data_2GAT
# 
_entry.id   2GAT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GAT         
WWPDB D_1000178121 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3GAT 
_pdbx_database_related.details        'ENSEMBLE OF 34 STRUCTURES' 
_pdbx_database_related.content_type   ensemble 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GAT 
_pdbx_database_status.recvd_initial_deposition_date   1997-11-07 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clore, G.M.'      1 
'Tjandra, N.'      2 
'Starich, M.'      3 
'Omichinski, J.G.' 4 
'Gronenborn, A.M.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Use of dipolar 1H-15N and 1H-13C couplings in the structure determination of magnetically oriented macromolecules in solution.' 
Nat.Struct.Biol. 4   732 738 1997 NSBIEW US 1072-8368 2024 ? 9303001 10.1038/nsb0997-732 
1       
;The solution structure of the Leu22-->Val mutant AREA DNA binding domain complexed with a TGATAG core element defines a role for hydrophobic packing in the determination of specificity
;
J.Mol.Biol.      277 621 634 1998 JMOBAK UK 0022-2836 0070 ? ?       ?                   
2       'NMR Structure of a Specific DNA Complex of Zn-Containing DNA Binding Domain of Gata-1' Science          261 438 ?   1993 
SCIEAS US 0036-8075 0038 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tjandra, N.'      1  
primary 'Omichinski, J.G.' 2  
primary 'Gronenborn, A.M.' 3  
primary 'Clore, G.M.'      4  
primary 'Bax, A.'          5  
1       'Starich, M.R.'    6  
1       'Wikstrom, M.'     7  
1       'Shumacher, S.'    8  
1       'Arst, H.N.'       9  
1       'Gronenborn, A.M.' 10 
1       'Clore, G.M.'      11 
2       'Omichinski, J.G.' 12 
2       'Clore, G.M.'      13 
2       'Schaad, O.'       14 
2       'Felsenfeld, G.'   15 
2       'Trainor, C.'      16 
2       'Appella, E.'      17 
2       'Stahl, S.J.'      18 
2       'Gronenborn, A.M.' 19 
# 
_cell.entry_id           2GAT 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2GAT 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*TP*TP*GP*CP*AP*GP*AP*TP*AP*AP*AP*CP*AP*TP*T)-3')
;
4921.228 1 ? ? ?                   ? 
2 polymer     syn 
;DNA (5'-D(*AP*AP*TP*GP*TP*TP*TP*AP*TP*CP*TP*GP*CP*AP*AP*C)-3')
;
4872.190 1 ? ? ?                   ? 
3 polymer     man 'ERYTHROID TRANSCRIPTION FACTOR GATA-1'                          7557.844 1 ? ? 'C-TERMINAL DOMAIN' ? 
4 non-polymer syn 'ZINC ION'                                                       65.409   1 ? ? ?                   ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DT)(DT)(DG)(DC)(DA)(DG)(DA)(DT)(DA)(DA)(DA)(DC)(DA)(DT)(DT)' GTTGCAGATAAACATT B ? 
2 polydeoxyribonucleotide no no '(DA)(DA)(DT)(DG)(DT)(DT)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DA)(DC)' AATGTTTATCTGCAAC C ? 
3 'polypeptide(L)'        no no KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSSKGKKRR 
KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSSKGKKRR A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DG  n 
1 2  DT  n 
1 3  DT  n 
1 4  DG  n 
1 5  DC  n 
1 6  DA  n 
1 7  DG  n 
1 8  DA  n 
1 9  DT  n 
1 10 DA  n 
1 11 DA  n 
1 12 DA  n 
1 13 DC  n 
1 14 DA  n 
1 15 DT  n 
1 16 DT  n 
2 1  DA  n 
2 2  DA  n 
2 3  DT  n 
2 4  DG  n 
2 5  DT  n 
2 6  DT  n 
2 7  DT  n 
2 8  DA  n 
2 9  DT  n 
2 10 DC  n 
2 11 DT  n 
2 12 DG  n 
2 13 DC  n 
2 14 DA  n 
2 15 DA  n 
2 16 DC  n 
3 1  LYS n 
3 2  ARG n 
3 3  ALA n 
3 4  GLY n 
3 5  THR n 
3 6  VAL n 
3 7  CYS n 
3 8  SER n 
3 9  ASN n 
3 10 CYS n 
3 11 GLN n 
3 12 THR n 
3 13 SER n 
3 14 THR n 
3 15 THR n 
3 16 THR n 
3 17 LEU n 
3 18 TRP n 
3 19 ARG n 
3 20 ARG n 
3 21 SER n 
3 22 PRO n 
3 23 MET n 
3 24 GLY n 
3 25 ASP n 
3 26 PRO n 
3 27 VAL n 
3 28 CYS n 
3 29 ASN n 
3 30 ALA n 
3 31 CYS n 
3 32 GLY n 
3 33 LEU n 
3 34 TYR n 
3 35 TYR n 
3 36 LYS n 
3 37 LEU n 
3 38 HIS n 
3 39 GLN n 
3 40 VAL n 
3 41 ASN n 
3 42 ARG n 
3 43 PRO n 
3 44 LEU n 
3 45 THR n 
3 46 MET n 
3 47 ARG n 
3 48 LYS n 
3 49 ASP n 
3 50 GLY n 
3 51 ILE n 
3 52 GLN n 
3 53 THR n 
3 54 ARG n 
3 55 ASN n 
3 56 ARG n 
3 57 LYS n 
3 58 VAL n 
3 59 SER n 
3 60 SER n 
3 61 LYS n 
3 62 GLY n 
3 63 LYS n 
3 64 LYS n 
3 65 ARG n 
3 66 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               chicken 
_entity_src_gen.gene_src_genus                     Gallus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Gallus gallus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9031 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP GATA1_CHICK P17678 3 158 ? ? 
2 PDB 2GAT        2GAT   1 ?   ? ? 
3 PDB 2GAT        2GAT   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GAT A 1 ? 66 ? P17678 158 ? 223 ? 1   66  
2 2 2GAT B 1 ? 16 ? 2GAT   101 ? 116 ? 101 116 
3 3 2GAT C 1 ? 16 ? 2GAT   117 ? 132 ? 117 132 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
1 AM360  Bruker 600 
2 DMX500 Bruker 500 
3 AMX600 Bruker 360 
4 DMX750 Bruker 750 
# 
_pdbx_nmr_refine.entry_id           2GAT 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;THE STRUCTURES WERE CALCULATED USING THE SIMULATED
 ANNEALING PROTOCOL OF NILGES ET AL. (1988) FEBS LETT.
 229, 129 - 136 AND PROTEIN ENGINEERING 2, 27 - 38 USING
 THE PROGRAM X-PLOR MODIFIED TO INCORPORATE DIPOLAR
 COUPLING RESTRAINTS (TJANDRA ET AL. (1997) NATURE STRUCT
 BIOL 4, 732-738) AND A CONFORMATIONAL DATABASE POTENTIAL
 FOR PROTEINS AND NUCLEIC ACIDS (KUSZEWSKI ET AL. (1996)
 PROTEIN SCI 5, 1067 - 1080 AND (1997) J. MAGN. RESON. 125,
 171-177).  THE EXPERIMENTAL RESTRAINTS ARE GIVEN IN
 R2GATMR.

THE STRUCTURES ARE BASED ON A TOTAL OF 1830 EXPERIMENTAL
NMR RESTRAINTS COMPRISING:  1444 INTERPROTON DISTANCE
RESTRAINTS DERIVED FROM NOE MEASUREMENTS; 296 TORSION
ANGLE RESTRAINTS; 90 RESIDUAL DIPOLAR COUPLINGS (52 N-H
AND 38 C-H).  THE NOE RESTRAINTS ARE SUBDIVIDED AS FOLLOWS:
(A) WITHIN THE PROTEIN:  242 INTERRESIDUE SEQUENTIAL
(|I-J|=1); 161 INTERRESIDUE SHORT RANGE (1(LESS
THAN)|I-J|(LESS THAN)=5); 182 INTERRESIDUE LONG RANGE
(|I-J|(GREATER THAN)5); AND. 334 INTRARESIDUE.  (B) WITHIN
THE DNA:  157 INTRARESIDUE; 180 SEQUENTIAL INTRASTRAND; 34
INTERSTRAND; AND 37. H-BONDS (C) BETWEEN PROTEIN AND DNA:
117.  THE TORSION ANGLE RESTRAINTS ARE SUBDIVIDED AS
FOLLOWS:  144 ANGLES FOR THE PROTEIN (58 PHI, 56 PSI, 26
CHI1 AND 4 CHI2) AND. 152 FOR THE DNA.  THE TORSION ANGLE
RESTRAINTS FOR THE DNA COMPRISE LOOSE RESTRAINTS ON THE
BACKBONE TORSION ANGLES ALPHA, BETA, GAMMA, EPSILON AND
ZETA TO PREVENT PROBLEMS ASSOCIATED WITH LOCAL MIRROR
IMAGES.

THE STRUCTURE IN THIS ENTRY IS THE RESTRAINED REGULARIZED
MEAN STRUCTURE AND THE LAST NUMERIC COLUMN REPRESENTS THE
RMS OF THE 34 INDIVIDUAL SIMULATED ANNEALING STRUCTURES
FOUND IN  PDB ENTRY 3GAT ABOUT THE MEAN COORDINATE
POSITIONS.  THE LAST NUMERIC COLUMN IN THE INDIVIDUAL SA
STRUCTURES HAS NO MEANING.

THE FOLLOWING TWO SETS OF COORDINATES DEFINE THE PRINCIPAL
AXIS OF THE MAGNETIC SUSCEPTIBILITY TENSOR:
     POINT 1         50.250 -27.763   2.413
     POINT 2         50.328 -26.611   3.418
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2GAT 
_pdbx_nmr_details.text       'DATA WERE RECORDED ON A 1:1 COMPLEX OF 1 MOLECULE OF DNA.' 
# 
_pdbx_nmr_ensemble.entry_id                             2GAT 
_pdbx_nmr_ensemble.conformers_calculated_total_number   34 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         'REGULARIZED MEAN STRUCTURE' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR            3.1      BRUNGER 1 
'structure solution' 'X-PLOR MODIFIED' MODIFIED ?       2 
# 
_exptl.entry_id          2GAT 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2GAT 
_struct.title                     
'SOLUTION STRUCTURE OF THE C-TERMINAL DOMAIN OF CHICKEN GATA-1 BOUND TO DNA, NMR, REGULARIZED MEAN STRUCTURE' 
_struct.pdbx_descriptor           'GATA-1/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GAT 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'DNA BINDING PROTEIN, TRANSCRIPTION FACTOR, ZINC BINDING DOMAIN, COMPLEX (TRANSCRIPTION REGULATION-DNA), TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN C 29 ? HIS C 38 ? ASN A 29 HIS A 38 1 ? 10 
HELX_P HELX_P2 2 LEU C 44 ? MET C 46 ? LEU A 44 MET A 46 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 7  SG ? ? A ZN 67  A CYS 7   1_555 ? ? ? ? ? ? ?            2.270 ? 
metalc2  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 10 SG ? ? A ZN 67  A CYS 10  1_555 ? ? ? ? ? ? ?            2.272 ? 
metalc3  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 28 SG ? ? A ZN 67  A CYS 28  1_555 ? ? ? ? ? ? ?            2.331 ? 
metalc4  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 31 SG ? ? A ZN 67  A CYS 31  1_555 ? ? ? ? ? ? ?            2.275 ? 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC  16 N3 ? ? B DG 101 C DC  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC  16 O2 ? ? B DG 101 C DC  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC  16 N4 ? ? B DG 101 C DC  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DT 2  N3 ? ? ? 1_555 B DA  15 N1 ? ? B DT 102 C DA  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DT 2  O4 ? ? ? 1_555 B DA  15 N6 ? ? B DT 102 C DA  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA  14 N1 ? ? B DT 103 C DA  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA  14 N6 ? ? B DT 103 C DA  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC  13 N3 ? ? B DG 104 C DC  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC  13 O2 ? ? B DG 104 C DC  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC  13 N4 ? ? B DG 104 C DC  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DC 5  N3 ? ? ? 1_555 B DG  12 N1 ? ? B DC 105 C DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DC 5  N4 ? ? ? 1_555 B DG  12 O6 ? ? B DC 105 C DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC 5  O2 ? ? ? 1_555 B DG  12 N2 ? ? B DC 105 C DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT  11 N3 ? ? B DA 106 C DT  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT  11 O4 ? ? B DA 106 C DT  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC  10 N3 ? ? B DG 107 C DC  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC  10 O2 ? ? B DG 107 C DC  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC  10 N4 ? ? B DG 107 C DC  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT  9  N3 ? ? B DA 108 C DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT  9  O4 ? ? B DA 108 C DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA  8  N1 ? ? B DT 109 C DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA  8  N6 ? ? B DT 109 C DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT  7  N3 ? ? B DA 110 C DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT  7  O4 ? ? B DA 110 C DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT  6  N3 ? ? B DA 111 C DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT  6  O4 ? ? B DA 111 C DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT  5  N3 ? ? B DA 112 C DT  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT  5  O4 ? ? B DA 112 C DT  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC 13 N3 ? ? ? 1_555 B DG  4  N1 ? ? B DC 113 C DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC 13 N4 ? ? ? 1_555 B DG  4  O6 ? ? B DC 113 C DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DC 13 O2 ? ? ? 1_555 B DG  4  N2 ? ? B DC 113 C DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT  3  N3 ? ? B DA 114 C DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT  3  O4 ? ? B DA 114 C DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DT 15 N3 ? ? ? 1_555 B DA  2  N1 ? ? B DT 115 C DA  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DT 15 O4 ? ? ? 1_555 B DA  2  N6 ? ? B DT 115 C DA  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DT 16 N3 ? ? ? 1_555 B DA  1  N1 ? ? B DT 116 C DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DT 16 O4 ? ? ? 1_555 B DA  1  N6 ? ? B DT 116 C DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP C 18 ? ARG C 20 ? TRP A 18 ARG A 20 
A 2 PRO C 26 ? CYS C 28 ? PRO A 26 CYS A 28 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ARG 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    19 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ARG 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     19 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    27 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     27 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 67' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS C 7  ? CYS A 7  . ? 1_555 ? 
2 AC1 4 CYS C 10 ? CYS A 10 . ? 1_555 ? 
3 AC1 4 CYS C 28 ? CYS A 28 . ? 1_555 ? 
4 AC1 4 CYS C 31 ? CYS A 31 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2GAT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GAT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'"  . DG  A 1 1  ? 19.233  23.358  7.852   1.00 3.16  ? 101 DG  B "O5'"  1 
ATOM   2    C  "C5'"  . DG  A 1 1  ? 19.772  22.891  9.091   1.00 3.28  ? 101 DG  B "C5'"  1 
ATOM   3    C  "C4'"  . DG  A 1 1  ? 18.772  22.007  9.843   1.00 3.16  ? 101 DG  B "C4'"  1 
ATOM   4    O  "O4'"  . DG  A 1 1  ? 17.629  22.791  10.252  1.00 3.12  ? 101 DG  B "O4'"  1 
ATOM   5    C  "C3'"  . DG  A 1 1  ? 18.265  20.847  8.976   1.00 2.96  ? 101 DG  B "C3'"  1 
ATOM   6    O  "O3'"  . DG  A 1 1  ? 18.378  19.605  9.686   1.00 2.96  ? 101 DG  B "O3'"  1 
ATOM   7    C  "C2'"  . DG  A 1 1  ? 16.816  21.170  8.683   1.00 2.78  ? 101 DG  B "C2'"  1 
ATOM   8    C  "C1'"  . DG  A 1 1  ? 16.432  22.333  9.589   1.00 2.89  ? 101 DG  B "C1'"  1 
ATOM   9    N  N9     . DG  A 1 1  ? 15.814  23.430  8.817   1.00 2.85  ? 101 DG  B N9     1 
ATOM   10   C  C8     . DG  A 1 1  ? 16.269  24.062  7.692   1.00 2.86  ? 101 DG  B C8     1 
ATOM   11   N  N7     . DG  A 1 1  ? 15.509  25.021  7.246   1.00 2.83  ? 101 DG  B N7     1 
ATOM   12   C  C5     . DG  A 1 1  ? 14.452  25.033  8.152   1.00 2.79  ? 101 DG  B C5     1 
ATOM   13   C  C6     . DG  A 1 1  ? 13.286  25.867  8.206   1.00 2.76  ? 101 DG  B C6     1 
ATOM   14   O  O6     . DG  A 1 1  ? 12.966  26.773  7.439   1.00 2.77  ? 101 DG  B O6     1 
ATOM   15   N  N1     . DG  A 1 1  ? 12.457  25.550  9.296   1.00 2.73  ? 101 DG  B N1     1 
ATOM   16   C  C2     . DG  A 1 1  ? 12.712  24.548  10.226  1.00 2.74  ? 101 DG  B C2     1 
ATOM   17   N  N2     . DG  A 1 1  ? 11.810  24.387  11.194  1.00 2.72  ? 101 DG  B N2     1 
ATOM   18   N  N3     . DG  A 1 1  ? 13.808  23.764  10.174  1.00 2.77  ? 101 DG  B N3     1 
ATOM   19   C  C4     . DG  A 1 1  ? 14.629  24.059  9.120   1.00 2.79  ? 101 DG  B C4     1 
ATOM   20   H  "H5'"  . DG  A 1 1  ? 20.027  23.748  9.714   1.00 3.42  ? 101 DG  B "H5'"  1 
ATOM   21   H  "H5''" . DG  A 1 1  ? 20.676  22.315  8.891   1.00 3.35  ? 101 DG  B "H5''" 1 
ATOM   22   H  "H4'"  . DG  A 1 1  ? 19.258  21.600  10.730  1.00 3.27  ? 101 DG  B "H4'"  1 
ATOM   23   H  "H3'"  . DG  A 1 1  ? 18.833  20.781  8.042   1.00 2.96  ? 101 DG  B "H3'"  1 
ATOM   24   H  "H2'"  . DG  A 1 1  ? 16.695  21.458  7.638   1.00 2.71  ? 101 DG  B "H2'"  1 
ATOM   25   H  "H2''" . DG  A 1 1  ? 16.194  20.306  8.900   1.00 2.67  ? 101 DG  B "H2''" 1 
ATOM   26   H  "H1'"  . DG  A 1 1  ? 15.720  21.985  10.342  1.00 2.85  ? 101 DG  B "H1'"  1 
ATOM   27   H  H8     . DG  A 1 1  ? 17.202  23.782  7.202   1.00 2.91  ? 101 DG  B H8     1 
ATOM   28   H  H1     . DG  A 1 1  ? 11.619  26.103  9.393   1.00 2.71  ? 101 DG  B H1     1 
ATOM   29   H  H21    . DG  A 1 1  ? 10.992  24.978  11.226  1.00 2.70  ? 101 DG  B H21    1 
ATOM   30   H  H22    . DG  A 1 1  ? 11.945  23.674  11.897  1.00 2.74  ? 101 DG  B H22    1 
ATOM   31   H  "HO5'" . DG  A 1 1  ? 19.973  23.542  7.269   1.00 3.27  ? 101 DG  B "HO5'" 1 
ATOM   32   P  P      . DT  A 1 2  ? 17.821  18.229  9.053   1.00 2.79  ? 102 DT  B P      1 
ATOM   33   O  OP1    . DT  A 1 2  ? 18.601  17.109  9.623   1.00 2.90  ? 102 DT  B OP1    1 
ATOM   34   O  OP2    . DT  A 1 2  ? 17.735  18.397  7.585   1.00 2.67  ? 102 DT  B OP2    1 
ATOM   35   O  "O5'"  . DT  A 1 2  ? 16.320  18.151  9.642   1.00 2.65  ? 102 DT  B "O5'"  1 
ATOM   36   C  "C5'"  . DT  A 1 2  ? 16.096  18.163  11.056  1.00 2.75  ? 102 DT  B "C5'"  1 
ATOM   37   C  "C4'"  . DT  A 1 2  ? 14.613  17.978  11.410  1.00 2.61  ? 102 DT  B "C4'"  1 
ATOM   38   O  "O4'"  . DT  A 1 2  ? 13.872  19.197  11.170  1.00 2.55  ? 102 DT  B "O4'"  1 
ATOM   39   C  "C3'"  . DT  A 1 2  ? 13.951  16.851  10.604  1.00 2.43  ? 102 DT  B "C3'"  1 
ATOM   40   O  "O3'"  . DT  A 1 2  ? 13.548  15.784  11.477  1.00 2.44  ? 102 DT  B "O3'"  1 
ATOM   41   C  "C2'"  . DT  A 1 2  ? 12.747  17.487  9.935   1.00 2.25  ? 102 DT  B "C2'"  1 
ATOM   42   C  "C1'"  . DT  A 1 2  ? 12.644  18.911  10.467  1.00 2.34  ? 102 DT  B "C1'"  1 
ATOM   43   N  N1     . DT  A 1 2  ? 12.419  19.899  9.376   1.00 2.27  ? 102 DT  B N1     1 
ATOM   44   C  C2     . DT  A 1 2  ? 11.280  20.706  9.441   1.00 2.20  ? 102 DT  B C2     1 
ATOM   45   O  O2     . DT  A 1 2  ? 10.450  20.600  10.341  1.00 2.18  ? 102 DT  B O2     1 
ATOM   46   N  N3     . DT  A 1 2  ? 11.144  21.639  8.421   1.00 2.17  ? 102 DT  B N3     1 
ATOM   47   C  C4     . DT  A 1 2  ? 12.026  21.831  7.361   1.00 2.20  ? 102 DT  B C4     1 
ATOM   48   O  O4     . DT  A 1 2  ? 11.803  22.693  6.513   1.00 2.19  ? 102 DT  B O4     1 
ATOM   49   C  C5     . DT  A 1 2  ? 13.178  20.947  7.369   1.00 2.26  ? 102 DT  B C5     1 
ATOM   50   C  C7     . DT  A 1 2  ? 14.216  21.061  6.250   1.00 2.31  ? 102 DT  B C7     1 
ATOM   51   C  C6     . DT  A 1 2  ? 13.333  20.027  8.359   1.00 2.30  ? 102 DT  B C6     1 
ATOM   52   H  "H5'"  . DT  A 1 2  ? 16.440  19.114  11.460  1.00 2.86  ? 102 DT  B "H5'"  1 
ATOM   53   H  "H5''" . DT  A 1 2  ? 16.671  17.356  11.511  1.00 2.82  ? 102 DT  B "H5''" 1 
ATOM   54   H  "H4'"  . DT  A 1 2  ? 14.541  17.733  12.470  1.00 2.70  ? 102 DT  B "H4'"  1 
ATOM   55   H  "H3'"  . DT  A 1 2  ? 14.638  16.460  9.847   1.00 2.43  ? 102 DT  B "H3'"  1 
ATOM   56   H  "H2'"  . DT  A 1 2  ? 12.872  17.497  8.851   1.00 2.18  ? 102 DT  B "H2'"  1 
ATOM   57   H  "H2''" . DT  A 1 2  ? 11.852  16.933  10.195  1.00 2.15  ? 102 DT  B "H2''" 1 
ATOM   58   H  "H1'"  . DT  A 1 2  ? 11.818  18.956  11.176  1.00 2.32  ? 102 DT  B "H1'"  1 
ATOM   59   H  H3     . DT  A 1 2  ? 10.329  22.234  8.452   1.00 2.13  ? 102 DT  B H3     1 
ATOM   60   H  H71    . DT  A 1 2  ? 13.706  21.092  5.287   1.00 2.61  ? 102 DT  B H71    1 
ATOM   61   H  H72    . DT  A 1 2  ? 14.889  20.202  6.274   1.00 2.45  ? 102 DT  B H72    1 
ATOM   62   H  H73    . DT  A 1 2  ? 14.791  21.977  6.382   1.00 2.53  ? 102 DT  B H73    1 
ATOM   63   H  H6     . DT  A 1 2  ? 14.194  19.369  8.348   1.00 2.36  ? 102 DT  B H6     1 
ATOM   64   P  P      . DT  A 1 3  ? 12.647  14.554  10.944  1.00 2.30  ? 103 DT  B P      1 
ATOM   65   O  OP1    . DT  A 1 3  ? 12.724  13.459  11.936  1.00 2.42  ? 103 DT  B OP1    1 
ATOM   66   O  OP2    . DT  A 1 3  ? 13.004  14.297  9.531   1.00 2.21  ? 103 DT  B OP2    1 
ATOM   67   O  "O5'"  . DT  A 1 3  ? 11.152  15.167  10.984  1.00 2.12  ? 103 DT  B "O5'"  1 
ATOM   68   C  "C5'"  . DT  A 1 3  ? 10.570  15.578  12.226  1.00 2.19  ? 103 DT  B "C5'"  1 
ATOM   69   C  "C4'"  . DT  A 1 3  ? 9.120   16.059  12.061  1.00 2.02  ? 103 DT  B "C4'"  1 
ATOM   70   O  "O4'"  . DT  A 1 3  ? 9.073   17.329  11.373  1.00 1.96  ? 103 DT  B "O4'"  1 
ATOM   71   C  "C3'"  . DT  A 1 3  ? 8.253   15.064  11.278  1.00 1.86  ? 103 DT  B "C3'"  1 
ATOM   72   O  "O3'"  . DT  A 1 3  ? 7.272   14.470  12.136  1.00 1.85  ? 103 DT  B "O3'"  1 
ATOM   73   C  "C2'"  . DT  A 1 3  ? 7.588   15.877  10.182  1.00 1.68  ? 103 DT  B "C2'"  1 
ATOM   74   C  "C1'"  . DT  A 1 3  ? 8.020   17.327  10.386  1.00 1.76  ? 103 DT  B "C1'"  1 
ATOM   75   N  N1     . DT  A 1 3  ? 8.497   17.928  9.113   1.00 1.71  ? 103 DT  B N1     1 
ATOM   76   C  C2     . DT  A 1 3  ? 7.817   19.036  8.604   1.00 1.64  ? 103 DT  B C2     1 
ATOM   77   O  O2     . DT  A 1 3  ? 6.829   19.513  9.157   1.00 1.62  ? 103 DT  B O2     1 
ATOM   78   N  N3     . DT  A 1 3  ? 8.333   19.567  7.429   1.00 1.64  ? 103 DT  B N3     1 
ATOM   79   C  C4     . DT  A 1 3  ? 9.444   19.096  6.732   1.00 1.67  ? 103 DT  B C4     1 
ATOM   80   O  O4     . DT  A 1 3  ? 9.811   19.649  5.698   1.00 1.68  ? 103 DT  B O4     1 
ATOM   81   C  C5     . DT  A 1 3  ? 10.084  17.940  7.332   1.00 1.73  ? 103 DT  B C5     1 
ATOM   82   C  C7     . DT  A 1 3  ? 11.314  17.328  6.654   1.00 1.80  ? 103 DT  B C7     1 
ATOM   83   C  C6     . DT  A 1 3  ? 9.596   17.405  8.481   1.00 1.75  ? 103 DT  B C6     1 
ATOM   84   H  "H5'"  . DT  A 1 3  ? 11.165  16.391  12.643  1.00 2.30  ? 103 DT  B "H5'"  1 
ATOM   85   H  "H5''" . DT  A 1 3  ? 10.585  14.737  12.919  1.00 2.26  ? 103 DT  B "H5''" 1 
ATOM   86   H  "H4'"  . DT  A 1 3  ? 8.686   16.188  13.052  1.00 2.09  ? 103 DT  B "H4'"  1 
ATOM   87   H  "H3'"  . DT  A 1 3  ? 8.872   14.277  10.836  1.00 1.89  ? 103 DT  B "H3'"  1 
ATOM   88   H  "H2'"  . DT  A 1 3  ? 7.910   15.526  9.200   1.00 1.63  ? 103 DT  B "H2'"  1 
ATOM   89   H  "H2''" . DT  A 1 3  ? 6.504   15.790  10.262  1.00 1.57  ? 103 DT  B "H2''" 1 
ATOM   90   H  "H1'"  . DT  A 1 3  ? 7.180   17.901  10.776  1.00 1.72  ? 103 DT  B "H1'"  1 
ATOM   91   H  H3     . DT  A 1 3  ? 7.859   20.370  7.044   1.00 1.62  ? 103 DT  B H3     1 
ATOM   92   H  H71    . DT  A 1 3  ? 11.624  16.423  7.179   1.00 2.02  ? 103 DT  B H71    1 
ATOM   93   H  H72    . DT  A 1 3  ? 12.130  18.051  6.667   1.00 2.19  ? 103 DT  B H72    1 
ATOM   94   H  H73    . DT  A 1 3  ? 11.069  17.080  5.621   1.00 2.04  ? 103 DT  B H73    1 
ATOM   95   H  H6     . DT  A 1 3  ? 10.074  16.535  8.913   1.00 1.82  ? 103 DT  B H6     1 
ATOM   96   P  P      . DG  A 1 4  ? 6.164   13.459  11.547  1.00 1.74  ? 104 DG  B P      1 
ATOM   97   O  OP1    . DG  A 1 4  ? 5.477   12.811  12.687  1.00 1.84  ? 104 DG  B OP1    1 
ATOM   98   O  OP2    . DG  A 1 4  ? 6.804   12.629  10.503  1.00 1.72  ? 104 DG  B OP2    1 
ATOM   99   O  "O5'"  . DG  A 1 4  ? 5.121   14.456  10.830  1.00 1.56  ? 104 DG  B "O5'"  1 
ATOM   100  C  "C5'"  . DG  A 1 4  ? 4.284   15.320  11.606  1.00 1.56  ? 104 DG  B "C5'"  1 
ATOM   101  C  "C4'"  . DG  A 1 4  ? 3.207   15.986  10.742  1.00 1.39  ? 104 DG  B "C4'"  1 
ATOM   102  O  "O4'"  . DG  A 1 4  ? 3.818   16.844  9.749   1.00 1.33  ? 104 DG  B "O4'"  1 
ATOM   103  C  "C3'"  . DG  A 1 4  ? 2.337   14.956  10.012  1.00 1.27  ? 104 DG  B "C3'"  1 
ATOM   104  O  "O3'"  . DG  A 1 4  ? 0.955   15.129  10.347  1.00 1.19  ? 104 DG  B "O3'"  1 
ATOM   105  C  "C2'"  . DG  A 1 4  ? 2.553   15.212  8.538   1.00 1.14  ? 104 DG  B "C2'"  1 
ATOM   106  C  "C1'"  . DG  A 1 4  ? 3.404   16.463  8.419   1.00 1.18  ? 104 DG  B "C1'"  1 
ATOM   107  N  N9     . DG  A 1 4  ? 4.576   16.238  7.547   1.00 1.16  ? 104 DG  B N9     1 
ATOM   108  C  C8     . DG  A 1 4  ? 5.540   15.269  7.619   1.00 1.23  ? 104 DG  B C8     1 
ATOM   109  N  N7     . DG  A 1 4  ? 6.477   15.350  6.717   1.00 1.20  ? 104 DG  B N7     1 
ATOM   110  C  C5     . DG  A 1 4  ? 6.108   16.469  5.974   1.00 1.12  ? 104 DG  B C5     1 
ATOM   111  C  C6     . DG  A 1 4  ? 6.735   17.083  4.836   1.00 1.09  ? 104 DG  B C6     1 
ATOM   112  O  O6     . DG  A 1 4  ? 7.769   16.743  4.262   1.00 1.11  ? 104 DG  B O6     1 
ATOM   113  N  N1     . DG  A 1 4  ? 6.026   18.208  4.383   1.00 1.05  ? 104 DG  B N1     1 
ATOM   114  C  C2     . DG  A 1 4  ? 4.854   18.693  4.950   1.00 1.04  ? 104 DG  B C2     1 
ATOM   115  N  N2     . DG  A 1 4  ? 4.316   19.773  4.383   1.00 1.04  ? 104 DG  B N2     1 
ATOM   116  N  N3     . DG  A 1 4  ? 4.265   18.118  6.018   1.00 1.06  ? 104 DG  B N3     1 
ATOM   117  C  C4     . DG  A 1 4  ? 4.940   17.019  6.476   1.00 1.10  ? 104 DG  B C4     1 
ATOM   118  H  "H5'"  . DG  A 1 4  ? 4.901   16.094  12.064  1.00 1.64  ? 104 DG  B "H5'"  1 
ATOM   119  H  "H5''" . DG  A 1 4  ? 3.801   14.738  12.391  1.00 1.62  ? 104 DG  B "H5''" 1 
ATOM   120  H  "H4'"  . DG  A 1 4  ? 2.568   16.592  11.384  1.00 1.41  ? 104 DG  B "H4'"  1 
ATOM   121  H  "H3'"  . DG  A 1 4  ? 2.645   13.936  10.264  1.00 1.35  ? 104 DG  B "H3'"  1 
ATOM   122  H  "H2'"  . DG  A 1 4  ? 3.063   14.368  8.069   1.00 1.15  ? 104 DG  B "H2'"  1 
ATOM   123  H  "H2''" . DG  A 1 4  ? 1.594   15.378  8.060   1.00 1.05  ? 104 DG  B "H2''" 1 
ATOM   124  H  "H1'"  . DG  A 1 4  ? 2.797   17.263  7.990   1.00 1.11  ? 104 DG  B "H1'"  1 
ATOM   125  H  H8     . DG  A 1 4  ? 5.522   14.483  8.373   1.00 1.31  ? 104 DG  B H8     1 
ATOM   126  H  H1     . DG  A 1 4  ? 6.416   18.687  3.583   1.00 1.06  ? 104 DG  B H1     1 
ATOM   127  H  H21    . DG  A 1 4  ? 4.762   20.198  3.583   1.00 1.05  ? 104 DG  B H21    1 
ATOM   128  H  H22    . DG  A 1 4  ? 3.463   20.166  4.754   1.00 1.04  ? 104 DG  B H22    1 
ATOM   129  P  P      . DC  A 1 5  ? -0.176  14.228  9.635   1.00 1.10  ? 105 DC  B P      1 
ATOM   130  O  OP1    . DC  A 1 5  ? -1.439  14.380  10.391  1.00 1.13  ? 105 DC  B OP1    1 
ATOM   131  O  OP2    . DC  A 1 5  ? 0.396   12.882  9.412   1.00 1.17  ? 105 DC  B OP2    1 
ATOM   132  O  "O5'"  . DC  A 1 5  ? -0.356  14.945  8.196   1.00 0.93  ? 105 DC  B "O5'"  1 
ATOM   133  C  "C5'"  . DC  A 1 5  ? -0.893  16.271  8.103   1.00 0.87  ? 105 DC  B "C5'"  1 
ATOM   134  C  "C4'"  . DC  A 1 5  ? -1.172  16.689  6.648   1.00 0.74  ? 105 DC  B "C4'"  1 
ATOM   135  O  "O4'"  . DC  A 1 5  ? 0.067   16.867  5.917   1.00 0.73  ? 105 DC  B "O4'"  1 
ATOM   136  C  "C3'"  . DC  A 1 5  ? -2.024  15.658  5.893   1.00 0.67  ? 105 DC  B "C3'"  1 
ATOM   137  O  "O3'"  . DC  A 1 5  ? -3.218  16.282  5.387   1.00 0.63  ? 105 DC  B "O3'"  1 
ATOM   138  C  "C2'"  . DC  A 1 5  ? -1.146  15.171  4.759   1.00 0.61  ? 105 DC  B "C2'"  1 
ATOM   139  C  "C1'"  . DC  A 1 5  ? 0.025   16.137  4.671   1.00 0.63  ? 105 DC  B "C1'"  1 
ATOM   140  N  N1     . DC  A 1 5  ? 1.312   15.429  4.428   1.00 0.67  ? 105 DC  B N1     1 
ATOM   141  C  C2     . DC  A 1 5  ? 2.036   15.738  3.269   1.00 0.64  ? 105 DC  B C2     1 
ATOM   142  O  O2     . DC  A 1 5  ? 1.593   16.550  2.459   1.00 0.58  ? 105 DC  B O2     1 
ATOM   143  N  N3     . DC  A 1 5  ? 3.237   15.110  3.079   1.00 0.69  ? 105 DC  B N3     1 
ATOM   144  C  C4     . DC  A 1 5  ? 3.712   14.220  3.978   1.00 0.79  ? 105 DC  B C4     1 
ATOM   145  N  N4     . DC  A 1 5  ? 4.888   13.633  3.758   1.00 0.87  ? 105 DC  B N4     1 
ATOM   146  C  C5     . DC  A 1 5  ? 2.971   13.899  5.166   1.00 0.84  ? 105 DC  B C5     1 
ATOM   147  C  C6     . DC  A 1 5  ? 1.783   14.526  5.341   1.00 0.78  ? 105 DC  B C6     1 
ATOM   148  H  "H5'"  . DC  A 1 5  ? -0.182  16.972  8.540   1.00 0.94  ? 105 DC  B "H5'"  1 
ATOM   149  H  "H5''" . DC  A 1 5  ? -1.825  16.315  8.667   1.00 0.89  ? 105 DC  B "H5''" 1 
ATOM   150  H  "H4'"  . DC  A 1 5  ? -1.707  17.638  6.659   1.00 0.73  ? 105 DC  B "H4'"  1 
ATOM   151  H  "H3'"  . DC  A 1 5  ? -2.297  14.823  6.545   1.00 0.73  ? 105 DC  B "H3'"  1 
ATOM   152  H  "H2'"  . DC  A 1 5  ? -0.787  14.161  4.961   1.00 0.68  ? 105 DC  B "H2'"  1 
ATOM   153  H  "H2''" . DC  A 1 5  ? -1.701  15.183  3.834   1.00 0.55  ? 105 DC  B "H2''" 1 
ATOM   154  H  "H1'"  . DC  A 1 5  ? -0.166  16.838  3.858   1.00 0.58  ? 105 DC  B "H1'"  1 
ATOM   155  H  H41    . DC  A 1 5  ? 5.415   13.855  2.926   1.00 0.84  ? 105 DC  B H41    1 
ATOM   156  H  H42    . DC  A 1 5  ? 5.252   12.967  4.424   1.00 0.96  ? 105 DC  B H42    1 
ATOM   157  H  H5     . DC  A 1 5  ? 3.351   13.186  5.898   1.00 0.95  ? 105 DC  B H5     1 
ATOM   158  H  H6     . DC  A 1 5  ? 1.184   14.304  6.213   1.00 0.82  ? 105 DC  B H6     1 
ATOM   159  P  P      . DA  A 1 6  ? -4.232  15.501  4.397   1.00 0.59  ? 106 DA  B P      1 
ATOM   160  O  OP1    . DA  A 1 6  ? -5.575  16.105  4.542   1.00 0.63  ? 106 DA  B OP1    1 
ATOM   161  O  OP2    . DA  A 1 6  ? -4.051  14.047  4.604   1.00 0.63  ? 106 DA  B OP2    1 
