 
ATOM   10567 O O   . HIS D 1 176 ? -4.800  -42.874 41.756  1.00 49.08  ? 187  HIS D O   1 
ATOM   10568 C CB  . HIS D 1 176 ? -2.243  -42.335 43.856  1.00 100.48 ? 187  HIS D CB  1 
ATOM   10569 C CG  . HIS D 1 176 ? -3.213  -42.789 44.906  1.00 100.48 ? 187  HIS D CG  1 
ATOM   10570 N ND1 . HIS D 1 176 ? -3.287  -44.097 45.334  1.00 100.48 ? 187  HIS D ND1 1 
ATOM   10571 C CD2 . HIS D 1 176 ? -4.162  -42.113 45.596  1.00 100.48 ? 187  HIS D CD2 1 
ATOM   10572 C CE1 . HIS D 1 176 ? -4.242  -44.209 46.241  1.00 100.48 ? 187  HIS D CE1 1 
ATOM   10573 N NE2 . HIS D 1 176 ? -4.789  -43.020 46.418  1.00 100.48 ? 187  HIS D NE2 1 
ATOM   10574 N N   . GLY D 1 177 ? -3.571  -41.037 41.362  1.00 34.71  ? 188  GLY D N   1 
ATOM   10575 C CA  . GLY D 1 177 ? -4.674  -40.329 40.744  1.00 34.71  ? 188  GLY D CA  1 
ATOM   10576 C C   . GLY D 1 177 ? -5.254  -41.046 39.549  1.00 34.71  ? 188  GLY D C   1 
ATOM   10577 O O   . GLY D 1 177 ? -6.430  -40.885 39.236  1.00 34.71  ? 188  GLY D O   1 
ATOM   10578 N N   . ALA D 1 178 ? -4.421  -41.832 38.879  1.00 45.50  ? 189  ALA D N   1 
ATOM   10579 C CA  . ALA D 1 178 ? -4.843  -42.590 37.711  1.00 45.50  ? 189  ALA D CA  1 
ATOM   10580 C C   . ALA D 1 178 ? -5.740  -43.761 38.095  1.00 45.50  ? 189  ALA D C   1 
ATOM   10581 O O   . ALA D 1 178 ? -6.861  -43.881 37.604  1.00 45.50  ? 189  ALA D O   1 
ATOM   10582 C CB  . ALA D 1 178 ? -3.629  -43.106 36.963  1.00 50.46  ? 189  ALA D CB  1 
ATOM   10583 N N   . LEU D 1 179 ? -5.245  -44.626 38.972  1.00 28.42  ? 190  LEU D N   1 
ATOM   10584 C CA  . LEU D 1 179 ? -6.014  -45.775 39.373  1.00 28.42  ? 190  LEU D CA  1 
ATOM   10585 C C   . LEU D 1 179 ? -7.395  -45.348 39.858  1.00 28.42  ? 190  LEU D C   1 
ATOM   10586 O O   . LEU D 1 179 ? -8.387  -46.023 39.597  1.00 28.42  ? 190  LEU D O   1 
ATOM   10587 C CB  . LEU D 1 179 ? -5.258  -46.564 40.448  1.00 46.55  ? 190  LEU D CB  1 
ATOM   10588 C CG  . LEU D 1 179 ? -3.805  -46.957 40.106  1.00 46.55  ? 190  LEU D CG  1 
ATOM   10589 C CD1 . LEU D 1 179 ? -3.229  -47.828 41.201  1.00 46.55  ? 190  LEU D CD1 1 
ATOM   10590 C CD2 . LEU D 1 179 ? -3.745  -47.696 38.786  1.00 46.55  ? 190  LEU D CD2 1 
ATOM   10591 N N   . GLU D 1 180 ? -7.483  -44.217 40.537  1.00 37.66  ? 191  GLU D N   1 
ATOM   10592 C CA  . GLU D 1 180 ? -8.778  -43.748 41.029  1.00 37.66  ? 191  GLU D CA  1 
ATOM   10593 C C   . GLU D 1 180 ? -9.623  -43.327 39.854  1.00 37.66  ? 191  GLU D C   1 
ATOM   10594 O O   . GLU D 1 180 ? -10.617 -42.631 40.017  1.00 37.66  ? 191  GLU D O   1 
ATOM   10595 C CB  . GLU D 1 180 ? -8.609  -42.549 41.965  1.00 127.26 ? 191  GLU D CB  1 
ATOM   10596 C CG  . GLU D 1 180 ? -7.809  -42.827 43.224  1.00 127.26 ? 191  GLU D CG  1 
ATOM   10597 C CD  . GLU D 1 180 ? -7.798  -41.646 44.174  1.00 127.26 ? 191  GLU D CD  1 
ATOM   10598 O OE1 . GLU D 1 180 ? -8.879  -41.274 44.677  1.00 127.26 ? 191  GLU D OE1 1 
ATOM   10599 O OE2 . GLU D 1 180 ? -6.708  -41.088 44.418  1.00 127.26 ? 191  GLU D OE2 1 
ATOM   10600 N N   . HIS D 1 181 ? -9.205  -43.725 38.660  1.00 59.12  ? 192  HIS D N   1 
ATOM   10601 C CA  . HIS D 1 181 ? -9.925  -43.388 37.439  1.00 59.12  ? 192  HIS D CA  1 
ATOM   10602 C C   . HIS D 1 181 ? -10.142 -44.640 36.615  1.00 59.12  ? 192  HIS D C   1 
ATOM   10603 O O   . HIS D 1 181 ? -10.986 -44.679 35.725  1.00 59.12  ? 192  HIS D O   1 
ATOM   10604 C CB  . HIS D 1 181 ? -9.134  -42.374 36.621  1.00 68.24  ? 192  HIS D CB  1 
ATOM   10605 C CG  . HIS D 1 181 ? -9.463  -40.948 36.935  1.00 68.24  ? 192  HIS D CG  1 
ATOM   10606 N ND1 . HIS D 1 181 ? -10.525 -40.286 36.357  1.00 68.24  ? 192  HIS D ND1 1 
ATOM   10607 C CD2 . HIS D 1 181 ? -8.869  -40.058 37.763  1.00 68.24  ? 192  HIS D CD2 1 
ATOM   10608 C CE1 . HIS D 1 181 ? -10.569 -39.049 36.816  1.00 68.24  ? 192  HIS D CE1 1 
ATOM   10609 N NE2 . HIS D 1 181 ? -9.576  -38.885 37.671  1.00 68.24  ? 192  HIS D NE2 1 
ATOM   10610 N N   . TYR D 1 182 ? -9.363  -45.666 36.917  1.00 50.60  ? 193  TYR D N   1 
ATOM   10611 C CA  . TYR D 1 182 ? -9.470  -46.926 36.210  1.00 50.60  ? 193  TYR D CA  1 
ATOM   10612 C C   . TYR D 1 182 ? -10.943 -47.344 36.044  1.00 50.60  ? 193  TYR D C   1 
ATOM   10613 O O   . TYR D 1 182 ? -11.510 -47.305 34.947  1.00 50.60  ? 193  TYR D O   1 
ATOM   10614 C CB  . TYR D 1 182 ? -8.692  -48.018 36.972  1.00 50.15  ? 193  TYR D CB  1 
ATOM   10615 C CG  . TYR D 1 182 ? -8.849  -49.380 36.343  1.00 50.15  ? 193  TYR D CG  1 
ATOM   10616 C CD1 . TYR D 1 182 ? -8.378  -49.621 35.058  1.00 50.15  ? 193  TYR D CD1 1 
ATOM   10617 C CD2 . TYR D 1 182 ? -9.561  -50.393 36.980  1.00 50.15  ? 193  TYR D CD2 1 
ATOM   10618 C CE1 . TYR D 1 182 ? -8.615  -50.816 34.415  1.00 50.15  ? 193  TYR D CE1 1 
ATOM   10619 C CE2 . TYR D 1 182 ? -9.803  -51.603 36.334  1.00 50.15  ? 193  TYR D CE2 1 
