data_2GAU
# 
_entry.id   2GAU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GAU         
RCSB  RCSB036900   
WWPDB D_1000036900 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          APC80792 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GAU 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rotella, F.J.'                                 1 
'Zhang, R.G.'                                   2 
'Mulligan, R.'                                  3 
'Moy, S.'                                       4 
'Joachimiak, A.'                                5 
'Midwest Center for Structural Genomics (MCSG)' 6 
# 
_citation.id                        primary 
_citation.title                     
'The 1.9-A crystal structure of transcriptional regulator, Crp/Fnr family from Porphyromonas gingivalis' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rotella, F.J.'  1 
primary 'Zhang, R.G.'    2 
primary 'Mulligan, R.'   3 
primary 'Moy, S.'        4 
primary 'Joachimiak, A.' 5 
# 
_cell.entry_id           2GAU 
_cell.length_a           76.723 
_cell.length_b           76.723 
_cell.length_c           86.320 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2GAU 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'transcriptional regulator, Crp/Fnr family' 26316.424 1   ? ? ? ? 
2 water   nat water                                       18.015    213 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MWKTASDKGLGHLLRDVWSLLNEEERELLDKEIQPFPCKKASTVFSEGDIPNNLFYLYEGKIKILREGVYGRFHISRIVK
PGQFFGMRPYFAEETCSSTAIAVENSKVLAIPVEAIEALLKGNTSFCRYFLKALAKELGYAERRTVTLTQKHVRGRLAET
LLILKENFGFENDGATLSIYLSREELATLSNMTVSNAIRTLSTFVSERMLALDGKRIKIIDCDRLQKTARSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MWKTASDKGLGHLLRDVWSLLNEEERELLDKEIQPFPCKKASTVFSEGDIPNNLFYLYEGKIKILREGVYGRFHISRIVK
PGQFFGMRPYFAEETCSSTAIAVENSKVLAIPVEAIEALLKGNTSFCRYFLKALAKELGYAERRTVTLTQKHVRGRLAET
LLILKENFGFENDGATLSIYLSREELATLSNMTVSNAIRTLSTFVSERMLALDGKRIKIIDCDRLQKTARSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         APC80792 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   TRP n 
1 3   LYS n 
1 4   THR n 
1 5   ALA n 
1 6   SER n 
1 7   ASP n 
1 8   LYS n 
1 9   GLY n 
1 10  LEU n 
1 11  GLY n 
1 12  HIS n 
1 13  LEU n 
1 14  LEU n 
1 15  ARG n 
1 16  ASP n 
1 17  VAL n 
1 18  TRP n 
1 19  SER n 
1 20  LEU n 
1 21  LEU n 
1 22  ASN n 
1 23  GLU n 
1 24  GLU n 
1 25  GLU n 
1 26  ARG n 
1 27  GLU n 
1 28  LEU n 
1 29  LEU n 
1 30  ASP n 
1 31  LYS n 
1 32  GLU n 
1 33  ILE n 
1 34  GLN n 
1 35  PRO n 
1 36  PHE n 
1 37  PRO n 
1 38  CYS n 
1 39  LYS n 
1 40  LYS n 
1 41  ALA n 
1 42  SER n 
1 43  THR n 
1 44  VAL n 
1 45  PHE n 
1 46  SER n 
1 47  GLU n 
1 48  GLY n 
1 49  ASP n 
1 50  ILE n 
1 51  PRO n 
1 52  ASN n 
1 53  ASN n 
1 54  LEU n 
1 55  PHE n 
1 56  TYR n 
1 57  LEU n 
1 58  TYR n 
1 59  GLU n 
1 60  GLY n 
1 61  LYS n 
1 62  ILE n 
1 63  LYS n 
1 64  ILE n 
1 65  LEU n 
1 66  ARG n 
1 67  GLU n 
1 68  GLY n 
1 69  VAL n 
1 70  TYR n 
1 71  GLY n 
1 72  ARG n 
1 73  PHE n 
1 74  HIS n 
1 75  ILE n 
1 76  SER n 
1 77  ARG n 
1 78  ILE n 
1 79  VAL n 
1 80  LYS n 
1 81  PRO n 
1 82  GLY n 
1 83  GLN n 
1 84  PHE n 
1 85  PHE n 
1 86  GLY n 
1 87  MET n 
1 88  ARG n 
1 89  PRO n 
1 90  TYR n 
1 91  PHE n 
1 92  ALA n 
1 93  GLU n 
1 94  GLU n 
1 95  THR n 
1 96  CYS n 
1 97  SER n 
1 98  SER n 
1 99  THR n 
1 100 ALA n 
1 101 ILE n 
1 102 ALA n 
1 103 VAL n 
1 104 GLU n 
1 105 ASN n 
1 106 SER n 
1 107 LYS n 
1 108 VAL n 
1 109 LEU n 
1 110 ALA n 
1 111 ILE n 
1 112 PRO n 
1 113 VAL n 
1 114 GLU n 
1 115 ALA n 
1 116 ILE n 
1 117 GLU n 
1 118 ALA n 
1 119 LEU n 
1 120 LEU n 
1 121 LYS n 
1 122 GLY n 
1 123 ASN n 
1 124 THR n 
1 125 SER n 
1 126 PHE n 
1 127 CYS n 
1 128 ARG n 
1 129 TYR n 
1 130 PHE n 
1 131 LEU n 
1 132 LYS n 
1 133 ALA n 
1 134 LEU n 
1 135 ALA n 
1 136 LYS n 
1 137 GLU n 
1 138 LEU n 
1 139 GLY n 
1 140 TYR n 
1 141 ALA n 
1 142 GLU n 
1 143 ARG n 
1 144 ARG n 
1 145 THR n 
1 146 VAL n 
1 147 THR n 
1 148 LEU n 
1 149 THR n 
1 150 GLN n 
1 151 LYS n 
1 152 HIS n 
1 153 VAL n 
1 154 ARG n 
1 155 GLY n 
1 156 ARG n 
1 157 LEU n 
1 158 ALA n 
1 159 GLU n 
1 160 THR n 
1 161 LEU n 
1 162 LEU n 
1 163 ILE n 
1 164 LEU n 
1 165 LYS n 
1 166 GLU n 
1 167 ASN n 
1 168 PHE n 
1 169 GLY n 
1 170 PHE n 
1 171 GLU n 
1 172 ASN n 
1 173 ASP n 
1 174 GLY n 
1 175 ALA n 
1 176 THR n 
1 177 LEU n 
1 178 SER n 
1 179 ILE n 
1 180 TYR n 
1 181 LEU n 
1 182 SER n 
1 183 ARG n 
1 184 GLU n 
1 185 GLU n 
1 186 LEU n 
1 187 ALA n 
1 188 THR n 
1 189 LEU n 
1 190 SER n 
1 191 ASN n 
1 192 MET n 
1 193 THR n 
1 194 VAL n 
1 195 SER n 
1 196 ASN n 
1 197 ALA n 
1 198 ILE n 
1 199 ARG n 
1 200 THR n 
1 201 LEU n 
1 202 SER n 
1 203 THR n 
1 204 PHE n 
1 205 VAL n 
1 206 SER n 
1 207 GLU n 
1 208 ARG n 
1 209 MET n 
1 210 LEU n 
1 211 ALA n 
1 212 LEU n 
1 213 ASP n 
1 214 GLY n 
1 215 LYS n 
1 216 ARG n 
1 217 ILE n 
1 218 LYS n 
1 219 ILE n 
1 220 ILE n 
1 221 ASP n 
1 222 CYS n 
1 223 ASP n 
1 224 ARG n 
1 225 LEU n 
1 226 GLN n 
1 227 LYS n 
1 228 THR n 
1 229 ALA n 
1 230 ARG n 
1 231 SER n 
1 232 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Porphyromonas 
_entity_src_gen.pdbx_gene_src_gene                 PG0396 
_entity_src_gen.gene_src_species                   'Porphyromonas gingivalis' 
_entity_src_gen.gene_src_strain                    W83 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Porphyromonas gingivalis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     242619 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PMCSG7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q7MAW7_PORGI 
_struct_ref.pdbx_db_accession          Q7MAW7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2GAU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 232 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q7MAW7 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  232 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       232 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2GAU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   49.02 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
;0.1M succinic acid, 15% PEG 3350  
, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-06-13 
_diffrn_detector.details                'horizontal-focussing Si-111 double-crystal monochromator and vertical-focussing mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'sagitally focused Si-111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97932 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97932 
# 
_reflns.entry_id                     2GAU 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             57.354 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   20641 
_reflns.number_all                   20940 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.115 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.4 
_reflns.B_iso_Wilson_estimate        35.5 
_reflns.pdbx_redundancy              14.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   91.5 
_reflns_shell.Rmerge_I_obs           0.897 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.42 
_reflns_shell.pdbx_redundancy        5.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1881 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2GAU 
_refine.ls_number_reflns_obs                     19581 
_refine.ls_number_reflns_all                     20641 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             57.35 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    98.58 
_refine.ls_R_factor_obs                          0.21058 
_refine.ls_R_factor_all                          0.211 
_refine.ls_R_factor_R_work                       0.20805 
_refine.ls_R_factor_R_free                       0.25837 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1060 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               .948 
_refine.correlation_coeff_Fo_to_Fc_free          .924 
_refine.B_iso_mean                               28.585 
_refine.aniso_B[1][1]                            -.46 
_refine.aniso_B[2][2]                            -.46 
_refine.aniso_B[3][3]                            .92 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             .80 
_refine.pdbx_solvent_shrinkage_radii             .80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       .165 
_refine.pdbx_overall_ESU_R_Free                  .159 
_refine.overall_SU_ML                            .108 
_refine.overall_SU_B                             3.662 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2GAU 
_refine_analyze.Luzzati_coordinate_error_obs    0.236 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1742 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             213 
_refine_hist.number_atoms_total               1955 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        57.35 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         .011   .022   ? 1769 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.221  1.982  ? 2379 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.578  5.000  ? 216  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   26.529 22.911 ? 79   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   13.747 15.000 ? 337  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   22.331 15.000 ? 17   'X-RAY DIFFRACTION' ? 
r_chiral_restr           .082   .200   ? 274  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     .004   .020   ? 1293 'X-RAY DIFFRACTION' ? 
r_nbd_refined            .224   .200   ? 815  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          .301   .200   ? 1226 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    .199   .200   ? 184  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   .195   .200   ? 61   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined .173   .200   ? 24   'X-RAY DIFFRACTION' ? 
r_mcbond_it              .717   1.500  ? 1128 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.149  2.000  ? 1743 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.013  3.000  ? 726  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.074  4.500  ? 636  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             1290 
_refine_ls_shell.R_factor_R_work                  0.286 
_refine_ls_shell.percent_reflns_obs               89.60 
_refine_ls_shell.R_factor_R_free                  0.312 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2GAU 
_struct.title                     
'Crystal structure of transcriptional regulator, Crp/Fnr family from Porphyromonas gingivalis (APC80792), Structural genomics, MCSG' 
_struct.pdbx_descriptor           'transcriptional regulator, Crp/Fnr family' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GAU 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;Structural genomics, transcriptional regulator, Porphyromonas gingivalis, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'the biological unit is a monomer' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 10  ? LEU A 13  ? LEU A 10  LEU A 13  5 ? 4  
HELX_P HELX_P2  2  LEU A 14  ? SER A 19  ? LEU A 14  SER A 19  1 ? 6  
HELX_P HELX_P3  3  ASN A 22  ? ILE A 33  ? ASN A 22  ILE A 33  1 ? 12 
HELX_P HELX_P4  4  GLY A 86  ? GLU A 93  ? GLY A 86  GLU A 93  1 ? 8  
HELX_P HELX_P5  5  VAL A 113 ? ASN A 123 ? VAL A 113 ASN A 123 1 ? 11 
HELX_P HELX_P6  6  ASN A 123 ? LYS A 151 ? ASN A 123 LYS A 151 1 ? 29 
HELX_P HELX_P7  7  HIS A 152 ? GLY A 169 ? HIS A 152 GLY A 169 1 ? 18 
HELX_P HELX_P8  8  SER A 182 ? SER A 190 ? SER A 182 SER A 190 1 ? 9  
HELX_P HELX_P9  9  THR A 193 ? GLU A 207 ? THR A 193 GLU A 207 1 ? 15 
HELX_P HELX_P10 10 ASP A 221 ? GLY A 232 ? ASP A 221 GLY A 232 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 34  ? CYS A 38  ? GLN A 34  CYS A 38  
A 2 SER A 106 ? PRO A 112 ? SER A 106 PRO A 112 
A 3 ASN A 53  ? GLU A 59  ? ASN A 53  GLU A 59  
A 4 PHE A 84  ? PHE A 85  ? PHE A 84  PHE A 85  
B 1 THR A 43  ? PHE A 45  ? THR A 43  PHE A 45  
B 2 THR A 99  ? ALA A 102 ? THR A 99  ALA A 102 
B 3 ILE A 62  ? ARG A 66  ? ILE A 62  ARG A 66  
B 4 HIS A 74  ? VAL A 79  ? HIS A 74  VAL A 79  
C 1 LEU A 210 ? ASP A 213 ? LEU A 210 ASP A 213 
C 2 ARG A 216 ? ILE A 219 ? ARG A 216 ILE A 219 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 34  ? N GLN A 34  O ALA A 110 ? O ALA A 110 
A 2 3 O ILE A 111 ? O ILE A 111 N LEU A 54  ? N LEU A 54  
A 3 4 N PHE A 55  ? N PHE A 55  O PHE A 85  ? O PHE A 85  
B 1 2 N VAL A 44  ? N VAL A 44  O ALA A 100 ? O ALA A 100 
B 2 3 O THR A 99  ? O THR A 99  N LEU A 65  ? N LEU A 65  
B 3 4 N ILE A 62  ? N ILE A 62  O VAL A 79  ? O VAL A 79  
C 1 2 N ALA A 211 ? N ALA A 211 O LYS A 218 ? O LYS A 218 
# 
_database_PDB_matrix.entry_id          2GAU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GAU 
_atom_sites.fract_transf_matrix[1][1]   .013034 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .013034 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .011585 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 10  ? 49.678 19.341  10.336  1.00 33.77 ? 10  LEU A N   1 
ATOM   2    C CA  . LEU A 1 10  ? 48.583 18.470  9.809   1.00 33.67 ? 10  LEU A CA  1 
ATOM   3    C C   . LEU A 1 10  ? 47.694 19.163  8.764   1.00 33.36 ? 10  LEU A C   1 
ATOM   4    O O   . LEU A 1 10  ? 46.913 18.508  8.073   1.00 33.56 ? 10  LEU A O   1 
ATOM   5    C CB  . LEU A 1 10  ? 47.735 17.937  10.960  1.00 33.88 ? 10  LEU A CB  1 
ATOM   6    C CG  . LEU A 1 10  ? 48.388 16.964  11.947  1.00 34.06 ? 10  LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 10  ? 47.378 16.627  13.018  1.00 33.51 ? 10  LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 10  ? 48.880 15.692  11.277  1.00 34.46 ? 10  LEU A CD2 1 
ATOM   9    N N   . GLY A 1 11  ? 47.834 20.480  8.641   1.00 32.66 ? 11  GLY A N   1 
ATOM   10   C CA  . GLY A 1 11  ? 47.034 21.267  7.711   1.00 31.62 ? 11  GLY A CA  1 
ATOM   11   C C   . GLY A 1 11  ? 47.189 20.843  6.266   1.00 31.45 ? 11  GLY A C   1 
ATOM   12   O O   . GLY A 1 11  ? 46.231 20.910  5.491   1.00 31.01 ? 11  GLY A O   1 
ATOM   13   N N   . HIS A 1 12  ? 48.400 20.411  5.897   1.00 30.56 ? 12  HIS A N   1 
ATOM   14   C CA  . HIS A 1 12  ? 48.690 19.986  4.530   1.00 30.10 ? 12  HIS A CA  1 
ATOM   15   C C   . HIS A 1 12  ? 47.885 18.753  4.097   1.00 29.78 ? 12  HIS A C   1 
ATOM   16   O O   . HIS A 1 12  ? 47.724 18.504  2.899   1.00 29.72 ? 12  HIS A O   1 
ATOM   17   C CB  . HIS A 1 12  ? 50.191 19.728  4.346   1.00 30.25 ? 12  HIS A CB  1 
ATOM   18   C CG  . HIS A 1 12  ? 50.649 18.432  4.928   1.00 30.08 ? 12  HIS A CG  1 
ATOM   19   N ND1 . HIS A 1 12  ? 50.873 18.261  6.276   1.00 31.37 ? 12  HIS A ND1 1 
ATOM   20   C CD2 . HIS A 1 12  ? 50.896 17.234  4.350   1.00 31.62 ? 12  HIS A CD2 1 
ATOM   21   C CE1 . HIS A 1 12  ? 51.253 17.016  6.502   1.00 32.00 ? 12  HIS A CE1 1 
ATOM   22   N NE2 . HIS A 1 12  ? 51.268 16.369  5.351   1.00 30.37 ? 12  HIS A NE2 1 
ATOM   23   N N   . LEU A 1 13  ? 47.382 17.986  5.061   1.00 29.55 ? 13  LEU A N   1 
ATOM   24   C CA  . LEU A 1 13  ? 46.565 16.804  4.742   1.00 29.41 ? 13  LEU A CA  1 
ATOM   25   C C   . LEU A 1 13  ? 45.245 17.187  4.060   1.00 29.59 ? 13  LEU A C   1 
ATOM   26   O O   . LEU A 1 13  ? 44.656 16.383  3.324   1.00 28.91 ? 13  LEU A O   1 
ATOM   27   C CB  . LEU A 1 13  ? 46.317 15.940  5.984   1.00 29.26 ? 13  LEU A CB  1 
ATOM   28   C CG  . LEU A 1 13  ? 47.550 15.316  6.668   1.00 29.28 ? 13  LEU A CG  1 
ATOM   29   C CD1 . LEU A 1 13  ? 47.162 14.634  7.959   1.00 29.46 ? 13  LEU A CD1 1 
ATOM   30   C CD2 . LEU A 1 13  ? 48.283 14.337  5.751   1.00 27.78 ? 13  LEU A CD2 1 
ATOM   31   N N   . LEU A 1 14  ? 44.801 18.419  4.300   1.00 29.38 ? 14  LEU A N   1 
ATOM   32   C CA  . LEU A 1 14  ? 43.640 18.977  3.611   1.00 30.18 ? 14  LEU A CA  1 
ATOM   33   C C   . LEU A 1 14  ? 44.094 19.490  2.247   1.00 30.63 ? 14  LEU A C   1 
ATOM   34   O O   . LEU A 1 14  ? 44.198 20.694  2.042   1.00 30.71 ? 14  LEU A O   1 
ATOM   35   C CB  . LEU A 1 14  ? 43.019 20.109  4.444   1.00 29.68 ? 14  LEU A CB  1 
ATOM   36   C CG  . LEU A 1 14  ? 42.180 19.800  5.695   1.00 30.98 ? 14  LEU A CG  1 
ATOM   37   C CD1 . LEU A 1 14  ? 42.937 19.027  6.777   1.00 31.79 ? 14  LEU A CD1 1 
ATOM   38   C CD2 . LEU A 1 14  ? 41.587 21.074  6.273   1.00 30.44 ? 14  LEU A CD2 1 
ATOM   39   N N   . ARG A 1 15  ? 44.344 18.563  1.318   1.00 31.11 ? 15  ARG A N   1 
ATOM   40   C CA  . ARG A 1 15  ? 45.039 18.847  0.046   1.00 32.17 ? 15  ARG A CA  1 
ATOM   41   C C   . ARG A 1 15  ? 44.460 20.018  -0.777  1.00 31.92 ? 15  ARG A C   1 
ATOM   42   O O   . ARG A 1 15  ? 45.198 20.928  -1.167  1.00 31.69 ? 15  ARG A O   1 
ATOM   43   C CB  . ARG A 1 15  ? 45.120 17.574  -0.810  1.00 32.75 ? 15  ARG A CB  1 
ATOM   44   C CG  . ARG A 1 15  ? 46.055 17.666  -2.033  1.00 35.95 ? 15  ARG A CG  1 
ATOM   45   C CD  . ARG A 1 15  ? 45.597 16.748  -3.170  1.00 40.27 ? 15  ARG A CD  1 
ATOM   46   N NE  . ARG A 1 15  ? 44.178 16.963  -3.494  1.00 44.08 ? 15  ARG A NE  1 
ATOM   47   C CZ  . ARG A 1 15  ? 43.564 16.517  -4.590  1.00 46.73 ? 15  ARG A CZ  1 
ATOM   48   N NH1 . ARG A 1 15  ? 44.224 15.817  -5.506  1.00 47.84 ? 15  ARG A NH1 1 
ATOM   49   N NH2 . ARG A 1 15  ? 42.277 16.773  -4.774  1.00 47.69 ? 15  ARG A NH2 1 
ATOM   50   N N   . ASP A 1 16  ? 43.152 19.989  -1.039  1.00 31.82 ? 16  ASP A N   1 
ATOM   51   C CA  . ASP A 1 16  ? 42.514 21.011  -1.883  1.00 32.30 ? 16  ASP A CA  1 
ATOM   52   C C   . ASP A 1 16  ? 42.601 22.394  -1.258  1.00 31.48 ? 16  ASP A C   1 
ATOM   53   O O   . ASP A 1 16  ? 43.020 23.353  -1.911  1.00 32.19 ? 16  ASP A O   1 
ATOM   54   C CB  . ASP A 1 16  ? 41.046 20.664  -2.164  1.00 32.62 ? 16  ASP A CB  1 
ATOM   55   C CG  . ASP A 1 16  ? 40.890 19.406  -2.981  1.00 35.18 ? 16  ASP A CG  1 
ATOM   56   O OD1 . ASP A 1 16  ? 41.733 19.160  -3.874  1.00 37.84 ? 16  ASP A OD1 1 
ATOM   57   O OD2 . ASP A 1 16  ? 39.907 18.667  -2.736  1.00 38.74 ? 16  ASP A OD2 1 
ATOM   58   N N   . VAL A 1 17  ? 42.240 22.472  0.019   1.00 30.55 ? 17  VAL A N   1 
ATOM   59   C CA  . VAL A 1 17  ? 42.204 23.713  0.779   1.00 29.85 ? 17  VAL A CA  1 
ATOM   60   C C   . VAL A 1 17  ? 43.604 24.325  1.021   1.00 29.80 ? 17  VAL A C   1 
ATOM   61   O O   . VAL A 1 17  ? 43.799 25.545  0.889   1.00 29.29 ? 17  VAL A O   1 
ATOM   62   C CB  . VAL A 1 17  ? 41.441 23.486  2.117   1.00 29.79 ? 17  VAL A CB  1 
ATOM   63   C CG1 . VAL A 1 17  ? 41.766 24.546  3.123   1.00 30.60 ? 17  VAL A CG1 1 
ATOM   64   C CG2 . VAL A 1 17  ? 39.943 23.449  1.862   1.00 29.21 ? 17  VAL A CG2 1 
ATOM   65   N N   . TRP A 1 18  ? 44.560 23.474  1.385   1.00 29.49 ? 18  TRP A N   1 
ATOM   66   C CA  . TRP A 1 18  ? 45.928 23.894  1.670   1.00 29.84 ? 18  TRP A CA  1 
ATOM   67   C C   . TRP A 1 18  ? 46.545 24.677  0.511   1.00 30.03 ? 18  TRP A C   1 
ATOM   68   O O   . TRP A 1 18  ? 47.271 25.646  0.736   1.00 29.99 ? 18  TRP A O   1 
ATOM   69   C CB  . TRP A 1 18  ? 46.773 22.664  1.984   1.00 30.48 ? 18  TRP A CB  1 
ATOM   70   C CG  . TRP A 1 18  ? 48.135 22.931  2.552   1.00 31.28 ? 18  TRP A CG  1 
ATOM   71   C CD1 . TRP A 1 18  ? 49.331 22.738  1.927   1.00 32.26 ? 18  TRP A CD1 1 
ATOM   72   C CD2 . TRP A 1 18  ? 48.442 23.397  3.873   1.00 31.85 ? 18  TRP A CD2 1 
ATOM   73   N NE1 . TRP A 1 18  ? 50.361 23.068  2.768   1.00 31.40 ? 18  TRP A NE1 1 
ATOM   74   C CE2 . TRP A 1 18  ? 49.845 23.472  3.971   1.00 32.46 ? 18  TRP A CE2 1 
ATOM   75   C CE3 . TRP A 1 18  ? 47.668 23.766  4.977   1.00 32.94 ? 18  TRP A CE3 1 
ATOM   76   C CZ2 . TRP A 1 18  ? 50.495 23.900  5.132   1.00 31.91 ? 18  TRP A CZ2 1 
ATOM   77   C CZ3 . TRP A 1 18  ? 48.314 24.186  6.138   1.00 32.67 ? 18  TRP A CZ3 1 
ATOM   78   C CH2 . TRP A 1 18  ? 49.719 24.245  6.204   1.00 32.85 ? 18  TRP A CH2 1 
ATOM   79   N N   . SER A 1 19  ? 46.251 24.261  -0.720  1.00 30.16 ? 19  SER A N   1 
ATOM   80   C CA  . SER A 1 19  ? 46.759 24.936  -1.917  1.00 30.66 ? 19  SER A CA  1 
ATOM   81   C C   . SER A 1 19  ? 46.215 26.363  -2.116  1.00 31.00 ? 19  SER A C   1 
ATOM   82   O O   . SER A 1 19  ? 46.793 27.150  -2.870  1.00 30.59 ? 19  SER A O   1 
ATOM   83   C CB  . SER A 1 19  ? 46.472 24.090  -3.157  1.00 30.63 ? 19  SER A CB  1 
ATOM   84   O OG  . SER A 1 19  ? 45.098 24.142  -3.510  1.00 31.99 ? 19  SER A OG  1 
ATOM   85   N N   . LEU A 1 20  ? 45.103 26.673  -1.447  1.00 30.85 ? 20  LEU A N   1 
ATOM   86   C CA  . LEU A 1 20  ? 44.434 27.976  -1.528  1.00 31.45 ? 20  LEU A CA  1 
ATOM   87   C C   . LEU A 1 20  ? 44.966 28.987  -0.511  1.00 31.51 ? 20  LEU A C   1 
ATOM   88   O O   . LEU A 1 20  ? 44.611 30.175  -0.550  1.00 31.32 ? 20  LEU A O   1 
ATOM   89   C CB  . LEU A 1 20  ? 42.931 27.813  -1.270  1.00 30.96 ? 20  LEU A CB  1 
ATOM   90   C CG  . LEU A 1 20  ? 42.096 26.870  -2.123  1.00 31.48 ? 20  LEU A CG  1 
ATOM   91   C CD1 . LEU A 1 20  ? 40.672 26.833  -1.586  1.00 30.82 ? 20  LEU A CD1 1 
ATOM   92   C CD2 . LEU A 1 20  ? 42.117 27.308  -3.585  1.00 31.40 ? 20  LEU A CD2 1 
ATOM   93   N N   . LEU A 1 21  ? 45.786 28.502  0.409   1.00 31.84 ? 21  LEU A N   1 
ATOM   94   C CA  . LEU A 1 21  ? 46.216 29.302  1.545   1.00 32.68 ? 21  LEU A CA  1 
ATOM   95   C C   . LEU A 1 21  ? 47.624 29.841  1.330   1.00 33.70 ? 21  LEU A C   1 
ATOM   96   O O   . LEU A 1 21  ? 48.477 29.154  0.754   1.00 34.11 ? 21  LEU A O   1 
ATOM   97   C CB  . LEU A 1 21  ? 46.137 28.477  2.837   1.00 32.02 ? 21  LEU A CB  1 
ATOM   98   C CG  . LEU A 1 21  ? 44.765 27.915  3.242   1.00 30.73 ? 21  LEU A CG  1 
ATOM   99   C CD1 . LEU A 1 21  ? 44.869 27.150  4.554   1.00 28.66 ? 21  LEU A CD1 1 
ATOM   100  C CD2 . LEU A 1 21  ? 43.700 29.007  3.334   1.00 28.26 ? 21  LEU A CD2 1 