ATOM   162  O  "O5'"  . DA  A 1 6  ? -3.663  15.878  2.930   1.00 0.50  ? 106 DA  B "O5'"  1 
ATOM   163  C  "C5'"  . DA  A 1 6  ? -3.651  17.240  2.481   1.00 0.50  ? 106 DA  B "C5'"  1 
ATOM   164  C  "C4'"  . DA  A 1 6  ? -3.345  17.361  0.976   1.00 0.44  ? 106 DA  B "C4'"  1 
ATOM   165  O  "O4'"  . DA  A 1 6  ? -1.946  17.103  0.713   1.00 0.42  ? 106 DA  B "O4'"  1 
ATOM   166  C  "C3'"  . DA  A 1 6  ? -4.180  16.394  0.126   1.00 0.42  ? 106 DA  B "C3'"  1 
ATOM   167  O  "O3'"  . DA  A 1 6  ? -4.957  17.124  -0.833  1.00 0.44  ? 106 DA  B "O3'"  1 
ATOM   168  C  "C2'"  . DA  A 1 6  ? -3.177  15.486  -0.563  1.00 0.37  ? 106 DA  B "C2'"  1 
ATOM   169  C  "C1'"  . DA  A 1 6  ? -1.789  16.026  -0.238  1.00 0.37  ? 106 DA  B "C1'"  1 
ATOM   170  N  N9     . DA  A 1 6  ? -0.945  14.973  0.329   1.00 0.34  ? 106 DA  B N9     1 
ATOM   171  C  C8     . DA  A 1 6  ? -1.195  14.222  1.419   1.00 0.34  ? 106 DA  B C8     1 
ATOM   172  N  N7     . DA  A 1 6  ? -0.250  13.406  1.771   1.00 0.32  ? 106 DA  B N7     1 
ATOM   173  C  C5     . DA  A 1 6  ? 0.724   13.630  0.800   1.00 0.30  ? 106 DA  B C5     1 
ATOM   174  C  C6     . DA  A 1 6  ? 2.002   13.076  0.565   1.00 0.29  ? 106 DA  B C6     1 
ATOM   175  N  N6     . DA  A 1 6  ? 2.539   12.140  1.346   1.00 0.31  ? 106 DA  B N6     1 
ATOM   176  N  N1     . DA  A 1 6  ? 2.705   13.527  -0.511  1.00 0.30  ? 106 DA  B N1     1 
ATOM   177  C  C2     . DA  A 1 6  ? 2.185   14.470  -1.316  1.00 0.31  ? 106 DA  B C2     1 
ATOM   178  N  N3     . DA  A 1 6  ? 0.987   15.060  -1.178  1.00 0.32  ? 106 DA  B N3     1 
ATOM   179  C  C4     . DA  A 1 6  ? 0.306   14.587  -0.092  1.00 0.31  ? 106 DA  B C4     1 
ATOM   180  H  "H5'"  . DA  A 1 6  ? -2.893  17.789  3.040   1.00 0.52  ? 106 DA  B "H5'"  1 
ATOM   181  H  "H5''" . DA  A 1 6  ? -4.626  17.685  2.679   1.00 0.53  ? 106 DA  B "H5''" 1 
ATOM   182  H  "H4'"  . DA  A 1 6  ? -3.573  18.380  0.661   1.00 0.47  ? 106 DA  B "H4'"  1 
ATOM   183  H  "H3'"  . DA  A 1 6  ? -4.849  15.801  0.758   1.00 0.45  ? 106 DA  B "H3'"  1 
ATOM   184  H  "H2'"  . DA  A 1 6  ? -3.274  14.464  -0.191  1.00 0.37  ? 106 DA  B "H2'"  1 
ATOM   185  H  "H2''" . DA  A 1 6  ? -3.340  15.498  -1.636  1.00 0.37  ? 106 DA  B "H2''" 1 
ATOM   186  H  "H1'"  . DA  A 1 6  ? -1.319  16.406  -1.137  1.00 0.37  ? 106 DA  B "H1'"  1 
ATOM   187  H  H8     . DA  A 1 6  ? -2.156  14.253  1.902   1.00 0.37  ? 106 DA  B H8     1 
ATOM   188  H  H61    . DA  A 1 6  ? 3.457   11.773  1.137   1.00 0.32  ? 106 DA  B H61    1 
ATOM   189  H  H62    . DA  A 1 6  ? 2.029   11.795  2.147   1.00 0.32  ? 106 DA  B H62    1 
ATOM   190  H  H2     . DA  A 1 6  ? 2.789   14.769  -2.171  1.00 0.33  ? 106 DA  B H2     1 
ATOM   191  P  P      . DG  A 1 7  ? -5.811  16.366  -1.969  1.00 0.44  ? 107 DG  B P      1 
ATOM   192  O  OP1    . DG  A 1 7  ? -6.778  17.328  -2.543  1.00 0.49  ? 107 DG  B OP1    1 
ATOM   193  O  OP2    . DG  A 1 7  ? -6.291  15.082  -1.409  1.00 0.45  ? 107 DG  B OP2    1 
ATOM   194  O  "O5'"  . DG  A 1 7  ? -4.696  16.042  -3.089  1.00 0.40  ? 107 DG  B "O5'"  1 
ATOM   195  C  "C5'"  . DG  A 1 7  ? -3.870  17.083  -3.624  1.00 0.41  ? 107 DG  B "C5'"  1 
ATOM   196  C  "C4'"  . DG  A 1 7  ? -2.882  16.538  -4.662  1.00 0.37  ? 107 DG  B "C4'"  1 
ATOM   197  O  "O4'"  . DG  A 1 7  ? -1.753  15.892  -4.018  1.00 0.33  ? 107 DG  B "O4'"  1 
ATOM   198  C  "C3'"  . DG  A 1 7  ? -3.538  15.513  -5.598  1.00 0.37  ? 107 DG  B "C3'"  1 
ATOM   199  O  "O3'"  . DG  A 1 7  ? -3.468  15.967  -6.960  1.00 0.39  ? 107 DG  B "O3'"  1 
ATOM   200  C  "C2'"  . DG  A 1 7  ? -2.741  14.240  -5.409  1.00 0.33  ? 107 DG  B "C2'"  1 
ATOM   201  C  "C1'"  . DG  A 1 7  ? -1.483  14.628  -4.663  1.00 0.30  ? 107 DG  B "C1'"  1 
ATOM   202  N  N9     . DG  A 1 7  ? -1.078  13.583  -3.693  1.00 0.28  ? 107 DG  B N9     1 
ATOM   203  C  C8     . DG  A 1 7  ? -1.747  13.087  -2.598  1.00 0.31  ? 107 DG  B C8     1 
ATOM   204  N  N7     . DG  A 1 7  ? -1.120  12.185  -1.935  1.00 0.32  ? 107 DG  B N7     1 
ATOM   205  C  C5     . DG  A 1 7  ? 0.068   12.041  -2.619  1.00 0.28  ? 107 DG  B C5     1 
ATOM   206  C  C6     . DG  A 1 7  ? 1.166   11.179  -2.349  1.00 0.28  ? 107 DG  B C6     1 
ATOM   207  O  O6     . DG  A 1 7  ? 1.274   10.383  -1.430  1.00 0.33  ? 107 DG  B O6     1 
ATOM   208  N  N1     . DG  A 1 7  ? 2.198   11.319  -3.284  1.00 0.25  ? 107 DG  B N1     1 
ATOM   209  C  C2     . DG  A 1 7  ? 2.180   12.195  -4.363  1.00 0.24  ? 107 DG  B C2     1 
ATOM   210  N  N2     . DG  A 1 7  ? 3.249   12.176  -5.162  1.00 0.25  ? 107 DG  B N2     1 
ATOM   211  N  N3     . DG  A 1 7  ? 1.135   13.021  -4.619  1.00 0.25  ? 107 DG  B N3     1 
ATOM   212  C  C4     . DG  A 1 7  ? 0.117   12.889  -3.706  1.00 0.26  ? 107 DG  B C4     1 
ATOM   213  H  "H5'"  . DG  A 1 7  ? -3.312  17.548  -2.812  1.00 0.41  ? 107 DG  B "H5'"  1 
ATOM   214  H  "H5''" . DG  A 1 7  ? -4.504  17.833  -4.096  1.00 0.44  ? 107 DG  B "H5''" 1 
ATOM   215  H  "H4'"  . DG  A 1 7  ? -2.512  17.371  -5.261  1.00 0.39  ? 107 DG  B "H4'"  1 
ATOM   216  H  "H3'"  . DG  A 1 7  ? -4.584  15.343  -5.323  1.00 0.40  ? 107 DG  B "H3'"  1 
ATOM   217  H  "H2'"  . DG  A 1 7  ? -3.310  13.513  -4.824  1.00 0.34  ? 107 DG  B "H2'"  1 
ATOM   218  H  "H2''" . DG  A 1 7  ? -2.486  13.824  -6.370  1.00 0.32  ? 107 DG  B "H2''" 1 
ATOM   219  H  "H1'"  . DG  A 1 7  ? -0.675  14.765  -5.386  1.00 0.29  ? 107 DG  B "H1'"  1 
ATOM   220  H  H8     . DG  A 1 7  ? -2.752  13.381  -2.323  1.00 0.33  ? 107 DG  B H8     1 
ATOM   221  H  H1     . DG  A 1 7  ? 3.005   10.729  -3.144  1.00 0.25  ? 107 DG  B H1     1 
ATOM   222  H  H21    . DG  A 1 7  ? 4.020   11.555  -4.960  1.00 0.25  ? 107 DG  B H21    1 
ATOM   223  H  H22    . DG  A 1 7  ? 3.287   12.781  -5.970  1.00 0.27  ? 107 DG  B H22    1 
ATOM   224  P  P      . DA  A 1 8  ? -3.943  15.030  -8.187  1.00 0.42  ? 108 DA  B P      1 
ATOM   225  O  OP1    . DA  A 1 8  ? -4.410  15.906  -9.285  1.00 0.48  ? 108 DA  B OP1    1 
ATOM   226  O  OP2    . DA  A 1 8  ? -4.838  13.981  -7.649  1.00 0.44  ? 108 DA  B OP2    1 
ATOM   227  O  "O5'"  . DA  A 1 8  ? -2.565  14.328  -8.652  1.00 0.38  ? 108 DA  B "O5'"  1 
ATOM   228  C  "C5'"  . DA  A 1 8  ? -1.458  15.119  -9.104  1.00 0.38  ? 108 DA  B "C5'"  1 
ATOM   229  C  "C4'"  . DA  A 1 8  ? -0.341  14.257  -9.710  1.00 0.35  ? 108 DA  B "C4'"  1 
ATOM   230  O  "O4'"  . DA  A 1 8  ? 0.365   13.536  -8.671  1.00 0.30  ? 108 DA  B "O4'"  1 
ATOM   231  C  "C3'"  . DA  A 1 8  ? -0.880  13.228  -10.712 1.00 0.37  ? 108 DA  B "C3'"  1 
ATOM   232  O  "O3'"  . DA  A 1 8  ? -0.123  13.289  -11.932 1.00 0.40  ? 108 DA  B "O3'"  1 
ATOM   233  C  "C2'"  . DA  A 1 8  ? -0.704  11.888  -10.028 1.00 0.35  ? 108 DA  B "C2'"  1 
ATOM   234  C  "C1'"  . DA  A 1 8  ? 0.295   12.112  -8.905  1.00 0.29  ? 108 DA  B "C1'"  1 
ATOM   235  N  N9     . DA  A 1 8  ? -0.095  11.398  -7.671  1.00 0.27  ? 108 DA  B N9     1 
ATOM   236  C  C8     . DA  A 1 8  ? -1.281  11.431  -6.988  1.00 0.34  ? 108 DA  B C8     1 
ATOM   237  N  N7     . DA  A 1 8  ? -1.299  10.772  -5.870  1.00 0.43  ? 108 DA  B N7     1 
ATOM   238  C  C5     . DA  A 1 8  ? -0.013  10.246  -5.800  1.00 0.40  ? 108 DA  B C5     1 
ATOM   239  C  C6     . DA  A 1 8  ? 0.646   9.437   -4.853  1.00 0.50  ? 108 DA  B C6     1 
ATOM   240  N  N6     . DA  A 1 8  ? 0.081   9.064   -3.714  1.00 0.71  ? 108 DA  B N6     1 
ATOM   241  N  N1     . DA  A 1 8  ? 1.933   9.079   -5.095  1.00 0.44  ? 108 DA  B N1     1 
ATOM   242  C  C2     . DA  A 1 8  ? 2.555   9.497   -6.203  1.00 0.30  ? 108 DA  B C2     1 
ATOM   243  N  N3     . DA  A 1 8  ? 2.028   10.277  -7.163  1.00 0.24  ? 108 DA  B N3     1 
ATOM   244  C  C4     . DA  A 1 8  ? 0.729   10.615  -6.895  1.00 0.28  ? 108 DA  B C4     1 
ATOM   245  H  "H5'"  . DA  A 1 8  ? -1.055  15.678  -8.259  1.00 0.37  ? 108 DA  B "H5'"  1 
ATOM   246  H  "H5''" . DA  A 1 8  ? -1.811  15.823  -9.858  1.00 0.43  ? 108 DA  B "H5''" 1 
ATOM   247  H  "H4'"  . DA  A 1 8  ? 0.364   14.910  -10.225 1.00 0.38  ? 108 DA  B "H4'"  1 
ATOM   248  H  "H3'"  . DA  A 1 8  ? -1.937  13.407  -10.928 1.00 0.40  ? 108 DA  B "H3'"  1 
ATOM   249  H  "H2'"  . DA  A 1 8  ? -1.655  11.548  -9.615  1.00 0.38  ? 108 DA  B "H2'"  1 
ATOM   250  H  "H2''" . DA  A 1 8  ? -0.324  11.156  -10.731 1.00 0.39  ? 108 DA  B "H2''" 1 
ATOM   251  H  "H1'"  . DA  A 1 8  ? 1.278   11.756  -9.223  1.00 0.28  ? 108 DA  B "H1'"  1 
ATOM   252  H  H8     . DA  A 1 8  ? -2.154  11.946  -7.366  1.00 0.34  ? 108 DA  B H8     1 
ATOM   253  H  H61    . DA  A 1 8  ? 0.591   8.484   -3.064  1.00 0.78  ? 108 DA  B H61    1 
ATOM   254  H  H62    . DA  A 1 8  ? -0.859  9.361   -3.496  1.00 0.79  ? 108 DA  B H62    1 
ATOM   255  H  H2     . DA  A 1 8  ? 3.579   9.161   -6.343  1.00 0.27  ? 108 DA  B H2     1 
ATOM   256  P  P      . DT  A 1 9  ? -0.373  12.244  -13.136 1.00 0.44  ? 109 DT  B P      1 
ATOM   257  O  OP1    . DT  A 1 9  ? -0.124  12.945  -14.415 1.00 0.52  ? 109 DT  B OP1    1 
ATOM   258  O  OP2    . DT  A 1 9  ? -1.669  11.569  -12.903 1.00 0.48  ? 109 DT  B OP2    1 
ATOM   259  O  "O5'"  . DT  A 1 9  ? 0.806   11.163  -12.916 1.00 0.36  ? 109 DT  B "O5'"  1 
ATOM   260  C  "C5'"  . DT  A 1 9  ? 2.180   11.567  -12.961 1.00 0.35  ? 109 DT  B "C5'"  1 
ATOM   261  C  "C4'"  . DT  A 1 9  ? 3.137   10.382  -12.767 1.00 0.30  ? 109 DT  B "C4'"  1 
ATOM   262  O  "O4'"  . DT  A 1 9  ? 3.047   9.869   -11.419 1.00 0.24  ? 109 DT  B "O4'"  1 
ATOM   263  C  "C3'"  . DT  A 1 9  ? 2.849   9.229   -13.737 1.00 0.31  ? 109 DT  B "C3'"  1 
ATOM   264  O  "O3'"  . DT  A 1 9  ? 3.953   9.039   -14.628 1.00 0.34  ? 109 DT  B "O3'"  1 
ATOM   265  C  "C2'"  . DT  A 1 9  ? 2.642   8.004   -12.867 1.00 0.26  ? 109 DT  B "C2'"  1 
ATOM   266  C  "C1'"  . DT  A 1 9  ? 2.927   8.431   -11.430 1.00 0.22  ? 109 DT  B "C1'"  1 
ATOM   267  N  N1     . DT  A 1 9  ? 1.838   7.996   -10.520 1.00 0.21  ? 109 DT  B N1     1 
ATOM   268  C  C2     . DT  A 1 9  ? 2.148   7.111   -9.485  1.00 0.22  ? 109 DT  B C2     1 
ATOM   269  O  O2     . DT  A 1 9  ? 3.278   6.656   -9.324  1.00 0.24  ? 109 DT  B O2     1 
ATOM   270  N  N3     . DT  A 1 9  ? 1.093   6.777   -8.647  1.00 0.25  ? 109 DT  B N3     1 
ATOM   271  C  C4     . DT  A 1 9  ? -0.217  7.240   -8.750  1.00 0.27  ? 109 DT  B C4     1 
ATOM   272  O  O4     . DT  A 1 9  ? -1.071  6.876   -7.950  1.00 0.31  ? 109 DT  B O4     1 
ATOM   273  C  C5     . DT  A 1 9  ? -0.448  8.152   -9.855  1.00 0.26  ? 109 DT  B C5     1 
ATOM   274  C  C7     . DT  A 1 9  ? -1.848  8.741   -10.056 1.00 0.31  ? 109 DT  B C7     1 
ATOM   275  C  C6     . DT  A 1 9  ? 0.570   8.490   -10.690 1.00 0.23  ? 109 DT  B C6     1 
ATOM   276  H  "H5'"  . DT  A 1 9  ? 2.359   12.299  -12.174 1.00 0.34  ? 109 DT  B "H5'"  1 
ATOM   277  H  "H5''" . DT  A 1 9  ? 2.381   12.029  -13.927 1.00 0.41  ? 109 DT  B "H5''" 1 
ATOM   278  H  "H4'"  . DT  A 1 9  ? 4.156   10.731  -12.937 1.00 0.33  ? 109 DT  B "H4'"  1 
ATOM   279  H  "H3'"  . DT  A 1 9  ? 1.944   9.430   -14.320 1.00 0.35  ? 109 DT  B "H3'"  1 
ATOM   280  H  "H2'"  . DT  A 1 9  ? 1.614   7.647   -12.951 1.00 0.27  ? 109 DT  B "H2'"  1 
ATOM   281  H  "H2''" . DT  A 1 9  ? 3.329   7.214   -13.170 1.00 0.26  ? 109 DT  B "H2''" 1 
ATOM   282  H  "H1'"  . DT  A 1 9  ? 3.875   8.002   -11.108 1.00 0.23  ? 109 DT  B "H1'"  1 
ATOM   283  H  H3     . DT  A 1 9  ? 1.295   6.140   -7.891  1.00 0.27  ? 109 DT  B H3     1 
ATOM   284  H  H71    . DT  A 1 9  ? -1.859  9.402   -10.924 1.00 1.11  ? 109 DT  B H71    1 
ATOM   285  H  H72    . DT  A 1 9  ? -2.131  9.307   -9.168  1.00 1.08  ? 109 DT  B H72    1 
ATOM   286  H  H73    . DT  A 1 9  ? -2.562  7.932   -10.209 1.00 1.04  ? 109 DT  B H73    1 
ATOM   287  H  H6     . DT  A 1 9  ? 0.380   9.152   -11.529 1.00 0.26  ? 109 DT  B H6     1 
ATOM   288  P  P      . DA  A 1 10 ? 3.947   7.841   -15.705 1.00 0.38  ? 110 DA  B P      1 
ATOM   289  O  OP1    . DA  A 1 10 ? 5.071   8.056   -16.643 1.00 0.45  ? 110 DA  B OP1    1 
ATOM   290  O  OP2    . DA  A 1 10 ? 2.570   7.693   -16.225 1.00 0.41  ? 110 DA  B OP2    1 
ATOM   291  O  "O5'"  . DA  A 1 10 ? 4.286   6.551   -14.800 1.00 0.35  ? 110 DA  B "O5'"  1 
ATOM   292  C  "C5'"  . DA  A 1 10 ? 5.587   6.378   -14.229 1.00 0.35  ? 110 DA  B "C5'"  1 
ATOM   293  C  "C4'"  . DA  A 1 10 ? 5.736   4.996   -13.585 1.00 0.33  ? 110 DA  B "C4'"  1 
ATOM   294  O  "O4'"  . DA  A 1 10 ? 4.753   4.822   -12.535 1.00 0.29  ? 110 DA  B "O4'"  1 
ATOM   295  C  "C3'"  . DA  A 1 10 ? 5.538   3.869   -14.605 1.00 0.36  ? 110 DA  B "C3'"  1 
ATOM   296  O  "O3'"  . DA  A 1 10 ? 6.595   2.904   -14.485 1.00 0.40  ? 110 DA  B "O3'"  1 
ATOM   297  C  "C2'"  . DA  A 1 10 ? 4.199   3.254   -14.259 1.00 0.33  ? 110 DA  B "C2'"  1 
ATOM   298  C  "C1'"  . DA  A 1 10 ? 3.837   3.754   -12.866 1.00 0.28  ? 110 DA  B "C1'"  1 
ATOM   299  N  N9     . DA  A 1 10 ? 2.436   4.226   -12.797 1.00 0.24  ? 110 DA  B N9     1 
ATOM   300  C  C8     . DA  A 1 10 ? 1.763   5.079   -13.632 1.00 0.26  ? 110 DA  B C8     1 
ATOM   301  N  N7     . DA  A 1 10 ? 0.526   5.316   -13.303 1.00 0.27  ? 110 DA  B N7     1 
ATOM   302  C  C5     . DA  A 1 10 ? 0.357   4.558   -12.147 1.00 0.24  ? 110 DA  B C5     1 
ATOM   303  C  C6     . DA  A 1 10 ? -0.737  4.355   -11.273 1.00 0.25  ? 110 DA  B C6     1 
ATOM   304  N  N6     . DA  A 1 10 ? -1.923  4.934   -11.455 1.00 0.29  ? 110 DA  B N6     1 
ATOM   305  N  N1     . DA  A 1 10 ? -0.560  3.528   -10.203 1.00 0.23  ? 110 DA  B N1     1 
ATOM   306  C  C2     . DA  A 1 10 ? 0.626   2.930   -9.998  1.00 0.22  ? 110 DA  B C2     1 
ATOM   307  N  N3     . DA  A 1 10 ? 1.721   3.055   -10.765 1.00 0.22  ? 110 DA  B N3     1 
ATOM   308  C  C4     . DA  A 1 10 ? 1.516   3.889   -11.829 1.00 0.22  ? 110 DA  B C4     1 
ATOM   309  H  "H5'"  . DA  A 1 10 ? 5.748   7.143   -13.470 1.00 0.33  ? 110 DA  B "H5'"  1 
ATOM   310  H  "H5''" . DA  A 1 10 ? 6.337   6.490   -15.012 1.00 0.40  ? 110 DA  B "H5''" 1 
ATOM   311  H  "H4'"  . DA  A 1 10 ? 6.733   4.912   -13.154 1.00 0.37  ? 110 DA  B "H4'"  1 
ATOM   312  H  "H3'"  . DA  A 1 10 ? 5.521   4.262   -15.626 1.00 0.38  ? 110 DA  B "H3'"  1 
ATOM   313  H  "H2'"  . DA  A 1 10 ? 3.440   3.568   -14.977 1.00 0.34  ? 110 DA  B "H2'"  1 
ATOM   314  H  "H2''" . DA  A 1 10 ? 4.278   2.173   -14.259 1.00 0.36  ? 110 DA  B "H2''" 1 
ATOM   315  H  "H1'"  . DA  A 1 10 ? 3.968   2.936   -12.151 1.00 0.29  ? 110 DA  B "H1'"  1 
ATOM   316  H  H8     . DA  A 1 10 ? 2.231   5.532   -14.506 1.00 0.29  ? 110 DA  B H8     1 
ATOM   317  H  H61    . DA  A 1 10 ? -2.676  4.759   -10.804 1.00 0.31  ? 110 DA  B H61    1 
ATOM   318  H  H62    . DA  A 1 10 ? -2.070  5.548   -12.243 1.00 0.32  ? 110 DA  B H62    1 
ATOM   319  H  H2     . DA  A 1 10 ? 0.708   2.286   -9.123  1.00 0.23  ? 110 DA  B H2     1 
ATOM   320  P  P      . DA  A 1 11 ? 6.597   1.548   -15.358 1.00 0.45  ? 111 DA  B P      1 
ATOM   321  O  OP1    . DA  A 1 11 ? 8.002   1.197   -15.663 1.00 0.54  ? 111 DA  B OP1    1 
ATOM   322  O  OP2    . DA  A 1 11 ? 5.619   1.702   -16.457 1.00 0.47  ? 111 DA  B OP2    1 
ATOM   323  O  "O5'"  . DA  A 1 11 ? 6.020   0.461   -14.316 1.00 0.39  ? 111 DA  B "O5'"  1 
ATOM   324  C  "C5'"  . DA  A 1 11 ? 6.614   0.313   -13.022 1.00 0.41  ? 111 DA  B "C5'"  1 
ATOM   325  C  "C4'"  . DA  A 1 11 ? 5.849   -0.688  -12.146 1.00 0.36  ? 111 DA  B "C4'"  1 
ATOM   326  O  "O4'"  . DA  A 1 11 ? 4.576   -0.139  -11.738 1.00 0.31  ? 111 DA  B "O4'"  1 
ATOM   327  C  "C3'"  . DA  A 1 11 ? 5.592   -2.019  -12.862 1.00 0.36  ? 111 DA  B "C3'"  1 
ATOM   328  O  "O3'"  . DA  A 1 11 ? 6.284   -3.082  -12.198 1.00 0.41  ? 111 DA  B "O3'"  1 
ATOM   329  C  "C2'"  . DA  A 1 11 ? 4.093   -2.235  -12.801 1.00 0.31  ? 111 DA  B "C2'"  1 
ATOM   330  C  "C1'"  . DA  A 1 11 ? 3.510   -1.075  -12.000 1.00 0.28  ? 111 DA  B "C1'"  1 
ATOM   331  N  N9     . DA  A 1 11 ? 2.420   -0.420  -12.746 1.00 0.25  ? 111 DA  B N9     1 
ATOM   332  C  C8     . DA  A 1 11 ? 2.451   0.140   -13.990 1.00 0.26  ? 111 DA  B C8     1 
ATOM   333  N  N7     . DA  A 1 11 ? 1.328   0.658   -14.396 1.00 0.26  ? 111 DA  B N7     1 
ATOM   334  C  C5     . DA  A 1 11 ? 0.471   0.418   -13.326 1.00 0.24  ? 111 DA  B C5     1 
ATOM   335  C  C6     . DA  A 1 11 ? -0.892  0.712   -13.093 1.00 0.25  ? 111 DA  B C6     1 
ATOM   336  N  N6     . DA  A 1 11 ? -1.656  1.348   -13.981 1.00 0.29  ? 111 DA  B N6     1 
ATOM   337  N  N1     . DA  A 1 11 ? -1.436  0.325   -11.905 1.00 0.26  ? 111 DA  B N1     1 
ATOM   338  C  C2     . DA  A 1 11 ? -0.686  -0.315  -10.991 1.00 0.26  ? 111 DA  B C2     1 
ATOM   339  N  N3     . DA  A 1 11 ? 0.610   -0.639  -11.114 1.00 0.25  ? 111 DA  B N3     1 
ATOM   340  C  C4     . DA  A 1 11 ? 1.128   -0.240  -12.313 1.00 0.24  ? 111 DA  B C4     1 
ATOM   341  H  "H5'"  . DA  A 1 11 ? 6.624   1.283   -12.524 1.00 0.41  ? 111 DA  B "H5'"  1 
ATOM   342  H  "H5''" . DA  A 1 11 ? 7.640   -0.035  -13.141 1.00 0.48  ? 111 DA  B "H5''" 1 
ATOM   343  H  "H4'"  . DA  A 1 11 ? 6.440   -0.888  -11.256 1.00 0.41  ? 111 DA  B "H4'"  1 
ATOM   344  H  "H3'"  . DA  A 1 11 ? 5.921   -1.969  -13.904 1.00 0.38  ? 111 DA  B "H3'"  1 
ATOM   345  H  "H2'"  . DA  A 1 11 ? 3.668   -2.237  -13.808 1.00 0.31  ? 111 DA  B "H2'"  1 
ATOM   346  H  "H2''" . DA  A 1 11 ? 3.876   -3.185  -12.308 1.00 0.33  ? 111 DA  B "H2''" 1 
ATOM   347  H  "H1'"  . DA  A 1 11 ? 3.120   -1.444  -11.049 1.00 0.30  ? 111 DA  B "H1'"  1 
ATOM   348  H  H8     . DA  A 1 11 ? 3.350   0.147   -14.598 1.00 0.28  ? 111 DA  B H8     1 
ATOM   349  H  H61    . DA  A 1 11 ? -2.625  1.536   -13.770 1.00 0.32  ? 111 DA  B H61    1 
ATOM   350  H  H62    . DA  A 1 11 ? -1.265  1.642   -14.864 1.00 0.31  ? 111 DA  B H62    1 
ATOM   351  H  H2     . DA  A 1 11 ? -1.176  -0.594  -10.059 1.00 0.29  ? 111 DA  B H2     1 
ATOM   352  P  P      . DA  A 1 12 ? 6.130   -4.605  -12.697 1.00 0.45  ? 112 DA  B P      1 
ATOM   353  O  OP1    . DA  A 1 12 ? 7.243   -5.395  -12.123 1.00 0.54  ? 112 DA  B OP1    1 
ATOM   354  O  OP2    . DA  A 1 12 ? 5.911   -4.593  -14.160 1.00 0.45  ? 112 DA  B OP2    1 
ATOM   355  O  "O5'"  . DA  A 1 12 ? 4.762   -5.075  -11.988 1.00 0.43  ? 112 DA  B "O5'"  1 
ATOM   356  C  "C5'"  . DA  A 1 12 ? 4.673   -5.177  -10.563 1.00 0.47  ? 112 DA  B "C5'"  1 
ATOM   357  C  "C4'"  . DA  A 1 12 ? 3.264   -5.583  -10.121 1.00 0.49  ? 112 DA  B "C4'"  1 
ATOM   358  O  "O4'"  . DA  A 1 12 ? 2.303   -4.603  -10.586 1.00 0.41  ? 112 DA  B "O4'"  1 
ATOM   359  C  "C3'"  . DA  A 1 12 ? 2.856   -6.954  -10.689 1.00 0.52  ? 112 DA  B "C3'"  1 
ATOM   360  O  "O3'"  . DA  A 1 12 ? 2.342   -7.807  -9.650  1.00 0.61  ? 112 DA  B "O3'"  1 
ATOM   361  C  "C2'"  . DA  A 1 12 ? 1.784   -6.645  -11.709 1.00 0.44  ? 112 DA  B "C2'"  1 
ATOM   362  C  "C1'"  . DA  A 1 12 ? 1.299   -5.236  -11.407 1.00 0.38  ? 112 DA  B "C1'"  1 
ATOM   363  N  N9     . DA  A 1 12 ? 1.048   -4.474  -12.648 1.00 0.31  ? 112 DA  B N9     1 
ATOM   364  C  C8     . DA  A 1 12 ? 1.848   -4.304  -13.746 1.00 0.31  ? 112 DA  B C8     1 
ATOM   365  N  N7     . DA  A 1 12 ? 1.341   -3.570  -14.694 1.00 0.30  ? 112 DA  B N7     1 
ATOM   366  C  C5     . DA  A 1 12 ? 0.093   -3.224  -14.186 1.00 0.28  ? 112 DA  B C5     1 
ATOM   367  C  C6     . DA  A 1 12 ? -0.976  -2.450  -14.690 1.00 0.31  ? 112 DA  B C6     1 
ATOM   368  N  N6     . DA  A 1 12 ? -0.940  -1.856  -15.883 1.00 0.36  ? 112 DA  B N6     1 
ATOM   369  N  N1     . DA  A 1 12 ? -2.088  -2.311  -13.914 1.00 0.32  ? 112 DA  B N1     1 
ATOM   370  C  C2     . DA  A 1 12 ? -2.150  -2.899  -12.707 1.00 0.32  ? 112 DA  B C2     1 
ATOM   371  N  N3     . DA  A 1 12 ? -1.195  -3.649  -12.141 1.00 0.32  ? 112 DA  B N3     1 
ATOM   372  C  C4     . DA  A 1 12 ? -0.095  -3.770  -12.939 1.00 0.29  ? 112 DA  B C4     1 
ATOM   373  H  "H5'"  . DA  A 1 12 ? 4.919   -4.211  -10.120 1.00 0.46  ? 112 DA  B "H5'"  1 
ATOM   374  H  "H5''" . DA  A 1 12 ? 5.386   -5.923  -10.212 1.00 0.53  ? 112 DA  B "H5''" 1 
ATOM   375  H  "H4'"  . DA  A 1 12 ? 3.230   -5.625  -9.032  1.00 0.56  ? 112 DA  B "H4'"  1 
ATOM   376  H  "H3'"  . DA  A 1 12 ? 3.706   -7.445  -11.173 1.00 0.54  ? 112 DA  B "H3'"  1 
ATOM   377  H  "H2'"  . DA  A 1 12 ? 2.197   -6.693  -12.715 1.00 0.43  ? 112 DA  B "H2'"  1 
ATOM   378  H  "H2''" . DA  A 1 12 ? 0.970   -7.343  -11.619 1.00 0.48  ? 112 DA  B "H2''" 1 
ATOM   379  H  "H1'"  . DA  A 1 12 ? 0.369   -5.293  -10.835 1.00 0.42  ? 112 DA  B "H1'"  1 
ATOM   380  H  H8     . DA  A 1 12 ? 2.824   -4.775  -13.834 1.00 0.34  ? 112 DA  B H8     1 
ATOM   381  H  H61    . DA  A 1 12 ? -1.729  -1.313  -16.201 1.00 0.41  ? 112 DA  B H61    1 
ATOM   382  H  H62    . DA  A 1 12 ? -0.123  -1.950  -16.469 1.00 0.39  ? 112 DA  B H62    1 
ATOM   383  H  H2     . DA  A 1 12 ? -3.065  -2.753  -12.134 1.00 0.37  ? 112 DA  B H2     1 
ATOM   384  P  P      . DC  A 1 13 ? 1.673   -9.239  -9.997  1.00 0.69  ? 113 DC  B P      1 
ATOM   385  O  OP1    . DC  A 1 13 ? 1.926   -10.163 -8.871  1.00 0.80  ? 113 DC  B OP1    1 
ATOM   386  O  OP2    . DC  A 1 13 ? 2.086   -9.619  -11.367 1.00 0.67  ? 113 DC  B OP2    1 
ATOM   387  O  "O5'"  . DC  A 1 13 ? 0.093   -8.898  -10.025 1.00 0.66  ? 113 DC  B "O5'"  1 
ATOM   388  C  "C5'"  . DC  A 1 13 ? -0.576  -8.443  -8.842  1.00 0.68  ? 113 DC  B "C5'"  1 
ATOM   389  C  "C4'"  . DC  A 1 13 ? -2.105  -8.434  -9.002  1.00 0.67  ? 113 DC  B "C4'"  1 
ATOM   390  O  "O4'"  . DC  A 1 13 ? -2.522  -7.359  -9.877  1.00 0.58  ? 113 DC  B "O4'"  1 
ATOM   391  C  "C3'"  . DC  A 1 13 ? -2.644  -9.752  -9.574  1.00 0.73  ? 113 DC  B "C3'"  1 
ATOM   392  O  "O3'"  . DC  A 1 13 ? -3.579  -10.344 -8.656  1.00 0.81  ? 113 DC  B "O3'"  1 
ATOM   393  C  "C2'"  . DC  A 1 13 ? -3.327  -9.381  -10.875 1.00 0.66  ? 113 DC  B "C2'"  1 
ATOM   394  C  "C1'"  . DC  A 1 13 ? -3.318  -7.864  -10.973 1.00 0.57  ? 113 DC  B "C1'"  1 
ATOM   395  N  N1     . DC  A 1 13 ? -2.755  -7.402  -12.267 1.00 0.50  ? 113 DC  B N1     1 
ATOM   396  C  C2     . DC  A 1 13 ? -3.543  -6.584  -13.086 1.00 0.45  ? 113 DC  B C2     1 
ATOM   397  O  O2     . DC  A 1 13 ? -4.704  -6.330  -12.774 1.00 0.48  ? 113 DC  B O2     1 
ATOM   398  N  N3     . DC  A 1 13 ? -2.977  -6.089  -14.228 1.00 0.41  ? 113 DC  B N3     1 
ATOM   399  C  C4     . DC  A 1 13 ? -1.700  -6.375  -14.559 1.00 0.41  ? 113 DC  B C4     1 
ATOM   400  N  N4     . DC  A 1 13 ? -1.191  -5.864  -15.680 1.00 0.41  ? 113 DC  B N4     1 
ATOM   401  C  C5     . DC  A 1 13 ? -0.886  -7.217  -13.724 1.00 0.45  ? 113 DC  B C5     1 
ATOM   402  C  C6     . DC  A 1 13 ? -1.464  -7.710  -12.596 1.00 0.49  ? 113 DC  B C6     1 
ATOM   403  H  "H5'"  . DC  A 1 13 ? -0.239  -7.433  -8.613  1.00 0.64  ? 113 DC  B "H5'"  1 
ATOM   404  H  "H5''" . DC  A 1 13 ? -0.312  -9.100  -8.013  1.00 0.77  ? 113 DC  B "H5''" 1 
ATOM   405  H  "H4'"  . DC  A 1 13 ? -2.553  -8.275  -8.022  1.00 0.72  ? 113 DC  B "H4'"  1 
ATOM   406  H  "H3'"  . DC  A 1 13 ? -1.828  -10.456 -9.765  1.00 0.76  ? 113 DC  B "H3'"  1 
ATOM   407  H  "H2'"  . DC  A 1 13 ? -2.796  -9.815  -11.725 1.00 0.65  ? 113 DC  B "H2'"  1 
ATOM   408  H  "H2''" . DC  A 1 13 ? -4.350  -9.735  -10.860 1.00 0.71  ? 113 DC  B "H2''" 1 
ATOM   409  H  "H1'"  . DC  A 1 13 ? -4.339  -7.502  -10.867 1.00 0.58  ? 113 DC  B "H1'"  1 
ATOM   410  H  H41    . DC  A 1 13 ? -1.761  -5.273  -16.268 1.00 0.41  ? 113 DC  B H41    1 
ATOM   411  H  H42    . DC  A 1 13 ? -0.237  -6.068  -15.941 1.00 0.42  ? 113 DC  B H42    1 
ATOM   412  H  H5     . DC  A 1 13 ? 0.163   -7.413  -13.964 1.00 0.46  ? 113 DC  B H5     1 
ATOM   413  H  H6     . DC  A 1 13 ? -0.918  -8.398  -11.961 1.00 0.55  ? 113 DC  B H6     1 
ATOM   414  P  P      . DA  A 1 14 ? -4.469  -11.629 -9.067  1.00 0.89  ? 114 DA  B P      1 
ATOM   415  O  OP1    . DA  A 1 14 ? -5.137  -12.138 -7.848  1.00 0.99  ? 114 DA  B OP1    1 
ATOM   416  O  OP2    . DA  A 1 14 ? -3.625  -12.535 -9.878  1.00 0.92  ? 114 DA  B OP2    1 
ATOM   417  O  "O5'"  . DA  A 1 14 ? -5.597  -10.988 -10.032 1.00 0.85  ? 114 DA  B "O5'"  1 
ATOM   418  C  "C5'"  . DA  A 1 14 ? -6.580  -10.084 -9.510  1.00 0.83  ? 114 DA  B "C5'"  1 
ATOM   419  C  "C4'"  . DA  A 1 14 ? -7.677  -9.767  -10.539 1.00 0.82  ? 114 DA  B "C4'"  1 
ATOM   420  O  "O4'"  . DA  A 1 14 ? -7.159  -8.929  -11.602 1.00 0.72  ? 114 DA  B "O4'"  1 
ATOM   421  C  "C3'"  . DA  A 1 14 ? -8.267  -11.034 -11.174 1.00 0.92  ? 114 DA  B "C3'"  1 
ATOM   422  O  "O3'"  . DA  A 1 14 ? -9.671  -11.129 -10.886 1.00 0.97  ? 114 DA  B "O3'"  1 
ATOM   423  C  "C2'"  . DA  A 1 14 ? -8.029  -10.891 -12.665 1.00 0.91  ? 114 DA  B "C2'"  1 
ATOM   424  C  "C1'"  . DA  A 1 14 ? -7.455  -9.502  -12.896 1.00 0.78  ? 114 DA  B "C1'"  1 
ATOM   425  N  N9     . DA  A 1 14 ? -6.246  -9.550  -13.733 1.00 0.75  ? 114 DA  B N9     1 
ATOM   426  C  C8     . DA  A 1 14 ? -5.084  -10.205 -13.497 1.00 0.78  ? 114 DA  B C8     1 
ATOM   427  N  N7     . DA  A 1 14 ? -4.146  -10.023 -14.379 1.00 0.77  ? 114 DA  B N7     1 
ATOM   428  C  C5     . DA  A 1 14 ? -4.747  -9.166  -15.295 1.00 0.72  ? 114 DA  B C5     1 
ATOM   429  C  C6     . DA  A 1 14 ? -4.302  -8.566  -16.494 1.00 0.70  ? 114 DA  B C6     1 
ATOM   430  N  N6     . DA  A 1 14 ? -3.071  -8.740  -16.973 1.00 0.74  ? 114 DA  B N6     1 
ATOM   431  N  N1     . DA  A 1 14 ? -5.169  -7.762  -17.169 1.00 0.67  ? 114 DA  B N1     1 
ATOM   432  C  C2     . DA  A 1 14 ? -6.409  -7.552  -16.695 1.00 0.66  ? 114 DA  B C2     1 
ATOM   433  N  N3     . DA  A 1 14 ? -6.926  -8.069  -15.568 1.00 0.68  ? 114 DA  B N3     1 
ATOM   434  C  C4     . DA  A 1 14 ? -6.034  -8.872  -14.913 1.00 0.70  ? 114 DA  B C4     1 
ATOM   435  H  "H5'"  . DA  A 1 14 ? -6.088  -9.155  -9.221  1.00 0.77  ? 114 DA  B "H5'"  1 
ATOM   436  H  "H5''" . DA  A 1 14 ? -7.040  -10.530 -8.629  1.00 0.91  ? 114 DA  B "H5''" 1 
ATOM   437  H  "H4'"  . DA  A 1 14 ? -8.479  -9.228  -10.034 1.00 0.83  ? 114 DA  B "H4'"  1 
ATOM   438  H  "H3'"  . DA  A 1 14 ? -7.760  -11.928 -10.798 1.00 0.98  ? 114 DA  B "H3'"  1 
ATOM   439  H  "H2'"  . DA  A 1 14 ? -7.321  -11.646 -13.013 1.00 0.96  ? 114 DA  B "H2'"  1 
ATOM   440  H  "H2''" . DA  A 1 14 ? -8.970  -10.994 -13.197 1.00 0.98  ? 114 DA  B "H2''" 1 
ATOM   441  H  "H1'"  . DA  A 1 14 ? -8.195  -8.890  -13.396 1.00 0.77  ? 114 DA  B "H1'"  1 
ATOM   442  H  H8     . DA  A 1 14 ? -4.961  -10.846 -12.639 1.00 0.83  ? 114 DA  B H8     1 
ATOM   443  H  H61    . DA  A 1 14 ? -2.797  -8.291  -17.835 1.00 0.75  ? 114 DA  B H61    1 
ATOM   444  H  H62    . DA  A 1 14 ? -2.412  -9.321  -16.475 1.00 0.79  ? 114 DA  B H62    1 
ATOM   445  H  H2     . DA  A 1 14 ? -7.059  -6.908  -17.287 1.00 0.66  ? 114 DA  B H2     1 
ATOM   446  P  P      . DT  A 1 15 ? -10.594 -12.260 -11.578 1.00 1.09  ? 115 DT  B P      1 
ATOM   447  O  OP1    . DT  A 1 15 ? -11.890 -12.299 -10.864 1.00 1.16  ? 115 DT  B OP1    1 
ATOM   448  O  OP2    . DT  A 1 15 ? -9.789  -13.494 -11.717 1.00 1.15  ? 115 DT  B OP2    1 
ATOM   449  O  "O5'"  . DT  A 1 15 ? -10.848 -11.652 -13.053 1.00 1.09  ? 115 DT  B "O5'"  1 
ATOM   450  C  "C5'"  . DT  A 1 15 ? -11.600 -10.445 -13.216 1.00 1.05  ? 115 DT  B "C5'"  1 
ATOM   451  C  "C4'"  . DT  A 1 15 ? -11.741 -10.037 -14.690 1.00 1.07  ? 115 DT  B "C4'"  1 
ATOM   452  O  "O4'"  . DT  A 1 15 ? -10.464 -9.637  -15.238 1.00 0.99  ? 115 DT  B "O4'"  1 
ATOM   453  C  "C3'"  . DT  A 1 15 ? -12.294 -11.168 -15.566 1.00 1.21  ? 115 DT  B "C3'"  1 
ATOM   454  O  "O3'"  . DT  A 1 15 ? -13.632 -10.880 -15.981 1.00 1.28  ? 115 DT  B "O3'"  1 
ATOM   455  C  "C2'"  . DT  A 1 15 ? -11.371 -11.238 -16.768 1.00 1.22  ? 115 DT  B "C2'"  1 
ATOM   456  C  "C1'"  . DT  A 1 15 ? -10.314 -10.153 -16.577 1.00 1.07  ? 115 DT  B "C1'"  1 
ATOM   457  N  N1     . DT  A 1 15 ? -8.946  -10.700 -16.784 1.00 1.07  ? 115 DT  B N1     1 
ATOM   458  C  C2     . DT  A 1 15 ? -8.176  -10.189 -17.831 1.00 1.05  ? 115 DT  B C2     1 
ATOM   459  O  O2     . DT  A 1 15 ? -8.590  -9.310  -18.584 1.00 1.06  ? 115 DT  B O2     1 