ATOM   10620 C CZ  . TYR D 1 182 ? -9.326  -51.798 35.046  1.00 50.15  ? 193  TYR D CZ  1 
ATOM   10621 O OH  . TYR D 1 182 ? -9.580  -52.959 34.358  1.00 50.15  ? 193  TYR D OH  1 
ATOM   10622 N N   . VAL D 1 183 ? -11.556 -47.731 37.154  1.00 49.39  ? 194  VAL D N   1 
ATOM   10623 C CA  . VAL D 1 183 ? -12.931 -48.192 37.143  1.00 49.39  ? 194  VAL D CA  1 
ATOM   10624 C C   . VAL D 1 183 ? -13.914 -47.322 36.382  1.00 49.39  ? 194  VAL D C   1 
ATOM   10625 O O   . VAL D 1 183 ? -14.714 -47.828 35.614  1.00 49.39  ? 194  VAL D O   1 
ATOM   10626 C CB  . VAL D 1 183 ? -13.446 -48.388 38.576  1.00 39.02  ? 194  VAL D CB  1 
ATOM   10627 C CG1 . VAL D 1 183 ? -14.947 -48.630 38.554  1.00 39.02  ? 194  VAL D CG1 1 
ATOM   10628 C CG2 . VAL D 1 183 ? -12.714 -49.562 39.234  1.00 39.02  ? 194  VAL D CG2 1 
ATOM   10629 N N   . ASN D 1 184 ? -13.862 -46.016 36.593  1.00 53.23  ? 195  ASN D N   1 
ATOM   10630 C CA  . ASN D 1 184 ? -14.791 -45.130 35.910  1.00 53.23  ? 195  ASN D CA  1 
ATOM   10631 C C   . ASN D 1 184 ? -14.477 -45.035 34.412  1.00 53.23  ? 195  ASN D C   1 
ATOM   10632 O O   . ASN D 1 184 ? -15.382 -45.003 33.577  1.00 53.23  ? 195  ASN D O   1 
ATOM   10633 C CB  . ASN D 1 184 ? -14.758 -43.747 36.564  1.00 117.99 ? 195  ASN D CB  1 
ATOM   10634 C CG  . ASN D 1 184 ? -16.072 -43.005 36.422  1.00 117.99 ? 195  ASN D CG  1 
ATOM   10635 O OD1 . ASN D 1 184 ? -16.389 -42.467 35.357  1.00 117.99 ? 195  ASN D OD1 1 
ATOM   10636 N ND2 . ASN D 1 184 ? -16.854 -42.984 37.500  1.00 117.99 ? 195  ASN D ND2 1 
ATOM   10637 N N   . CYS D 1 185 ? -13.193 -44.997 34.069  1.00 66.40  ? 196  CYS D N   1 
ATOM   10638 C CA  . CYS D 1 185 ? -12.791 -44.928 32.668  1.00 66.40  ? 196  CYS D CA  1 
ATOM   10639 C C   . CYS D 1 185 ? -12.747 -46.313 32.041  1.00 66.40  ? 196  CYS D C   1 
ATOM   10640 O O   . CYS D 1 185 ? -12.079 -46.515 31.033  1.00 66.40  ? 196  CYS D O   1 
ATOM   10641 C CB  . CYS D 1 185 ? -11.424 -44.256 32.521  1.00 76.29  ? 196  CYS D CB  1 
ATOM   10642 S SG  . CYS D 1 185 ? -11.475 -42.451 32.557  1.00 76.29  ? 196  CYS D SG  1 
ATOM   10643 N N   . LEU D 1 186 ? -13.446 -47.269 32.652  1.00 102.06 ? 197  LEU D N   1 
ATOM   10644 C CA  . LEU D 1 186 ? -13.500 -48.624 32.118  1.00 102.06 ? 197  LEU D CA  1 
ATOM   10645 C C   . LEU D 1 186 ? -14.688 -48.656 31.175  1.00 102.06 ? 197  LEU D C   1 
ATOM   10646 O O   . LEU D 1 186 ? -14.586 -49.153 30.057  1.00 102.06 ? 197  LEU D O   1 
ATOM   10647 C CB  . LEU D 1 186 ? -13.692 -49.652 33.226  1.00 53.88  ? 197  LEU D CB  1 
ATOM   10648 C CG  . LEU D 1 186 ? -13.160 -51.030 32.842  1.00 53.88  ? 197  LEU D CG  1 
ATOM   10649 C CD1 . LEU D 1 186 ? -11.696 -50.962 32.452  1.00 53.88  ? 197  LEU D CD1 1 
ATOM   10650 C CD2 . LEU D 1 186 ? -13.325 -51.943 34.018  1.00 53.88  ? 197  LEU D CD2 1 
ATOM   10651 N N   . ASP D 1 187 ? -15.819 -48.126 31.629  1.00 75.25  ? 198  ASP D N   1 
ATOM   10652 C CA  . ASP D 1 187 ? -16.998 -48.062 30.776  1.00 75.25  ? 198  ASP D CA  1 
ATOM   10653 C C   . ASP D 1 187 ? -16.743 -46.906 29.812  1.00 75.25  ? 198  ASP D C   1 
ATOM   10654 O O   . ASP D 1 187 ? -17.488 -45.922 29.784  1.00 75.25  ? 198  ASP D O   1 
ATOM   10655 C CB  . ASP D 1 187 ? -18.260 -47.783 31.593  1.00 139.59 ? 198  ASP D CB  1 
ATOM   10656 C CG  . ASP D 1 187 ? -19.500 -47.674 30.721  1.00 139.59 ? 198  ASP D CG  1 
ATOM   10657 O OD1 . ASP D 1 187 ? -19.977 -48.716 30.212  1.00 139.59 ? 198  ASP D OD1 1 
ATOM   10658 O OD2 . ASP D 1 187 ? -19.988 -46.538 30.534  1.00 139.59 ? 198  ASP D OD2 1 
ATOM   10659 N N   . LEU D 1 188 ? -15.671 -47.043 29.036  1.00 56.55  ? 199  LEU D N   1 
ATOM   10660 C CA  . LEU D 1 188 ? -15.252 -46.036 28.071  1.00 56.55  ? 199  LEU D CA  1 
ATOM   10661 C C   . LEU D 1 188 ? -14.480 -46.747 26.963  1.00 56.55  ? 199  LEU D C   1 
ATOM   10662 O O   . LEU D 1 188 ? -13.834 -46.119 26.113  1.00 56.55  ? 199  LEU D O   1 
ATOM   10663 C CB  . LEU D 1 188 ? -14.363 -44.995 28.760  1.00 59.27  ? 199  LEU D CB  1 
ATOM   10664 C CG  . LEU D 1 188 ? -13.993 -43.737 27.979  1.00 59.27  ? 199  LEU D CG  1 
ATOM   10665 C CD1 . LEU D 1 188 ? -15.261 -43.081 27.483  1.00 59.27  ? 199  LEU D CD1 1 
ATOM   10666 C CD2 . LEU D 1 188 ? -13.216 -42.768 28.857  1.00 59.27  ? 199  LEU D CD2 1 
ATOM   10667 N N   . VAL D 1 189 ? -14.543 -48.074 27.016  1.00 49.29  ? 200  VAL D N   1 
ATOM   10668 C CA  . VAL D 1 189 ? -13.915 -48.969 26.045  1.00 49.29  ? 200  VAL D CA  1 
ATOM   10669 C C   . VAL D 1 189 ? -14.456 -50.342 26.352  1.00 49.29  ? 200  VAL D C   1 
ATOM   10670 O O   . VAL D 1 189 ? -13.752 -51.337 26.238  1.00 49.29  ? 200  VAL D O   1 
ATOM   10671 C CB  . VAL D 1 189 ? -12.356 -49.035 26.132  1.00 37.34  ? 200  VAL D CB  1 
ATOM   10672 C CG1 . VAL D 1 189 ? -11.752 -47.741 25.656  1.00 37.34  ? 200  VAL D CG1 1 