ATOM   101  N N   . ASN A 1 22  ? 47.853 31.078  1.767   1.00 34.85 ? 22  ASN A N   1 
ATOM   102  C CA  . ASN A 1 22  ? 49.194 31.664  1.742   1.00 35.80 ? 22  ASN A CA  1 
ATOM   103  C C   . ASN A 1 22  ? 49.932 31.252  3.005   1.00 36.55 ? 22  ASN A C   1 
ATOM   104  O O   . ASN A 1 22  ? 49.413 30.446  3.788   1.00 36.39 ? 22  ASN A O   1 
ATOM   105  C CB  . ASN A 1 22  ? 49.156 33.197  1.567   1.00 36.11 ? 22  ASN A CB  1 
ATOM   106  C CG  . ASN A 1 22  ? 48.493 33.926  2.736   1.00 36.00 ? 22  ASN A CG  1 
ATOM   107  O OD1 . ASN A 1 22  ? 48.457 33.435  3.869   1.00 36.50 ? 22  ASN A OD1 1 
ATOM   108  N ND2 . ASN A 1 22  ? 47.967 35.117  2.457   1.00 35.92 ? 22  ASN A ND2 1 
ATOM   109  N N   . GLU A 1 23  ? 51.124 31.808  3.220   1.00 37.06 ? 23  GLU A N   1 
ATOM   110  C CA  . GLU A 1 23  ? 51.985 31.342  4.306   1.00 37.74 ? 23  GLU A CA  1 
ATOM   111  C C   . GLU A 1 23  ? 51.417 31.620  5.688   1.00 37.15 ? 23  GLU A C   1 
ATOM   112  O O   . GLU A 1 23  ? 51.469 30.764  6.561   1.00 37.52 ? 23  GLU A O   1 
ATOM   113  C CB  . GLU A 1 23  ? 53.408 31.905  4.170   1.00 38.37 ? 23  GLU A CB  1 
ATOM   114  C CG  . GLU A 1 23  ? 54.486 30.902  4.565   1.00 41.46 ? 23  GLU A CG  1 
ATOM   115  C CD  . GLU A 1 23  ? 54.319 29.542  3.863   1.00 45.60 ? 23  GLU A CD  1 
ATOM   116  O OE1 . GLU A 1 23  ? 54.015 29.504  2.640   1.00 46.96 ? 23  GLU A OE1 1 
ATOM   117  O OE2 . GLU A 1 23  ? 54.493 28.508  4.545   1.00 47.41 ? 23  GLU A OE2 1 
ATOM   118  N N   . GLU A 1 24  ? 50.857 32.811  5.874   1.00 36.86 ? 24  GLU A N   1 
ATOM   119  C CA  . GLU A 1 24  ? 50.262 33.202  7.144   1.00 36.85 ? 24  GLU A CA  1 
ATOM   120  C C   . GLU A 1 24  ? 49.019 32.360  7.472   1.00 35.82 ? 24  GLU A C   1 
ATOM   121  O O   . GLU A 1 24  ? 48.793 31.984  8.628   1.00 35.56 ? 24  GLU A O   1 
ATOM   122  C CB  . GLU A 1 24  ? 49.900 34.680  7.080   1.00 36.82 ? 24  GLU A CB  1 
ATOM   123  C CG  . GLU A 1 24  ? 49.484 35.316  8.396   1.00 39.01 ? 24  GLU A CG  1 
ATOM   124  C CD  . GLU A 1 24  ? 49.075 36.775  8.227   1.00 39.19 ? 24  GLU A CD  1 
ATOM   125  O OE1 . GLU A 1 24  ? 49.380 37.370  7.160   1.00 42.52 ? 24  GLU A OE1 1 
ATOM   126  O OE2 . GLU A 1 24  ? 48.441 37.323  9.156   1.00 42.54 ? 24  GLU A OE2 1 
ATOM   127  N N   . GLU A 1 25  ? 48.216 32.080  6.443   1.00 34.88 ? 25  GLU A N   1 
ATOM   128  C CA  . GLU A 1 25  ? 46.982 31.301  6.600   1.00 33.83 ? 25  GLU A CA  1 
ATOM   129  C C   . GLU A 1 25  ? 47.288 29.837  6.911   1.00 33.76 ? 25  GLU A C   1 
ATOM   130  O O   . GLU A 1 25  ? 46.615 29.215  7.742   1.00 33.35 ? 25  GLU A O   1 
ATOM   131  C CB  . GLU A 1 25  ? 46.124 31.418  5.340   1.00 33.45 ? 25  GLU A CB  1 
ATOM   132  C CG  . GLU A 1 25  ? 45.430 32.765  5.198   1.00 32.54 ? 25  GLU A CG  1 
ATOM   133  C CD  . GLU A 1 25  ? 44.980 33.063  3.778   1.00 31.75 ? 25  GLU A CD  1 
ATOM   134  O OE1 . GLU A 1 25  ? 45.443 32.393  2.834   1.00 30.83 ? 25  GLU A OE1 1 
ATOM   135  O OE2 . GLU A 1 25  ? 44.173 33.994  3.609   1.00 32.13 ? 25  GLU A OE2 1 
ATOM   136  N N   . ARG A 1 26  ? 48.310 29.305  6.243   1.00 33.75 ? 26  ARG A N   1 
ATOM   137  C CA  . ARG A 1 26  ? 48.818 27.954  6.496   1.00 34.11 ? 26  ARG A CA  1 
ATOM   138  C C   . ARG A 1 26  ? 49.336 27.779  7.922   1.00 34.50 ? 26  ARG A C   1 
ATOM   139  O O   . ARG A 1 26  ? 49.087 26.742  8.544   1.00 34.74 ? 26  ARG A O   1 
ATOM   140  C CB  . ARG A 1 26  ? 49.906 27.583  5.482   1.00 34.01 ? 26  ARG A CB  1 
ATOM   141  C CG  . ARG A 1 26  ? 49.361 27.216  4.119   1.00 33.34 ? 26  ARG A CG  1 
ATOM   142  C CD  . ARG A 1 26  ? 50.462 26.933  3.114   1.00 34.62 ? 26  ARG A CD  1 
ATOM   143  N NE  . ARG A 1 26  ? 49.917 26.594  1.800   1.00 34.53 ? 26  ARG A NE  1 
ATOM   144  C CZ  . ARG A 1 26  ? 50.612 26.030  0.818   1.00 34.98 ? 26  ARG A CZ  1 
ATOM   145  N NH1 . ARG A 1 26  ? 51.897 25.736  0.992   1.00 37.26 ? 26  ARG A NH1 1 
ATOM   146  N NH2 . ARG A 1 26  ? 50.026 25.759  -0.340  1.00 34.31 ? 26  ARG A NH2 1 
ATOM   147  N N   . GLU A 1 27  ? 50.051 28.790  8.434   1.00 35.00 ? 27  GLU A N   1 
ATOM   148  C CA  . GLU A 1 27  ? 50.515 28.818  9.831   1.00 35.18 ? 27  GLU A CA  1 
ATOM   149  C C   . GLU A 1 27  ? 49.356 28.751  10.813  1.00 34.22 ? 27  GLU A C   1 
ATOM   150  O O   . GLU A 1 27  ? 49.412 28.022  11.812  1.00 33.76 ? 27  GLU A O   1 
ATOM   151  C CB  . GLU A 1 27  ? 51.303 30.101  10.132  1.00 35.56 ? 27  GLU A CB  1 
ATOM   152  C CG  . GLU A 1 27  ? 52.615 30.261  9.387   1.00 37.23 ? 27  GLU A CG  1 
ATOM   153  C CD  . GLU A 1 27  ? 53.376 31.534  9.795   1.00 37.52 ? 27  GLU A CD  1 
ATOM   154  O OE1 . GLU A 1 27  ? 53.101 32.096  10.883  1.00 40.43 ? 27  GLU A OE1 1 
ATOM   155  O OE2 . GLU A 1 27  ? 54.256 31.970  9.018   1.00 41.69 ? 27  GLU A OE2 1 
ATOM   156  N N   . LEU A 1 28  ? 48.323 29.549  10.542  1.00 33.29 ? 28  LEU A N   1 
ATOM   157  C CA  . LEU A 1 28  ? 47.138 29.595  11.388  1.00 32.39 ? 28  LEU A CA  1 
ATOM   158  C C   . LEU A 1 28  ? 46.444 28.236  11.392  1.00 31.67 ? 28  LEU A C   1 
ATOM   159  O O   . LEU A 1 28  ? 46.117 27.708  12.458  1.00 31.26 ? 28  LEU A O   1 
ATOM   160  C CB  . LEU A 1 28  ? 46.176 30.694  10.922  1.00 32.26 ? 28  LEU A CB  1 
ATOM   161  C CG  . LEU A 1 28  ? 44.775 30.777  11.547  1.00 33.22 ? 28  LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 28  ? 44.816 31.043  13.048  1.00 33.69 ? 28  LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 28  ? 43.952 31.847  10.838  1.00 32.48 ? 28  LEU A CD2 1 
ATOM   164  N N   . LEU A 1 29  ? 46.239 27.675  10.201  1.00 31.43 ? 29  LEU A N   1 
ATOM   165  C CA  . LEU A 1 29  ? 45.628 26.347  10.080  1.00 31.09 ? 29  LEU A CA  1 
ATOM   166  C C   . LEU A 1 29  ? 46.442 25.303  10.839  1.00 31.50 ? 29  LEU A C   1 
ATOM   167  O O   . LEU A 1 29  ? 45.898 24.580  11.679  1.00 31.16 ? 29  LEU A O   1 
ATOM   168  C CB  . LEU A 1 29  ? 45.432 25.930  8.617   1.00 30.87 ? 29  LEU A CB  1 
ATOM   169  C CG  . LEU A 1 29  ? 44.628 24.628  8.420   1.00 29.58 ? 29  LEU A CG  1 
ATOM   170  C CD1 . LEU A 1 29  ? 43.219 24.720  9.048   1.00 27.85 ? 29  LEU A CD1 1 
ATOM   171  C CD2 . LEU A 1 29  ? 44.549 24.217  6.956   1.00 31.04 ? 29  LEU A CD2 1 
ATOM   172  N N   . ASP A 1 30  ? 47.745 25.237  10.565  1.00 31.77 ? 30  ASP A N   1 
ATOM   173  C CA  . ASP A 1 30  ? 48.617 24.291  11.273  1.00 32.28 ? 30  ASP A CA  1 
ATOM   174  C C   . ASP A 1 30  ? 48.513 24.444  12.794  1.00 32.42 ? 30  ASP A C   1 
ATOM   175  O O   . ASP A 1 30  ? 48.501 23.449  13.521  1.00 32.33 ? 30  ASP A O   1 
ATOM   176  C CB  . ASP A 1 30  ? 50.073 24.445  10.819  1.00 32.67 ? 30  ASP A CB  1 
ATOM   177  C CG  . ASP A 1 30  ? 50.414 23.591  9.606   1.00 33.15 ? 30  ASP A CG  1 
ATOM   178  O OD1 . ASP A 1 30  ? 49.662 22.657  9.259   1.00 35.03 ? 30  ASP A OD1 1 
ATOM   179  O OD2 . ASP A 1 30  ? 51.472 23.841  8.996   1.00 34.79 ? 30  ASP A OD2 1 
ATOM   180  N N   . LYS A 1 31  ? 48.409 25.690  13.261  1.00 32.50 ? 31  LYS A N   1 
ATOM   181  C CA  . LYS A 1 31  ? 48.316 25.995  14.691  1.00 33.23 ? 31  LYS A CA  1 
ATOM   182  C C   . LYS A 1 31  ? 46.997 25.548  15.327  1.00 32.51 ? 31  LYS A C   1 
ATOM   183  O O   . LYS A 1 31  ? 46.982 25.101  16.475  1.00 32.55 ? 31  LYS A O   1 
ATOM   184  C CB  . LYS A 1 31  ? 48.516 27.497  14.941  1.00 33.28 ? 31  LYS A CB  1 
ATOM   185  C CG  . LYS A 1 31  ? 48.785 27.848  16.399  1.00 34.71 ? 31  LYS A CG  1 
ATOM   186  C CD  . LYS A 1 31  ? 48.621 29.345  16.680  1.00 35.50 ? 31  LYS A CD  1 
ATOM   187  C CE  . LYS A 1 31  ? 48.827 29.639  18.174  1.00 38.46 ? 31  LYS A CE  1 
ATOM   188  N NZ  . LYS A 1 31  ? 48.302 30.994  18.608  1.00 40.65 ? 31  LYS A NZ  1 
ATOM   189  N N   . GLU A 1 32  ? 45.895 25.670  14.586  1.00 31.61 ? 32  GLU A N   1 
ATOM   190  C CA  . GLU A 1 32  ? 44.566 25.440  15.163  1.00 31.43 ? 32  GLU A CA  1 
ATOM   191  C C   . GLU A 1 32  ? 43.978 24.046  14.929  1.00 30.41 ? 32  GLU A C   1 
ATOM   192  O O   . GLU A 1 32  ? 43.162 23.589  15.717  1.00 29.95 ? 32  GLU A O   1 
ATOM   193  C CB  . GLU A 1 32  ? 43.577 26.521  14.702  1.00 31.54 ? 32  GLU A CB  1 
ATOM   194  C CG  . GLU A 1 32  ? 43.969 27.969  15.080  1.00 33.68 ? 32  GLU A CG  1 
ATOM   195  C CD  . GLU A 1 32  ? 44.066 28.216  16.584  1.00 37.74 ? 32  GLU A CD  1 
ATOM   196  O OE1 . GLU A 1 32  ? 43.351 27.552  17.371  1.00 39.04 ? 32  GLU A OE1 1 
ATOM   197  O OE2 . GLU A 1 32  ? 44.861 29.101  16.985  1.00 40.74 ? 32  GLU A OE2 1 
ATOM   198  N N   . ILE A 1 33  ? 44.402 23.376  13.859  1.00 30.15 ? 33  ILE A N   1 
ATOM   199  C CA  . ILE A 1 33  ? 43.886 22.045  13.520  1.00 29.93 ? 33  ILE A CA  1 
ATOM   200  C C   . ILE A 1 33  ? 44.256 21.011  14.598  1.00 30.62 ? 33  ILE A C   1 
ATOM   201  O O   . ILE A 1 33  ? 45.375 21.046  15.130  1.00 30.05 ? 33  ILE A O   1 
ATOM   202  C CB  . ILE A 1 33  ? 44.361 21.601  12.112  1.00 29.85 ? 33  ILE A CB  1 
ATOM   203  C CG1 . ILE A 1 33  ? 43.490 20.454  11.568  1.00 29.90 ? 33  ILE A CG1 1 
ATOM   204  C CG2 . ILE A 1 33  ? 45.857 21.236  12.110  1.00 29.39 ? 33  ILE A CG2 1 
ATOM   205  C CD1 . ILE A 1 33  ? 43.612 20.262  10.082  1.00 29.10 ? 33  ILE A CD1 1 
ATOM   206  N N   . GLN A 1 34  ? 43.312 20.119  14.918  1.00 30.93 ? 34  GLN A N   1 
ATOM   207  C CA  . GLN A 1 34  ? 43.488 19.061  15.925  1.00 31.97 ? 34  GLN A CA  1 
ATOM   208  C C   . GLN A 1 34  ? 43.067 17.693  15.393  1.00 32.42 ? 34  GLN A C   1 
ATOM   209  O O   . GLN A 1 34  ? 41.993 17.574  14.785  1.00 31.93 ? 34  GLN A O   1 
ATOM   210  C CB  . GLN A 1 34  ? 42.622 19.324  17.169  1.00 32.02 ? 34  GLN A CB  1 
ATOM   211  C CG  . GLN A 1 34  ? 42.904 20.600  17.942  1.00 34.13 ? 34  GLN A CG  1 
ATOM   212  C CD  . GLN A 1 34  ? 44.226 20.556  18.703  1.00 37.84 ? 34  GLN A CD  1 
ATOM   213  O OE1 . GLN A 1 34  ? 44.667 19.491  19.153  1.00 38.96 ? 34  GLN A OE1 1 
ATOM   214  N NE2 . GLN A 1 34  ? 44.861 21.719  18.854  1.00 37.84 ? 34  GLN A NE2 1 
ATOM   215  N N   . PRO A 1 35  ? 43.878 16.643  15.657  1.00 33.25 ? 35  PRO A N   1 
ATOM   216  C CA  . PRO A 1 35  ? 43.430 15.264  15.400  1.00 33.53 ? 35  PRO A CA  1 
ATOM   217  C C   . PRO A 1 35  ? 42.197 14.956  16.251  1.00 34.05 ? 35  PRO A C   1 
ATOM   218  O O   . PRO A 1 35  ? 42.078 15.450  17.378  1.00 33.76 ? 35  PRO A O   1 
ATOM   219  C CB  . PRO A 1 35  ? 44.614 14.396  15.864  1.00 33.79 ? 35  PRO A CB  1 
ATOM   220  C CG  . PRO A 1 35  ? 45.755 15.298  16.008  1.00 33.67 ? 35  PRO A CG  1 
ATOM   221  C CD  . PRO A 1 35  ? 45.233 16.686  16.239  1.00 33.27 ? 35  PRO A CD  1 
ATOM   222  N N   . PHE A 1 36  ? 41.271 14.168  15.712  1.00 34.62 ? 36  PHE A N   1 
ATOM   223  C CA  . PHE A 1 36  ? 40.020 13.883  16.419  1.00 35.15 ? 36  PHE A CA  1 
ATOM   224  C C   . PHE A 1 36  ? 39.753 12.378  16.437  1.00 35.79 ? 36  PHE A C   1 
ATOM   225  O O   . PHE A 1 36  ? 39.326 11.819  15.418  1.00 35.68 ? 36  PHE A O   1 
ATOM   226  C CB  . PHE A 1 36  ? 38.855 14.643  15.772  1.00 34.76 ? 36  PHE A CB  1 
ATOM   227  C CG  . PHE A 1 36  ? 37.586 14.640  16.593  1.00 35.37 ? 36  PHE A CG  1 
ATOM   228  C CD1 . PHE A 1 36  ? 37.291 15.705  17.445  1.00 36.14 ? 36  PHE A CD1 1 
ATOM   229  C CD2 . PHE A 1 36  ? 36.678 13.583  16.508  1.00 35.92 ? 36  PHE A CD2 1 
ATOM   230  C CE1 . PHE A 1 36  ? 36.114 15.717  18.210  1.00 36.35 ? 36  PHE A CE1 1 
ATOM   231  C CE2 . PHE A 1 36  ? 35.499 13.583  17.271  1.00 35.84 ? 36  PHE A CE2 1 
ATOM   232  C CZ  . PHE A 1 36  ? 35.216 14.654  18.118  1.00 35.79 ? 36  PHE A CZ  1 
ATOM   233  N N   . PRO A 1 37  ? 39.983 11.716  17.598  1.00 36.27 ? 37  PRO A N   1 
ATOM   234  C CA  . PRO A 1 37  ? 39.921 10.243  17.652  1.00 36.06 ? 37  PRO A CA  1 
ATOM   235  C C   . PRO A 1 37  ? 38.570 9.751   17.181  1.00 35.27 ? 37  PRO A C   1 
ATOM   236  O O   . PRO A 1 37  ? 37.538 10.286  17.614  1.00 35.72 ? 37  PRO A O   1 
ATOM   237  C CB  . PRO A 1 37  ? 40.115 9.920   19.149  1.00 36.37 ? 37  PRO A CB  1 
ATOM   238  C CG  . PRO A 1 37  ? 39.894 11.191  19.874  1.00 36.36 ? 37  PRO A CG  1 
ATOM   239  C CD  . PRO A 1 37  ? 40.268 12.300  18.925  1.00 36.67 ? 37  PRO A CD  1 
ATOM   240  N N   . CYS A 1 38  ? 38.553 8.766   16.289  1.00 34.82 ? 38  CYS A N   1 
ATOM   241  C CA  . CYS A 1 38  ? 37.278 8.354   15.711  1.00 33.10 ? 38  CYS A CA  1 
ATOM   242  C C   . CYS A 1 38  ? 37.093 6.844   15.442  1.00 31.57 ? 38  CYS A C   1 
ATOM   243  O O   . CYS A 1 38  ? 37.095 6.406   14.288  1.00 30.65 ? 38  CYS A O   1 
ATOM   244  C CB  . CYS A 1 38  ? 37.025 9.181   14.455  1.00 33.46 ? 38  CYS A CB  1 
ATOM   245  S SG  . CYS A 1 38  ? 35.310 9.389   14.100  1.00 37.70 ? 38  CYS A SG  1 
ATOM   246  N N   . LYS A 1 39  ? 36.899 6.073   16.514  1.00 29.65 ? 39  LYS A N   1 
ATOM   247  C CA  . LYS A 1 39  ? 36.691 4.623   16.427  1.00 29.14 ? 39  LYS A CA  1 
ATOM   248  C C   . LYS A 1 39  ? 35.333 4.313   15.785  1.00 27.75 ? 39  LYS A C   1 
ATOM   249  O O   . LYS A 1 39  ? 34.381 5.074   15.966  1.00 26.80 ? 39  LYS A O   1 
ATOM   250  C CB  . LYS A 1 39  ? 36.743 4.004   17.832  1.00 29.36 ? 39  LYS A CB  1 
ATOM   251  C CG  . LYS A 1 39  ? 36.744 2.477   17.865  1.00 30.16 ? 39  LYS A CG  1 
ATOM   252  C CD  . LYS A 1 39  ? 36.641 1.948   19.309  1.00 30.76 ? 39  LYS A CD  1 
ATOM   253  C CE  . LYS A 1 39  ? 37.207 0.519   19.459  1.00 32.79 ? 39  LYS A CE  1 
ATOM   254  N NZ  . LYS A 1 39  ? 36.996 -0.404  18.286  1.00 30.98 ? 39  LYS A NZ  1 
ATOM   255  N N   . LYS A 1 40  ? 35.252 3.209   15.044  1.00 26.74 ? 40  LYS A N   1 
ATOM   256  C CA  . LYS A 1 40  ? 33.974 2.718   14.528  1.00 26.25 ? 40  LYS A CA  1 
ATOM   257  C C   . LYS A 1 40  ? 32.910 2.791   15.622  1.00 25.36 ? 40  LYS A C   1 
ATOM   258  O O   . LYS A 1 40  ? 33.165 2.416   16.776  1.00 24.34 ? 40  LYS A O   1 
ATOM   259  C CB  . LYS A 1 40  ? 34.102 1.275   14.028  1.00 26.33 ? 40  LYS A CB  1 
ATOM   260  C CG  . LYS A 1 40  ? 32.821 0.726   13.419  1.00 26.96 ? 40  LYS A CG  1 
ATOM   261  C CD  . LYS A 1 40  ? 32.970 -0.703  12.921  1.00 28.62 ? 40  LYS A CD  1 
ATOM   262  C CE  . LYS A 1 40  ? 31.635 -1.192  12.363  1.00 31.83 ? 40  LYS A CE  1 
ATOM   263  N NZ  . LYS A 1 40  ? 31.671 -2.604  11.926  1.00 35.05 ? 40  LYS A NZ  1 
ATOM   264  N N   . ALA A 1 41  ? 31.739 3.304   15.250  1.00 24.63 ? 41  ALA A N   1 
ATOM   265  C CA  . ALA A 1 41  ? 30.582 3.441   16.129  1.00 24.17 ? 41  ALA A CA  1 
ATOM   266  C C   . ALA A 1 41  ? 30.623 4.626   17.097  1.00 23.98 ? 41  ALA A C   1 
ATOM   267  O O   . ALA A 1 41  ? 29.636 4.867   17.784  1.00 23.57 ? 41  ALA A O   1 
ATOM   268  C CB  . ALA A 1 41  ? 30.278 2.109   16.893  1.00 24.17 ? 41  ALA A CB  1 
ATOM   269  N N   . SER A 1 42  ? 31.735 5.362   17.159  1.00 23.81 ? 42  SER A N   1 
ATOM   270  C CA  . SER A 1 42  ? 31.799 6.562   18.012  1.00 24.07 ? 42  SER A CA  1 
ATOM   271  C C   . SER A 1 42  ? 31.091 7.736   17.331  1.00 24.24 ? 42  SER A C   1 
ATOM   272  O O   . SER A 1 42  ? 30.885 7.702   16.118  1.00 23.74 ? 42  SER A O   1 
ATOM   273  C CB  . SER A 1 42  ? 33.245 6.940   18.350  1.00 24.47 ? 42  SER A CB  1 
ATOM   274  O OG  . SER A 1 42  ? 33.948 7.378   17.190  1.00 25.29 ? 42  SER A OG  1 
ATOM   275  N N   . THR A 1 43  ? 30.728 8.764   18.095  1.00 24.07 ? 43  THR A N   1 
ATOM   276  C CA  . THR A 1 43  ? 30.039 9.921   17.486  1.00 24.69 ? 43  THR A CA  1 
ATOM   277  C C   . THR A 1 43  ? 30.881 11.169  17.518  1.00 23.90 ? 43  THR A C   1 
ATOM   278  O O   . THR A 1 43  ? 31.475 11.529  18.539  1.00 24.23 ? 43  THR A O   1 
ATOM   279  C CB  . THR A 1 43  ? 28.547 10.170  17.970  1.00 25.55 ? 43  THR A CB  1 
ATOM   280  O OG1 . THR A 1 43  ? 28.377 11.482  18.533  1.00 29.21 ? 43  THR A OG1 1 
ATOM   281  C CG2 . THR A 1 43  ? 28.053 9.116   18.897  1.00 23.93 ? 43  THR A CG2 1 
ATOM   282  N N   . VAL A 1 44  ? 30.946 11.811  16.363  1.00 22.51 ? 44  VAL A N   1 
ATOM   283  C CA  . VAL A 1 44  ? 31.733 13.012  16.181  1.00 21.66 ? 44  VAL A CA  1 
ATOM   284  C C   . VAL A 1 44  ? 30.994 14.211  16.777  1.00 21.41 ? 44  VAL A C   1 
ATOM   285  O O   . VAL A 1 44  ? 31.594 15.038  17.481  1.00 22.02 ? 44  VAL A O   1 
ATOM   286  C CB  . VAL A 1 44  ? 32.047 13.209  14.687  1.00 21.06 ? 44  VAL A CB  1 
ATOM   287  C CG1 . VAL A 1 44  ? 33.009 14.382  14.464  1.00 20.80 ? 44  VAL A CG1 1 
ATOM   288  C CG2 . VAL A 1 44  ? 32.650 11.913  14.115  1.00 21.98 ? 44  VAL A CG2 1 
ATOM   289  N N   . PHE A 1 45  ? 29.697 14.280  16.494  1.00 20.64 ? 45  PHE A N   1 
ATOM   290  C CA  . PHE A 1 45  ? 28.797 15.274  17.075  1.00 20.48 ? 45  PHE A CA  1 
ATOM   291  C C   . PHE A 1 45  ? 27.390 14.723  17.027  1.00 20.38 ? 45  PHE A C   1 
ATOM   292  O O   . PHE A 1 45  ? 27.142 13.731  16.340  1.00 20.49 ? 45  PHE A O   1 
ATOM   293  C CB  . PHE A 1 45  ? 28.901 16.632  16.360  1.00 19.30 ? 45  PHE A CB  1 
ATOM   294  C CG  . PHE A 1 45  ? 28.604 16.595  14.872  1.00 20.03 ? 45  PHE A CG  1 
ATOM   295  C CD1 . PHE A 1 45  ? 27.297 16.473  14.400  1.00 17.96 ? 45  PHE A CD1 1 
ATOM   296  C CD2 . PHE A 1 45  ? 29.631 16.744  13.945  1.00 18.92 ? 45  PHE A CD2 1 
ATOM   297  C CE1 . PHE A 1 45  ? 27.032 16.464  13.022  1.00 20.18 ? 45  PHE A CE1 1 
ATOM   298  C CE2 . PHE A 1 45  ? 29.370 16.746  12.569  1.00 17.54 ? 45  PHE A CE2 1 
ATOM   299  C CZ  . PHE A 1 45  ? 28.066 16.621  12.108  1.00 17.74 ? 45  PHE A CZ  1 
ATOM   300  N N   . SER A 1 46  ? 26.478 15.361  17.756  1.00 21.10 ? 46  SER A N   1 
ATOM   301  C CA  . SER A 1 46  ? 25.112 14.890  17.867  1.00 21.82 ? 46  SER A CA  1 
ATOM   302  C C   . SER A 1 46  ? 24.136 15.951  17.423  1.00 22.41 ? 46  SER A C   1 
ATOM   303  O O   . SER A 1 46  ? 24.372 17.145  17.625  1.00 21.55 ? 46  SER A O   1 
ATOM   304  C CB  . SER A 1 46  ? 24.787 14.500  19.313  1.00 22.24 ? 46  SER A CB  1 
ATOM   305  O OG  . SER A 1 46  ? 25.597 13.424  19.736  1.00 23.77 ? 46  SER A OG  1 
ATOM   306  N N   . GLU A 1 47  ? 23.037 15.489  16.835  1.00 22.62 ? 47  GLU A N   1 
ATOM   307  C CA  . GLU A 1 47  ? 21.878 16.328  16.530  1.00 24.44 ? 47  GLU A CA  1 
ATOM   308  C C   . GLU A 1 47  ? 21.555 17.246  17.725  1.00 24.28 ? 47  GLU A C   1 
ATOM   309  O O   . GLU A 1 47  ? 21.457 16.776  18.865  1.00 24.60 ? 47  GLU A O   1 
ATOM   310  C CB  . GLU A 1 47  ? 20.691 15.416  16.175  1.00 23.72 ? 47  GLU A CB  1 
ATOM   311  C CG  . GLU A 1 47  ? 19.444 16.127  15.680  1.00 25.97 ? 47  GLU A CG  1 
ATOM   312  C CD  . GLU A 1 47  ? 18.344 15.175  15.236  1.00 26.52 ? 47  GLU A CD  1 
ATOM   313  O OE1 . GLU A 1 47  ? 18.585 13.940  15.101  1.00 28.29 ? 47  GLU A OE1 1 
ATOM   314  O OE2 . GLU A 1 47  ? 17.223 15.673  15.017  1.00 29.62 ? 47  GLU A OE2 1 
ATOM   315  N N   . GLY A 1 48  ? 21.425 18.549  17.468  1.00 23.97 ? 48  GLY A N   1 
ATOM   316  C CA  . GLY A 1 48  ? 21.168 19.521  18.532  1.00 23.75 ? 48  GLY A CA  1 
ATOM   317  C C   . GLY A 1 48  ? 22.415 20.218  19.060  1.00 23.58 ? 48  GLY A C   1 
ATOM   318  O O   . GLY A 1 48  ? 22.315 21.243  19.735  1.00 23.65 ? 48  GLY A O   1 
ATOM   319  N N   . ASP A 1 49  ? 23.590 19.669  18.751  1.00 22.94 ? 49  ASP A N   1 
ATOM   320  C CA  . ASP A 1 49  ? 24.853 20.245  19.197  1.00 22.98 ? 49  ASP A CA  1 
ATOM   321  C C   . ASP A 1 49  ? 25.100 21.599  18.558  1.00 23.32 ? 49  ASP A C   1 
ATOM   322  O O   . ASP A 1 49  ? 24.774 21.832  17.394  1.00 22.93 ? 49  ASP A O   1 
ATOM   323  C CB  . ASP A 1 49  ? 26.042 19.340  18.841  1.00 23.03 ? 49  ASP A CB  1 
ATOM   324  C CG  . ASP A 1 49  ? 26.216 18.166  19.803  1.00 23.14 ? 49  ASP A CG  1 
ATOM   325  O OD1 . ASP A 1 49  ? 25.368 17.966  20.698  1.00 23.40 ? 49  ASP A OD1 1 
ATOM   326  O OD2 . ASP A 1 49  ? 27.206 17.426  19.631  1.00 22.02 ? 49  ASP A OD2 1 
ATOM   327  N N   . ILE A 1 50  ? 25.731 22.473  19.324  1.00 23.79 ? 50  ILE A N   1 
ATOM   328  C CA  . ILE A 1 50  ? 26.182 23.769  18.826  1.00 24.09 ? 50  ILE A CA  1 
ATOM   329  C C   . ILE A 1 50  ? 27.565 23.588  18.198  1.00 24.12 ? 50  ILE A C   1 
ATOM   330  O O   . ILE A 1 50  ? 28.479 23.072  18.861  1.00 24.50 ? 50  ILE A O   1 
ATOM   331  C CB  . ILE A 1 50  ? 26.265 24.765  19.997  1.00 24.53 ? 50  ILE A CB  1 
ATOM   332  C CG1 . ILE A 1 50  ? 24.902 24.884  20.702  1.00 26.11 ? 50  ILE A CG1 1 
ATOM   333  C CG2 . ILE A 1 50  ? 26.780 26.114  19.529  1.00 24.98 ? 50  ILE A CG2 1 
ATOM   334  C CD1 . ILE A 1 50  ? 23.880 25.721  19.951  1.00 28.77 ? 50  ILE A CD1 1 
ATOM   335  N N   . PRO A 1 51  ? 27.728 23.968  16.906  1.00 23.24 ? 51  PRO A N   1 
ATOM   336  C CA  . PRO A 1 51  ? 29.024 23.802  16.232  1.00 22.77 ? 51  PRO A CA  1 
ATOM   337  C C   . PRO A 1 51  ? 30.200 24.522  16.910  1.00 22.59 ? 51  PRO A C   1 
ATOM   338  O O   . PRO A 1 51  ? 30.140 25.736  17.128  1.00 21.69 ? 51  PRO A O   1 
ATOM   339  C CB  . PRO A 1 51  ? 28.778 24.395  14.836  1.00 22.77 ? 51  PRO A CB  1 
ATOM   340  C CG  . PRO A 1 51  ? 27.289 24.208  14.616  1.00 23.27 ? 51  PRO A CG  1 
ATOM   341  C CD  . PRO A 1 51  ? 26.694 24.492  15.989  1.00 23.20 ? 51  PRO A CD  1 
ATOM   342  N N   . ASN A 1 52  ? 31.240 23.756  17.234  1.00 21.96 ? 52  ASN A N   1 
ATOM   343  C CA  . ASN A 1 52  ? 32.493 24.286  17.765  1.00 22.71 ? 52  ASN A CA  1 
ATOM   344  C C   . ASN A 1 52  ? 33.646 24.083  16.792  1.00 21.94 ? 52  ASN A C   1 
ATOM   345  O O   . ASN A 1 52  ? 34.657 24.793  16.856  1.00 22.07 ? 52  ASN A O   1 
ATOM   346  C CB  . ASN A 1 52  ? 32.858 23.599  19.087  1.00 23.14 ? 52  ASN A CB  1 
ATOM   347  C CG  . ASN A 1 52  ? 32.016 24.077  20.258  1.00 25.42 ? 52  ASN A CG  1 
ATOM   348  O OD1 . ASN A 1 52  ? 31.640 23.285  21.131  1.00 29.26 ? 52  ASN A OD1 1 
ATOM   349  N ND2 . ASN A 1 52  ? 31.730 25.368  20.298  1.00 25.32 ? 52  ASN A ND2 1 