ATOM   460  N  N3     . DT  A 1 15 ? -6.908  -10.739 -17.967 1.00 1.07  ? 115 DT  B N3     1 
ATOM   461  C  C4     . DT  A 1 15 ? -6.352  -11.733 -17.166 1.00 1.11  ? 115 DT  B C4     1 
ATOM   462  O  O4     . DT  A 1 15 ? -5.213  -12.143 -17.382 1.00 1.15  ? 115 DT  B O4     1 
ATOM   463  C  C5     . DT  A 1 15 ? -7.223  -12.205 -16.105 1.00 1.11  ? 115 DT  B C5     1 
ATOM   464  C  C7     . DT  A 1 15 ? -6.726  -13.303 -15.161 1.00 1.18  ? 115 DT  B C7     1 
ATOM   465  C  C6     . DT  A 1 15 ? -8.467  -11.681 -15.953 1.00 1.09  ? 115 DT  B C6     1 
ATOM   466  H  "H5'"  . DT  A 1 15 ? -11.101 -9.642  -12.674 1.00 0.97  ? 115 DT  B "H5'"  1 
ATOM   467  H  "H5''" . DT  A 1 15 ? -12.595 -10.590 -12.795 1.00 1.12  ? 115 DT  B "H5''" 1 
ATOM   468  H  "H4'"  . DT  A 1 15 ? -12.423 -9.189  -14.749 1.00 1.07  ? 115 DT  B "H4'"  1 
ATOM   469  H  "H3'"  . DT  A 1 15 ? -12.277 -12.119 -15.025 1.00 1.27  ? 115 DT  B "H3'"  1 
ATOM   470  H  "H2'"  . DT  A 1 15 ? -10.893 -12.216 -16.825 1.00 1.27  ? 115 DT  B "H2'"  1 
ATOM   471  H  "H2''" . DT  A 1 15 ? -11.941 -11.055 -17.681 1.00 1.28  ? 115 DT  B "H2''" 1 
ATOM   472  H  "H1'"  . DT  A 1 15 ? -10.499 -9.342  -17.281 1.00 1.07  ? 115 DT  B "H1'"  1 
ATOM   473  H  H3     . DT  A 1 15 ? -6.335  -10.385 -18.716 1.00 1.08  ? 115 DT  B H3     1 
ATOM   474  H  H71    . DT  A 1 15 ? -7.561  -13.708 -14.586 1.00 1.60  ? 115 DT  B H71    1 
ATOM   475  H  H72    . DT  A 1 15 ? -5.985  -12.886 -14.479 1.00 1.62  ? 115 DT  B H72    1 
ATOM   476  H  H73    . DT  A 1 15 ? -6.270  -14.102 -15.745 1.00 1.52  ? 115 DT  B H73    1 
ATOM   477  H  H6     . DT  A 1 15 ? -9.108  -12.048 -15.162 1.00 1.12  ? 115 DT  B H6     1 
ATOM   478  P  P      . DT  A 1 16 ? -14.468 -11.948 -16.850 1.00 1.45  ? 116 DT  B P      1 
ATOM   479  O  OP1    . DT  A 1 16 ? -15.883 -11.515 -16.880 1.00 1.51  ? 116 DT  B OP1    1 
ATOM   480  O  OP2    . DT  A 1 16 ? -14.123 -13.306 -16.371 1.00 1.51  ? 116 DT  B OP2    1 
ATOM   481  O  "O5'"  . DT  A 1 16 ? -13.852 -11.762 -18.326 1.00 1.48  ? 116 DT  B "O5'"  1 
ATOM   482  C  "C5'"  . DT  A 1 16 ? -14.137 -10.585 -19.087 1.00 1.45  ? 116 DT  B "C5'"  1 
ATOM   483  C  "C4'"  . DT  A 1 16 ? -13.430 -10.604 -20.445 1.00 1.50  ? 116 DT  B "C4'"  1 
ATOM   484  O  "O4'"  . DT  A 1 16 ? -11.998 -10.646 -20.271 1.00 1.41  ? 116 DT  B "O4'"  1 
ATOM   485  C  "C3'"  . DT  A 1 16 ? -13.841 -11.810 -21.299 1.00 1.67  ? 116 DT  B "C3'"  1 
ATOM   486  O  "O3'"  . DT  A 1 16 ? -14.641 -11.397 -22.411 1.00 1.77  ? 116 DT  B "O3'"  1 
ATOM   487  C  "C2'"  . DT  A 1 16 ? -12.544 -12.435 -21.773 1.00 1.67  ? 116 DT  B "C2'"  1 
ATOM   488  C  "C1'"  . DT  A 1 16 ? -11.409 -11.622 -21.156 1.00 1.51  ? 116 DT  B "C1'"  1 
ATOM   489  N  N1     . DT  A 1 16 ? -10.476 -12.507 -20.411 1.00 1.49  ? 116 DT  B N1     1 
ATOM   490  C  C2     . DT  A 1 16 ? -9.153  -12.593 -20.849 1.00 1.47  ? 116 DT  B C2     1 
ATOM   491  O  O2     . DT  A 1 16 ? -8.742  -11.967 -21.823 1.00 1.47  ? 116 DT  B O2     1 
ATOM   492  N  N3     . DT  A 1 16 ? -8.331  -13.433 -20.113 1.00 1.48  ? 116 DT  B N3     1 
ATOM   493  C  C4     . DT  A 1 16 ? -8.703  -14.182 -18.999 1.00 1.50  ? 116 DT  B C4     1 
ATOM   494  O  O4     . DT  A 1 16 ? -7.881  -14.895 -18.427 1.00 1.54  ? 116 DT  B O4     1 
ATOM   495  C  C5     . DT  A 1 16 ? -10.096 -14.033 -18.613 1.00 1.51  ? 116 DT  B C5     1 
ATOM   496  C  C7     . DT  A 1 16 ? -10.630 -14.822 -17.414 1.00 1.55  ? 116 DT  B C7     1 
ATOM   497  C  C6     . DT  A 1 16 ? -10.921 -13.212 -19.318 1.00 1.50  ? 116 DT  B C6     1 
ATOM   498  H  "H5'"  . DT  A 1 16 ? -13.805 -9.711  -18.526 1.00 1.35  ? 116 DT  B "H5'"  1 
ATOM   499  H  "H5''" . DT  A 1 16 ? -15.213 -10.517 -19.247 1.00 1.52  ? 116 DT  B "H5''" 1 
ATOM   500  H  "H4'"  . DT  A 1 16 ? -13.689 -9.692  -20.984 1.00 1.51  ? 116 DT  B "H4'"  1 
ATOM   501  H  "H3'"  . DT  A 1 16 ? -14.404 -12.533 -20.698 1.00 1.72  ? 116 DT  B "H3'"  1 
ATOM   502  H  "HO3'" . DT  A 1 16 ? -14.557 -10.443 -22.485 1.00 1.94  ? 116 DT  B "HO3'" 1 
ATOM   503  H  "H2'"  . DT  A 1 16 ? -12.478 -13.474 -21.443 1.00 1.73  ? 116 DT  B "H2'"  1 
ATOM   504  H  "H2''" . DT  A 1 16 ? -12.494 -12.392 -22.863 1.00 1.75  ? 116 DT  B "H2''" 1 
ATOM   505  H  "H1'"  . DT  A 1 16 ? -10.871 -11.095 -21.943 1.00 1.51  ? 116 DT  B "H1'"  1 
ATOM   506  H  H3     . DT  A 1 16 ? -7.372  -13.510 -20.414 1.00 1.49  ? 116 DT  B H3     1 
ATOM   507  H  H71    . DT  A 1 16 ? -10.201 -14.422 -16.496 1.00 1.85  ? 116 DT  B H71    1 
ATOM   508  H  H72    . DT  A 1 16 ? -10.346 -15.870 -17.517 1.00 1.82  ? 116 DT  B H72    1 
ATOM   509  H  H73    . DT  A 1 16 ? -11.718 -14.747 -17.369 1.00 1.87  ? 116 DT  B H73    1 
ATOM   510  H  H6     . DT  A 1 16 ? -11.960 -13.106 -19.016 1.00 1.52  ? 116 DT  B H6     1 
ATOM   511  O  "O5'"  . DA  B 2 1  ? 0.899   -14.071 -23.070 1.00 1.96  ? 117 DA  C "O5'"  1 
ATOM   512  C  "C5'"  . DA  B 2 1  ? 1.117   -14.097 -24.484 1.00 2.14  ? 117 DA  C "C5'"  1 
ATOM   513  C  "C4'"  . DA  B 2 1  ? 0.285   -13.030 -25.201 1.00 1.94  ? 117 DA  C "C4'"  1 
ATOM   514  O  "O4'"  . DA  B 2 1  ? -1.119  -13.348 -25.099 1.00 1.88  ? 117 DA  C "O4'"  1 
ATOM   515  C  "C3'"  . DA  B 2 1  ? 0.499   -11.633 -24.603 1.00 1.67  ? 117 DA  C "C3'"  1 
ATOM   516  O  "O3'"  . DA  B 2 1  ? 0.825   -10.694 -25.632 1.00 1.66  ? 117 DA  C "O3'"  1 
ATOM   517  C  "C2'"  . DA  B 2 1  ? -0.814  -11.267 -23.942 1.00 1.44  ? 117 DA  C "C2'"  1 
ATOM   518  C  "C1'"  . DA  B 2 1  ? -1.798  -12.388 -24.263 1.00 1.59  ? 117 DA  C "C1'"  1 
ATOM   519  N  N9     . DA  B 2 1  ? -2.279  -13.038 -23.035 1.00 1.56  ? 117 DA  C N9     1 
ATOM   520  C  C8     . DA  B 2 1  ? -1.592  -13.840 -22.181 1.00 1.59  ? 117 DA  C C8     1 
ATOM   521  N  N7     . DA  B 2 1  ? -2.285  -14.326 -21.192 1.00 1.58  ? 117 DA  C N7     1 
ATOM   522  C  C5     . DA  B 2 1  ? -3.552  -13.793 -21.411 1.00 1.54  ? 117 DA  C C5     1 
ATOM   523  C  C6     . DA  B 2 1  ? -4.783  -13.906 -20.726 1.00 1.54  ? 117 DA  C C6     1 
ATOM   524  N  N6     . DA  B 2 1  ? -4.933  -14.636 -19.620 1.00 1.58  ? 117 DA  C N6     1 
ATOM   525  N  N1     . DA  B 2 1  ? -5.859  -13.235 -21.227 1.00 1.53  ? 117 DA  C N1     1 
ATOM   526  C  C2     . DA  B 2 1  ? -5.737  -12.489 -22.339 1.00 1.53  ? 117 DA  C C2     1 
ATOM   527  N  N3     . DA  B 2 1  ? -4.618  -12.314 -23.057 1.00 1.53  ? 117 DA  C N3     1 
ATOM   528  C  C4     . DA  B 2 1  ? -3.558  -13.001 -22.535 1.00 1.53  ? 117 DA  C C4     1 
ATOM   529  H  "H5'"  . DA  B 2 1  ? 0.842   -15.080 -24.867 1.00 2.33  ? 117 DA  C "H5'"  1 
ATOM   530  H  "H5''" . DA  B 2 1  ? 2.173   -13.920 -24.684 1.00 2.33  ? 117 DA  C "H5''" 1 
ATOM   531  H  "H4'"  . DA  B 2 1  ? 0.567   -13.011 -26.253 1.00 2.13  ? 117 DA  C "H4'"  1 
ATOM   532  H  "H3'"  . DA  B 2 1  ? 1.304   -11.647 -23.860 1.00 1.77  ? 117 DA  C "H3'"  1 
ATOM   533  H  "H2'"  . DA  B 2 1  ? -0.687  -11.184 -22.860 1.00 1.40  ? 117 DA  C "H2'"  1 
ATOM   534  H  "H2''" . DA  B 2 1  ? -1.175  -10.317 -24.344 1.00 1.34  ? 117 DA  C "H2''" 1 
ATOM   535  H  "H1'"  . DA  B 2 1  ? -2.647  -11.990 -24.803 1.00 1.63  ? 117 DA  C "H1'"  1 
ATOM   536  H  H8     . DA  B 2 1  ? -0.540  -14.058 -22.325 1.00 1.64  ? 117 DA  C H8     1 
ATOM   537  H  H61    . DA  B 2 1  ? -5.834  -14.686 -19.166 1.00 1.59  ? 117 DA  C H61    1 
ATOM   538  H  H62    . DA  B 2 1  ? -4.145  -15.138 -19.236 1.00 1.61  ? 117 DA  C H62    1 
ATOM   539  H  H2     . DA  B 2 1  ? -6.633  -11.977 -22.690 1.00 1.57  ? 117 DA  C H2     1 
ATOM   540  H  "HO5'" . DA  B 2 1  ? 1.738   -13.857 -22.655 1.00 2.24  ? 117 DA  C "HO5'" 1 
ATOM   541  P  P      . DA  B 2 2  ? 1.169   -9.163  -25.268 1.00 1.54  ? 118 DA  C P      1 
ATOM   542  O  OP1    . DA  B 2 2  ? 1.923   -8.578  -26.399 1.00 1.61  ? 118 DA  C OP1    1 
ATOM   543  O  OP2    . DA  B 2 2  ? 1.741   -9.129  -23.904 1.00 1.53  ? 118 DA  C OP2    1 
ATOM   544  O  "O5'"  . DA  B 2 2  ? -0.287  -8.474  -25.222 1.00 1.37  ? 118 DA  C "O5'"  1 
ATOM   545  C  "C5'"  . DA  B 2 2  ? -1.083  -8.375  -26.407 1.00 1.40  ? 118 DA  C "C5'"  1 
ATOM   546  C  "C4'"  . DA  B 2 2  ? -2.315  -7.488  -26.191 1.00 1.28  ? 118 DA  C "C4'"  1 
ATOM   547  O  "O4'"  . DA  B 2 2  ? -3.217  -8.107  -25.245 1.00 1.24  ? 118 DA  C "O4'"  1 
ATOM   548  C  "C3'"  . DA  B 2 2  ? -1.941  -6.098  -25.656 1.00 1.17  ? 118 DA  C "C3'"  1 
ATOM   549  O  "O3'"  . DA  B 2 2  ? -2.498  -5.074  -26.494 1.00 1.15  ? 118 DA  C "O3'"  1 
ATOM   550  C  "C2'"  . DA  B 2 2  ? -2.528  -6.033  -24.260 1.00 1.07  ? 118 DA  C "C2'"  1 
ATOM   551  C  "C1'"  . DA  B 2 2  ? -3.381  -7.278  -24.075 1.00 1.11  ? 118 DA  C "C1'"  1 
ATOM   552  N  N9     . DA  B 2 2  ? -2.994  -8.013  -22.863 1.00 1.10  ? 118 DA  C N9     1 
ATOM   553  C  C8     . DA  B 2 2  ? -1.773  -8.494  -22.522 1.00 1.14  ? 118 DA  C C8     1 
ATOM   554  N  N7     . DA  B 2 2  ? -1.729  -9.172  -21.411 1.00 1.13  ? 118 DA  C N7     1 
ATOM   555  C  C5     . DA  B 2 2  ? -3.050  -9.131  -20.972 1.00 1.08  ? 118 DA  C C5     1 
ATOM   556  C  C6     . DA  B 2 2  ? -3.713  -9.659  -19.841 1.00 1.07  ? 118 DA  C C6     1 
ATOM   557  N  N6     . DA  B 2 2  ? -3.091  -10.386 -18.914 1.00 1.11  ? 118 DA  C N6     1 
ATOM   558  N  N1     . DA  B 2 2  ? -5.050  -9.422  -19.714 1.00 1.04  ? 118 DA  C N1     1 
ATOM   559  C  C2     . DA  B 2 2  ? -5.705  -8.707  -20.645 1.00 1.03  ? 118 DA  C C2     1 
ATOM   560  N  N3     . DA  B 2 2  ? -5.170  -8.168  -21.751 1.00 1.04  ? 118 DA  C N3     1 
ATOM   561  C  C4     . DA  B 2 2  ? -3.831  -8.421  -21.852 1.00 1.06  ? 118 DA  C C4     1 
ATOM   562  H  "H5'"  . DA  B 2 2  ? -1.410  -9.373  -26.699 1.00 1.49  ? 118 DA  C "H5'"  1 
ATOM   563  H  "H5''" . DA  B 2 2  ? -0.476  -7.952  -27.208 1.00 1.45  ? 118 DA  C "H5''" 1 
ATOM   564  H  "H4'"  . DA  B 2 2  ? -2.832  -7.370  -27.143 1.00 1.33  ? 118 DA  C "H4'"  1 
ATOM   565  H  "H3'"  . DA  B 2 2  ? -0.854  -5.977  -25.612 1.00 1.21  ? 118 DA  C "H3'"  1 
ATOM   566  H  "H2'"  . DA  B 2 2  ? -1.732  -6.014  -23.512 1.00 1.06  ? 118 DA  C "H2'"  1 
ATOM   567  H  "H2''" . DA  B 2 2  ? -3.145  -5.146  -24.164 1.00 1.01  ? 118 DA  C "H2''" 1 
ATOM   568  H  "H1'"  . DA  B 2 2  ? -4.421  -6.990  -23.986 1.00 1.08  ? 118 DA  C "H1'"  1 
ATOM   569  H  H8     . DA  B 2 2  ? -0.898  -8.307  -23.133 1.00 1.18  ? 118 DA  C H8     1 
ATOM   570  H  H61    . DA  B 2 2  ? -3.607  -10.742 -18.122 1.00 1.11  ? 118 DA  C H61    1 
ATOM   571  H  H62    . DA  B 2 2  ? -2.104  -10.580 -19.002 1.00 1.15  ? 118 DA  C H62    1 
ATOM   572  H  H2     . DA  B 2 2  ? -6.772  -8.545  -20.481 1.00 1.02  ? 118 DA  C H2     1 
ATOM   573  P  P      . DT  B 2 3  ? -2.432  -3.516  -26.072 1.00 1.09  ? 119 DT  C P      1 
ATOM   574  O  OP1    . DT  B 2 3  ? -2.715  -2.699  -27.273 1.00 1.16  ? 119 DT  C OP1    1 
ATOM   575  O  OP2    . DT  B 2 3  ? -1.184  -3.297  -25.306 1.00 1.10  ? 119 DT  C OP2    1 
ATOM   576  O  "O5'"  . DT  B 2 3  ? -3.681  -3.374  -25.057 1.00 0.99  ? 119 DT  C "O5'"  1 
ATOM   577  C  "C5'"  . DT  B 2 3  ? -5.002  -3.730  -25.481 1.00 1.01  ? 119 DT  C "C5'"  1 
ATOM   578  C  "C4'"  . DT  B 2 3  ? -6.052  -3.513  -24.380 1.00 0.94  ? 119 DT  C "C4'"  1 
ATOM   579  O  "O4'"  . DT  B 2 3  ? -5.922  -4.507  -23.335 1.00 0.89  ? 119 DT  C "O4'"  1 
ATOM   580  C  "C3'"  . DT  B 2 3  ? -5.951  -2.125  -23.730 1.00 0.87  ? 119 DT  C "C3'"  1 
ATOM   581  O  "O3'"  . DT  B 2 3  ? -7.149  -1.372  -23.989 1.00 0.91  ? 119 DT  C "O3'"  1 
ATOM   582  C  "C2'"  . DT  B 2 3  ? -5.778  -2.389  -22.244 1.00 0.77  ? 119 DT  C "C2'"  1 
ATOM   583  C  "C1'"  . DT  B 2 3  ? -6.003  -3.880  -22.037 1.00 0.78  ? 119 DT  C "C1'"  1 
ATOM   584  N  N1     . DT  B 2 3  ? -5.010  -4.472  -21.097 1.00 0.73  ? 119 DT  C N1     1 
ATOM   585  C  C2     . DT  B 2 3  ? -5.486  -5.088  -19.937 1.00 0.70  ? 119 DT  C C2     1 
ATOM   586  O  O2     . DT  B 2 3  ? -6.683  -5.129  -19.659 1.00 0.72  ? 119 DT  C O2     1 
ATOM   587  N  N3     . DT  B 2 3  ? -4.520  -5.653  -19.116 1.00 0.69  ? 119 DT  C N3     1 
ATOM   588  C  C4     . DT  B 2 3  ? -3.147  -5.659  -19.345 1.00 0.72  ? 119 DT  C C4     1 
ATOM   589  O  O4     . DT  B 2 3  ? -2.383  -6.195  -18.545 1.00 0.75  ? 119 DT  C O4     1 
ATOM   590  C  C5     . DT  B 2 3  ? -2.742  -4.997  -20.573 1.00 0.75  ? 119 DT  C C5     1 
ATOM   591  C  C7     . DT  B 2 3  ? -1.258  -4.946  -20.944 1.00 0.82  ? 119 DT  C C7     1 
ATOM   592  C  C6     . DT  B 2 3  ? -3.669  -4.436  -21.391 1.00 0.75  ? 119 DT  C C6     1 
ATOM   593  H  "H5'"  . DT  B 2 3  ? -5.008  -4.780  -25.773 1.00 1.07  ? 119 DT  C "H5'"  1 
ATOM   594  H  "H5''" . DT  B 2 3  ? -5.269  -3.122  -26.346 1.00 1.07  ? 119 DT  C "H5''" 1 
ATOM   595  H  "H4'"  . DT  B 2 3  ? -7.042  -3.612  -24.826 1.00 0.99  ? 119 DT  C "H4'"  1 
ATOM   596  H  "H3'"  . DT  B 2 3  ? -5.086  -1.577  -24.117 1.00 0.90  ? 119 DT  C "H3'"  1 
ATOM   597  H  "H2'"  . DT  B 2 3  ? -4.774  -2.111  -21.920 1.00 0.75  ? 119 DT  C "H2'"  1 
ATOM   598  H  "H2''" . DT  B 2 3  ? -6.515  -1.827  -21.682 1.00 0.75  ? 119 DT  C "H2''" 1 
ATOM   599  H  "H1'"  . DT  B 2 3  ? -7.007  -4.022  -21.641 1.00 0.78  ? 119 DT  C "H1'"  1 
ATOM   600  H  H3     . DT  B 2 3  ? -4.845  -6.104  -18.272 1.00 0.69  ? 119 DT  C H3     1 
ATOM   601  H  H71    . DT  B 2 3  ? -0.675  -4.679  -20.063 1.00 1.34  ? 119 DT  C H71    1 
ATOM   602  H  H72    . DT  B 2 3  ? -1.093  -4.203  -21.726 1.00 1.31  ? 119 DT  C H72    1 
ATOM   603  H  H73    . DT  B 2 3  ? -0.942  -5.926  -21.303 1.00 1.30  ? 119 DT  C H73    1 
ATOM   604  H  H6     . DT  B 2 3  ? -3.348  -3.936  -22.295 1.00 0.80  ? 119 DT  C H6     1 
ATOM   605  P  P      . DG  B 2 4  ? -7.449  0.030   -23.245 1.00 0.90  ? 120 DG  C P      1 
ATOM   606  O  OP1    . DG  B 2 4  ? -8.496  0.744   -24.009 1.00 1.00  ? 120 DG  C OP1    1 
ATOM   607  O  OP2    . DG  B 2 4  ? -6.156  0.693   -22.967 1.00 0.89  ? 120 DG  C OP2    1 
ATOM   608  O  "O5'"  . DG  B 2 4  ? -8.086  -0.447  -21.838 1.00 0.81  ? 120 DG  C "O5'"  1 
ATOM   609  C  "C5'"  . DG  B 2 4  ? -9.264  -1.263  -21.809 1.00 0.83  ? 120 DG  C "C5'"  1 
ATOM   610  C  "C4'"  . DG  B 2 4  ? -9.756  -1.521  -20.376 1.00 0.76  ? 120 DG  C "C4'"  1 
ATOM   611  O  "O4'"  . DG  B 2 4  ? -8.895  -2.475  -19.705 1.00 0.68  ? 120 DG  C "O4'"  1 
ATOM   612  C  "C3'"  . DG  B 2 4  ? -9.796  -0.238  -19.533 1.00 0.74  ? 120 DG  C "C3'"  1 
ATOM   613  O  "O3'"  . DG  B 2 4  ? -11.120 -0.014  -19.024 1.00 0.78  ? 120 DG  C "O3'"  1 
ATOM   614  C  "C2'"  . DG  B 2 4  ? -8.812  -0.469  -18.404 1.00 0.63  ? 120 DG  C "C2'"  1 
ATOM   615  C  "C1'"  . DG  B 2 4  ? -8.432  -1.944  -18.443 1.00 0.60  ? 120 DG  C "C1'"  1 
ATOM   616  N  N9     . DG  B 2 4  ? -6.976  -2.137  -18.290 1.00 0.55  ? 120 DG  C N9     1 
ATOM   617  C  C8     . DG  B 2 4  ? -5.961  -1.550  -18.978 1.00 0.57  ? 120 DG  C C8     1 
ATOM   618  N  N7     . DG  B 2 4  ? -4.762  -1.924  -18.641 1.00 0.53  ? 120 DG  C N7     1 
ATOM   619  C  C5     . DG  B 2 4  ? -4.994  -2.845  -17.627 1.00 0.47  ? 120 DG  C C5     1 
ATOM   620  C  C6     . DG  B 2 4  ? -4.071  -3.611  -16.842 1.00 0.43  ? 120 DG  C C6     1 
ATOM   621  O  O6     . DG  B 2 4  ? -2.844  -3.613  -16.906 1.00 0.44  ? 120 DG  C O6     1 
ATOM   622  N  N1     . DG  B 2 4  ? -4.723  -4.434  -15.910 1.00 0.42  ? 120 DG  C N1     1 
ATOM   623  C  C2     . DG  B 2 4  ? -6.102  -4.515  -15.747 1.00 0.44  ? 120 DG  C C2     1 
ATOM   624  N  N2     . DG  B 2 4  ? -6.545  -5.355  -14.811 1.00 0.45  ? 120 DG  C N2     1 
ATOM   625  N  N3     . DG  B 2 4  ? -6.973  -3.794  -16.486 1.00 0.47  ? 120 DG  C N3     1 
ATOM   626  C  C4     . DG  B 2 4  ? -6.354  -2.985  -17.401 1.00 0.49  ? 120 DG  C C4     1 
ATOM   627  H  "H5'"  . DG  B 2 4  ? -9.046  -2.218  -22.286 1.00 0.85  ? 120 DG  C "H5'"  1 
ATOM   628  H  "H5''" . DG  B 2 4  ? -10.055 -0.761  -22.368 1.00 0.90  ? 120 DG  C "H5''" 1 
ATOM   629  H  "H4'"  . DG  B 2 4  ? -10.763 -1.936  -20.425 1.00 0.81  ? 120 DG  C "H4'"  1 
ATOM   630  H  "H3'"  . DG  B 2 4  ? -9.487  0.628   -20.128 1.00 0.81  ? 120 DG  C "H3'"  1 
ATOM   631  H  "H2'"  . DG  B 2 4  ? -7.927  0.147   -18.546 1.00 0.65  ? 120 DG  C "H2'"  1 
ATOM   632  H  "H2''" . DG  B 2 4  ? -9.274  -0.229  -17.455 1.00 0.58  ? 120 DG  C "H2''" 1 
ATOM   633  H  "H1'"  . DG  B 2 4  ? -8.937  -2.463  -17.631 1.00 0.58  ? 120 DG  C "H1'"  1 
ATOM   634  H  H8     . DG  B 2 4  ? -6.143  -0.788  -19.723 1.00 0.63  ? 120 DG  C H8     1 
ATOM   635  H  H1     . DG  B 2 4  ? -4.126  -4.999  -15.322 1.00 0.41  ? 120 DG  C H1     1 
ATOM   636  H  H21    . DG  B 2 4  ? -5.888  -5.891  -14.262 1.00 0.45  ? 120 DG  C H21    1 
ATOM   637  H  H22    . DG  B 2 4  ? -7.537  -5.455  -14.651 1.00 0.49  ? 120 DG  C H22    1 
ATOM   638  P  P      . DT  B 2 5  ? -11.423 1.170   -17.969 1.00 0.80  ? 121 DT  C P      1 
ATOM   639  O  OP1    . DT  B 2 5  ? -12.890 1.343   -17.875 1.00 0.91  ? 121 DT  C OP1    1 
ATOM   640  O  OP2    . DT  B 2 5  ? -10.564 2.326   -18.310 1.00 0.82  ? 121 DT  C OP2    1 
ATOM   641  O  "O5'"  . DT  B 2 5  ? -10.899 0.542   -16.577 1.00 0.69  ? 121 DT  C "O5'"  1 
ATOM   642  C  "C5'"  . DT  B 2 5  ? -11.469 -0.670  -16.073 1.00 0.69  ? 121 DT  C "C5'"  1 
ATOM   643  C  "C4'"  . DT  B 2 5  ? -10.775 -1.156  -14.793 1.00 0.59  ? 121 DT  C "C4'"  1 
ATOM   644  O  "O4'"  . DT  B 2 5  ? -9.491  -1.751  -15.094 1.00 0.50  ? 121 DT  C "O4'"  1 
ATOM   645  C  "C3'"  . DT  B 2 5  ? -10.535 -0.024  -13.786 1.00 0.58  ? 121 DT  C "C3'"  1 
ATOM   646  O  "O3'"  . DT  B 2 5  ? -11.405 -0.152  -12.658 1.00 0.63  ? 121 DT  C "O3'"  1 
ATOM   647  C  "C2'"  . DT  B 2 5  ? -9.089  -0.174  -13.350 1.00 0.48  ? 121 DT  C "C2'"  1 
ATOM   648  C  "C1'"  . DT  B 2 5  ? -8.549  -1.416  -14.056 1.00 0.43  ? 121 DT  C "C1'"  1 
ATOM   649  N  N1     . DT  B 2 5  ? -7.180  -1.177  -14.609 1.00 0.38  ? 121 DT  C N1     1 
ATOM   650  C  C2     . DT  B 2 5  ? -6.137  -1.975  -14.134 1.00 0.41  ? 121 DT  C C2     1 
ATOM   651  O  O2     . DT  B 2 5  ? -6.315  -2.861  -13.300 1.00 0.48  ? 121 DT  C O2     1 
ATOM   652  N  N3     . DT  B 2 5  ? -4.882  -1.705  -14.664 1.00 0.45  ? 121 DT  C N3     1 
ATOM   653  C  C4     . DT  B 2 5  ? -4.579  -0.725  -15.606 1.00 0.42  ? 121 DT  C C4     1 
ATOM   654  O  O4     . DT  B 2 5  ? -3.426  -0.576  -16.003 1.00 0.49  ? 121 DT  C O4     1 
ATOM   655  C  C5     . DT  B 2 5  ? -5.722  0.057   -16.041 1.00 0.42  ? 121 DT  C C5     1 
ATOM   656  C  C7     . DT  B 2 5  ? -5.530  1.195   -17.037 1.00 0.52  ? 121 DT  C C7     1 
ATOM   657  C  C6     . DT  B 2 5  ? -6.955  -0.188  -15.547 1.00 0.43  ? 121 DT  C C6     1 
ATOM   658  H  "H5'"  . DT  B 2 5  ? -11.384 -1.444  -16.836 1.00 0.70  ? 121 DT  C "H5'"  1 
ATOM   659  H  "H5''" . DT  B 2 5  ? -12.524 -0.501  -15.859 1.00 0.77  ? 121 DT  C "H5''" 1 
ATOM   660  H  "H4'"  . DT  B 2 5  ? -11.405 -1.910  -14.323 1.00 0.64  ? 121 DT  C "H4'"  1 
ATOM   661  H  "H3'"  . DT  B 2 5  ? -10.686 0.953   -14.256 1.00 0.64  ? 121 DT  C "H3'"  1 
ATOM   662  H  "H2'"  . DT  B 2 5  ? -8.511  0.704   -13.641 1.00 0.49  ? 121 DT  C "H2'"  1 
ATOM   663  H  "H2''" . DT  B 2 5  ? -9.041  -0.302  -12.267 1.00 0.46  ? 121 DT  C "H2''" 1 
ATOM   664  H  "H1'"  . DT  B 2 5  ? -8.520  -2.246  -13.341 1.00 0.43  ? 121 DT  C "H1'"  1 
ATOM   665  H  H3     . DT  B 2 5  ? -4.118  -2.277  -14.340 1.00 0.57  ? 121 DT  C H3     1 
ATOM   666  H  H71    . DT  B 2 5  ? -5.801  0.861   -18.033 1.00 1.12  ? 121 DT  C H71    1 
ATOM   667  H  H72    . DT  B 2 5  ? -4.489  1.508   -17.032 1.00 1.20  ? 121 DT  C H72    1 
ATOM   668  H  H73    . DT  B 2 5  ? -6.166  2.033   -16.753 1.00 1.17  ? 121 DT  C H73    1 
ATOM   669  H  H6     . DT  B 2 5  ? -7.785  0.409   -15.902 1.00 0.55  ? 121 DT  C H6     1 
ATOM   670  P  P      . DT  B 2 6  ? -11.330 0.906   -11.446 1.00 0.66  ? 122 DT  C P      1 
ATOM   671  O  OP1    . DT  B 2 6  ? -12.598 0.831   -10.687 1.00 0.80  ? 122 DT  C OP1    1 
ATOM   672  O  OP2    . DT  B 2 6  ? -10.872 2.203   -11.992 1.00 0.72  ? 122 DT  C OP2    1 
ATOM   673  O  "O5'"  . DT  B 2 6  ? -10.153 0.305   -10.524 1.00 0.49  ? 122 DT  C "O5'"  1 
ATOM   674  C  "C5'"  . DT  B 2 6  ? -10.282 -0.992  -9.936  1.00 0.46  ? 122 DT  C "C5'"  1 
ATOM   675  C  "C4'"  . DT  B 2 6  ? -9.070  -1.343  -9.067  1.00 0.35  ? 122 DT  C "C4'"  1 
ATOM   676  O  "O4'"  . DT  B 2 6  ? -7.886  -1.496  -9.882  1.00 0.29  ? 122 DT  C "O4'"  1 
ATOM   677  C  "C3'"  . DT  B 2 6  ? -8.783  -0.270  -8.010  1.00 0.33  ? 122 DT  C "C3'"  1 
ATOM   678  O  "O3'"  . DT  B 2 6  ? -9.078  -0.752  -6.697  1.00 0.34  ? 122 DT  C "O3'"  1 
ATOM   679  C  "C2'"  . DT  B 2 6  ? -7.308  0.047   -8.143  1.00 0.29  ? 122 DT  C "C2'"  1 
ATOM   680  C  "C1'"  . DT  B 2 6  ? -6.768  -0.808  -9.285  1.00 0.26  ? 122 DT  C "C1'"  1 
ATOM   681  N  N1     . DT  B 2 6  ? -6.074  0.045   -10.291 1.00 0.26  ? 122 DT  C N1     1 
ATOM   682  C  C2     . DT  B 2 6  ? -4.704  -0.142  -10.479 1.00 0.29  ? 122 DT  C C2     1 
ATOM   683  O  O2     . DT  B 2 6  ? -4.064  -0.983  -9.851  1.00 0.33  ? 122 DT  C O2     1 
ATOM   684  N  N3     . DT  B 2 6  ? -4.107  0.683   -11.422 1.00 0.31  ? 122 DT  C N3     1 
ATOM   685  C  C4     . DT  B 2 6  ? -4.743  1.662   -12.180 1.00 0.32  ? 122 DT  C C4     1 
ATOM   686  O  O4     . DT  B 2 6  ? -4.106  2.334   -12.989 1.00 0.36  ? 122 DT  C O4     1 
ATOM   687  C  C5     . DT  B 2 6  ? -6.166  1.792   -11.923 1.00 0.32  ? 122 DT  C C5     1 
ATOM   688  C  C7     . DT  B 2 6  ? -6.970  2.845   -12.692 1.00 0.41  ? 122 DT  C C7     1 
ATOM   689  C  C6     . DT  B 2 6  ? -6.777  0.995   -11.005 1.00 0.30  ? 122 DT  C C6     1 
ATOM   690  H  "H5'"  . DT  B 2 6  ? -10.375 -1.734  -10.730 1.00 0.49  ? 122 DT  C "H5'"  1 
ATOM   691  H  "H5''" . DT  B 2 6  ? -11.180 -1.016  -9.320  1.00 0.55  ? 122 DT  C "H5''" 1 
ATOM   692  H  "H4'"  . DT  B 2 6  ? -9.267  -2.287  -8.560  1.00 0.41  ? 122 DT  C "H4'"  1 
ATOM   693  H  "H3'"  . DT  B 2 6  ? -9.376  0.629   -8.204  1.00 0.39  ? 122 DT  C "H3'"  1 
ATOM   694  H  "H2'"  . DT  B 2 6  ? -7.168  1.101   -8.377  1.00 0.35  ? 122 DT  C "H2'"  1 
ATOM   695  H  "H2''" . DT  B 2 6  ? -6.793  -0.193  -7.210  1.00 0.30  ? 122 DT  C "H2''" 1 
ATOM   696  H  "H1'"  . DT  B 2 6  ? -6.074  -1.554  -8.882  1.00 0.28  ? 122 DT  C "H1'"  1 
ATOM   697  H  H3     . DT  B 2 6  ? -3.116  0.561   -11.573 1.00 0.35  ? 122 DT  C H3     1 
ATOM   698  H  H71    . DT  B 2 6  ? -7.963  2.954   -12.252 1.00 1.10  ? 122 DT  C H71    1 
ATOM   699  H  H72    . DT  B 2 6  ? -7.066  2.537   -13.733 1.00 1.14  ? 122 DT  C H72    1 
ATOM   700  H  H73    . DT  B 2 6  ? -6.448  3.801   -12.645 1.00 1.09  ? 122 DT  C H73    1 
ATOM   701  H  H6     . DT  B 2 6  ? -7.846  1.110   -10.827 1.00 0.34  ? 122 DT  C H6     1 
ATOM   702  P  P      . DT  B 2 7  ? -8.801  0.176   -5.409  1.00 0.34  ? 123 DT  C P      1 
ATOM   703  O  OP1    . DT  B 2 7  ? -9.527  -0.400  -4.255  1.00 0.40  ? 123 DT  C OP1    1 
ATOM   704  O  OP2    . DT  B 2 7  ? -9.025  1.585   -5.795  1.00 0.38  ? 123 DT  C OP2    1 
ATOM   705  O  "O5'"  . DT  B 2 7  ? -7.224  -0.021  -5.164  1.00 0.28  ? 123 DT  C "O5'"  1 
ATOM   706  C  "C5'"  . DT  B 2 7  ? -6.713  -1.259  -4.669  1.00 0.28  ? 123 DT  C "C5'"  1 
ATOM   707  C  "C4'"  . DT  B 2 7  ? -5.228  -1.145  -4.323  1.00 0.27  ? 123 DT  C "C4'"  1 
ATOM   708  O  "O4'"  . DT  B 2 7  ? -4.475  -0.739  -5.492  1.00 0.25  ? 123 DT  C "O4'"  1 
ATOM   709  C  "C3'"  . DT  B 2 7  ? -4.970  -0.114  -3.212  1.00 0.26  ? 123 DT  C "C3'"  1 
ATOM   710  O  "O3'"  . DT  B 2 7  ? -4.166  -0.712  -2.176  1.00 0.30  ? 123 DT  C "O3'"  1 
ATOM   711  C  "C2'"  . DT  B 2 7  ? -4.247  1.024   -3.906  1.00 0.24  ? 123 DT  C "C2'"  1 
ATOM   712  C  "C1'"  . DT  B 2 7  ? -3.694  0.436   -5.196  1.00 0.24  ? 123 DT  C "C1'"  1 
ATOM   713  N  N1     . DT  B 2 7  ? -3.731  1.413   -6.329  1.00 0.22  ? 123 DT  C N1     1 
ATOM   714  C  C2     . DT  B 2 7  ? -2.523  1.702   -6.973  1.00 0.24  ? 123 DT  C C2     1 
ATOM   715  O  O2     . DT  B 2 7  ? -1.462  1.179   -6.640  1.00 0.27  ? 123 DT  C O2     1 
ATOM   716  N  N3     . DT  B 2 7  ? -2.595  2.614   -8.017  1.00 0.25  ? 123 DT  C N3     1 
ATOM   717  C  C4     . DT  B 2 7  ? -3.743  3.258   -8.468  1.00 0.24  ? 123 DT  C C4     1 
ATOM   718  O  O4     . DT  B 2 7  ? -3.683  4.051   -9.405  1.00 0.27  ? 123 DT  C O4     1 
ATOM   719  C  C5     . DT  B 2 7  ? -4.955  2.906   -7.748  1.00 0.22  ? 123 DT  C C5     1 
ATOM   720  C  C7     . DT  B 2 7  ? -6.274  3.578   -8.140  1.00 0.23  ? 123 DT  C C7     1 
ATOM   721  C  C6     . DT  B 2 7  ? -4.917  2.010   -6.723  1.00 0.22  ? 123 DT  C C6     1 
ATOM   722  H  "H5'"  . DT  B 2 7  ? -6.844  -2.028  -5.431  1.00 0.29  ? 123 DT  C "H5'"  1 
ATOM   723  H  "H5''" . DT  B 2 7  ? -7.268  -1.544  -3.775  1.00 0.32  ? 123 DT  C "H5''" 1 
ATOM   724  H  "H4'"  . DT  B 2 7  ? -4.868  -2.119  -3.992  1.00 0.31  ? 123 DT  C "H4'"  1 
ATOM   725  H  "H3'"  . DT  B 2 7  ? -5.911  0.245   -2.783  1.00 0.26  ? 123 DT  C "H3'"  1 
ATOM   726  H  "H2'"  . DT  B 2 7  ? -4.942  1.833   -4.121  1.00 0.24  ? 123 DT  C "H2'"  1 
ATOM   727  H  "H2''" . DT  B 2 7  ? -3.442  1.399   -3.294  1.00 0.27  ? 123 DT  C "H2''" 1 
ATOM   728  H  "H1'"  . DT  B 2 7  ? -2.662  0.124   -5.011  1.00 0.26  ? 123 DT  C "H1'"  1 
ATOM   729  H  H3     . DT  B 2 7  ? -1.732  2.830   -8.495  1.00 0.28  ? 123 DT  C H3     1 
ATOM   730  H  H71    . DT  B 2 7  ? -6.141  4.659   -8.131  1.00 1.03  ? 123 DT  C H71    1 
ATOM   731  H  H72    . DT  B 2 7  ? -7.061  3.305   -7.436  1.00 0.99  ? 123 DT  C H72    1 
ATOM   732  H  H73    . DT  B 2 7  ? -6.558  3.258   -9.142  1.00 1.07  ? 123 DT  C H73    1 
ATOM   733  H  H6     . DT  B 2 7  ? -5.845  1.746   -6.212  1.00 0.22  ? 123 DT  C H6     1 
ATOM   734  P  P      . DA  B 2 8  ? -3.415  0.169   -1.050  1.00 0.33  ? 124 DA  C P      1 
ATOM   735  O  OP1    . DA  B 2 8  ? -3.449  -0.583  0.225   1.00 0.41  ? 124 DA  C OP1    1 
ATOM   736  O  OP2    . DA  B 2 8  ? -3.945  1.549   -1.108  1.00 0.34  ? 124 DA  C OP2    1 
ATOM   737  O  "O5'"  . DA  B 2 8  ? -1.892  0.185   -1.588  1.00 0.29  ? 124 DA  C "O5'"  1 
ATOM   738  C  "C5'"  . DA  B 2 8  ? -1.122  -1.020  -1.577  1.00 0.33  ? 124 DA  C "C5'"  1 
ATOM   739  C  "C4'"  . DA  B 2 8  ? 0.372   -0.771  -1.835  1.00 0.30  ? 124 DA  C "C4'"  1 
ATOM   740  O  "O4'"  . DA  B 2 8  ? 0.546   -0.034  -3.066  1.00 0.28  ? 124 DA  C "O4'"  1 
ATOM   741  C  "C3'"  . DA  B 2 8  ? 1.025   0.038   -0.707  1.00 0.28  ? 124 DA  C "C3'"  1 
ATOM   742  O  "O3'"  . DA  B 2 8  ? 2.284   -0.531  -0.330  1.00 0.31  ? 124 DA  C "O3'"  1 
ATOM   743  C  "C2'"  . DA  B 2 8  ? 1.220   1.421   -1.285  1.00 0.24  ? 124 DA  C "C2'"  1 
ATOM   744  C  "C1'"  . DA  B 2 8  ? 1.039   1.294   -2.794  1.00 0.24  ? 124 DA  C "C1'"  1 
ATOM   745  N  N9     . DA  B 2 8  ? 0.104   2.304   -3.305  1.00 0.22  ? 124 DA  C N9     1 
ATOM   746  C  C8     . DA  B 2 8  ? -1.155  2.570   -2.885  1.00 0.23  ? 124 DA  C C8     1 
ATOM   747  N  N7     . DA  B 2 8  ? -1.782  3.500   -3.544  1.00 0.24  ? 124 DA  C N7     1 
ATOM   748  C  C5     . DA  B 2 8  ? -0.844  3.887   -4.495  1.00 0.22  ? 124 DA  C C5     1 
ATOM   749  C  C6     . DA  B 2 8  ? -0.857  4.844   -5.533  1.00 0.24  ? 124 DA  C C6     1 
ATOM   750  N  N6     . DA  B 2 8  ? -1.913  5.620   -5.779  1.00 0.28  ? 124 DA  C N6     1 
ATOM   751  N  N1     . DA  B 2 8  ? 0.263   4.973   -6.302  1.00 0.23  ? 124 DA  C N1     1 
ATOM   752  C  C2     . DA  B 2 8  ? 1.340   4.202   -6.064  1.00 0.22  ? 124 DA  C C2     1 
ATOM   753  N  N3     . DA  B 2 8  ? 1.451   3.268   -5.108  1.00 0.21  ? 124 DA  C N3     1 
ATOM   754  C  C4     . DA  B 2 8  ? 0.316   3.163   -4.357  1.00 0.21  ? 124 DA  C C4     1 
ATOM   755  H  "H5'"  . DA  B 2 8  ? -1.507  -1.693  -2.343  1.00 0.34  ? 124 DA  C "H5'"  1 
ATOM   756  H  "H5''" . DA  B 2 8  ? -1.239  -1.486  -0.608  1.00 0.40  ? 124 DA  C "H5''" 1 