ATOM   10673 C CG2 . VAL D 1 189 ? -11.915 -49.331 27.527  1.00 37.34  ? 200  VAL D CG2 1 
ATOM   10674 N N   . ASN D 1 190 ? -15.714 -50.376 26.774  1.00 107.60 ? 201  ASN D N   1 
ATOM   10675 C CA  . ASN D 1 190 ? -16.387 -51.622 27.089  1.00 107.60 ? 201  ASN D CA  1 
ATOM   10676 C C   . ASN D 1 190 ? -15.448 -52.662 27.699  1.00 107.60 ? 201  ASN D C   1 
ATOM   10677 O O   . ASN D 1 190 ? -15.233 -53.737 27.135  1.00 107.60 ? 201  ASN D O   1 
ATOM   10678 C CB  . ASN D 1 190 ? -17.033 -52.172 25.819  1.00 150.83 ? 201  ASN D CB  1 
ATOM   10679 C CG  . ASN D 1 190 ? -17.859 -51.127 25.096  1.00 150.83 ? 201  ASN D CG  1 
ATOM   10680 O OD1 . ASN D 1 190 ? -18.846 -50.623 25.631  1.00 150.83 ? 201  ASN D OD1 1 
ATOM   10681 N ND2 . ASN D 1 190 ? -17.454 -50.787 23.878  1.00 150.83 ? 201  ASN D ND2 1 
ATOM   10682 N N   . LYS D 1 191 ? -14.887 -52.323 28.852  1.00 56.03  ? 202  LYS D N   1 
ATOM   10683 C CA  . LYS D 1 191 ? -13.980 -53.203 29.584  1.00 56.03  ? 202  LYS D CA  1 
ATOM   10684 C C   . LYS D 1 191 ? -12.833 -53.813 28.761  1.00 56.03  ? 202  LYS D C   1 
ATOM   10685 O O   . LYS D 1 191 ? -12.273 -54.842 29.134  1.00 56.03  ? 202  LYS D O   1 
ATOM   10686 C CB  . LYS D 1 191 ? -14.787 -54.317 30.266  1.00 88.71  ? 202  LYS D CB  1 
ATOM   10687 C CG  . LYS D 1 191 ? -15.744 -53.836 31.349  1.00 88.71  ? 202  LYS D CG  1 
ATOM   10688 C CD  . LYS D 1 191 ? -16.862 -52.965 30.782  1.00 88.71  ? 202  LYS D CD  1 
ATOM   10689 C CE  . LYS D 1 191 ? -17.771 -52.419 31.888  1.00 88.71  ? 202  LYS D CE  1 
ATOM   10690 N NZ  . LYS D 1 191 ? -18.913 -51.586 31.376  1.00 88.71  ? 202  LYS D NZ  1 
ATOM   10691 N N   . ARG D 1 192 ? -12.453 -53.178 27.661  1.00 42.30  ? 203  ARG D N   1 
ATOM   10692 C CA  . ARG D 1 192 ? -11.372 -53.736 26.855  1.00 42.30  ? 203  ARG D CA  1 
ATOM   10693 C C   . ARG D 1 192 ? -9.954  -53.300 27.224  1.00 42.30  ? 203  ARG D C   1 
ATOM   10694 O O   . ARG D 1 192 ? -9.608  -52.112 27.164  1.00 42.30  ? 203  ARG D O   1 
ATOM   10695 C CB  . ARG D 1 192 ? -11.592 -53.449 25.363  1.00 114.94 ? 203  ARG D CB  1 
ATOM   10696 C CG  . ARG D 1 192 ? -12.709 -54.247 24.694  1.00 114.94 ? 203  ARG D CG  1 
ATOM   10697 C CD  . ARG D 1 192 ? -12.523 -54.234 23.183  1.00 114.94 ? 203  ARG D CD  1 
ATOM   10698 N NE  . ARG D 1 192 ? -12.240 -52.889 22.686  1.00 114.94 ? 203  ARG D NE  1 
ATOM   10699 C CZ  . ARG D 1 192 ? -13.120 -51.891 22.664  1.00 114.94 ? 203  ARG D CZ  1 
ATOM   10700 N NH1 . ARG D 1 192 ? -12.764 -50.702 22.198  1.00 114.94 ? 203  ARG D NH1 1 
ATOM   10701 N NH2 . ARG D 1 192 ? -14.360 -52.081 23.096  1.00 114.94 ? 203  ARG D NH2 1 
ATOM   10702 N N   . LEU D 1 193 ? -9.128  -54.271 27.596  1.00 49.88  ? 204  LEU D N   1 
ATOM   10703 C CA  . LEU D 1 193 ? -7.746  -53.979 27.936  1.00 49.88  ? 204  LEU D CA  1 
ATOM   10704 C C   . LEU D 1 193 ? -6.961  -54.358 26.690  1.00 49.88  ? 204  LEU D C   1 
ATOM   10705 O O   . LEU D 1 193 ? -7.421  -55.171 25.888  1.00 49.88  ? 204  LEU D O   1 
ATOM   10706 C CB  . LEU D 1 193 ? -7.278  -54.843 29.105  1.00 78.53  ? 204  LEU D CB  1 
ATOM   10707 C CG  . LEU D 1 193 ? -8.249  -55.222 30.228  1.00 78.53  ? 204  LEU D CG  1 
ATOM   10708 C CD1 . LEU D 1 193 ? -7.536  -56.211 31.134  1.00 78.53  ? 204  LEU D CD1 1 
ATOM   10709 C CD2 . LEU D 1 193 ? -8.708  -54.010 31.019  1.00 78.53  ? 204  LEU D CD2 1 
ATOM   10710 N N   . PRO D 1 194 ? -5.790  -53.752 26.486  1.00 77.10  ? 205  PRO D N   1 
ATOM   10711 C CA  . PRO D 1 194 ? -5.201  -52.748 27.366  1.00 77.10  ? 205  PRO D CA  1 
ATOM   10712 C C   . PRO D 1 194 ? -5.572  -51.327 26.902  1.00 77.10  ? 205  PRO D C   1 
ATOM   10713 O O   . PRO D 1 194 ? -5.783  -51.089 25.713  1.00 77.10  ? 205  PRO D O   1 
ATOM   10714 C CB  . PRO D 1 194 ? -3.713  -53.029 27.225  1.00 63.67  ? 205  PRO D CB  1 
ATOM   10715 C CG  . PRO D 1 194 ? -3.604  -53.310 25.755  1.00 63.67  ? 205  PRO D CG  1 
ATOM   10716 C CD  . PRO D 1 194 ? -4.807  -54.213 25.488  1.00 63.67  ? 205  PRO D CD  1 
ATOM   10717 N N   . TYR D 1 195 ? -5.654  -50.396 27.847  1.00 28.14  ? 206  TYR D N   1 
ATOM   10718 C CA  . TYR D 1 195 ? -5.964  -49.006 27.561  1.00 28.14  ? 206  TYR D CA  1 
ATOM   10719 C C   . TYR D 1 195 ? -5.260  -48.208 28.632  1.00 28.14  ? 206  TYR D C   1 
ATOM   10720 O O   . TYR D 1 195 ? -5.225  -48.637 29.770  1.00 28.14  ? 206  TYR D O   1 
ATOM   10721 C CB  . TYR D 1 195 ? -7.464  -48.784 27.644  1.00 42.67  ? 206  TYR D CB  1 
ATOM   10722 C CG  . TYR D 1 195 ? -7.981  -48.479 29.025  1.00 42.67  ? 206  TYR D CG  1 
ATOM   10723 C CD1 . TYR D 1 195 ? -8.118  -47.159 29.462  1.00 42.67  ? 206  TYR D CD1 1 
ATOM   10724 C CD2 . TYR D 1 195 ? -8.382  -49.503 29.872  1.00 42.67  ? 206  TYR D CD2 1 