ATOM   350  N N   . ASN A 1 53  ? 33.490 23.101  15.908  1.00 21.10 ? 53  ASN A N   1 
ATOM   351  C CA  . ASN A 1 53  ? 34.502 22.767  14.907  1.00 20.96 ? 53  ASN A CA  1 
ATOM   352  C C   . ASN A 1 53  ? 33.885 22.417  13.564  1.00 20.30 ? 53  ASN A C   1 
ATOM   353  O O   . ASN A 1 53  ? 32.757 21.940  13.515  1.00 20.46 ? 53  ASN A O   1 
ATOM   354  C CB  . ASN A 1 53  ? 35.293 21.526  15.349  1.00 20.63 ? 53  ASN A CB  1 
ATOM   355  C CG  . ASN A 1 53  ? 36.042 21.735  16.649  1.00 20.74 ? 53  ASN A CG  1 
ATOM   356  O OD1 . ASN A 1 53  ? 37.042 22.444  16.688  1.00 19.94 ? 53  ASN A OD1 1 
ATOM   357  N ND2 . ASN A 1 53  ? 35.571 21.106  17.709  1.00 21.64 ? 53  ASN A ND2 1 
ATOM   358  N N   . LEU A 1 54  ? 34.647 22.632  12.488  1.00 19.92 ? 54  LEU A N   1 
ATOM   359  C CA  . LEU A 1 54  ? 34.421 21.916  11.222  1.00 20.58 ? 54  LEU A CA  1 
ATOM   360  C C   . LEU A 1 54  ? 35.266 20.651  11.252  1.00 20.27 ? 54  LEU A C   1 
ATOM   361  O O   . LEU A 1 54  ? 36.335 20.610  11.890  1.00 20.30 ? 54  LEU A O   1 
ATOM   362  C CB  . LEU A 1 54  ? 34.771 22.783  9.993   1.00 20.51 ? 54  LEU A CB  1 
ATOM   363  C CG  . LEU A 1 54  ? 33.628 23.559  9.302   1.00 22.31 ? 54  LEU A CG  1 
ATOM   364  C CD1 . LEU A 1 54  ? 32.917 24.479  10.278  1.00 22.42 ? 54  LEU A CD1 1 
ATOM   365  C CD2 . LEU A 1 54  ? 34.128 24.366  8.130   1.00 20.82 ? 54  LEU A CD2 1 
ATOM   366  N N   . PHE A 1 55  ? 34.795 19.613  10.570  1.00 20.00 ? 55  PHE A N   1 
ATOM   367  C CA  . PHE A 1 55  ? 35.513 18.357  10.545  1.00 19.52 ? 55  PHE A CA  1 
ATOM   368  C C   . PHE A 1 55  ? 35.863 17.954  9.124   1.00 19.61 ? 55  PHE A C   1 
ATOM   369  O O   . PHE A 1 55  ? 35.061 18.101  8.200   1.00 18.84 ? 55  PHE A O   1 
ATOM   370  C CB  . PHE A 1 55  ? 34.699 17.252  11.219  1.00 19.43 ? 55  PHE A CB  1 
ATOM   371  C CG  . PHE A 1 55  ? 34.316 17.555  12.639  1.00 20.33 ? 55  PHE A CG  1 
ATOM   372  C CD1 . PHE A 1 55  ? 35.160 17.185  13.695  1.00 19.67 ? 55  PHE A CD1 1 
ATOM   373  C CD2 . PHE A 1 55  ? 33.111 18.202  12.928  1.00 20.08 ? 55  PHE A CD2 1 
ATOM   374  C CE1 . PHE A 1 55  ? 34.811 17.459  15.024  1.00 20.93 ? 55  PHE A CE1 1 
ATOM   375  C CE2 . PHE A 1 55  ? 32.744 18.474  14.251  1.00 20.40 ? 55  PHE A CE2 1 
ATOM   376  C CZ  . PHE A 1 55  ? 33.596 18.096  15.303  1.00 20.74 ? 55  PHE A CZ  1 
ATOM   377  N N   . TYR A 1 56  ? 37.080 17.451  8.964   1.00 19.30 ? 56  TYR A N   1 
ATOM   378  C CA  . TYR A 1 56  ? 37.562 16.984  7.683   1.00 19.22 ? 56  TYR A CA  1 
ATOM   379  C C   . TYR A 1 56  ? 37.832 15.482  7.805   1.00 18.79 ? 56  TYR A C   1 
ATOM   380  O O   . TYR A 1 56  ? 38.577 15.045  8.690   1.00 18.18 ? 56  TYR A O   1 
ATOM   381  C CB  . TYR A 1 56  ? 38.844 17.741  7.297   1.00 19.06 ? 56  TYR A CB  1 
ATOM   382  C CG  . TYR A 1 56  ? 39.432 17.328  5.955   1.00 19.98 ? 56  TYR A CG  1 
ATOM   383  C CD1 . TYR A 1 56  ? 38.893 17.817  4.757   1.00 19.44 ? 56  TYR A CD1 1 
ATOM   384  C CD2 . TYR A 1 56  ? 40.515 16.431  5.884   1.00 20.66 ? 56  TYR A CD2 1 
ATOM   385  C CE1 . TYR A 1 56  ? 39.424 17.427  3.514   1.00 19.65 ? 56  TYR A CE1 1 
ATOM   386  C CE2 . TYR A 1 56  ? 41.060 16.039  4.642   1.00 19.61 ? 56  TYR A CE2 1 
ATOM   387  C CZ  . TYR A 1 56  ? 40.514 16.554  3.473   1.00 18.68 ? 56  TYR A CZ  1 
ATOM   388  O OH  . TYR A 1 56  ? 41.029 16.196  2.249   1.00 20.21 ? 56  TYR A OH  1 
ATOM   389  N N   . LEU A 1 57  ? 37.232 14.701  6.913   1.00 18.62 ? 57  LEU A N   1 
ATOM   390  C CA  . LEU A 1 57  ? 37.436 13.258  6.916   1.00 18.73 ? 57  LEU A CA  1 
ATOM   391  C C   . LEU A 1 57  ? 38.697 12.891  6.130   1.00 18.93 ? 57  LEU A C   1 
ATOM   392  O O   . LEU A 1 57  ? 38.696 12.854  4.891   1.00 18.39 ? 57  LEU A O   1 
ATOM   393  C CB  . LEU A 1 57  ? 36.205 12.523  6.363   1.00 18.71 ? 57  LEU A CB  1 
ATOM   394  C CG  . LEU A 1 57  ? 36.295 10.996  6.422   1.00 18.37 ? 57  LEU A CG  1 
ATOM   395  C CD1 . LEU A 1 57  ? 36.504 10.514  7.877   1.00 18.18 ? 57  LEU A CD1 1 
ATOM   396  C CD2 . LEU A 1 57  ? 35.038 10.387  5.820   1.00 18.38 ? 57  LEU A CD2 1 
ATOM   397  N N   . TYR A 1 58  ? 39.779 12.643  6.855   1.00 20.30 ? 58  TYR A N   1 
ATOM   398  C CA  . TYR A 1 58  ? 41.042 12.304  6.197   1.00 21.75 ? 58  TYR A CA  1 
ATOM   399  C C   . TYR A 1 58  ? 41.006 10.857  5.674   1.00 22.10 ? 58  TYR A C   1 
ATOM   400  O O   . TYR A 1 58  ? 41.302 10.592  4.500   1.00 21.88 ? 58  TYR A O   1 
ATOM   401  C CB  . TYR A 1 58  ? 42.233 12.544  7.142   1.00 23.18 ? 58  TYR A CB  1 
ATOM   402  C CG  . TYR A 1 58  ? 43.554 12.126  6.536   1.00 24.22 ? 58  TYR A CG  1 
ATOM   403  C CD1 . TYR A 1 58  ? 44.045 12.747  5.385   1.00 26.68 ? 58  TYR A CD1 1 
ATOM   404  C CD2 . TYR A 1 58  ? 44.300 11.103  7.102   1.00 26.92 ? 58  TYR A CD2 1 
ATOM   405  C CE1 . TYR A 1 58  ? 45.276 12.345  4.803   1.00 27.42 ? 58  TYR A CE1 1 
ATOM   406  C CE2 . TYR A 1 58  ? 45.526 10.696  6.536   1.00 26.95 ? 58  TYR A CE2 1 
ATOM   407  C CZ  . TYR A 1 58  ? 46.003 11.322  5.394   1.00 27.20 ? 58  TYR A CZ  1 
ATOM   408  O OH  . TYR A 1 58  ? 47.216 10.913  4.850   1.00 28.54 ? 58  TYR A OH  1 
ATOM   409  N N   . GLU A 1 59  ? 40.636 9.929   6.551   1.00 22.20 ? 59  GLU A N   1 
ATOM   410  C CA  . GLU A 1 59  ? 40.524 8.513   6.198   1.00 23.17 ? 59  GLU A CA  1 
ATOM   411  C C   . GLU A 1 59  ? 39.302 7.939   6.874   1.00 21.66 ? 59  GLU A C   1 
ATOM   412  O O   . GLU A 1 59  ? 38.973 8.343   7.980   1.00 21.37 ? 59  GLU A O   1 
ATOM   413  C CB  . GLU A 1 59  ? 41.742 7.722   6.697   1.00 23.50 ? 59  GLU A CB  1 
ATOM   414  C CG  . GLU A 1 59  ? 42.881 7.669   5.720   1.00 26.32 ? 59  GLU A CG  1 
ATOM   415  C CD  . GLU A 1 59  ? 44.004 6.729   6.157   1.00 26.45 ? 59  GLU A CD  1 
ATOM   416  O OE1 . GLU A 1 59  ? 43.780 5.853   7.040   1.00 31.35 ? 59  GLU A OE1 1 
ATOM   417  O OE2 . GLU A 1 59  ? 45.107 6.883   5.593   1.00 32.22 ? 59  GLU A OE2 1 
ATOM   418  N N   . GLY A 1 60  ? 38.627 7.005   6.214   1.00 20.69 ? 60  GLY A N   1 
ATOM   419  C CA  . GLY A 1 60  ? 37.524 6.297   6.878   1.00 20.30 ? 60  GLY A CA  1 
ATOM   420  C C   . GLY A 1 60  ? 36.186 6.671   6.290   1.00 19.47 ? 60  GLY A C   1 
ATOM   421  O O   . GLY A 1 60  ? 36.115 7.064   5.134   1.00 19.43 ? 60  GLY A O   1 
ATOM   422  N N   . LYS A 1 61  ? 35.120 6.515   7.078   1.00 19.21 ? 61  LYS A N   1 
ATOM   423  C CA  . LYS A 1 61  ? 33.742 6.694   6.599   1.00 19.04 ? 61  LYS A CA  1 
ATOM   424  C C   . LYS A 1 61  ? 32.856 7.138   7.759   1.00 18.92 ? 61  LYS A C   1 
ATOM   425  O O   . LYS A 1 61  ? 32.918 6.554   8.848   1.00 17.78 ? 61  LYS A O   1 
ATOM   426  C CB  . LYS A 1 61  ? 33.177 5.391   6.000   1.00 19.59 ? 61  LYS A CB  1 
ATOM   427  C CG  . LYS A 1 61  ? 34.113 4.607   5.048   1.00 19.61 ? 61  LYS A CG  1 
ATOM   428  C CD  . LYS A 1 61  ? 33.351 3.519   4.279   1.00 20.75 ? 61  LYS A CD  1 
ATOM   429  C CE  . LYS A 1 61  ? 34.233 2.473   3.632   1.00 22.37 ? 61  LYS A CE  1 
ATOM   430  N NZ  . LYS A 1 61  ? 35.636 2.848   3.340   1.00 23.57 ? 61  LYS A NZ  1 
ATOM   431  N N   . ILE A 1 62  ? 32.028 8.168   7.530   1.00 18.25 ? 62  ILE A N   1 
ATOM   432  C CA  . ILE A 1 62  ? 31.159 8.733   8.587   1.00 18.46 ? 62  ILE A CA  1 
ATOM   433  C C   . ILE A 1 62  ? 29.722 8.746   8.069   1.00 18.64 ? 62  ILE A C   1 
ATOM   434  O O   . ILE A 1 62  ? 29.466 9.264   6.982   1.00 18.57 ? 62  ILE A O   1 
ATOM   435  C CB  . ILE A 1 62  ? 31.553 10.189  8.951   1.00 17.65 ? 62  ILE A CB  1 
ATOM   436  C CG1 . ILE A 1 62  ? 33.050 10.312  9.336   1.00 17.23 ? 62  ILE A CG1 1 
ATOM   437  C CG2 . ILE A 1 62  ? 30.624 10.778  10.025  1.00 16.94 ? 62  ILE A CG2 1 
ATOM   438  C CD1 . ILE A 1 62  ? 33.427 9.690   10.685  1.00 18.30 ? 62  ILE A CD1 1 
ATOM   439  N N   . LYS A 1 63  ? 28.789 8.177   8.826   1.00 18.86 ? 63  LYS A N   1 
ATOM   440  C CA  . LYS A 1 63  ? 27.379 8.280   8.432   1.00 20.28 ? 63  LYS A CA  1 
ATOM   441  C C   . LYS A 1 63  ? 26.749 9.480   9.123   1.00 19.19 ? 63  LYS A C   1 
ATOM   442  O O   . LYS A 1 63  ? 26.994 9.719   10.317  1.00 18.95 ? 63  LYS A O   1 
ATOM   443  C CB  . LYS A 1 63  ? 26.592 6.994   8.736   1.00 20.35 ? 63  LYS A CB  1 
ATOM   444  C CG  . LYS A 1 63  ? 26.707 6.503   10.163  1.00 22.24 ? 63  LYS A CG  1 
ATOM   445  C CD  . LYS A 1 63  ? 26.238 5.047   10.302  1.00 23.21 ? 63  LYS A CD  1 
ATOM   446  C CE  . LYS A 1 63  ? 25.023 4.911   11.195  1.00 26.47 ? 63  LYS A CE  1 
ATOM   447  N NZ  . LYS A 1 63  ? 24.710 3.460   11.492  1.00 24.89 ? 63  LYS A NZ  1 
ATOM   448  N N   . ILE A 1 64  ? 25.946 10.232  8.384   1.00 18.59 ? 64  ILE A N   1 
ATOM   449  C CA  . ILE A 1 64  ? 25.219 11.378  8.954   1.00 18.61 ? 64  ILE A CA  1 
ATOM   450  C C   . ILE A 1 64  ? 23.757 10.977  9.063   1.00 19.77 ? 64  ILE A C   1 
ATOM   451  O O   . ILE A 1 64  ? 23.132 10.618  8.057   1.00 19.19 ? 64  ILE A O   1 
ATOM   452  C CB  . ILE A 1 64  ? 25.387 12.666  8.072   1.00 18.77 ? 64  ILE A CB  1 
ATOM   453  C CG1 . ILE A 1 64  ? 26.871 12.972  7.816   1.00 18.04 ? 64  ILE A CG1 1 
ATOM   454  C CG2 . ILE A 1 64  ? 24.638 13.853  8.668   1.00 17.95 ? 64  ILE A CG2 1 
ATOM   455  C CD1 . ILE A 1 64  ? 27.666 13.343  9.036   1.00 19.19 ? 64  ILE A CD1 1 
ATOM   456  N N   . LEU A 1 65  ? 23.216 11.030  10.280  1.00 20.85 ? 65  LEU A N   1 
ATOM   457  C CA  . LEU A 1 65  ? 21.879 10.523  10.522  1.00 22.89 ? 65  LEU A CA  1 
ATOM   458  C C   . LEU A 1 65  ? 21.052 11.412  11.437  1.00 22.51 ? 65  LEU A C   1 
ATOM   459  O O   . LEU A 1 65  ? 21.595 12.165  12.252  1.00 21.93 ? 65  LEU A O   1 
ATOM   460  C CB  . LEU A 1 65  ? 21.938 9.093   11.077  1.00 23.07 ? 65  LEU A CB  1 
ATOM   461  C CG  . LEU A 1 65  ? 22.535 8.780   12.447  1.00 25.23 ? 65  LEU A CG  1 
ATOM   462  C CD1 . LEU A 1 65  ? 21.632 9.223   13.565  1.00 29.78 ? 65  LEU A CD1 1 
ATOM   463  C CD2 . LEU A 1 65  ? 22.692 7.270   12.522  1.00 26.15 ? 65  LEU A CD2 1 
ATOM   464  N N   . ARG A 1 66  ? 19.735 11.281  11.340  1.00 22.54 ? 66  ARG A N   1 
ATOM   465  C CA  . ARG A 1 66  ? 18.852 12.084  12.175  1.00 24.11 ? 66  ARG A CA  1 
ATOM   466  C C   . ARG A 1 66  ? 17.583 11.318  12.551  1.00 23.71 ? 66  ARG A C   1 
ATOM   467  O O   . ARG A 1 66  ? 17.211 10.368  11.855  1.00 24.22 ? 66  ARG A O   1 
ATOM   468  C CB  . ARG A 1 66  ? 18.493 13.386  11.459  1.00 24.52 ? 66  ARG A CB  1 
ATOM   469  C CG  . ARG A 1 66  ? 17.386 13.233  10.409  1.00 27.29 ? 66  ARG A CG  1 
ATOM   470  C CD  . ARG A 1 66  ? 16.977 14.581  9.860   1.00 32.11 ? 66  ARG A CD  1 
ATOM   471  N NE  . ARG A 1 66  ? 18.049 15.196  9.091   1.00 33.72 ? 66  ARG A NE  1 
ATOM   472  C CZ  . ARG A 1 66  ? 18.113 16.495  8.798   1.00 35.69 ? 66  ARG A CZ  1 
ATOM   473  N NH1 . ARG A 1 66  ? 17.172 17.334  9.212   1.00 35.23 ? 66  ARG A NH1 1 
ATOM   474  N NH2 . ARG A 1 66  ? 19.146 16.959  8.105   1.00 36.84 ? 66  ARG A NH2 1 
ATOM   475  N N   . ARG A 1 72  ? 11.845 5.956   13.223  1.00 39.54 ? 72  ARG A N   1 
ATOM   476  C CA  . ARG A 1 72  ? 12.712 5.669   12.084  1.00 39.34 ? 72  ARG A CA  1 
ATOM   477  C C   . ARG A 1 72  ? 13.862 6.659   12.111  1.00 38.17 ? 72  ARG A C   1 
ATOM   478  O O   . ARG A 1 72  ? 13.681 7.812   12.505  1.00 38.75 ? 72  ARG A O   1 
ATOM   479  C CB  . ARG A 1 72  ? 11.946 5.826   10.767  1.00 39.59 ? 72  ARG A CB  1 
ATOM   480  C CG  . ARG A 1 72  ? 10.863 4.774   10.501  1.00 40.84 ? 72  ARG A CG  1 
ATOM   481  C CD  . ARG A 1 72  ? 10.180 5.018   9.141   1.00 40.33 ? 72  ARG A CD  1 
ATOM   482  N NE  . ARG A 1 72  ? 11.139 4.971   8.033   1.00 42.50 ? 72  ARG A NE  1 
ATOM   483  C CZ  . ARG A 1 72  ? 10.840 5.149   6.747   1.00 43.71 ? 72  ARG A CZ  1 
ATOM   484  N NH1 . ARG A 1 72  ? 9.593  5.401   6.369   1.00 44.21 ? 72  ARG A NH1 1 
ATOM   485  N NH2 . ARG A 1 72  ? 11.800 5.083   5.830   1.00 43.60 ? 72  ARG A NH2 1 
ATOM   486  N N   . PHE A 1 73  ? 15.048 6.213   11.723  1.00 36.73 ? 73  PHE A N   1 
ATOM   487  C CA  . PHE A 1 73  ? 16.156 7.147   11.503  1.00 35.37 ? 73  PHE A CA  1 
ATOM   488  C C   . PHE A 1 73  ? 16.285 7.382   9.998   1.00 33.90 ? 73  PHE A C   1 
ATOM   489  O O   . PHE A 1 73  ? 15.745 6.619   9.194   1.00 34.05 ? 73  PHE A O   1 
ATOM   490  C CB  . PHE A 1 73  ? 17.471 6.649   12.126  1.00 35.76 ? 73  PHE A CB  1 
ATOM   491  C CG  . PHE A 1 73  ? 17.608 6.961   13.607  1.00 36.04 ? 73  PHE A CG  1 
ATOM   492  C CD1 . PHE A 1 73  ? 18.187 8.153   14.033  1.00 37.67 ? 73  PHE A CD1 1 
ATOM   493  C CD2 . PHE A 1 73  ? 17.163 6.060   14.568  1.00 37.99 ? 73  PHE A CD2 1 
ATOM   494  C CE1 . PHE A 1 73  ? 18.325 8.447   15.395  1.00 37.55 ? 73  PHE A CE1 1 
ATOM   495  C CE2 . PHE A 1 73  ? 17.286 6.343   15.929  1.00 37.42 ? 73  PHE A CE2 1 
ATOM   496  C CZ  . PHE A 1 73  ? 17.869 7.535   16.344  1.00 37.16 ? 73  PHE A CZ  1 
ATOM   497  N N   . HIS A 1 74  ? 16.944 8.472   9.628   1.00 31.52 ? 74  HIS A N   1 
ATOM   498  C CA  . HIS A 1 74  ? 17.225 8.773   8.236   1.00 29.18 ? 74  HIS A CA  1 
ATOM   499  C C   . HIS A 1 74  ? 18.720 9.000   8.126   1.00 27.46 ? 74  HIS A C   1 
ATOM   500  O O   . HIS A 1 74  ? 19.285 9.755   8.900   1.00 25.58 ? 74  HIS A O   1 
ATOM   501  C CB  . HIS A 1 74  ? 16.479 10.043  7.804   1.00 29.33 ? 74  HIS A CB  1 
ATOM   502  C CG  . HIS A 1 74  ? 16.799 10.492  6.414   1.00 28.76 ? 74  HIS A CG  1 
ATOM   503  N ND1 . HIS A 1 74  ? 16.342 9.830   5.295   1.00 29.76 ? 74  HIS A ND1 1 
ATOM   504  C CD2 . HIS A 1 74  ? 17.542 11.529  5.963   1.00 29.02 ? 74  HIS A CD2 1 
ATOM   505  C CE1 . HIS A 1 74  ? 16.780 10.448  4.212   1.00 30.23 ? 74  HIS A CE1 1 
ATOM   506  N NE2 . HIS A 1 74  ? 17.506 11.485  4.590   1.00 29.90 ? 74  HIS A NE2 1 
ATOM   507  N N   . ILE A 1 75  ? 19.354 8.310   7.185   1.00 26.55 ? 75  ILE A N   1 
ATOM   508  C CA  . ILE A 1 75  ? 20.759 8.562   6.880   1.00 25.55 ? 75  ILE A CA  1 
ATOM   509  C C   . ILE A 1 75  ? 20.781 9.523   5.715   1.00 24.98 ? 75  ILE A C   1 
ATOM   510  O O   . ILE A 1 75  ? 20.348 9.182   4.614   1.00 25.66 ? 75  ILE A O   1 
ATOM   511  C CB  . ILE A 1 75  ? 21.530 7.270   6.508   1.00 25.32 ? 75  ILE A CB  1 
ATOM   512  C CG1 . ILE A 1 75  ? 21.482 6.253   7.659   1.00 25.61 ? 75  ILE A CG1 1 
ATOM   513  C CG2 . ILE A 1 75  ? 22.963 7.609   6.121   1.00 25.02 ? 75  ILE A CG2 1 
ATOM   514  C CD1 . ILE A 1 75  ? 21.932 4.843   7.264   1.00 25.63 ? 75  ILE A CD1 1 
ATOM   515  N N   . SER A 1 76  ? 21.275 10.728  5.949   1.00 24.35 ? 76  SER A N   1 
ATOM   516  C CA  . SER A 1 76  ? 21.255 11.735  4.900   1.00 24.24 ? 76  SER A CA  1 
ATOM   517  C C   . SER A 1 76  ? 22.434 11.578  3.930   1.00 23.76 ? 76  SER A C   1 
ATOM   518  O O   . SER A 1 76  ? 22.329 11.950  2.739   1.00 23.72 ? 76  SER A O   1 
ATOM   519  C CB  . SER A 1 76  ? 21.174 13.141  5.496   1.00 24.16 ? 76  SER A CB  1 
ATOM   520  O OG  . SER A 1 76  ? 22.316 13.450  6.266   1.00 27.09 ? 76  SER A OG  1 
ATOM   521  N N   . ARG A 1 77  ? 23.552 11.043  4.433   1.00 22.58 ? 77  ARG A N   1 
ATOM   522  C CA  . ARG A 1 77  ? 24.756 10.820  3.611   1.00 21.94 ? 77  ARG A CA  1 
ATOM   523  C C   . ARG A 1 77  ? 25.755 9.891   4.316   1.00 20.45 ? 77  ARG A C   1 
ATOM   524  O O   . ARG A 1 77  ? 25.708 9.737   5.549   1.00 18.60 ? 77  ARG A O   1 
ATOM   525  C CB  . ARG A 1 77  ? 25.437 12.155  3.208   1.00 22.32 ? 77  ARG A CB  1 
ATOM   526  C CG  . ARG A 1 77  ? 26.313 12.808  4.254   1.00 24.10 ? 77  ARG A CG  1 
ATOM   527  C CD  . ARG A 1 77  ? 26.754 14.291  3.938   1.00 23.81 ? 77  ARG A CD  1 
ATOM   528  N NE  . ARG A 1 77  ? 27.957 14.428  3.125   1.00 28.00 ? 77  ARG A NE  1 
ATOM   529  C CZ  . ARG A 1 77  ? 28.911 15.359  3.285   1.00 30.79 ? 77  ARG A CZ  1 
ATOM   530  N NH1 . ARG A 1 77  ? 28.869 16.259  4.272   1.00 28.39 ? 77  ARG A NH1 1 
ATOM   531  N NH2 . ARG A 1 77  ? 29.949 15.375  2.454   1.00 32.69 ? 77  ARG A NH2 1 
ATOM   532  N N   . ILE A 1 78  ? 26.639 9.271   3.532   1.00 19.35 ? 78  ILE A N   1 
ATOM   533  C CA  . ILE A 1 78  ? 27.862 8.684   4.106   1.00 19.25 ? 78  ILE A CA  1 
ATOM   534  C C   . ILE A 1 78  ? 29.018 9.484   3.543   1.00 18.49 ? 78  ILE A C   1 
ATOM   535  O O   . ILE A 1 78  ? 29.232 9.501   2.332   1.00 18.50 ? 78  ILE A O   1 
ATOM   536  C CB  . ILE A 1 78  ? 28.020 7.186   3.831   1.00 19.48 ? 78  ILE A CB  1 
ATOM   537  C CG1 . ILE A 1 78  ? 26.795 6.444   4.371   1.00 21.51 ? 78  ILE A CG1 1 
ATOM   538  C CG2 . ILE A 1 78  ? 29.321 6.645   4.503   1.00 19.59 ? 78  ILE A CG2 1 
ATOM   539  C CD1 . ILE A 1 78  ? 26.725 5.003   3.945   1.00 26.43 ? 78  ILE A CD1 1 
ATOM   540  N N   . VAL A 1 79  ? 29.723 10.180  4.428   1.00 18.09 ? 79  VAL A N   1 
ATOM   541  C CA  . VAL A 1 79  ? 30.874 11.008  4.047   1.00 18.29 ? 79  VAL A CA  1 
ATOM   542  C C   . VAL A 1 79  ? 32.082 10.146  3.624   1.00 19.13 ? 79  VAL A C   1 
ATOM   543  O O   . VAL A 1 79  ? 32.377 9.143   4.264   1.00 18.45 ? 79  VAL A O   1 
ATOM   544  C CB  . VAL A 1 79  ? 31.290 11.951  5.223   1.00 18.31 ? 79  VAL A CB  1 
ATOM   545  C CG1 . VAL A 1 79  ? 32.388 12.919  4.791   1.00 17.87 ? 79  VAL A CG1 1 
ATOM   546  C CG2 . VAL A 1 79  ? 30.075 12.686  5.814   1.00 15.50 ? 79  VAL A CG2 1 
ATOM   547  N N   . LYS A 1 80  ? 32.759 10.555  2.544   1.00 19.44 ? 80  LYS A N   1 
ATOM   548  C CA  . LYS A 1 80  ? 33.946 9.868   2.008   1.00 20.51 ? 80  LYS A CA  1 
ATOM   549  C C   . LYS A 1 80  ? 35.216 10.697  2.257   1.00 20.64 ? 80  LYS A C   1 
ATOM   550  O O   . LYS A 1 80  ? 35.136 11.926  2.492   1.00 20.44 ? 80  LYS A O   1 
ATOM   551  C CB  . LYS A 1 80  ? 33.776 9.574   0.503   1.00 20.07 ? 80  LYS A CB  1 
ATOM   552  C CG  . LYS A 1 80  ? 33.829 10.818  -0.401  1.00 20.02 ? 80  LYS A CG  1 
ATOM   553  C CD  . LYS A 1 80  ? 33.327 10.492  -1.821  1.00 22.45 ? 80  LYS A CD  1 
ATOM   554  C CE  . LYS A 1 80  ? 33.920 11.439  -2.859  1.00 26.22 ? 80  LYS A CE  1 
ATOM   555  N NZ  . LYS A 1 80  ? 33.113 11.401  -4.126  1.00 30.77 ? 80  LYS A NZ  1 
ATOM   556  N N   . PRO A 1 81  ? 36.394 10.035  2.239   1.00 21.56 ? 81  PRO A N   1 
ATOM   557  C CA  . PRO A 1 81  ? 37.618 10.768  2.505   1.00 21.79 ? 81  PRO A CA  1 
ATOM   558  C C   . PRO A 1 81  ? 37.807 11.962  1.578   1.00 22.09 ? 81  PRO A C   1 
ATOM   559  O O   . PRO A 1 81  ? 37.368 11.948  0.405   1.00 21.70 ? 81  PRO A O   1 
ATOM   560  C CB  . PRO A 1 81  ? 38.711 9.711   2.290   1.00 21.85 ? 81  PRO A CB  1 
ATOM   561  C CG  . PRO A 1 81  ? 38.043 8.430   2.596   1.00 22.34 ? 81  PRO A CG  1 
ATOM   562  C CD  . PRO A 1 81  ? 36.665 8.597   2.035   1.00 21.32 ? 81  PRO A CD  1 
ATOM   563  N N   . GLY A 1 82  ? 38.408 13.013  2.126   1.00 22.46 ? 82  GLY A N   1 
ATOM   564  C CA  . GLY A 1 82  ? 38.579 14.271  1.399   1.00 22.46 ? 82  GLY A CA  1 
ATOM   565  C C   . GLY A 1 82  ? 37.417 15.259  1.464   1.00 22.80 ? 82  GLY A C   1 
ATOM   566  O O   . GLY A 1 82  ? 37.480 16.302  0.828   1.00 22.64 ? 82  GLY A O   1 
ATOM   567  N N   . GLN A 1 83  ? 36.347 14.927  2.196   1.00 22.51 ? 83  GLN A N   1 
ATOM   568  C CA  . GLN A 1 83  ? 35.197 15.824  2.363   1.00 22.20 ? 83  GLN A CA  1 
ATOM   569  C C   . GLN A 1 83  ? 35.169 16.432  3.768   1.00 21.97 ? 83  GLN A C   1 
ATOM   570  O O   . GLN A 1 83  ? 35.661 15.826  4.732   1.00 21.25 ? 83  GLN A O   1 
ATOM   571  C CB  . GLN A 1 83  ? 33.848 15.103  2.107   1.00 22.13 ? 83  GLN A CB  1 
ATOM   572  C CG  . GLN A 1 83  ? 33.604 14.604  0.675   1.00 22.87 ? 83  GLN A CG  1 
ATOM   573  C CD  . GLN A 1 83  ? 32.203 13.998  0.487   1.00 24.08 ? 83  GLN A CD  1 
ATOM   574  O OE1 . GLN A 1 83  ? 31.705 13.245  1.333   1.00 23.11 ? 83  GLN A OE1 1 
ATOM   575  N NE2 . GLN A 1 83  ? 31.571 14.326  -0.632  1.00 24.10 ? 83  GLN A NE2 1 
ATOM   576  N N   . PHE A 1 84  ? 34.579 17.625  3.863   1.00 21.32 ? 84  PHE A N   1 
ATOM   577  C CA  . PHE A 1 84  ? 34.221 18.255  5.138   1.00 21.05 ? 84  PHE A CA  1 
ATOM   578  C C   . PHE A 1 84  ? 32.817 17.837  5.600   1.00 20.58 ? 84  PHE A C   1 
ATOM   579  O O   . PHE A 1 84  ? 31.928 17.598  4.776   1.00 20.14 ? 84  PHE A O   1 
ATOM   580  C CB  . PHE A 1 84  ? 34.245 19.785  4.995   1.00 20.94 ? 84  PHE A CB  1 
ATOM   581  C CG  . PHE A 1 84  ? 35.618 20.356  4.982   1.00 22.17 ? 84  PHE A CG  1 
ATOM   582  C CD1 . PHE A 1 84  ? 36.225 20.776  6.169   1.00 23.71 ? 84  PHE A CD1 1 
ATOM   583  C CD2 . PHE A 1 84  ? 36.327 20.455  3.791   1.00 22.81 ? 84  PHE A CD2 1 
ATOM   584  C CE1 . PHE A 1 84  ? 37.517 21.291  6.153   1.00 24.01 ? 84  PHE A CE1 1 
ATOM   585  C CE2 . PHE A 1 84  ? 37.623 20.963  3.775   1.00 24.42 ? 84  PHE A CE2 1 
ATOM   586  C CZ  . PHE A 1 84  ? 38.211 21.386  4.955   1.00 23.00 ? 84  PHE A CZ  1 
ATOM   587  N N   . PHE A 1 85  ? 32.617 17.777  6.911   1.00 19.60 ? 85  PHE A N   1 
ATOM   588  C CA  . PHE A 1 85  ? 31.281 17.594  7.480   1.00 19.20 ? 85  PHE A CA  1 
ATOM   589  C C   . PHE A 1 85  ? 31.133 18.408  8.771   1.00 19.09 ? 85  PHE A C   1 
ATOM   590  O O   . PHE A 1 85  ? 32.123 18.901  9.323   1.00 18.30 ? 85  PHE A O   1 
ATOM   591  C CB  . PHE A 1 85  ? 30.927 16.099  7.661   1.00 19.16 ? 85  PHE A CB  1 
ATOM   592  C CG  . PHE A 1 85  ? 31.827 15.362  8.623   1.00 18.47 ? 85  PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 85  ? 31.361 15.010  9.894   1.00 19.05 ? 85  PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 85  ? 33.129 14.999  8.259   1.00 17.09 ? 85  PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 85  ? 32.177 14.333  10.780  1.00 18.75 ? 85  PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 85  ? 33.960 14.335  9.145   1.00 17.14 ? 85  PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 85  ? 33.486 13.981  10.408  1.00 17.99 ? 85  PHE A CZ  1 