ATOM   757  H  "H4'"  . DA  B 2 8  ? 0.881   -1.731  -1.922  1.00 0.34  ? 124 DA  C "H4'"  1 
ATOM   758  H  "H3'"  . DA  B 2 8  ? 0.373   0.076   0.171   1.00 0.30  ? 124 DA  C "H3'"  1 
ATOM   759  H  "H2'"  . DA  B 2 8  ? 0.475   2.100   -0.880  1.00 0.25  ? 124 DA  C "H2'"  1 
ATOM   760  H  "H2''" . DA  B 2 8  ? 2.219   1.787   -1.053  1.00 0.24  ? 124 DA  C "H2''" 1 
ATOM   761  H  "H1'"  . DA  B 2 8  ? 1.994   1.424   -3.285  1.00 0.24  ? 124 DA  C "H1'"  1 
ATOM   762  H  H8     . DA  B 2 8  ? -1.603  2.031   -2.060  1.00 0.25  ? 124 DA  C H8     1 
ATOM   763  H  H61    . DA  B 2 8  ? -1.880  6.292   -6.532  1.00 0.30  ? 124 DA  C H61    1 
ATOM   764  H  H62    . DA  B 2 8  ? -2.745  5.535   -5.214  1.00 0.30  ? 124 DA  C H62    1 
ATOM   765  H  H2     . DA  B 2 8  ? 2.206   4.350   -6.710  1.00 0.23  ? 124 DA  C H2     1 
ATOM   766  P  P      . DT  B 2 9  ? 3.207   0.181   0.788   1.00 0.32  ? 125 DT  C P      1 
ATOM   767  O  OP1    . DT  B 2 9  ? 4.166   -0.821  1.304   1.00 0.38  ? 125 DT  C OP1    1 
ATOM   768  O  OP2    . DT  B 2 9  ? 2.321   0.906   1.727   1.00 0.32  ? 125 DT  C OP2    1 
ATOM   769  O  "O5'"  . DT  B 2 9  ? 4.028   1.270   -0.075  1.00 0.29  ? 125 DT  C "O5'"  1 
ATOM   770  C  "C5'"  . DT  B 2 9  ? 4.993   0.839   -1.038  1.00 0.32  ? 125 DT  C "C5'"  1 
ATOM   771  C  "C4'"  . DT  B 2 9  ? 5.614   2.008   -1.814  1.00 0.31  ? 125 DT  C "C4'"  1 
ATOM   772  O  "O4'"  . DT  B 2 9  ? 4.642   2.635   -2.682  1.00 0.30  ? 125 DT  C "O4'"  1 
ATOM   773  C  "C3'"  . DT  B 2 9  ? 6.193   3.098   -0.894  1.00 0.29  ? 125 DT  C "C3'"  1 
ATOM   774  O  "O3'"  . DT  B 2 9  ? 7.618   3.204   -1.093  1.00 0.31  ? 125 DT  C "O3'"  1 
ATOM   775  C  "C2'"  . DT  B 2 9  ? 5.483   4.372   -1.311  1.00 0.28  ? 125 DT  C "C2'"  1 
ATOM   776  C  "C1'"  . DT  B 2 9  ? 4.831   4.061   -2.648  1.00 0.29  ? 125 DT  C "C1'"  1 
ATOM   777  N  N1     . DT  B 2 9  ? 3.544   4.790   -2.864  1.00 0.32  ? 125 DT  C N1     1 
ATOM   778  C  C2     . DT  B 2 9  ? 3.421   5.562   -4.027  1.00 0.41  ? 125 DT  C C2     1 
ATOM   779  O  O2     . DT  B 2 9  ? 4.345   5.697   -4.825  1.00 0.44  ? 125 DT  C O2     1 
ATOM   780  N  N3     . DT  B 2 9  ? 2.187   6.167   -4.222  1.00 0.51  ? 125 DT  C N3     1 
ATOM   781  C  C4     . DT  B 2 9  ? 1.083   6.071   -3.378  1.00 0.51  ? 125 DT  C C4     1 
ATOM   782  O  O4     . DT  B 2 9  ? 0.011   6.585   -3.684  1.00 0.67  ? 125 DT  C O4     1 
ATOM   783  C  C5     . DT  B 2 9  ? 1.301   5.270   -2.195  1.00 0.40  ? 125 DT  C C5     1 
ATOM   784  C  C7     . DT  B 2 9  ? 0.171   5.141   -1.179  1.00 0.41  ? 125 DT  C C7     1 
ATOM   785  C  C6     . DT  B 2 9  ? 2.497   4.663   -1.976  1.00 0.31  ? 125 DT  C C6     1 
ATOM   786  H  "H5'"  . DT  B 2 9  ? 4.509   0.166   -1.745  1.00 0.35  ? 125 DT  C "H5'"  1 
ATOM   787  H  "H5''" . DT  B 2 9  ? 5.787   0.298   -0.523  1.00 0.36  ? 125 DT  C "H5''" 1 
ATOM   788  H  "H4'"  . DT  B 2 9  ? 6.419   1.619   -2.432  1.00 0.35  ? 125 DT  C "H4'"  1 
ATOM   789  H  "H3'"  . DT  B 2 9  ? 5.983   2.875   0.157   1.00 0.31  ? 125 DT  C "H3'"  1 
ATOM   790  H  "H2'"  . DT  B 2 9  ? 4.735   4.652   -0.572  1.00 0.29  ? 125 DT  C "H2'"  1 
ATOM   791  H  "H2''" . DT  B 2 9  ? 6.193   5.167   -1.426  1.00 0.30  ? 125 DT  C "H2''" 1 
ATOM   792  H  "H1'"  . DT  B 2 9  ? 5.538   4.330   -3.434  1.00 0.31  ? 125 DT  C "H1'"  1 
ATOM   793  H  H3     . DT  B 2 9  ? 2.084   6.740   -5.051  1.00 0.59  ? 125 DT  C H3     1 
ATOM   794  H  H71    . DT  B 2 9  ? -0.760  4.915   -1.699  1.00 1.09  ? 125 DT  C H71    1 
ATOM   795  H  H72    . DT  B 2 9  ? 0.064   6.080   -0.636  1.00 1.14  ? 125 DT  C H72    1 
ATOM   796  H  H73    . DT  B 2 9  ? 0.394   4.344   -0.479  1.00 1.07  ? 125 DT  C H73    1 
ATOM   797  H  H6     . DT  B 2 9  ? 2.630   4.060   -1.084  1.00 0.28  ? 125 DT  C H6     1 
ATOM   798  P  P      . DC  B 2 10 ? 8.484   4.435   -0.497  1.00 0.33  ? 126 DC  C P      1 
ATOM   799  O  OP1    . DC  B 2 10 ? 9.893   3.998   -0.383  1.00 0.38  ? 126 DC  C OP1    1 
ATOM   800  O  OP2    . DC  B 2 10 ? 7.778   4.964   0.692   1.00 0.35  ? 126 DC  C OP2    1 
ATOM   801  O  "O5'"  . DC  B 2 10 ? 8.394   5.544   -1.673  1.00 0.30  ? 126 DC  C "O5'"  1 
ATOM   802  C  "C5'"  . DC  B 2 10 ? 9.173   5.407   -2.871  1.00 0.32  ? 126 DC  C "C5'"  1 
ATOM   803  C  "C4'"  . DC  B 2 10 ? 9.162   6.685   -3.729  1.00 0.33  ? 126 DC  C "C4'"  1 
ATOM   804  O  "O4'"  . DC  B 2 10 ? 7.827   6.946   -4.233  1.00 0.31  ? 126 DC  C "O4'"  1 
ATOM   805  C  "C3'"  . DC  B 2 10 ? 9.619   7.926   -2.944  1.00 0.34  ? 126 DC  C "C3'"  1 
ATOM   806  O  "O3'"  . DC  B 2 10 ? 10.876  8.415   -3.416  1.00 0.42  ? 126 DC  C "O3'"  1 
ATOM   807  C  "C2'"  . DC  B 2 10 ? 8.540   8.967   -3.151  1.00 0.30  ? 126 DC  C "C2'"  1 
ATOM   808  C  "C1'"  . DC  B 2 10 ? 7.423   8.308   -3.950  1.00 0.28  ? 126 DC  C "C1'"  1 
ATOM   809  N  N1     . DC  B 2 10 ? 6.177   8.332   -3.152  1.00 0.25  ? 126 DC  C N1     1 
ATOM   810  C  C2     . DC  B 2 10 ? 5.064   9.027   -3.644  1.00 0.26  ? 126 DC  C C2     1 
ATOM   811  O  O2     . DC  B 2 10 ? 5.110   9.596   -4.735  1.00 0.28  ? 126 DC  C O2     1 
ATOM   812  N  N3     . DC  B 2 10 ? 3.944   9.057   -2.862  1.00 0.26  ? 126 DC  C N3     1 
ATOM   813  C  C4     . DC  B 2 10 ? 3.911   8.440   -1.660  1.00 0.27  ? 126 DC  C C4     1 
ATOM   814  N  N4     . DC  B 2 10 ? 2.805   8.495   -0.936  1.00 0.32  ? 126 DC  C N4     1 
ATOM   815  C  C5     . DC  B 2 10 ? 5.049   7.731   -1.156  1.00 0.26  ? 126 DC  C C5     1 
ATOM   816  C  C6     . DC  B 2 10 ? 6.150   7.707   -1.934  1.00 0.25  ? 126 DC  C C6     1 
ATOM   817  H  "H5'"  . DC  B 2 10 ? 8.769   4.584   -3.460  1.00 0.32  ? 126 DC  C "H5'"  1 
ATOM   818  H  "H5''" . DC  B 2 10 ? 10.202  5.174   -2.598  1.00 0.36  ? 126 DC  C "H5''" 1 
ATOM   819  H  "H4'"  . DC  B 2 10 ? 9.839   6.537   -4.578  1.00 0.38  ? 126 DC  C "H4'"  1 
ATOM   820  H  "H3'"  . DC  B 2 10 ? 9.705   7.692   -1.878  1.00 0.35  ? 126 DC  C "H3'"  1 
ATOM   821  H  "H2'"  . DC  B 2 10 ? 8.165   9.317   -2.192  1.00 0.30  ? 126 DC  C "H2'"  1 
ATOM   822  H  "H2''" . DC  B 2 10 ? 8.935   9.807   -3.697  1.00 0.32  ? 126 DC  C "H2''" 1 
ATOM   823  H  "H1'"  . DC  B 2 10 ? 7.277   8.840   -4.897  1.00 0.30  ? 126 DC  C "H1'"  1 
ATOM   824  H  H41    . DC  B 2 10 ? 2.005   9.008   -1.284  1.00 0.34  ? 126 DC  C H41    1 
ATOM   825  H  H42    . DC  B 2 10 ? 2.764   8.039   -0.035  1.00 0.36  ? 126 DC  C H42    1 
ATOM   826  H  H5     . DC  B 2 10 ? 5.031   7.240   -0.183  1.00 0.29  ? 126 DC  C H5     1 
ATOM   827  H  H6     . DC  B 2 10 ? 7.045   7.196   -1.583  1.00 0.26  ? 126 DC  C H6     1 
ATOM   828  P  P      . DT  B 2 11 ? 11.648  9.570   -2.597  1.00 0.48  ? 127 DT  C P      1 
ATOM   829  O  OP1    . DT  B 2 11 ? 13.055  9.596   -3.046  1.00 0.57  ? 127 DT  C OP1    1 
ATOM   830  O  OP2    . DT  B 2 11 ? 11.340  9.398   -1.159  1.00 0.48  ? 127 DT  C OP2    1 
ATOM   831  O  "O5'"  . DT  B 2 11 ? 10.931  10.923  -3.110  1.00 0.48  ? 127 DT  C "O5'"  1 
ATOM   832  C  "C5'"  . DT  B 2 11 ? 10.936  11.261  -4.500  1.00 0.53  ? 127 DT  C "C5'"  1 
ATOM   833  C  "C4'"  . DT  B 2 11 ? 10.111  12.507  -4.802  1.00 0.56  ? 127 DT  C "C4'"  1 
ATOM   834  O  "O4'"  . DT  B 2 11 ? 8.710   12.240  -4.592  1.00 0.49  ? 127 DT  C "O4'"  1 
ATOM   835  C  "C3'"  . DT  B 2 11 ? 10.511  13.702  -3.936  1.00 0.60  ? 127 DT  C "C3'"  1 
ATOM   836  O  "O3'"  . DT  B 2 11 ? 11.095  14.724  -4.749  1.00 0.71  ? 127 DT  C "O3'"  1 
ATOM   837  C  "C2'"  . DT  B 2 11 ? 9.224   14.185  -3.298  1.00 0.55  ? 127 DT  C "C2'"  1 
ATOM   838  C  "C1'"  . DT  B 2 11 ? 8.101   13.308  -3.845  1.00 0.50  ? 127 DT  C "C1'"  1 
ATOM   839  N  N1     . DT  B 2 11 ? 7.259   12.758  -2.745  1.00 0.43  ? 127 DT  C N1     1 
ATOM   840  C  C2     . DT  B 2 11 ? 5.911   13.116  -2.721  1.00 0.45  ? 127 DT  C C2     1 
ATOM   841  O  O2     . DT  B 2 11 ? 5.418   13.868  -3.558  1.00 0.50  ? 127 DT  C O2     1 
ATOM   842  N  N3     . DT  B 2 11 ? 5.161   12.568  -1.693  1.00 0.43  ? 127 DT  C N3     1 
ATOM   843  C  C4     . DT  B 2 11 ? 5.623   11.711  -0.700  1.00 0.40  ? 127 DT  C C4     1 
ATOM   844  O  O4     . DT  B 2 11 ? 4.858   11.290  0.164   1.00 0.43  ? 127 DT  C O4     1 
ATOM   845  C  C5     . DT  B 2 11 ? 7.034   11.388  -0.794  1.00 0.38  ? 127 DT  C C5     1 
ATOM   846  C  C7     . DT  B 2 11 ? 7.652   10.455  0.249   1.00 0.39  ? 127 DT  C C7     1 
ATOM   847  C  C6     . DT  B 2 11 ? 7.798   11.909  -1.793  1.00 0.39  ? 127 DT  C C6     1 
ATOM   848  H  "H5'"  . DT  B 2 11 ? 10.515  10.436  -5.060  1.00 0.51  ? 127 DT  C "H5'"  1 
ATOM   849  H  "H5''" . DT  B 2 11 ? 11.957  11.427  -4.822  1.00 0.60  ? 127 DT  C "H5''" 1 
ATOM   850  H  "H4'"  . DT  B 2 11 ? 10.259  12.774  -5.849  1.00 0.63  ? 127 DT  C "H4'"  1 
ATOM   851  H  "H3'"  . DT  B 2 11 ? 11.224  13.401  -3.162  1.00 0.61  ? 127 DT  C "H3'"  1 
ATOM   852  H  "H2'"  . DT  B 2 11 ? 9.275   14.084  -2.212  1.00 0.53  ? 127 DT  C "H2'"  1 
ATOM   853  H  "H2''" . DT  B 2 11 ? 9.054   15.229  -3.564  1.00 0.60  ? 127 DT  C "H2''" 1 
ATOM   854  H  "H1'"  . DT  B 2 11 ? 7.483   13.900  -4.531  1.00 0.54  ? 127 DT  C "H1'"  1 
ATOM   855  H  H3     . DT  B 2 11 ? 4.184   12.810  -1.665  1.00 0.46  ? 127 DT  C H3     1 
ATOM   856  H  H71    . DT  B 2 11 ? 8.733   10.596  0.279   1.00 1.11  ? 127 DT  C H71    1 
ATOM   857  H  H72    . DT  B 2 11 ? 7.427   9.420   -0.009  1.00 1.11  ? 127 DT  C H72    1 
ATOM   858  H  H73    . DT  B 2 11 ? 7.230   10.679  1.228   1.00 1.07  ? 127 DT  C H73    1 
ATOM   859  H  H6     . DT  B 2 11 ? 8.855   11.646  -1.848  1.00 0.40  ? 127 DT  C H6     1 
ATOM   860  P  P      . DG  B 2 12 ? 11.712  16.055  -4.089  1.00 0.81  ? 128 DG  C P      1 
ATOM   861  O  OP1    . DG  B 2 12 ? 12.699  16.624  -5.034  1.00 0.91  ? 128 DG  C OP1    1 
ATOM   862  O  OP2    . DG  B 2 12 ? 12.115  15.741  -2.701  1.00 0.79  ? 128 DG  C OP2    1 
ATOM   863  O  "O5'"  . DG  B 2 12 ? 10.440  17.039  -4.037  1.00 0.84  ? 128 DG  C "O5'"  1 
ATOM   864  C  "C5'"  . DG  B 2 12 ? 9.712   17.346  -5.229  1.00 0.89  ? 128 DG  C "C5'"  1 
ATOM   865  C  "C4'"  . DG  B 2 12 ? 8.490   18.218  -4.929  1.00 0.92  ? 128 DG  C "C4'"  1 
ATOM   866  O  "O4'"  . DG  B 2 12 ? 7.494   17.455  -4.212  1.00 0.78  ? 128 DG  C "O4'"  1 
ATOM   867  C  "C3'"  . DG  B 2 12 ? 8.852   19.448  -4.086  1.00 1.05  ? 128 DG  C "C3'"  1 
ATOM   868  O  "O3'"  . DG  B 2 12 ? 8.543   20.652  -4.790  1.00 1.20  ? 128 DG  C "O3'"  1 
ATOM   869  C  "C2'"  . DG  B 2 12 ? 8.024   19.339  -2.824  1.00 0.98  ? 128 DG  C "C2'"  1 
ATOM   870  C  "C1'"  . DG  B 2 12 ? 7.134   18.112  -2.979  1.00 0.81  ? 128 DG  C "C1'"  1 
ATOM   871  N  N9     . DG  B 2 12 ? 7.299   17.202  -1.836  1.00 0.71  ? 128 DG  C N9     1 
ATOM   872  C  C8     . DG  B 2 12 ? 8.434   16.605  -1.392  1.00 0.73  ? 128 DG  C C8     1 
ATOM   873  N  N7     . DG  B 2 12 ? 8.291   15.827  -0.358  1.00 0.70  ? 128 DG  C N7     1 
ATOM   874  C  C5     . DG  B 2 12 ? 6.929   15.918  -0.085  1.00 0.64  ? 128 DG  C C5     1 
ATOM   875  C  C6     . DG  B 2 12 ? 6.143   15.293  0.939   1.00 0.64  ? 128 DG  C C6     1 
ATOM   876  O  O6     . DG  B 2 12 ? 6.520   14.519  1.816   1.00 0.71  ? 128 DG  C O6     1 
ATOM   877  N  N1     . DG  B 2 12 ? 4.788   15.659  0.864   1.00 0.59  ? 128 DG  C N1     1 
ATOM   878  C  C2     . DG  B 2 12 ? 4.247   16.522  -0.082  1.00 0.56  ? 128 DG  C C2     1 
ATOM   879  N  N2     . DG  B 2 12 ? 2.939   16.764  0.006   1.00 0.54  ? 128 DG  C N2     1 
ATOM   880  N  N3     . DG  B 2 12 ? 4.986   17.108  -1.047  1.00 0.61  ? 128 DG  C N3     1 
ATOM   881  C  C4     . DG  B 2 12 ? 6.309   16.763  -0.989  1.00 0.64  ? 128 DG  C C4     1 
ATOM   882  H  "H5'"  . DG  B 2 12 ? 9.381   16.418  -5.695  1.00 0.83  ? 128 DG  C "H5'"  1 
ATOM   883  H  "H5''" . DG  B 2 12 ? 10.367  17.878  -5.920  1.00 0.97  ? 128 DG  C "H5''" 1 
ATOM   884  H  "H4'"  . DG  B 2 12 ? 8.060   18.555  -5.873  1.00 1.00  ? 128 DG  C "H4'"  1 
ATOM   885  H  "H3'"  . DG  B 2 12 ? 9.917   19.445  -3.832  1.00 1.09  ? 128 DG  C "H3'"  1 
ATOM   886  H  "H2'"  . DG  B 2 12 ? 8.672   19.215  -1.954  1.00 0.99  ? 128 DG  C "H2'"  1 
ATOM   887  H  "H2''" . DG  B 2 12 ? 7.416   20.238  -2.704  1.00 1.06  ? 128 DG  C "H2''" 1 
ATOM   888  H  "H1'"  . DG  B 2 12 ? 6.097   18.418  -3.034  1.00 0.81  ? 128 DG  C "H1'"  1 
ATOM   889  H  H8     . DG  B 2 12 ? 9.393   16.784  -1.864  1.00 0.79  ? 128 DG  C H8     1 
ATOM   890  H  H1     . DG  B 2 12 ? 4.178   15.252  1.558   1.00 0.61  ? 128 DG  C H1     1 
ATOM   891  H  H21    . DG  B 2 12 ? 2.392   16.322  0.731   1.00 0.54  ? 128 DG  C H21    1 
ATOM   892  H  H22    . DG  B 2 12 ? 2.495   17.388  -0.652  1.00 0.57  ? 128 DG  C H22    1 
ATOM   893  P  P      . DC  B 2 13 ? 8.969   22.082  -4.186  1.00 1.38  ? 129 DC  C P      1 
ATOM   894  O  OP1    . DC  B 2 13 ? 8.955   23.073  -5.285  1.00 1.53  ? 129 DC  C OP1    1 
ATOM   895  O  OP2    . DC  B 2 13 ? 10.195  21.895  -3.377  1.00 1.39  ? 129 DC  C OP2    1 
ATOM   896  O  "O5'"  . DC  B 2 13 ? 7.752   22.417  -3.187  1.00 1.38  ? 129 DC  C "O5'"  1 
ATOM   897  C  "C5'"  . DC  B 2 13 ? 6.421   22.564  -3.688  1.00 1.37  ? 129 DC  C "C5'"  1 
ATOM   898  C  "C4'"  . DC  B 2 13 ? 5.466   23.081  -2.607  1.00 1.38  ? 129 DC  C "C4'"  1 
ATOM   899  O  "O4'"  . DC  B 2 13 ? 5.241   22.061  -1.605  1.00 1.23  ? 129 DC  C "O4'"  1 
ATOM   900  C  "C3'"  . DC  B 2 13 ? 6.013   24.329  -1.904  1.00 1.53  ? 129 DC  C "C3'"  1 
ATOM   901  O  "O3'"  . DC  B 2 13 ? 5.075   25.411  -2.005  1.00 1.63  ? 129 DC  C "O3'"  1 
ATOM   902  C  "C2'"  . DC  B 2 13 ? 6.211   23.925  -0.459  1.00 1.48  ? 129 DC  C "C2'"  1 
ATOM   903  C  "C1'"  . DC  B 2 13 ? 5.599   22.543  -0.292  1.00 1.29  ? 129 DC  C "C1'"  1 
ATOM   904  N  N1     . DC  B 2 13 ? 6.542   21.596  0.373   1.00 1.22  ? 129 DC  C N1     1 
ATOM   905  C  C2     . DC  B 2 13 ? 6.122   20.980  1.559   1.00 1.17  ? 129 DC  C C2     1 
ATOM   906  O  O2     . DC  B 2 13 ? 5.024   21.250  2.041   1.00 1.17  ? 129 DC  C O2     1 
ATOM   907  N  N3     . DC  B 2 13 ? 6.966   20.081  2.149   1.00 1.15  ? 129 DC  C N3     1 
ATOM   908  C  C4     . DC  B 2 13 ? 8.169   19.791  1.614   1.00 1.17  ? 129 DC  C C4     1 
ATOM   909  N  N4     . DC  B 2 13 ? 8.952   18.897  2.221   1.00 1.18  ? 129 DC  C N4     1 
ATOM   910  C  C5     . DC  B 2 13 ? 8.613   20.421  0.400   1.00 1.20  ? 129 DC  C C5     1 
ATOM   911  C  C6     . DC  B 2 13 ? 7.772   21.312  -0.183  1.00 1.23  ? 129 DC  C C6     1 
ATOM   912  H  "H5'"  . DC  B 2 13 ? 6.065   21.598  -4.046  1.00 1.26  ? 129 DC  C "H5'"  1 
ATOM   913  H  "H5''" . DC  B 2 13 ? 6.430   23.269  -4.520  1.00 1.49  ? 129 DC  C "H5''" 1 
ATOM   914  H  "H4'"  . DC  B 2 13 ? 4.513   23.330  -3.073  1.00 1.40  ? 129 DC  C "H4'"  1 
ATOM   915  H  "H3'"  . DC  B 2 13 ? 6.968   24.637  -2.342  1.00 1.62  ? 129 DC  C "H3'"  1 
ATOM   916  H  "H2'"  . DC  B 2 13 ? 7.274   23.898  -0.209  1.00 1.52  ? 129 DC  C "H2'"  1 
ATOM   917  H  "H2''" . DC  B 2 13 ? 5.699   24.631  0.184   1.00 1.54  ? 129 DC  C "H2''" 1 
ATOM   918  H  "H1'"  . DC  B 2 13 ? 4.688   22.640  0.310   1.00 1.27  ? 129 DC  C "H1'"  1 
ATOM   919  H  H41    . DC  B 2 13 ? 8.644   18.452  3.074   1.00 1.18  ? 129 DC  C H41    1 
ATOM   920  H  H42    . DC  B 2 13 ? 9.853   18.665  1.828   1.00 1.20  ? 129 DC  C H42    1 
ATOM   921  H  H5     . DC  B 2 13 ? 9.588   20.194  -0.033  1.00 1.22  ? 129 DC  C H5     1 
ATOM   922  H  H6     . DC  B 2 13 ? 8.073   21.810  -1.105  1.00 1.28  ? 129 DC  C H6     1 
ATOM   923  P  P      . DA  B 2 14 ? 5.324   26.811  -1.240  1.00 1.81  ? 130 DA  C P      1 
ATOM   924  O  OP1    . DA  B 2 14 ? 4.464   27.840  -1.867  1.00 1.93  ? 130 DA  C OP1    1 
ATOM   925  O  OP2    . DA  B 2 14 ? 6.784   27.030  -1.141  1.00 1.87  ? 130 DA  C OP2    1 
ATOM   926  O  "O5'"  . DA  B 2 14 ? 4.756   26.512  0.243   1.00 1.78  ? 130 DA  C "O5'"  1 
ATOM   927  C  "C5'"  . DA  B 2 14 ? 3.363   26.246  0.449   1.00 1.72  ? 130 DA  C "C5'"  1 
ATOM   928  C  "C4'"  . DA  B 2 14 ? 2.995   26.202  1.941   1.00 1.72  ? 130 DA  C "C4'"  1 
ATOM   929  O  "O4'"  . DA  B 2 14 ? 3.523   25.006  2.561   1.00 1.60  ? 130 DA  C "O4'"  1 
ATOM   930  C  "C3'"  . DA  B 2 14 ? 3.529   27.418  2.713   1.00 1.90  ? 130 DA  C "C3'"  1 
ATOM   931  O  "O3'"  . DA  B 2 14 ? 2.444   28.151  3.303   1.00 1.99  ? 130 DA  C "O3'"  1 
ATOM   932  C  "C2'"  . DA  B 2 14 ? 4.441   26.852  3.783   1.00 1.90  ? 130 DA  C "C2'"  1 
ATOM   933  C  "C1'"  . DA  B 2 14 ? 4.317   25.338  3.721   1.00 1.71  ? 130 DA  C "C1'"  1 
ATOM   934  N  N9     . DA  B 2 14 ? 5.637   24.695  3.649   1.00 1.68  ? 130 DA  C N9     1 
ATOM   935  C  C8     . DA  B 2 14 ? 6.623   24.892  2.742   1.00 1.71  ? 130 DA  C C8     1 
ATOM   936  N  N7     . DA  B 2 14 ? 7.683   24.152  2.894   1.00 1.69  ? 130 DA  C N7     1 
ATOM   937  C  C5     . DA  B 2 14 ? 7.367   23.392  4.016   1.00 1.64  ? 130 DA  C C5     1 
ATOM   938  C  C6     . DA  B 2 14 ? 8.058   22.391  4.733   1.00 1.62  ? 130 DA  C C6     1 
ATOM   939  N  N6     . DA  B 2 14 ? 9.276   21.970  4.392   1.00 1.65  ? 130 DA  C N6     1 
ATOM   940  N  N1     . DA  B 2 14 ? 7.443   21.839  5.817   1.00 1.60  ? 130 DA  C N1     1 
ATOM   941  C  C2     . DA  B 2 14 ? 6.214   22.246  6.180   1.00 1.59  ? 130 DA  C C2     1 
ATOM   942  N  N3     . DA  B 2 14 ? 5.476   23.184  5.567   1.00 1.60  ? 130 DA  C N3     1 
ATOM   943  C  C4     . DA  B 2 14 ? 6.118   23.718  4.487   1.00 1.63  ? 130 DA  C C4     1 
ATOM   944  H  "H5'"  . DA  B 2 14 ? 3.116   25.286  -0.004  1.00 1.60  ? 130 DA  C "H5'"  1 
ATOM   945  H  "H5''" . DA  B 2 14 ? 2.778   27.027  -0.037  1.00 1.81  ? 130 DA  C "H5''" 1 
ATOM   946  H  "H4'"  . DA  B 2 14 ? 1.909   26.187  2.028   1.00 1.70  ? 130 DA  C "H4'"  1 
ATOM   947  H  "H3'"  . DA  B 2 14 ? 4.094   28.081  2.050   1.00 1.98  ? 130 DA  C "H3'"  1 
ATOM   948  H  "H2'"  . DA  B 2 14 ? 5.476   27.147  3.599   1.00 1.95  ? 130 DA  C "H2'"  1 
ATOM   949  H  "H2''" . DA  B 2 14 ? 4.122   27.208  4.760   1.00 2.01  ? 130 DA  C "H2''" 1 
ATOM   950  H  "H1'"  . DA  B 2 14 ? 3.812   24.987  4.611   1.00 1.70  ? 130 DA  C "H1'"  1 
ATOM   951  H  H8     . DA  B 2 14 ? 6.528   25.622  1.954   1.00 1.77  ? 130 DA  C H8     1 
ATOM   952  H  H61    . DA  B 2 14 ? 9.732   21.251  4.935   1.00 1.66  ? 130 DA  C H61    1 
ATOM   953  H  H62    . DA  B 2 14 ? 9.742   22.370  3.590   1.00 1.68  ? 130 DA  C H62    1 
ATOM   954  H  H2     . DA  B 2 14 ? 5.774   21.769  7.056   1.00 1.58  ? 130 DA  C H2     1 
ATOM   955  P  P      . DA  B 2 15 ? 2.714   29.375  4.322   1.00 2.19  ? 131 DA  C P      1 
ATOM   956  O  OP1    . DA  B 2 15 ? 1.435   30.088  4.539   1.00 2.27  ? 131 DA  C OP1    1 
ATOM   957  O  OP2    . DA  B 2 15 ? 3.902   30.119  3.847   1.00 2.29  ? 131 DA  C OP2    1 
ATOM   958  O  "O5'"  . DA  B 2 15 ? 3.108   28.616  5.693   1.00 2.19  ? 131 DA  C "O5'"  1 
ATOM   959  C  "C5'"  . DA  B 2 15 ? 2.127   27.863  6.416   1.00 2.11  ? 131 DA  C "C5'"  1 
ATOM   960  C  "C4'"  . DA  B 2 15 ? 2.633   27.429  7.801   1.00 2.16  ? 131 DA  C "C4'"  1 
ATOM   961  O  "O4'"  . DA  B 2 15 ? 3.569   26.331  7.684   1.00 2.06  ? 131 DA  C "O4'"  1 
ATOM   962  C  "C3'"  . DA  B 2 15 ? 3.326   28.571  8.557   1.00 2.36  ? 131 DA  C "C3'"  1 
ATOM   963  O  "O3'"  . DA  B 2 15 ? 2.575   28.927  9.729   1.00 2.45  ? 131 DA  C "O3'"  1 
ATOM   964  C  "C2'"  . DA  B 2 15 ? 4.692   28.036  8.935   1.00 2.40  ? 131 DA  C "C2'"  1 
ATOM   965  C  "C1'"  . DA  B 2 15 ? 4.757   26.593  8.463   1.00 2.20  ? 131 DA  C "C1'"  1 
ATOM   966  N  N9     . DA  B 2 15 ? 5.971   26.345  7.670   1.00 2.20  ? 131 DA  C N9     1 
ATOM   967  C  C8     . DA  B 2 15 ? 6.385   26.970  6.540   1.00 2.22  ? 131 DA  C C8     1 
ATOM   968  N  N7     . DA  B 2 15 ? 7.497   26.528  6.029   1.00 2.21  ? 131 DA  C N7     1 
ATOM   969  C  C5     . DA  B 2 15 ? 7.857   25.511  6.907   1.00 2.19  ? 131 DA  C C5     1 
ATOM   970  C  C6     . DA  B 2 15 ? 8.948   24.616  6.957   1.00 2.19  ? 131 DA  C C6     1 
ATOM   971  N  N6     . DA  B 2 15 ? 9.923   24.616  6.048   1.00 2.20  ? 131 DA  C N6     1 
ATOM   972  N  N1     . DA  B 2 15 ? 8.997   23.720  7.983   1.00 2.19  ? 131 DA  C N1     1 
ATOM   973  C  C2     . DA  B 2 15 ? 8.027   23.701  8.914   1.00 2.18  ? 131 DA  C C2     1 
ATOM   974  N  N3     . DA  B 2 15 ? 6.953   24.505  8.956   1.00 2.18  ? 131 DA  C N3     1 
ATOM   975  C  C4     . DA  B 2 15 ? 6.932   25.391  7.916   1.00 2.18  ? 131 DA  C C4     1 
ATOM   976  H  "H5'"  . DA  B 2 15 ? 1.867   26.975  5.841   1.00 1.98  ? 131 DA  C "H5'"  1 
ATOM   977  H  "H5''" . DA  B 2 15 ? 1.235   28.477  6.543   1.00 2.18  ? 131 DA  C "H5''" 1 
ATOM   978  H  "H4'"  . DA  B 2 15 ? 1.779   27.093  8.390   1.00 2.13  ? 131 DA  C "H4'"  1 
ATOM   979  H  "H3'"  . DA  B 2 15 ? 3.434   29.451  7.915   1.00 2.44  ? 131 DA  C "H3'"  1 
ATOM   980  H  "H2'"  . DA  B 2 15 ? 5.481   28.620  8.455   1.00 2.47  ? 131 DA  C "H2'"  1 
ATOM   981  H  "H2''" . DA  B 2 15 ? 4.809   28.072  10.012  1.00 2.49  ? 131 DA  C "H2''" 1 
ATOM   982  H  "H1'"  . DA  B 2 15 ? 4.771   25.938  9.325   1.00 2.20  ? 131 DA  C "H1'"  1 
ATOM   983  H  H8     . DA  B 2 15 ? 5.824   27.783  6.105   1.00 2.25  ? 131 DA  C H8     1 
ATOM   984  H  H61    . DA  B 2 15 ? 10.685  23.957  6.124   1.00 2.21  ? 131 DA  C H61    1 
ATOM   985  H  H62    . DA  B 2 15 ? 9.900   25.276  5.284   1.00 2.22  ? 131 DA  C H62    1 
ATOM   986  H  H2     . DA  B 2 15 ? 8.122   22.963  9.710   1.00 2.20  ? 131 DA  C H2     1 
ATOM   987  P  P      . DC  B 2 16 ? 3.172   29.950  10.828  1.00 2.67  ? 132 DC  C P      1 
ATOM   988  O  OP1    . DC  B 2 16 ? 2.081   30.319  11.758  1.00 2.74  ? 132 DC  C OP1    1 
ATOM   989  O  OP2    . DC  B 2 16 ? 3.923   31.008  10.116  1.00 2.77  ? 132 DC  C OP2    1 
ATOM   990  O  "O5'"  . DC  B 2 16 ? 4.231   29.031  11.630  1.00 2.71  ? 132 DC  C "O5'"  1 
ATOM   991  C  "C5'"  . DC  B 2 16 ? 3.779   27.934  12.432  1.00 2.62  ? 132 DC  C "C5'"  1 
ATOM   992  C  "C4'"  . DC  B 2 16 ? 4.930   27.240  13.176  1.00 2.68  ? 132 DC  C "C4'"  1 
ATOM   993  O  "O4'"  . DC  B 2 16 ? 5.827   26.585  12.249  1.00 2.58  ? 132 DC  C "O4'"  1 
ATOM   994  C  "C3'"  . DC  B 2 16 ? 5.759   28.218  14.016  1.00 2.90  ? 132 DC  C "C3'"  1 
ATOM   995  O  "O3'"  . DC  B 2 16 ? 5.528   28.007  15.412  1.00 3.00  ? 132 DC  C "O3'"  1 
ATOM   996  C  "C2'"  . DC  B 2 16 ? 7.206   27.926  13.668  1.00 2.94  ? 132 DC  C "C2'"  1 
ATOM   997  C  "C1'"  . DC  B 2 16 ? 7.200   26.809  12.639  1.00 2.73  ? 132 DC  C "C1'"  1 
ATOM   998  N  N1     . DC  B 2 16 ? 8.035   27.169  11.462  1.00 2.72  ? 132 DC  C N1     1 
ATOM   999  C  C2     . DC  B 2 16 ? 9.202   26.436  11.216  1.00 2.71  ? 132 DC  C C2     1 
ATOM   1000 O  O2     . DC  B 2 16 ? 9.523   25.512  11.962  1.00 2.72  ? 132 DC  C O2     1 
ATOM   1001 N  N3     . DC  B 2 16 ? 9.957   26.785  10.129  1.00 2.71  ? 132 DC  C N3     1 
ATOM   1002 C  C4     . DC  B 2 16 ? 9.590   27.800  9.317   1.00 2.72  ? 132 DC  C C4     1 
ATOM   1003 N  N4     . DC  B 2 16 ? 10.352  28.104  8.266   1.00 2.73  ? 132 DC  C N4     1 
ATOM   1004 C  C5     . DC  B 2 16 ? 8.393   28.554  9.568   1.00 2.73  ? 132 DC  C C5     1 
ATOM   1005 C  C6     . DC  B 2 16 ? 7.656   28.201  10.649  1.00 2.73  ? 132 DC  C C6     1 
ATOM   1006 H  "H5'"  . DC  B 2 16 ? 3.285   27.206  11.789  1.00 2.47  ? 132 DC  C "H5'"  1 
ATOM   1007 H  "H5''" . DC  B 2 16 ? 3.060   28.304  13.163  1.00 2.68  ? 132 DC  C "H5''" 1 
ATOM   1008 H  "H4'"  . DC  B 2 16 ? 4.508   26.486  13.840  1.00 2.65  ? 132 DC  C "H4'"  1 
ATOM   1009 H  "H3'"  . DC  B 2 16 ? 5.513   29.254  13.760  1.00 2.97  ? 132 DC  C "H3'"  1 
ATOM   1010 H  "HO3'" . DC  B 2 16 ? 5.696   28.839  15.859  1.00 3.33  ? 132 DC  C "HO3'" 1 
ATOM   1011 H  "H2'"  . DC  B 2 16 ? 7.682   28.801  13.241  1.00 3.02  ? 132 DC  C "H2'"  1 
ATOM   1012 H  "H2''" . DC  B 2 16 ? 7.746   27.617  14.566  1.00 3.04  ? 132 DC  C "H2''" 1 
ATOM   1013 H  "H1'"  . DC  B 2 16 ? 7.584   25.908  13.097  1.00 2.72  ? 132 DC  C "H1'"  1 
ATOM   1014 H  H41    . DC  B 2 16 ? 11.194  27.578  8.084   1.00 2.72  ? 132 DC  C H41    1 
ATOM   1015 H  H42    . DC  B 2 16 ? 10.086  28.861  7.652   1.00 2.75  ? 132 DC  C H42    1 
ATOM   1016 H  H5     . DC  B 2 16 ? 8.092   29.375  8.918   1.00 2.75  ? 132 DC  C H5     1 
ATOM   1017 H  H6     . DC  B 2 16 ? 6.754   28.749  10.885  1.00 2.75  ? 132 DC  C H6     1 
ATOM   1018 N  N      . LYS C 3 1  ? -4.724  13.925  12.277  1.00 2.56  ? 1   LYS A N      1 
ATOM   1019 C  CA     . LYS C 3 1  ? -5.904  13.428  13.043  1.00 1.90  ? 1   LYS A CA     1 
ATOM   1020 C  C      . LYS C 3 1  ? -6.261  12.012  12.597  1.00 1.49  ? 1   LYS A C      1 
ATOM   1021 O  O      . LYS C 3 1  ? -7.309  11.791  12.037  1.00 1.51  ? 1   LYS A O      1 
ATOM   1022 C  CB     . LYS C 3 1  ? -7.121  14.321  12.790  1.00 2.18  ? 1   LYS A CB     1 
ATOM   1023 C  CG     . LYS C 3 1  ? -6.945  15.691  13.440  1.00 2.78  ? 1   LYS A CG     1 
ATOM   1024 C  CD     . LYS C 3 1  ? -8.197  16.528  13.143  1.00 3.41  ? 1   LYS A CD     1 
ATOM   1025 C  CE     . LYS C 3 1  ? -8.197  17.796  14.001  1.00 4.15  ? 1   LYS A CE     1 
ATOM   1026 N  NZ     . LYS C 3 1  ? -6.864  18.456  13.927  1.00 4.81  ? 1   LYS A NZ     1 
ATOM   1027 H  H1     . LYS C 3 1  ? -4.912  13.844  11.256  1.00 2.99  ? 1   LYS A H1     1 
ATOM   1028 H  H2     . LYS C 3 1  ? -4.549  14.921  12.519  1.00 2.95  ? 1   LYS A H2     1 
ATOM   1029 H  H3     . LYS C 3 1  ? -3.889  13.356  12.518  1.00 2.86  ? 1   LYS A H3     1 
ATOM   1030 H  HA     . LYS C 3 1  ? -5.678  13.396  14.098  1.00 2.16  ? 1   LYS A HA     1 
ATOM   1031 H  HB2    . LYS C 3 1  ? -7.250  14.448  11.726  1.00 2.52  ? 1   LYS A HB2    1 
ATOM   1032 H  HB3    . LYS C 3 1  ? -8.003  13.848  13.199  1.00 2.43  ? 1   LYS A HB3    1 
ATOM   1033 H  HG2    . LYS C 3 1  ? -6.824  15.574  14.509  1.00 3.01  ? 1   LYS A HG2    1 
ATOM   1034 H  HG3    . LYS C 3 1  ? -6.075  16.179  13.025  1.00 3.14  ? 1   LYS A HG3    1 
ATOM   1035 H  HD2    . LYS C 3 1  ? -8.209  16.801  12.095  1.00 3.68  ? 1   LYS A HD2    1 
ATOM   1036 H  HD3    . LYS C 3 1  ? -9.077  15.945  13.369  1.00 3.61  ? 1   LYS A HD3    1 
ATOM   1037 H  HE2    . LYS C 3 1  ? -8.951  18.477  13.631  1.00 4.52  ? 1   LYS A HE2    1 
ATOM   1038 H  HE3    . LYS C 3 1  ? -8.419  17.537  15.025  1.00 4.33  ? 1   LYS A HE3    1 
ATOM   1039 H  HZ1    . LYS C 3 1  ? -6.261  17.943  13.256  1.00 5.07  ? 1   LYS A HZ1    1 
ATOM   1040 H  HZ2    . LYS C 3 1  ? -6.988  19.435  13.602  1.00 5.05  ? 1   LYS A HZ2    1 
ATOM   1041 H  HZ3    . LYS C 3 1  ? -6.415  18.456  14.867  1.00 5.18  ? 1   LYS A HZ3    1 
ATOM   1042 N  N      . ARG C 3 2  ? -5.429  11.041  12.876  1.00 1.33  ? 2   ARG A N      1 
ATOM   1043 C  CA     . ARG C 3 2  ? -5.780  9.634   12.501  1.00 1.13  ? 2   ARG A CA     1 
ATOM   1044 C  C      . ARG C 3 2  ? -6.535  9.015   13.681  1.00 0.94  ? 2   ARG A C      1 
ATOM   1045 O  O      . ARG C 3 2  ? -7.109  7.947   13.581  1.00 1.02  ? 2   ARG A O      1 
ATOM   1046 C  CB     . ARG C 3 2  ? -4.497  8.821   12.200  1.00 1.41  ? 2   ARG A CB     1 
ATOM   1047 C  CG     . ARG C 3 2  ? -4.165  8.850   10.694  1.00 1.66  ? 2   ARG A CG     1 
ATOM   1048 C  CD     . ARG C 3 2  ? -3.361  10.110  10.329  1.00 2.42  ? 2   ARG A CD     1 
ATOM   1049 N  NE     . ARG C 3 2  ? -1.910  9.782   10.313  1.00 3.28  ? 2   ARG A NE     1 
ATOM   1050 C  CZ     . ARG C 3 2  ? -1.082  10.525  9.634   1.00 4.09  ? 2   ARG A CZ     1 
ATOM   1051 N  NH1    . ARG C 3 2  ? -1.536  11.504  8.898   1.00 4.34  ? 2   ARG A NH1    1 
ATOM   1052 N  NH2    . ARG C 3 2  ? 0.197   10.276  9.673   1.00 5.00  ? 2   ARG A NH2    1 
ATOM   1053 H  H      . ARG C 3 2  ? -4.599  11.235  13.363  1.00 1.52  ? 2   ARG A H      1 