ATOM   10725 C CE1 . TYR D 1 195 ? -8.647  -46.874 30.699  1.00 42.67  ? 206  TYR D CE1 1 
ATOM   10726 C CE2 . TYR D 1 195 ? -8.909  -49.234 31.103  1.00 42.67  ? 206  TYR D CE2 1 
ATOM   10727 C CZ  . TYR D 1 195 ? -9.046  -47.924 31.517  1.00 42.67  ? 206  TYR D CZ  1 
ATOM   10728 O OH  . TYR D 1 195 ? -9.610  -47.685 32.751  1.00 42.67  ? 206  TYR D OH  1 
ATOM   10729 N N   . GLY D 1 196 ? -4.707  -47.051 28.295  1.00 61.38  ? 207  GLY D N   1 
ATOM   10730 C CA  . GLY D 1 196 ? -4.002  -46.284 29.310  1.00 61.38  ? 207  GLY D CA  1 
ATOM   10731 C C   . GLY D 1 196 ? -4.589  -44.958 29.760  1.00 61.38  ? 207  GLY D C   1 
ATOM   10732 O O   . GLY D 1 196 ? -5.580  -44.475 29.216  1.00 61.38  ? 207  GLY D O   1 
ATOM   10733 N N   . LEU D 1 197 ? -3.978  -44.380 30.786  1.00 58.44  ? 208  LEU D N   1 
ATOM   10734 C CA  . LEU D 1 197 ? -4.411  -43.091 31.299  1.00 58.44  ? 208  LEU D CA  1 
ATOM   10735 C C   . LEU D 1 197 ? -3.169  -42.205 31.366  1.00 58.44  ? 208  LEU D C   1 
ATOM   10736 O O   . LEU D 1 197 ? -2.340  -42.351 32.259  1.00 58.44  ? 208  LEU D O   1 
ATOM   10737 C CB  . LEU D 1 197 ? -5.039  -43.228 32.693  1.00 24.81  ? 208  LEU D CB  1 
ATOM   10738 C CG  . LEU D 1 197 ? -6.314  -44.058 32.895  1.00 24.81  ? 208  LEU D CG  1 
ATOM   10739 C CD1 . LEU D 1 197 ? -6.908  -43.704 34.242  1.00 24.81  ? 208  LEU D CD1 1 
ATOM   10740 C CD2 . LEU D 1 197 ? -7.331  -43.792 31.782  1.00 24.81  ? 208  LEU D CD2 1 
ATOM   10741 N N   . ALA D 1 198 ? -3.025  -41.287 30.419  1.00 26.38  ? 209  ALA D N   1 
ATOM   10742 C CA  . ALA D 1 198 ? -1.847  -40.434 30.415  1.00 26.38  ? 209  ALA D CA  1 
ATOM   10743 C C   . ALA D 1 198 ? -2.064  -39.190 31.235  1.00 26.38  ? 209  ALA D C   1 
ATOM   10744 O O   . ALA D 1 198 ? -3.200  -38.803 31.510  1.00 26.38  ? 209  ALA D O   1 
ATOM   10745 C CB  . ALA D 1 198 ? -1.460  -40.061 28.991  1.00 40.66  ? 209  ALA D CB  1 
ATOM   10746 N N   . GLN D 1 199 ? -0.953  -38.560 31.605  1.00 34.05  ? 210  GLN D N   1 
ATOM   10747 C CA  . GLN D 1 199 ? -0.980  -37.347 32.408  1.00 34.05  ? 210  GLN D CA  1 
ATOM   10748 C C   . GLN D 1 199 ? 0.425   -36.744 32.477  1.00 34.05  ? 210  GLN D C   1 
ATOM   10749 O O   . GLN D 1 199 ? 1.415   -37.473 32.519  1.00 34.05  ? 210  GLN D O   1 
ATOM   10750 C CB  . GLN D 1 199 ? -1.478  -37.704 33.800  1.00 58.17  ? 210  GLN D CB  1 
ATOM   10751 C CG  . GLN D 1 199 ? -1.714  -36.549 34.714  1.00 58.17  ? 210  GLN D CG  1 
ATOM   10752 C CD  . GLN D 1 199 ? -2.458  -36.972 35.958  1.00 58.17  ? 210  GLN D CD  1 
ATOM   10753 O OE1 . GLN D 1 199 ? -2.970  -36.130 36.697  1.00 58.17  ? 210  GLN D OE1 1 
ATOM   10754 N NE2 . GLN D 1 199 ? -2.523  -38.286 36.200  1.00 58.17  ? 210  GLN D NE2 1 
ATOM   10755 N N   . ILE D 1 200 ? 0.506   -35.415 32.438  1.00 45.77  ? 211  ILE D N   1 
ATOM   10756 C CA  . ILE D 1 200 ? 1.781   -34.687 32.544  1.00 45.77  ? 211  ILE D CA  1 
ATOM   10757 C C   . ILE D 1 200 ? 1.569   -33.630 33.614  1.00 45.77  ? 211  ILE D C   1 
ATOM   10758 O O   . ILE D 1 200 ? 0.789   -32.710 33.418  1.00 45.77  ? 211  ILE D O   1 
ATOM   10759 C CB  . ILE D 1 200 ? 2.185   -33.971 31.231  1.00 37.29  ? 211  ILE D CB  1 
ATOM   10760 C CG1 . ILE D 1 200 ? 2.673   -34.999 30.203  1.00 37.29  ? 211  ILE D CG1 1 
ATOM   10761 C CG2 . ILE D 1 200 ? 3.262   -32.914 31.520  1.00 37.29  ? 211  ILE D CG2 1 
ATOM   10762 C CD1 . ILE D 1 200 ? 3.579   -34.407 29.121  1.00 37.29  ? 211  ILE D CD1 1 
ATOM   10763 N N   . GLY D 1 201 ? 2.247   -33.759 34.747  1.00 59.09  ? 212  GLY D N   1 
ATOM   10764 C CA  . GLY D 1 201 ? 2.041   -32.796 35.810  1.00 59.09  ? 212  GLY D CA  1 
ATOM   10765 C C   . GLY D 1 201 ? 3.097   -32.730 36.886  1.00 59.09  ? 212  GLY D C   1 
ATOM   10766 O O   . GLY D 1 201 ? 4.085   -33.463 36.866  1.00 59.09  ? 212  GLY D O   1 
ATOM   10767 N N   . VAL D 1 202 ? 2.864   -31.855 37.853  1.00 37.53  ? 213  VAL D N   1 
ATOM   10768 C CA  . VAL D 1 202 ? 3.816   -31.633 38.930  1.00 37.53  ? 213  VAL D CA  1 
ATOM   10769 C C   . VAL D 1 202 ? 3.568   -32.430 40.189  1.00 37.53  ? 213  VAL D C   1 
ATOM   10770 O O   . VAL D 1 202 ? 2.434   -32.549 40.652  1.00 37.53  ? 213  VAL D O   1 
ATOM   10771 C CB  . VAL D 1 202 ? 3.851   -30.139 39.318  1.00 28.50  ? 213  VAL D CB  1 
ATOM   10772 C CG1 . VAL D 1 202 ? 4.897   -29.884 40.360  1.00 28.50  ? 213  VAL D CG1 1 
ATOM   10773 C CG2 . VAL D 1 202 ? 4.118   -29.298 38.094  1.00 28.50  ? 213  VAL D CG2 1 
ATOM   10774 N N   . CYS D 1 203 ? 4.652   -32.958 40.744  1.00 37.89  ? 214  CYS D N   1 
ATOM   10775 C CA  . CYS D 1 203 ? 4.602   -33.714 41.983  1.00 37.89  ? 214  CYS D CA  1 
ATOM   10776 C C   . CYS D 1 203 ? 5.582   -33.055 42.946  1.00 37.89  ? 214  CYS D C   1 
ATOM   10777 O O   . CYS D 1 203 ? 6.616   -32.539 42.524  1.00 37.89  ? 214  CYS D O   1 