ATOM   598  N N   . GLY A 1 86  ? 29.897 18.591  9.226   1.00 18.80 ? 86  GLY A N   1 
ATOM   599  C CA  . GLY A 1 86  ? 29.625 19.609  10.236  1.00 19.49 ? 86  GLY A CA  1 
ATOM   600  C C   . GLY A 1 86  ? 29.824 21.036  9.745   1.00 19.74 ? 86  GLY A C   1 
ATOM   601  O O   . GLY A 1 86  ? 29.867 21.964  10.554  1.00 19.60 ? 86  GLY A O   1 
ATOM   602  N N   . MET A 1 87  ? 29.933 21.219  8.421   1.00 19.36 ? 87  MET A N   1 
ATOM   603  C CA  . MET A 1 87  ? 30.122 22.551  7.823   1.00 19.54 ? 87  MET A CA  1 
ATOM   604  C C   . MET A 1 87  ? 28.789 23.288  7.643   1.00 19.35 ? 87  MET A C   1 
ATOM   605  O O   . MET A 1 87  ? 28.712 24.491  7.868   1.00 18.72 ? 87  MET A O   1 
ATOM   606  C CB  . MET A 1 87  ? 30.968 22.535  6.506   1.00 19.83 ? 87  MET A CB  1 
ATOM   607  C CG  . MET A 1 87  ? 30.462 21.668  5.330   1.00 20.55 ? 87  MET A CG  1 
ATOM   608  S SD  . MET A 1 87  ? 31.195 21.873  3.638   1.00 19.39 ? 87  MET A SD  1 
ATOM   609  C CE  . MET A 1 87  ? 30.517 23.461  3.265   1.00 27.29 ? 87  MET A CE  1 
ATOM   610  N N   . ARG A 1 88  ? 27.745 22.540  7.289   1.00 19.20 ? 88  ARG A N   1 
ATOM   611  C CA  . ARG A 1 88  ? 26.391 23.086  7.066   1.00 20.03 ? 88  ARG A CA  1 
ATOM   612  C C   . ARG A 1 88  ? 25.892 23.971  8.240   1.00 18.60 ? 88  ARG A C   1 
ATOM   613  O O   . ARG A 1 88  ? 25.531 25.142  8.032   1.00 18.74 ? 88  ARG A O   1 
ATOM   614  C CB  . ARG A 1 88  ? 25.399 21.925  6.793   1.00 20.21 ? 88  ARG A CB  1 
ATOM   615  C CG  . ARG A 1 88  ? 24.946 21.201  8.120   1.00 23.92 ? 88  ARG A CG  1 
ATOM   616  C CD  . ARG A 1 88  ? 24.151 19.830  8.071   1.00 20.90 ? 88  ARG A CD  1 
ATOM   617  N NE  . ARG A 1 88  ? 23.929 19.369  9.429   1.00 24.20 ? 88  ARG A NE  1 
ATOM   618  C CZ  . ARG A 1 88  ? 24.646 18.408  10.027  1.00 28.46 ? 88  ARG A CZ  1 
ATOM   619  N NH1 . ARG A 1 88  ? 25.644 17.773  9.399   1.00 30.71 ? 88  ARG A NH1 1 
ATOM   620  N NH2 . ARG A 1 88  ? 24.369 18.080  11.269  1.00 31.21 ? 88  ARG A NH2 1 
ATOM   621  N N   . PRO A 1 89  ? 25.880 23.429  9.477   1.00 18.53 ? 89  PRO A N   1 
ATOM   622  C CA  . PRO A 1 89  ? 25.256 24.221  10.528  1.00 17.75 ? 89  PRO A CA  1 
ATOM   623  C C   . PRO A 1 89  ? 26.093 25.441  10.887  1.00 17.37 ? 89  PRO A C   1 
ATOM   624  O O   . PRO A 1 89  ? 25.537 26.436  11.318  1.00 17.10 ? 89  PRO A O   1 
ATOM   625  C CB  . PRO A 1 89  ? 25.110 23.248  11.700  1.00 17.92 ? 89  PRO A CB  1 
ATOM   626  C CG  . PRO A 1 89  ? 26.005 22.097  11.417  1.00 19.57 ? 89  PRO A CG  1 
ATOM   627  C CD  . PRO A 1 89  ? 26.382 22.125  9.961   1.00 18.18 ? 89  PRO A CD  1 
ATOM   628  N N   . TYR A 1 90  ? 27.407 25.366  10.677  1.00 17.01 ? 90  TYR A N   1 
ATOM   629  C CA  . TYR A 1 90  ? 28.269 26.518  10.885  1.00 17.62 ? 90  TYR A CA  1 
ATOM   630  C C   . TYR A 1 90  ? 27.870 27.669  9.936   1.00 17.41 ? 90  TYR A C   1 
ATOM   631  O O   . TYR A 1 90  ? 27.627 28.792  10.382  1.00 17.16 ? 90  TYR A O   1 
ATOM   632  C CB  . TYR A 1 90  ? 29.744 26.159  10.680  1.00 18.11 ? 90  TYR A CB  1 
ATOM   633  C CG  . TYR A 1 90  ? 30.582 27.411  10.565  1.00 20.02 ? 90  TYR A CG  1 
ATOM   634  C CD1 . TYR A 1 90  ? 30.802 28.231  11.679  1.00 20.31 ? 90  TYR A CD1 1 
ATOM   635  C CD2 . TYR A 1 90  ? 31.101 27.805  9.341   1.00 20.13 ? 90  TYR A CD2 1 
ATOM   636  C CE1 . TYR A 1 90  ? 31.550 29.404  11.572  1.00 20.81 ? 90  TYR A CE1 1 
ATOM   637  C CE2 . TYR A 1 90  ? 31.835 28.974  9.219   1.00 20.68 ? 90  TYR A CE2 1 
ATOM   638  C CZ  . TYR A 1 90  ? 32.044 29.767  10.328  1.00 21.32 ? 90  TYR A CZ  1 
ATOM   639  O OH  . TYR A 1 90  ? 32.775 30.926  10.173  1.00 24.52 ? 90  TYR A OH  1 
ATOM   640  N N   . PHE A 1 91  ? 27.810 27.375  8.635   1.00 16.51 ? 91  PHE A N   1 
ATOM   641  C CA  . PHE A 1 91  ? 27.444 28.381  7.636   1.00 16.91 ? 91  PHE A CA  1 
ATOM   642  C C   . PHE A 1 91  ? 25.993 28.867  7.764   1.00 16.48 ? 91  PHE A C   1 
ATOM   643  O O   . PHE A 1 91  ? 25.709 30.053  7.562   1.00 16.41 ? 91  PHE A O   1 
ATOM   644  C CB  . PHE A 1 91  ? 27.756 27.876  6.214   1.00 17.04 ? 91  PHE A CB  1 
ATOM   645  C CG  . PHE A 1 91  ? 29.248 27.758  5.924   1.00 16.20 ? 91  PHE A CG  1 
ATOM   646  C CD1 . PHE A 1 91  ? 30.071 28.885  5.947   1.00 18.83 ? 91  PHE A CD1 1 
ATOM   647  C CD2 . PHE A 1 91  ? 29.820 26.527  5.629   1.00 18.22 ? 91  PHE A CD2 1 
ATOM   648  C CE1 . PHE A 1 91  ? 31.439 28.784  5.663   1.00 19.92 ? 91  PHE A CE1 1 
ATOM   649  C CE2 . PHE A 1 91  ? 31.186 26.418  5.341   1.00 20.25 ? 91  PHE A CE2 1 
ATOM   650  C CZ  . PHE A 1 91  ? 31.999 27.557  5.370   1.00 19.59 ? 91  PHE A CZ  1 
ATOM   651  N N   . ALA A 1 92  ? 25.087 27.968  8.140   1.00 16.20 ? 92  ALA A N   1 
ATOM   652  C CA  . ALA A 1 92  ? 23.663 28.311  8.270   1.00 16.05 ? 92  ALA A CA  1 
ATOM   653  C C   . ALA A 1 92  ? 23.365 29.071  9.558   1.00 17.23 ? 92  ALA A C   1 
ATOM   654  O O   . ALA A 1 92  ? 22.306 29.679  9.683   1.00 17.25 ? 92  ALA A O   1 
ATOM   655  C CB  . ALA A 1 92  ? 22.795 27.065  8.182   1.00 15.31 ? 92  ALA A CB  1 
ATOM   656  N N   . GLU A 1 93  ? 24.312 29.030  10.494  1.00 16.90 ? 93  GLU A N   1 
ATOM   657  C CA  . GLU A 1 93  ? 24.135 29.559  11.859  1.00 18.32 ? 93  GLU A CA  1 
ATOM   658  C C   . GLU A 1 93  ? 22.956 28.860  12.544  1.00 18.35 ? 93  GLU A C   1 
ATOM   659  O O   . GLU A 1 93  ? 21.948 29.482  12.939  1.00 17.74 ? 93  GLU A O   1 
ATOM   660  C CB  . GLU A 1 93  ? 23.995 31.085  11.850  1.00 17.76 ? 93  GLU A CB  1 
ATOM   661  C CG  . GLU A 1 93  ? 25.181 31.794  11.194  1.00 19.17 ? 93  GLU A CG  1 
ATOM   662  C CD  . GLU A 1 93  ? 25.128 33.285  11.402  1.00 22.59 ? 93  GLU A CD  1 
ATOM   663  O OE1 . GLU A 1 93  ? 24.275 33.956  10.784  1.00 22.87 ? 93  GLU A OE1 1 
ATOM   664  O OE2 . GLU A 1 93  ? 25.933 33.776  12.212  1.00 25.10 ? 93  GLU A OE2 1 
ATOM   665  N N   . GLU A 1 94  ? 23.103 27.545  12.661  1.00 18.31 ? 94  GLU A N   1 
ATOM   666  C CA  . GLU A 1 94  ? 22.101 26.698  13.273  1.00 18.32 ? 94  GLU A CA  1 
ATOM   667  C C   . GLU A 1 94  ? 22.812 25.673  14.162  1.00 18.18 ? 94  GLU A C   1 
ATOM   668  O O   . GLU A 1 94  ? 24.048 25.569  14.160  1.00 17.99 ? 94  GLU A O   1 
ATOM   669  C CB  . GLU A 1 94  ? 21.309 25.956  12.181  1.00 17.75 ? 94  GLU A CB  1 
ATOM   670  C CG  . GLU A 1 94  ? 20.431 26.852  11.314  1.00 19.32 ? 94  GLU A CG  1 
ATOM   671  C CD  . GLU A 1 94  ? 19.833 26.137  10.093  1.00 19.13 ? 94  GLU A CD  1 
ATOM   672  O OE1 . GLU A 1 94  ? 20.056 24.924  9.907   1.00 20.95 ? 94  GLU A OE1 1 
ATOM   673  O OE2 . GLU A 1 94  ? 19.125 26.808  9.327   1.00 20.59 ? 94  GLU A OE2 1 
ATOM   674  N N   . THR A 1 95  ? 22.021 24.893  14.885  1.00 18.22 ? 95  THR A N   1 
ATOM   675  C CA  . THR A 1 95  ? 22.522 23.724  15.599  1.00 18.38 ? 95  THR A CA  1 
ATOM   676  C C   . THR A 1 95  ? 22.658 22.576  14.591  1.00 18.68 ? 95  THR A C   1 
ATOM   677  O O   . THR A 1 95  ? 22.081 22.646  13.497  1.00 18.32 ? 95  THR A O   1 
ATOM   678  C CB  . THR A 1 95  ? 21.557 23.333  16.724  1.00 18.89 ? 95  THR A CB  1 
ATOM   679  O OG1 . THR A 1 95  ? 20.261 23.112  16.168  1.00 19.87 ? 95  THR A OG1 1 
ATOM   680  C CG2 . THR A 1 95  ? 21.463 24.452  17.778  1.00 19.90 ? 95  THR A CG2 1 
ATOM   681  N N   . CYS A 1 96  ? 23.412 21.528  14.945  1.00 18.43 ? 96  CYS A N   1 
ATOM   682  C CA  . CYS A 1 96  ? 23.543 20.349  14.083  1.00 18.82 ? 96  CYS A CA  1 
ATOM   683  C C   . CYS A 1 96  ? 22.179 19.690  13.905  1.00 18.56 ? 96  CYS A C   1 
ATOM   684  O O   . CYS A 1 96  ? 21.488 19.428  14.888  1.00 17.78 ? 96  CYS A O   1 
ATOM   685  C CB  . CYS A 1 96  ? 24.532 19.338  14.684  1.00 18.63 ? 96  CYS A CB  1 
ATOM   686  S SG  . CYS A 1 96  ? 26.196 19.973  14.730  1.00 21.64 ? 96  CYS A SG  1 
ATOM   687  N N   . SER A 1 97  ? 21.783 19.463  12.656  1.00 17.98 ? 97  SER A N   1 
ATOM   688  C CA  . SER A 1 97  ? 20.500 18.820  12.354  1.00 18.81 ? 97  SER A CA  1 
ATOM   689  C C   . SER A 1 97  ? 20.590 17.313  12.472  1.00 18.68 ? 97  SER A C   1 
ATOM   690  O O   . SER A 1 97  ? 19.569 16.635  12.403  1.00 19.27 ? 97  SER A O   1 
ATOM   691  C CB  . SER A 1 97  ? 20.084 19.143  10.913  1.00 18.76 ? 97  SER A CB  1 
ATOM   692  O OG  . SER A 1 97  ? 20.987 18.462  10.042  1.00 21.93 ? 97  SER A OG  1 
ATOM   693  N N   . SER A 1 98  ? 21.812 16.797  12.628  1.00 18.80 ? 98  SER A N   1 
ATOM   694  C CA  . SER A 1 98  ? 22.121 15.375  12.474  1.00 19.58 ? 98  SER A CA  1 
ATOM   695  C C   . SER A 1 98  ? 23.227 14.936  13.430  1.00 19.47 ? 98  SER A C   1 
ATOM   696  O O   . SER A 1 98  ? 23.968 15.776  13.937  1.00 19.53 ? 98  SER A O   1 
ATOM   697  C CB  . SER A 1 98  ? 22.601 15.122  11.045  1.00 19.57 ? 98  SER A CB  1 
ATOM   698  O OG  . SER A 1 98  ? 21.572 15.419  10.124  1.00 22.07 ? 98  SER A OG  1 
ATOM   699  N N   . THR A 1 99  ? 23.314 13.627  13.668  1.00 19.45 ? 99  THR A N   1 
ATOM   700  C CA  . THR A 1 99  ? 24.407 12.989  14.418  1.00 19.04 ? 99  THR A CA  1 
ATOM   701  C C   . THR A 1 99  ? 25.379 12.379  13.410  1.00 19.08 ? 99  THR A C   1 
ATOM   702  O O   . THR A 1 99  ? 24.949 11.798  12.410  1.00 18.65 ? 99  THR A O   1 
ATOM   703  C CB  . THR A 1 99  ? 23.852 11.868  15.329  1.00 19.66 ? 99  THR A CB  1 
ATOM   704  O OG1 . THR A 1 99  ? 22.900 12.421  16.245  1.00 19.60 ? 99  THR A OG1 1 
ATOM   705  C CG2 . THR A 1 99  ? 24.970 11.139  16.102  1.00 19.05 ? 99  THR A CG2 1 
ATOM   706  N N   . ALA A 1 100 ? 26.680 12.508  13.664  1.00 18.31 ? 100 ALA A N   1 
ATOM   707  C CA  . ALA A 1 100 ? 27.697 11.941  12.796  1.00 18.44 ? 100 ALA A CA  1 
ATOM   708  C C   . ALA A 1 100 ? 28.375 10.795  13.535  1.00 19.08 ? 100 ALA A C   1 
ATOM   709  O O   . ALA A 1 100 ? 28.930 11.017  14.626  1.00 19.04 ? 100 ALA A O   1 
ATOM   710  C CB  . ALA A 1 100 ? 28.724 13.004  12.442  1.00 18.63 ? 100 ALA A CB  1 
ATOM   711  N N   . ILE A 1 101 ? 28.310 9.597   12.948  1.00 18.36 ? 101 ILE A N   1 
ATOM   712  C CA  . ILE A 1 101 ? 28.817 8.353   13.569  1.00 19.16 ? 101 ILE A CA  1 
ATOM   713  C C   . ILE A 1 101 ? 29.782 7.669   12.597  1.00 18.83 ? 101 ILE A C   1 
ATOM   714  O O   . ILE A 1 101 ? 29.481 7.534   11.412  1.00 18.23 ? 101 ILE A O   1 
ATOM   715  C CB  . ILE A 1 101 ? 27.665 7.366   13.937  1.00 18.81 ? 101 ILE A CB  1 
ATOM   716  C CG1 . ILE A 1 101 ? 26.717 7.993   14.970  1.00 19.43 ? 101 ILE A CG1 1 
ATOM   717  C CG2 . ILE A 1 101 ? 28.228 6.044   14.511  1.00 20.22 ? 101 ILE A CG2 1 
ATOM   718  C CD1 . ILE A 1 101 ? 25.416 7.252   15.138  1.00 19.65 ? 101 ILE A CD1 1 
ATOM   719  N N   . ALA A 1 102 ? 30.938 7.240   13.097  1.00 19.40 ? 102 ALA A N   1 
ATOM   720  C CA  . ALA A 1 102 ? 31.911 6.521   12.267  1.00 19.58 ? 102 ALA A CA  1 
ATOM   721  C C   . ALA A 1 102 ? 31.437 5.097   11.885  1.00 20.34 ? 102 ALA A C   1 
ATOM   722  O O   . ALA A 1 102 ? 31.014 4.307   12.736  1.00 19.70 ? 102 ALA A O   1 
ATOM   723  C CB  . ALA A 1 102 ? 33.292 6.490   12.968  1.00 21.10 ? 102 ALA A CB  1 
ATOM   724  N N   . VAL A 1 103 ? 31.506 4.799   10.592  1.00 21.01 ? 103 VAL A N   1 
ATOM   725  C CA  . VAL A 1 103 ? 31.113 3.499   10.015  1.00 22.55 ? 103 VAL A CA  1 
ATOM   726  C C   . VAL A 1 103 ? 32.291 2.530   10.142  1.00 23.23 ? 103 VAL A C   1 
ATOM   727  O O   . VAL A 1 103 ? 32.106 1.301   10.185  1.00 23.36 ? 103 VAL A O   1 
ATOM   728  C CB  . VAL A 1 103 ? 30.699 3.678   8.518   1.00 22.08 ? 103 VAL A CB  1 
ATOM   729  C CG1 . VAL A 1 103 ? 30.657 2.335   7.730   1.00 23.48 ? 103 VAL A CG1 1 
ATOM   730  C CG2 . VAL A 1 103 ? 29.368 4.406   8.424   1.00 23.19 ? 103 VAL A CG2 1 
ATOM   731  N N   . GLU A 1 104 ? 33.494 3.106   10.189  1.00 23.76 ? 104 GLU A N   1 
ATOM   732  C CA  . GLU A 1 104 ? 34.747 2.378   10.432  1.00 24.40 ? 104 GLU A CA  1 
ATOM   733  C C   . GLU A 1 104 ? 35.690 3.305   11.200  1.00 23.59 ? 104 GLU A C   1 
ATOM   734  O O   . GLU A 1 104 ? 35.441 4.521   11.261  1.00 23.57 ? 104 GLU A O   1 
ATOM   735  C CB  . GLU A 1 104 ? 35.379 1.923   9.108   1.00 24.68 ? 104 GLU A CB  1 
ATOM   736  C CG  . GLU A 1 104 ? 36.119 3.004   8.323   1.00 25.50 ? 104 GLU A CG  1 
ATOM   737  C CD  . GLU A 1 104 ? 36.491 2.579   6.894   1.00 27.61 ? 104 GLU A CD  1 
ATOM   738  O OE1 . GLU A 1 104 ? 35.934 1.587   6.385   1.00 31.64 ? 104 GLU A OE1 1 
ATOM   739  O OE2 . GLU A 1 104 ? 37.355 3.236   6.272   1.00 31.10 ? 104 GLU A OE2 1 
ATOM   740  N N   . ASN A 1 105 ? 36.755 2.749   11.791  1.00 22.64 ? 105 ASN A N   1 
ATOM   741  C CA  . ASN A 1 105 ? 37.824 3.571   12.365  1.00 22.04 ? 105 ASN A CA  1 
ATOM   742  C C   . ASN A 1 105 ? 38.231 4.621   11.338  1.00 21.91 ? 105 ASN A C   1 
ATOM   743  O O   . ASN A 1 105 ? 38.560 4.278   10.196  1.00 21.28 ? 105 ASN A O   1 
ATOM   744  C CB  . ASN A 1 105 ? 39.062 2.737   12.734  1.00 21.97 ? 105 ASN A CB  1 
ATOM   745  C CG  . ASN A 1 105 ? 38.860 1.875   13.966  1.00 22.58 ? 105 ASN A CG  1 
ATOM   746  O OD1 . ASN A 1 105 ? 37.781 1.855   14.571  1.00 21.99 ? 105 ASN A OD1 1 
ATOM   747  N ND2 . ASN A 1 105 ? 39.916 1.138   14.343  1.00 22.02 ? 105 ASN A ND2 1 
ATOM   748  N N   . SER A 1 106 ? 38.187 5.887   11.750  1.00 21.50 ? 106 SER A N   1 
ATOM   749  C CA  . SER A 1 106 ? 38.409 7.011   10.853  1.00 21.13 ? 106 SER A CA  1 
ATOM   750  C C   . SER A 1 106 ? 39.425 7.980   11.443  1.00 21.03 ? 106 SER A C   1 
ATOM   751  O O   . SER A 1 106 ? 39.560 8.091   12.663  1.00 21.09 ? 106 SER A O   1 
ATOM   752  C CB  . SER A 1 106 ? 37.095 7.763   10.597  1.00 20.93 ? 106 SER A CB  1 
ATOM   753  O OG  . SER A 1 106 ? 36.113 6.912   10.037  1.00 21.71 ? 106 SER A OG  1 
ATOM   754  N N   . LYS A 1 107 ? 40.111 8.693   10.559  1.00 21.03 ? 107 LYS A N   1 
ATOM   755  C CA  . LYS A 1 107 ? 41.048 9.736   10.938  1.00 21.41 ? 107 LYS A CA  1 
ATOM   756  C C   . LYS A 1 107 ? 40.383 11.057  10.584  1.00 21.17 ? 107 LYS A C   1 
ATOM   757  O O   . LYS A 1 107 ? 40.209 11.369  9.408   1.00 20.79 ? 107 LYS A O   1 
ATOM   758  C CB  . LYS A 1 107 ? 42.361 9.577   10.165  1.00 22.28 ? 107 LYS A CB  1 
ATOM   759  C CG  . LYS A 1 107 ? 43.155 8.326   10.527  1.00 24.57 ? 107 LYS A CG  1 
ATOM   760  C CD  . LYS A 1 107 ? 44.516 8.357   9.844   1.00 28.57 ? 107 LYS A CD  1 
ATOM   761  C CE  . LYS A 1 107 ? 45.362 7.166   10.254  1.00 32.10 ? 107 LYS A CE  1 
ATOM   762  N NZ  . LYS A 1 107 ? 44.868 5.920   9.628   1.00 34.40 ? 107 LYS A NZ  1 
ATOM   763  N N   . VAL A 1 108 ? 39.958 11.795  11.604  1.00 20.87 ? 108 VAL A N   1 
ATOM   764  C CA  . VAL A 1 108 ? 39.215 13.040  11.397  1.00 21.37 ? 108 VAL A CA  1 
ATOM   765  C C   . VAL A 1 108 ? 40.063 14.192  11.899  1.00 22.05 ? 108 VAL A C   1 
ATOM   766  O O   . VAL A 1 108 ? 40.706 14.077  12.948  1.00 22.59 ? 108 VAL A O   1 
ATOM   767  C CB  . VAL A 1 108 ? 37.849 13.003  12.140  1.00 21.27 ? 108 VAL A CB  1 
ATOM   768  C CG1 . VAL A 1 108 ? 37.106 14.337  12.044  1.00 21.16 ? 108 VAL A CG1 1 
ATOM   769  C CG2 . VAL A 1 108 ? 36.981 11.854  11.594  1.00 21.50 ? 108 VAL A CG2 1 
ATOM   770  N N   . LEU A 1 109 ? 40.081 15.286  11.140  1.00 21.76 ? 109 LEU A N   1 
ATOM   771  C CA  . LEU A 1 109 ? 40.738 16.525  11.576  1.00 22.44 ? 109 LEU A CA  1 
ATOM   772  C C   . LEU A 1 109 ? 39.696 17.581  11.957  1.00 22.88 ? 109 LEU A C   1 
ATOM   773  O O   . LEU A 1 109 ? 38.786 17.852  11.170  1.00 22.71 ? 109 LEU A O   1 
ATOM   774  C CB  . LEU A 1 109 ? 41.682 17.034  10.475  1.00 22.25 ? 109 LEU A CB  1 
ATOM   775  C CG  . LEU A 1 109 ? 42.849 16.045  10.267  1.00 24.15 ? 109 LEU A CG  1 
ATOM   776  C CD1 . LEU A 1 109 ? 43.507 16.182  8.903   1.00 24.06 ? 109 LEU A CD1 1 
ATOM   777  C CD2 . LEU A 1 109 ? 43.890 16.168  11.415  1.00 24.37 ? 109 LEU A CD2 1 
ATOM   778  N N   . ALA A 1 110 ? 39.831 18.164  13.154  1.00 22.63 ? 110 ALA A N   1 
ATOM   779  C CA  . ALA A 1 110 ? 38.930 19.221  13.622  1.00 23.29 ? 110 ALA A CA  1 
ATOM   780  C C   . ALA A 1 110 ? 39.542 20.620  13.506  1.00 23.94 ? 110 ALA A C   1 
ATOM   781  O O   . ALA A 1 110 ? 40.689 20.867  13.947  1.00 23.92 ? 110 ALA A O   1 
ATOM   782  C CB  . ALA A 1 110 ? 38.479 18.951  15.058  1.00 23.48 ? 110 ALA A CB  1 
ATOM   783  N N   . ILE A 1 111 ? 38.789 21.519  12.870  1.00 23.91 ? 111 ILE A N   1 
ATOM   784  C CA  . ILE A 1 111 ? 39.197 22.913  12.734  1.00 23.43 ? 111 ILE A CA  1 
ATOM   785  C C   . ILE A 1 111 ? 38.193 23.802  13.482  1.00 23.56 ? 111 ILE A C   1 
ATOM   786  O O   . ILE A 1 111 ? 37.025 23.895  13.083  1.00 23.43 ? 111 ILE A O   1 
ATOM   787  C CB  . ILE A 1 111 ? 39.332 23.384  11.266  1.00 23.26 ? 111 ILE A CB  1 
ATOM   788  C CG1 . ILE A 1 111 ? 40.085 22.376  10.373  1.00 24.56 ? 111 ILE A CG1 1 
ATOM   789  C CG2 . ILE A 1 111 ? 40.058 24.749  11.218  1.00 22.54 ? 111 ILE A CG2 1 
ATOM   790  C CD1 . ILE A 1 111 ? 39.245 21.177  9.897   1.00 26.77 ? 111 ILE A CD1 1 
ATOM   791  N N   . PRO A 1 112 ? 38.647 24.477  14.560  1.00 23.74 ? 112 PRO A N   1 
ATOM   792  C CA  . PRO A 1 112 ? 37.798 25.371  15.349  1.00 23.21 ? 112 PRO A CA  1 
ATOM   793  C C   . PRO A 1 112 ? 37.116 26.427  14.464  1.00 23.24 ? 112 PRO A C   1 
ATOM   794  O O   . PRO A 1 112 ? 37.751 26.973  13.549  1.00 22.43 ? 112 PRO A O   1 
ATOM   795  C CB  . PRO A 1 112 ? 38.800 26.048  16.301  1.00 23.93 ? 112 PRO A CB  1 
ATOM   796  C CG  . PRO A 1 112 ? 39.909 25.037  16.442  1.00 23.97 ? 112 PRO A CG  1 
ATOM   797  C CD  . PRO A 1 112 ? 40.037 24.456  15.063  1.00 24.26 ? 112 PRO A CD  1 
ATOM   798  N N   . VAL A 1 113 ? 35.832 26.686  14.716  1.00 22.97 ? 113 VAL A N   1 
ATOM   799  C CA  . VAL A 1 113 ? 35.064 27.637  13.899  1.00 23.68 ? 113 VAL A CA  1 
ATOM   800  C C   . VAL A 1 113 ? 35.706 29.033  13.892  1.00 23.84 ? 113 VAL A C   1 
ATOM   801  O O   . VAL A 1 113 ? 35.649 29.731  12.896  1.00 23.32 ? 113 VAL A O   1 
ATOM   802  C CB  . VAL A 1 113 ? 33.554 27.716  14.308  1.00 23.54 ? 113 VAL A CB  1 
ATOM   803  C CG1 . VAL A 1 113 ? 32.831 26.424  13.960  1.00 24.04 ? 113 VAL A CG1 1 
ATOM   804  C CG2 . VAL A 1 113 ? 33.388 28.066  15.796  1.00 23.84 ? 113 VAL A CG2 1 
ATOM   805  N N   . GLU A 1 114 ? 36.341 29.414  15.002  1.00 25.26 ? 114 GLU A N   1 
ATOM   806  C CA  . GLU A 1 114 ? 37.084 30.685  15.079  1.00 26.16 ? 114 GLU A CA  1 
ATOM   807  C C   . GLU A 1 114 ? 38.199 30.750  14.038  1.00 26.18 ? 114 GLU A C   1 
ATOM   808  O O   . GLU A 1 114 ? 38.356 31.768  13.354  1.00 26.65 ? 114 GLU A O   1 
ATOM   809  C CB  . GLU A 1 114 ? 37.649 30.912  16.489  1.00 26.89 ? 114 GLU A CB  1 
ATOM   810  C CG  . GLU A 1 114 ? 36.574 31.065  17.572  1.00 29.62 ? 114 GLU A CG  1 
ATOM   811  C CD  . GLU A 1 114 ? 36.027 29.726  18.086  1.00 33.42 ? 114 GLU A CD  1 
ATOM   812  O OE1 . GLU A 1 114 ? 36.538 28.643  17.695  1.00 32.23 ? 114 GLU A OE1 1 
ATOM   813  O OE2 . GLU A 1 114 ? 35.067 29.763  18.887  1.00 35.54 ? 114 GLU A OE2 1 
ATOM   814  N N   . ALA A 1 115 ? 38.961 29.663  13.904  1.00 26.05 ? 115 ALA A N   1 
ATOM   815  C CA  . ALA A 1 115 ? 39.998 29.579  12.872  1.00 26.04 ? 115 ALA A CA  1 
ATOM   816  C C   . ALA A 1 115 ? 39.383 29.595  11.464  1.00 25.93 ? 115 ALA A C   1 
ATOM   817  O O   . ALA A 1 115 ? 39.883 30.283  10.571  1.00 26.01 ? 115 ALA A O   1 
ATOM   818  C CB  . ALA A 1 115 ? 40.841 28.327  13.057  1.00 26.38 ? 115 ALA A CB  1 
ATOM   819  N N   . ILE A 1 116 ? 38.309 28.823  11.273  1.00 25.23 ? 116 ILE A N   1 
ATOM   820  C CA  . ILE A 1 116 ? 37.592 28.806  9.982   1.00 24.49 ? 116 ILE A CA  1 
ATOM   821  C C   . ILE A 1 116 ? 37.161 30.212  9.593   1.00 24.96 ? 116 ILE A C   1 
ATOM   822  O O   . ILE A 1 116 ? 37.386 30.644  8.461   1.00 24.77 ? 116 ILE A O   1 
ATOM   823  C CB  . ILE A 1 116 ? 36.362 27.854  9.997   1.00 24.00 ? 116 ILE A CB  1 
ATOM   824  C CG1 . ILE A 1 116 ? 36.803 26.382  10.060  1.00 22.79 ? 116 ILE A CG1 1 
ATOM   825  C CG2 . ILE A 1 116 ? 35.475 28.091  8.770   1.00 23.83 ? 116 ILE A CG2 1 
ATOM   826  C CD1 . ILE A 1 116 ? 37.629 25.900  8.843   1.00 20.69 ? 116 ILE A CD1 1 
ATOM   827  N N   . GLU A 1 117 ? 36.550 30.923  10.539  1.00 25.39 ? 117 GLU A N   1 
ATOM   828  C CA  . GLU A 1 117 ? 36.045 32.273  10.272  1.00 27.07 ? 117 GLU A CA  1 
ATOM   829  C C   . GLU A 1 117 ? 37.138 33.271  9.880   1.00 26.95 ? 117 GLU A C   1 
ATOM   830  O O   . GLU A 1 117 ? 36.948 34.069  8.953   1.00 26.87 ? 117 GLU A O   1 
ATOM   831  C CB  . GLU A 1 117 ? 35.244 32.807  11.458  1.00 27.18 ? 117 GLU A CB  1 
ATOM   832  C CG  . GLU A 1 117 ? 34.228 33.866  11.042  1.00 32.03 ? 117 GLU A CG  1 
ATOM   833  C CD  . GLU A 1 117 ? 33.643 34.625  12.216  1.00 36.67 ? 117 GLU A CD  1 
ATOM   834  O OE1 . GLU A 1 117 ? 34.306 34.715  13.276  1.00 40.02 ? 117 GLU A OE1 1 
ATOM   835  O OE2 . GLU A 1 117 ? 32.518 35.152  12.070  1.00 40.46 ? 117 GLU A OE2 1 
ATOM   836  N N   . ALA A 1 118 ? 38.274 33.229  10.579  1.00 27.43 ? 118 ALA A N   1 
ATOM   837  C CA  . ALA A 1 118 ? 39.423 34.086  10.235  1.00 27.11 ? 118 ALA A CA  1 
ATOM   838  C C   . ALA A 1 118 ? 39.894 33.822  8.811   1.00 27.27 ? 118 ALA A C   1 
ATOM   839  O O   . ALA A 1 118 ? 40.179 34.751  8.053   1.00 27.16 ? 118 ALA A O   1 
ATOM   840  C CB  . ALA A 1 118 ? 40.568 33.866  11.207  1.00 27.37 ? 118 ALA A CB  1 
ATOM   841  N N   . LEU A 1 119 ? 39.974 32.546  8.452   1.00 26.88 ? 119 LEU A N   1 
ATOM   842  C CA  . LEU A 1 119 ? 40.428 32.152  7.129   1.00 27.06 ? 119 LEU A CA  1 
ATOM   843  C C   . LEU A 1 119 ? 39.462 32.618  6.040   1.00 26.96 ? 119 LEU A C   1 
ATOM   844  O O   . LEU A 1 119 ? 39.896 33.175  5.029   1.00 27.29 ? 119 LEU A O   1 
ATOM   845  C CB  . LEU A 1 119 ? 40.640 30.633  7.063   1.00 26.96 ? 119 LEU A CB  1 