ATOM   1054 H  HA     . ARG C 3 2  ? -6.433  9.639   11.641  1.00 1.15  ? 2   ARG A HA     1 
ATOM   1055 H  HB2    . ARG C 3 2  ? -3.672  9.244   12.751  1.00 1.83  ? 2   ARG A HB2    1 
ATOM   1056 H  HB3    . ARG C 3 2  ? -4.636  7.792   12.507  1.00 1.72  ? 2   ARG A HB3    1 
ATOM   1057 H  HG2    . ARG C 3 2  ? -3.575  7.978   10.449  1.00 2.23  ? 2   ARG A HG2    1 
ATOM   1058 H  HG3    . ARG C 3 2  ? -5.076  8.824   10.118  1.00 1.75  ? 2   ARG A HG3    1 
ATOM   1059 H  HD2    . ARG C 3 2  ? -3.670  10.461  9.350   1.00 2.77  ? 2   ARG A HD2    1 
ATOM   1060 H  HD3    . ARG C 3 2  ? -3.528  10.886  11.059  1.00 2.78  ? 2   ARG A HD3    1 
ATOM   1061 H  HE     . ARG C 3 2  ? -1.573  9.023   10.834  1.00 3.54  ? 2   ARG A HE     1 
ATOM   1062 H  HH11   . ARG C 3 2  ? -2.516  11.687  8.855   1.00 3.98  ? 2   ARG A HH11   1 
ATOM   1063 H  HH12   . ARG C 3 2  ? -0.900  12.069  8.372   1.00 5.13  ? 2   ARG A HH12   1 
ATOM   1064 H  HH21   . ARG C 3 2  ? 0.542   9.515   10.224  1.00 5.20  ? 2   ARG A HH21   1 
ATOM   1065 H  HH22   . ARG C 3 2  ? 0.834   10.844  9.153   1.00 5.67  ? 2   ARG A HH22   1 
ATOM   1066 N  N      . ALA C 3 3  ? -6.533  9.687   14.796  1.00 0.92  ? 3   ALA A N      1 
ATOM   1067 C  CA     . ALA C 3 3  ? -7.244  9.156   15.988  1.00 0.97  ? 3   ALA A CA     1 
ATOM   1068 C  C      . ALA C 3 3  ? -8.748  9.106   15.699  1.00 0.86  ? 3   ALA A C      1 
ATOM   1069 O  O      . ALA C 3 3  ? -9.425  10.114  15.693  1.00 0.94  ? 3   ALA A O      1 
ATOM   1070 C  CB     . ALA C 3 3  ? -6.967  10.066  17.194  1.00 1.21  ? 3   ALA A CB     1 
ATOM   1071 H  H      . ALA C 3 3  ? -6.057  10.542  14.840  1.00 1.04  ? 3   ALA A H      1 
ATOM   1072 H  HA     . ALA C 3 3  ? -6.886  8.158   16.199  1.00 1.07  ? 3   ALA A HA     1 
ATOM   1073 H  HB1    . ALA C 3 3  ? -6.892  11.090  16.861  1.00 1.66  ? 3   ALA A HB1    1 
ATOM   1074 H  HB2    . ALA C 3 3  ? -7.771  9.979   17.912  1.00 1.53  ? 3   ALA A HB2    1 
ATOM   1075 H  HB3    . ALA C 3 3  ? -6.038  9.772   17.661  1.00 1.68  ? 3   ALA A HB3    1 
ATOM   1076 N  N      . GLY C 3 4  ? -9.275  7.928   15.489  1.00 0.84  ? 4   GLY A N      1 
ATOM   1077 C  CA     . GLY C 3 4  ? -10.741 7.790   15.232  1.00 0.81  ? 4   GLY A CA     1 
ATOM   1078 C  C      . GLY C 3 4  ? -11.061 7.922   13.737  1.00 0.65  ? 4   GLY A C      1 
ATOM   1079 O  O      . GLY C 3 4  ? -12.175 7.671   13.321  1.00 0.68  ? 4   GLY A O      1 
ATOM   1080 H  H      . GLY C 3 4  ? -8.705  7.132   15.532  1.00 0.95  ? 4   GLY A H      1 
ATOM   1081 H  HA2    . GLY C 3 4  ? -11.069 6.821   15.579  1.00 0.94  ? 4   GLY A HA2    1 
ATOM   1082 H  HA3    . GLY C 3 4  ? -11.275 8.558   15.774  1.00 0.86  ? 4   GLY A HA3    1 
ATOM   1083 N  N      . THR C 3 5  ? -10.121 8.318   12.920  1.00 0.52  ? 5   THR A N      1 
ATOM   1084 C  CA     . THR C 3 5  ? -10.440 8.461   11.468  1.00 0.43  ? 5   THR A CA     1 
ATOM   1085 C  C      . THR C 3 5  ? -10.743 7.097   10.866  1.00 0.41  ? 5   THR A C      1 
ATOM   1086 O  O      . THR C 3 5  ? -9.891  6.235   10.784  1.00 0.48  ? 5   THR A O      1 
ATOM   1087 C  CB     . THR C 3 5  ? -9.263  9.075   10.721  1.00 0.42  ? 5   THR A CB     1 
ATOM   1088 O  OG1    . THR C 3 5  ? -8.847  10.245  11.398  1.00 0.49  ? 5   THR A OG1    1 
ATOM   1089 C  CG2    . THR C 3 5  ? -9.674  9.433   9.282   1.00 0.41  ? 5   THR A CG2    1 
ATOM   1090 H  H      . THR C 3 5  ? -9.227  8.532   13.259  1.00 0.53  ? 5   THR A H      1 
ATOM   1091 H  HA     . THR C 3 5  ? -11.297 9.096   11.353  1.00 0.44  ? 5   THR A HA     1 
ATOM   1092 H  HB     . THR C 3 5  ? -8.459  8.366   10.693  1.00 0.43  ? 5   THR A HB     1 
ATOM   1093 H  HG1    . THR C 3 5  ? -9.588  10.566  11.918  1.00 1.02  ? 5   THR A HG1    1 
ATOM   1094 H  HG21   . THR C 3 5  ? -10.656 9.884   9.281   1.00 1.08  ? 5   THR A HG21   1 
ATOM   1095 H  HG22   . THR C 3 5  ? -8.961  10.131  8.868   1.00 1.08  ? 5   THR A HG22   1 
ATOM   1096 H  HG23   . THR C 3 5  ? -9.690  8.538   8.677   1.00 1.11  ? 5   THR A HG23   1 
ATOM   1097 N  N      . VAL C 3 6  ? -11.953 6.918   10.416  1.00 0.41  ? 6   VAL A N      1 
ATOM   1098 C  CA     . VAL C 3 6  ? -12.361 5.639   9.771   1.00 0.39  ? 6   VAL A CA     1 
ATOM   1099 C  C      . VAL C 3 6  ? -12.819 5.984   8.362   1.00 0.35  ? 6   VAL A C      1 
ATOM   1100 O  O      . VAL C 3 6  ? -13.441 7.004   8.141   1.00 0.36  ? 6   VAL A O      1 
ATOM   1101 C  CB     . VAL C 3 6  ? -13.513 4.996   10.555  1.00 0.43  ? 6   VAL A CB     1 
ATOM   1102 C  CG1    . VAL C 3 6  ? -13.007 4.477   11.917  1.00 0.50  ? 6   VAL A CG1    1 
ATOM   1103 C  CG2    . VAL C 3 6  ? -14.617 6.036   10.779  1.00 0.49  ? 6   VAL A CG2    1 
ATOM   1104 H  H      . VAL C 3 6  ? -12.603 7.649   10.480  1.00 0.48  ? 6   VAL A H      1 
ATOM   1105 H  HA     . VAL C 3 6  ? -11.521 4.958   9.722   1.00 0.39  ? 6   VAL A HA     1 
ATOM   1106 H  HB     . VAL C 3 6  ? -13.911 4.169   9.985   1.00 0.43  ? 6   VAL A HB     1 
ATOM   1107 H  HG11   . VAL C 3 6  ? -11.994 4.113   11.820  1.00 1.12  ? 6   VAL A HG11   1 
ATOM   1108 H  HG12   . VAL C 3 6  ? -13.029 5.275   12.646  1.00 1.16  ? 6   VAL A HG12   1 
ATOM   1109 H  HG13   . VAL C 3 6  ? -13.644 3.671   12.252  1.00 1.13  ? 6   VAL A HG13   1 
ATOM   1110 H  HG21   . VAL C 3 6  ? -14.957 6.412   9.827   1.00 1.15  ? 6   VAL A HG21   1 
ATOM   1111 H  HG22   . VAL C 3 6  ? -15.443 5.577   11.301  1.00 1.13  ? 6   VAL A HG22   1 
ATOM   1112 H  HG23   . VAL C 3 6  ? -14.228 6.852   11.371  1.00 1.12  ? 6   VAL A HG23   1 
ATOM   1113 N  N      . CYS C 3 7  ? -12.520 5.171   7.396   1.00 0.33  ? 7   CYS A N      1 
ATOM   1114 C  CA     . CYS C 3 7  ? -12.947 5.496   6.015   1.00 0.31  ? 7   CYS A CA     1 
ATOM   1115 C  C      . CYS C 3 7  ? -14.468 5.558   5.947   1.00 0.34  ? 7   CYS A C      1 
ATOM   1116 O  O      . CYS C 3 7  ? -15.155 4.589   6.201   1.00 0.36  ? 7   CYS A O      1 
ATOM   1117 C  CB     . CYS C 3 7  ? -12.418 4.420   5.078   1.00 0.32  ? 7   CYS A CB     1 
ATOM   1118 S  SG     . CYS C 3 7  ? -12.737 4.881   3.361   1.00 0.31  ? 7   CYS A SG     1 
ATOM   1119 H  H      . CYS C 3 7  ? -12.021 4.345   7.558   1.00 0.34  ? 7   CYS A H      1 
ATOM   1120 H  HA     . CYS C 3 7  ? -12.537 6.447   5.720   1.00 0.30  ? 7   CYS A HA     1 
ATOM   1121 H  HB2    . CYS C 3 7  ? -11.354 4.326   5.227   1.00 0.34  ? 7   CYS A HB2    1 
ATOM   1122 H  HB3    . CYS C 3 7  ? -12.899 3.479   5.298   1.00 0.36  ? 7   CYS A HB3    1 
ATOM   1123 N  N      . SER C 3 8  ? -14.996 6.695   5.606   1.00 0.36  ? 8   SER A N      1 
ATOM   1124 C  CA     . SER C 3 8  ? -16.471 6.835   5.524   1.00 0.41  ? 8   SER A CA     1 
ATOM   1125 C  C      . SER C 3 8  ? -17.023 5.854   4.491   1.00 0.43  ? 8   SER A C      1 
ATOM   1126 O  O      . SER C 3 8  ? -18.067 5.263   4.678   1.00 0.46  ? 8   SER A O      1 
ATOM   1127 C  CB     . SER C 3 8  ? -16.818 8.259   5.093   1.00 0.43  ? 8   SER A CB     1 
ATOM   1128 O  OG     . SER C 3 8  ? -16.508 9.157   6.149   1.00 0.44  ? 8   SER A OG     1 
ATOM   1129 H  H      . SER C 3 8  ? -14.422 7.462   5.409   1.00 0.35  ? 8   SER A H      1 
ATOM   1130 H  HA     . SER C 3 8  ? -16.907 6.640   6.491   1.00 0.42  ? 8   SER A HA     1 
ATOM   1131 H  HB2    . SER C 3 8  ? -16.244 8.525   4.222   1.00 0.43  ? 8   SER A HB2    1 
ATOM   1132 H  HB3    . SER C 3 8  ? -17.873 8.313   4.856   1.00 0.48  ? 8   SER A HB3    1 
ATOM   1133 H  HG     . SER C 3 8  ? -15.729 9.657   5.892   1.00 1.04  ? 8   SER A HG     1 
ATOM   1134 N  N      . ASN C 3 9  ? -16.342 5.689   3.388   1.00 0.42  ? 9   ASN A N      1 
ATOM   1135 C  CA     . ASN C 3 9  ? -16.844 4.763   2.343   1.00 0.45  ? 9   ASN A CA     1 
ATOM   1136 C  C      . ASN C 3 9  ? -16.660 3.301   2.755   1.00 0.44  ? 9   ASN A C      1 
ATOM   1137 O  O      . ASN C 3 9  ? -17.556 2.504   2.552   1.00 0.48  ? 9   ASN A O      1 
ATOM   1138 C  CB     . ASN C 3 9  ? -16.109 5.018   1.021   1.00 0.46  ? 9   ASN A CB     1 
ATOM   1139 C  CG     . ASN C 3 9  ? -16.645 6.296   0.372   1.00 0.50  ? 9   ASN A CG     1 
ATOM   1140 O  OD1    . ASN C 3 9  ? -17.694 6.784   0.745   1.00 1.20  ? 9   ASN A OD1    1 
ATOM   1141 N  ND2    . ASN C 3 9  ? -15.974 6.850   -0.605  1.00 1.16  ? 9   ASN A ND2    1 
ATOM   1142 H  H      . ASN C 3 9  ? -15.506 6.179   3.239   1.00 0.39  ? 9   ASN A H      1 
ATOM   1143 H  HA     . ASN C 3 9  ? -17.899 4.947   2.197   1.00 0.49  ? 9   ASN A HA     1 
ATOM   1144 H  HB2    . ASN C 3 9  ? -15.051 5.128   1.213   1.00 0.42  ? 9   ASN A HB2    1 
ATOM   1145 H  HB3    . ASN C 3 9  ? -16.268 4.186   0.352   1.00 0.50  ? 9   ASN A HB3    1 
ATOM   1146 H  HD21   . ASN C 3 9  ? -15.135 6.447   -0.914  1.00 1.92  ? 9   ASN A HD21   1 
ATOM   1147 H  HD22   . ASN C 3 9  ? -16.310 7.667   -1.030  1.00 1.17  ? 9   ASN A HD22   1 
ATOM   1148 N  N      . CYS C 3 10 ? -15.506 2.908   3.279   1.00 0.40  ? 10  CYS A N      1 
ATOM   1149 C  CA     . CYS C 3 10 ? -15.311 1.453   3.626   1.00 0.42  ? 10  CYS A CA     1 
ATOM   1150 C  C      . CYS C 3 10 ? -14.860 1.213   5.084   1.00 0.42  ? 10  CYS A C      1 
ATOM   1151 O  O      . CYS C 3 10 ? -14.539 0.099   5.442   1.00 0.58  ? 10  CYS A O      1 
ATOM   1152 C  CB     . CYS C 3 10 ? -14.306 0.838   2.656   1.00 0.43  ? 10  CYS A CB     1 
ATOM   1153 S  SG     . CYS C 3 10 ? -12.619 1.261   3.167   1.00 0.39  ? 10  CYS A SG     1 
ATOM   1154 H  H      . CYS C 3 10 ? -14.768 3.543   3.389   1.00 0.38  ? 10  CYS A H      1 
ATOM   1155 H  HA     . CYS C 3 10 ? -16.253 0.949   3.508   1.00 0.46  ? 10  CYS A HA     1 
ATOM   1156 H  HB2    . CYS C 3 10 ? -14.429 -0.234  2.651   1.00 0.46  ? 10  CYS A HB2    1 
ATOM   1157 H  HB3    . CYS C 3 10 ? -14.488 1.223   1.664   1.00 0.44  ? 10  CYS A HB3    1 
ATOM   1158 N  N      . GLN C 3 11 ? -14.891 2.205   5.938   1.00 0.40  ? 11  GLN A N      1 
ATOM   1159 C  CA     . GLN C 3 11 ? -14.544 2.005   7.394   1.00 0.39  ? 11  GLN A CA     1 
ATOM   1160 C  C      . GLN C 3 11 ? -13.119 1.485   7.680   1.00 0.41  ? 11  GLN A C      1 
ATOM   1161 O  O      . GLN C 3 11 ? -12.789 1.274   8.831   1.00 0.55  ? 11  GLN A O      1 
ATOM   1162 C  CB     . GLN C 3 11 ? -15.552 1.034   8.026   1.00 0.43  ? 11  GLN A CB     1 
ATOM   1163 C  CG     . GLN C 3 11 ? -16.923 1.703   8.128   1.00 1.09  ? 11  GLN A CG     1 
ATOM   1164 C  CD     . GLN C 3 11 ? -17.919 0.715   8.738   1.00 1.66  ? 11  GLN A CD     1 
ATOM   1165 O  OE1    . GLN C 3 11 ? -17.949 -0.442  8.364   1.00 2.07  ? 11  GLN A OE1    1 
ATOM   1166 N  NE2    . GLN C 3 11 ? -18.735 1.122   9.673   1.00 2.51  ? 11  GLN A NE2    1 
ATOM   1167 H  H      . GLN C 3 11 ? -15.189 3.099   5.669   1.00 0.50  ? 11  GLN A H      1 
ATOM   1168 H  HA     . GLN C 3 11 ? -14.651 2.956   7.889   1.00 0.42  ? 11  GLN A HA     1 
ATOM   1169 H  HB2    . GLN C 3 11 ? -15.633 0.144   7.426   1.00 0.92  ? 11  GLN A HB2    1 
ATOM   1170 H  HB3    . GLN C 3 11 ? -15.217 0.765   9.018   1.00 0.92  ? 11  GLN A HB3    1 
ATOM   1171 H  HG2    . GLN C 3 11 ? -16.853 2.581   8.754   1.00 1.68  ? 11  GLN A HG2    1 
ATOM   1172 H  HG3    . GLN C 3 11 ? -17.258 1.988   7.142   1.00 1.70  ? 11  GLN A HG3    1 
ATOM   1173 H  HE21   . GLN C 3 11 ? -18.705 2.054   9.977   1.00 2.88  ? 11  GLN A HE21   1 
ATOM   1174 H  HE22   . GLN C 3 11 ? -19.376 0.497   10.072  1.00 3.07  ? 11  GLN A HE22   1 
ATOM   1175 N  N      . THR C 3 12 ? -12.257 1.279   6.721   1.00 0.36  ? 12  THR A N      1 
ATOM   1176 C  CA     . THR C 3 12 ? -10.892 0.785   7.108   1.00 0.38  ? 12  THR A CA     1 
ATOM   1177 C  C      . THR C 3 12 ? -10.212 1.856   7.957   1.00 0.38  ? 12  THR A C      1 
ATOM   1178 O  O      . THR C 3 12 ? -10.381 3.034   7.720   1.00 0.40  ? 12  THR A O      1 
ATOM   1179 C  CB     . THR C 3 12 ? -10.034 0.495   5.867   1.00 0.39  ? 12  THR A CB     1 
ATOM   1180 O  OG1    . THR C 3 12 ? -8.742  0.075   6.290   1.00 0.45  ? 12  THR A OG1    1 
ATOM   1181 C  CG2    . THR C 3 12 ? -9.897  1.767   5.040   1.00 0.36  ? 12  THR A CG2    1 
ATOM   1182 H  H      . THR C 3 12 ? -12.489 1.443   5.784   1.00 0.42  ? 12  THR A H      1 
ATOM   1183 H  HA     . THR C 3 12 ? -10.986 -0.122  7.684   1.00 0.40  ? 12  THR A HA     1 
ATOM   1184 H  HB     . THR C 3 12 ? -10.494 -0.289  5.267   1.00 0.41  ? 12  THR A HB     1 
ATOM   1185 H  HG1    . THR C 3 12 ? -8.680  -0.874  6.163   1.00 0.97  ? 12  THR A HG1    1 
ATOM   1186 H  HG21   . THR C 3 12 ? -10.870 2.158   4.831   1.00 1.08  ? 12  THR A HG21   1 
ATOM   1187 H  HG22   . THR C 3 12 ? -9.336  2.496   5.598   1.00 1.06  ? 12  THR A HG22   1 
ATOM   1188 H  HG23   . THR C 3 12 ? -9.387  1.548   4.114   1.00 1.06  ? 12  THR A HG23   1 
ATOM   1189 N  N      . SER C 3 13 ? -9.413  1.453   8.918   1.00 0.42  ? 13  SER A N      1 
ATOM   1190 C  CA     . SER C 3 13 ? -8.676  2.453   9.762   1.00 0.45  ? 13  SER A CA     1 
ATOM   1191 C  C      . SER C 3 13 ? -7.214  2.393   9.344   1.00 0.42  ? 13  SER A C      1 
ATOM   1192 O  O      . SER C 3 13 ? -6.389  3.176   9.771   1.00 0.49  ? 13  SER A O      1 
ATOM   1193 C  CB     . SER C 3 13 ? -8.827  2.128   11.249  1.00 0.49  ? 13  SER A CB     1 
ATOM   1194 O  OG     . SER C 3 13 ? -8.297  0.832   11.501  1.00 1.23  ? 13  SER A OG     1 
ATOM   1195 H  H      . SER C 3 13 ? -9.273  0.490   9.031   1.00 0.46  ? 13  SER A H      1 
ATOM   1196 H  HA     . SER C 3 13 ? -9.064  3.442   9.541   1.00 0.49  ? 13  SER A HA     1 
ATOM   1197 H  HB2    . SER C 3 13 ? -8.286  2.853   11.835  1.00 1.02  ? 13  SER A HB2    1 
ATOM   1198 H  HB3    . SER C 3 13 ? -9.875  2.160   11.520  1.00 1.00  ? 13  SER A HB3    1 
ATOM   1199 H  HG     . SER C 3 13 ? -7.363  0.843   11.276  1.00 1.66  ? 13  SER A HG     1 
ATOM   1200 N  N      . THR C 3 14 ? -6.905  1.471   8.469   1.00 0.41  ? 14  THR A N      1 
ATOM   1201 C  CA     . THR C 3 14 ? -5.519  1.334   7.949   1.00 0.41  ? 14  THR A CA     1 
ATOM   1202 C  C      . THR C 3 14 ? -5.507  1.918   6.544   1.00 0.46  ? 14  THR A C      1 
ATOM   1203 O  O      . THR C 3 14 ? -6.214  1.458   5.669   1.00 0.99  ? 14  THR A O      1 
ATOM   1204 C  CB     . THR C 3 14 ? -5.143  -0.147  7.875   1.00 0.42  ? 14  THR A CB     1 
ATOM   1205 O  OG1    . THR C 3 14 ? -5.976  -0.795  6.923   1.00 0.56  ? 14  THR A OG1    1 
ATOM   1206 C  CG2    . THR C 3 14 ? -5.327  -0.800  9.244   1.00 0.58  ? 14  THR A CG2    1 
ATOM   1207 H  H      . THR C 3 14 ? -7.599  0.870   8.124   1.00 0.46  ? 14  THR A H      1 
ATOM   1208 H  HA     . THR C 3 14 ? -4.817  1.863   8.579   1.00 0.43  ? 14  THR A HA     1 
ATOM   1209 H  HB     . THR C 3 14 ? -4.112  -0.241  7.573   1.00 0.51  ? 14  THR A HB     1 
ATOM   1210 H  HG1    . THR C 3 14 ? -6.052  -1.719  7.173   1.00 1.11  ? 14  THR A HG1    1 
ATOM   1211 H  HG21   . THR C 3 14 ? -6.264  -0.482  9.675   1.00 1.17  ? 14  THR A HG21   1 
ATOM   1212 H  HG22   . THR C 3 14 ? -5.330  -1.873  9.130   1.00 1.21  ? 14  THR A HG22   1 
ATOM   1213 H  HG23   . THR C 3 14 ? -4.514  -0.510  9.892   1.00 1.21  ? 14  THR A HG23   1 
ATOM   1214 N  N      . THR C 3 15 ? -4.717  2.923   6.311   1.00 0.38  ? 15  THR A N      1 
ATOM   1215 C  CA     . THR C 3 15 ? -4.675  3.535   4.952   1.00 0.31  ? 15  THR A CA     1 
ATOM   1216 C  C      . THR C 3 15 ? -3.266  4.035   4.683   1.00 0.30  ? 15  THR A C      1 
ATOM   1217 O  O      . THR C 3 15 ? -2.577  4.478   5.581   1.00 0.33  ? 15  THR A O      1 
ATOM   1218 C  CB     . THR C 3 15 ? -5.640  4.724   4.898   1.00 0.29  ? 15  THR A CB     1 
ATOM   1219 O  OG1    . THR C 3 15 ? -5.019  5.863   5.480   1.00 0.30  ? 15  THR A OG1    1 
ATOM   1220 C  CG2    . THR C 3 15 ? -6.901  4.388   5.681   1.00 0.31  ? 15  THR A CG2    1 
ATOM   1221 H  H      . THR C 3 15 ? -4.150  3.275   7.029   1.00 0.82  ? 15  THR A H      1 
ATOM   1222 H  HA     . THR C 3 15 ? -4.953  2.806   4.204   1.00 0.31  ? 15  THR A HA     1 
ATOM   1223 H  HB     . THR C 3 15 ? -5.906  4.935   3.873   1.00 0.29  ? 15  THR A HB     1 
ATOM   1224 H  HG1    . THR C 3 15 ? -5.671  6.567   5.523   1.00 0.96  ? 15  THR A HG1    1 
ATOM   1225 H  HG21   . THR C 3 15 ? -7.315  3.473   5.300   1.00 1.07  ? 15  THR A HG21   1 
ATOM   1226 H  HG22   . THR C 3 15 ? -6.657  4.268   6.726   1.00 1.06  ? 15  THR A HG22   1 
ATOM   1227 H  HG23   . THR C 3 15 ? -7.619  5.185   5.566   1.00 1.06  ? 15  THR A HG23   1 
ATOM   1228 N  N      . THR C 3 16 ? -2.832  4.004   3.458   1.00 0.28  ? 16  THR A N      1 
ATOM   1229 C  CA     . THR C 3 16 ? -1.474  4.522   3.170   1.00 0.29  ? 16  THR A CA     1 
ATOM   1230 C  C      . THR C 3 16 ? -1.553  6.044   3.215   1.00 0.28  ? 16  THR A C      1 
ATOM   1231 O  O      . THR C 3 16 ? -0.679  6.709   3.737   1.00 0.30  ? 16  THR A O      1 
ATOM   1232 C  CB     . THR C 3 16 ? -0.984  4.071   1.790   1.00 0.30  ? 16  THR A CB     1 
ATOM   1233 O  OG1    . THR C 3 16 ? -1.571  4.902   0.799   1.00 0.40  ? 16  THR A OG1    1 
ATOM   1234 C  CG2    . THR C 3 16 ? -1.358  2.600   1.500   1.00 0.34  ? 16  THR A CG2    1 
ATOM   1235 H  H      . THR C 3 16 ? -3.408  3.676   2.735   1.00 0.27  ? 16  THR A H      1 
ATOM   1236 H  HA     . THR C 3 16 ? -0.788  4.177   3.931   1.00 0.32  ? 16  THR A HA     1 
ATOM   1237 H  HB     . THR C 3 16 ? 0.090   4.176   1.762   1.00 0.36  ? 16  THR A HB     1 
ATOM   1238 H  HG1    . THR C 3 16 ? -2.500  5.014   1.016   1.00 0.95  ? 16  THR A HG1    1 
ATOM   1239 H  HG21   . THR C 3 16 ? -1.839  2.155   2.356   1.00 1.10  ? 16  THR A HG21   1 
ATOM   1240 H  HG22   . THR C 3 16 ? -2.031  2.567   0.656   1.00 1.04  ? 16  THR A HG22   1 
ATOM   1241 H  HG23   . THR C 3 16 ? -0.466  2.034   1.263   1.00 1.10  ? 16  THR A HG23   1 
ATOM   1242 N  N      . LEU C 3 17 ? -2.620  6.604   2.693   1.00 0.26  ? 17  LEU A N      1 
ATOM   1243 C  CA     . LEU C 3 17 ? -2.783  8.090   2.730   1.00 0.26  ? 17  LEU A CA     1 
ATOM   1244 C  C      . LEU C 3 17 ? -4.262  8.408   2.959   1.00 0.27  ? 17  LEU A C      1 
ATOM   1245 O  O      . LEU C 3 17 ? -5.127  7.897   2.275   1.00 0.26  ? 17  LEU A O      1 
ATOM   1246 C  CB     . LEU C 3 17 ? -2.306  8.715   1.401   1.00 0.27  ? 17  LEU A CB     1 
ATOM   1247 C  CG     . LEU C 3 17 ? -1.715  10.107  1.632   1.00 0.30  ? 17  LEU A CG     1 
ATOM   1248 C  CD1    . LEU C 3 17 ? -0.439  10.031  2.513   1.00 0.37  ? 17  LEU A CD1    1 
ATOM   1249 C  CD2    . LEU C 3 17 ? -1.377  10.671  0.261   1.00 0.36  ? 17  LEU A CD2    1 
ATOM   1250 H  H      . LEU C 3 17 ? -3.327  6.043   2.299   1.00 0.25  ? 17  LEU A H      1 
ATOM   1251 H  HA     . LEU C 3 17 ? -2.217  8.490   3.548   1.00 0.28  ? 17  LEU A HA     1 
ATOM   1252 H  HB2    . LEU C 3 17 ? -1.557  8.092   0.948   1.00 0.29  ? 17  LEU A HB2    1 
ATOM   1253 H  HB3    . LEU C 3 17 ? -3.139  8.813   0.719   1.00 0.26  ? 17  LEU A HB3    1 
ATOM   1254 H  HG     . LEU C 3 17 ? -2.452  10.738  2.109   1.00 0.31  ? 17  LEU A HG     1 
ATOM   1255 H  HD11   . LEU C 3 17 ? 0.007   9.050   2.433   1.00 1.03  ? 17  LEU A HD11   1 
ATOM   1256 H  HD12   . LEU C 3 17 ? 0.279   10.773  2.193   1.00 1.03  ? 17  LEU A HD12   1 
ATOM   1257 H  HD13   . LEU C 3 17 ? -0.702  10.220  3.545   1.00 1.02  ? 17  LEU A HD13   1 
ATOM   1258 H  HD21   . LEU C 3 17 ? -0.747  9.973   -0.267  1.00 1.04  ? 17  LEU A HD21   1 
ATOM   1259 H  HD22   . LEU C 3 17 ? -2.288  10.821  -0.294  1.00 1.04  ? 17  LEU A HD22   1 
ATOM   1260 H  HD23   . LEU C 3 17 ? -0.868  11.604  0.370   1.00 1.16  ? 17  LEU A HD23   1 
ATOM   1261 N  N      . TRP C 3 18 ? -4.563  9.252   3.905   1.00 0.29  ? 18  TRP A N      1 
ATOM   1262 C  CA     . TRP C 3 18 ? -5.980  9.606   4.164   1.00 0.30  ? 18  TRP A CA     1 
ATOM   1263 C  C      . TRP C 3 18 ? -6.423  10.671  3.167   1.00 0.30  ? 18  TRP A C      1 
ATOM   1264 O  O      . TRP C 3 18 ? -5.764  11.676  2.983   1.00 0.30  ? 18  TRP A O      1 
ATOM   1265 C  CB     . TRP C 3 18 ? -6.097  10.163  5.590   1.00 0.33  ? 18  TRP A CB     1 
ATOM   1266 C  CG     . TRP C 3 18 ? -6.129  9.029   6.567   1.00 0.31  ? 18  TRP A CG     1 
ATOM   1267 C  CD1    . TRP C 3 18 ? -5.126  8.691   7.412   1.00 0.34  ? 18  TRP A CD1    1 
ATOM   1268 C  CD2    . TRP C 3 18 ? -7.202  8.073   6.804   1.00 0.29  ? 18  TRP A CD2    1 
ATOM   1269 N  NE1    . TRP C 3 18 ? -5.516  7.592   8.154   1.00 0.34  ? 18  TRP A NE1    1 
ATOM   1270 C  CE2    . TRP C 3 18 ? -6.786  7.174   7.823   1.00 0.31  ? 18  TRP A CE2    1 
ATOM   1271 C  CE3    . TRP C 3 18 ? -8.488  7.899   6.243   1.00 0.29  ? 18  TRP A CE3    1 
ATOM   1272 C  CZ2    . TRP C 3 18 ? -7.616  6.139   8.271   1.00 0.33  ? 18  TRP A CZ2    1 
ATOM   1273 C  CZ3    . TRP C 3 18 ? -9.326  6.856   6.692   1.00 0.31  ? 18  TRP A CZ3    1 
ATOM   1274 C  CH2    . TRP C 3 18 ? -8.890  5.979   7.704   1.00 0.32  ? 18  TRP A CH2    1 
ATOM   1275 H  H      . TRP C 3 18 ? -3.864  9.672   4.447   1.00 0.30  ? 18  TRP A H      1 
ATOM   1276 H  HA     . TRP C 3 18 ? -6.618  8.736   4.077   1.00 0.30  ? 18  TRP A HA     1 
ATOM   1277 H  HB2    . TRP C 3 18 ? -5.247  10.795  5.800   1.00 0.36  ? 18  TRP A HB2    1 
ATOM   1278 H  HB3    . TRP C 3 18 ? -7.005  10.741  5.682   1.00 0.35  ? 18  TRP A HB3    1 
ATOM   1279 H  HD1    . TRP C 3 18 ? -4.176  9.195   7.495   1.00 0.38  ? 18  TRP A HD1    1 
ATOM   1280 H  HE1    . TRP C 3 18 ? -4.972  7.153   8.840   1.00 0.38  ? 18  TRP A HE1    1 
ATOM   1281 H  HE3    . TRP C 3 18 ? -8.831  8.566   5.466   1.00 0.31  ? 18  TRP A HE3    1 
ATOM   1282 H  HZ2    . TRP C 3 18 ? -7.278  5.469   9.048   1.00 0.37  ? 18  TRP A HZ2    1 
ATOM   1283 H  HZ3    . TRP C 3 18 ? -10.303 6.727   6.257   1.00 0.34  ? 18  TRP A HZ3    1 
ATOM   1284 H  HH2    . TRP C 3 18 ? -9.536  5.186   8.044   1.00 0.35  ? 18  TRP A HH2    1 
ATOM   1285 N  N      . ARG C 3 19 ? -7.536  10.457  2.525   1.00 0.30  ? 19  ARG A N      1 
ATOM   1286 C  CA     . ARG C 3 19 ? -8.044  11.447  1.534   1.00 0.31  ? 19  ARG A CA     1 
ATOM   1287 C  C      . ARG C 3 19 ? -9.253  12.156  2.129   1.00 0.32  ? 19  ARG A C      1 
ATOM   1288 O  O      . ARG C 3 19 ? -9.791  11.748  3.141   1.00 0.65  ? 19  ARG A O      1 
ATOM   1289 C  CB     . ARG C 3 19 ? -8.500  10.717  0.265   1.00 0.35  ? 19  ARG A CB     1 
ATOM   1290 C  CG     . ARG C 3 19 ? -7.413  9.772   -0.235  1.00 0.57  ? 19  ARG A CG     1 
ATOM   1291 C  CD     . ARG C 3 19 ? -6.221  10.563  -0.762  1.00 0.77  ? 19  ARG A CD     1 
ATOM   1292 N  NE     . ARG C 3 19 ? -5.338  9.623   -1.522  1.00 1.20  ? 19  ARG A NE     1 
ATOM   1293 C  CZ     . ARG C 3 19 ? -4.266  10.054  -2.132  1.00 0.63  ? 19  ARG A CZ     1 
ATOM   1294 N  NH1    . ARG C 3 19 ? -3.883  11.287  -2.000  1.00 0.54  ? 19  ARG A NH1    1 
ATOM   1295 N  NH2    . ARG C 3 19 ? -3.556  9.239   -2.855  1.00 1.03  ? 19  ARG A NH2    1 
ATOM   1296 H  H      . ARG C 3 19 ? -8.044  9.635   2.691   1.00 0.32  ? 19  ARG A H      1 
ATOM   1297 H  HA     . ARG C 3 19 ? -7.279  12.165  1.278   1.00 0.30  ? 19  ARG A HA     1 
ATOM   1298 H  HB2    . ARG C 3 19 ? -9.382  10.147  0.484   1.00 0.67  ? 19  ARG A HB2    1 
ATOM   1299 H  HB3    . ARG C 3 19 ? -8.724  11.440  -0.504  1.00 0.35  ? 19  ARG A HB3    1 
ATOM   1300 H  HG2    . ARG C 3 19 ? -7.091  9.142   0.579   1.00 0.91  ? 19  ARG A HG2    1 
ATOM   1301 H  HG3    . ARG C 3 19 ? -7.814  9.160   -1.029  1.00 0.58  ? 19  ARG A HG3    1 
ATOM   1302 H  HD2    . ARG C 3 19 ? -6.561  11.340  -1.418  1.00 0.78  ? 19  ARG A HD2    1 
ATOM   1303 H  HD3    . ARG C 3 19 ? -5.690  11.006  0.072   1.00 0.91  ? 19  ARG A HD3    1 
ATOM   1304 H  HE     . ARG C 3 19 ? -5.586  8.677   -1.593  1.00 1.96  ? 19  ARG A HE     1 
ATOM   1305 H  HH11   . ARG C 3 19 ? -4.407  11.918  -1.427  1.00 0.82  ? 19  ARG A HH11   1 
ATOM   1306 H  HH12   . ARG C 3 19 ? -3.068  11.602  -2.471  1.00 0.95  ? 19  ARG A HH12   1 
ATOM   1307 H  HH21   . ARG C 3 19 ? -3.830  8.282   -2.947  1.00 1.79  ? 19  ARG A HH21   1 
ATOM   1308 H  HH22   . ARG C 3 19 ? -2.735  9.571   -3.321  1.00 0.65  ? 19  ARG A HH22   1 
ATOM   1309 N  N      . ARG C 3 20 ? -9.719  13.171  1.464   1.00 0.49  ? 20  ARG A N      1 
ATOM   1310 C  CA     . ARG C 3 20 ? -10.939 13.890  1.908   1.00 0.49  ? 20  ARG A CA     1 
ATOM   1311 C  C      . ARG C 3 20 ? -11.893 13.795  0.719   1.00 0.54  ? 20  ARG A C      1 
ATOM   1312 O  O      . ARG C 3 20 ? -11.483 13.969  -0.412  1.00 0.81  ? 20  ARG A O      1 
ATOM   1313 C  CB     . ARG C 3 20 ? -10.592 15.349  2.236   1.00 0.57  ? 20  ARG A CB     1 
ATOM   1314 C  CG     . ARG C 3 20 ? -11.632 15.925  3.205   1.00 1.18  ? 20  ARG A CG     1 
ATOM   1315 C  CD     . ARG C 3 20 ? -11.485 15.292  4.611   1.00 0.88  ? 20  ARG A CD     1 
ATOM   1316 N  NE     . ARG C 3 20 ? -11.244 16.366  5.617   1.00 1.56  ? 20  ARG A NE     1 
ATOM   1317 C  CZ     . ARG C 3 20 ? -11.397 16.112  6.889   1.00 1.85  ? 20  ARG A CZ     1 
ATOM   1318 N  NH1    . ARG C 3 20 ? -11.786 14.927  7.276   1.00 2.10  ? 20  ARG A NH1    1 
ATOM   1319 N  NH2    . ARG C 3 20 ? -11.165 17.042  7.775   1.00 2.59  ? 20  ARG A NH2    1 
ATOM   1320 H  H      . ARG C 3 20 ? -9.295  13.421  0.619   1.00 0.83  ? 20  ARG A H      1 
ATOM   1321 H  HA     . ARG C 3 20 ? -11.384 13.389  2.767   1.00 0.46  ? 20  ARG A HA     1 
ATOM   1322 H  HB2    . ARG C 3 20 ? -9.613  15.390  2.693   1.00 1.02  ? 20  ARG A HB2    1 
ATOM   1323 H  HB3    . ARG C 3 20 ? -10.586 15.936  1.329   1.00 0.99  ? 20  ARG A HB3    1 
ATOM   1324 H  HG2    . ARG C 3 20 ? -11.487 16.992  3.278   1.00 1.90  ? 20  ARG A HG2    1 
ATOM   1325 H  HG3    . ARG C 3 20 ? -12.620 15.724  2.817   1.00 1.84  ? 20  ARG A HG3    1 
ATOM   1326 H  HD2    . ARG C 3 20 ? -12.392 14.762  4.869   1.00 1.04  ? 20  ARG A HD2    1 
ATOM   1327 H  HD3    . ARG C 3 20 ? -10.654 14.600  4.629   1.00 1.06  ? 20  ARG A HD3    1 
ATOM   1328 H  HE     . ARG C 3 20 ? -10.961 17.259  5.326   1.00 2.23  ? 20  ARG A HE     1 
ATOM   1329 H  HH11   . ARG C 3 20 ? -11.966 14.214  6.598   1.00 2.02  ? 20  ARG A HH11   1 
ATOM   1330 H  HH12   . ARG C 3 20 ? -11.904 14.732  8.249   1.00 2.78  ? 20  ARG A HH12   1 
ATOM   1331 H  HH21   . ARG C 3 20 ? -10.869 17.951  7.481   1.00 3.02  ? 20  ARG A HH21   1 
ATOM   1332 H  HH22   . ARG C 3 20 ? -11.283 16.846  8.749   1.00 2.96  ? 20  ARG A HH22   1 
ATOM   1333 N  N      . SER C 3 21 ? -13.144 13.493  0.939   1.00 0.50  ? 21  SER A N      1 
ATOM   1334 C  CA     . SER C 3 21 ? -14.081 13.359  -0.221  1.00 0.54  ? 21  SER A CA     1 
ATOM   1335 C  C      . SER C 3 21 ? -14.729 14.723  -0.511  1.00 0.58  ? 21  SER A C      1 
ATOM   1336 O  O      . SER C 3 21 ? -14.761 15.583  0.341   1.00 0.56  ? 21  SER A O      1 
ATOM   1337 C  CB     . SER C 3 21 ? -15.140 12.289  0.102   1.00 0.54  ? 21  SER A CB     1 
ATOM   1338 O  OG     . SER C 3 21 ? -15.104 11.278  -0.898  1.00 1.42  ? 21  SER A OG     1 
ATOM   1339 H  H      . SER C 3 21 ? -13.459 13.357  1.857   1.00 0.64  ? 21  SER A H      1 
ATOM   1340 H  HA     . SER C 3 21 ? -13.507 13.060  -1.086  1.00 0.57  ? 21  SER A HA     1 
ATOM   1341 H  HB2    . SER C 3 21 ? -14.919 11.843  1.057   1.00 1.06  ? 21  SER A HB2    1 
ATOM   1342 H  HB3    . SER C 3 21 ? -16.127 12.736  0.141   1.00 1.08  ? 21  SER A HB3    1 
ATOM   1343 H  HG     . SER C 3 21 ? -16.003 11.126  -1.199  1.00 1.80  ? 21  SER A HG     1 
ATOM   1344 N  N      . PRO C 3 22 ? -15.235 14.929  -1.707  1.00 0.66  ? 22  PRO A N      1 
ATOM   1345 C  CA     . PRO C 3 22 ? -15.879 16.225  -2.051  1.00 0.72  ? 22  PRO A CA     1 
ATOM   1346 C  C      . PRO C 3 22 ? -16.951 16.625  -1.021  1.00 0.68  ? 22  PRO A C      1 
ATOM   1347 O  O      . PRO C 3 22 ? -17.346 17.770  -0.932  1.00 0.71  ? 22  PRO A O      1 
ATOM   1348 C  CB     . PRO C 3 22 ? -16.504 15.933  -3.435  1.00 0.83  ? 22  PRO A CB     1 
ATOM   1349 C  CG     . PRO C 3 22 ? -16.082 14.515  -3.879  1.00 0.82  ? 22  PRO A CG     1 
ATOM   1350 C  CD     . PRO C 3 22 ? -15.193 13.902  -2.788  1.00 0.72  ? 22  PRO A CD     1 