ATOM   10778 C CB  . CYS D 1 203 ? 5.009   -35.151 41.719  1.00 79.54  ? 214  CYS D CB  1 
ATOM   10779 S SG  . CYS D 1 203 ? 4.097   -35.851 40.371  1.00 79.54  ? 214  CYS D SG  1 
ATOM   10780 N N   . PHE D 1 204 ? 5.267   -33.065 44.234  1.00 49.52  ? 215  PHE D N   1 
ATOM   10781 C CA  . PHE D 1 204 ? 6.158   -32.451 45.204  1.00 49.52  ? 215  PHE D CA  1 
ATOM   10782 C C   . PHE D 1 204 ? 6.842   -33.472 46.104  1.00 49.52  ? 215  PHE D C   1 
ATOM   10783 O O   . PHE D 1 204 ? 6.175   -34.139 46.883  1.00 49.52  ? 215  PHE D O   1 
ATOM   10784 C CB  . PHE D 1 204 ? 5.382   -31.479 46.067  1.00 52.74  ? 215  PHE D CB  1 
ATOM   10785 C CG  . PHE D 1 204 ? 4.382   -30.682 45.315  1.00 52.74  ? 215  PHE D CG  1 
ATOM   10786 C CD1 . PHE D 1 204 ? 3.160   -31.234 44.968  1.00 52.74  ? 215  PHE D CD1 1 
ATOM   10787 C CD2 . PHE D 1 204 ? 4.646   -29.369 44.972  1.00 52.74  ? 215  PHE D CD2 1 
ATOM   10788 C CE1 . PHE D 1 204 ? 2.205   -30.482 44.292  1.00 52.74  ? 215  PHE D CE1 1 
ATOM   10789 C CE2 . PHE D 1 204 ? 3.710   -28.609 44.300  1.00 52.74  ? 215  PHE D CE2 1 
ATOM   10790 C CZ  . PHE D 1 204 ? 2.482   -29.165 43.959  1.00 52.74  ? 215  PHE D CZ  1 
ATOM   10791 N N   . HIS D 1 205 ? 8.165   -33.579 46.008  1.00 42.30  ? 216  HIS D N   1 
ATOM   10792 C CA  . HIS D 1 205 ? 8.936   -34.514 46.822  1.00 42.30  ? 216  HIS D CA  1 
ATOM   10793 C C   . HIS D 1 205 ? 9.857   -33.719 47.735  1.00 42.30  ? 216  HIS D C   1 
ATOM   10794 O O   . HIS D 1 205 ? 10.355  -32.667 47.347  1.00 42.30  ? 216  HIS D O   1 
ATOM   10795 C CB  . HIS D 1 205 ? 9.801   -35.398 45.939  1.00 93.00  ? 216  HIS D CB  1 
ATOM   10796 C CG  . HIS D 1 205 ? 9.098   -35.916 44.727  1.00 93.00  ? 216  HIS D CG  1 
ATOM   10797 N ND1 . HIS D 1 205 ? 8.528   -35.085 43.789  1.00 93.00  ? 216  HIS D ND1 1 
ATOM   10798 C CD2 . HIS D 1 205 ? 8.886   -37.180 44.292  1.00 93.00  ? 216  HIS D CD2 1 
ATOM   10799 C CE1 . HIS D 1 205 ? 7.994   -35.816 42.827  1.00 93.00  ? 216  HIS D CE1 1 
ATOM   10800 N NE2 . HIS D 1 205 ? 8.197   -37.090 43.108  1.00 93.00  ? 216  HIS D NE2 1 
ATOM   10801 N N   . PRO D 1 206 ? 10.112  -34.215 48.959  1.00 56.99  ? 217  PRO D N   1 
ATOM   10802 C CA  . PRO D 1 206 ? 10.989  -33.528 49.915  1.00 56.99  ? 217  PRO D CA  1 
ATOM   10803 C C   . PRO D 1 206 ? 12.483  -33.698 49.600  1.00 56.99  ? 217  PRO D C   1 
ATOM   10804 O O   . PRO D 1 206 ? 12.905  -34.733 49.071  1.00 56.99  ? 217  PRO D O   1 
ATOM   10805 C CB  . PRO D 1 206 ? 10.597  -34.162 51.243  1.00 66.59  ? 217  PRO D CB  1 
ATOM   10806 C CG  . PRO D 1 206 ? 10.329  -35.561 50.847  1.00 66.59  ? 217  PRO D CG  1 
ATOM   10807 C CD  . PRO D 1 206 ? 9.508   -35.407 49.578  1.00 66.59  ? 217  PRO D CD  1 
ATOM   10808 N N   . VAL D 1 207 ? 13.267  -32.674 49.940  1.00 70.42  ? 218  VAL D N   1 
ATOM   10809 C CA  . VAL D 1 207 ? 14.705  -32.668 49.708  1.00 70.42  ? 218  VAL D CA  1 
ATOM   10810 C C   . VAL D 1 207 ? 15.495  -33.007 50.974  1.00 70.42  ? 218  VAL D C   1 
ATOM   10811 O O   . VAL D 1 207 ? 16.395  -33.862 50.960  1.00 70.42  ? 218  VAL D O   1 
ATOM   10812 C CB  . VAL D 1 207 ? 15.165  -31.299 49.202  1.00 81.87  ? 218  VAL D CB  1 
ATOM   10813 C CG1 . VAL D 1 207 ? 16.643  -31.340 48.861  1.00 81.87  ? 218  VAL D CG1 1 
ATOM   10814 C CG2 . VAL D 1 207 ? 14.359  -30.906 47.984  1.00 81.87  ? 218  VAL D CG2 1 
ATOM   10815 N N   . LYS D 1 218 ? 12.962  -29.048 56.479  1.00 83.98  ? 229  LYS D N   1 
ATOM   10816 C CA  . LYS D 1 218 ? 13.237  -29.670 55.188  1.00 83.98  ? 229  LYS D CA  1 
ATOM   10817 C C   . LYS D 1 218 ? 12.689  -28.793 54.049  1.00 83.98  ? 229  LYS D C   1 
ATOM   10818 O O   . LYS D 1 218 ? 11.780  -27.984 54.260  1.00 83.98  ? 229  LYS D O   1 
ATOM   10819 C CB  . LYS D 1 218 ? 12.609  -31.078 55.124  1.00 87.48  ? 229  LYS D CB  1 
ATOM   10820 C CG  . LYS D 1 218 ? 13.088  -32.053 56.214  1.00 87.48  ? 229  LYS D CG  1 
ATOM   10821 C CD  . LYS D 1 218 ? 12.740  -33.522 55.897  1.00 87.48  ? 229  LYS D CD  1 
ATOM   10822 C CE  . LYS D 1 218 ? 13.580  -34.073 54.726  1.00 87.48  ? 229  LYS D CE  1 
ATOM   10823 N NZ  . LYS D 1 218 ? 13.276  -35.485 54.330  1.00 87.48  ? 229  LYS D NZ  1 
ATOM   10824 N N   . SER D 1 219 ? 13.242  -28.956 52.845  1.00 146.34 ? 230  SER D N   1 
ATOM   10825 C CA  . SER D 1 219 ? 12.804  -28.171 51.689  1.00 146.34 ? 230  SER D CA  1 
ATOM   10826 C C   . SER D 1 219 ? 12.007  -28.956 50.644  1.00 146.34 ? 230  SER D C   1 
ATOM   10827 O O   . SER D 1 219 ? 12.368  -30.071 50.267  1.00 146.34 ? 230  SER D O   1 
ATOM   10828 C CB  . SER D 1 219 ? 14.007  -27.508 51.009  1.00 95.13  ? 230  SER D CB  1 
ATOM   10829 O OG  . SER D 1 219 ? 14.561  -26.484 51.817  1.00 95.13  ? 230  SER D OG  1 
ATOM   10830 N N   . ILE D 1 220 ? 10.921  -28.340 50.186  1.00 86.35  ? 231  ILE D N   1 