ATOM   846  C CG  . LEU A 1 119 ? 41.832 30.079  7.849   1.00 28.01 ? 119 LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 119 ? 41.746 28.560  7.952   1.00 27.06 ? 119 LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 119 ? 43.156 30.512  7.201   1.00 28.04 ? 119 LEU A CD2 1 
ATOM   849  N N   . LEU A 1 120 ? 38.162 32.394  6.247   1.00 27.08 ? 120 LEU A N   1 
ATOM   850  C CA  . LEU A 1 120 ? 37.130 32.857  5.307   1.00 26.79 ? 120 LEU A CA  1 
ATOM   851  C C   . LEU A 1 120 ? 37.145 34.384  5.093   1.00 27.56 ? 120 LEU A C   1 
ATOM   852  O O   . LEU A 1 120 ? 36.987 34.868  3.967   1.00 26.92 ? 120 LEU A O   1 
ATOM   853  C CB  . LEU A 1 120 ? 35.739 32.422  5.781   1.00 26.91 ? 120 LEU A CB  1 
ATOM   854  C CG  . LEU A 1 120 ? 35.354 30.932  5.747   1.00 26.18 ? 120 LEU A CG  1 
ATOM   855  C CD1 . LEU A 1 120 ? 34.154 30.690  6.641   1.00 24.61 ? 120 LEU A CD1 1 
ATOM   856  C CD2 . LEU A 1 120 ? 35.069 30.473  4.331   1.00 25.79 ? 120 LEU A CD2 1 
ATOM   857  N N   . LYS A 1 121 ? 37.326 35.136  6.177   1.00 28.13 ? 121 LYS A N   1 
ATOM   858  C CA  . LYS A 1 121 ? 37.358 36.605  6.109   1.00 28.70 ? 121 LYS A CA  1 
ATOM   859  C C   . LYS A 1 121 ? 38.450 37.170  5.196   1.00 28.78 ? 121 LYS A C   1 
ATOM   860  O O   . LYS A 1 121 ? 38.269 38.225  4.580   1.00 28.90 ? 121 LYS A O   1 
ATOM   861  C CB  . LYS A 1 121 ? 37.500 37.200  7.499   1.00 28.91 ? 121 LYS A CB  1 
ATOM   862  C CG  . LYS A 1 121 ? 36.230 37.156  8.315   1.00 31.85 ? 121 LYS A CG  1 
ATOM   863  C CD  . LYS A 1 121 ? 36.374 38.050  9.537   1.00 36.07 ? 121 LYS A CD  1 
ATOM   864  C CE  . LYS A 1 121 ? 35.464 37.587  10.667  1.00 39.25 ? 121 LYS A CE  1 
ATOM   865  N NZ  . LYS A 1 121 ? 34.011 37.545  10.273  1.00 40.96 ? 121 LYS A NZ  1 
ATOM   866  N N   . GLY A 1 122 ? 39.576 36.472  5.109   1.00 28.70 ? 122 GLY A N   1 
ATOM   867  C CA  . GLY A 1 122 ? 40.709 36.978  4.357   1.00 28.11 ? 122 GLY A CA  1 
ATOM   868  C C   . GLY A 1 122 ? 40.908 36.389  2.982   1.00 28.04 ? 122 GLY A C   1 
ATOM   869  O O   . GLY A 1 122 ? 41.783 36.843  2.246   1.00 28.44 ? 122 GLY A O   1 
ATOM   870  N N   . ASN A 1 123 ? 40.096 35.396  2.612   1.00 27.22 ? 123 ASN A N   1 
ATOM   871  C CA  . ASN A 1 123 ? 40.409 34.562  1.459   1.00 26.63 ? 123 ASN A CA  1 
ATOM   872  C C   . ASN A 1 123 ? 39.159 34.151  0.665   1.00 26.29 ? 123 ASN A C   1 
ATOM   873  O O   . ASN A 1 123 ? 38.459 33.216  1.055   1.00 25.65 ? 123 ASN A O   1 
ATOM   874  C CB  . ASN A 1 123 ? 41.191 33.324  1.943   1.00 26.61 ? 123 ASN A CB  1 
ATOM   875  C CG  . ASN A 1 123 ? 41.864 32.561  0.815   1.00 26.75 ? 123 ASN A CG  1 
ATOM   876  O OD1 . ASN A 1 123 ? 41.291 32.361  -0.252  1.00 27.73 ? 123 ASN A OD1 1 
ATOM   877  N ND2 . ASN A 1 123 ? 43.084 32.126  1.057   1.00 27.57 ? 123 ASN A ND2 1 
ATOM   878  N N   . THR A 1 124 ? 38.885 34.840  -0.449  1.00 25.73 ? 124 THR A N   1 
ATOM   879  C CA  . THR A 1 124 ? 37.708 34.495  -1.272  1.00 25.57 ? 124 THR A CA  1 
ATOM   880  C C   . THR A 1 124 ? 37.796 33.097  -1.915  1.00 25.33 ? 124 THR A C   1 
ATOM   881  O O   . THR A 1 124 ? 36.766 32.444  -2.099  1.00 24.97 ? 124 THR A O   1 
ATOM   882  C CB  . THR A 1 124 ? 37.396 35.541  -2.364  1.00 25.44 ? 124 THR A CB  1 
ATOM   883  O OG1 . THR A 1 124 ? 38.509 35.663  -3.255  1.00 25.52 ? 124 THR A OG1 1 
ATOM   884  C CG2 . THR A 1 124 ? 37.064 36.898  -1.739  1.00 24.70 ? 124 THR A CG2 1 
ATOM   885  N N   . SER A 1 125 ? 39.009 32.650  -2.256  1.00 24.49 ? 125 SER A N   1 
ATOM   886  C CA  . SER A 1 125 ? 39.229 31.284  -2.777  1.00 24.42 ? 125 SER A CA  1 
ATOM   887  C C   . SER A 1 125 ? 38.777 30.201  -1.800  1.00 22.95 ? 125 SER A C   1 
ATOM   888  O O   . SER A 1 125 ? 38.184 29.194  -2.197  1.00 21.95 ? 125 SER A O   1 
ATOM   889  C CB  . SER A 1 125 ? 40.702 31.051  -3.093  1.00 24.31 ? 125 SER A CB  1 
ATOM   890  O OG  . SER A 1 125 ? 41.025 31.627  -4.325  1.00 28.01 ? 125 SER A OG  1 
ATOM   891  N N   . PHE A 1 126 ? 39.112 30.406  -0.534  1.00 22.71 ? 126 PHE A N   1 
ATOM   892  C CA  . PHE A 1 126 ? 38.685 29.544  0.577   1.00 22.25 ? 126 PHE A CA  1 
ATOM   893  C C   . PHE A 1 126 ? 37.154 29.562  0.679   1.00 21.92 ? 126 PHE A C   1 
ATOM   894  O O   . PHE A 1 126 ? 36.525 28.524  0.818   1.00 21.76 ? 126 PHE A O   1 
ATOM   895  C CB  . PHE A 1 126 ? 39.327 30.046  1.873   1.00 22.42 ? 126 PHE A CB  1 
ATOM   896  C CG  . PHE A 1 126 ? 39.213 29.090  3.057   1.00 22.88 ? 126 PHE A CG  1 
ATOM   897  C CD1 . PHE A 1 126 ? 39.916 27.893  3.082   1.00 24.81 ? 126 PHE A CD1 1 
ATOM   898  C CD2 . PHE A 1 126 ? 38.450 29.428  4.165   1.00 23.19 ? 126 PHE A CD2 1 
ATOM   899  C CE1 . PHE A 1 126 ? 39.825 27.019  4.185   1.00 25.03 ? 126 PHE A CE1 1 
ATOM   900  C CE2 . PHE A 1 126 ? 38.354 28.573  5.262   1.00 23.53 ? 126 PHE A CE2 1 
ATOM   901  C CZ  . PHE A 1 126 ? 39.051 27.362  5.271   1.00 24.14 ? 126 PHE A CZ  1 
ATOM   902  N N   . CYS A 1 127 ? 36.558 30.750  0.613   1.00 21.84 ? 127 CYS A N   1 
ATOM   903  C CA  . CYS A 1 127 ? 35.090 30.872  0.599   1.00 21.85 ? 127 CYS A CA  1 
ATOM   904  C C   . CYS A 1 127 ? 34.480 30.094  -0.563  1.00 21.42 ? 127 CYS A C   1 
ATOM   905  O O   . CYS A 1 127 ? 33.509 29.350  -0.392  1.00 20.07 ? 127 CYS A O   1 
ATOM   906  C CB  . CYS A 1 127 ? 34.685 32.335  0.475   1.00 21.61 ? 127 CYS A CB  1 
ATOM   907  S SG  . CYS A 1 127 ? 35.078 33.320  1.898   1.00 25.38 ? 127 CYS A SG  1 
ATOM   908  N N   . ARG A 1 128 ? 35.067 30.260  -1.745  1.00 21.19 ? 128 ARG A N   1 
ATOM   909  C CA  . ARG A 1 128 ? 34.495 29.685  -2.961  1.00 21.80 ? 128 ARG A CA  1 
ATOM   910  C C   . ARG A 1 128 ? 34.622 28.159  -3.024  1.00 21.46 ? 128 ARG A C   1 
ATOM   911  O O   . ARG A 1 128 ? 33.796 27.477  -3.663  1.00 21.18 ? 128 ARG A O   1 
ATOM   912  C CB  . ARG A 1 128 ? 35.057 30.382  -4.192  1.00 22.76 ? 128 ARG A CB  1 
ATOM   913  C CG  . ARG A 1 128 ? 34.555 31.828  -4.299  1.00 23.52 ? 128 ARG A CG  1 
ATOM   914  C CD  . ARG A 1 128 ? 35.337 32.640  -5.289  1.00 27.28 ? 128 ARG A CD  1 
ATOM   915  N NE  . ARG A 1 128 ? 35.111 32.141  -6.637  1.00 32.25 ? 128 ARG A NE  1 
ATOM   916  C CZ  . ARG A 1 128 ? 35.966 32.274  -7.640  1.00 34.57 ? 128 ARG A CZ  1 
ATOM   917  N NH1 . ARG A 1 128 ? 37.119 32.912  -7.448  1.00 36.94 ? 128 ARG A NH1 1 
ATOM   918  N NH2 . ARG A 1 128 ? 35.670 31.769  -8.835  1.00 35.24 ? 128 ARG A NH2 1 
ATOM   919  N N   . TYR A 1 129 ? 35.640 27.629  -2.350  1.00 20.94 ? 129 TYR A N   1 
ATOM   920  C CA  . TYR A 1 129 ? 35.766 26.186  -2.162  1.00 20.71 ? 129 TYR A CA  1 
ATOM   921  C C   . TYR A 1 129 ? 34.519 25.645  -1.437  1.00 19.54 ? 129 TYR A C   1 
ATOM   922  O O   . TYR A 1 129 ? 33.943 24.649  -1.859  1.00 18.14 ? 129 TYR A O   1 
ATOM   923  C CB  . TYR A 1 129 ? 37.044 25.828  -1.383  1.00 21.92 ? 129 TYR A CB  1 
ATOM   924  C CG  . TYR A 1 129 ? 37.071 24.380  -0.898  1.00 23.82 ? 129 TYR A CG  1 
ATOM   925  C CD1 . TYR A 1 129 ? 37.649 23.367  -1.664  1.00 25.31 ? 129 TYR A CD1 1 
ATOM   926  C CD2 . TYR A 1 129 ? 36.501 24.029  0.323   1.00 24.96 ? 129 TYR A CD2 1 
ATOM   927  C CE1 . TYR A 1 129 ? 37.667 22.021  -1.203  1.00 25.36 ? 129 TYR A CE1 1 
ATOM   928  C CE2 . TYR A 1 129 ? 36.507 22.711  0.779   1.00 26.57 ? 129 TYR A CE2 1 
ATOM   929  C CZ  . TYR A 1 129 ? 37.094 21.718  0.019   1.00 26.73 ? 129 TYR A CZ  1 
ATOM   930  O OH  . TYR A 1 129 ? 37.087 20.415  0.510   1.00 28.23 ? 129 TYR A OH  1 
ATOM   931  N N   . PHE A 1 130 ? 34.114 26.306  -0.353  1.00 19.07 ? 130 PHE A N   1 
ATOM   932  C CA  . PHE A 1 130 ? 32.959 25.832  0.424   1.00 18.58 ? 130 PHE A CA  1 
ATOM   933  C C   . PHE A 1 130 ? 31.641 26.096  -0.285  1.00 18.33 ? 130 PHE A C   1 
ATOM   934  O O   . PHE A 1 130 ? 30.693 25.331  -0.127  1.00 17.85 ? 130 PHE A O   1 
ATOM   935  C CB  . PHE A 1 130 ? 32.952 26.417  1.831   1.00 19.75 ? 130 PHE A CB  1 
ATOM   936  C CG  . PHE A 1 130 ? 33.997 25.824  2.712   1.00 20.75 ? 130 PHE A CG  1 
ATOM   937  C CD1 . PHE A 1 130 ? 33.889 24.496  3.135   1.00 21.25 ? 130 PHE A CD1 1 
ATOM   938  C CD2 . PHE A 1 130 ? 35.108 26.564  3.091   1.00 22.22 ? 130 PHE A CD2 1 
ATOM   939  C CE1 . PHE A 1 130 ? 34.865 23.922  3.946   1.00 22.21 ? 130 PHE A CE1 1 
ATOM   940  C CE2 . PHE A 1 130 ? 36.096 25.988  3.909   1.00 23.81 ? 130 PHE A CE2 1 
ATOM   941  C CZ  . PHE A 1 130 ? 35.966 24.665  4.332   1.00 22.14 ? 130 PHE A CZ  1 
ATOM   942  N N   . LEU A 1 131 ? 31.586 27.185  -1.055  1.00 17.30 ? 131 LEU A N   1 
ATOM   943  C CA  . LEU A 1 131 ? 30.426 27.491  -1.888  1.00 16.79 ? 131 LEU A CA  1 
ATOM   944  C C   . LEU A 1 131 ? 30.152 26.331  -2.848  1.00 17.29 ? 131 LEU A C   1 
ATOM   945  O O   . LEU A 1 131 ? 29.023 25.866  -2.950  1.00 16.37 ? 131 LEU A O   1 
ATOM   946  C CB  . LEU A 1 131 ? 30.665 28.786  -2.668  1.00 17.24 ? 131 LEU A CB  1 
ATOM   947  C CG  . LEU A 1 131 ? 30.416 30.089  -1.901  1.00 16.41 ? 131 LEU A CG  1 
ATOM   948  C CD1 . LEU A 1 131 ? 30.956 31.286  -2.677  1.00 17.33 ? 131 LEU A CD1 1 
ATOM   949  C CD2 . LEU A 1 131 ? 28.920 30.249  -1.607  1.00 17.47 ? 131 LEU A CD2 1 
ATOM   950  N N   . LYS A 1 132 ? 31.200 25.859  -3.529  1.00 16.87 ? 132 LYS A N   1 
ATOM   951  C CA  . LYS A 1 132 ? 31.058 24.725  -4.427  1.00 17.95 ? 132 LYS A CA  1 
ATOM   952  C C   . LYS A 1 132 ? 30.653 23.467  -3.661  1.00 17.53 ? 132 LYS A C   1 
ATOM   953  O O   . LYS A 1 132 ? 29.764 22.730  -4.099  1.00 17.26 ? 132 LYS A O   1 
ATOM   954  C CB  . LYS A 1 132 ? 32.350 24.468  -5.218  1.00 17.64 ? 132 LYS A CB  1 
ATOM   955  C CG  . LYS A 1 132 ? 32.200 23.287  -6.178  1.00 19.77 ? 132 LYS A CG  1 
ATOM   956  C CD  . LYS A 1 132 ? 33.406 23.039  -7.054  1.00 20.33 ? 132 LYS A CD  1 
ATOM   957  C CE  . LYS A 1 132 ? 33.013 21.988  -8.110  1.00 23.35 ? 132 LYS A CE  1 
ATOM   958  N NZ  . LYS A 1 132 ? 33.921 21.920  -9.295  1.00 24.85 ? 132 LYS A NZ  1 
ATOM   959  N N   . ALA A 1 133 ? 31.299 23.225  -2.520  1.00 17.05 ? 133 ALA A N   1 
ATOM   960  C CA  . ALA A 1 133 ? 31.015 22.021  -1.730  1.00 17.06 ? 133 ALA A CA  1 
ATOM   961  C C   . ALA A 1 133 ? 29.549 21.993  -1.298  1.00 16.94 ? 133 ALA A C   1 
ATOM   962  O O   . ALA A 1 133 ? 28.862 20.967  -1.450  1.00 15.97 ? 133 ALA A O   1 
ATOM   963  C CB  . ALA A 1 133 ? 31.947 21.947  -0.511  1.00 16.88 ? 133 ALA A CB  1 
ATOM   964  N N   . LEU A 1 134 ? 29.054 23.125  -0.788  1.00 16.94 ? 134 LEU A N   1 
ATOM   965  C CA  . LEU A 1 134 ? 27.646 23.201  -0.383  1.00 17.05 ? 134 LEU A CA  1 
ATOM   966  C C   . LEU A 1 134 ? 26.683 23.073  -1.559  1.00 16.56 ? 134 LEU A C   1 
ATOM   967  O O   . LEU A 1 134 ? 25.631 22.439  -1.442  1.00 16.49 ? 134 LEU A O   1 
ATOM   968  C CB  . LEU A 1 134 ? 27.359 24.498  0.372   1.00 17.52 ? 134 LEU A CB  1 
ATOM   969  C CG  . LEU A 1 134 ? 27.907 24.636  1.792   1.00 18.08 ? 134 LEU A CG  1 
ATOM   970  C CD1 . LEU A 1 134 ? 27.824 26.113  2.209   1.00 19.05 ? 134 LEU A CD1 1 
ATOM   971  C CD2 . LEU A 1 134 ? 27.186 23.718  2.777   1.00 20.01 ? 134 LEU A CD2 1 
ATOM   972  N N   . ALA A 1 135 ? 27.032 23.673  -2.693  1.00 16.48 ? 135 ALA A N   1 
ATOM   973  C CA  . ALA A 1 135 ? 26.166 23.617  -3.861  1.00 15.80 ? 135 ALA A CA  1 
ATOM   974  C C   . ALA A 1 135 ? 26.076 22.187  -4.381  1.00 16.33 ? 135 ALA A C   1 
ATOM   975  O O   . ALA A 1 135 ? 24.984 21.738  -4.745  1.00 15.69 ? 135 ALA A O   1 
ATOM   976  C CB  . ALA A 1 135 ? 26.658 24.571  -4.953  1.00 16.32 ? 135 ALA A CB  1 
ATOM   977  N N   . LYS A 1 136 ? 27.210 21.480  -4.403  1.00 16.24 ? 136 LYS A N   1 
ATOM   978  C CA  . LYS A 1 136 ? 27.235 20.054  -4.757  1.00 17.48 ? 136 LYS A CA  1 
ATOM   979  C C   . LYS A 1 136 ? 26.327 19.220  -3.849  1.00 17.11 ? 136 LYS A C   1 
ATOM   980  O O   . LYS A 1 136 ? 25.537 18.408  -4.343  1.00 16.50 ? 136 LYS A O   1 
ATOM   981  C CB  . LYS A 1 136 ? 28.671 19.486  -4.726  1.00 18.17 ? 136 LYS A CB  1 
ATOM   982  C CG  . LYS A 1 136 ? 29.548 19.895  -5.929  1.00 20.63 ? 136 LYS A CG  1 
ATOM   983  C CD  . LYS A 1 136 ? 29.184 19.078  -7.147  1.00 23.87 ? 136 LYS A CD  1 
ATOM   984  C CE  . LYS A 1 136 ? 30.096 19.322  -8.334  1.00 24.25 ? 136 LYS A CE  1 
ATOM   985  N NZ  . LYS A 1 136 ? 29.432 18.679  -9.515  1.00 24.87 ? 136 LYS A NZ  1 
ATOM   986  N N   . GLU A 1 137 ? 26.464 19.420  -2.532  1.00 16.57 ? 137 GLU A N   1 
ATOM   987  C CA  . GLU A 1 137 ? 25.676 18.699  -1.527  1.00 17.22 ? 137 GLU A CA  1 
ATOM   988  C C   . GLU A 1 137 ? 24.194 18.975  -1.719  1.00 17.02 ? 137 GLU A C   1 
ATOM   989  O O   . GLU A 1 137 ? 23.370 18.057  -1.644  1.00 16.44 ? 137 GLU A O   1 
ATOM   990  C CB  . GLU A 1 137 ? 26.098 19.098  -0.107  1.00 18.01 ? 137 GLU A CB  1 
ATOM   991  C CG  . GLU A 1 137 ? 27.433 18.447  0.336   1.00 18.98 ? 137 GLU A CG  1 
ATOM   992  C CD  . GLU A 1 137 ? 27.402 16.925  0.228   1.00 21.50 ? 137 GLU A CD  1 
ATOM   993  O OE1 . GLU A 1 137 ? 26.498 16.278  0.816   1.00 22.80 ? 137 GLU A OE1 1 
ATOM   994  O OE2 . GLU A 1 137 ? 28.298 16.359  -0.428  1.00 22.52 ? 137 GLU A OE2 1 
ATOM   995  N N   . LEU A 1 138 ? 23.855 20.237  -1.989  1.00 16.43 ? 138 LEU A N   1 
ATOM   996  C CA  . LEU A 1 138 ? 22.451 20.587  -2.232  1.00 16.83 ? 138 LEU A CA  1 
ATOM   997  C C   . LEU A 1 138 ? 21.932 19.884  -3.491  1.00 16.20 ? 138 LEU A C   1 
ATOM   998  O O   . LEU A 1 138 ? 20.802 19.390  -3.499  1.00 16.25 ? 138 LEU A O   1 
ATOM   999  C CB  . LEU A 1 138 ? 22.248 22.112  -2.301  1.00 16.83 ? 138 LEU A CB  1 
ATOM   1000 C CG  . LEU A 1 138 ? 20.831 22.647  -2.526  1.00 16.88 ? 138 LEU A CG  1 
ATOM   1001 C CD1 . LEU A 1 138 ? 19.903 22.222  -1.384  1.00 16.20 ? 138 LEU A CD1 1 
ATOM   1002 C CD2 . LEU A 1 138 ? 20.866 24.190  -2.667  1.00 18.26 ? 138 LEU A CD2 1 
ATOM   1003 N N   . GLY A 1 139 ? 22.760 19.815  -4.534  1.00 15.40 ? 139 GLY A N   1 
ATOM   1004 C CA  . GLY A 1 139 ? 22.358 19.106  -5.768  1.00 16.07 ? 139 GLY A CA  1 
ATOM   1005 C C   . GLY A 1 139 ? 22.075 17.642  -5.465  1.00 16.01 ? 139 GLY A C   1 
ATOM   1006 O O   . GLY A 1 139 ? 21.048 17.101  -5.886  1.00 16.42 ? 139 GLY A O   1 
ATOM   1007 N N   . TYR A 1 140 ? 22.968 16.999  -4.708  1.00 16.22 ? 140 TYR A N   1 
ATOM   1008 C CA  . TYR A 1 140 ? 22.777 15.586  -4.318  1.00 17.22 ? 140 TYR A CA  1 
ATOM   1009 C C   . TYR A 1 140 ? 21.518 15.390  -3.484  1.00 16.63 ? 140 TYR A C   1 
ATOM   1010 O O   . TYR A 1 140 ? 20.769 14.423  -3.688  1.00 16.41 ? 140 TYR A O   1 
ATOM   1011 C CB  . TYR A 1 140 ? 23.970 15.058  -3.508  1.00 18.54 ? 140 TYR A CB  1 
ATOM   1012 C CG  . TYR A 1 140 ? 25.319 15.193  -4.164  1.00 21.65 ? 140 TYR A CG  1 
ATOM   1013 C CD1 . TYR A 1 140 ? 25.475 15.085  -5.556  1.00 23.65 ? 140 TYR A CD1 1 
ATOM   1014 C CD2 . TYR A 1 140 ? 26.461 15.393  -3.385  1.00 23.45 ? 140 TYR A CD2 1 
ATOM   1015 C CE1 . TYR A 1 140 ? 26.734 15.207  -6.150  1.00 23.62 ? 140 TYR A CE1 1 
ATOM   1016 C CE2 . TYR A 1 140 ? 27.710 15.520  -3.959  1.00 24.05 ? 140 TYR A CE2 1 
ATOM   1017 C CZ  . TYR A 1 140 ? 27.842 15.424  -5.340  1.00 25.16 ? 140 TYR A CZ  1 
ATOM   1018 O OH  . TYR A 1 140 ? 29.090 15.542  -5.893  1.00 25.38 ? 140 TYR A OH  1 
ATOM   1019 N N   . ALA A 1 141 ? 21.315 16.284  -2.517  1.00 16.27 ? 141 ALA A N   1 
ATOM   1020 C CA  . ALA A 1 141 ? 20.164 16.225  -1.621  1.00 16.95 ? 141 ALA A CA  1 
ATOM   1021 C C   . ALA A 1 141 ? 18.833 16.316  -2.374  1.00 17.41 ? 141 ALA A C   1 
ATOM   1022 O O   . ALA A 1 141 ? 17.941 15.482  -2.165  1.00 16.98 ? 141 ALA A O   1 
ATOM   1023 C CB  . ALA A 1 141 ? 20.270 17.309  -0.544  1.00 17.32 ? 141 ALA A CB  1 
ATOM   1024 N N   . GLU A 1 142 ? 18.706 17.295  -3.271  1.00 17.98 ? 142 GLU A N   1 
ATOM   1025 C CA  . GLU A 1 142 ? 17.450 17.502  -3.994  1.00 19.30 ? 142 GLU A CA  1 
ATOM   1026 C C   . GLU A 1 142 ? 17.176 16.333  -4.942  1.00 19.74 ? 142 GLU A C   1 
ATOM   1027 O O   . GLU A 1 142 ? 16.032 15.903  -5.075  1.00 19.44 ? 142 GLU A O   1 
ATOM   1028 C CB  . GLU A 1 142 ? 17.442 18.880  -4.708  1.00 18.67 ? 142 GLU A CB  1 
ATOM   1029 C CG  . GLU A 1 142 ? 17.607 20.043  -3.715  1.00 19.95 ? 142 GLU A CG  1 
ATOM   1030 C CD  . GLU A 1 142 ? 17.606 21.434  -4.352  1.00 21.65 ? 142 GLU A CD  1 
ATOM   1031 O OE1 . GLU A 1 142 ? 18.303 21.667  -5.371  1.00 25.62 ? 142 GLU A OE1 1 
ATOM   1032 O OE2 . GLU A 1 142 ? 16.916 22.305  -3.791  1.00 26.09 ? 142 GLU A OE2 1 
ATOM   1033 N N   . ARG A 1 143 ? 18.227 15.807  -5.574  1.00 20.42 ? 143 ARG A N   1 
ATOM   1034 C CA  . ARG A 1 143 ? 18.133 14.604  -6.419  1.00 22.73 ? 143 ARG A CA  1 
ATOM   1035 C C   . ARG A 1 143 ? 17.634 13.413  -5.592  1.00 22.66 ? 143 ARG A C   1 
ATOM   1036 O O   . ARG A 1 143 ? 16.742 12.665  -6.016  1.00 22.51 ? 143 ARG A O   1 
ATOM   1037 C CB  . ARG A 1 143 ? 19.506 14.278  -7.015  1.00 22.53 ? 143 ARG A CB  1 
ATOM   1038 C CG  . ARG A 1 143 ? 19.551 13.321  -8.213  1.00 24.91 ? 143 ARG A CG  1 
ATOM   1039 C CD  . ARG A 1 143 ? 20.967 13.338  -8.862  1.00 26.57 ? 143 ARG A CD  1 
ATOM   1040 N NE  . ARG A 1 143 ? 21.572 14.685  -8.907  1.00 30.76 ? 143 ARG A NE  1 
ATOM   1041 C CZ  . ARG A 1 143 ? 22.869 14.949  -8.713  1.00 35.03 ? 143 ARG A CZ  1 
ATOM   1042 N NH1 . ARG A 1 143 ? 23.735 13.960  -8.455  1.00 37.83 ? 143 ARG A NH1 1 
ATOM   1043 N NH2 . ARG A 1 143 ? 23.312 16.208  -8.758  1.00 33.85 ? 143 ARG A NH2 1 
ATOM   1044 N N   . ARG A 1 144 ? 18.203 13.256  -4.401  1.00 22.31 ? 144 ARG A N   1 
ATOM   1045 C CA  . ARG A 1 144 ? 17.867 12.121  -3.536  1.00 22.77 ? 144 ARG A CA  1 
ATOM   1046 C C   . ARG A 1 144 ? 16.398 12.155  -3.105  1.00 21.55 ? 144 ARG A C   1 
ATOM   1047 O O   . ARG A 1 144 ? 15.758 11.111  -3.000  1.00 20.82 ? 144 ARG A O   1 
ATOM   1048 C CB  . ARG A 1 144 ? 18.796 12.058  -2.322  1.00 22.81 ? 144 ARG A CB  1 
ATOM   1049 C CG  . ARG A 1 144 ? 18.656 10.763  -1.543  1.00 25.80 ? 144 ARG A CG  1 
ATOM   1050 C CD  . ARG A 1 144 ? 19.925 10.408  -0.776  1.00 28.12 ? 144 ARG A CD  1 
ATOM   1051 N NE  . ARG A 1 144 ? 19.667 9.276   0.114   1.00 29.01 ? 144 ARG A NE  1 
ATOM   1052 C CZ  . ARG A 1 144 ? 19.448 9.398   1.422   1.00 28.61 ? 144 ARG A CZ  1 
ATOM   1053 N NH1 . ARG A 1 144 ? 19.465 10.606  1.985   1.00 29.42 ? 144 ARG A NH1 1 
ATOM   1054 N NH2 . ARG A 1 144 ? 19.193 8.326   2.162   1.00 25.73 ? 144 ARG A NH2 1 
ATOM   1055 N N   . THR A 1 145 ? 15.862 13.350  -2.887  1.00 20.76 ? 145 THR A N   1 
ATOM   1056 C CA  . THR A 1 145 ? 14.444 13.486  -2.538  1.00 20.78 ? 145 THR A CA  1 
ATOM   1057 C C   . THR A 1 145 ? 13.548 12.898  -3.630  1.00 21.08 ? 145 THR A C   1 
ATOM   1058 O O   . THR A 1 145 ? 12.577 12.191  -3.323  1.00 21.31 ? 145 THR A O   1 
ATOM   1059 C CB  . THR A 1 145 ? 14.053 14.944  -2.273  1.00 20.40 ? 145 THR A CB  1 
ATOM   1060 O OG1 . THR A 1 145 ? 14.920 15.480  -1.273  1.00 20.11 ? 145 THR A OG1 1 
ATOM   1061 C CG2 . THR A 1 145 ? 12.599 15.046  -1.786  1.00 19.66 ? 145 THR A CG2 1 
ATOM   1062 N N   . VAL A 1 146 ? 13.875 13.189  -4.889  1.00 21.65 ? 146 VAL A N   1 
ATOM   1063 C CA  . VAL A 1 146 ? 13.118 12.659  -6.042  1.00 21.91 ? 146 VAL A CA  1 
ATOM   1064 C C   . VAL A 1 146 ? 13.242 11.142  -6.107  1.00 22.20 ? 146 VAL A C   1 
ATOM   1065 O O   . VAL A 1 146 ? 12.237 10.453  -6.186  1.00 22.40 ? 146 VAL A O   1 
ATOM   1066 C CB  . VAL A 1 146 ? 13.578 13.274  -7.381  1.00 22.01 ? 146 VAL A CB  1 
ATOM   1067 C CG1 . VAL A 1 146 ? 12.817 12.648  -8.578  1.00 22.61 ? 146 VAL A CG1 1 
ATOM   1068 C CG2 . VAL A 1 146 ? 13.393 14.792  -7.347  1.00 22.23 ? 146 VAL A CG2 1 
ATOM   1069 N N   . THR A 1 147 ? 14.470 10.630  -6.057  1.00 22.12 ? 147 THR A N   1 
ATOM   1070 C CA  . THR A 1 147 ? 14.710 9.185   -5.971  1.00 22.71 ? 147 THR A CA  1 
ATOM   1071 C C   . THR A 1 147 ? 13.905 8.490   -4.882  1.00 21.82 ? 147 THR A C   1 
ATOM   1072 O O   . THR A 1 147 ? 13.190 7.517   -5.146  1.00 22.00 ? 147 THR A O   1 
ATOM   1073 C CB  . THR A 1 147 ? 16.206 8.873   -5.772  1.00 22.76 ? 147 THR A CB  1 
ATOM   1074 O OG1 . THR A 1 147 ? 16.886 9.200   -6.979  1.00 26.28 ? 147 THR A OG1 1 
ATOM   1075 C CG2 . THR A 1 147 ? 16.429 7.364   -5.445  1.00 24.78 ? 147 THR A CG2 1 
ATOM   1076 N N   . LEU A 1 148 ? 14.018 8.984   -3.655  1.00 21.03 ? 148 LEU A N   1 
ATOM   1077 C CA  . LEU A 1 148 ? 13.432 8.285   -2.517  1.00 20.76 ? 148 LEU A CA  1 
ATOM   1078 C C   . LEU A 1 148 ? 11.903 8.341   -2.500  1.00 20.74 ? 148 LEU A C   1 
ATOM   1079 O O   . LEU A 1 148 ? 11.272 7.443   -1.968  1.00 21.19 ? 148 LEU A O   1 
ATOM   1080 C CB  . LEU A 1 148 ? 13.979 8.838   -1.194  1.00 20.15 ? 148 LEU A CB  1 
ATOM   1081 C CG  . LEU A 1 148 ? 15.473 8.682   -0.919  1.00 20.88 ? 148 LEU A CG  1 
ATOM   1082 C CD1 . LEU A 1 148 ? 15.788 9.060   0.555   1.00 21.47 ? 148 LEU A CD1 1 
ATOM   1083 C CD2 . LEU A 1 148 ? 15.950 7.260   -1.252  1.00 20.48 ? 148 LEU A CD2 1 
ATOM   1084 N N   . THR A 1 149 ? 11.317 9.405   -3.048  1.00 20.47 ? 149 THR A N   1 
ATOM   1085 C CA  . THR A 1 149 ? 9.858  9.571   -3.016  1.00 19.95 ? 149 THR A CA  1 
ATOM   1086 C C   . THR A 1 149 ? 9.146  8.996   -4.245  1.00 21.47 ? 149 THR A C   1 
ATOM   1087 O O   . THR A 1 149 ? 7.938  8.747   -4.195  1.00 22.67 ? 149 THR A O   1 
ATOM   1088 C CB  . THR A 1 149 ? 9.435  11.048  -2.860  1.00 20.28 ? 149 THR A CB  1 
ATOM   1089 O OG1 . THR A 1 149 ? 9.988  11.827  -3.937  1.00 17.29 ? 149 THR A OG1 1 
ATOM   1090 C CG2 . THR A 1 149 ? 9.876  11.619  -1.517  1.00 18.93 ? 149 THR A CG2 1 
ATOM   1091 N N   . GLN A 1 150 ? 9.874  8.798   -5.339  1.00 21.41 ? 150 GLN A N   1 
ATOM   1092 C CA  . GLN A 1 150 ? 9.237  8.488   -6.616  1.00 23.14 ? 150 GLN A CA  1 
ATOM   1093 C C   . GLN A 1 150 ? 9.637  7.150   -7.224  1.00 23.66 ? 150 GLN A C   1 
ATOM   1094 O O   . GLN A 1 150 ? 8.836  6.524   -7.925  1.00 24.17 ? 150 GLN A O   1 
ATOM   1095 C CB  . GLN A 1 150 ? 9.482  9.617   -7.622  1.00 22.85 ? 150 GLN A CB  1 