ATOM   1351 H  HA     . PRO C 3 22 ? -15.128 16.995  -2.149  1.00 0.75  ? 22  PRO A HA     1 
ATOM   1352 H  HB2    . PRO C 3 22 ? -17.585 15.993  -3.376  1.00 0.88  ? 22  PRO A HB2    1 
ATOM   1353 H  HB3    . PRO C 3 22 ? -16.148 16.658  -4.157  1.00 0.89  ? 22  PRO A HB3    1 
ATOM   1354 H  HG2    . PRO C 3 22 ? -16.961 13.898  -4.023  1.00 0.87  ? 22  PRO A HG2    1 
ATOM   1355 H  HG3    . PRO C 3 22 ? -15.527 14.568  -4.808  1.00 0.88  ? 22  PRO A HG3    1 
ATOM   1356 H  HD2    . PRO C 3 22 ? -15.598 12.960  -2.442  1.00 0.70  ? 22  PRO A HD2    1 
ATOM   1357 H  HD3    . PRO C 3 22 ? -14.181 13.778  -3.145  1.00 0.74  ? 22  PRO A HD3    1 
ATOM   1358 N  N      . MET C 3 23 ? -17.419 15.679  -0.243  1.00 0.63  ? 23  MET A N      1 
ATOM   1359 C  CA     . MET C 3 23 ? -18.464 15.980  0.788   1.00 0.61  ? 23  MET A CA     1 
ATOM   1360 C  C      . MET C 3 23 ? -17.794 16.272  2.135   1.00 0.56  ? 23  MET A C      1 
ATOM   1361 O  O      . MET C 3 23 ? -18.428 16.728  3.066   1.00 0.58  ? 23  MET A O      1 
ATOM   1362 C  CB     . MET C 3 23 ? -19.392 14.760  0.941   1.00 0.62  ? 23  MET A CB     1 
ATOM   1363 C  CG     . MET C 3 23 ? -20.506 14.805  -0.110  1.00 1.44  ? 23  MET A CG     1 
ATOM   1364 S  SD     . MET C 3 23 ? -21.575 13.356  0.102   1.00 1.98  ? 23  MET A SD     1 
ATOM   1365 C  CE     . MET C 3 23 ? -22.912 13.851  -1.016  1.00 2.68  ? 23  MET A CE     1 
ATOM   1366 H  H      . MET C 3 23 ? -17.074 14.765  -0.328  1.00 0.62  ? 23  MET A H      1 
ATOM   1367 H  HA     . MET C 3 23 ? -19.043 16.840  0.482   1.00 0.65  ? 23  MET A HA     1 
ATOM   1368 H  HB2    . MET C 3 23 ? -18.814 13.856  0.808   1.00 1.02  ? 23  MET A HB2    1 
ATOM   1369 H  HB3    . MET C 3 23 ? -19.836 14.757  1.927   1.00 1.10  ? 23  MET A HB3    1 
ATOM   1370 H  HG2    . MET C 3 23 ? -21.087 15.706  0.018   1.00 2.05  ? 23  MET A HG2    1 
ATOM   1371 H  HG3    . MET C 3 23 ? -20.071 14.792  -1.099  1.00 2.07  ? 23  MET A HG3    1 
ATOM   1372 H  HE1    . MET C 3 23 ? -22.693 14.818  -1.447  1.00 3.08  ? 23  MET A HE1    1 
ATOM   1373 H  HE2    . MET C 3 23 ? -23.012 13.124  -1.805  1.00 3.05  ? 23  MET A HE2    1 
ATOM   1374 H  HE3    . MET C 3 23 ? -23.838 13.903  -0.460  1.00 3.10  ? 23  MET A HE3    1 
ATOM   1375 N  N      . GLY C 3 24 ? -16.528 15.994  2.252   1.00 0.53  ? 24  GLY A N      1 
ATOM   1376 C  CA     . GLY C 3 24 ? -15.823 16.230  3.545   1.00 0.51  ? 24  GLY A CA     1 
ATOM   1377 C  C      . GLY C 3 24 ? -15.904 14.956  4.386   1.00 0.47  ? 24  GLY A C      1 
ATOM   1378 O  O      . GLY C 3 24 ? -15.779 14.987  5.594   1.00 0.48  ? 24  GLY A O      1 
ATOM   1379 H  H      . GLY C 3 24 ? -16.043 15.611  1.495   1.00 0.53  ? 24  GLY A H      1 
ATOM   1380 H  HA2    . GLY C 3 24 ? -14.787 16.472  3.352   1.00 0.51  ? 24  GLY A HA2    1 
ATOM   1381 H  HA3    . GLY C 3 24 ? -16.292 17.042  4.081   1.00 0.53  ? 24  GLY A HA3    1 
ATOM   1382 N  N      . ASP C 3 25 ? -16.103 13.830  3.749   1.00 0.44  ? 25  ASP A N      1 
ATOM   1383 C  CA     . ASP C 3 25 ? -16.188 12.536  4.484   1.00 0.42  ? 25  ASP A CA     1 
ATOM   1384 C  C      . ASP C 3 25 ? -14.815 11.832  4.417   1.00 0.37  ? 25  ASP A C      1 
ATOM   1385 O  O      . ASP C 3 25 ? -14.389 11.450  3.345   1.00 0.43  ? 25  ASP A O      1 
ATOM   1386 C  CB     . ASP C 3 25 ? -17.216 11.650  3.775   1.00 0.45  ? 25  ASP A CB     1 
ATOM   1387 C  CG     . ASP C 3 25 ? -18.577 12.348  3.772   1.00 0.53  ? 25  ASP A CG     1 
ATOM   1388 O  OD1    . ASP C 3 25 ? -19.031 12.723  4.840   1.00 1.23  ? 25  ASP A OD1    1 
ATOM   1389 O  OD2    . ASP C 3 25 ? -19.143 12.496  2.701   1.00 1.21  ? 25  ASP A OD2    1 
ATOM   1390 H  H      . ASP C 3 25 ? -16.192 13.811  2.774   1.00 0.45  ? 25  ASP A H      1 
ATOM   1391 H  HA     . ASP C 3 25 ? -16.508 12.688  5.499   1.00 0.44  ? 25  ASP A HA     1 
ATOM   1392 H  HB2    . ASP C 3 25 ? -16.898 11.474  2.757   1.00 0.45  ? 25  ASP A HB2    1 
ATOM   1393 H  HB3    . ASP C 3 25 ? -17.299 10.708  4.294   1.00 0.47  ? 25  ASP A HB3    1 
ATOM   1394 N  N      . PRO C 3 26 ? -14.111 11.650  5.519   1.00 0.34  ? 26  PRO A N      1 
ATOM   1395 C  CA     . PRO C 3 26 ? -12.782 10.970  5.459   1.00 0.31  ? 26  PRO A CA     1 
ATOM   1396 C  C      . PRO C 3 26 ? -12.839 9.628   4.707   1.00 0.30  ? 26  PRO A C      1 
ATOM   1397 O  O      . PRO C 3 26 ? -13.676 8.791   4.984   1.00 0.34  ? 26  PRO A O      1 
ATOM   1398 C  CB     . PRO C 3 26 ? -12.458 10.765  6.952   1.00 0.34  ? 26  PRO A CB     1 
ATOM   1399 C  CG     . PRO C 3 26 ? -13.363 11.706  7.761   1.00 0.50  ? 26  PRO A CG     1 
ATOM   1400 C  CD     . PRO C 3 26 ? -14.558 12.088  6.876   1.00 0.40  ? 26  PRO A CD     1 
ATOM   1401 H  HA     . PRO C 3 26 ? -12.044 11.628  5.019   1.00 0.31  ? 26  PRO A HA     1 
ATOM   1402 H  HB2    . PRO C 3 26 ? -12.651 9.736   7.239   1.00 0.40  ? 26  PRO A HB2    1 
ATOM   1403 H  HB3    . PRO C 3 26 ? -11.420 11.003  7.145   1.00 0.35  ? 26  PRO A HB3    1 
ATOM   1404 H  HG2    . PRO C 3 26 ? -13.711 11.207  8.657   1.00 0.67  ? 26  PRO A HG2    1 
ATOM   1405 H  HG3    . PRO C 3 26 ? -12.816 12.599  8.033   1.00 0.68  ? 26  PRO A HG3    1 
ATOM   1406 H  HD2    . PRO C 3 26 ? -15.447 11.548  7.184   1.00 0.43  ? 26  PRO A HD2    1 
ATOM   1407 H  HD3    . PRO C 3 26 ? -14.727 13.154  6.890   1.00 0.45  ? 26  PRO A HD3    1 
ATOM   1408 N  N      . VAL C 3 27 ? -11.928 9.409   3.787   1.00 0.28  ? 27  VAL A N      1 
ATOM   1409 C  CA     . VAL C 3 27 ? -11.899 8.100   3.048   1.00 0.28  ? 27  VAL A CA     1 
ATOM   1410 C  C      . VAL C 3 27 ? -10.456 7.612   2.911   1.00 0.26  ? 27  VAL A C      1 
ATOM   1411 O  O      . VAL C 3 27 ? -9.520  8.376   3.032   1.00 0.26  ? 27  VAL A O      1 
ATOM   1412 C  CB     . VAL C 3 27 ? -12.570 8.204   1.666   1.00 0.30  ? 27  VAL A CB     1 
ATOM   1413 C  CG1    . VAL C 3 27 ? -14.094 8.350   1.841   1.00 0.32  ? 27  VAL A CG1    1 
ATOM   1414 C  CG2    . VAL C 3 27 ? -11.993 9.400   0.861   1.00 0.30  ? 27  VAL A CG2    1 
ATOM   1415 H  H      . VAL C 3 27 ? -11.253 10.102  3.630   1.00 0.28  ? 27  VAL A H      1 
ATOM   1416 H  HA     . VAL C 3 27 ? -12.430 7.381   3.633   1.00 0.29  ? 27  VAL A HA     1 
ATOM   1417 H  HB     . VAL C 3 27 ? -12.380 7.287   1.127   1.00 0.33  ? 27  VAL A HB     1 
ATOM   1418 H  HG11   . VAL C 3 27 ? -14.442 7.680   2.616   1.00 0.97  ? 27  VAL A HG11   1 
ATOM   1419 H  HG12   . VAL C 3 27 ? -14.332 9.366   2.111   1.00 1.11  ? 27  VAL A HG12   1 
ATOM   1420 H  HG13   . VAL C 3 27 ? -14.586 8.100   0.913   1.00 1.11  ? 27  VAL A HG13   1 
ATOM   1421 H  HG21   . VAL C 3 27 ? -11.459 10.073  1.520   1.00 1.10  ? 27  VAL A HG21   1 
ATOM   1422 H  HG22   . VAL C 3 27 ? -11.313 9.027   0.106   1.00 1.07  ? 27  VAL A HG22   1 
ATOM   1423 H  HG23   . VAL C 3 27 ? -12.790 9.943   0.373   1.00 0.98  ? 27  VAL A HG23   1 
ATOM   1424 N  N      . CYS C 3 28 ? -10.264 6.334   2.672   1.00 0.26  ? 28  CYS A N      1 
ATOM   1425 C  CA     . CYS C 3 28 ? -8.882  5.791   2.544   1.00 0.25  ? 28  CYS A CA     1 
ATOM   1426 C  C      . CYS C 3 28 ? -8.350  6.010   1.120   1.00 0.25  ? 28  CYS A C      1 
ATOM   1427 O  O      . CYS C 3 28 ? -9.098  6.209   0.183   1.00 0.25  ? 28  CYS A O      1 
ATOM   1428 C  CB     . CYS C 3 28 ? -8.870  4.296   2.933   1.00 0.27  ? 28  CYS A CB     1 
ATOM   1429 S  SG     . CYS C 3 28 ? -9.714  3.269   1.693   1.00 0.31  ? 28  CYS A SG     1 
ATOM   1430 H  H      . CYS C 3 28 ? -11.020 5.728   2.568   1.00 0.28  ? 28  CYS A H      1 
ATOM   1431 H  HA     . CYS C 3 28 ? -8.238  6.326   3.230   1.00 0.25  ? 28  CYS A HA     1 
ATOM   1432 H  HB2    . CYS C 3 28 ? -7.845  3.966   3.014   1.00 0.28  ? 28  CYS A HB2    1 
ATOM   1433 H  HB3    . CYS C 3 28 ? -9.349  4.177   3.890   1.00 0.28  ? 28  CYS A HB3    1 
ATOM   1434 N  N      . ASN C 3 29 ? -7.052  6.011   0.971   1.00 0.26  ? 29  ASN A N      1 
ATOM   1435 C  CA     . ASN C 3 29 ? -6.421  6.258   -0.365  1.00 0.27  ? 29  ASN A CA     1 
ATOM   1436 C  C      . ASN C 3 29 ? -7.081  5.428   -1.468  1.00 0.25  ? 29  ASN A C      1 
ATOM   1437 O  O      . ASN C 3 29 ? -7.232  5.886   -2.584  1.00 0.27  ? 29  ASN A O      1 
ATOM   1438 C  CB     . ASN C 3 29 ? -4.938  5.891   -0.284  1.00 0.35  ? 29  ASN A CB     1 
ATOM   1439 C  CG     . ASN C 3 29 ? -4.258  6.202   -1.618  1.00 0.44  ? 29  ASN A CG     1 
ATOM   1440 O  OD1    . ASN C 3 29 ? -4.716  5.777   -2.660  1.00 0.56  ? 29  ASN A OD1    1 
ATOM   1441 N  ND2    . ASN C 3 29 ? -3.175  6.932   -1.629  1.00 0.86  ? 29  ASN A ND2    1 
ATOM   1442 H  H      . ASN C 3 29 ? -6.481  5.886   1.757   1.00 0.28  ? 29  ASN A H      1 
ATOM   1443 H  HA     . ASN C 3 29 ? -6.507  7.298   -0.621  1.00 0.27  ? 29  ASN A HA     1 
ATOM   1444 H  HB2    . ASN C 3 29 ? -4.468  6.465   0.503   1.00 0.38  ? 29  ASN A HB2    1 
ATOM   1445 H  HB3    . ASN C 3 29 ? -4.839  4.838   -0.069  1.00 0.39  ? 29  ASN A HB3    1 
ATOM   1446 H  HD21   . ASN C 3 29 ? -2.807  7.275   -0.788  1.00 1.21  ? 29  ASN A HD21   1 
ATOM   1447 H  HD22   . ASN C 3 29 ? -2.731  7.136   -2.479  1.00 0.93  ? 29  ASN A HD22   1 
ATOM   1448 N  N      . ALA C 3 30 ? -7.457  4.219   -1.192  1.00 0.26  ? 30  ALA A N      1 
ATOM   1449 C  CA     . ALA C 3 30 ? -8.080  3.388   -2.258  1.00 0.25  ? 30  ALA A CA     1 
ATOM   1450 C  C      . ALA C 3 30 ? -9.484  3.913   -2.618  1.00 0.27  ? 30  ALA A C      1 
ATOM   1451 O  O      . ALA C 3 30 ? -9.770  4.182   -3.768  1.00 0.30  ? 30  ALA A O      1 
ATOM   1452 C  CB     . ALA C 3 30 ? -8.161  1.945   -1.780  1.00 0.25  ? 30  ALA A CB     1 
ATOM   1453 H  H      . ALA C 3 30 ? -7.319  3.854   -0.293  1.00 0.28  ? 30  ALA A H      1 
ATOM   1454 H  HA     . ALA C 3 30 ? -7.456  3.427   -3.140  1.00 0.25  ? 30  ALA A HA     1 
ATOM   1455 H  HB1    . ALA C 3 30 ? -7.193  1.643   -1.406  1.00 1.03  ? 30  ALA A HB1    1 
ATOM   1456 H  HB2    . ALA C 3 30 ? -8.894  1.865   -0.994  1.00 1.03  ? 30  ALA A HB2    1 
ATOM   1457 H  HB3    . ALA C 3 30 ? -8.441  1.311   -2.606  1.00 1.03  ? 30  ALA A HB3    1 
ATOM   1458 N  N      . CYS C 3 31 ? -10.365 4.052   -1.658  1.00 0.27  ? 31  CYS A N      1 
ATOM   1459 C  CA     . CYS C 3 31 ? -11.747 4.548   -1.974  1.00 0.29  ? 31  CYS A CA     1 
ATOM   1460 C  C      . CYS C 3 31 ? -11.679 5.888   -2.699  1.00 0.29  ? 31  CYS A C      1 
ATOM   1461 O  O      . CYS C 3 31 ? -12.402 6.135   -3.627  1.00 0.33  ? 31  CYS A O      1 
ATOM   1462 C  CB     . CYS C 3 31 ? -12.541 4.779   -0.685  1.00 0.31  ? 31  CYS A CB     1 
ATOM   1463 S  SG     . CYS C 3 31 ? -13.042 3.215   0.047   1.00 0.35  ? 31  CYS A SG     1 
ATOM   1464 H  H      . CYS C 3 31 ? -10.125 3.822   -0.736  1.00 0.26  ? 31  CYS A H      1 
ATOM   1465 H  HA     . CYS C 3 31 ? -12.260 3.826   -2.590  1.00 0.32  ? 31  CYS A HA     1 
ATOM   1466 H  HB2    . CYS C 3 31 ? -11.921 5.309   0.017   1.00 0.28  ? 31  CYS A HB2    1 
ATOM   1467 H  HB3    . CYS C 3 31 ? -13.422 5.370   -0.898  1.00 0.33  ? 31  CYS A HB3    1 
ATOM   1468 N  N      . GLY C 3 32 ? -10.846 6.771   -2.256  1.00 0.28  ? 32  GLY A N      1 
ATOM   1469 C  CA     . GLY C 3 32 ? -10.793 8.103   -2.908  1.00 0.30  ? 32  GLY A CA     1 
ATOM   1470 C  C      . GLY C 3 32 ? -10.547 7.958   -4.409  1.00 0.31  ? 32  GLY A C      1 
ATOM   1471 O  O      . GLY C 3 32 ? -11.240 8.542   -5.218  1.00 0.34  ? 32  GLY A O      1 
ATOM   1472 H  H      . GLY C 3 32 ? -10.277 6.563   -1.487  1.00 0.27  ? 32  GLY A H      1 
ATOM   1473 H  HA2    . GLY C 3 32 ? -11.730 8.613   -2.749  1.00 0.33  ? 32  GLY A HA2    1 
ATOM   1474 H  HA3    . GLY C 3 32 ? -10.001 8.677   -2.474  1.00 0.32  ? 32  GLY A HA3    1 
ATOM   1475 N  N      . LEU C 3 33 ? -9.565  7.196   -4.791  1.00 0.29  ? 33  LEU A N      1 
ATOM   1476 C  CA     . LEU C 3 33 ? -9.276  7.038   -6.243  1.00 0.31  ? 33  LEU A CA     1 
ATOM   1477 C  C      . LEU C 3 33 ? -10.386 6.221   -6.914  1.00 0.33  ? 33  LEU A C      1 
ATOM   1478 O  O      . LEU C 3 33 ? -10.920 6.612   -7.930  1.00 0.37  ? 33  LEU A O      1 
ATOM   1479 C  CB     . LEU C 3 33 ? -7.931  6.326   -6.415  1.00 0.30  ? 33  LEU A CB     1 
ATOM   1480 C  CG     . LEU C 3 33 ? -6.826  7.103   -5.673  1.00 0.31  ? 33  LEU A CG     1 
ATOM   1481 C  CD1    . LEU C 3 33 ? -5.625  6.183   -5.430  1.00 0.29  ? 33  LEU A CD1    1 
ATOM   1482 C  CD2    . LEU C 3 33 ? -6.374  8.308   -6.512  1.00 0.38  ? 33  LEU A CD2    1 
ATOM   1483 H  H      . LEU C 3 33 ? -9.007  6.741   -4.125  1.00 0.28  ? 33  LEU A H      1 
ATOM   1484 H  HA     . LEU C 3 33 ? -9.233  8.008   -6.711  1.00 0.35  ? 33  LEU A HA     1 
ATOM   1485 H  HB2    . LEU C 3 33 ? -8.005  5.325   -6.013  1.00 0.28  ? 33  LEU A HB2    1 
ATOM   1486 H  HB3    . LEU C 3 33 ? -7.689  6.273   -7.465  1.00 0.31  ? 33  LEU A HB3    1 
ATOM   1487 H  HG     . LEU C 3 33 ? -7.202  7.448   -4.722  1.00 0.35  ? 33  LEU A HG     1 
ATOM   1488 H  HD11   . LEU C 3 33 ? -5.951  5.295   -4.906  1.00 1.00  ? 33  LEU A HD11   1 
ATOM   1489 H  HD12   . LEU C 3 33 ? -5.188  5.902   -6.376  1.00 1.03  ? 33  LEU A HD12   1 
ATOM   1490 H  HD13   . LEU C 3 33 ? -4.891  6.701   -4.832  1.00 1.11  ? 33  LEU A HD13   1 
ATOM   1491 H  HD21   . LEU C 3 33 ? -6.085  7.976   -7.497  1.00 1.06  ? 33  LEU A HD21   1 
ATOM   1492 H  HD22   . LEU C 3 33 ? -7.181  9.020   -6.594  1.00 1.12  ? 33  LEU A HD22   1 
ATOM   1493 H  HD23   . LEU C 3 33 ? -5.531  8.783   -6.032  1.00 1.00  ? 33  LEU A HD23   1 
ATOM   1494 N  N      . TYR C 3 34 ? -10.750 5.098   -6.361  1.00 0.32  ? 34  TYR A N      1 
ATOM   1495 C  CA     . TYR C 3 34 ? -11.830 4.287   -6.993  1.00 0.36  ? 34  TYR A CA     1 
ATOM   1496 C  C      . TYR C 3 34 ? -13.111 5.112   -7.060  1.00 0.37  ? 34  TYR A C      1 
ATOM   1497 O  O      . TYR C 3 34 ? -13.779 5.169   -8.075  1.00 0.41  ? 34  TYR A O      1 
ATOM   1498 C  CB     . TYR C 3 34 ? -12.094 3.031   -6.161  1.00 0.39  ? 34  TYR A CB     1 
ATOM   1499 C  CG     . TYR C 3 34 ? -13.242 2.259   -6.766  1.00 0.44  ? 34  TYR A CG     1 
ATOM   1500 C  CD1    . TYR C 3 34 ? -14.564 2.558   -6.384  1.00 0.38  ? 34  TYR A CD1    1 
ATOM   1501 C  CD2    . TYR C 3 34 ? -12.995 1.240   -7.708  1.00 0.77  ? 34  TYR A CD2    1 
ATOM   1502 C  CE1    . TYR C 3 34 ? -15.638 1.842   -6.943  1.00 0.47  ? 34  TYR A CE1    1 
ATOM   1503 C  CE2    . TYR C 3 34 ? -14.071 0.524   -8.267  1.00 0.88  ? 34  TYR A CE2    1 
ATOM   1504 C  CZ     . TYR C 3 34 ? -15.393 0.825   -7.885  1.00 0.68  ? 34  TYR A CZ     1 
ATOM   1505 O  OH     . TYR C 3 34 ? -16.448 0.124   -8.434  1.00 0.82  ? 34  TYR A OH     1 
ATOM   1506 H  H      . TYR C 3 34 ? -10.318 4.785   -5.539  1.00 0.30  ? 34  TYR A H      1 
ATOM   1507 H  HA     . TYR C 3 34 ? -11.533 4.002   -7.992  1.00 0.41  ? 34  TYR A HA     1 
ATOM   1508 H  HB2    . TYR C 3 34 ? -11.210 2.413   -6.156  1.00 0.46  ? 34  TYR A HB2    1 
ATOM   1509 H  HB3    . TYR C 3 34 ? -12.343 3.312   -5.149  1.00 0.38  ? 34  TYR A HB3    1 
ATOM   1510 H  HD1    . TYR C 3 34 ? -14.753 3.339   -5.662  1.00 0.49  ? 34  TYR A HD1    1 
ATOM   1511 H  HD2    . TYR C 3 34 ? -11.982 1.009   -8.001  1.00 0.98  ? 34  TYR A HD2    1 
ATOM   1512 H  HE1    . TYR C 3 34 ? -16.651 2.074   -6.649  1.00 0.56  ? 34  TYR A HE1    1 
ATOM   1513 H  HE2    . TYR C 3 34 ? -13.884 -0.257  -8.989  1.00 1.16  ? 34  TYR A HE2    1 
ATOM   1514 H  HH     . TYR C 3 34 ? -16.171 -0.203  -9.293  1.00 1.30  ? 34  TYR A HH     1 
ATOM   1515 N  N      . TYR C 3 35 ? -13.467 5.743   -5.980  1.00 0.34  ? 35  TYR A N      1 
ATOM   1516 C  CA     . TYR C 3 35 ? -14.707 6.558   -5.959  1.00 0.36  ? 35  TYR A CA     1 
ATOM   1517 C  C      . TYR C 3 35 ? -14.591 7.678   -6.994  1.00 0.39  ? 35  TYR A C      1 
ATOM   1518 O  O      . TYR C 3 35 ? -15.486 7.929   -7.754  1.00 0.42  ? 35  TYR A O      1 
ATOM   1519 C  CB     . TYR C 3 35 ? -14.889 7.170   -4.564  1.00 0.37  ? 35  TYR A CB     1 
ATOM   1520 C  CG     . TYR C 3 35 ? -16.317 7.625   -4.409  1.00 0.42  ? 35  TYR A CG     1 
ATOM   1521 C  CD1    . TYR C 3 35 ? -16.702 8.890   -4.879  1.00 0.47  ? 35  TYR A CD1    1 
ATOM   1522 C  CD2    . TYR C 3 35 ? -17.264 6.777   -3.800  1.00 0.44  ? 35  TYR A CD2    1 
ATOM   1523 C  CE1    . TYR C 3 35 ? -18.038 9.315   -4.741  1.00 0.55  ? 35  TYR A CE1    1 
ATOM   1524 C  CE2    . TYR C 3 35 ? -18.597 7.197   -3.661  1.00 0.50  ? 35  TYR A CE2    1 
ATOM   1525 C  CZ     . TYR C 3 35 ? -18.987 8.467   -4.132  1.00 0.56  ? 35  TYR A CZ     1 
ATOM   1526 O  OH     . TYR C 3 35 ? -20.296 8.882   -3.996  1.00 0.64  ? 35  TYR A OH     1 
ATOM   1527 H  H      . TYR C 3 35 ? -12.919 5.683   -5.173  1.00 0.32  ? 35  TYR A H      1 
ATOM   1528 H  HA     . TYR C 3 35 ? -15.553 5.930   -6.194  1.00 0.37  ? 35  TYR A HA     1 
ATOM   1529 H  HB2    . TYR C 3 35 ? -14.655 6.439   -3.806  1.00 0.35  ? 35  TYR A HB2    1 
ATOM   1530 H  HB3    . TYR C 3 35 ? -14.230 8.020   -4.452  1.00 0.38  ? 35  TYR A HB3    1 
ATOM   1531 H  HD1    . TYR C 3 35 ? -15.971 9.534   -5.348  1.00 0.48  ? 35  TYR A HD1    1 
ATOM   1532 H  HD2    . TYR C 3 35 ? -16.966 5.802   -3.442  1.00 0.43  ? 35  TYR A HD2    1 
ATOM   1533 H  HE1    . TYR C 3 35 ? -18.335 10.288  -5.103  1.00 0.61  ? 35  TYR A HE1    1 
ATOM   1534 H  HE2    . TYR C 3 35 ? -19.321 6.543   -3.194  1.00 0.53  ? 35  TYR A HE2    1 
ATOM   1535 H  HH     . TYR C 3 35 ? -20.371 9.758   -4.381  1.00 1.09  ? 35  TYR A HH     1 
ATOM   1536 N  N      . LYS C 3 36 ? -13.495 8.363   -7.025  1.00 0.40  ? 36  LYS A N      1 
ATOM   1537 C  CA     . LYS C 3 36 ? -13.350 9.469   -8.011  1.00 0.46  ? 36  LYS A CA     1 
ATOM   1538 C  C      . LYS C 3 36 ? -13.475 8.923   -9.437  1.00 0.48  ? 36  LYS A C      1 
ATOM   1539 O  O      . LYS C 3 36 ? -14.122 9.514   -10.279 1.00 0.53  ? 36  LYS A O      1 
ATOM   1540 C  CB     . LYS C 3 36 ? -11.968 10.096  -7.825  1.00 0.49  ? 36  LYS A CB     1 
ATOM   1541 C  CG     . LYS C 3 36 ? -11.766 11.233  -8.822  1.00 0.73  ? 36  LYS A CG     1 
ATOM   1542 C  CD     . LYS C 3 36 ? -10.448 11.952  -8.509  1.00 0.75  ? 36  LYS A CD     1 
ATOM   1543 C  CE     . LYS C 3 36 ? -9.256  11.048  -8.851  1.00 0.72  ? 36  LYS A CE     1 
ATOM   1544 N  NZ     . LYS C 3 36 ? -8.029  11.883  -8.992  1.00 1.55  ? 36  LYS A NZ     1 
ATOM   1545 H  H      . LYS C 3 36 ? -12.774 8.168   -6.394  1.00 0.39  ? 36  LYS A H      1 
ATOM   1546 H  HA     . LYS C 3 36 ? -14.123 10.210  -7.851  1.00 0.48  ? 36  LYS A HA     1 
ATOM   1547 H  HB2    . LYS C 3 36 ? -11.883 10.482  -6.819  1.00 0.71  ? 36  LYS A HB2    1 
ATOM   1548 H  HB3    . LYS C 3 36 ? -11.213 9.342   -7.984  1.00 0.67  ? 36  LYS A HB3    1 
ATOM   1549 H  HG2    . LYS C 3 36 ? -11.736 10.834  -9.826  1.00 0.97  ? 36  LYS A HG2    1 
ATOM   1550 H  HG3    . LYS C 3 36 ? -12.583 11.932  -8.739  1.00 0.98  ? 36  LYS A HG3    1 
ATOM   1551 H  HD2    . LYS C 3 36 ? -10.388 12.861  -9.089  1.00 0.90  ? 36  LYS A HD2    1 
ATOM   1552 H  HD3    . LYS C 3 36 ? -10.417 12.197  -7.457  1.00 0.88  ? 36  LYS A HD3    1 
ATOM   1553 H  HE2    . LYS C 3 36 ? -9.109  10.330  -8.059  1.00 1.15  ? 36  LYS A HE2    1 
ATOM   1554 H  HE3    . LYS C 3 36 ? -9.444  10.528  -9.779  1.00 0.98  ? 36  LYS A HE3    1 
ATOM   1555 H  HZ1    . LYS C 3 36 ? -8.276  12.885  -8.867  1.00 2.01  ? 36  LYS A HZ1    1 
ATOM   1556 H  HZ2    . LYS C 3 36 ? -7.334  11.607  -8.270  1.00 2.08  ? 36  LYS A HZ2    1 
ATOM   1557 H  HZ3    . LYS C 3 36 ? -7.619  11.742  -9.940  1.00 2.06  ? 36  LYS A HZ3    1 
ATOM   1558 N  N      . LEU C 3 37 ? -12.866 7.810   -9.718  1.00 0.48  ? 37  LEU A N      1 
ATOM   1559 C  CA     . LEU C 3 37 ? -12.951 7.245   -11.094 1.00 0.53  ? 37  LEU A CA     1 
ATOM   1560 C  C      . LEU C 3 37 ? -14.361 6.707   -11.399 1.00 0.57  ? 37  LEU A C      1 
ATOM   1561 O  O      . LEU C 3 37 ? -14.841 6.850   -12.508 1.00 0.67  ? 37  LEU A O      1 
ATOM   1562 C  CB     . LEU C 3 37 ? -11.908 6.114   -11.236 1.00 0.55  ? 37  LEU A CB     1 
ATOM   1563 C  CG     . LEU C 3 37 ? -10.573 6.677   -11.756 1.00 0.59  ? 37  LEU A CG     1 
ATOM   1564 C  CD1    . LEU C 3 37 ? -10.021 7.734   -10.790 1.00 0.60  ? 37  LEU A CD1    1 
ATOM   1565 C  CD2    . LEU C 3 37 ? -9.563  5.536   -11.886 1.00 0.68  ? 37  LEU A CD2    1 
ATOM   1566 H  H      . LEU C 3 37 ? -12.346 7.347   -9.028  1.00 0.45  ? 37  LEU A H      1 
ATOM   1567 H  HA     . LEU C 3 37 ? -12.725 8.024   -11.804 1.00 0.58  ? 37  LEU A HA     1 
ATOM   1568 H  HB2    . LEU C 3 37 ? -11.747 5.655   -10.272 1.00 0.55  ? 37  LEU A HB2    1 
ATOM   1569 H  HB3    . LEU C 3 37 ? -12.267 5.366   -11.930 1.00 0.59  ? 37  LEU A HB3    1 
ATOM   1570 H  HG     . LEU C 3 37 ? -10.733 7.126   -12.724 1.00 0.63  ? 37  LEU A HG     1 
ATOM   1571 H  HD11   . LEU C 3 37 ? -10.754 8.512   -10.637 1.00 1.13  ? 37  LEU A HD11   1 
ATOM   1572 H  HD12   . LEU C 3 37 ? -9.785  7.272   -9.846  1.00 1.20  ? 37  LEU A HD12   1 
ATOM   1573 H  HD13   . LEU C 3 37 ? -9.125  8.168   -11.210 1.00 1.16  ? 37  LEU A HD13   1 
ATOM   1574 H  HD21   . LEU C 3 37 ? -10.031 4.696   -12.377 1.00 1.16  ? 37  LEU A HD21   1 
ATOM   1575 H  HD22   . LEU C 3 37 ? -8.717  5.869   -12.468 1.00 1.30  ? 37  LEU A HD22   1 
ATOM   1576 H  HD23   . LEU C 3 37 ? -9.228  5.237   -10.903 1.00 1.26  ? 37  LEU A HD23   1 
ATOM   1577 N  N      . HIS C 3 38 ? -15.016 6.062   -10.455 1.00 0.54  ? 38  HIS A N      1 
ATOM   1578 C  CA     . HIS C 3 38 ? -16.380 5.482   -10.739 1.00 0.65  ? 38  HIS A CA     1 
ATOM   1579 C  C      . HIS C 3 38 ? -17.491 6.184   -9.943  1.00 0.69  ? 38  HIS A C      1 
ATOM   1580 O  O      . HIS C 3 38 ? -18.652 6.048   -10.263 1.00 1.18  ? 38  HIS A O      1 
ATOM   1581 C  CB     . HIS C 3 38 ? -16.356 3.995   -10.392 1.00 0.73  ? 38  HIS A CB     1 
ATOM   1582 C  CG     . HIS C 3 38 ? -15.374 3.304   -11.298 1.00 0.75  ? 38  HIS A CG     1 
ATOM   1583 N  ND1    . HIS C 3 38 ? -15.765 2.697   -12.482 1.00 0.91  ? 38  HIS A ND1    1 
ATOM   1584 C  CD2    . HIS C 3 38 ? -14.014 3.133   -11.220 1.00 0.71  ? 38  HIS A CD2    1 
ATOM   1585 C  CE1    . HIS C 3 38 ? -14.662 2.194   -13.064 1.00 0.96  ? 38  HIS A CE1    1 
ATOM   1586 N  NE2    . HIS C 3 38 ? -13.566 2.431   -12.336 1.00 0.85  ? 38  HIS A NE2    1 
ATOM   1587 H  H      . HIS C 3 38 ? -14.602 5.930   -9.577  1.00 0.49  ? 38  HIS A H      1 
ATOM   1588 H  HA     . HIS C 3 38 ? -16.605 5.578   -11.792 1.00 0.71  ? 38  HIS A HA     1 
ATOM   1589 H  HB2    . HIS C 3 38 ? -16.056 3.866   -9.363  1.00 0.71  ? 38  HIS A HB2    1 
ATOM   1590 H  HB3    . HIS C 3 38 ? -17.338 3.573   -10.542 1.00 0.86  ? 38  HIS A HB3    1 
ATOM   1591 H  HD1    . HIS C 3 38 ? -16.680 2.645   -12.831 1.00 1.01  ? 38  HIS A HD1    1 
ATOM   1592 H  HD2    . HIS C 3 38 ? -13.385 3.496   -10.421 1.00 0.64  ? 38  HIS A HD2    1 
ATOM   1593 H  HE1    . HIS C 3 38 ? -14.661 1.665   -14.005 1.00 1.11  ? 38  HIS A HE1    1 
ATOM   1594 N  N      . GLN C 3 39 ? -17.169 6.960   -8.944  1.00 0.48  ? 39  GLN A N      1 
ATOM   1595 C  CA     . GLN C 3 39 ? -18.216 7.698   -8.167  1.00 0.50  ? 39  GLN A CA     1 
ATOM   1596 C  C      . GLN C 3 39 ? -19.361 6.756   -7.719  1.00 0.56  ? 39  GLN A C      1 
ATOM   1597 O  O      . GLN C 3 39 ? -20.527 7.082   -7.739  1.00 0.64  ? 39  GLN A O      1 
ATOM   1598 C  CB     . GLN C 3 39 ? -18.654 8.919   -9.019  1.00 0.56  ? 39  GLN A CB     1 
ATOM   1599 C  CG     . GLN C 3 39 ? -20.079 9.397   -8.700  1.00 1.34  ? 39  GLN A CG     1 
ATOM   1600 C  CD     . GLN C 3 39 ? -20.278 10.811  -9.252  1.00 1.50  ? 39  GLN A CD     1 
ATOM   1601 O  OE1    . GLN C 3 39 ? -19.322 11.527  -9.481  1.00 1.67  ? 39  GLN A OE1    1 
ATOM   1602 N  NE2    . GLN C 3 39 ? -21.492 11.242  -9.480  1.00 2.08  ? 39  GLN A NE2    1 
ATOM   1603 H  H      . GLN C 3 39 ? -16.238 7.126   -8.683  1.00 0.72  ? 39  GLN A H      1 
ATOM   1604 H  HA     . GLN C 3 39 ? -17.729 8.044   -7.267  1.00 0.48  ? 39  GLN A HA     1 
ATOM   1605 H  HB2    . GLN C 3 39 ? -17.962 9.733   -8.833  1.00 1.07  ? 39  GLN A HB2    1 
ATOM   1606 H  HB3    . GLN C 3 39 ? -18.595 8.652   -10.063 1.00 1.07  ? 39  GLN A HB3    1 
ATOM   1607 H  HG2    . GLN C 3 39 ? -20.792 8.741   -9.176  1.00 1.90  ? 39  GLN A HG2    1 
ATOM   1608 H  HG3    . GLN C 3 39 ? -20.236 9.403   -7.633  1.00 1.93  ? 39  GLN A HG3    1 
ATOM   1609 H  HE21   . GLN C 3 39 ? -22.260 10.660  -9.297  1.00 2.56  ? 39  GLN A HE21   1 
ATOM   1610 H  HE22   . GLN C 3 39 ? -21.636 12.145  -9.835  1.00 2.27  ? 39  GLN A HE22   1 
ATOM   1611 N  N      . VAL C 3 40 ? -19.014 5.585   -7.247  1.00 0.57  ? 40  VAL A N      1 
ATOM   1612 C  CA     . VAL C 3 40 ? -20.043 4.634   -6.738  1.00 0.65  ? 40  VAL A CA     1 
ATOM   1613 C  C      . VAL C 3 40 ? -19.488 3.906   -5.514  1.00 0.63  ? 40  VAL A C      1 
ATOM   1614 O  O      . VAL C 3 40 ? -18.295 3.720   -5.376  1.00 0.60  ? 40  VAL A O      1 
ATOM   1615 C  CB     . VAL C 3 40 ? -20.392 3.602   -7.803  1.00 0.72  ? 40  VAL A CB     1 
ATOM   1616 C  CG1    . VAL C 3 40 ? -21.149 4.277   -8.946  1.00 0.77  ? 40  VAL A CG1    1 
ATOM   1617 C  CG2    . VAL C 3 40 ? -19.114 2.938   -8.328  1.00 0.69  ? 40  VAL A CG2    1 
ATOM   1618 H  H      . VAL C 3 40 ? -18.074 5.340   -7.195  1.00 0.54  ? 40  VAL A H      1 
ATOM   1619 H  HA     . VAL C 3 40 ? -20.933 5.173   -6.453  1.00 0.71  ? 40  VAL A HA     1 
ATOM   1620 H  HB     . VAL C 3 40 ? -21.019 2.855   -7.359  1.00 0.79  ? 40  VAL A HB     1 
ATOM   1621 H  HG11   . VAL C 3 40 ? -20.570 5.101   -9.326  1.00 1.42  ? 40  VAL A HG11   1 
ATOM   1622 H  HG12   . VAL C 3 40 ? -21.323 3.562   -9.736  1.00 1.27  ? 40  VAL A HG12   1 
ATOM   1623 H  HG13   . VAL C 3 40 ? -22.097 4.644   -8.580  1.00 1.14  ? 40  VAL A HG13   1 
ATOM   1624 H  HG21   . VAL C 3 40 ? -18.344 3.679   -8.460  1.00 1.29  ? 40  VAL A HG21   1 
ATOM   1625 H  HG22   . VAL C 3 40 ? -18.782 2.198   -7.616  1.00 1.13  ? 40  VAL A HG22   1 
ATOM   1626 H  HG23   . VAL C 3 40 ? -19.318 2.458   -9.273  1.00 1.22  ? 40  VAL A HG23   1 
ATOM   1627 N  N      . ASN C 3 41 ? -20.346 3.476   -4.635  1.00 0.65  ? 41  ASN A N      1 
ATOM   1628 C  CA     . ASN C 3 41 ? -19.874 2.737   -3.426  1.00 0.64  ? 41  ASN A CA     1 
ATOM   1629 C  C      . ASN C 3 41 ? -19.702 1.261   -3.807  1.00 0.66  ? 41  ASN A C      1 
ATOM   1630 O  O      . ASN C 3 41 ? -20.486 0.726   -4.565  1.00 0.71  ? 41  ASN A O      1 
ATOM   1631 C  CB     . ASN C 3 41 ? -20.912 2.872   -2.306  1.00 0.66  ? 41  ASN A CB     1 
ATOM   1632 C  CG     . ASN C 3 41 ? -22.223 2.209   -2.728  1.00 0.70  ? 41  ASN A CG     1 
ATOM   1633 O  OD1    . ASN C 3 41 ? -22.419 1.911   -3.890  1.00 0.98  ? 41  ASN A OD1    1 
ATOM   1634 N  ND2    . ASN C 3 41 ? -23.137 1.967   -1.825  1.00 1.06  ? 41  ASN A ND2    1 
ATOM   1635 H  H      . ASN C 3 41 ? -21.303 3.626   -4.779  1.00 0.68  ? 41  ASN A H      1 
ATOM   1636 H  HA     . ASN C 3 41 ? -18.929 3.150   -3.094  1.00 0.63  ? 41  ASN A HA     1 
ATOM   1637 H  HB2    . ASN C 3 41 ? -20.540 2.395   -1.412  1.00 0.69  ? 41  ASN A HB2    1 
ATOM   1638 H  HB3    . ASN C 3 41 ? -21.090 3.918   -2.107  1.00 0.67  ? 41  ASN A HB3    1 
ATOM   1639 H  HD21   . ASN C 3 41 ? -22.978 2.211   -0.888  1.00 1.50  ? 41  ASN A HD21   1 
ATOM   1640 H  HD22   . ASN C 3 41 ? -23.982 1.542   -2.082  1.00 1.12  ? 41  ASN A HD22   1 
ATOM   1641 N  N      . ARG C 3 42 ? -18.667 0.603   -3.326  1.00 0.68  ? 42  ARG A N      1 
ATOM   1642 C  CA     . ARG C 3 42 ? -18.426 -0.835  -3.704  1.00 0.72  ? 42  ARG A CA     1 
ATOM   1643 C  C      . ARG C 3 42 ? -18.345 -1.725  -2.437  1.00 0.68  ? 42  ARG A C      1 
ATOM   1644 O  O      . ARG C 3 42 ? -17.929 -1.265  -1.391  1.00 0.71  ? 42  ARG A O      1 
ATOM   1645 C  CB     . ARG C 3 42 ? -17.084 -0.900  -4.459  1.00 0.82  ? 42  ARG A CB     1 
ATOM   1646 C  CG     . ARG C 3 42 ? -15.944 -0.514  -3.508  1.00 1.54  ? 42  ARG A CG     1 
ATOM   1647 C  CD     . ARG C 3 42 ? -14.618 -0.474  -4.265  1.00 2.19  ? 42  ARG A CD     1 
ATOM   1648 N  NE     . ARG C 3 42 ? -14.212 -1.885  -4.555  1.00 3.16  ? 42  ARG A NE     1 