ATOM   10831 C CA  . ILE D 1 220 ? 10.023  -28.895 49.180  1.00 86.35  ? 231  ILE D CA  1 
ATOM   10832 C C   . ILE D 1 220 ? 10.782  -29.101 47.873  1.00 86.35  ? 231  ILE D C   1 
ATOM   10833 O O   . ILE D 1 220 ? 11.920  -28.654 47.736  1.00 86.35  ? 231  ILE D O   1 
ATOM   10834 C CB  . ILE D 1 220 ? 8.814   -27.923 48.953  1.00 45.11  ? 231  ILE D CB  1 
ATOM   10835 C CG1 . ILE D 1 220 ? 7.817   -28.072 50.103  1.00 45.11  ? 231  ILE D CG1 1 
ATOM   10836 C CG2 . ILE D 1 220 ? 8.138   -28.181 47.621  1.00 45.11  ? 231  ILE D CG2 1 
ATOM   10837 C CD1 . ILE D 1 220 ? 6.575   -27.256 49.964  1.00 45.11  ? 231  ILE D CD1 1 
ATOM   10838 N N   . GLY D 1 221 ? 10.156  -29.781 46.916  1.00 48.21  ? 232  GLY D N   1 
ATOM   10839 C CA  . GLY D 1 221 ? 10.801  -30.019 45.638  1.00 48.21  ? 232  GLY D CA  1 
ATOM   10840 C C   . GLY D 1 221 ? 9.823   -30.327 44.523  1.00 48.21  ? 232  GLY D C   1 
ATOM   10841 O O   . GLY D 1 221 ? 9.241   -31.403 44.471  1.00 48.21  ? 232  GLY D O   1 
ATOM   10842 N N   . GLU D 1 222 ? 9.645   -29.374 43.621  1.00 33.20  ? 233  GLU D N   1 
ATOM   10843 C CA  . GLU D 1 222 ? 8.734   -29.544 42.515  1.00 33.20  ? 233  GLU D CA  1 
ATOM   10844 C C   . GLU D 1 222 ? 9.412   -30.093 41.268  1.00 33.20  ? 233  GLU D C   1 
ATOM   10845 O O   . GLU D 1 222 ? 10.473  -29.630 40.862  1.00 33.20  ? 233  GLU D O   1 
ATOM   10846 C CB  . GLU D 1 222 ? 8.057   -28.213 42.202  1.00 58.92  ? 233  GLU D CB  1 
ATOM   10847 C CG  . GLU D 1 222 ? 6.973   -27.844 43.198  1.00 58.92  ? 233  GLU D CG  1 
ATOM   10848 C CD  . GLU D 1 222 ? 6.337   -26.497 42.910  1.00 58.92  ? 233  GLU D CD  1 
ATOM   10849 O OE1 . GLU D 1 222 ? 6.235   -26.132 41.719  1.00 58.92  ? 233  GLU D OE1 1 
ATOM   10850 O OE2 . GLU D 1 222 ? 5.924   -25.809 43.867  1.00 58.92  ? 233  GLU D OE2 1 
ATOM   10851 N N   . LYS D 1 223 ? 8.792   -31.111 40.679  1.00 58.50  ? 234  LYS D N   1 
ATOM   10852 C CA  . LYS D 1 223 ? 9.271   -31.730 39.451  1.00 58.50  ? 234  LYS D CA  1 
ATOM   10853 C C   . LYS D 1 223 ? 8.034   -31.973 38.601  1.00 58.50  ? 234  LYS D C   1 
ATOM   10854 O O   . LYS D 1 223 ? 6.981   -32.350 39.116  1.00 58.50  ? 234  LYS D O   1 
ATOM   10855 C CB  . LYS D 1 223 ? 9.979   -33.061 39.733  1.00 107.70 ? 234  LYS D CB  1 
ATOM   10856 C CG  . LYS D 1 223 ? 11.197  -32.950 40.646  1.00 107.70 ? 234  LYS D CG  1 
ATOM   10857 C CD  . LYS D 1 223 ? 12.435  -33.659 40.070  1.00 107.70 ? 234  LYS D CD  1 
ATOM   10858 C CE  . LYS D 1 223 ? 13.078  -32.859 38.925  1.00 107.70 ? 234  LYS D CE  1 
ATOM   10859 N NZ  . LYS D 1 223 ? 14.285  -33.519 38.336  1.00 107.70 ? 234  LYS D NZ  1 
ATOM   10860 N N   . THR D 1 224 ? 8.153   -31.724 37.305  1.00 39.31  ? 235  THR D N   1 
ATOM   10861 C CA  . THR D 1 224 ? 7.040   -31.934 36.381  1.00 39.31  ? 235  THR D CA  1 
ATOM   10862 C C   . THR D 1 224 ? 7.162   -33.338 35.824  1.00 39.31  ? 235  THR D C   1 
ATOM   10863 O O   . THR D 1 224 ? 8.088   -33.655 35.068  1.00 39.31  ? 235  THR D O   1 
ATOM   10864 C CB  . THR D 1 224 ? 7.078   -30.945 35.203  1.00 56.73  ? 235  THR D CB  1 
ATOM   10865 O OG1 . THR D 1 224 ? 6.931   -29.607 35.686  1.00 56.73  ? 235  THR D OG1 1 
ATOM   10866 C CG2 . THR D 1 224 ? 5.965   -31.241 34.239  1.00 56.73  ? 235  THR D CG2 1 
ATOM   10867 N N   . GLU D 1 225 ? 6.231   -34.190 36.201  1.00 36.56  ? 236  GLU D N   1 
ATOM   10868 C CA  . GLU D 1 225 ? 6.295   -35.538 35.714  1.00 36.56  ? 236  GLU D CA  1 
ATOM   10869 C C   . GLU D 1 225 ? 5.233   -35.896 34.675  1.00 36.56  ? 236  GLU D C   1 
ATOM   10870 O O   . GLU D 1 225 ? 4.087   -35.454 34.762  1.00 36.56  ? 236  GLU D O   1 
ATOM   10871 C CB  . GLU D 1 225 ? 6.257   -36.491 36.905  1.00 88.00  ? 236  GLU D CB  1 
ATOM   10872 C CG  . GLU D 1 225 ? 7.507   -36.356 37.755  1.00 88.00  ? 236  GLU D CG  1 
ATOM   10873 C CD  . GLU D 1 225 ? 7.436   -37.106 39.063  1.00 88.00  ? 236  GLU D CD  1 
ATOM   10874 O OE1 . GLU D 1 225 ? 8.459   -37.110 39.779  1.00 88.00  ? 236  GLU D OE1 1 
ATOM   10875 O OE2 . GLU D 1 225 ? 6.371   -37.684 39.380  1.00 88.00  ? 236  GLU D OE2 1 
ATOM   10876 N N   . ALA D 1 226 ? 5.648   -36.670 33.672  1.00 65.91  ? 237  ALA D N   1 
ATOM   10877 C CA  . ALA D 1 226 ? 4.762   -37.152 32.616  1.00 65.91  ? 237  ALA D CA  1 
ATOM   10878 C C   . ALA D 1 226 ? 4.620   -38.631 32.902  1.00 65.91  ? 237  ALA D C   1 
ATOM   10879 O O   . ALA D 1 226 ? 5.625   -39.329 33.056  1.00 65.91  ? 237  ALA D O   1 
ATOM   10880 C CB  . ALA D 1 226 ? 5.391   -36.964 31.274  1.00 21.17  ? 237  ALA D CB  1 
ATOM   10881 N N   . SER D 1 227 ? 3.390   -39.119 32.981  1.00 50.49  ? 238  SER D N   1 
ATOM   10882 C CA  . SER D 1 227 ? 3.204   -40.527 33.277  1.00 50.49  ? 238  SER D CA  1 
ATOM   10883 C C   . SER D 1 227 ? 2.158   -41.242 32.463  1.00 50.49  ? 238  SER D C   1 