ATOM   1096 C CG  . GLN A 1 150 ? 8.813  10.927  -7.218  1.00 22.41 ? 150 GLN A CG  1 
ATOM   1097 C CD  . GLN A 1 150 ? 8.719  11.918  -8.354  1.00 25.45 ? 150 GLN A CD  1 
ATOM   1098 O OE1 . GLN A 1 150 ? 9.138  11.638  -9.474  1.00 23.63 ? 150 GLN A OE1 1 
ATOM   1099 N NE2 . GLN A 1 150 ? 8.195  13.104  -8.061  1.00 25.71 ? 150 GLN A NE2 1 
ATOM   1100 N N   . LYS A 1 151 ? 10.861 6.703   -6.964  1.00 24.22 ? 151 LYS A N   1 
ATOM   1101 C CA  . LYS A 1 151 ? 11.300 5.441   -7.549  1.00 24.98 ? 151 LYS A CA  1 
ATOM   1102 C C   . LYS A 1 151 ? 10.727 4.269   -6.772  1.00 25.61 ? 151 LYS A C   1 
ATOM   1103 O O   . LYS A 1 151 ? 10.450 4.378   -5.583  1.00 25.78 ? 151 LYS A O   1 
ATOM   1104 C CB  . LYS A 1 151 ? 12.817 5.341   -7.605  1.00 25.03 ? 151 LYS A CB  1 
ATOM   1105 C CG  . LYS A 1 151 ? 13.447 6.272   -8.585  1.00 24.91 ? 151 LYS A CG  1 
ATOM   1106 C CD  . LYS A 1 151 ? 14.807 5.759   -8.987  1.00 26.51 ? 151 LYS A CD  1 
ATOM   1107 C CE  . LYS A 1 151 ? 15.388 6.610   -10.083 1.00 25.89 ? 151 LYS A CE  1 
ATOM   1108 N NZ  . LYS A 1 151 ? 16.832 6.360   -10.145 1.00 27.46 ? 151 LYS A NZ  1 
ATOM   1109 N N   . HIS A 1 152 ? 10.533 3.149   -7.457  1.00 26.35 ? 152 HIS A N   1 
ATOM   1110 C CA  . HIS A 1 152 ? 10.048 1.956   -6.798  1.00 27.30 ? 152 HIS A CA  1 
ATOM   1111 C C   . HIS A 1 152 ? 11.211 1.235   -6.114  1.00 27.18 ? 152 HIS A C   1 
ATOM   1112 O O   . HIS A 1 152 ? 12.364 1.644   -6.259  1.00 26.19 ? 152 HIS A O   1 
ATOM   1113 C CB  . HIS A 1 152 ? 9.281  1.086   -7.793  1.00 28.33 ? 152 HIS A CB  1 
ATOM   1114 C CG  . HIS A 1 152 ? 8.033  1.744   -8.304  1.00 31.19 ? 152 HIS A CG  1 
ATOM   1115 N ND1 . HIS A 1 152 ? 7.093  2.308   -7.462  1.00 34.59 ? 152 HIS A ND1 1 
ATOM   1116 C CD2 . HIS A 1 152 ? 7.583  1.958   -9.564  1.00 34.51 ? 152 HIS A CD2 1 
ATOM   1117 C CE1 . HIS A 1 152 ? 6.113  2.830   -8.180  1.00 34.40 ? 152 HIS A CE1 1 
ATOM   1118 N NE2 . HIS A 1 152 ? 6.388  2.637   -9.458  1.00 36.28 ? 152 HIS A NE2 1 
ATOM   1119 N N   . VAL A 1 153 ? 10.899 0.187   -5.355  1.00 27.24 ? 153 VAL A N   1 
ATOM   1120 C CA  . VAL A 1 153 ? 11.882 -0.488  -4.491  1.00 27.75 ? 153 VAL A CA  1 
ATOM   1121 C C   . VAL A 1 153 ? 13.148 -0.902  -5.227  1.00 27.30 ? 153 VAL A C   1 
ATOM   1122 O O   . VAL A 1 153 ? 14.255 -0.664  -4.738  1.00 27.12 ? 153 VAL A O   1 
ATOM   1123 C CB  . VAL A 1 153 ? 11.241 -1.662  -3.714  1.00 27.88 ? 153 VAL A CB  1 
ATOM   1124 C CG1 . VAL A 1 153 ? 12.283 -2.593  -3.171  1.00 29.52 ? 153 VAL A CG1 1 
ATOM   1125 C CG2 . VAL A 1 153 ? 10.440 -1.124  -2.569  1.00 28.97 ? 153 VAL A CG2 1 
ATOM   1126 N N   . ARG A 1 154 ? 12.986 -1.474  -6.420  1.00 27.51 ? 154 ARG A N   1 
ATOM   1127 C CA  . ARG A 1 154 ? 14.120 -1.891  -7.242  1.00 27.35 ? 154 ARG A CA  1 
ATOM   1128 C C   . ARG A 1 154 ? 15.011 -0.730  -7.673  1.00 27.46 ? 154 ARG A C   1 
ATOM   1129 O O   . ARG A 1 154 ? 16.243 -0.845  -7.635  1.00 26.85 ? 154 ARG A O   1 
ATOM   1130 C CB  . ARG A 1 154 ? 13.645 -2.667  -8.476  1.00 28.29 ? 154 ARG A CB  1 
ATOM   1131 C CG  . ARG A 1 154 ? 13.100 -4.062  -8.161  1.00 28.70 ? 154 ARG A CG  1 
ATOM   1132 C CD  . ARG A 1 154 ? 12.424 -4.673  -9.385  1.00 31.07 ? 154 ARG A CD  1 
ATOM   1133 N NE  . ARG A 1 154 ? 13.330 -4.781  -10.532 1.00 31.28 ? 154 ARG A NE  1 
ATOM   1134 C CZ  . ARG A 1 154 ? 14.070 -5.851  -10.819 1.00 32.19 ? 154 ARG A CZ  1 
ATOM   1135 N NH1 . ARG A 1 154 ? 14.031 -6.932  -10.055 1.00 32.91 ? 154 ARG A NH1 1 
ATOM   1136 N NH2 . ARG A 1 154 ? 14.852 -5.843  -11.883 1.00 33.50 ? 154 ARG A NH2 1 
ATOM   1137 N N   . GLY A 1 155 ? 14.393 0.374   -8.094  1.00 26.33 ? 155 GLY A N   1 
ATOM   1138 C CA  . GLY A 1 155 ? 15.141 1.549   -8.538  1.00 25.69 ? 155 GLY A CA  1 
ATOM   1139 C C   . GLY A 1 155 ? 15.898 2.209   -7.397  1.00 24.88 ? 155 GLY A C   1 
ATOM   1140 O O   . GLY A 1 155 ? 17.082 2.544   -7.538  1.00 24.58 ? 155 GLY A O   1 
ATOM   1141 N N   . ARG A 1 156 ? 15.213 2.385   -6.271  1.00 24.03 ? 156 ARG A N   1 
ATOM   1142 C CA  . ARG A 1 156 ? 15.815 2.983   -5.070  1.00 23.76 ? 156 ARG A CA  1 
ATOM   1143 C C   . ARG A 1 156 ? 17.053 2.218   -4.588  1.00 23.36 ? 156 ARG A C   1 
ATOM   1144 O O   . ARG A 1 156 ? 18.089 2.821   -4.300  1.00 22.00 ? 156 ARG A O   1 
ATOM   1145 C CB  . ARG A 1 156 ? 14.807 3.070   -3.926  1.00 23.60 ? 156 ARG A CB  1 
ATOM   1146 C CG  . ARG A 1 156 ? 13.653 4.035   -4.151  1.00 24.16 ? 156 ARG A CG  1 
ATOM   1147 C CD  . ARG A 1 156 ? 12.982 4.373   -2.851  1.00 25.31 ? 156 ARG A CD  1 
ATOM   1148 N NE  . ARG A 1 156 ? 12.384 3.178   -2.270  1.00 29.10 ? 156 ARG A NE  1 
ATOM   1149 C CZ  . ARG A 1 156 ? 11.395 3.176   -1.385  1.00 32.92 ? 156 ARG A CZ  1 
ATOM   1150 N NH1 . ARG A 1 156 ? 10.900 4.326   -0.952  1.00 38.51 ? 156 ARG A NH1 1 
ATOM   1151 N NH2 . ARG A 1 156 ? 10.890 2.031   -0.932  1.00 29.93 ? 156 ARG A NH2 1 
ATOM   1152 N N   . LEU A 1 157 ? 16.939 0.895   -4.478  1.00 23.41 ? 157 LEU A N   1 
ATOM   1153 C CA  . LEU A 1 157 ? 18.069 0.109   -3.978  1.00 23.40 ? 157 LEU A CA  1 
ATOM   1154 C C   . LEU A 1 157 ? 19.228 0.085   -4.979  1.00 23.30 ? 157 LEU A C   1 
ATOM   1155 O O   . LEU A 1 157 ? 20.395 0.232   -4.588  1.00 23.41 ? 157 LEU A O   1 
ATOM   1156 C CB  . LEU A 1 157 ? 17.645 -1.314  -3.564  1.00 23.76 ? 157 LEU A CB  1 
ATOM   1157 C CG  . LEU A 1 157 ? 18.794 -2.188  -3.040  1.00 23.32 ? 157 LEU A CG  1 
ATOM   1158 C CD1 . LEU A 1 157 ? 19.386 -1.621  -1.762  1.00 23.77 ? 157 LEU A CD1 1 
ATOM   1159 C CD2 . LEU A 1 157 ? 18.363 -3.633  -2.854  1.00 24.10 ? 157 LEU A CD2 1 
ATOM   1160 N N   . ALA A 1 158 ? 18.920 -0.104  -6.262  1.00 23.02 ? 158 ALA A N   1 
ATOM   1161 C CA  . ALA A 1 158 ? 19.949 -0.048  -7.305  1.00 22.90 ? 158 ALA A CA  1 
ATOM   1162 C C   . ALA A 1 158 ? 20.647 1.313   -7.287  1.00 23.08 ? 158 ALA A C   1 
ATOM   1163 O O   . ALA A 1 158 ? 21.868 1.395   -7.384  1.00 23.00 ? 158 ALA A O   1 
ATOM   1164 C CB  . ALA A 1 158 ? 19.344 -0.329  -8.679  1.00 22.92 ? 158 ALA A CB  1 
ATOM   1165 N N   . GLU A 1 159 ? 19.875 2.384   -7.133  1.00 23.16 ? 159 GLU A N   1 
ATOM   1166 C CA  . GLU A 1 159 ? 20.478 3.716   -7.085  1.00 23.41 ? 159 GLU A CA  1 
ATOM   1167 C C   . GLU A 1 159 ? 21.446 3.829   -5.898  1.00 21.97 ? 159 GLU A C   1 
ATOM   1168 O O   . GLU A 1 159 ? 22.585 4.257   -6.066  1.00 21.53 ? 159 GLU A O   1 
ATOM   1169 C CB  . GLU A 1 159 ? 19.410 4.797   -6.999  1.00 23.96 ? 159 GLU A CB  1 
ATOM   1170 C CG  . GLU A 1 159 ? 20.001 6.146   -6.652  1.00 28.43 ? 159 GLU A CG  1 
ATOM   1171 C CD  . GLU A 1 159 ? 19.470 7.276   -7.503  1.00 32.96 ? 159 GLU A CD  1 
ATOM   1172 O OE1 . GLU A 1 159 ? 18.657 7.023   -8.424  1.00 35.48 ? 159 GLU A OE1 1 
ATOM   1173 O OE2 . GLU A 1 159 ? 19.886 8.426   -7.247  1.00 34.75 ? 159 GLU A OE2 1 
ATOM   1174 N N   . THR A 1 160 ? 20.981 3.433   -4.717  1.00 21.02 ? 160 THR A N   1 
ATOM   1175 C CA  . THR A 1 160 ? 21.818 3.396   -3.501  1.00 20.49 ? 160 THR A CA  1 
ATOM   1176 C C   . THR A 1 160 ? 23.137 2.660   -3.745  1.00 19.84 ? 160 THR A C   1 
ATOM   1177 O O   . THR A 1 160 ? 24.204 3.200   -3.453  1.00 19.07 ? 160 THR A O   1 
ATOM   1178 C CB  . THR A 1 160 ? 21.063 2.759   -2.313  1.00 20.20 ? 160 THR A CB  1 
ATOM   1179 O OG1 . THR A 1 160 ? 20.037 3.661   -1.881  1.00 21.93 ? 160 THR A OG1 1 
ATOM   1180 C CG2 . THR A 1 160 ? 22.010 2.470   -1.141  1.00 20.15 ? 160 THR A CG2 1 
ATOM   1181 N N   . LEU A 1 161 ? 23.057 1.437   -4.275  1.00 19.43 ? 161 LEU A N   1 
ATOM   1182 C CA  . LEU A 1 161 ? 24.252 0.629   -4.548  1.00 19.38 ? 161 LEU A CA  1 
ATOM   1183 C C   . LEU A 1 161 ? 25.211 1.325   -5.541  1.00 19.56 ? 161 LEU A C   1 
ATOM   1184 O O   . LEU A 1 161 ? 26.434 1.313   -5.359  1.00 18.61 ? 161 LEU A O   1 
ATOM   1185 C CB  . LEU A 1 161 ? 23.856 -0.781  -5.031  1.00 19.92 ? 161 LEU A CB  1 
ATOM   1186 C CG  . LEU A 1 161 ? 23.098 -1.640  -3.994  1.00 19.77 ? 161 LEU A CG  1 
ATOM   1187 C CD1 . LEU A 1 161 ? 22.590 -2.929  -4.625  1.00 20.59 ? 161 LEU A CD1 1 
ATOM   1188 C CD2 . LEU A 1 161 ? 23.956 -1.945  -2.769  1.00 17.79 ? 161 LEU A CD2 1 
ATOM   1189 N N   . LEU A 1 162 ? 24.666 1.951   -6.577  1.00 19.92 ? 162 LEU A N   1 
ATOM   1190 C CA  . LEU A 1 162 ? 25.529 2.661   -7.549  1.00 20.26 ? 162 LEU A CA  1 
ATOM   1191 C C   . LEU A 1 162 ? 26.175 3.913   -6.940  1.00 20.07 ? 162 LEU A C   1 
ATOM   1192 O O   . LEU A 1 162 ? 27.308 4.265   -7.287  1.00 20.21 ? 162 LEU A O   1 
ATOM   1193 C CB  . LEU A 1 162 ? 24.759 2.999   -8.827  1.00 20.93 ? 162 LEU A CB  1 
ATOM   1194 C CG  . LEU A 1 162 ? 24.339 1.770   -9.661  1.00 22.88 ? 162 LEU A CG  1 
ATOM   1195 C CD1 . LEU A 1 162 ? 23.328 2.170   -10.709 1.00 22.47 ? 162 LEU A CD1 1 
ATOM   1196 C CD2 . LEU A 1 162 ? 25.542 1.034   -10.280 1.00 24.13 ? 162 LEU A CD2 1 
ATOM   1197 N N   . ILE A 1 163 ? 25.471 4.560   -6.009  1.00 19.76 ? 163 ILE A N   1 
ATOM   1198 C CA  . ILE A 1 163 ? 26.050 5.695   -5.265  1.00 19.60 ? 163 ILE A CA  1 
ATOM   1199 C C   . ILE A 1 163 ? 27.225 5.272   -4.368  1.00 19.50 ? 163 ILE A C   1 
ATOM   1200 O O   . ILE A 1 163 ? 28.224 5.995   -4.261  1.00 19.28 ? 163 ILE A O   1 
ATOM   1201 C CB  . ILE A 1 163 ? 24.991 6.484   -4.457  1.00 19.77 ? 163 ILE A CB  1 
ATOM   1202 C CG1 . ILE A 1 163 ? 24.081 7.275   -5.417  1.00 19.77 ? 163 ILE A CG1 1 
ATOM   1203 C CG2 . ILE A 1 163 ? 25.668 7.477   -3.473  1.00 19.57 ? 163 ILE A CG2 1 
ATOM   1204 C CD1 . ILE A 1 163 ? 22.763 7.738   -4.795  1.00 19.61 ? 163 ILE A CD1 1 
ATOM   1205 N N   . LEU A 1 164 ? 27.089 4.113   -3.731  1.00 19.16 ? 164 LEU A N   1 
ATOM   1206 C CA  . LEU A 1 164 ? 28.169 3.552   -2.901  1.00 19.43 ? 164 LEU A CA  1 
ATOM   1207 C C   . LEU A 1 164 ? 29.342 3.180   -3.795  1.00 20.06 ? 164 LEU A C   1 
ATOM   1208 O O   . LEU A 1 164 ? 30.491 3.485   -3.460  1.00 19.93 ? 164 LEU A O   1 
ATOM   1209 C CB  . LEU A 1 164 ? 27.671 2.347   -2.098  1.00 19.27 ? 164 LEU A CB  1 
ATOM   1210 C CG  . LEU A 1 164 ? 26.571 2.668   -1.071  1.00 19.58 ? 164 LEU A CG  1 
ATOM   1211 C CD1 . LEU A 1 164 ? 26.013 1.362   -0.468  1.00 20.11 ? 164 LEU A CD1 1 
ATOM   1212 C CD2 . LEU A 1 164 ? 27.087 3.621   0.020   1.00 18.34 ? 164 LEU A CD2 1 
ATOM   1213 N N   . LYS A 1 165 ? 29.046 2.568   -4.945  1.00 19.91 ? 165 LYS A N   1 
ATOM   1214 C CA  . LYS A 1 165 ? 30.070 2.250   -5.953  1.00 21.69 ? 165 LYS A CA  1 
ATOM   1215 C C   . LYS A 1 165 ? 30.844 3.516   -6.320  1.00 21.62 ? 165 LYS A C   1 
ATOM   1216 O O   . LYS A 1 165 ? 32.083 3.536   -6.288  1.00 21.52 ? 165 LYS A O   1 
ATOM   1217 C CB  . LYS A 1 165 ? 29.442 1.634   -7.209  1.00 21.77 ? 165 LYS A CB  1 
ATOM   1218 C CG  . LYS A 1 165 ? 30.447 1.355   -8.355  1.00 24.12 ? 165 LYS A CG  1 
ATOM   1219 C CD  . LYS A 1 165 ? 29.719 0.895   -9.630  1.00 25.41 ? 165 LYS A CD  1 
ATOM   1220 C CE  . LYS A 1 165 ? 29.541 2.026   -10.621 1.00 31.95 ? 165 LYS A CE  1 
ATOM   1221 N NZ  . LYS A 1 165 ? 30.787 2.167   -11.464 1.00 34.99 ? 165 LYS A NZ  1 
ATOM   1222 N N   . GLU A 1 166 ? 30.107 4.579   -6.632  1.00 21.88 ? 166 GLU A N   1 
ATOM   1223 C CA  . GLU A 1 166 ? 30.737 5.833   -7.029  1.00 22.29 ? 166 GLU A CA  1 
ATOM   1224 C C   . GLU A 1 166 ? 31.602 6.428   -5.912  1.00 21.38 ? 166 GLU A C   1 
ATOM   1225 O O   . GLU A 1 166 ? 32.734 6.826   -6.170  1.00 21.58 ? 166 GLU A O   1 
ATOM   1226 C CB  . GLU A 1 166 ? 29.677 6.829   -7.525  1.00 23.14 ? 166 GLU A CB  1 
ATOM   1227 C CG  . GLU A 1 166 ? 30.217 8.206   -7.914  1.00 27.68 ? 166 GLU A CG  1 
ATOM   1228 C CD  . GLU A 1 166 ? 31.182 8.184   -9.110  1.00 32.59 ? 166 GLU A CD  1 
ATOM   1229 O OE1 . GLU A 1 166 ? 31.049 7.312   -9.999  1.00 35.63 ? 166 GLU A OE1 1 
ATOM   1230 O OE2 . GLU A 1 166 ? 32.058 9.074   -9.171  1.00 35.16 ? 166 GLU A OE2 1 
ATOM   1231 N N   . ASN A 1 167 ? 31.086 6.465   -4.683  1.00 20.29 ? 167 ASN A N   1 
ATOM   1232 C CA  . ASN A 1 167 ? 31.750 7.153   -3.577  1.00 20.64 ? 167 ASN A CA  1 
ATOM   1233 C C   . ASN A 1 167 ? 32.857 6.357   -2.905  1.00 20.86 ? 167 ASN A C   1 
ATOM   1234 O O   . ASN A 1 167 ? 33.813 6.943   -2.381  1.00 20.89 ? 167 ASN A O   1 
ATOM   1235 C CB  . ASN A 1 167 ? 30.722 7.585   -2.524  1.00 20.36 ? 167 ASN A CB  1 
ATOM   1236 C CG  . ASN A 1 167 ? 29.742 8.629   -3.051  1.00 22.35 ? 167 ASN A CG  1 
ATOM   1237 O OD1 . ASN A 1 167 ? 29.986 9.260   -4.087  1.00 23.68 ? 167 ASN A OD1 1 
ATOM   1238 N ND2 . ASN A 1 167 ? 28.623 8.815   -2.339  1.00 22.34 ? 167 ASN A ND2 1 
ATOM   1239 N N   . PHE A 1 168 ? 32.732 5.024   -2.914  1.00 20.42 ? 168 PHE A N   1 
ATOM   1240 C CA  . PHE A 1 168 ? 33.670 4.152   -2.193  1.00 20.78 ? 168 PHE A CA  1 
ATOM   1241 C C   . PHE A 1 168 ? 34.413 3.125   -3.052  1.00 21.07 ? 168 PHE A C   1 
ATOM   1242 O O   . PHE A 1 168 ? 35.451 2.615   -2.634  1.00 21.47 ? 168 PHE A O   1 
ATOM   1243 C CB  . PHE A 1 168 ? 32.988 3.513   -0.970  1.00 20.77 ? 168 PHE A CB  1 
ATOM   1244 C CG  . PHE A 1 168 ? 32.361 4.524   -0.065  1.00 20.77 ? 168 PHE A CG  1 
ATOM   1245 C CD1 . PHE A 1 168 ? 33.146 5.252   0.833   1.00 21.75 ? 168 PHE A CD1 1 
ATOM   1246 C CD2 . PHE A 1 168 ? 30.997 4.805   -0.156  1.00 21.03 ? 168 PHE A CD2 1 
ATOM   1247 C CE1 . PHE A 1 168 ? 32.571 6.239   1.645   1.00 23.40 ? 168 PHE A CE1 1 
ATOM   1248 C CE2 . PHE A 1 168 ? 30.410 5.788   0.662   1.00 21.08 ? 168 PHE A CE2 1 
ATOM   1249 C CZ  . PHE A 1 168 ? 31.208 6.498   1.556   1.00 21.61 ? 168 PHE A CZ  1 
ATOM   1250 N N   . GLY A 1 169 ? 33.897 2.849   -4.245  1.00 21.32 ? 169 GLY A N   1 
ATOM   1251 C CA  . GLY A 1 169 ? 34.625 2.064   -5.231  1.00 22.54 ? 169 GLY A CA  1 
ATOM   1252 C C   . GLY A 1 169 ? 34.616 0.574   -4.947  1.00 23.76 ? 169 GLY A C   1 
ATOM   1253 O O   . GLY A 1 169 ? 33.759 0.074   -4.205  1.00 22.77 ? 169 GLY A O   1 
ATOM   1254 N N   . PHE A 1 170 ? 35.563 -0.131  -5.560  1.00 24.69 ? 170 PHE A N   1 
ATOM   1255 C CA  . PHE A 1 170 ? 35.625 -1.596  -5.492  1.00 26.08 ? 170 PHE A CA  1 
ATOM   1256 C C   . PHE A 1 170 ? 36.875 -2.070  -4.759  1.00 26.83 ? 170 PHE A C   1 
ATOM   1257 O O   . PHE A 1 170 ? 37.878 -1.341  -4.673  1.00 26.12 ? 170 PHE A O   1 
ATOM   1258 C CB  . PHE A 1 170 ? 35.645 -2.205  -6.898  1.00 26.42 ? 170 PHE A CB  1 
ATOM   1259 C CG  . PHE A 1 170 ? 34.370 -2.055  -7.660  1.00 27.23 ? 170 PHE A CG  1 
ATOM   1260 C CD1 . PHE A 1 170 ? 33.182 -2.598  -7.185  1.00 27.94 ? 170 PHE A CD1 1 
ATOM   1261 C CD2 . PHE A 1 170 ? 34.365 -1.410  -8.887  1.00 28.14 ? 170 PHE A CD2 1 
ATOM   1262 C CE1 . PHE A 1 170 ? 31.992 -2.471  -7.913  1.00 28.58 ? 170 PHE A CE1 1 
ATOM   1263 C CE2 . PHE A 1 170 ? 33.180 -1.278  -9.625  1.00 28.53 ? 170 PHE A CE2 1 
ATOM   1264 C CZ  . PHE A 1 170 ? 31.996 -1.817  -9.133  1.00 27.88 ? 170 PHE A CZ  1 
ATOM   1265 N N   . GLU A 1 171 ? 36.803 -3.301  -4.249  1.00 28.15 ? 171 GLU A N   1 
ATOM   1266 C CA  . GLU A 1 171 ? 37.967 -4.022  -3.727  1.00 29.78 ? 171 GLU A CA  1 
ATOM   1267 C C   . GLU A 1 171 ? 38.851 -4.465  -4.898  1.00 29.86 ? 171 GLU A C   1 
ATOM   1268 O O   . GLU A 1 171 ? 38.544 -4.174  -6.051  1.00 29.60 ? 171 GLU A O   1 
ATOM   1269 C CB  . GLU A 1 171 ? 37.528 -5.259  -2.901  1.00 30.00 ? 171 GLU A CB  1 
ATOM   1270 C CG  . GLU A 1 171 ? 36.734 -4.962  -1.615  1.00 32.81 ? 171 GLU A CG  1 
ATOM   1271 C CD  . GLU A 1 171 ? 37.513 -4.170  -0.546  1.00 37.24 ? 171 GLU A CD  1 
ATOM   1272 O OE1 . GLU A 1 171 ? 38.732 -3.935  -0.703  1.00 37.38 ? 171 GLU A OE1 1 
ATOM   1273 O OE2 . GLU A 1 171 ? 36.895 -3.778  0.479   1.00 39.15 ? 171 GLU A OE2 1 
ATOM   1274 N N   . ASN A 1 172 ? 39.931 -5.189  -4.601  1.00 31.35 ? 172 ASN A N   1 
ATOM   1275 C CA  . ASN A 1 172 ? 40.870 -5.645  -5.642  1.00 32.41 ? 172 ASN A CA  1 
ATOM   1276 C C   . ASN A 1 172 ? 40.217 -6.442  -6.770  1.00 32.28 ? 172 ASN A C   1 
ATOM   1277 O O   . ASN A 1 172 ? 40.687 -6.404  -7.900  1.00 32.49 ? 172 ASN A O   1 
ATOM   1278 C CB  . ASN A 1 172 ? 42.044 -6.434  -5.044  1.00 33.12 ? 172 ASN A CB  1 
ATOM   1279 C CG  . ASN A 1 172 ? 42.911 -5.591  -4.116  1.00 35.98 ? 172 ASN A CG  1 
ATOM   1280 O OD1 . ASN A 1 172 ? 43.032 -4.370  -4.285  1.00 39.17 ? 172 ASN A OD1 1 
ATOM   1281 N ND2 . ASN A 1 172 ? 43.519 -6.242  -3.121  1.00 37.93 ? 172 ASN A ND2 1 
ATOM   1282 N N   . ASP A 1 173 ? 39.127 -7.151  -6.469  1.00 31.91 ? 173 ASP A N   1 
ATOM   1283 C CA  . ASP A 1 173 ? 38.421 -7.925  -7.486  1.00 31.23 ? 173 ASP A CA  1 
ATOM   1284 C C   . ASP A 1 173 ? 37.666 -7.054  -8.483  1.00 30.57 ? 173 ASP A C   1 
ATOM   1285 O O   . ASP A 1 173 ? 37.164 -7.544  -9.491  1.00 30.70 ? 173 ASP A O   1 
ATOM   1286 C CB  . ASP A 1 173 ? 37.488 -8.966  -6.849  1.00 31.61 ? 173 ASP A CB  1 
ATOM   1287 C CG  . ASP A 1 173 ? 36.271 -8.345  -6.154  1.00 32.88 ? 173 ASP A CG  1 
ATOM   1288 O OD1 . ASP A 1 173 ? 36.110 -7.100  -6.128  1.00 32.71 ? 173 ASP A OD1 1 
ATOM   1289 O OD2 . ASP A 1 173 ? 35.465 -9.132  -5.615  1.00 34.33 ? 173 ASP A OD2 1 
ATOM   1290 N N   . GLY A 1 174 ? 37.573 -5.759  -8.203  1.00 29.60 ? 174 GLY A N   1 
ATOM   1291 C CA  . GLY A 1 174 ? 36.941 -4.839  -9.141  1.00 28.70 ? 174 GLY A CA  1 
ATOM   1292 C C   . GLY A 1 174 ? 35.438 -5.003  -9.270  1.00 28.06 ? 174 GLY A C   1 
ATOM   1293 O O   . GLY A 1 174 ? 34.850 -4.546  -10.250 1.00 27.62 ? 174 GLY A O   1 
ATOM   1294 N N   . ALA A 1 175 ? 34.815 -5.652  -8.283  1.00 27.48 ? 175 ALA A N   1 
ATOM   1295 C CA  . ALA A 1 175 ? 33.374 -5.922  -8.323  1.00 26.79 ? 175 ALA A CA  1 
ATOM   1296 C C   . ALA A 1 175 ? 32.695 -5.846  -6.951  1.00 26.41 ? 175 ALA A C   1 
ATOM   1297 O O   . ALA A 1 175 ? 31.498 -5.535  -6.860  1.00 26.23 ? 175 ALA A O   1 
ATOM   1298 C CB  . ALA A 1 175 ? 33.095 -7.285  -8.997  1.00 27.25 ? 175 ALA A CB  1 
ATOM   1299 N N   . THR A 1 176 ? 33.457 -6.119  -5.898  1.00 25.44 ? 176 THR A N   1 
ATOM   1300 C CA  . THR A 1 176 ? 32.934 -6.096  -4.531  1.00 25.53 ? 176 THR A CA  1 
ATOM   1301 C C   . THR A 1 176 ? 33.041 -4.684  -3.987  1.00 24.92 ? 176 THR A C   1 
ATOM   1302 O O   . THR A 1 176 ? 34.135 -4.122  -3.963  1.00 24.12 ? 176 THR A O   1 
ATOM   1303 C CB  . THR A 1 176 ? 33.726 -7.063  -3.623  1.00 25.85 ? 176 THR A CB  1 
ATOM   1304 O OG1 . THR A 1 176 ? 33.551 -8.405  -4.100  1.00 26.93 ? 176 THR A OG1 1 
ATOM   1305 C CG2 . THR A 1 176 ? 33.274 -6.973  -2.161  1.00 25.65 ? 176 THR A CG2 1 
ATOM   1306 N N   . LEU A 1 177 ? 31.907 -4.124  -3.554  1.00 24.31 ? 177 LEU A N   1 
ATOM   1307 C CA  . LEU A 1 177 ? 31.880 -2.780  -2.970  1.00 24.47 ? 177 LEU A CA  1 
ATOM   1308 C C   . LEU A 1 177 ? 32.787 -2.692  -1.737  1.00 24.14 ? 177 LEU A C   1 
ATOM   1309 O O   . LEU A 1 177 ? 32.768 -3.593  -0.883  1.00 23.87 ? 177 LEU A O   1 
ATOM   1310 C CB  . LEU A 1 177 ? 30.443 -2.377  -2.607  1.00 24.22 ? 177 LEU A CB  1 
ATOM   1311 C CG  . LEU A 1 177 ? 29.435 -2.168  -3.747  1.00 24.17 ? 177 LEU A CG  1 
ATOM   1312 C CD1 . LEU A 1 177 ? 28.067 -1.768  -3.212  1.00 23.71 ? 177 LEU A CD1 1 
ATOM   1313 C CD2 . LEU A 1 177 ? 29.934 -1.123  -4.754  1.00 24.14 ? 177 LEU A CD2 1 
ATOM   1314 N N   . SER A 1 178 ? 33.576 -1.615  -1.660  1.00 23.81 ? 178 SER A N   1 
ATOM   1315 C CA  . SER A 1 178 ? 34.519 -1.374  -0.555  1.00 24.18 ? 178 SER A CA  1 
ATOM   1316 C C   . SER A 1 178 ? 33.873 -0.757  0.681   1.00 23.93 ? 178 SER A C   1 
ATOM   1317 O O   . SER A 1 178 ? 34.554 -0.173  1.521   1.00 24.92 ? 178 SER A O   1 
ATOM   1318 C CB  . SER A 1 178 ? 35.665 -0.455  -1.000  1.00 24.29 ? 178 SER A CB  1 
ATOM   1319 O OG  . SER A 1 178 ? 36.487 -1.101  -1.957  1.00 27.86 ? 178 SER A OG  1 
ATOM   1320 N N   . ILE A 1 179 ? 32.562 -0.869  0.796   1.00 22.78 ? 179 ILE A N   1 
ATOM   1321 C CA  . ILE A 1 179 ? 31.882 -0.435  2.006   1.00 22.19 ? 179 ILE A CA  1 
ATOM   1322 C C   . ILE A 1 179 ? 30.972 -1.573  2.436   1.00 22.83 ? 179 ILE A C   1 
ATOM   1323 O O   . ILE A 1 179 ? 30.416 -2.263  1.583   1.00 22.50 ? 179 ILE A O   1 
ATOM   1324 C CB  . ILE A 1 179 ? 31.101 0.869   1.751   1.00 21.63 ? 179 ILE A CB  1 
ATOM   1325 C CG1 . ILE A 1 179 ? 30.474 1.406   3.041   1.00 20.98 ? 179 ILE A CG1 1 
ATOM   1326 C CG2 . ILE A 1 179 ? 30.107 0.692   0.595   1.00 20.92 ? 179 ILE A CG2 1 
ATOM   1327 C CD1 . ILE A 1 179 ? 30.065 2.892   2.924   1.00 20.64 ? 179 ILE A CD1 1 
ATOM   1328 N N   . TYR A 1 180 ? 30.826 -1.754  3.747   1.00 23.59 ? 180 TYR A N   1 
ATOM   1329 C CA  . TYR A 1 180 ? 30.179 -2.938  4.300   1.00 24.11 ? 180 TYR A CA  1 
ATOM   1330 C C   . TYR A 1 180 ? 29.082 -2.543  5.285   1.00 24.40 ? 180 TYR A C   1 
ATOM   1331 O O   . TYR A 1 180 ? 29.189 -2.762  6.486   1.00 25.05 ? 180 TYR A O   1 
ATOM   1332 C CB  . TYR A 1 180 ? 31.240 -3.882  4.921   1.00 25.12 ? 180 TYR A CB  1 
ATOM   1333 C CG  . TYR A 1 180 ? 32.355 -4.219  3.940   1.00 24.70 ? 180 TYR A CG  1 
ATOM   1334 C CD1 . TYR A 1 180 ? 32.147 -5.146  2.931   1.00 26.09 ? 180 TYR A CD1 1 
ATOM   1335 C CD2 . TYR A 1 180 ? 33.603 -3.587  4.012   1.00 25.94 ? 180 TYR A CD2 1 
ATOM   1336 C CE1 . TYR A 1 180 ? 33.133 -5.449  2.020   1.00 26.87 ? 180 TYR A CE1 1 
ATOM   1337 C CE2 . TYR A 1 180 ? 34.617 -3.892  3.096   1.00 26.34 ? 180 TYR A CE2 1 
ATOM   1338 C CZ  . TYR A 1 180 ? 34.363 -4.828  2.104   1.00 27.91 ? 180 TYR A CZ  1 
ATOM   1339 O OH  . TYR A 1 180 ? 35.327 -5.167  1.171   1.00 29.40 ? 180 TYR A OH  1 
ATOM   1340 N N   . LEU A 1 181 ? 28.030 -1.936  4.754   1.00 24.16 ? 181 LEU A N   1 
ATOM   1341 C CA  . LEU A 1 181 ? 26.892 -1.513  5.560   1.00 24.45 ? 181 LEU A CA  1 
ATOM   1342 C C   . LEU A 1 181 ? 26.033 -2.699  6.000   1.00 24.58 ? 181 LEU A C   1 
ATOM   1343 O O   . LEU A 1 181 ? 25.966 -3.733  5.315   1.00 24.01 ? 181 LEU A O   1 