ATOM   1649 C  CZ     . ARG C 3 42 ? -13.052 -2.153  -5.082  1.00 3.97  ? 42  ARG A CZ     1 
ATOM   1650 N  NH1    . ARG C 3 42 ? -12.172 -1.203  -5.233  1.00 4.14  ? 42  ARG A NH1    1 
ATOM   1651 N  NH2    . ARG C 3 42 ? -12.756 -3.378  -5.421  1.00 4.99  ? 42  ARG A NH2    1 
ATOM   1652 H  H      . ARG C 3 42 ? -18.021 1.055   -2.744  1.00 0.73  ? 42  ARG A H      1 
ATOM   1653 H  HA     . ARG C 3 42 ? -19.218 -1.179  -4.351  1.00 0.76  ? 42  ARG A HA     1 
ATOM   1654 H  HB2    . ARG C 3 42 ? -16.919 -1.898  -4.831  1.00 1.23  ? 42  ARG A HB2    1 
ATOM   1655 H  HB3    . ARG C 3 42 ? -17.105 -0.208  -5.289  1.00 1.47  ? 42  ARG A HB3    1 
ATOM   1656 H  HG2    . ARG C 3 42 ? -16.143 0.458   -3.082  1.00 2.17  ? 42  ARG A HG2    1 
ATOM   1657 H  HG3    . ARG C 3 42 ? -15.869 -1.243  -2.715  1.00 2.06  ? 42  ARG A HG3    1 
ATOM   1658 H  HD2    . ARG C 3 42 ? -14.732 0.045   -5.190  1.00 2.40  ? 42  ARG A HD2    1 
ATOM   1659 H  HD3    . ARG C 3 42 ? -13.878 0.049   -3.660  1.00 2.58  ? 42  ARG A HD3    1 
ATOM   1660 H  HE     . ARG C 3 42 ? -14.845 -2.613  -4.384  1.00 3.52  ? 42  ARG A HE     1 
ATOM   1661 H  HH11   . ARG C 3 42 ? -12.389 -0.270  -4.946  1.00 3.69  ? 42  ARG A HH11   1 
ATOM   1662 H  HH12   . ARG C 3 42 ? -11.276 -1.409  -5.627  1.00 4.99  ? 42  ARG A HH12   1 
ATOM   1663 H  HH21   . ARG C 3 42 ? -13.421 -4.111  -5.279  1.00 5.24  ? 42  ARG A HH21   1 
ATOM   1664 H  HH22   . ARG C 3 42 ? -11.862 -3.585  -5.819  1.00 5.70  ? 42  ARG A HH22   1 
ATOM   1665 N  N      . PRO C 3 43 ? -18.717 -2.996  -2.524  1.00 0.68  ? 43  PRO A N      1 
ATOM   1666 C  CA     . PRO C 3 43 ? -18.641 -3.915  -1.342  1.00 0.70  ? 43  PRO A CA     1 
ATOM   1667 C  C      . PRO C 3 43 ? -17.219 -4.034  -0.755  1.00 0.68  ? 43  PRO A C      1 
ATOM   1668 O  O      . PRO C 3 43 ? -16.230 -3.832  -1.431  1.00 0.97  ? 43  PRO A O      1 
ATOM   1669 C  CB     . PRO C 3 43 ? -19.133 -5.259  -1.918  1.00 0.80  ? 43  PRO A CB     1 
ATOM   1670 C  CG     . PRO C 3 43 ? -19.269 -5.107  -3.444  1.00 0.85  ? 43  PRO A CG     1 
ATOM   1671 C  CD     . PRO C 3 43 ? -19.245 -3.608  -3.781  1.00 0.76  ? 43  PRO A CD     1 
ATOM   1672 H  HA     . PRO C 3 43 ? -19.322 -3.579  -0.576  1.00 0.72  ? 43  PRO A HA     1 
ATOM   1673 H  HB2    . PRO C 3 43 ? -18.427 -6.047  -1.685  1.00 0.86  ? 43  PRO A HB2    1 
ATOM   1674 H  HB3    . PRO C 3 43 ? -20.098 -5.509  -1.494  1.00 0.98  ? 43  PRO A HB3    1 
ATOM   1675 H  HG2    . PRO C 3 43 ? -18.441 -5.607  -3.935  1.00 0.98  ? 43  PRO A HG2    1 
ATOM   1676 H  HG3    . PRO C 3 43 ? -20.202 -5.541  -3.779  1.00 1.03  ? 43  PRO A HG3    1 
ATOM   1677 H  HD2    . PRO C 3 43 ? -18.592 -3.416  -4.618  1.00 0.80  ? 43  PRO A HD2    1 
ATOM   1678 H  HD3    . PRO C 3 43 ? -20.242 -3.243  -3.981  1.00 0.79  ? 43  PRO A HD3    1 
ATOM   1679 N  N      . LEU C 3 44 ? -17.136 -4.333  0.514   1.00 0.60  ? 44  LEU A N      1 
ATOM   1680 C  CA     . LEU C 3 44 ? -15.817 -4.447  1.213   1.00 0.59  ? 44  LEU A CA     1 
ATOM   1681 C  C      . LEU C 3 44 ? -15.088 -5.757  0.870   1.00 0.61  ? 44  LEU A C      1 
ATOM   1682 O  O      . LEU C 3 44 ? -14.206 -6.178  1.592   1.00 0.68  ? 44  LEU A O      1 
ATOM   1683 C  CB     . LEU C 3 44 ? -16.082 -4.423  2.725   1.00 0.65  ? 44  LEU A CB     1 
ATOM   1684 C  CG     . LEU C 3 44 ? -16.374 -2.985  3.177   1.00 0.66  ? 44  LEU A CG     1 
ATOM   1685 C  CD1    . LEU C 3 44 ? -17.702 -2.505  2.570   1.00 0.76  ? 44  LEU A CD1    1 
ATOM   1686 C  CD2    . LEU C 3 44 ? -16.454 -2.920  4.716   1.00 0.79  ? 44  LEU A CD2    1 
ATOM   1687 H  H      . LEU C 3 44 ? -17.961 -4.465  1.029   1.00 0.77  ? 44  LEU A H      1 
ATOM   1688 H  HA     . LEU C 3 44 ? -15.196 -3.600  0.961   1.00 0.57  ? 44  LEU A HA     1 
ATOM   1689 H  HB2    . LEU C 3 44 ? -16.930 -5.053  2.951   1.00 0.71  ? 44  LEU A HB2    1 
ATOM   1690 H  HB3    . LEU C 3 44 ? -15.212 -4.792  3.250   1.00 0.71  ? 44  LEU A HB3    1 
ATOM   1691 H  HG     . LEU C 3 44 ? -15.579 -2.344  2.828   1.00 0.80  ? 44  LEU A HG     1 
ATOM   1692 H  HD11   . LEU C 3 44 ? -18.430 -3.302  2.607   1.00 1.29  ? 44  LEU A HD11   1 
ATOM   1693 H  HD12   . LEU C 3 44 ? -18.070 -1.658  3.131   1.00 1.25  ? 44  LEU A HD12   1 
ATOM   1694 H  HD13   . LEU C 3 44 ? -17.542 -2.210  1.544   1.00 1.30  ? 44  LEU A HD13   1 
ATOM   1695 H  HD21   . LEU C 3 44 ? -15.742 -3.605  5.154   1.00 1.23  ? 44  LEU A HD21   1 
ATOM   1696 H  HD22   . LEU C 3 44 ? -16.228 -1.915  5.043   1.00 1.34  ? 44  LEU A HD22   1 
ATOM   1697 H  HD23   . LEU C 3 44 ? -17.450 -3.185  5.042   1.00 1.35  ? 44  LEU A HD23   1 
ATOM   1698 N  N      . THR C 3 45 ? -15.441 -6.419  -0.193  1.00 0.73  ? 45  THR A N      1 
ATOM   1699 C  CA     . THR C 3 45 ? -14.746 -7.706  -0.509  1.00 0.79  ? 45  THR A CA     1 
ATOM   1700 C  C      . THR C 3 45 ? -13.304 -7.423  -0.941  1.00 0.71  ? 45  THR A C      1 
ATOM   1701 O  O      . THR C 3 45 ? -12.494 -8.321  -1.059  1.00 0.73  ? 45  THR A O      1 
ATOM   1702 C  CB     . THR C 3 45 ? -15.469 -8.442  -1.650  1.00 0.97  ? 45  THR A CB     1 
ATOM   1703 O  OG1    . THR C 3 45 ? -15.190 -7.777  -2.873  1.00 1.55  ? 45  THR A OG1    1 
ATOM   1704 C  CG2    . THR C 3 45 ? -16.999 -8.472  -1.425  1.00 1.83  ? 45  THR A CG2    1 
ATOM   1705 H  H      . THR C 3 45 ? -16.163 -6.083  -0.765  1.00 0.87  ? 45  THR A H      1 
ATOM   1706 H  HA     . THR C 3 45 ? -14.738 -8.329  0.372   1.00 0.84  ? 45  THR A HA     1 
ATOM   1707 H  HB     . THR C 3 45 ? -15.094 -9.455  -1.706  1.00 1.23  ? 45  THR A HB     1 
ATOM   1708 H  HG1    . THR C 3 45 ? -14.297 -8.012  -3.140  1.00 1.98  ? 45  THR A HG1    1 
ATOM   1709 H  HG21   . THR C 3 45 ? -17.271 -7.864  -0.575  1.00 2.31  ? 45  THR A HG21   1 
ATOM   1710 H  HG22   . THR C 3 45 ? -17.490 -8.090  -2.307  1.00 2.35  ? 45  THR A HG22   1 
ATOM   1711 H  HG23   . THR C 3 45 ? -17.325 -9.489  -1.252  1.00 2.30  ? 45  THR A HG23   1 
ATOM   1712 N  N      . MET C 3 46 ? -12.983 -6.186  -1.202  1.00 0.67  ? 46  MET A N      1 
ATOM   1713 C  CA     . MET C 3 46 ? -11.594 -5.845  -1.656  1.00 0.72  ? 46  MET A CA     1 
ATOM   1714 C  C      . MET C 3 46 ? -10.722 -5.488  -0.446  1.00 0.70  ? 46  MET A C      1 
ATOM   1715 O  O      . MET C 3 46 ? -9.527  -5.300  -0.556  1.00 0.86  ? 46  MET A O      1 
ATOM   1716 C  CB     . MET C 3 46 ? -11.687 -4.626  -2.594  1.00 0.83  ? 46  MET A CB     1 
ATOM   1717 C  CG     . MET C 3 46 ? -10.357 -4.391  -3.353  1.00 0.90  ? 46  MET A CG     1 
ATOM   1718 S  SD     . MET C 3 46 ? -10.473 -5.079  -5.030  1.00 1.10  ? 46  MET A SD     1 
ATOM   1719 C  CE     . MET C 3 46 ? -9.545  -3.781  -5.890  1.00 0.55  ? 46  MET A CE     1 
ATOM   1720 H  H      . MET C 3 46 ? -13.665 -5.476  -1.117  1.00 0.67  ? 46  MET A H      1 
ATOM   1721 H  HA     . MET C 3 46 ? -11.161 -6.679  -2.189  1.00 0.80  ? 46  MET A HA     1 
ATOM   1722 H  HB2    . MET C 3 46 ? -12.482 -4.792  -3.307  1.00 1.21  ? 46  MET A HB2    1 
ATOM   1723 H  HB3    . MET C 3 46 ? -11.923 -3.751  -2.004  1.00 1.36  ? 46  MET A HB3    1 
ATOM   1724 H  HG2    . MET C 3 46 ? -10.164 -3.328  -3.418  1.00 1.67  ? 46  MET A HG2    1 
ATOM   1725 H  HG3    . MET C 3 46 ? -9.542  -4.865  -2.830  1.00 1.59  ? 46  MET A HG3    1 
ATOM   1726 H  HE1    . MET C 3 46 ? -10.037 -2.830  -5.740  1.00 1.15  ? 46  MET A HE1    1 
ATOM   1727 H  HE2    . MET C 3 46 ? -8.538  -3.737  -5.498  1.00 1.22  ? 46  MET A HE2    1 
ATOM   1728 H  HE3    . MET C 3 46 ? -9.508  -4.000  -6.946  1.00 1.12  ? 46  MET A HE3    1 
ATOM   1729 N  N      . ARG C 3 47 ? -11.323 -5.337  0.701   1.00 0.67  ? 47  ARG A N      1 
ATOM   1730 C  CA     . ARG C 3 47 ? -10.548 -4.922  1.914   1.00 0.78  ? 47  ARG A CA     1 
ATOM   1731 C  C      . ARG C 3 47 ? -9.866  -6.070  2.661   1.00 0.63  ? 47  ARG A C      1 
ATOM   1732 O  O      . ARG C 3 47 ? -10.341 -7.187  2.737   1.00 0.60  ? 47  ARG A O      1 
ATOM   1733 C  CB     . ARG C 3 47 ? -11.506 -4.170  2.873   1.00 1.00  ? 47  ARG A CB     1 
ATOM   1734 C  CG     . ARG C 3 47 ? -11.147 -2.664  2.944   1.00 1.50  ? 47  ARG A CG     1 
ATOM   1735 C  CD     . ARG C 3 47 ? -12.395 -1.790  3.053   1.00 2.16  ? 47  ARG A CD     1 
ATOM   1736 N  NE     . ARG C 3 47 ? -12.483 -1.283  4.463   1.00 3.26  ? 47  ARG A NE     1 
ATOM   1737 C  CZ     . ARG C 3 47 ? -12.750 -2.093  5.445   1.00 4.20  ? 47  ARG A CZ     1 
ATOM   1738 N  NH1    . ARG C 3 47 ? -13.359 -3.223  5.215   1.00 4.42  ? 47  ARG A NH1    1 
ATOM   1739 N  NH2    . ARG C 3 47 ? -12.496 -1.738  6.668   1.00 5.27  ? 47  ARG A NH2    1 
ATOM   1740 H  H      . ARG C 3 47 ? -12.294 -5.459  0.756   1.00 0.69  ? 47  ARG A H      1 
ATOM   1741 H  HA     . ARG C 3 47 ? -9.765  -4.255  1.594   1.00 0.95  ? 47  ARG A HA     1 
ATOM   1742 H  HB2    . ARG C 3 47 ? -12.508 -4.292  2.508   1.00 1.25  ? 47  ARG A HB2    1 
ATOM   1743 H  HB3    . ARG C 3 47 ? -11.448 -4.589  3.872   1.00 1.71  ? 47  ARG A HB3    1 
ATOM   1744 H  HG2    . ARG C 3 47 ? -10.525 -2.489  3.812   1.00 2.19  ? 47  ARG A HG2    1 
ATOM   1745 H  HG3    . ARG C 3 47 ? -10.595 -2.368  2.062   1.00 1.79  ? 47  ARG A HG3    1 
ATOM   1746 H  HD2    . ARG C 3 47 ? -12.274 -0.964  2.411   1.00 2.14  ? 47  ARG A HD2    1 
ATOM   1747 H  HD3    . ARG C 3 47 ? -13.283 -2.335  2.738   1.00 2.59  ? 47  ARG A HD3    1 
ATOM   1748 H  HE     . ARG C 3 47 ? -12.204 -0.364  4.660   1.00 3.58  ? 47  ARG A HE     1 
ATOM   1749 H  HH11   . ARG C 3 47 ? -13.625 -3.468  4.283   1.00 3.89  ? 47  ARG A HH11   1 
ATOM   1750 H  HH12   . ARG C 3 47 ? -13.571 -3.839  5.974   1.00 5.34  ? 47  ARG A HH12   1 
ATOM   1751 H  HH21   . ARG C 3 47 ? -12.103 -0.847  6.849   1.00 5.46  ? 47  ARG A HH21   1 
ATOM   1752 H  HH22   . ARG C 3 47 ? -12.683 -2.366  7.422   1.00 6.05  ? 47  ARG A HH22   1 
ATOM   1753 N  N      . LYS C 3 48 ? -8.752  -5.724  3.252   1.00 0.63  ? 48  LYS A N      1 
ATOM   1754 C  CA     . LYS C 3 48 ? -7.950  -6.664  4.078   1.00 0.64  ? 48  LYS A CA     1 
ATOM   1755 C  C      . LYS C 3 48 ? -7.655  -5.968  5.408   1.00 0.64  ? 48  LYS A C      1 
ATOM   1756 O  O      . LYS C 3 48 ? -7.726  -4.758  5.509   1.00 0.79  ? 48  LYS A O      1 
ATOM   1757 C  CB     . LYS C 3 48 ? -6.629  -6.965  3.379   1.00 0.76  ? 48  LYS A CB     1 
ATOM   1758 C  CG     . LYS C 3 48 ? -6.869  -7.863  2.169   1.00 1.34  ? 48  LYS A CG     1 
ATOM   1759 C  CD     . LYS C 3 48 ? -5.543  -8.057  1.426   1.00 1.52  ? 48  LYS A CD     1 
ATOM   1760 C  CE     . LYS C 3 48 ? -5.659  -9.213  0.421   1.00 2.15  ? 48  LYS A CE     1 
ATOM   1761 N  NZ     . LYS C 3 48 ? -5.259  -10.481 1.094   1.00 2.88  ? 48  LYS A NZ     1 
ATOM   1762 H  H      . LYS C 3 48 ? -8.444  -4.799  3.155   1.00 0.68  ? 48  LYS A H      1 
ATOM   1763 H  HA     . LYS C 3 48 ? -8.499  -7.579  4.253   1.00 0.68  ? 48  LYS A HA     1 
ATOM   1764 H  HB2    . LYS C 3 48 ? -6.178  -6.039  3.055   1.00 1.18  ? 48  LYS A HB2    1 
ATOM   1765 H  HB3    . LYS C 3 48 ? -5.966  -7.465  4.069   1.00 1.27  ? 48  LYS A HB3    1 
ATOM   1766 H  HG2    . LYS C 3 48 ? -7.245  -8.820  2.500   1.00 2.06  ? 48  LYS A HG2    1 
ATOM   1767 H  HG3    . LYS C 3 48 ? -7.587  -7.399  1.509   1.00 1.85  ? 48  LYS A HG3    1 
ATOM   1768 H  HD2    . LYS C 3 48 ? -5.299  -7.147  0.902   1.00 1.72  ? 48  LYS A HD2    1 
ATOM   1769 H  HD3    . LYS C 3 48 ? -4.761  -8.280  2.137   1.00 2.11  ? 48  LYS A HD3    1 
ATOM   1770 H  HE2    . LYS C 3 48 ? -6.676  -9.295  0.064   1.00 2.61  ? 48  LYS A HE2    1 
ATOM   1771 H  HE3    . LYS C 3 48 ? -5.000  -9.031  -0.415  1.00 2.48  ? 48  LYS A HE3    1 
ATOM   1772 H  HZ1    . LYS C 3 48 ? -4.954  -10.273 2.067   1.00 3.28  ? 48  LYS A HZ1    1 
ATOM   1773 H  HZ2    . LYS C 3 48 ? -6.067  -11.135 1.115   1.00 3.16  ? 48  LYS A HZ2    1 
ATOM   1774 H  HZ3    . LYS C 3 48 ? -4.475  -10.917 0.571   1.00 3.35  ? 48  LYS A HZ3    1 
ATOM   1775 N  N      . ASP C 3 49 ? -7.324  -6.703  6.428   1.00 0.68  ? 49  ASP A N      1 
ATOM   1776 C  CA     . ASP C 3 49 ? -7.028  -6.053  7.736   1.00 0.72  ? 49  ASP A CA     1 
ATOM   1777 C  C      . ASP C 3 49 ? -5.868  -5.065  7.566   1.00 0.67  ? 49  ASP A C      1 
ATOM   1778 O  O      . ASP C 3 49 ? -6.061  -3.864  7.542   1.00 1.14  ? 49  ASP A O      1 
ATOM   1779 C  CB     . ASP C 3 49 ? -6.636  -7.125  8.756   1.00 0.87  ? 49  ASP A CB     1 
ATOM   1780 C  CG     . ASP C 3 49 ? -7.850  -8.009  9.054   1.00 1.75  ? 49  ASP A CG     1 
ATOM   1781 O  OD1    . ASP C 3 49 ? -8.840  -7.482  9.536   1.00 2.42  ? 49  ASP A OD1    1 
ATOM   1782 O  OD2    . ASP C 3 49 ? -7.773  -9.196  8.785   1.00 2.50  ? 49  ASP A OD2    1 
ATOM   1783 H  H      . ASP C 3 49 ? -7.270  -7.678  6.339   1.00 0.81  ? 49  ASP A H      1 
ATOM   1784 H  HA     . ASP C 3 49 ? -7.896  -5.520  8.092   1.00 0.76  ? 49  ASP A HA     1 
ATOM   1785 H  HB2    . ASP C 3 49 ? -5.838  -7.731  8.350   1.00 1.24  ? 49  ASP A HB2    1 
ATOM   1786 H  HB3    . ASP C 3 49 ? -6.302  -6.652  9.668   1.00 1.28  ? 49  ASP A HB3    1 
ATOM   1787 N  N      . GLY C 3 50 ? -4.665  -5.558  7.466   1.00 0.71  ? 50  GLY A N      1 
ATOM   1788 C  CA     . GLY C 3 50 ? -3.491  -4.645  7.320   1.00 0.61  ? 50  GLY A CA     1 
ATOM   1789 C  C      . GLY C 3 50 ? -3.468  -4.028  5.919   1.00 0.51  ? 50  GLY A C      1 
ATOM   1790 O  O      . GLY C 3 50 ? -4.367  -4.221  5.126   1.00 0.54  ? 50  GLY A O      1 
ATOM   1791 H  H      . GLY C 3 50 ? -4.530  -6.527  7.512   1.00 1.16  ? 50  GLY A H      1 
ATOM   1792 H  HA2    . GLY C 3 50 ? -3.559  -3.859  8.058   1.00 0.60  ? 50  GLY A HA2    1 
ATOM   1793 H  HA3    . GLY C 3 50 ? -2.580  -5.204  7.477   1.00 0.69  ? 50  GLY A HA3    1 
ATOM   1794 N  N      . ILE C 3 51 ? -2.430  -3.294  5.609   1.00 0.42  ? 51  ILE A N      1 
ATOM   1795 C  CA     . ILE C 3 51 ? -2.314  -2.665  4.264   1.00 0.37  ? 51  ILE A CA     1 
ATOM   1796 C  C      . ILE C 3 51 ? -1.546  -3.606  3.331   1.00 0.38  ? 51  ILE A C      1 
ATOM   1797 O  O      . ILE C 3 51 ? -0.598  -4.255  3.726   1.00 0.42  ? 51  ILE A O      1 
ATOM   1798 C  CB     . ILE C 3 51 ? -1.570  -1.336  4.394   1.00 0.33  ? 51  ILE A CB     1 
ATOM   1799 C  CG1    . ILE C 3 51 ? -2.308  -0.470  5.417   1.00 0.36  ? 51  ILE A CG1    1 
ATOM   1800 C  CG2    . ILE C 3 51 ? -1.534  -0.612  3.041   1.00 0.40  ? 51  ILE A CG2    1 
ATOM   1801 C  CD1    . ILE C 3 51 ? -1.717  0.938   5.430   1.00 0.32  ? 51  ILE A CD1    1 
ATOM   1802 H  H      . ILE C 3 51 ? -1.709  -3.172  6.260   1.00 0.43  ? 51  ILE A H      1 
ATOM   1803 H  HA     . ILE C 3 51 ? -3.299  -2.476  3.862   1.00 0.41  ? 51  ILE A HA     1 
ATOM   1804 H  HB     . ILE C 3 51 ? -0.561  -1.518  4.734   1.00 0.38  ? 51  ILE A HB     1 
ATOM   1805 H  HG12   . ILE C 3 51 ? -3.354  -0.418  5.153   1.00 0.48  ? 51  ILE A HG12   1 
ATOM   1806 H  HG13   . ILE C 3 51 ? -2.206  -0.909  6.397   1.00 0.48  ? 51  ILE A HG13   1 
ATOM   1807 H  HG21   . ILE C 3 51 ? -1.257  -1.302  2.261   1.00 1.10  ? 51  ILE A HG21   1 
ATOM   1808 H  HG22   . ILE C 3 51 ? -2.510  -0.200  2.828   1.00 1.09  ? 51  ILE A HG22   1 
ATOM   1809 H  HG23   . ILE C 3 51 ? -0.809  0.186   3.084   1.00 1.12  ? 51  ILE A HG23   1 
ATOM   1810 H  HD11   . ILE C 3 51 ? -0.639  0.878   5.396   1.00 1.07  ? 51  ILE A HD11   1 
ATOM   1811 H  HD12   . ILE C 3 51 ? -2.075  1.482   4.570   1.00 1.09  ? 51  ILE A HD12   1 
ATOM   1812 H  HD13   . ILE C 3 51 ? -2.023  1.446   6.330   1.00 1.05  ? 51  ILE A HD13   1 
ATOM   1813 N  N      . GLN C 3 52 ? -1.937  -3.667  2.089   1.00 0.40  ? 52  GLN A N      1 
ATOM   1814 C  CA     . GLN C 3 52 ? -1.212  -4.543  1.127   1.00 0.45  ? 52  GLN A CA     1 
ATOM   1815 C  C      . GLN C 3 52 ? 0.089   -3.847  0.723   1.00 0.42  ? 52  GLN A C      1 
ATOM   1816 O  O      . GLN C 3 52 ? 0.174   -2.638  0.723   1.00 0.40  ? 52  GLN A O      1 
ATOM   1817 C  CB     . GLN C 3 52 ? -2.070  -4.779  -0.121  1.00 0.51  ? 52  GLN A CB     1 
ATOM   1818 C  CG     . GLN C 3 52 ? -3.264  -5.670  0.223   1.00 1.02  ? 52  GLN A CG     1 
ATOM   1819 C  CD     . GLN C 3 52 ? -4.227  -5.696  -0.968  1.00 1.31  ? 52  GLN A CD     1 
ATOM   1820 O  OE1    . GLN C 3 52 ? -4.728  -6.739  -1.337  1.00 1.95  ? 52  GLN A OE1    1 
ATOM   1821 N  NE2    . GLN C 3 52 ? -4.507  -4.582  -1.588  1.00 1.22  ? 52  GLN A NE2    1 
ATOM   1822 H  H      . GLN C 3 52 ? -2.688  -3.110  1.796   1.00 0.42  ? 52  GLN A H      1 
ATOM   1823 H  HA     . GLN C 3 52 ? -0.987  -5.491  1.598   1.00 0.49  ? 52  GLN A HA     1 
ATOM   1824 H  HB2    . GLN C 3 52 ? -2.431  -3.832  -0.494  1.00 0.79  ? 52  GLN A HB2    1 
ATOM   1825 H  HB3    . GLN C 3 52 ? -1.474  -5.259  -0.882  1.00 0.68  ? 52  GLN A HB3    1 
ATOM   1826 H  HG2    . GLN C 3 52 ? -2.920  -6.675  0.434   1.00 1.41  ? 52  GLN A HG2    1 
ATOM   1827 H  HG3    . GLN C 3 52 ? -3.774  -5.275  1.088   1.00 1.48  ? 52  GLN A HG3    1 
ATOM   1828 H  HE21   . GLN C 3 52 ? -4.102  -3.739  -1.291  1.00 1.05  ? 52  GLN A HE21   1 
ATOM   1829 H  HE22   . GLN C 3 52 ? -5.121  -4.587  -2.351  1.00 1.59  ? 52  GLN A HE22   1 
ATOM   1830 N  N      . THR C 3 53 ? 1.112   -4.593  0.395   1.00 0.45  ? 53  THR A N      1 
ATOM   1831 C  CA     . THR C 3 53 ? 2.411   -3.961  -0.008  1.00 0.44  ? 53  THR A CA     1 
ATOM   1832 C  C      . THR C 3 53 ? 2.926   -4.635  -1.276  1.00 0.47  ? 53  THR A C      1 
ATOM   1833 O  O      . THR C 3 53 ? 2.475   -5.696  -1.662  1.00 0.49  ? 53  THR A O      1 
ATOM   1834 C  CB     . THR C 3 53 ? 3.439   -4.105  1.116   1.00 0.46  ? 53  THR A CB     1 
ATOM   1835 O  OG1    . THR C 3 53 ? 4.746   -4.146  0.560   1.00 0.50  ? 53  THR A OG1    1 
ATOM   1836 C  CG2    . THR C 3 53 ? 3.169   -5.391  1.888   1.00 0.49  ? 53  THR A CG2    1 
ATOM   1837 H  H      . THR C 3 53 ? 1.031   -5.569  0.429   1.00 0.48  ? 53  THR A H      1 
ATOM   1838 H  HA     . THR C 3 53 ? 2.260   -2.915  -0.232  1.00 0.42  ? 53  THR A HA     1 
ATOM   1839 H  HB     . THR C 3 53 ? 3.360   -3.264  1.788   1.00 0.46  ? 53  THR A HB     1 
ATOM   1840 H  HG1    . THR C 3 53 ? 5.266   -3.452  0.972   1.00 1.04  ? 53  THR A HG1    1 
ATOM   1841 H  HG21   . THR C 3 53 ? 3.120   -6.218  1.197   1.00 1.09  ? 53  THR A HG21   1 
ATOM   1842 H  HG22   . THR C 3 53 ? 3.964   -5.557  2.598   1.00 1.25  ? 53  THR A HG22   1 
ATOM   1843 H  HG23   . THR C 3 53 ? 2.228   -5.302  2.412   1.00 1.02  ? 53  THR A HG23   1 
ATOM   1844 N  N      . ARG C 3 54 ? 3.854   -4.003  -1.943  1.00 0.47  ? 54  ARG A N      1 
ATOM   1845 C  CA     . ARG C 3 54 ? 4.391   -4.578  -3.210  1.00 0.50  ? 54  ARG A CA     1 
ATOM   1846 C  C      . ARG C 3 54 ? 5.848   -4.152  -3.400  1.00 0.50  ? 54  ARG A C      1 
ATOM   1847 O  O      . ARG C 3 54 ? 6.293   -3.168  -2.844  1.00 0.49  ? 54  ARG A O      1 
ATOM   1848 C  CB     . ARG C 3 54 ? 3.549   -4.046  -4.383  1.00 0.52  ? 54  ARG A CB     1 
ATOM   1849 C  CG     . ARG C 3 54 ? 3.703   -4.958  -5.618  1.00 1.25  ? 54  ARG A CG     1 
ATOM   1850 C  CD     . ARG C 3 54 ? 2.602   -6.028  -5.637  1.00 1.35  ? 54  ARG A CD     1 
ATOM   1851 N  NE     . ARG C 3 54 ? 3.122   -7.251  -6.310  1.00 1.78  ? 54  ARG A NE     1 
ATOM   1852 C  CZ     . ARG C 3 54 ? 2.445   -8.360  -6.251  1.00 2.17  ? 54  ARG A CZ     1 
ATOM   1853 N  NH1    . ARG C 3 54 ? 1.268   -8.378  -5.683  1.00 2.50  ? 54  ARG A NH1    1 
ATOM   1854 N  NH2    . ARG C 3 54 ? 2.933   -9.448  -6.775  1.00 2.89  ? 54  ARG A NH2    1 
ATOM   1855 H  H      . ARG C 3 54 ? 4.179   -3.141  -1.609  1.00 0.47  ? 54  ARG A H      1 
ATOM   1856 H  HA     . ARG C 3 54 ? 4.331   -5.654  -3.169  1.00 0.52  ? 54  ARG A HA     1 
ATOM   1857 H  HB2    . ARG C 3 54 ? 2.512   -4.008  -4.084  1.00 0.92  ? 54  ARG A HB2    1 
ATOM   1858 H  HB3    . ARG C 3 54 ? 3.877   -3.046  -4.637  1.00 1.04  ? 54  ARG A HB3    1 
ATOM   1859 H  HG2    . ARG C 3 54 ? 3.628   -4.358  -6.514  1.00 1.93  ? 54  ARG A HG2    1 
ATOM   1860 H  HG3    . ARG C 3 54 ? 4.669   -5.442  -5.597  1.00 2.03  ? 54  ARG A HG3    1 
ATOM   1861 H  HD2    . ARG C 3 54 ? 2.312   -6.278  -4.627  1.00 1.84  ? 54  ARG A HD2    1 
ATOM   1862 H  HD3    . ARG C 3 54 ? 1.741   -5.647  -6.171  1.00 1.81  ? 54  ARG A HD3    1 
ATOM   1863 H  HE     . ARG C 3 54 ? 3.988   -7.229  -6.772  1.00 2.32  ? 54  ARG A HE     1 
ATOM   1864 H  HH11   . ARG C 3 54 ? 0.888   -7.539  -5.292  1.00 2.47  ? 54  ARG A HH11   1 
ATOM   1865 H  HH12   . ARG C 3 54 ? 0.747   -9.230  -5.640  1.00 3.17  ? 54  ARG A HH12   1 
ATOM   1866 H  HH21   . ARG C 3 54 ? 3.829   -9.431  -7.221  1.00 3.26  ? 54  ARG A HH21   1 
ATOM   1867 H  HH22   . ARG C 3 54 ? 2.413   -10.300 -6.732  1.00 3.34  ? 54  ARG A HH22   1 
ATOM   1868 N  N      . ASN C 3 55 ? 6.588   -4.869  -4.204  1.00 0.54  ? 55  ASN A N      1 
ATOM   1869 C  CA     . ASN C 3 55 ? 8.001   -4.473  -4.446  1.00 0.55  ? 55  ASN A CA     1 
ATOM   1870 C  C      . ASN C 3 55 ? 7.991   -3.044  -4.995  1.00 0.54  ? 55  ASN A C      1 
ATOM   1871 O  O      . ASN C 3 55 ? 7.239   -2.723  -5.893  1.00 0.56  ? 55  ASN A O      1 
ATOM   1872 C  CB     . ASN C 3 55 ? 8.641   -5.436  -5.483  1.00 0.60  ? 55  ASN A CB     1 
ATOM   1873 C  CG     . ASN C 3 55 ? 9.593   -6.438  -4.804  1.00 1.38  ? 55  ASN A CG     1 
ATOM   1874 O  OD1    . ASN C 3 55 ? 9.879   -6.339  -3.625  1.00 2.16  ? 55  ASN A OD1    1 
ATOM   1875 N  ND2    . ASN C 3 55 ? 10.108  -7.404  -5.521  1.00 2.07  ? 55  ASN A ND2    1 
ATOM   1876 H  H      . ASN C 3 55 ? 6.208   -5.650  -4.660  1.00 0.58  ? 55  ASN A H      1 
ATOM   1877 H  HA     . ASN C 3 55 ? 8.549   -4.491  -3.518  1.00 0.55  ? 55  ASN A HA     1 
ATOM   1878 H  HB2    . ASN C 3 55 ? 7.854   -5.985  -5.981  1.00 1.14  ? 55  ASN A HB2    1 
ATOM   1879 H  HB3    . ASN C 3 55 ? 9.194   -4.871  -6.223  1.00 1.06  ? 55  ASN A HB3    1 
ATOM   1880 H  HD21   . ASN C 3 55 ? 9.882   -7.478  -6.472  1.00 2.27  ? 55  ASN A HD21   1 
ATOM   1881 H  HD22   . ASN C 3 55 ? 10.722  -8.051  -5.112  1.00 2.76  ? 55  ASN A HD22   1 
ATOM   1882 N  N      . ARG C 3 56 ? 8.814   -2.184  -4.469  1.00 0.55  ? 56  ARG A N      1 
ATOM   1883 C  CA     . ARG C 3 56 ? 8.830   -0.790  -4.983  1.00 0.60  ? 56  ARG A CA     1 
ATOM   1884 C  C      . ARG C 3 56 ? 9.139   -0.812  -6.475  1.00 0.62  ? 56  ARG A C      1 
ATOM   1885 O  O      . ARG C 3 56 ? 10.123  -1.381  -6.904  1.00 0.63  ? 56  ARG A O      1 
ATOM   1886 C  CB     . ARG C 3 56 ? 9.911   0.018   -4.261  1.00 0.65  ? 56  ARG A CB     1 
ATOM   1887 C  CG     . ARG C 3 56 ? 9.489   0.259   -2.812  1.00 1.04  ? 56  ARG A CG     1 
ATOM   1888 C  CD     . ARG C 3 56 ? 10.474  1.221   -2.146  1.00 1.05  ? 56  ARG A CD     1 
ATOM   1889 N  NE     . ARG C 3 56 ? 10.248  1.224   -0.674  1.00 1.73  ? 56  ARG A NE     1 
ATOM   1890 C  CZ     . ARG C 3 56 ? 11.157  1.713   0.124   1.00 2.30  ? 56  ARG A CZ     1 
ATOM   1891 N  NH1    . ARG C 3 56 ? 12.259  2.210   -0.368  1.00 2.62  ? 56  ARG A NH1    1 
ATOM   1892 N  NH2    . ARG C 3 56 ? 10.962  1.707   1.414   1.00 3.08  ? 56  ARG A NH2    1 
ATOM   1893 H  H      . ARG C 3 56 ? 9.417   -2.454  -3.745  1.00 0.55  ? 56  ARG A H      1 
ATOM   1894 H  HA     . ARG C 3 56 ? 7.870   -0.324  -4.813  1.00 0.63  ? 56  ARG A HA     1 
ATOM   1895 H  HB2    . ARG C 3 56 ? 10.842  -0.532  -4.278  1.00 1.04  ? 56  ARG A HB2    1 
ATOM   1896 H  HB3    . ARG C 3 56 ? 10.045  0.967   -4.759  1.00 1.18  ? 56  ARG A HB3    1 
ATOM   1897 H  HG2    . ARG C 3 56 ? 8.501   0.689   -2.795  1.00 1.78  ? 56  ARG A HG2    1 
ATOM   1898 H  HG3    . ARG C 3 56 ? 9.484   -0.677  -2.275  1.00 1.80  ? 56  ARG A HG3    1 
ATOM   1899 H  HD2    . ARG C 3 56 ? 11.484  0.904   -2.358  1.00 1.57  ? 56  ARG A HD2    1 
ATOM   1900 H  HD3    . ARG C 3 56 ? 10.320  2.218   -2.533  1.00 1.52  ? 56  ARG A HD3    1 
ATOM   1901 H  HE     . ARG C 3 56 ? 9.417   0.858   -0.305  1.00 2.22  ? 56  ARG A HE     1 
ATOM   1902 H  HH11   . ARG C 3 56 ? 12.407  2.218   -1.357  1.00 2.54  ? 56  ARG A HH11   1 
ATOM   1903 H  HH12   . ARG C 3 56 ? 12.955  2.585   0.245   1.00 3.29  ? 56  ARG A HH12   1 
ATOM   1904 H  HH21   . ARG C 3 56 ? 10.117  1.328   1.791   1.00 3.43  ? 56  ARG A HH21   1 
ATOM   1905 H  HH22   . ARG C 3 56 ? 11.659  2.081   2.026   1.00 3.57  ? 56  ARG A HH22   1 
ATOM   1906 N  N      . LYS C 3 57 ? 8.320   -0.187  -7.272  1.00 0.69  ? 57  LYS A N      1 
ATOM   1907 C  CA     . LYS C 3 57 ? 8.594   -0.170  -8.730  1.00 0.80  ? 57  LYS A CA     1 
ATOM   1908 C  C      . LYS C 3 57 ? 10.008  0.354   -8.945  1.00 0.72  ? 57  LYS A C      1 
ATOM   1909 O  O      . LYS C 3 57 ? 10.688  0.697   -7.997  1.00 0.77  ? 57  LYS A O      1 
ATOM   1910 C  CB     . LYS C 3 57 ? 7.591   0.730   -9.430  1.00 1.02  ? 57  LYS A CB     1 
ATOM   1911 C  CG     . LYS C 3 57 ? 7.626   2.114   -8.810  1.00 0.86  ? 57  LYS A CG     1 
ATOM   1912 C  CD     . LYS C 3 57 ? 6.601   2.985   -9.527  1.00 0.93  ? 57  LYS A CD     1 
ATOM   1913 C  CE     . LYS C 3 57 ? 6.388   4.278   -8.744  1.00 0.75  ? 57  LYS A CE     1 
ATOM   1914 N  NZ     . LYS C 3 57 ? 5.492   5.187   -9.514  1.00 1.24  ? 57  LYS A NZ     1 
ATOM   1915 H  H      . LYS C 3 57 ? 7.534   0.276   -6.913  1.00 0.71  ? 57  LYS A H      1 
ATOM   1916 H  HA     . LYS C 3 57 ? 8.511   -1.157  -9.125  1.00 0.90  ? 57  LYS A HA     1 
ATOM   1917 H  HB2    . LYS C 3 57 ? 7.838   0.799   -10.479 1.00 1.58  ? 57  LYS A HB2    1 
ATOM   1918 H  HB3    . LYS C 3 57 ? 6.599   0.318   -9.317  1.00 1.67  ? 57  LYS A HB3    1 
ATOM   1919 H  HG2    . LYS C 3 57 ? 7.381   2.044   -7.760  1.00 1.50  ? 57  LYS A HG2    1 
ATOM   1920 H  HG3    . LYS C 3 57 ? 8.610   2.539   -8.930  1.00 1.36  ? 57  LYS A HG3    1 
ATOM   1921 H  HD2    . LYS C 3 57 ? 6.963   3.212   -10.519 1.00 1.27  ? 57  LYS A HD2    1 
ATOM   1922 H  HD3    . LYS C 3 57 ? 5.666   2.449   -9.599  1.00 1.47  ? 57  LYS A HD3    1 
ATOM   1923 H  HE2    . LYS C 3 57 ? 5.935   4.046   -7.792  1.00 1.30  ? 57  LYS A HE2    1 
ATOM   1924 H  HE3    . LYS C 3 57 ? 7.339   4.761   -8.583  1.00 1.23  ? 57  LYS A HE3    1 
ATOM   1925 H  HZ1    . LYS C 3 57 ? 4.602   4.696   -9.734  1.00 1.72  ? 57  LYS A HZ1    1 
ATOM   1926 H  HZ2    . LYS C 3 57 ? 5.289   6.036   -8.946  1.00 1.65  ? 57  LYS A HZ2    1 
ATOM   1927 H  HZ3    . LYS C 3 57 ? 5.960   5.465   -10.399 1.00 1.85  ? 57  LYS A HZ3    1 
ATOM   1928 N  N      . VAL C 3 58 ? 10.466  0.431   -10.168 1.00 0.70  ? 58  VAL A N      1 
ATOM   1929 C  CA     . VAL C 3 58 ? 11.843  0.954   -10.403 1.00 0.71  ? 58  VAL A CA     1 
ATOM   1930 C  C      . VAL C 3 58 ? 12.003  2.236   -9.583  1.00 0.68  ? 58  VAL A C      1 
ATOM   1931 O  O      . VAL C 3 58 ? 11.047  2.953   -9.364  1.00 0.83  ? 58  VAL A O      1 
ATOM   1932 C  CB     . VAL C 3 58 ? 12.027  1.254   -11.895 1.00 0.83  ? 58  VAL A CB     1 
ATOM   1933 C  CG1    . VAL C 3 58 ? 10.806  2.009   -12.416 1.00 1.61  ? 58  VAL A CG1    1 
ATOM   1934 C  CG2    . VAL C 3 58 ? 13.286  2.108   -12.108 1.00 1.77  ? 58  VAL A CG2    1 
ATOM   1935 H  H      . VAL C 3 58 ? 9.906   0.158   -10.924 1.00 0.75  ? 58  VAL A H      1 
ATOM   1936 H  HA     . VAL C 3 58 ? 12.569  0.215   -10.091 1.00 0.79  ? 58  VAL A HA     1 
ATOM   1937 H  HB     . VAL C 3 58 ? 12.125  0.323   -12.436 1.00 1.32  ? 58  VAL A HB     1 
ATOM   1938 H  HG11   . VAL C 3 58 ? 10.608  2.857   -11.779 1.00 2.18  ? 58  VAL A HG11   1 
ATOM   1939 H  HG12   . VAL C 3 58 ? 11.001  2.350   -13.421 1.00 2.12  ? 58  VAL A HG12   1 
ATOM   1940 H  HG13   . VAL C 3 58 ? 9.948   1.351   -12.419 1.00 2.16  ? 58  VAL A HG13   1 
ATOM   1941 H  HG21   . VAL C 3 58 ? 14.099  1.706   -11.520 1.00 2.31  ? 58  VAL A HG21   1 
ATOM   1942 H  HG22   . VAL C 3 58 ? 13.560  2.099   -13.153 1.00 2.31  ? 58  VAL A HG22   1 
ATOM   1943 H  HG23   . VAL C 3 58 ? 13.088  3.123   -11.797 1.00 2.32  ? 58  VAL A HG23   1 
ATOM   1944 N  N      . SER C 3 59 ? 13.174  2.529   -9.109  1.00 0.80  ? 59  SER A N      1 
ATOM   1945 C  CA     . SER C 3 59 ? 13.324  3.764   -8.297  1.00 0.95  ? 59  SER A CA     1 