ATOM   10884 O O   . SER D 1 227 ? 1.129   -40.681 32.093  1.00 50.49  ? 238  SER D O   1 
ATOM   10885 C CB  . SER D 1 227 ? 2.826   -40.725 34.737  1.00 39.50  ? 238  SER D CB  1 
ATOM   10886 O OG  . SER D 1 227 ? 1.431   -40.972 34.847  1.00 39.50  ? 238  SER D OG  1 
ATOM   10887 N N   . LEU D 1 228 ? 2.436   -42.509 32.207  1.00 33.83  ? 239  LEU D N   1 
ATOM   10888 C CA  . LEU D 1 228 ? 1.511   -43.370 31.504  1.00 33.83  ? 239  LEU D CA  1 
ATOM   10889 C C   . LEU D 1 228 ? 1.253   -44.573 32.409  1.00 33.83  ? 239  LEU D C   1 
ATOM   10890 O O   . LEU D 1 228 ? 2.183   -45.227 32.884  1.00 33.83  ? 239  LEU D O   1 
ATOM   10891 C CB  . LEU D 1 228 ? 2.099   -43.819 30.155  1.00 29.52  ? 239  LEU D CB  1 
ATOM   10892 C CG  . LEU D 1 228 ? 1.449   -45.008 29.432  1.00 29.52  ? 239  LEU D CG  1 
ATOM   10893 C CD1 . LEU D 1 228 ? -0.061  -44.811 29.262  1.00 29.52  ? 239  LEU D CD1 1 
ATOM   10894 C CD2 . LEU D 1 228 ? 2.127   -45.169 28.104  1.00 29.52  ? 239  LEU D CD2 1 
ATOM   10895 N N   . VAL D 1 229 ? -0.021  -44.823 32.665  1.00 42.26  ? 240  VAL D N   1 
ATOM   10896 C CA  . VAL D 1 229 ? -0.447  -45.941 33.476  1.00 42.26  ? 240  VAL D CA  1 
ATOM   10897 C C   . VAL D 1 229 ? -1.199  -46.872 32.530  1.00 42.26  ? 240  VAL D C   1 
ATOM   10898 O O   . VAL D 1 229 ? -2.374  -46.649 32.233  1.00 42.26  ? 240  VAL D O   1 
ATOM   10899 C CB  . VAL D 1 229 ? -1.371  -45.472 34.581  1.00 43.73  ? 240  VAL D CB  1 
ATOM   10900 C CG1 . VAL D 1 229 ? -2.041  -46.647 35.210  1.00 43.73  ? 240  VAL D CG1 1 
ATOM   10901 C CG2 . VAL D 1 229 ? -0.584  -44.706 35.614  1.00 43.73  ? 240  VAL D CG2 1 
ATOM   10902 N N   . TRP D 1 230 ? -0.494  -47.901 32.063  1.00 61.80  ? 241  TRP D N   1 
ATOM   10903 C CA  . TRP D 1 230 ? -0.974  -48.910 31.112  1.00 61.80  ? 241  TRP D CA  1 
ATOM   10904 C C   . TRP D 1 230 ? -1.614  -50.113 31.815  1.00 61.80  ? 241  TRP D C   1 
ATOM   10905 O O   . TRP D 1 230 ? -0.920  -50.894 32.459  1.00 61.80  ? 241  TRP D O   1 
ATOM   10906 C CB  . TRP D 1 230 ? 0.235   -49.387 30.310  1.00 75.54  ? 241  TRP D CB  1 
ATOM   10907 C CG  . TRP D 1 230 ? -0.005  -50.012 28.970  1.00 75.54  ? 241  TRP D CG  1 
ATOM   10908 C CD1 . TRP D 1 230 ? 0.725   -51.019 28.415  1.00 75.54  ? 241  TRP D CD1 1 
ATOM   10909 C CD2 . TRP D 1 230 ? -0.929  -49.587 27.957  1.00 75.54  ? 241  TRP D CD2 1 
ATOM   10910 N NE1 . TRP D 1 230 ? 0.327   -51.244 27.125  1.00 75.54  ? 241  TRP D NE1 1 
ATOM   10911 C CE2 . TRP D 1 230 ? -0.688  -50.380 26.815  1.00 75.54  ? 241  TRP D CE2 1 
ATOM   10912 C CE3 . TRP D 1 230 ? -1.933  -48.610 27.900  1.00 75.54  ? 241  TRP D CE3 1 
ATOM   10913 C CZ2 . TRP D 1 230 ? -1.412  -50.231 25.630  1.00 75.54  ? 241  TRP D CZ2 1 
ATOM   10914 C CZ3 . TRP D 1 230 ? -2.652  -48.461 26.719  1.00 75.54  ? 241  TRP D CZ3 1 
ATOM   10915 C CH2 . TRP D 1 230 ? -2.385  -49.269 25.601  1.00 75.54  ? 241  TRP D CH2 1 
ATOM   10916 N N   . PHE D 1 231 ? -2.926  -50.273 31.702  1.00 54.26  ? 242  PHE D N   1 
ATOM   10917 C CA  . PHE D 1 231 ? -3.603  -51.409 32.331  1.00 54.26  ? 242  PHE D CA  1 
ATOM   10918 C C   . PHE D 1 231 ? -3.603  -52.500 31.292  1.00 54.26  ? 242  PHE D C   1 
ATOM   10919 O O   . PHE D 1 231 ? -3.886  -52.231 30.131  1.00 54.26  ? 242  PHE D O   1 
ATOM   10920 C CB  . PHE D 1 231 ? -5.036  -51.047 32.685  1.00 76.12  ? 242  PHE D CB  1 
ATOM   10921 C CG  . PHE D 1 231 ? -5.138  -49.946 33.679  1.00 76.12  ? 242  PHE D CG  1 
ATOM   10922 C CD1 . PHE D 1 231 ? -4.827  -50.168 35.008  1.00 76.12  ? 242  PHE D CD1 1 
ATOM   10923 C CD2 . PHE D 1 231 ? -5.512  -48.671 33.282  1.00 76.12  ? 242  PHE D CD2 1 
ATOM   10924 C CE1 . PHE D 1 231 ? -4.889  -49.133 35.928  1.00 76.12  ? 242  PHE D CE1 1 
ATOM   10925 C CE2 . PHE D 1 231 ? -5.576  -47.628 34.195  1.00 76.12  ? 242  PHE D CE2 1 
ATOM   10926 C CZ  . PHE D 1 231 ? -5.264  -47.859 35.522  1.00 76.12  ? 242  PHE D CZ  1 
ATOM   10927 N N   . THR D 1 232 ? -3.289  -53.730 31.686  1.00 55.96  ? 243  THR D N   1 
ATOM   10928 C CA  . THR D 1 232 ? -3.237  -54.807 30.703  1.00 55.96  ? 243  THR D CA  1 
ATOM   10929 C C   . THR D 1 232 ? -3.564  -56.152 31.285  1.00 55.96  ? 243  THR D C   1 
ATOM   10930 O O   . THR D 1 232 ? -3.571  -56.322 32.492  1.00 55.96  ? 243  THR D O   1 
ATOM   10931 C CB  . THR D 1 232 ? -1.835  -54.957 30.093  1.00 64.74  ? 243  THR D CB  1 
ATOM   10932 O OG1 . THR D 1 232 ? -0.955  -55.500 31.083  1.00 64.74  ? 243  THR D OG1 1 
ATOM   10933 C CG2 . THR D 1 232 ? -1.302  -53.612 29.598  1.00 64.74  ? 243  THR D CG2 1 
ATOM   10934 N N   . PRO D 1 233 ? -3.838  -57.136 30.419  1.00 65.61  ? 244  PRO D N   1 
ATOM   10935 C CA  . PRO D 1 233 ? -4.153  -58.466 30.922  1.00 65.61  ? 244  PRO D CA  1 
ATOM   10936 C C   . PRO D 1 233 ? -2.830  -59.068 31.364  1.00 65.61  ? 244  PRO D C   1 