ATOM   1344 C CB  . LEU A 1 181 ? 26.037 -0.504  4.770   1.00 24.58 ? 181 LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 181 ? 26.743 0.774   4.300   1.00 24.15 ? 181 LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 181 ? 25.752 1.696   3.634   1.00 24.06 ? 181 LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 181 ? 27.474 1.499   5.449   1.00 24.38 ? 181 LEU A CD2 1 
ATOM   1348 N N   . SER A 1 182 ? 25.381 -2.541  7.149   1.00 25.05 ? 182 SER A N   1 
ATOM   1349 C CA  . SER A 1 182 ? 24.395 -3.498  7.611   1.00 25.60 ? 182 SER A CA  1 
ATOM   1350 C C   . SER A 1 182 ? 23.186 -3.409  6.695   1.00 26.03 ? 182 SER A C   1 
ATOM   1351 O O   . SER A 1 182 ? 23.034 -2.427  5.948   1.00 25.58 ? 182 SER A O   1 
ATOM   1352 C CB  . SER A 1 182 ? 23.983 -3.197  9.055   1.00 26.12 ? 182 SER A CB  1 
ATOM   1353 O OG  . SER A 1 182 ? 23.291 -1.963  9.153   1.00 26.15 ? 182 SER A OG  1 
ATOM   1354 N N   . ARG A 1 183 ? 22.323 -4.421  6.756   1.00 25.65 ? 183 ARG A N   1 
ATOM   1355 C CA  . ARG A 1 183 ? 21.070 -4.411  6.000   1.00 25.98 ? 183 ARG A CA  1 
ATOM   1356 C C   . ARG A 1 183 ? 20.202 -3.219  6.397   1.00 25.76 ? 183 ARG A C   1 
ATOM   1357 O O   . ARG A 1 183 ? 19.506 -2.630  5.552   1.00 25.60 ? 183 ARG A O   1 
ATOM   1358 C CB  . ARG A 1 183 ? 20.294 -5.721  6.207   1.00 26.37 ? 183 ARG A CB  1 
ATOM   1359 C CG  . ARG A 1 183 ? 20.953 -6.959  5.592   1.00 27.24 ? 183 ARG A CG  1 
ATOM   1360 C CD  . ARG A 1 183 ? 21.352 -6.727  4.143   1.00 27.59 ? 183 ARG A CD  1 
ATOM   1361 N NE  . ARG A 1 183 ? 21.717 -7.963  3.457   1.00 29.53 ? 183 ARG A NE  1 
ATOM   1362 C CZ  . ARG A 1 183 ? 22.898 -8.194  2.894   1.00 29.30 ? 183 ARG A CZ  1 
ATOM   1363 N NH1 . ARG A 1 183 ? 23.843 -7.265  2.918   1.00 30.22 ? 183 ARG A NH1 1 
ATOM   1364 N NH2 . ARG A 1 183 ? 23.127 -9.353  2.287   1.00 29.10 ? 183 ARG A NH2 1 
ATOM   1365 N N   . GLU A 1 184 ? 20.274 -2.869  7.678   1.00 25.58 ? 184 GLU A N   1 
ATOM   1366 C CA  . GLU A 1 184 ? 19.523 -1.763  8.264   1.00 25.48 ? 184 GLU A CA  1 
ATOM   1367 C C   . GLU A 1 184 ? 19.968 -0.411  7.694   1.00 25.13 ? 184 GLU A C   1 
ATOM   1368 O O   . GLU A 1 184 ? 19.141 0.436   7.355   1.00 24.82 ? 184 GLU A O   1 
ATOM   1369 C CB  . GLU A 1 184 ? 19.671 -1.792  9.788   1.00 26.25 ? 184 GLU A CB  1 
ATOM   1370 C CG  . GLU A 1 184 ? 18.788 -2.875  10.485  1.00 28.17 ? 184 GLU A CG  1 
ATOM   1371 C CD  . GLU A 1 184 ? 19.359 -4.307  10.450  1.00 31.58 ? 184 GLU A CD  1 
ATOM   1372 O OE1 . GLU A 1 184 ? 20.554 -4.504  10.082  1.00 30.70 ? 184 GLU A OE1 1 
ATOM   1373 O OE2 . GLU A 1 184 ? 18.599 -5.242  10.829  1.00 30.20 ? 184 GLU A OE2 1 
ATOM   1374 N N   . GLU A 1 185 ? 21.277 -0.224  7.594   1.00 24.08 ? 185 GLU A N   1 
ATOM   1375 C CA  . GLU A 1 185 ? 21.840 0.960   6.973   1.00 23.93 ? 185 GLU A CA  1 
ATOM   1376 C C   . GLU A 1 185 ? 21.475 1.056   5.492   1.00 23.76 ? 185 GLU A C   1 
ATOM   1377 O O   . GLU A 1 185 ? 21.106 2.133   5.010   1.00 22.81 ? 185 GLU A O   1 
ATOM   1378 C CB  . GLU A 1 185 ? 23.350 0.987   7.169   1.00 23.99 ? 185 GLU A CB  1 
ATOM   1379 C CG  . GLU A 1 185 ? 23.751 1.335   8.589   1.00 24.86 ? 185 GLU A CG  1 
ATOM   1380 C CD  . GLU A 1 185 ? 25.206 1.030   8.879   1.00 25.37 ? 185 GLU A CD  1 
ATOM   1381 O OE1 . GLU A 1 185 ? 25.751 0.074   8.283   1.00 27.03 ? 185 GLU A OE1 1 
ATOM   1382 O OE2 . GLU A 1 185 ? 25.797 1.742   9.711   1.00 24.29 ? 185 GLU A OE2 1 
ATOM   1383 N N   . LEU A 1 186 ? 21.575 -0.065  4.776   1.00 22.89 ? 186 LEU A N   1 
ATOM   1384 C CA  . LEU A 1 186 ? 21.238 -0.088  3.358   1.00 23.28 ? 186 LEU A CA  1 
ATOM   1385 C C   . LEU A 1 186 ? 19.757 0.196   3.140   1.00 23.22 ? 186 LEU A C   1 
ATOM   1386 O O   . LEU A 1 186 ? 19.393 0.927   2.217   1.00 22.67 ? 186 LEU A O   1 
ATOM   1387 C CB  . LEU A 1 186 ? 21.606 -1.425  2.713   1.00 23.76 ? 186 LEU A CB  1 
ATOM   1388 C CG  . LEU A 1 186 ? 23.086 -1.679  2.475   1.00 26.16 ? 186 LEU A CG  1 
ATOM   1389 C CD1 . LEU A 1 186 ? 23.357 -3.200  2.359   1.00 29.78 ? 186 LEU A CD1 1 
ATOM   1390 C CD2 . LEU A 1 186 ? 23.553 -0.924  1.219   1.00 28.82 ? 186 LEU A CD2 1 
ATOM   1391 N N   . ALA A 1 187 ? 18.908 -0.384  3.988   1.00 22.62 ? 187 ALA A N   1 
ATOM   1392 C CA  . ALA A 1 187 ? 17.465 -0.138  3.934   1.00 22.90 ? 187 ALA A CA  1 
ATOM   1393 C C   . ALA A 1 187 ? 17.128 1.328   4.204   1.00 23.09 ? 187 ALA A C   1 
ATOM   1394 O O   . ALA A 1 187 ? 16.397 1.949   3.429   1.00 23.19 ? 187 ALA A O   1 
ATOM   1395 C CB  . ALA A 1 187 ? 16.726 -1.064  4.911   1.00 22.98 ? 187 ALA A CB  1 
ATOM   1396 N N   . THR A 1 188 ? 17.676 1.881   5.285   1.00 23.35 ? 188 THR A N   1 
ATOM   1397 C CA  . THR A 1 188 ? 17.397 3.267   5.681   1.00 24.69 ? 188 THR A CA  1 
ATOM   1398 C C   . THR A 1 188 ? 17.849 4.237   4.574   1.00 24.59 ? 188 THR A C   1 
ATOM   1399 O O   . THR A 1 188 ? 17.103 5.143   4.164   1.00 25.21 ? 188 THR A O   1 
ATOM   1400 C CB  . THR A 1 188 ? 18.090 3.619   7.022   1.00 24.69 ? 188 THR A CB  1 
ATOM   1401 O OG1 . THR A 1 188 ? 17.575 2.770   8.066   1.00 26.23 ? 188 THR A OG1 1 
ATOM   1402 C CG2 . THR A 1 188 ? 17.851 5.089   7.403   1.00 26.06 ? 188 THR A CG2 1 
ATOM   1403 N N   . LEU A 1 189 ? 19.068 4.029   4.092   1.00 24.02 ? 189 LEU A N   1 
ATOM   1404 C CA  . LEU A 1 189 ? 19.642 4.844   3.017   1.00 24.36 ? 189 LEU A CA  1 
ATOM   1405 C C   . LEU A 1 189 ? 18.729 4.894   1.787   1.00 24.35 ? 189 LEU A C   1 
ATOM   1406 O O   . LEU A 1 189 ? 18.636 5.928   1.102   1.00 24.50 ? 189 LEU A O   1 
ATOM   1407 C CB  . LEU A 1 189 ? 20.998 4.254   2.632   1.00 23.43 ? 189 LEU A CB  1 
ATOM   1408 C CG  . LEU A 1 189 ? 22.175 5.060   2.096   1.00 26.24 ? 189 LEU A CG  1 
ATOM   1409 C CD1 . LEU A 1 189 ? 22.361 6.439   2.747   1.00 23.14 ? 189 LEU A CD1 1 
ATOM   1410 C CD2 . LEU A 1 189 ? 23.447 4.191   2.249   1.00 25.02 ? 189 LEU A CD2 1 
ATOM   1411 N N   . SER A 1 190 ? 18.033 3.790   1.533   1.00 23.57 ? 190 SER A N   1 
ATOM   1412 C CA  . SER A 1 190 ? 17.244 3.634   0.325   1.00 24.24 ? 190 SER A CA  1 
ATOM   1413 C C   . SER A 1 190 ? 15.722 3.751   0.543   1.00 23.13 ? 190 SER A C   1 
ATOM   1414 O O   . SER A 1 190 ? 14.936 3.423   -0.343  1.00 23.18 ? 190 SER A O   1 
ATOM   1415 C CB  . SER A 1 190 ? 17.623 2.308   -0.345  1.00 24.67 ? 190 SER A CB  1 
ATOM   1416 O OG  . SER A 1 190 ? 17.032 1.243   0.365   1.00 28.62 ? 190 SER A OG  1 
ATOM   1417 N N   . ASN A 1 191 ? 15.325 4.241   1.716   1.00 22.95 ? 191 ASN A N   1 
ATOM   1418 C CA  . ASN A 1 191 ? 13.924 4.486   2.072   1.00 22.60 ? 191 ASN A CA  1 
ATOM   1419 C C   . ASN A 1 191 ? 13.057 3.234   1.927   1.00 22.54 ? 191 ASN A C   1 
ATOM   1420 O O   . ASN A 1 191 ? 12.026 3.261   1.251   1.00 21.43 ? 191 ASN A O   1 
ATOM   1421 C CB  . ASN A 1 191 ? 13.314 5.652   1.257   1.00 22.18 ? 191 ASN A CB  1 
ATOM   1422 C CG  . ASN A 1 191 ? 11.890 5.998   1.697   1.00 22.91 ? 191 ASN A CG  1 
ATOM   1423 O OD1 . ASN A 1 191 ? 11.523 5.821   2.861   1.00 22.33 ? 191 ASN A OD1 1 
ATOM   1424 N ND2 . ASN A 1 191 ? 11.082 6.495   0.763   1.00 24.39 ? 191 ASN A ND2 1 
ATOM   1425 N N   . MET A 1 192 ? 13.493 2.134   2.536   1.00 22.79 ? 192 MET A N   1 
ATOM   1426 C CA  . MET A 1 192 ? 12.675 0.919   2.572   1.00 23.05 ? 192 MET A CA  1 
ATOM   1427 C C   . MET A 1 192 ? 12.843 0.165   3.877   1.00 24.56 ? 192 MET A C   1 
ATOM   1428 O O   . MET A 1 192 ? 13.724 0.485   4.677   1.00 24.36 ? 192 MET A O   1 
ATOM   1429 C CB  . MET A 1 192 ? 12.926 0.014   1.348   1.00 23.10 ? 192 MET A CB  1 
ATOM   1430 C CG  . MET A 1 192 ? 14.335 -0.594  1.201   1.00 22.72 ? 192 MET A CG  1 
ATOM   1431 S SD  . MET A 1 192 ? 14.561 -1.519  -0.324  1.00 19.57 ? 192 MET A SD  1 
ATOM   1432 C CE  . MET A 1 192 ? 14.511 -0.166  -1.521  1.00 25.71 ? 192 MET A CE  1 
ATOM   1433 N N   . THR A 1 193 ? 11.960 -0.809  4.100   1.00 25.84 ? 193 THR A N   1 
ATOM   1434 C CA  . THR A 1 193 ? 12.075 -1.697  5.246   1.00 26.86 ? 193 THR A CA  1 
ATOM   1435 C C   . THR A 1 193 ? 13.220 -2.667  4.973   1.00 26.99 ? 193 THR A C   1 
ATOM   1436 O O   . THR A 1 193 ? 13.542 -2.961  3.817   1.00 26.27 ? 193 THR A O   1 
ATOM   1437 C CB  . THR A 1 193 ? 10.775 -2.517  5.488   1.00 26.72 ? 193 THR A CB  1 
ATOM   1438 O OG1 . THR A 1 193 ? 10.379 -3.156  4.271   1.00 27.18 ? 193 THR A OG1 1 
ATOM   1439 C CG2 . THR A 1 193 ? 9.630  -1.623  5.985   1.00 28.17 ? 193 THR A CG2 1 
ATOM   1440 N N   . VAL A 1 194 ? 13.846 -3.145  6.044   1.00 27.89 ? 194 VAL A N   1 
ATOM   1441 C CA  . VAL A 1 194 ? 14.861 -4.191  5.926   1.00 28.70 ? 194 VAL A CA  1 
ATOM   1442 C C   . VAL A 1 194 ? 14.295 -5.403  5.174   1.00 29.22 ? 194 VAL A C   1 
ATOM   1443 O O   . VAL A 1 194 ? 14.981 -5.967  4.306   1.00 29.25 ? 194 VAL A O   1 
ATOM   1444 C CB  . VAL A 1 194 ? 15.469 -4.559  7.297   1.00 28.93 ? 194 VAL A CB  1 
ATOM   1445 C CG1 . VAL A 1 194 ? 16.452 -5.726  7.173   1.00 29.26 ? 194 VAL A CG1 1 
ATOM   1446 C CG2 . VAL A 1 194 ? 16.163 -3.348  7.886   1.00 29.31 ? 194 VAL A CG2 1 
ATOM   1447 N N   . SER A 1 195 ? 13.034 -5.771  5.452   1.00 29.66 ? 195 SER A N   1 
ATOM   1448 C CA  . SER A 1 195 ? 12.369 -6.860  4.713   1.00 29.97 ? 195 SER A CA  1 
ATOM   1449 C C   . SER A 1 195 ? 12.396 -6.608  3.220   1.00 29.75 ? 195 SER A C   1 
ATOM   1450 O O   . SER A 1 195 ? 12.760 -7.488  2.434   1.00 29.66 ? 195 SER A O   1 
ATOM   1451 C CB  . SER A 1 195 ? 10.904 -7.060  5.147   1.00 30.64 ? 195 SER A CB  1 
ATOM   1452 O OG  . SER A 1 195 ? 10.199 -7.825  4.163   1.00 32.63 ? 195 SER A OG  1 
ATOM   1453 N N   . ASN A 1 196 ? 12.009 -5.398  2.821   1.00 29.45 ? 196 ASN A N   1 
ATOM   1454 C CA  . ASN A 1 196 ? 12.036 -5.061  1.407   1.00 28.75 ? 196 ASN A CA  1 
ATOM   1455 C C   . ASN A 1 196 ? 13.435 -5.047  0.825   1.00 27.62 ? 196 ASN A C   1 
ATOM   1456 O O   . ASN A 1 196 ? 13.618 -5.431  -0.313  1.00 27.69 ? 196 ASN A O   1 
ATOM   1457 C CB  . ASN A 1 196 ? 11.295 -3.757  1.133   1.00 29.58 ? 196 ASN A CB  1 
ATOM   1458 C CG  . ASN A 1 196 ? 9.836  -3.988  0.800   1.00 31.45 ? 196 ASN A CG  1 
ATOM   1459 O OD1 . ASN A 1 196 ? 9.500  -4.832  -0.044  1.00 35.05 ? 196 ASN A OD1 1 
ATOM   1460 N ND2 . ASN A 1 196 ? 8.963  -3.246  1.458   1.00 33.99 ? 196 ASN A ND2 1 
ATOM   1461 N N   . ALA A 1 197 ? 14.413 -4.605  1.612   1.00 27.25 ? 197 ALA A N   1 
ATOM   1462 C CA  . ALA A 1 197 ? 15.812 -4.559  1.159   1.00 26.75 ? 197 ALA A CA  1 
ATOM   1463 C C   . ALA A 1 197 ? 16.327 -5.971  0.902   1.00 26.43 ? 197 ALA A C   1 
ATOM   1464 O O   . ALA A 1 197 ? 16.875 -6.262  -0.171  1.00 25.77 ? 197 ALA A O   1 
ATOM   1465 C CB  . ALA A 1 197 ? 16.672 -3.863  2.186   1.00 26.38 ? 197 ALA A CB  1 
ATOM   1466 N N   . ILE A 1 198 ? 16.133 -6.849  1.886   1.00 26.29 ? 198 ILE A N   1 
ATOM   1467 C CA  . ILE A 1 198 ? 16.620 -8.224  1.769   1.00 27.31 ? 198 ILE A CA  1 
ATOM   1468 C C   . ILE A 1 198 ? 15.863 -8.983  0.685   1.00 27.12 ? 198 ILE A C   1 
ATOM   1469 O O   . ILE A 1 198 ? 16.453 -9.737  -0.074  1.00 27.48 ? 198 ILE A O   1 
ATOM   1470 C CB  . ILE A 1 198 ? 16.725 -8.983  3.148   1.00 26.87 ? 198 ILE A CB  1 
ATOM   1471 C CG1 . ILE A 1 198 ? 15.357 -9.182  3.809   1.00 27.23 ? 198 ILE A CG1 1 
ATOM   1472 C CG2 . ILE A 1 198 ? 17.688 -8.246  4.077   1.00 27.59 ? 198 ILE A CG2 1 
ATOM   1473 C CD1 . ILE A 1 198 ? 15.420 -9.926  5.123   1.00 27.57 ? 198 ILE A CD1 1 
ATOM   1474 N N   . ARG A 1 199 ? 14.571 -8.708  0.575   1.00 28.11 ? 199 ARG A N   1 
ATOM   1475 C CA  . ARG A 1 199 ? 13.737 -9.223  -0.508  1.00 28.31 ? 199 ARG A CA  1 
ATOM   1476 C C   . ARG A 1 199 ? 14.289 -8.781  -1.870  1.00 28.40 ? 199 ARG A C   1 
ATOM   1477 O O   . ARG A 1 199 ? 14.460 -9.609  -2.771  1.00 28.25 ? 199 ARG A O   1 
ATOM   1478 C CB  . ARG A 1 199 ? 12.296 -8.726  -0.308  1.00 28.74 ? 199 ARG A CB  1 
ATOM   1479 C CG  . ARG A 1 199 ? 11.213 -9.533  -0.960  1.00 28.25 ? 199 ARG A CG  1 
ATOM   1480 C CD  . ARG A 1 199 ? 9.848  -8.919  -0.680  1.00 28.68 ? 199 ARG A CD  1 
ATOM   1481 N NE  . ARG A 1 199 ? 9.298  -9.237  0.644   1.00 29.86 ? 199 ARG A NE  1 
ATOM   1482 C CZ  . ARG A 1 199 ? 8.672  -10.375 0.949   1.00 29.80 ? 199 ARG A CZ  1 
ATOM   1483 N NH1 . ARG A 1 199 ? 8.543  -11.338 0.039   1.00 31.04 ? 199 ARG A NH1 1 
ATOM   1484 N NH2 . ARG A 1 199 ? 8.192  -10.566 2.173   1.00 29.72 ? 199 ARG A NH2 1 
ATOM   1485 N N   . THR A 1 200 ? 14.600 -7.487  -2.012  1.00 27.76 ? 200 THR A N   1 
ATOM   1486 C CA  . THR A 1 200 ? 15.110 -6.945  -3.283  1.00 28.09 ? 200 THR A CA  1 
ATOM   1487 C C   . THR A 1 200 ? 16.523 -7.428  -3.614  1.00 27.99 ? 200 THR A C   1 
ATOM   1488 O O   . THR A 1 200 ? 16.797 -7.739  -4.763  1.00 28.02 ? 200 THR A O   1 
ATOM   1489 C CB  . THR A 1 200 ? 15.065 -5.394  -3.315  1.00 27.63 ? 200 THR A CB  1 
ATOM   1490 O OG1 . THR A 1 200 ? 13.751 -4.964  -2.969  1.00 28.52 ? 200 THR A OG1 1 
ATOM   1491 C CG2 . THR A 1 200 ? 15.415 -4.853  -4.705  1.00 28.10 ? 200 THR A CG2 1 
ATOM   1492 N N   . LEU A 1 201 ? 17.410 -7.478  -2.612  1.00 28.44 ? 201 LEU A N   1 
ATOM   1493 C CA  . LEU A 1 201 ? 18.747 -8.055  -2.797  1.00 29.32 ? 201 LEU A CA  1 
ATOM   1494 C C   . LEU A 1 201 ? 18.660 -9.511  -3.293  1.00 30.20 ? 201 LEU A C   1 
ATOM   1495 O O   . LEU A 1 201 ? 19.338 -9.893  -4.238  1.00 29.80 ? 201 LEU A O   1 
ATOM   1496 C CB  . LEU A 1 201 ? 19.561 -8.008  -1.491  1.00 28.98 ? 201 LEU A CB  1 
ATOM   1497 C CG  . LEU A 1 201 ? 20.134 -6.663  -1.023  1.00 28.24 ? 201 LEU A CG  1 
ATOM   1498 C CD1 . LEU A 1 201 ? 20.665 -6.762  0.404   1.00 25.56 ? 201 LEU A CD1 1 
ATOM   1499 C CD2 . LEU A 1 201 ? 21.217 -6.181  -1.972  1.00 26.99 ? 201 LEU A CD2 1 
ATOM   1500 N N   . SER A 1 202 ? 17.825 -10.305 -2.626  1.00 31.94 ? 202 SER A N   1 
ATOM   1501 C CA  . SER A 1 202 ? 17.547 -11.686 -3.030  1.00 33.59 ? 202 SER A CA  1 
ATOM   1502 C C   . SER A 1 202 ? 17.206 -11.776 -4.523  1.00 33.88 ? 202 SER A C   1 
ATOM   1503 O O   . SER A 1 202 ? 17.810 -12.559 -5.247  1.00 34.43 ? 202 SER A O   1 
ATOM   1504 C CB  . SER A 1 202 ? 16.423 -12.266 -2.171  1.00 33.88 ? 202 SER A CB  1 
ATOM   1505 O OG  . SER A 1 202 ? 16.256 -13.649 -2.429  1.00 36.73 ? 202 SER A OG  1 
ATOM   1506 N N   . THR A 1 203 ? 16.272 -10.941 -4.981  1.00 34.53 ? 203 THR A N   1 
ATOM   1507 C CA  . THR A 1 203 ? 15.903 -10.863 -6.397  1.00 34.67 ? 203 THR A CA  1 
ATOM   1508 C C   . THR A 1 203 ? 17.060 -10.423 -7.300  1.00 35.14 ? 203 THR A C   1 
ATOM   1509 O O   . THR A 1 203 ? 17.237 -10.950 -8.408  1.00 35.00 ? 203 THR A O   1 
ATOM   1510 C CB  . THR A 1 203 ? 14.679 -9.937  -6.607  1.00 35.05 ? 203 THR A CB  1 
ATOM   1511 O OG1 . THR A 1 203 ? 13.548 -10.486 -5.920  1.00 34.57 ? 203 THR A OG1 1 
ATOM   1512 C CG2 . THR A 1 203 ? 14.336 -9.784  -8.092  1.00 35.36 ? 203 THR A CG2 1 
ATOM   1513 N N   . PHE A 1 204 ? 17.853 -9.457  -6.840  1.00 35.04 ? 204 PHE A N   1 
ATOM   1514 C CA  . PHE A 1 204 ? 19.003 -9.015  -7.629  1.00 35.65 ? 204 PHE A CA  1 
ATOM   1515 C C   . PHE A 1 204 ? 20.030 -10.153 -7.823  1.00 35.90 ? 204 PHE A C   1 
ATOM   1516 O O   . PHE A 1 204 ? 20.640 -10.254 -8.878  1.00 35.79 ? 204 PHE A O   1 
ATOM   1517 C CB  . PHE A 1 204 ? 19.667 -7.767  -7.016  1.00 35.22 ? 204 PHE A CB  1 
ATOM   1518 C CG  . PHE A 1 204 ? 18.880 -6.480  -7.198  1.00 35.10 ? 204 PHE A CG  1 
ATOM   1519 C CD1 . PHE A 1 204 ? 17.732 -6.428  -8.002  1.00 34.51 ? 204 PHE A CD1 1 
ATOM   1520 C CD2 . PHE A 1 204 ? 19.321 -5.301  -6.586  1.00 35.05 ? 204 PHE A CD2 1 
ATOM   1521 C CE1 . PHE A 1 204 ? 17.013 -5.231  -8.164  1.00 35.35 ? 204 PHE A CE1 1 
ATOM   1522 C CE2 . PHE A 1 204 ? 18.621 -4.088  -6.745  1.00 34.72 ? 204 PHE A CE2 1 
ATOM   1523 C CZ  . PHE A 1 204 ? 17.463 -4.050  -7.538  1.00 35.16 ? 204 PHE A CZ  1 
ATOM   1524 N N   . VAL A 1 205 ? 20.212 -10.993 -6.802  1.00 36.72 ? 205 VAL A N   1 
ATOM   1525 C CA  . VAL A 1 205 ? 21.043 -12.205 -6.917  1.00 37.72 ? 205 VAL A CA  1 
ATOM   1526 C C   . VAL A 1 205 ? 20.423 -13.228 -7.884  1.00 38.59 ? 205 VAL A C   1 
ATOM   1527 O O   . VAL A 1 205 ? 21.118 -13.736 -8.768  1.00 39.20 ? 205 VAL A O   1 
ATOM   1528 C CB  . VAL A 1 205 ? 21.312 -12.881 -5.543  1.00 37.68 ? 205 VAL A CB  1 
ATOM   1529 C CG1 . VAL A 1 205 ? 22.147 -14.150 -5.714  1.00 37.37 ? 205 VAL A CG1 1 
ATOM   1530 C CG2 . VAL A 1 205 ? 22.018 -11.924 -4.601  1.00 37.45 ? 205 VAL A CG2 1 
ATOM   1531 N N   . SER A 1 206 ? 19.127 -13.512 -7.719  1.00 39.50 ? 206 SER A N   1 
ATOM   1532 C CA  . SER A 1 206 ? 18.383 -14.389 -8.643  1.00 40.36 ? 206 SER A CA  1 
ATOM   1533 C C   . SER A 1 206 ? 18.561 -13.951 -10.087 1.00 40.75 ? 206 SER A C   1 
ATOM   1534 O O   . SER A 1 206 ? 18.701 -14.785 -10.977 1.00 41.37 ? 206 SER A O   1 
ATOM   1535 C CB  . SER A 1 206 ? 16.885 -14.404 -8.322  1.00 40.31 ? 206 SER A CB  1 
ATOM   1536 O OG  . SER A 1 206 ? 16.632 -14.867 -7.011  1.00 40.78 ? 206 SER A OG  1 
ATOM   1537 N N   . GLU A 1 207 ? 18.550 -12.639 -10.319 1.00 41.35 ? 207 GLU A N   1 
ATOM   1538 C CA  . GLU A 1 207 ? 18.725 -12.083 -11.665 1.00 41.33 ? 207 GLU A CA  1 
ATOM   1539 C C   . GLU A 1 207 ? 20.186 -11.969 -12.092 1.00 41.30 ? 207 GLU A C   1 
ATOM   1540 O O   . GLU A 1 207 ? 20.476 -11.483 -13.184 1.00 41.33 ? 207 GLU A O   1 
ATOM   1541 C CB  . GLU A 1 207 ? 18.054 -10.716 -11.774 1.00 41.71 ? 207 GLU A CB  1 
ATOM   1542 C CG  . GLU A 1 207 ? 16.534 -10.761 -11.731 1.00 42.55 ? 207 GLU A CG  1 
ATOM   1543 C CD  . GLU A 1 207 ? 15.917 -9.391  -11.545 1.00 43.63 ? 207 GLU A CD  1 
ATOM   1544 O OE1 . GLU A 1 207 ? 16.661 -8.386  -11.595 1.00 44.20 ? 207 GLU A OE1 1 
ATOM   1545 O OE2 . GLU A 1 207 ? 14.688 -9.320  -11.339 1.00 44.21 ? 207 GLU A OE2 1 
ATOM   1546 N N   . ARG A 1 208 ? 21.101 -12.413 -11.232 1.00 41.09 ? 208 ARG A N   1 
ATOM   1547 C CA  . ARG A 1 208 ? 22.538 -12.356 -11.519 1.00 41.12 ? 208 ARG A CA  1 
ATOM   1548 C C   . ARG A 1 208 ? 23.044 -10.927 -11.812 1.00 39.91 ? 208 ARG A C   1 
ATOM   1549 O O   . ARG A 1 208 ? 23.874 -10.710 -12.705 1.00 39.44 ? 208 ARG A O   1 
ATOM   1550 C CB  . ARG A 1 208 ? 22.915 -13.361 -12.621 1.00 41.16 ? 208 ARG A CB  1 
ATOM   1551 C CG  . ARG A 1 208 ? 22.611 -14.802 -12.220 1.00 42.68 ? 208 ARG A CG  1 
ATOM   1552 C CD  . ARG A 1 208 ? 22.828 -15.829 -13.341 1.00 43.58 ? 208 ARG A CD  1 
ATOM   1553 N NE  . ARG A 1 208 ? 22.355 -17.149 -12.905 1.00 48.74 ? 208 ARG A NE  1 
ATOM   1554 C CZ  . ARG A 1 208 ? 21.212 -17.713 -13.296 1.00 50.83 ? 208 ARG A CZ  1 
ATOM   1555 N NH1 . ARG A 1 208 ? 20.421 -17.093 -14.165 1.00 51.87 ? 208 ARG A NH1 1 
ATOM   1556 N NH2 . ARG A 1 208 ? 20.864 -18.911 -12.828 1.00 51.55 ? 208 ARG A NH2 1 
ATOM   1557 N N   . MET A 1 209 ? 22.531 -9.959  -11.050 1.00 38.90 ? 209 MET A N   1 
ATOM   1558 C CA  . MET A 1 209 ? 23.085 -8.597  -11.049 1.00 37.82 ? 209 MET A CA  1 
ATOM   1559 C C   . MET A 1 209 ? 24.082 -8.443  -9.902  1.00 36.98 ? 209 MET A C   1 
ATOM   1560 O O   . MET A 1 209 ? 25.068 -7.708  -10.019 1.00 36.91 ? 209 MET A O   1 
ATOM   1561 C CB  . MET A 1 209 ? 21.993 -7.538  -10.912 1.00 37.89 ? 209 MET A CB  1 
ATOM   1562 C CG  . MET A 1 209 ? 20.839 -7.658  -11.886 1.00 38.33 ? 209 MET A CG  1 
ATOM   1563 S SD  . MET A 1 209 ? 19.851 -6.149  -11.907 1.00 37.91 ? 209 MET A SD  1 
ATOM   1564 C CE  . MET A 1 209 ? 20.433 -5.516  -13.391 1.00 34.55 ? 209 MET A CE  1 
ATOM   1565 N N   . LEU A 1 210 ? 23.812 -9.148  -8.804  1.00 35.89 ? 210 LEU A N   1 
ATOM   1566 C CA  . LEU A 1 210 ? 24.664 -9.137  -7.623  1.00 35.17 ? 210 LEU A CA  1 
ATOM   1567 C C   . LEU A 1 210 ? 25.070 -10.544 -7.194  1.00 35.24 ? 210 LEU A C   1 
ATOM   1568 O O   . LEU A 1 210 ? 24.541 -11.532 -7.704  1.00 35.13 ? 210 LEU A O   1 
ATOM   1569 C CB  . LEU A 1 210 ? 23.955 -8.451  -6.445  1.00 34.64 ? 210 LEU A CB  1 
ATOM   1570 C CG  . LEU A 1 210 ? 23.472 -7.000  -6.552  1.00 33.90 ? 210 LEU A CG  1 
ATOM   1571 C CD1 . LEU A 1 210 ? 22.808 -6.611  -5.247  1.00 31.40 ? 210 LEU A CD1 1 
ATOM   1572 C CD2 . LEU A 1 210 ? 24.602 -6.023  -6.891  1.00 32.34 ? 210 LEU A CD2 1 
ATOM   1573 N N   . ALA A 1 211 ? 26.011 -10.603 -6.255  1.00 35.05 ? 211 ALA A N   1 
ATOM   1574 C CA  . ALA A 1 211 ? 26.328 -11.793 -5.484  1.00 35.09 ? 211 ALA A CA  1 
ATOM   1575 C C   . ALA A 1 211 ? 26.583 -11.302 -4.067  1.00 35.50 ? 211 ALA A C   1 
ATOM   1576 O O   . ALA A 1 211 ? 27.190 -10.240 -3.879  1.00 35.50 ? 211 ALA A O   1 
ATOM   1577 C CB  . ALA A 1 211 ? 27.559 -12.491 -6.047  1.00 35.02 ? 211 ALA A CB  1 
ATOM   1578 N N   . LEU A 1 212 ? 26.101 -12.052 -3.076  1.00 35.52 ? 212 LEU A N   1 
ATOM   1579 C CA  . LEU A 1 212 ? 26.170 -11.641 -1.667  1.00 36.22 ? 212 LEU A CA  1 
ATOM   1580 C C   . LEU A 1 212 ? 26.976 -12.606 -0.796  1.00 36.51 ? 212 LEU A C   1 
ATOM   1581 O O   . LEU A 1 212 ? 26.913 -13.818 -0.975  1.00 36.26 ? 212 LEU A O   1 
ATOM   1582 C CB  . LEU A 1 212 ? 24.760 -11.492 -1.077  1.00 36.19 ? 212 LEU A CB  1 
ATOM   1583 C CG  . LEU A 1 212 ? 23.755 -10.529 -1.716  1.00 37.00 ? 212 LEU A CG  1 
ATOM   1584 C CD1 . LEU A 1 212 ? 22.406 -10.605 -1.003  1.00 38.36 ? 212 LEU A CD1 1 
ATOM   1585 C CD2 . LEU A 1 212 ? 24.276 -9.098  -1.739  1.00 37.87 ? 212 LEU A CD2 1 
ATOM   1586 N N   . ASP A 1 213 ? 27.716 -12.058 0.161   1.00 36.75 ? 213 ASP A N   1 
ATOM   1587 C CA  . ASP A 1 213 ? 28.554 -12.857 1.053   1.00 37.05 ? 213 ASP A CA  1 
ATOM   1588 C C   . ASP A 1 213 ? 28.714 -12.080 2.350   1.00 36.85 ? 213 ASP A C   1 
ATOM   1589 O O   . ASP A 1 213 ? 29.671 -11.326 2.523   1.00 36.45 ? 213 ASP A O   1 
ATOM   1590 C CB  . ASP A 1 213 ? 29.916 -13.135 0.403   1.00 37.61 ? 213 ASP A CB  1 
ATOM   1591 C CG  . ASP A 1 213 ? 30.815 -14.034 1.253   1.00 39.75 ? 213 ASP A CG  1 
ATOM   1592 O OD1 . ASP A 1 213 ? 30.355 -14.566 2.291   1.00 42.77 ? 213 ASP A OD1 1 
ATOM   1593 O OD2 . ASP A 1 213 ? 31.996 -14.201 0.883   1.00 42.61 ? 213 ASP A OD2 1 
ATOM   1594 N N   . GLY A 1 214 ? 27.757 -12.267 3.256   1.00 36.91 ? 214 GLY A N   1 