ATOM   1946 C  C      . SER C 3 59 ? 13.090  4.993   -9.175  1.00 1.11  ? 59  SER A C      1 
ATOM   1947 O  O      . SER C 3 59 ? 13.697  6.027   -8.976  1.00 1.42  ? 59  SER A O      1 
ATOM   1948 C  CB     . SER C 3 59 ? 14.712  3.833   -7.664  1.00 1.34  ? 59  SER A CB     1 
ATOM   1949 O  OG     . SER C 3 59 ? 15.676  4.137   -8.664  1.00 2.11  ? 59  SER A OG     1 
ATOM   1950 H  H      . SER C 3 59 ? 13.935  1.937   -9.278  1.00 0.98  ? 59  SER A H      1 
ATOM   1951 H  HA     . SER C 3 59 ? 12.581  3.754   -7.511  1.00 0.96  ? 59  SER A HA     1 
ATOM   1952 H  HB2    . SER C 3 59 ? 14.722  4.608   -6.912  1.00 1.64  ? 59  SER A HB2    1 
ATOM   1953 H  HB3    . SER C 3 59 ? 14.940  2.884   -7.198  1.00 1.60  ? 59  SER A HB3    1 
ATOM   1954 H  HG     . SER C 3 59 ? 16.110  3.319   -8.916  1.00 2.44  ? 59  SER A HG     1 
ATOM   1955 N  N      . SER C 3 60 ? 12.186  4.913   -10.125 1.00 1.42  ? 60  SER A N      1 
ATOM   1956 C  CA     . SER C 3 60 ? 11.908  6.106   -10.966 1.00 1.83  ? 60  SER A CA     1 
ATOM   1957 C  C      . SER C 3 60 ? 11.528  7.222   -10.003 1.00 2.07  ? 60  SER A C      1 
ATOM   1958 O  O      . SER C 3 60 ? 10.918  6.985   -8.979  1.00 2.55  ? 60  SER A O      1 
ATOM   1959 C  CB     . SER C 3 60 ? 10.763  5.822   -11.938 1.00 2.25  ? 60  SER A CB     1 
ATOM   1960 O  OG     . SER C 3 60 ? 10.524  6.981   -12.725 1.00 2.76  ? 60  SER A OG     1 
ATOM   1961 H  H      . SER C 3 60 ? 11.682  4.089   -10.262 1.00 1.64  ? 60  SER A H      1 
ATOM   1962 H  HA     . SER C 3 60 ? 12.800  6.376   -11.515 1.00 1.98  ? 60  SER A HA     1 
ATOM   1963 H  HB2    . SER C 3 60 ? 11.035  5.006   -12.587 1.00 2.37  ? 60  SER A HB2    1 
ATOM   1964 H  HB3    . SER C 3 60 ? 9.874   5.558   -11.381 1.00 2.41  ? 60  SER A HB3    1 
ATOM   1965 H  HG     . SER C 3 60 ? 11.212  7.622   -12.527 1.00 3.04  ? 60  SER A HG     1 
ATOM   1966 N  N      . LYS C 3 61 ? 11.959  8.410   -10.258 1.00 2.23  ? 61  LYS A N      1 
ATOM   1967 C  CA     . LYS C 3 61 ? 11.706  9.500   -9.285  1.00 2.69  ? 61  LYS A CA     1 
ATOM   1968 C  C      . LYS C 3 61 ? 11.813  10.838  -10.009 1.00 3.22  ? 61  LYS A C      1 
ATOM   1969 O  O      . LYS C 3 61 ? 12.282  10.901  -11.130 1.00 3.66  ? 61  LYS A O      1 
ATOM   1970 C  CB     . LYS C 3 61 ? 12.858  9.370   -8.264  1.00 3.06  ? 61  LYS A CB     1 
ATOM   1971 C  CG     . LYS C 3 61 ? 12.677  10.219  -7.009  1.00 3.69  ? 61  LYS A CG     1 
ATOM   1972 C  CD     . LYS C 3 61 ? 14.013  10.242  -6.193  1.00 4.47  ? 61  LYS A CD     1 
ATOM   1973 C  CE     . LYS C 3 61 ? 14.499  11.684  -5.899  1.00 5.27  ? 61  LYS A CE     1 
ATOM   1974 N  NZ     . LYS C 3 61 ? 15.995  11.700  -5.884  1.00 5.94  ? 61  LYS A NZ     1 
ATOM   1975 H  H      . LYS C 3 61 ? 12.514  8.575   -11.050 1.00 2.35  ? 61  LYS A H      1 
ATOM   1976 H  HA     . LYS C 3 61 ? 10.749  9.389   -8.802  1.00 2.86  ? 61  LYS A HA     1 
ATOM   1977 H  HB2    . LYS C 3 61 ? 12.959  8.335   -7.974  1.00 3.31  ? 61  LYS A HB2    1 
ATOM   1978 H  HB3    . LYS C 3 61 ? 13.754  9.670   -8.734  1.00 3.30  ? 61  LYS A HB3    1 
ATOM   1979 H  HG2    . LYS C 3 61 ? 12.376  11.216  -7.275  1.00 3.93  ? 61  LYS A HG2    1 
ATOM   1980 H  HG3    . LYS C 3 61 ? 11.919  9.761   -6.418  1.00 3.94  ? 61  LYS A HG3    1 
ATOM   1981 H  HD2    . LYS C 3 61 ? 13.859  9.730   -5.257  1.00 4.76  ? 61  LYS A HD2    1 
ATOM   1982 H  HD3    . LYS C 3 61 ? 14.789  9.723   -6.736  1.00 4.63  ? 61  LYS A HD3    1 
ATOM   1983 H  HE2    . LYS C 3 61 ? 14.147  12.368  -6.659  1.00 5.52  ? 61  LYS A HE2    1 
ATOM   1984 H  HE3    . LYS C 3 61 ? 14.134  12.003  -4.935  1.00 5.53  ? 61  LYS A HE3    1 
ATOM   1985 H  HZ1    . LYS C 3 61 ? 16.354  10.729  -5.765  1.00 6.28  ? 61  LYS A HZ1    1 
ATOM   1986 H  HZ2    . LYS C 3 61 ? 16.346  12.091  -6.780  1.00 6.22  ? 61  LYS A HZ2    1 
ATOM   1987 H  HZ3    . LYS C 3 61 ? 16.331  12.291  -5.097  1.00 6.13  ? 61  LYS A HZ3    1 
ATOM   1988 N  N      . GLY C 3 62 ? 11.483  11.924  -9.360  1.00 3.73  ? 62  GLY A N      1 
ATOM   1989 C  CA     . GLY C 3 62 ? 11.695  13.251  -10.012 1.00 4.56  ? 62  GLY A CA     1 
ATOM   1990 C  C      . GLY C 3 62 ? 13.221  13.448  -10.027 1.00 4.98  ? 62  GLY A C      1 
ATOM   1991 O  O      . GLY C 3 62 ? 13.743  14.533  -10.189 1.00 5.52  ? 62  GLY A O      1 
ATOM   1992 H  H      . GLY C 3 62 ? 11.172  11.871  -8.431  1.00 3.86  ? 62  GLY A H      1 
ATOM   1993 H  HA2    . GLY C 3 62 ? 11.303  13.236  -11.021 1.00 4.66  ? 62  GLY A HA2    1 
ATOM   1994 H  HA3    . GLY C 3 62 ? 11.229  14.036  -9.437  1.00 5.13  ? 62  GLY A HA3    1 
ATOM   1995 N  N      . LYS C 3 63 ? 13.899  12.340  -9.830  1.00 5.16  ? 63  LYS A N      1 
ATOM   1996 C  CA     . LYS C 3 63 ? 15.377  12.228  -9.773  1.00 5.94  ? 63  LYS A CA     1 
ATOM   1997 C  C      . LYS C 3 63 ? 16.138  13.529  -9.925  1.00 6.47  ? 63  LYS A C      1 
ATOM   1998 O  O      . LYS C 3 63 ? 16.851  13.961  -9.039  1.00 6.92  ? 63  LYS A O      1 
ATOM   1999 C  CB     . LYS C 3 63 ? 15.878  11.376  -10.971 1.00 6.22  ? 63  LYS A CB     1 
ATOM   2000 C  CG     . LYS C 3 63 ? 15.638  9.872   -10.782 1.00 6.54  ? 63  LYS A CG     1 
ATOM   2001 C  CD     . LYS C 3 63 ? 15.411  9.174   -12.138 1.00 7.16  ? 63  LYS A CD     1 
ATOM   2002 C  CE     . LYS C 3 63 ? 16.472  9.571   -13.191 1.00 7.63  ? 63  LYS A CE     1 
ATOM   2003 N  NZ     . LYS C 3 63 ? 15.818  10.406  -14.239 1.00 8.00  ? 63  LYS A NZ     1 
ATOM   2004 H  H      . LYS C 3 63 ? 13.400  11.524  -9.691  1.00 5.05  ? 63  LYS A H      1 
ATOM   2005 H  HA     . LYS C 3 63 ? 15.667  11.736  -8.860  1.00 6.28  ? 63  LYS A HA     1 
ATOM   2006 H  HB2    . LYS C 3 63 ? 15.378  11.709  -11.865 1.00 6.34  ? 63  LYS A HB2    1 
ATOM   2007 H  HB3    . LYS C 3 63 ? 16.944  11.541  -11.085 1.00 6.49  ? 63  LYS A HB3    1 
ATOM   2008 H  HG2    . LYS C 3 63 ? 16.484  9.422   -10.283 1.00 6.58  ? 63  LYS A HG2    1 
ATOM   2009 H  HG3    . LYS C 3 63 ? 14.777  9.734   -10.194 1.00 6.67  ? 63  LYS A HG3    1 
ATOM   2010 H  HD2    . LYS C 3 63 ? 15.438  8.106   -11.987 1.00 7.50  ? 63  LYS A HD2    1 
ATOM   2011 H  HD3    . LYS C 3 63 ? 14.432  9.449   -12.508 1.00 7.27  ? 63  LYS A HD3    1 
ATOM   2012 H  HE2    . LYS C 3 63 ? 17.276  10.124  -12.739 1.00 7.74  ? 63  LYS A HE2    1 
ATOM   2013 H  HE3    . LYS C 3 63 ? 16.876  8.682   -13.652 1.00 7.91  ? 63  LYS A HE3    1 
ATOM   2014 H  HZ1    . LYS C 3 63 ? 15.041  10.953  -13.812 1.00 8.20  ? 63  LYS A HZ1    1 
ATOM   2015 H  HZ2    . LYS C 3 63 ? 16.515  11.056  -14.651 1.00 8.18  ? 63  LYS A HZ2    1 
ATOM   2016 H  HZ3    . LYS C 3 63 ? 15.437  9.790   -14.985 1.00 8.16  ? 63  LYS A HZ3    1 
ATOM   2017 N  N      . LYS C 3 64 ? 16.180  13.993  -11.139 1.00 6.72  ? 64  LYS A N      1 
ATOM   2018 C  CA     . LYS C 3 64 ? 17.125  15.080  -11.463 1.00 7.46  ? 64  LYS A CA     1 
ATOM   2019 C  C      . LYS C 3 64 ? 16.604  16.139  -12.442 1.00 7.61  ? 64  LYS A C      1 
ATOM   2020 O  O      . LYS C 3 64 ? 15.480  16.599  -12.402 1.00 7.68  ? 64  LYS A O      1 
ATOM   2021 C  CB     . LYS C 3 64 ? 18.258  14.299  -12.153 1.00 8.13  ? 64  LYS A CB     1 
ATOM   2022 C  CG     . LYS C 3 64 ? 19.612  15.008  -12.055 1.00 8.48  ? 64  LYS A CG     1 
ATOM   2023 C  CD     . LYS C 3 64 ? 20.426  14.677  -13.321 1.00 9.07  ? 64  LYS A CD     1 
ATOM   2024 C  CE     . LYS C 3 64 ? 20.557  13.145  -13.494 1.00 9.72  ? 64  LYS A CE     1 
ATOM   2025 N  NZ     . LYS C 3 64 ? 19.462  12.628  -14.373 1.00 10.07 ? 64  LYS A NZ     1 
ATOM   2026 H  H      . LYS C 3 64 ? 15.734  13.505  -11.862 1.00 6.61  ? 64  LYS A H      1 
ATOM   2027 H  HA     . LYS C 3 64 ? 17.515  15.550  -10.577 1.00 7.71  ? 64  LYS A HA     1 
ATOM   2028 H  HB2    . LYS C 3 64 ? 18.342  13.322  -11.691 1.00 8.22  ? 64  LYS A HB2    1 
ATOM   2029 H  HB3    . LYS C 3 64 ? 17.991  14.159  -13.194 1.00 8.55  ? 64  LYS A HB3    1 
ATOM   2030 H  HG2    . LYS C 3 64 ? 19.472  16.077  -11.971 1.00 8.56  ? 64  LYS A HG2    1 
ATOM   2031 H  HG3    . LYS C 3 64 ? 20.147  14.648  -11.188 1.00 8.52  ? 64  LYS A HG3    1 
ATOM   2032 H  HD2    . LYS C 3 64 ? 19.916  15.087  -14.183 1.00 9.09  ? 64  LYS A HD2    1 
ATOM   2033 H  HD3    . LYS C 3 64 ? 21.406  15.118  -13.242 1.00 9.28  ? 64  LYS A HD3    1 
ATOM   2034 H  HE2    . LYS C 3 64 ? 21.509  12.916  -13.949 1.00 9.87  ? 64  LYS A HE2    1 
ATOM   2035 H  HE3    . LYS C 3 64 ? 20.499  12.658  -12.530 1.00 10.04 ? 64  LYS A HE3    1 
ATOM   2036 H  HZ1    . LYS C 3 64 ? 18.778  13.385  -14.567 1.00 10.19 ? 64  LYS A HZ1    1 
ATOM   2037 H  HZ2    . LYS C 3 64 ? 19.867  12.291  -15.271 1.00 10.32 ? 64  LYS A HZ2    1 
ATOM   2038 H  HZ3    . LYS C 3 64 ? 18.978  11.841  -13.896 1.00 10.15 ? 64  LYS A HZ3    1 
ATOM   2039 N  N      . ARG C 3 65 ? 17.511  16.517  -13.302 1.00 7.94  ? 65  ARG A N      1 
ATOM   2040 C  CA     . ARG C 3 65 ? 17.305  17.544  -14.334 1.00 8.38  ? 65  ARG A CA     1 
ATOM   2041 C  C      . ARG C 3 65 ? 17.190  18.920  -13.685 1.00 8.71  ? 65  ARG A C      1 
ATOM   2042 O  O      . ARG C 3 65 ? 18.130  19.376  -13.057 1.00 8.96  ? 65  ARG A O      1 
ATOM   2043 C  CB     . ARG C 3 65 ? 16.140  17.172  -15.293 1.00 9.01  ? 65  ARG A CB     1 
ATOM   2044 C  CG     . ARG C 3 65 ? 16.675  17.170  -16.745 1.00 9.23  ? 65  ARG A CG     1 
ATOM   2045 C  CD     . ARG C 3 65 ? 15.601  16.736  -17.727 1.00 9.72  ? 65  ARG A CD     1 
ATOM   2046 N  NE     . ARG C 3 65 ? 14.426  17.657  -17.556 1.00 10.30 ? 65  ARG A NE     1 
ATOM   2047 C  CZ     . ARG C 3 65 ? 13.299  17.265  -17.059 1.00 10.79 ? 65  ARG A CZ     1 
ATOM   2048 N  NH1    . ARG C 3 65 ? 13.131  16.017  -16.707 1.00 10.80 ? 65  ARG A NH1    1 
ATOM   2049 N  NH2    . ARG C 3 65 ? 12.324  18.116  -16.918 1.00 11.49 ? 65  ARG A NH2    1 
ATOM   2050 H  H      . ARG C 3 65 ? 18.390  16.104  -13.249 1.00 8.09  ? 65  ARG A H      1 
ATOM   2051 H  HA     . ARG C 3 65 ? 18.213  17.579  -14.902 1.00 8.32  ? 65  ARG A HA     1 
ATOM   2052 H  HB2    . ARG C 3 65 ? 15.776  16.186  -15.047 1.00 9.16  ? 65  ARG A HB2    1 
ATOM   2053 H  HB3    . ARG C 3 65 ? 15.336  17.878  -15.212 1.00 9.42  ? 65  ARG A HB3    1 
ATOM   2054 H  HG2    . ARG C 3 65 ? 17.008  18.163  -17.003 1.00 9.28  ? 65  ARG A HG2    1 
ATOM   2055 H  HG3    . ARG C 3 65 ? 17.510  16.487  -16.813 1.00 9.27  ? 65  ARG A HG3    1 
ATOM   2056 H  HD2    . ARG C 3 65 ? 15.946  16.871  -18.721 1.00 9.79  ? 65  ARG A HD2    1 
ATOM   2057 H  HD3    . ARG C 3 65 ? 15.391  15.667  -17.581 1.00 9.83  ? 65  ARG A HD3    1 
ATOM   2058 H  HE     . ARG C 3 65 ? 14.521  18.596  -17.825 1.00 10.47 ? 65  ARG A HE     1 
ATOM   2059 H  HH11   . ARG C 3 65 ? 13.874  15.361  -16.820 1.00 10.42 ? 65  ARG A HH11   1 
ATOM   2060 H  HH12   . ARG C 3 65 ? 12.256  15.718  -16.328 1.00 11.32 ? 65  ARG A HH12   1 
ATOM   2061 H  HH21   . ARG C 3 65 ? 12.450  19.069  -17.193 1.00 11.64 ? 65  ARG A HH21   1 
ATOM   2062 H  HH22   . ARG C 3 65 ? 11.451  17.816  -16.537 1.00 11.98 ? 65  ARG A HH22   1 
ATOM   2063 N  N      . ARG C 3 66 ? 16.136  19.632  -13.879 1.00 8.97  ? 66  ARG A N      1 
ATOM   2064 C  CA     . ARG C 3 66 ? 16.093  20.995  -13.325 1.00 9.57  ? 66  ARG A CA     1 
ATOM   2065 C  C      . ARG C 3 66 ? 14.658  21.538  -13.350 1.00 10.22 ? 66  ARG A C      1 
ATOM   2066 O  O      . ARG C 3 66 ? 14.353  22.371  -12.515 1.00 10.51 ? 66  ARG A O      1 
ATOM   2067 C  CB     . ARG C 3 66 ? 17.015  21.867  -14.202 1.00 9.88  ? 66  ARG A CB     1 
ATOM   2068 C  CG     . ARG C 3 66 ? 16.921  21.447  -15.710 1.00 9.96  ? 66  ARG A CG     1 
ATOM   2069 C  CD     . ARG C 3 66 ? 18.217  20.750  -16.182 1.00 10.40 ? 66  ARG A CD     1 
ATOM   2070 N  NE     . ARG C 3 66 ? 19.406  21.600  -15.846 1.00 10.62 ? 66  ARG A NE     1 
ATOM   2071 C  CZ     . ARG C 3 66 ? 19.541  22.787  -16.351 1.00 11.09 ? 66  ARG A CZ     1 
ATOM   2072 N  NH1    . ARG C 3 66 ? 18.718  23.200  -17.278 1.00 11.37 ? 66  ARG A NH1    1 
ATOM   2073 N  NH2    . ARG C 3 66 ? 20.521  23.550  -15.963 1.00 11.49 ? 66  ARG A NH2    1 
ATOM   2074 O  OXT    . ARG C 3 66 ? 13.892  21.114  -14.202 1.00 10.61 ? 66  ARG A OXT    1 
ATOM   2075 H  H      . ARG C 3 66 ? 15.417  19.306  -14.434 1.00 8.95  ? 66  ARG A H      1 
ATOM   2076 H  HA     . ARG C 3 66 ? 16.463  20.988  -12.310 1.00 9.58  ? 66  ARG A HA     1 
ATOM   2077 H  HB2    . ARG C 3 66 ? 16.725  22.902  -14.095 1.00 9.98  ? 66  ARG A HB2    1 
ATOM   2078 H  HB3    . ARG C 3 66 ? 18.034  21.751  -13.859 1.00 10.20 ? 66  ARG A HB3    1 
ATOM   2079 H  HG2    . ARG C 3 66 ? 16.089  20.773  -15.860 1.00 9.95  ? 66  ARG A HG2    1 
ATOM   2080 H  HG3    . ARG C 3 66 ? 16.754  22.325  -16.314 1.00 9.99  ? 66  ARG A HG3    1 
ATOM   2081 H  HD2    . ARG C 3 66 ? 18.341  19.824  -15.676 1.00 10.66 ? 66  ARG A HD2    1 
ATOM   2082 H  HD3    . ARG C 3 66 ? 18.140  20.550  -17.251 1.00 10.54 ? 66  ARG A HD3    1 
ATOM   2083 H  HE     . ARG C 3 66 ? 20.070  21.271  -15.200 1.00 10.56 ? 66  ARG A HE     1 
ATOM   2084 H  HH11   . ARG C 3 66 ? 17.984  22.600  -17.599 1.00 11.23 ? 66  ARG A HH11   1 
ATOM   2085 H  HH12   . ARG C 3 66 ? 18.819  24.116  -17.664 1.00 11.85 ? 66  ARG A HH12   1 
ATOM   2086 H  HH21   . ARG C 3 66 ? 21.170  23.221  -15.276 1.00 11.44 ? 66  ARG A HH21   1 
ATOM   2087 H  HH22   . ARG C 3 66 ? 20.622  24.466  -16.348 1.00 11.97 ? 66  ARG A HH22   1 
HETATM 2088 ZN ZN     . ZN  D 4 .  ? -12.011 3.158   2.074   1.00 0.33  ? 67  ZN  A ZN     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DG  1  101 101 DG  G   B . n 
A 1 2  DT  2  102 102 DT  T   B . n 
A 1 3  DT  3  103 103 DT  T   B . n 
A 1 4  DG  4  104 104 DG  G   B . n 
A 1 5  DC  5  105 105 DC  C   B . n 
A 1 6  DA  6  106 106 DA  A   B . n 
A 1 7  DG  7  107 107 DG  G   B . n 
A 1 8  DA  8  108 108 DA  A   B . n 
A 1 9  DT  9  109 109 DT  T   B . n 
A 1 10 DA  10 110 110 DA  A   B . n 
A 1 11 DA  11 111 111 DA  A   B . n 
A 1 12 DA  12 112 112 DA  A   B . n 
A 1 13 DC  13 113 113 DC  C   B . n 
A 1 14 DA  14 114 114 DA  A   B . n 
A 1 15 DT  15 115 115 DT  T   B . n 
A 1 16 DT  16 116 116 DT  T   B . n 
B 2 1  DA  1  117 117 DA  A   C . n 
B 2 2  DA  2  118 118 DA  A   C . n 
B 2 3  DT  3  119 119 DT  T   C . n 
B 2 4  DG  4  120 120 DG  G   C . n 
B 2 5  DT  5  121 121 DT  T   C . n 
B 2 6  DT  6  122 122 DT  T   C . n 
B 2 7  DT  7  123 123 DT  T   C . n 
B 2 8  DA  8  124 124 DA  A   C . n 
B 2 9  DT  9  125 125 DT  T   C . n 
B 2 10 DC  10 126 126 DC  C   C . n 
B 2 11 DT  11 127 127 DT  T   C . n 
B 2 12 DG  12 128 128 DG  G   C . n 
B 2 13 DC  13 129 129 DC  C   C . n 
B 2 14 DA  14 130 130 DA  A   C . n 
B 2 15 DA  15 131 131 DA  A   C . n 
B 2 16 DC  16 132 132 DC  C   C . n 
C 3 1  LYS 1  1   1   LYS LYS A . n 
C 3 2  ARG 2  2   2   ARG ARG A . n 
C 3 3  ALA 3  3   3   ALA ALA A . n 
C 3 4  GLY 4  4   4   GLY GLY A . n 
C 3 5  THR 5  5   5   THR THR A . n 
C 3 6  VAL 6  6   6   VAL VAL A . n 
C 3 7  CYS 7  7   7   CYS CYS A . n 
C 3 8  SER 8  8   8   SER SER A . n 
C 3 9  ASN 9  9   9   ASN ASN A . n 
C 3 10 CYS 10 10  10  CYS CYS A . n 
C 3 11 GLN 11 11  11  GLN GLN A . n 
C 3 12 THR 12 12  12  THR THR A . n 
C 3 13 SER 13 13  13  SER SER A . n 
C 3 14 THR 14 14  14  THR THR A . n 
C 3 15 THR 15 15  15  THR THR A . n 
C 3 16 THR 16 16  16  THR THR A . n 
C 3 17 LEU 17 17  17  LEU LEU A . n 
C 3 18 TRP 18 18  18  TRP TRP A . n 
C 3 19 ARG 19 19  19  ARG ARG A . n 
C 3 20 ARG 20 20  20  ARG ARG A . n 
C 3 21 SER 21 21  21  SER SER A . n 
C 3 22 PRO 22 22  22  PRO PRO A . n 
C 3 23 MET 23 23  23  MET MET A . n 
C 3 24 GLY 24 24  24  GLY GLY A . n 
C 3 25 ASP 25 25  25  ASP ASP A . n 
C 3 26 PRO 26 26  26  PRO PRO A . n 
C 3 27 VAL 27 27  27  VAL VAL A . n 
C 3 28 CYS 28 28  28  CYS CYS A . n 
C 3 29 ASN 29 29  29  ASN ASN A . n 
C 3 30 ALA 30 30  30  ALA ALA A . n 
C 3 31 CYS 31 31  31  CYS CYS A . n 
C 3 32 GLY 32 32  32  GLY GLY A . n 
C 3 33 LEU 33 33  33  LEU LEU A . n 
C 3 34 TYR 34 34  34  TYR TYR A . n 
C 3 35 TYR 35 35  35  TYR TYR A . n 
C 3 36 LYS 36 36  36  LYS LYS A . n 
C 3 37 LEU 37 37  37  LEU LEU A . n 
C 3 38 HIS 38 38  38  HIS HIS A . n 
C 3 39 GLN 39 39  39  GLN GLN A . n 
C 3 40 VAL 40 40  40  VAL VAL A . n 
C 3 41 ASN 41 41  41  ASN ASN A . n 
C 3 42 ARG 42 42  42  ARG ARG A . n 
C 3 43 PRO 43 43  43  PRO PRO A . n 
C 3 44 LEU 44 44  44  LEU LEU A . n 
C 3 45 THR 45 45  45  THR THR A . n 
C 3 46 MET 46 46  46  MET MET A . n 
C 3 47 ARG 47 47  47  ARG ARG A . n 
C 3 48 LYS 48 48  48  LYS LYS A . n 
C 3 49 ASP 49 49  49  ASP ASP A . n 
C 3 50 GLY 50 50  50  GLY GLY A . n 
C 3 51 ILE 51 51  51  ILE ILE A . n 
C 3 52 GLN 52 52  52  GLN GLN A . n 
C 3 53 THR 53 53  53  THR THR A . n 
C 3 54 ARG 54 54  54  ARG ARG A . n 
C 3 55 ASN 55 55  55  ASN ASN A . n 
C 3 56 ARG 56 56  56  ARG ARG A . n 
C 3 57 LYS 57 57  57  LYS LYS A . n 
C 3 58 VAL 58 58  58  VAL VAL A . n 
C 3 59 SER 59 59  59  SER SER A . n 
C 3 60 SER 60 60  60  SER SER A . n 
C 3 61 LYS 61 61  61  LYS LYS A . n 
C 3 62 GLY 62 62  62  GLY GLY A . n 
C 3 63 LYS 63 63  63  LYS LYS A . n 
C 3 64 LYS 64 64  64  LYS LYS A . n 
C 3 65 ARG 65 65  65  ARG ARG A . n 
C 3 66 ARG 66 66  66  ARG ARG A . n 
# 
_pdbx_nonpoly_scheme.asym_id         D 
_pdbx_nonpoly_scheme.entity_id       4 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     67 
_pdbx_nonpoly_scheme.auth_seq_num    67 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? C CYS 7  ? A CYS 7  ? 1_555 ZN ? D ZN . ? A ZN 67 ? 1_555 SG ? C CYS 10 ? A CYS 10 ? 1_555 106.0 ? 
2 SG ? C CYS 7  ? A CYS 7  ? 1_555 ZN ? D ZN . ? A ZN 67 ? 1_555 SG ? C CYS 28 ? A CYS 28 ? 1_555 111.8 ? 
3 SG ? C CYS 10 ? A CYS 10 ? 1_555 ZN ? D ZN . ? A ZN 67 ? 1_555 SG ? C CYS 28 ? A CYS 28 ? 1_555 112.5 ? 
4 SG ? C CYS 7  ? A CYS 7  ? 1_555 ZN ? D ZN . ? A ZN 67 ? 1_555 SG ? C CYS 31 ? A CYS 31 ? 1_555 110.0 ? 
5 SG ? C CYS 10 ? A CYS 10 ? 1_555 ZN ? D ZN . ? A ZN 67 ? 1_555 SG ? C CYS 31 ? A CYS 31 ? 1_555 109.2 ? 
6 SG ? C CYS 28 ? A CYS 28 ? 1_555 ZN ? D ZN . ? A ZN 67 ? 1_555 SG ? C CYS 31 ? A CYS 31 ? 1_555 107.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-01-28 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.1 ? 1 
X-PLOR refinement       3.1 ? 2 
X-PLOR phasing          3.1 ? 3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  A TYR 35  ? ? H   A GLN 39  ? ? 1.44 
2 1 O6 B DG  107 ? ? H41 C DC  126 ? ? 1.56 
3 1 O  A VAL 58  ? ? H   A SER 60  ? ? 1.58 
4 1 H  A SER 8   ? ? O   A PRO 26  ? ? 1.58 
5 1 O  A CYS 7   ? ? H   A GLN 11  ? ? 1.58 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C5 B DT 103 ? ? C7 B DT 103 ? ? 1.532 1.496 0.036 0.006 N 
2 1 C5 B DT 109 ? ? C7 B DT 109 ? ? 1.532 1.496 0.036 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" B DG 101 ? ? "C1'" B DG 101 ? ? N9 B DG 101 ? ? 110.58 108.30 2.28  0.30 N 
2  1 "O4'" B DT 102 ? ? "C1'" B DT 102 ? ? N1 B DT 102 ? ? 110.73 108.30 2.43  0.30 N 
3  1 "O4'" B DT 103 ? ? "C1'" B DT 103 ? ? N1 B DT 103 ? ? 110.55 108.30 2.25  0.30 N 
4  1 "O4'" B DG 104 ? ? "C1'" B DG 104 ? ? N9 B DG 104 ? ? 110.87 108.30 2.57  0.30 N 
5  1 "O4'" B DC 105 ? ? "C1'" B DC 105 ? ? N1 B DC 105 ? ? 110.85 108.30 2.55  0.30 N 
6  1 "O4'" B DA 106 ? ? "C1'" B DA 106 ? ? N9 B DA 106 ? ? 110.11 108.30 1.81  0.30 N 
7  1 N1    B DA 106 ? ? C2    B DA 106 ? ? N3 B DA 106 ? ? 126.29 129.30 -3.01 0.50 N 
8  1 "O4'" B DG 107 ? ? "C1'" B DG 107 ? ? N9 B DG 107 ? ? 112.07 108.30 3.77  0.30 N 
9  1 "O4'" B DA 108 ? ? "C1'" B DA 108 ? ? N9 B DA 108 ? ? 110.71 108.30 2.41  0.30 N 
10 1 N1    B DA 108 ? ? C2    B DA 108 ? ? N3 B DA 108 ? ? 126.19 129.30 -3.11 0.50 N 
11 1 "O4'" B DT 109 ? ? "C1'" B DT 109 ? ? N1 B DT 109 ? ? 110.39 108.30 2.09  0.30 N 
12 1 "O4'" B DA 110 ? ? "C1'" B DA 110 ? ? N9 B DA 110 ? ? 110.71 108.30 2.41  0.30 N 
13 1 N1    B DA 110 ? ? C2    B DA 110 ? ? N3 B DA 110 ? ? 126.23 129.30 -3.07 0.50 N 
14 1 "O4'" B DA 111 ? ? "C1'" B DA 111 ? ? N9 B DA 111 ? ? 110.48 108.30 2.18  0.30 N 
15 1 N1    B DA 111 ? ? C2    B DA 111 ? ? N3 B DA 111 ? ? 126.27 129.30 -3.03 0.50 N 
16 1 "O4'" B DA 112 ? ? "C1'" B DA 112 ? ? N9 B DA 112 ? ? 111.70 108.30 3.40  0.30 N 
17 1 N1    B DA 112 ? ? C2    B DA 112 ? ? N3 B DA 112 ? ? 126.26 129.30 -3.04 0.50 N 
18 1 "O4'" B DA 114 ? ? "C1'" B DA 114 ? ? N9 B DA 114 ? ? 110.72 108.30 2.42  0.30 N 
19 1 N1    B DA 114 ? ? C2    B DA 114 ? ? N3 B DA 114 ? ? 126.21 129.30 -3.09 0.50 N 
20 1 "O4'" B DT 115 ? ? "C1'" B DT 115 ? ? N1 B DT 115 ? ? 110.87 108.30 2.57  0.30 N 
21 1 "O4'" B DT 116 ? ? "C1'" B DT 116 ? ? N1 B DT 116 ? ? 110.58 108.30 2.28  0.30 N 
22 1 "O4'" C DA 117 ? ? "C1'" C DA 117 ? ? N9 C DA 117 ? ? 110.11 108.30 1.81  0.30 N 
23 1 N1    C DA 117 ? ? C2    C DA 117 ? ? N3 C DA 117 ? ? 126.22 129.30 -3.08 0.50 N 
24 1 "O4'" C DA 118 ? ? "C1'" C DA 118 ? ? N9 C DA 118 ? ? 110.57 108.30 2.27  0.30 N 
25 1 N1    C DA 118 ? ? C2    C DA 118 ? ? N3 C DA 118 ? ? 126.18 129.30 -3.12 0.50 N 
26 1 "O4'" C DT 119 ? ? "C1'" C DT 119 ? ? N1 C DT 119 ? ? 110.93 108.30 2.63  0.30 N 
27 1 "O4'" C DG 120 ? ? "C1'" C DG 120 ? ? N9 C DG 120 ? ? 111.00 108.30 2.70  0.30 N 
28 1 "O4'" C DT 121 ? ? "C1'" C DT 121 ? ? N1 C DT 121 ? ? 111.66 108.30 3.36  0.30 N 
29 1 C6    C DT 121 ? ? C5    C DT 121 ? ? C7 C DT 121 ? ? 119.30 122.90 -3.60 0.60 N 
30 1 "O4'" C DT 122 ? ? "C1'" C DT 122 ? ? N1 C DT 122 ? ? 110.77 108.30 2.47  0.30 N 
31 1 "O4'" C DT 123 ? ? "C1'" C DT 123 ? ? N1 C DT 123 ? ? 111.30 108.30 3.00  0.30 N 
32 1 "O4'" C DA 124 ? ? "C1'" C DA 124 ? ? N9 C DA 124 ? ? 110.49 108.30 2.19  0.30 N 
33 1 N1    C DA 124 ? ? C2    C DA 124 ? ? N3 C DA 124 ? ? 126.25 129.30 -3.05 0.50 N 
34 1 "O4'" C DT 125 ? ? "C1'" C DT 125 ? ? N1 C DT 125 ? ? 111.52 108.30 3.22  0.30 N 
35 1 "O4'" C DC 126 ? ? "C1'" C DC 126 ? ? N1 C DC 126 ? ? 110.82 108.30 2.52  0.30 N 
36 1 "O4'" C DT 127 ? ? "C1'" C DT 127 ? ? N1 C DT 127 ? ? 110.39 108.30 2.09  0.30 N 
37 1 "O4'" C DG 128 ? ? "C1'" C DG 128 ? ? N9 C DG 128 ? ? 110.76 108.30 2.46  0.30 N 
38 1 "O4'" C DC 129 ? ? "C1'" C DC 129 ? ? N1 C DC 129 ? ? 110.49 108.30 2.19  0.30 N 
39 1 "O4'" C DA 130 ? ? "C1'" C DA 130 ? ? N9 C DA 130 ? ? 110.72 108.30 2.42  0.30 N 
40 1 N1    C DA 130 ? ? C2    C DA 130 ? ? N3 C DA 130 ? ? 126.23 129.30 -3.07 0.50 N 
41 1 "O4'" C DA 131 ? ? "C1'" C DA 131 ? ? N9 C DA 131 ? ? 110.94 108.30 2.64  0.30 N 
42 1 N1    C DA 131 ? ? C2    C DA 131 ? ? N3 C DA 131 ? ? 126.19 129.30 -3.11 0.50 N 
43 1 "O4'" C DC 132 ? ? "C1'" C DC 132 ? ? N1 C DC 132 ? ? 110.94 108.30 2.64  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 11 ? ? 59.97   2.36    
2 1 ASP A 49 ? ? -58.94  -75.90  
3 1 LYS A 57 ? ? -53.99  178.89  
4 1 SER A 59 ? ? -66.54  35.51   
5 1 LYS A 63 ? ? 1.59    -75.13  
6 1 LYS A 64 ? ? -142.06 -139.84 
7 1 ARG A 65 ? ? 69.95   -122.42 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     47 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.098 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2GAT 'double helix'        
2GAT 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 16 1_555 0.334  -0.027 -0.021 -1.743  -0.339  2.730   1  B_DG101:DC132_C B 101 ? C 132 ? 19 1 
1 A DT 2  1_555 B DA 15 1_555 -0.640 0.031  0.059  -0.751  -0.401  -10.574 2  B_DT102:DA131_C B 102 ? C 131 ? 20 1 
1 A DT 3  1_555 B DA 14 1_555 -0.687 -0.063 0.105  6.389   -10.726 -9.700  3  B_DT103:DA130_C B 103 ? C 130 ? 20 1 
1 A DG 4  1_555 B DC 13 1_555 0.168  0.083  0.613  7.015   -10.030 0.868   4  B_DG104:DC129_C B 104 ? C 129 ? 19 1 
1 A DC 5  1_555 B DG 12 1_555 -0.025 -0.237 0.008  -15.673 -9.042  -2.413  5  B_DC105:DG128_C B 105 ? C 128 ? 19 1 
1 A DA 6  1_555 B DT 11 1_555 0.745  -0.145 -0.793 -11.553 -2.756  -6.816  6  B_DA106:DT127_C B 106 ? C 127 ? 20 1 
1 A DG 7  1_555 B DC 10 1_555 -0.261 -0.397 -0.965 -8.781  -7.845  -11.152 7  B_DG107:DC126_C B 107 ? C 126 ? 19 1 
1 A DA 8  1_555 B DT 9  1_555 0.605  -0.654 -1.849 0.818   0.043   -28.263 8  B_DA108:DT125_C B 108 ? C 125 ? 20 1 
1 A DT 9  1_555 B DA 8  1_555 -1.329 -0.025 -0.157 4.559   -7.960  -15.507 9  B_DT109:DA124_C B 109 ? C 124 ? 20 1 
1 A DA 10 1_555 B DT 7  1_555 0.856  0.131  0.282  9.299   1.305   -10.470 10 B_DA110:DT123_C B 110 ? C 123 ? 20 1 
1 A DA 11 1_555 B DT 6  1_555 0.125  -0.221 0.229  7.919   -20.146 -3.483  11 B_DA111:DT122_C B 111 ? C 122 ? 20 1 
1 A DA 12 1_555 B DT 5  1_555 0.920  -0.141 -0.575 2.228   -24.299 -4.637  12 B_DA112:DT121_C B 112 ? C 121 ? 20 1 
1 A DC 13 1_555 B DG 4  1_555 0.242  -0.081 0.179  -1.905  -19.057 -0.175  13 B_DC113:DG120_C B 113 ? C 120 ? 19 1 
1 A DA 14 1_555 B DT 3  1_555 0.507  -0.158 1.021  0.692   -14.902 -5.741  14 B_DA114:DT119_C B 114 ? C 119 ? 20 1 
1 A DT 15 1_555 B DA 2  1_555 -0.249 -0.098 0.682  0.426   -14.255 0.539   15 B_DT115:DA118_C B 115 ? C 118 ? 20 1 
1 A DT 16 1_555 B DA 1  1_555 0.328  -0.172 0.145  -0.091  -2.834  9.068   16 B_DT116:DA117_C B 116 ? C 117 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 16 1_555 A DT 2  1_555 B DA 15 1_555 -0.990 -0.316 3.710 -0.304 -1.483 27.576 -0.252 1.990  3.732 -3.109  
0.638  27.617 1  BB_DG101DT102:DA131DC132_CC B 101 ? C 132 ? B 102 ? C 131 ? 
1 A DT 2  1_555 B DA 15 1_555 A DT 3  1_555 B DA 14 1_555 0.023  -0.158 3.157 0.289  1.149  32.313 -0.480 0.009  3.150 2.065   
-0.520 32.334 2  BB_DT102DT103:DA130DA131_CC B 102 ? C 131 ? B 103 ? C 130 ? 
1 A DT 3  1_555 B DA 14 1_555 A DG 4  1_555 B DC 13 1_555 0.780  0.496  3.649 0.041  1.530  38.936 0.537  -1.164 3.666 2.294   
-0.061 38.965 3  BB_DT103DG104:DC129DA130_CC B 103 ? C 130 ? B 104 ? C 129 ? 
1 A DG 4  1_555 B DC 13 1_555 A DC 5  1_555 B DG 12 1_555 -0.044 0.200  4.560 0.901  10.683 34.706 -1.783 0.248  4.425 17.402  
-1.468 36.276 4  BB_DG104DC105:DG128DC129_CC B 104 ? C 129 ? B 105 ? C 128 ? 
1 A DC 5  1_555 B DG 12 1_555 A DA 6  1_555 B DT 11 1_555 -0.681 0.522  3.508 0.966  -1.279 40.994 0.893  1.084  3.474 -1.825  
-1.378 41.023 5  BB_DC105DA106:DT127DG128_CC B 105 ? C 128 ? B 106 ? C 127 ? 
1 A DA 6  1_555 B DT 11 1_555 A DG 7  1_555 B DC 10 1_555 -0.373 -0.288 3.461 -2.844 4.608  23.978 -2.177 -0.048 3.368 10.915  
6.735  24.573 6  BB_DA106DG107:DC126DT127_CC B 106 ? C 127 ? B 107 ? C 126 ? 
1 A DG 7  1_555 B DC 10 1_555 A DA 8  1_555 B DT 9  1_555 -0.933 0.108  3.091 3.946  -1.083 43.643 0.241  1.600  2.996 -1.452  
-5.294 43.825 7  BB_DG107DA108:DT125DC126_CC B 107 ? C 126 ? B 108 ? C 125 ? 
1 A DA 8  1_555 B DT 9  1_555 A DT 9  1_555 B DA 8  1_555 0.291  -0.276 3.284 -7.845 -3.113 26.461 0.174  -2.493 3.084 -6.591  
16.609 27.751 8  BB_DA108DT109:DA124DT125_CC B 108 ? C 125 ? B 109 ? C 124 ? 
1 A DT 9  1_555 B DA 8  1_555 A DA 10 1_555 B DT 7  1_555 1.059  0.877  3.641 0.046  -3.930 46.468 1.471  -1.333 3.560 -4.971  
-0.059 46.625 9  BB_DT109DA110:DT123DA124_CC B 109 ? C 124 ? B 110 ? C 123 ? 
1 A DA 10 1_555 B DT 7  1_555 A DA 11 1_555 B DT 6  1_555 0.187  0.143  3.854 0.854  -2.224 31.308 0.755  -0.156 3.839 -4.114  
-1.580 31.397 10 BB_DA110DA111:DT122DT123_CC B 110 ? C 123 ? B 111 ? C 122 ? 
1 A DA 11 1_555 B DT 6  1_555 A DA 12 1_555 B DT 5  1_555 -0.004 0.426  3.776 3.877  1.695  39.240 0.399  0.535  3.773 2.515   
-5.753 39.458 11 BB_DA111DA112:DT121DT122_CC B 111 ? C 122 ? B 112 ? C 121 ? 
1 A DA 12 1_555 B DT 5  1_555 A DC 13 1_555 B DG 4  1_555 -0.594 -0.170 2.972 -4.872 4.356  34.689 -0.873 0.317  2.982 7.226   
8.083  35.281 12 BB_DA112DC113:DG120DT121_CC B 112 ? C 121 ? B 113 ? C 120 ? 
1 A DC 13 1_555 B DG 4  1_555 A DA 14 1_555 B DT 3  1_555 -0.296 0.230  3.101 -5.628 -2.787 37.808 0.684  -0.221 3.087 -4.265  
8.612  38.307 13 BB_DC113DA114:DT119DG120_CC B 113 ? C 120 ? B 114 ? C 119 ? 
1 A DA 14 1_555 B DT 3  1_555 A DT 15 1_555 B DA 2  1_555 0.371  -0.248 3.392 2.066  -5.804 30.214 0.719  -0.275 3.397 -10.990 
-3.913 30.821 14 BB_DA114DT115:DA118DT119_CC B 114 ? C 119 ? B 115 ? C 118 ? 
1 A DT 15 1_555 B DA 2  1_555 A DT 16 1_555 B DA 1  1_555 1.062  0.654  3.853 2.410  0.735  38.437 0.883  -1.254 3.921 1.115   
-3.656 38.517 15 BB_DT115DT116:DA117DA118_CC B 115 ? C 118 ? B 116 ? C 117 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
#