ATOM   10937 O O   . PRO D 1 233 ? -1.780  -58.763 30.783  1.00 65.61  ? 244  PRO D O   1 
ATOM   10938 C CB  . PRO D 1 233 ? -4.725  -59.158 29.700  1.00 74.31  ? 244  PRO D CB  1 
ATOM   10939 C CG  . PRO D 1 233 ? -3.893  -58.594 28.609  1.00 74.31  ? 244  PRO D CG  1 
ATOM   10940 C CD  . PRO D 1 233 ? -3.885  -57.118 28.946  1.00 74.31  ? 244  PRO D CD  1 
ATOM   10941 N N   . PRO D 1 234 ? -2.858  -59.908 32.415  1.00 64.94  ? 245  PRO D N   1 
ATOM   10942 C CA  . PRO D 1 234 ? -1.671  -60.572 32.966  1.00 64.94  ? 245  PRO D CA  1 
ATOM   10943 C C   . PRO D 1 234 ? -0.928  -61.330 31.868  1.00 64.94  ? 245  PRO D C   1 
ATOM   10944 O O   . PRO D 1 234 ? 0.307   -61.335 31.809  1.00 64.94  ? 245  PRO D O   1 
ATOM   10945 C CB  . PRO D 1 234 ? -2.268  -61.495 34.023  1.00 41.71  ? 245  PRO D CB  1 
ATOM   10946 C CG  . PRO D 1 234 ? -3.456  -60.707 34.516  1.00 41.71  ? 245  PRO D CG  1 
ATOM   10947 C CD  . PRO D 1 234 ? -4.056  -60.225 33.218  1.00 41.71  ? 245  PRO D CD  1 
ATOM   10948 N N   . ARG D 1 235 ? -1.712  -61.967 31.001  1.00 57.29  ? 246  ARG D N   1 
ATOM   10949 C CA  . ARG D 1 235 ? -1.196  -62.727 29.880  1.00 57.29  ? 246  ARG D CA  1 
ATOM   10950 C C   . ARG D 1 235 ? -0.031  -61.975 29.227  1.00 57.29  ? 246  ARG D C   1 
ATOM   10951 O O   . ARG D 1 235 ? 1.083   -62.492 29.152  1.00 57.29  ? 246  ARG D O   1 
ATOM   10952 C CB  . ARG D 1 235 ? -2.335  -62.957 28.876  1.00 93.57  ? 246  ARG D CB  1 
ATOM   10953 C CG  . ARG D 1 235 ? -1.948  -63.666 27.581  1.00 93.57  ? 246  ARG D CG  1 
ATOM   10954 C CD  . ARG D 1 235 ? -3.183  -64.219 26.864  1.00 93.57  ? 246  ARG D CD  1 
ATOM   10955 N NE  . ARG D 1 235 ? -4.055  -63.195 26.290  1.00 93.57  ? 246  ARG D NE  1 
ATOM   10956 C CZ  . ARG D 1 235 ? -3.766  -62.499 25.194  1.00 93.57  ? 246  ARG D CZ  1 
ATOM   10957 N NH1 . ARG D 1 235 ? -2.622  -62.714 24.553  1.00 93.57  ? 246  ARG D NH1 1 
ATOM   10958 N NH2 . ARG D 1 235 ? -4.624  -61.599 24.725  1.00 93.57  ? 246  ARG D NH2 1 
ATOM   10959 N N   . THR D 1 236 ? -0.285  -60.742 28.789  1.00 53.66  ? 247  THR D N   1 
ATOM   10960 C CA  . THR D 1 236 ? 0.736   -59.930 28.123  1.00 53.66  ? 247  THR D CA  1 
ATOM   10961 C C   . THR D 1 236 ? 1.502   -58.922 28.980  1.00 53.66  ? 247  THR D C   1 
ATOM   10962 O O   . THR D 1 236 ? 2.342   -58.174 28.460  1.00 53.66  ? 247  THR D O   1 
ATOM   10963 C CB  . THR D 1 236 ? 0.130   -59.160 26.946  1.00 60.18  ? 247  THR D CB  1 
ATOM   10964 O OG1 . THR D 1 236 ? -1.297  -59.281 26.982  1.00 60.18  ? 247  THR D OG1 1 
ATOM   10965 C CG2 . THR D 1 236 ? 0.674   -59.695 25.622  1.00 60.18  ? 247  THR D CG2 1 
ATOM   10966 N N   . SER D 1 237 ? 1.217   -58.913 30.281  1.00 93.60  ? 248  SER D N   1 
ATOM   10967 C CA  . SER D 1 237 ? 1.866   -57.993 31.217  1.00 93.60  ? 248  SER D CA  1 
ATOM   10968 C C   . SER D 1 237 ? 3.352   -57.834 30.917  1.00 93.60  ? 248  SER D C   1 
ATOM   10969 O O   . SER D 1 237 ? 3.854   -56.717 30.828  1.00 93.60  ? 248  SER D O   1 
ATOM   10970 C CB  . SER D 1 237 ? 1.681   -58.480 32.659  1.00 93.35  ? 248  SER D CB  1 
ATOM   10971 O OG  . SER D 1 237 ? 2.094   -57.496 33.597  1.00 93.35  ? 248  SER D OG  1 
ATOM   10972 N N   . ASN D 1 238 ? 4.048   -58.955 30.763  1.00 75.11  ? 249  ASN D N   1 
ATOM   10973 C CA  . ASN D 1 238 ? 5.478   -58.945 30.460  1.00 75.11  ? 249  ASN D CA  1 
ATOM   10974 C C   . ASN D 1 238 ? 5.747   -58.336 29.076  1.00 75.11  ? 249  ASN D C   1 
ATOM   10975 O O   . ASN D 1 238 ? 6.648   -57.508 28.904  1.00 75.11  ? 249  ASN D O   1 
ATOM   10976 C CB  . ASN D 1 238 ? 6.027   -60.376 30.493  1.00 201.99 ? 249  ASN D CB  1 
ATOM   10977 C CG  . ASN D 1 238 ? 5.306   -61.303 29.519  1.00 201.99 ? 249  ASN D CG  1 
ATOM   10978 O OD1 . ASN D 1 238 ? 4.118   -61.589 29.680  1.00 201.99 ? 249  ASN D OD1 1 
ATOM   10979 N ND2 . ASN D 1 238 ? 6.023   -61.771 28.502  1.00 201.99 ? 249  ASN D ND2 1 
ATOM   10980 N N   . GLN D 1 239 ? 4.960   -58.764 28.093  1.00 89.72  ? 250  GLN D N   1 
ATOM   10981 C CA  . GLN D 1 239 ? 5.113   -58.288 26.731  1.00 89.72  ? 250  GLN D CA  1 
ATOM   10982 C C   . GLN D 1 239 ? 5.152   -56.764 26.702  1.00 89.72  ? 250  GLN D C   1 
ATOM   10983 O O   . GLN D 1 239 ? 6.144   -56.171 26.283  1.00 89.72  ? 250  GLN D O   1 
ATOM   10984 C CB  . GLN D 1 239 ? 3.961   -58.803 25.859  1.00 201.99 ? 250  GLN D CB  1 
ATOM   10985 C CG  . GLN D 1 239 ? 4.176   -58.635 24.355  1.00 201.99 ? 250  GLN D CG  1 
ATOM   10986 C CD  . GLN D 1 239 ? 5.171   -59.632 23.779  1.00 201.99 ? 250  GLN D CD  1 
ATOM   10987 O OE1 . GLN D 1 239 ? 6.279   -59.792 24.293  1.00 201.99 ? 250  GLN D OE1 1 
ATOM   10988 N NE2 . GLN D 1 239 ? 4.779   -60.302 22.700  1.00 201.99 ? 250  GLN D NE2 1 
ATOM   10989 N N   . TRP D 1 240 ? 4.072   -56.138 27.1