ATOM   1595 C CA  . GLY A 1 214 ? 27.684 -11.485 4.492   1.00 36.53 ? 214 GLY A CA  1 
ATOM   1596 C C   . GLY A 1 214 ? 27.308 -10.047 4.184   1.00 36.46 ? 214 GLY A C   1 
ATOM   1597 O O   . GLY A 1 214 ? 26.292 -9.787  3.538   1.00 36.83 ? 214 GLY A O   1 
ATOM   1598 N N   . LYS A 1 215 ? 28.134 -9.112  4.648   1.00 35.91 ? 215 LYS A N   1 
ATOM   1599 C CA  . LYS A 1 215 ? 27.967 -7.691  4.349   1.00 35.26 ? 215 LYS A CA  1 
ATOM   1600 C C   . LYS A 1 215 ? 28.608 -7.323  3.018   1.00 34.36 ? 215 LYS A C   1 
ATOM   1601 O O   . LYS A 1 215 ? 28.536 -6.171  2.602   1.00 34.42 ? 215 LYS A O   1 
ATOM   1602 C CB  . LYS A 1 215 ? 28.584 -6.832  5.460   1.00 35.70 ? 215 LYS A CB  1 
ATOM   1603 C CG  . LYS A 1 215 ? 27.730 -6.699  6.705   1.00 36.76 ? 215 LYS A CG  1 
ATOM   1604 C CD  . LYS A 1 215 ? 28.555 -6.145  7.851   1.00 40.17 ? 215 LYS A CD  1 
ATOM   1605 C CE  . LYS A 1 215 ? 27.682 -5.815  9.038   1.00 42.21 ? 215 LYS A CE  1 
ATOM   1606 N NZ  . LYS A 1 215 ? 28.455 -5.063  10.058  1.00 44.63 ? 215 LYS A NZ  1 
ATOM   1607 N N   . ARG A 1 216 ? 29.245 -8.293  2.363   1.00 33.15 ? 216 ARG A N   1 
ATOM   1608 C CA  . ARG A 1 216 ? 29.908 -8.062  1.079   1.00 32.43 ? 216 ARG A CA  1 
ATOM   1609 C C   . ARG A 1 216 ? 28.913 -8.136  -0.070  1.00 31.64 ? 216 ARG A C   1 
ATOM   1610 O O   . ARG A 1 216 ? 28.224 -9.146  -0.241  1.00 31.15 ? 216 ARG A O   1 
ATOM   1611 C CB  . ARG A 1 216 ? 31.065 -9.048  0.855   1.00 32.52 ? 216 ARG A CB  1 
ATOM   1612 C CG  . ARG A 1 216 ? 32.133 -8.989  1.945   1.00 35.28 ? 216 ARG A CG  1 
ATOM   1613 C CD  . ARG A 1 216 ? 33.451 -9.598  1.484   1.00 42.33 ? 216 ARG A CD  1 
ATOM   1614 N NE  . ARG A 1 216 ? 33.503 -11.046 1.666   1.00 47.02 ? 216 ARG A NE  1 
ATOM   1615 C CZ  . ARG A 1 216 ? 34.437 -11.699 2.363   1.00 49.98 ? 216 ARG A CZ  1 
ATOM   1616 N NH1 . ARG A 1 216 ? 35.438 -11.042 2.957   1.00 50.44 ? 216 ARG A NH1 1 
ATOM   1617 N NH2 . ARG A 1 216 ? 34.374 -13.025 2.455   1.00 49.80 ? 216 ARG A NH2 1 
ATOM   1618 N N   . ILE A 1 217 ? 28.832 -7.051  -0.842  1.00 30.29 ? 217 ILE A N   1 
ATOM   1619 C CA  . ILE A 1 217 ? 27.969 -6.990  -2.017  1.00 29.69 ? 217 ILE A CA  1 
ATOM   1620 C C   . ILE A 1 217 ? 28.838 -6.846  -3.267  1.00 29.82 ? 217 ILE A C   1 
ATOM   1621 O O   . ILE A 1 217 ? 29.581 -5.872  -3.425  1.00 28.50 ? 217 ILE A O   1 
ATOM   1622 C CB  . ILE A 1 217 ? 26.928 -5.825  -1.951  1.00 29.65 ? 217 ILE A CB  1 
ATOM   1623 C CG1 . ILE A 1 217 ? 26.082 -5.916  -0.674  1.00 29.05 ? 217 ILE A CG1 1 
ATOM   1624 C CG2 . ILE A 1 217 ? 26.053 -5.813  -3.205  1.00 27.89 ? 217 ILE A CG2 1 
ATOM   1625 C CD1 . ILE A 1 217 ? 25.113 -4.755  -0.480  1.00 29.41 ? 217 ILE A CD1 1 
ATOM   1626 N N   . LYS A 1 218 ? 28.735 -7.836  -4.144  1.00 30.37 ? 218 LYS A N   1 
ATOM   1627 C CA  . LYS A 1 218 ? 29.503 -7.866  -5.376  1.00 31.30 ? 218 LYS A CA  1 
ATOM   1628 C C   . LYS A 1 218 ? 28.596 -7.516  -6.540  1.00 32.17 ? 218 LYS A C   1 
ATOM   1629 O O   . LYS A 1 218 ? 27.563 -8.158  -6.736  1.00 31.96 ? 218 LYS A O   1 
ATOM   1630 C CB  . LYS A 1 218 ? 30.106 -9.253  -5.580  1.00 31.29 ? 218 LYS A CB  1 
ATOM   1631 C CG  . LYS A 1 218 ? 30.989 -9.359  -6.799  1.00 32.86 ? 218 LYS A CG  1 
ATOM   1632 C CD  . LYS A 1 218 ? 31.454 -10.793 -7.051  1.00 36.39 ? 218 LYS A CD  1 
ATOM   1633 C CE  . LYS A 1 218 ? 32.640 -11.167 -6.171  1.00 37.39 ? 218 LYS A CE  1 
ATOM   1634 N NZ  . LYS A 1 218 ? 33.230 -12.472 -6.599  1.00 38.71 ? 218 LYS A NZ  1 
ATOM   1635 N N   . ILE A 1 219 ? 28.977 -6.493  -7.302  1.00 32.85 ? 219 ILE A N   1 
ATOM   1636 C CA  . ILE A 1 219 ? 28.240 -6.117  -8.498  1.00 34.48 ? 219 ILE A CA  1 
ATOM   1637 C C   . ILE A 1 219 ? 28.791 -6.908  -9.681  1.00 36.04 ? 219 ILE A C   1 
ATOM   1638 O O   . ILE A 1 219 ? 29.941 -6.723  -10.075 1.00 36.13 ? 219 ILE A O   1 
ATOM   1639 C CB  . ILE A 1 219 ? 28.300 -4.597  -8.784  1.00 34.31 ? 219 ILE A CB  1 
ATOM   1640 C CG1 . ILE A 1 219 ? 27.669 -3.807  -7.632  1.00 33.88 ? 219 ILE A CG1 1 
ATOM   1641 C CG2 . ILE A 1 219 ? 27.587 -4.279  -10.112 1.00 34.12 ? 219 ILE A CG2 1 
ATOM   1642 C CD1 . ILE A 1 219 ? 27.910 -2.288  -7.701  1.00 34.26 ? 219 ILE A CD1 1 
ATOM   1643 N N   . ILE A 1 220 ? 27.969 -7.800  -10.229 1.00 37.82 ? 220 ILE A N   1 
ATOM   1644 C CA  . ILE A 1 220 ? 28.413 -8.665  -11.326 1.00 39.96 ? 220 ILE A CA  1 
ATOM   1645 C C   . ILE A 1 220 ? 27.863 -8.211  -12.684 1.00 40.81 ? 220 ILE A C   1 
ATOM   1646 O O   . ILE A 1 220 ? 28.380 -8.594  -13.734 1.00 41.34 ? 220 ILE A O   1 
ATOM   1647 C CB  . ILE A 1 220 ? 28.130 -10.173 -11.048 1.00 39.93 ? 220 ILE A CB  1 
ATOM   1648 C CG1 . ILE A 1 220 ? 26.638 -10.421 -10.782 1.00 40.15 ? 220 ILE A CG1 1 
ATOM   1649 C CG2 . ILE A 1 220 ? 28.989 -10.666 -9.873  1.00 40.12 ? 220 ILE A CG2 1 
ATOM   1650 C CD1 . ILE A 1 220 ? 26.278 -11.869 -10.505 1.00 40.62 ? 220 ILE A CD1 1 
ATOM   1651 N N   . ASP A 1 221 ? 26.818 -7.395  -12.659 1.00 42.07 ? 221 ASP A N   1 
ATOM   1652 C CA  . ASP A 1 221 ? 26.314 -6.788  -13.880 1.00 43.17 ? 221 ASP A CA  1 
ATOM   1653 C C   . ASP A 1 221 ? 25.973 -5.321  -13.653 1.00 44.01 ? 221 ASP A C   1 
ATOM   1654 O O   . ASP A 1 221 ? 24.811 -4.957  -13.431 1.00 44.00 ? 221 ASP A O   1 
ATOM   1655 C CB  . ASP A 1 221 ? 25.106 -7.553  -14.413 1.00 43.23 ? 221 ASP A CB  1 
ATOM   1656 C CG  . ASP A 1 221 ? 24.796 -7.216  -15.864 1.00 43.68 ? 221 ASP A CG  1 
ATOM   1657 O OD1 . ASP A 1 221 ? 25.408 -6.278  -16.430 1.00 42.69 ? 221 ASP A OD1 1 
ATOM   1658 O OD2 . ASP A 1 221 ? 23.928 -7.901  -16.433 1.00 44.25 ? 221 ASP A OD2 1 
ATOM   1659 N N   . CYS A 1 222 ? 27.001 -4.483  -13.719 1.00 45.21 ? 222 CYS A N   1 
ATOM   1660 C CA  . CYS A 1 222 ? 26.845 -3.063  -13.466 1.00 45.50 ? 222 CYS A CA  1 
ATOM   1661 C C   . CYS A 1 222 ? 25.936 -2.367  -14.486 1.00 45.59 ? 222 CYS A C   1 
ATOM   1662 O O   . CYS A 1 222 ? 25.068 -1.577  -14.101 1.00 45.13 ? 222 CYS A O   1 
ATOM   1663 C CB  . CYS A 1 222 ? 28.206 -2.385  -13.405 1.00 45.68 ? 222 CYS A CB  1 
ATOM   1664 S SG  . CYS A 1 222 ? 28.102 -0.740  -12.722 1.00 47.14 ? 222 CYS A SG  1 
ATOM   1665 N N   . ASP A 1 223 ? 26.131 -2.672  -15.773 1.00 45.68 ? 223 ASP A N   1 
ATOM   1666 C CA  . ASP A 1 223 ? 25.321 -2.085  -16.849 1.00 45.79 ? 223 ASP A CA  1 
ATOM   1667 C C   . ASP A 1 223 ? 23.832 -2.276  -16.605 1.00 45.14 ? 223 ASP A C   1 
ATOM   1668 O O   . ASP A 1 223 ? 23.050 -1.333  -16.740 1.00 45.14 ? 223 ASP A O   1 
ATOM   1669 C CB  . ASP A 1 223 ? 25.705 -2.661  -18.221 1.00 46.27 ? 223 ASP A CB  1 
ATOM   1670 C CG  . ASP A 1 223 ? 26.967 -2.029  -18.797 1.00 47.81 ? 223 ASP A CG  1 
ATOM   1671 O OD1 . ASP A 1 223 ? 27.225 -0.832  -18.533 1.00 49.56 ? 223 ASP A OD1 1 
ATOM   1672 O OD2 . ASP A 1 223 ? 27.699 -2.732  -19.532 1.00 50.00 ? 223 ASP A OD2 1 
ATOM   1673 N N   . ARG A 1 224 ? 23.450 -3.496  -16.235 1.00 44.65 ? 224 ARG A N   1 
ATOM   1674 C CA  . ARG A 1 224 ? 22.054 -3.813  -15.975 1.00 44.11 ? 224 ARG A CA  1 
ATOM   1675 C C   . ARG A 1 224 ? 21.576 -3.201  -14.658 1.00 43.28 ? 224 ARG A C   1 
ATOM   1676 O O   . ARG A 1 224 ? 20.433 -2.738  -14.567 1.00 43.05 ? 224 ARG A O   1 
ATOM   1677 C CB  . ARG A 1 224 ? 21.822 -5.329  -16.004 1.00 44.12 ? 224 ARG A CB  1 
ATOM   1678 C CG  . ARG A 1 224 ? 21.250 -5.847  -17.328 1.00 45.23 ? 224 ARG A CG  1 
ATOM   1679 C CD  . ARG A 1 224 ? 21.420 -7.355  -17.508 1.00 45.19 ? 224 ARG A CD  1 
ATOM   1680 N NE  . ARG A 1 224 ? 20.500 -8.156  -16.700 1.00 47.81 ? 224 ARG A NE  1 
ATOM   1681 C CZ  . ARG A 1 224 ? 20.865 -9.069  -15.796 1.00 48.40 ? 224 ARG A CZ  1 
ATOM   1682 N NH1 . ARG A 1 224 ? 22.149 -9.322  -15.553 1.00 47.87 ? 224 ARG A NH1 1 
ATOM   1683 N NH2 . ARG A 1 224 ? 19.932 -9.737  -15.126 1.00 48.02 ? 224 ARG A NH2 1 
ATOM   1684 N N   . LEU A 1 225 ? 22.443 -3.197  -13.641 1.00 42.38 ? 225 LEU A N   1 
ATOM   1685 C CA  . LEU A 1 225 ? 22.110 -2.538  -12.378 1.00 41.72 ? 225 LEU A CA  1 
ATOM   1686 C C   . LEU A 1 225 ? 21.770 -1.066  -12.628 1.00 41.84 ? 225 LEU A C   1 
ATOM   1687 O O   . LEU A 1 225 ? 20.794 -0.556  -12.085 1.00 41.56 ? 225 LEU A O   1 
ATOM   1688 C CB  . LEU A 1 225 ? 23.229 -2.699  -11.334 1.00 41.51 ? 225 LEU A CB  1 
ATOM   1689 C CG  . LEU A 1 225 ? 22.921 -2.259  -9.887  1.00 40.98 ? 225 LEU A CG  1 
ATOM   1690 C CD1 . LEU A 1 225 ? 21.842 -3.121  -9.222  1.00 39.69 ? 225 LEU A CD1 1 
ATOM   1691 C CD2 . LEU A 1 225 ? 24.177 -2.244  -9.029  1.00 40.94 ? 225 LEU A CD2 1 
ATOM   1692 N N   . GLN A 1 226 ? 22.561 -0.408  -13.476 1.00 42.13 ? 226 GLN A N   1 
ATOM   1693 C CA  . GLN A 1 226 ? 22.323 0.987   -13.868 1.00 42.77 ? 226 GLN A CA  1 
ATOM   1694 C C   . GLN A 1 226 ? 20.980 1.158   -14.593 1.00 42.49 ? 226 GLN A C   1 
ATOM   1695 O O   . GLN A 1 226 ? 20.244 2.115   -14.341 1.00 42.24 ? 226 GLN A O   1 
ATOM   1696 C CB  . GLN A 1 226 ? 23.483 1.525   -14.714 1.00 42.61 ? 226 GLN A CB  1 
ATOM   1697 C CG  . GLN A 1 226 ? 24.839 1.509   -13.997 1.00 44.37 ? 226 GLN A CG  1 
ATOM   1698 C CD  . GLN A 1 226 ? 26.003 1.948   -14.874 1.00 44.72 ? 226 GLN A CD  1 
ATOM   1699 O OE1 . GLN A 1 226 ? 25.978 3.033   -15.469 1.00 49.12 ? 226 GLN A OE1 1 
ATOM   1700 N NE2 . GLN A 1 226 ? 27.042 1.114   -14.947 1.00 46.21 ? 226 GLN A NE2 1 
ATOM   1701 N N   . LYS A 1 227 ? 20.657 0.219   -15.479 1.00 42.47 ? 227 LYS A N   1 
ATOM   1702 C CA  . LYS A 1 227 ? 19.356 0.218   -16.137 1.00 42.66 ? 227 LYS A CA  1 
ATOM   1703 C C   . LYS A 1 227 ? 18.224 0.093   -15.109 1.00 42.31 ? 227 LYS A C   1 
ATOM   1704 O O   . LYS A 1 227 ? 17.210 0.784   -15.215 1.00 42.53 ? 227 LYS A O   1 
ATOM   1705 C CB  . LYS A 1 227 ? 19.284 -0.900  -17.180 1.00 42.97 ? 227 LYS A CB  1 
ATOM   1706 C CG  . LYS A 1 227 ? 18.177 -0.726  -18.213 1.00 44.26 ? 227 LYS A CG  1 
ATOM   1707 C CD  . LYS A 1 227 ? 18.335 -1.722  -19.358 1.00 46.82 ? 227 LYS A CD  1 
ATOM   1708 C CE  . LYS A 1 227 ? 19.251 -1.190  -20.464 1.00 47.29 ? 227 LYS A CE  1 
ATOM   1709 N NZ  . LYS A 1 227 ? 18.526 -0.282  -21.404 1.00 47.65 ? 227 LYS A NZ  1 
ATOM   1710 N N   . THR A 1 228 ? 18.416 -0.769  -14.111 1.00 41.94 ? 228 THR A N   1 
ATOM   1711 C CA  . THR A 1 228 ? 17.445 -0.954  -13.030 1.00 41.60 ? 228 THR A CA  1 
ATOM   1712 C C   . THR A 1 228 ? 17.283 0.313   -12.187 1.00 41.72 ? 228 THR A C   1 
ATOM   1713 O O   . THR A 1 228 ? 16.164 0.682   -11.833 1.00 41.36 ? 228 THR A O   1 
ATOM   1714 C CB  . THR A 1 228 ? 17.829 -2.144  -12.125 1.00 41.54 ? 228 THR A CB  1 
ATOM   1715 O OG1 . THR A 1 228 ? 18.085 -3.293  -12.940 1.00 41.31 ? 228 THR A OG1 1 
ATOM   1716 C CG2 . THR A 1 228 ? 16.719 -2.460  -11.131 1.00 40.85 ? 228 THR A CG2 1 
ATOM   1717 N N   . ALA A 1 229 ? 18.395 0.977   -11.872 1.00 41.92 ? 229 ALA A N   1 
ATOM   1718 C CA  . ALA A 1 229 ? 18.346 2.254   -11.153 1.00 42.59 ? 229 ALA A CA  1 
ATOM   1719 C C   . ALA A 1 229 ? 17.526 3.281   -11.922 1.00 43.32 ? 229 ALA A C   1 
ATOM   1720 O O   . ALA A 1 229 ? 16.721 3.998   -11.335 1.00 42.88 ? 229 ALA A O   1 
ATOM   1721 C CB  . ALA A 1 229 ? 19.741 2.783   -10.894 1.00 42.30 ? 229 ALA A CB  1 
ATOM   1722 N N   . ARG A 1 230 ? 17.719 3.323   -13.238 1.00 44.52 ? 230 ARG A N   1 
ATOM   1723 C CA  . ARG A 1 230 ? 17.069 4.325   -14.082 1.00 46.19 ? 230 ARG A CA  1 
ATOM   1724 C C   . ARG A 1 230 ? 15.647 3.960   -14.476 1.00 46.89 ? 230 ARG A C   1 
ATOM   1725 O O   . ARG A 1 230 ? 14.748 4.793   -14.366 1.00 47.37 ? 230 ARG A O   1 
ATOM   1726 C CB  . ARG A 1 230 ? 17.896 4.609   -15.332 1.00 46.23 ? 230 ARG A CB  1 
ATOM   1727 C CG  . ARG A 1 230 ? 19.073 5.521   -15.078 1.00 48.15 ? 230 ARG A CG  1 
ATOM   1728 C CD  . ARG A 1 230 ? 19.816 5.825   -16.366 1.00 50.89 ? 230 ARG A CD  1 
ATOM   1729 N NE  . ARG A 1 230 ? 21.081 6.509   -16.109 1.00 52.61 ? 230 ARG A NE  1 
ATOM   1730 C CZ  . ARG A 1 230 ? 21.982 6.800   -17.043 1.00 53.80 ? 230 ARG A CZ  1 
ATOM   1731 N NH1 . ARG A 1 230 ? 21.766 6.467   -18.315 1.00 54.25 ? 230 ARG A NH1 1 
ATOM   1732 N NH2 . ARG A 1 230 ? 23.102 7.423   -16.703 1.00 53.14 ? 230 ARG A NH2 1 
ATOM   1733 N N   . SER A 1 231 ? 15.455 2.718   -14.920 1.00 47.64 ? 231 SER A N   1 
ATOM   1734 C CA  . SER A 1 231 ? 14.196 2.275   -15.523 1.00 48.26 ? 231 SER A CA  1 
ATOM   1735 C C   . SER A 1 231 ? 13.252 1.607   -14.526 1.00 48.51 ? 231 SER A C   1 
ATOM   1736 O O   . SER A 1 231 ? 12.036 1.674   -14.689 1.00 48.72 ? 231 SER A O   1 
ATOM   1737 C CB  . SER A 1 231 ? 14.468 1.323   -16.696 1.00 48.35 ? 231 SER A CB  1 
ATOM   1738 O OG  . SER A 1 231 ? 15.500 1.816   -17.536 1.00 48.09 ? 231 SER A OG  1 
ATOM   1739 N N   . GLY A 1 232 ? 13.810 0.952   -13.511 1.00 48.92 ? 232 GLY A N   1 
ATOM   1740 C CA  . GLY A 1 232 ? 13.004 0.282   -12.489 1.00 49.20 ? 232 GLY A CA  1 
ATOM   1741 C C   . GLY A 1 232 ? 13.474 -1.127  -12.168 1.00 49.57 ? 232 GLY A C   1 
ATOM   1742 O O   . GLY A 1 232 ? 13.441 -2.021  -13.024 1.00 49.82 ? 232 GLY A O   1 
HETATM 1743 O O   . HOH B 2 .   ? 30.449 -4.896  -0.056  1.00 20.05 ? 233 HOH A O   1 
HETATM 1744 O O   . HOH B 2 .   ? 21.489 23.792  7.669   1.00 15.01 ? 234 HOH A O   1 
HETATM 1745 O O   . HOH B 2 .   ? 28.066 19.819  6.597   1.00 17.13 ? 235 HOH A O   1 
HETATM 1746 O O   . HOH B 2 .   ? 20.020 18.048  -8.121  1.00 19.74 ? 236 HOH A O   1 
HETATM 1747 O O   . HOH B 2 .   ? 25.925 9.633   0.607   1.00 21.27 ? 237 HOH A O   1 
HETATM 1748 O O   . HOH B 2 .   ? 18.213 25.154  7.288   1.00 18.91 ? 238 HOH A O   1 
HETATM 1749 O O   . HOH B 2 .   ? 14.559 11.921  12.804  1.00 27.92 ? 239 HOH A O   1 
HETATM 1750 O O   . HOH B 2 .   ? 27.792 7.832   0.282   1.00 23.13 ? 240 HOH A O   1 
HETATM 1751 O O   . HOH B 2 .   ? 25.983 27.605  14.730  1.00 21.90 ? 241 HOH A O   1 
HETATM 1752 O O   . HOH B 2 .   ? 22.968 12.634  -0.030  1.00 28.44 ? 242 HOH A O   1 
HETATM 1753 O O   . HOH B 2 .   ? 18.516 24.204  -5.854  1.00 25.93 ? 243 HOH A O   1 
HETATM 1754 O O   . HOH B 2 .   ? 18.299 14.016  4.142   1.00 26.75 ? 244 HOH A O   1 
HETATM 1755 O O   . HOH B 2 .   ? 32.380 -0.363  5.602   1.00 23.19 ? 245 HOH A O   1 
HETATM 1756 O O   . HOH B 2 .   ? 20.476 12.033  15.600  1.00 28.04 ? 246 HOH A O   1 
HETATM 1757 O O   . HOH B 2 .   ? 17.716 7.586   4.981   1.00 31.04 ? 247 HOH A O   1 
HETATM 1758 O O   . HOH B 2 .   ? 27.731 -2.162  1.872   1.00 25.92 ? 248 HOH A O   1 
HETATM 1759 O O   . HOH B 2 .   ? 27.204 32.239  8.035   1.00 23.34 ? 249 HOH A O   1 
HETATM 1760 O O   . HOH B 2 .   ? 19.124 26.044  14.900  1.00 31.15 ? 250 HOH A O   1 
HETATM 1761 O O   . HOH B 2 .   ? 26.944 11.424  -3.206  1.00 31.11 ? 251 HOH A O   1 
HETATM 1762 O O   . HOH B 2 .   ? 20.574 13.233  8.674   1.00 32.02 ? 252 HOH A O   1 
HETATM 1763 O O   . HOH B 2 .   ? 33.189 19.540  18.554  1.00 27.60 ? 253 HOH A O   1 
HETATM 1764 O O   . HOH B 2 .   ? 36.731 5.247   3.096   1.00 25.56 ? 254 HOH A O   1 
HETATM 1765 O O   . HOH B 2 .   ? 33.717 18.947  1.348   1.00 32.91 ? 255 HOH A O   1 
HETATM 1766 O O   . HOH B 2 .   ? 37.209 -0.050  11.488  1.00 27.70 ? 256 HOH A O   1 
HETATM 1767 O O   . HOH B 2 .   ? 26.652 -4.341  2.804   1.00 28.03 ? 257 HOH A O   1 
HETATM 1768 O O   . HOH B 2 .   ? 10.314 -2.307  -7.659  1.00 25.70 ? 258 HOH A O   1 
HETATM 1769 O O   . HOH B 2 .   ? 15.270 22.071  -1.767  1.00 24.72 ? 259 HOH A O   1 
HETATM 1770 O O   . HOH B 2 .   ? 34.761 22.534  -3.572  1.00 26.76 ? 260 HOH A O   1 
HETATM 1771 O O   . HOH B 2 .   ? 24.767 14.408  -0.320  1.00 31.06 ? 261 HOH A O   1 
HETATM 1772 O O   . HOH B 2 .   ? 36.707 -0.437  15.590  1.00 25.80 ? 262 HOH A O   1 
HETATM 1773 O O   . HOH B 2 .   ? 31.855 17.250  18.913  1.00 26.08 ? 263 HOH A O   1 
HETATM 1774 O O   . HOH B 2 .   ? 7.338  6.097   7.902   1.00 29.74 ? 264 HOH A O   1 
HETATM 1775 O O   . HOH B 2 .   ? 36.996 7.063   19.161  1.00 26.61 ? 265 HOH A O   1 
HETATM 1776 O O   . HOH B 2 .   ? 11.916 0.257   -9.341  1.00 40.49 ? 266 HOH A O   1 
HETATM 1777 O O   . HOH B 2 .   ? 32.672 31.037  -7.478  1.00 31.06 ? 267 HOH A O   1 
HETATM 1778 O O   . HOH B 2 .   ? 31.375 20.942  16.612  1.00 30.12 ? 268 HOH A O   1 
HETATM 1779 O O   . HOH B 2 .   ? 27.850 15.194  20.959  1.00 39.71 ? 269 HOH A O   1 
HETATM 1780 O O   . HOH B 2 .   ? 38.669 33.917  -5.207  1.00 27.16 ? 270 HOH A O   1 
HETATM 1781 O O   . HOH B 2 .   ? 28.506 6.461   19.481  1.00 33.47 ? 271 HOH A O   1 
HETATM 1782 O O   . HOH B 2 .   ? 26.318 21.844  22.100  1.00 32.37 ? 272 HOH A O   1 
HETATM 1783 O O   . HOH B 2 .   ? 42.266 34.482  5.411   1.00 27.23 ? 273 HOH A O   1 
HETATM 1784 O O   . HOH B 2 .   ? 18.444 -7.702  9.923   1.00 26.68 ? 274 HOH A O   1 
HETATM 1785 O O   . HOH B 2 .   ? 28.516 13.971  -0.244  1.00 24.99 ? 275 HOH A O   1 
HETATM 1786 O O   . HOH B 2 .   ? 11.256 10.634  13.078  1.00 35.24 ? 276 HOH A O   1 
HETATM 1787 O O   . HOH B 2 .   ? 11.427 -5.784  7.602   1.00 46.08 ? 277 HOH A O   1 
HETATM 1788 O O   . HOH B 2 .   ? 25.323 36.318  12.586  1.00 33.68 ? 278 HOH A O   1 
HETATM 1789 O O   . HOH B 2 .   ? 18.994 20.775  -7.483  1.00 22.74 ? 279 HOH A O   1 
HETATM 1790 O O   . HOH B 2 .   ? 20.354 -10.404 2.749   1.00 30.62 ? 280 HOH A O   1 
HETATM 1791 O O   . HOH B 2 .   ? 23.511 -6.777  8.041   1.00 36.01 ? 281 HOH A O   1 
HETATM 1792 O O   . HOH B 2 .   ? 27.859 10.485  -5.555  1.00 30.53 ? 282 HOH A O   1 
HETATM 1793 O O   . HOH B 2 .   ? 40.465 -3.770  -9.220  1.00 28.93 ? 283 HOH A O   1 
HETATM 1794 O O   . HOH B 2 .   ? 40.904 28.763  16.926  1.00 38.09 ? 284 HOH A O   1 
HETATM 1795 O O   . HOH B 2 .   ? 29.766 -11.164 -2.746  1.00 31.79 ? 285 HOH A O   1 
HETATM 1796 O O   . HOH B 2 .   ? 33.142 3.102   19.515  1.00 40.67 ? 286 HOH A O   1 
HETATM 1797 O O   . HOH B 2 .   ? 36.213 7.145   -1.278  1.00 30.02 ? 287 HOH A O   1 
HETATM 1798 O O   . HOH B 2 .   ? 41.766 34.287  -2.544  1.00 30.71 ? 288 HOH A O   1 
HETATM 1799 O O   . HOH B 2 .   ? 8.475  13.830  -5.338  1.00 28.90 ? 289 HOH A O   1 
HETATM 1800 O O   . HOH B 2 .   ? 31.236 8.603   20.909  1.00 31.20 ? 290 HOH A O   1 
HETATM 1801 O O   . HOH B 2 .   ? 41.144 18.015  0.386   1.00 39.70 ? 291 HOH A O   1 
HETATM 1802 O O   . HOH B 2 .   ? 38.911 28.651  18.972  1.00 38.00 ? 292 HOH A O   1 
HETATM 1803 O O   . HOH B 2 .   ? 30.220 10.935  0.256   1.00 34.59 ? 293 HOH A O   1 
HETATM 1804 O O   . HOH B 2 .   ? 34.609 4.909   -7.384  1.00 41.63 ? 294 HOH A O   1 
HETATM 1805 O O   . HOH B 2 .   ? 28.492 -0.586  9.091   1.00 35.24 ? 295 HOH A O   1 
HETATM 1806 O O   . HOH B 2 .   ? 28.882 2.360   12.971  1.00 35.10 ? 296 HOH A O   1 
HETATM 1807 O O   . HOH B 2 .   ? 14.507 17.743  -0.297  1.00 31.73 ? 297 HOH A O   1 
HETATM 1808 O O   . HOH B 2 .   ? 19.487 22.419  12.534  1.00 28.95 ? 298 HOH A O   1 
HETATM 1809 O O   . HOH B 2 .   ? 38.425 28.048  -4.635  1.00 28.77 ? 299 HOH A O   1 
HETATM 1810 O O   . HOH B 2 .   ? 25.437 17.306  3.162   1.00 32.22 ? 300 HOH A O   1 
HETATM 1811 O O   . HOH B 2 .   ? 21.528 11.995  -4.697  1.00 27.33 ? 301 HOH A O   1 
HETATM 1812 O O   . HOH B 2 .   ? 40.957 5.365   9.248   1.00 29.79 ? 302 HOH A O   1 
HETATM 1813 O O   . HOH B 2 .   ? 30.051 21.681  13.086  1.00 26.80 ? 303 HOH A O   1 
HETATM 1814 O O   . HOH B 2 .   ? 39.515 21.385  17.462  1.00 36.67 ? 304 HOH A O   1 
HETATM 1815 O O   . HOH B 2 .   ? 18.953 -10.865 0.777   1.00 31.38 ? 305 HOH A O   1 
HETATM 1816 O O   . HOH B 2 .   ? 38.618 -8.424  -3.708  1.00 38.12 ? 306 HOH A O   1 
HETATM 1817 O O   . HOH B 2 .   ? 19.654 13.897  1.847   1.00 32.88 ? 307 HOH A O   1 
HETATM 1818 O O   . HOH B 2 .   ? 22.389 21.989  7.729   1.00 18.33 ? 308 HOH A O   1 
HETATM 1819 O O   . HOH B 2 .   ? 26.585 12.159  -0.466  1.00 26.11 ? 309 HOH A O   1 
HETATM 1820 O O   . HOH B 2 .   ? 8.985  9.360   13.247  1.00 35.05 ? 310 HOH A O   1 
HETATM 1821 O O   . HOH B 2 .   ? 43.075 24.151  18.298  1.00 38.56 ? 311 HOH A O   1 
HETATM 1822 O O   . HOH B 2 .   ? 26.825 19.212  4.452   1.00 30.43 ? 312 HOH A O   1 
HETATM 1823 O O   . HOH B 2 .   ? 29.591 18.542  19.154  1.00 32.92 ? 313 HOH A O   1 
HETATM 1824 O O   . HOH B 2 .   ? 27.597 29.229  13.038  1.00 25.86 ? 314 HOH A O   1 
HETATM 1825 O O   . HOH B 2 .   ? 32.594 28.540  -5.880  1.00 35.75 ? 315 HOH A O   1 
HETATM 1826 O O   . HOH B 2 .   ? 26.612 16.478  5.958   1.00 35.13 ? 316 HOH A O   1 
HETATM 1827 O O   . HOH B 2 .   ? 8.306  -4.675  4.902   1.00 35.28 ? 317 HOH A O   1 
HETATM 1828 O O   . HOH B 2 .   ? 23.648 9.387   -0.869  1.00 37.36 ? 318 HOH A O   1 
HETATM 1829 O O   . HOH B 2 .   ? 13.873 4.071   -11.709 1.00 46.30 ? 319 HOH A O   1 
HETATM 1830 O O   . HOH B 2 .   ? 24.213 11.363  -3.610  1.00 27.84 ? 320 HOH A O   1 
HETATM 1831 O O   . HOH B 2 .   ? 18.043 5.089   -3.000  1.00 31.09 ? 321 HOH A O   1 
HETATM 1832 O O   . HOH B 2 .   ? 29.439 21.201  20.187  1.00 37.65 ? 322 HOH A O   1 
HETATM 1833 O O   . HOH B 2 .   ? 12.116 -10.049 4.258   1.00 45.33 ? 323 HOH A O   1 
HETATM 1834 O O   . HOH B 2 .   ? 30.642 -9.936  5.840   1.00 40.33 ? 324 HOH A O   1 
HETATM 1835 O O   . HOH B 2 .   ? 9.079  4.996   3.683   1.00 41.69 ? 325 HOH A O   1 
HETATM 1836 O O   . HOH B 2 .   ? 30.070 18.411  -1.719  1.00 35.03 ? 326 HOH A O   1 
HETATM 1837 O O   . HOH B 2 .   ? 8.175  5.665   -4.537  1.00 37.12 ? 327 HOH A O   1 
HETATM 1838 O O   . HOH B 2 .   ? 39.780 -0.310  10.891  1.00 39.30 ? 328 HOH A O   1 
HETATM 1839 O O   . HOH B 2 .   ? 43.226 14.362  1.926   1.00 39.23 ? 329 HOH A O   1 
HETATM 1840 O O   . HOH B 2 .   ? 29.316 20.136  15.199  1.00 31.64 ? 330 HOH A O   1 
HETATM 1841 O O   . HOH B 2 .   ? 14.461 5.832   5.322   1.00 39.36 ? 331 HOH A O   1 
HETATM 1842 O O   . HOH B 2 .   ? 35.625 26.543  19.003  1.00 42.67 ? 332 HOH A O   1 
HETATM 1843 O O   . HOH B 2 .   ? 36.575 13.518  -1.846  1.00 39.06 ? 333 HOH A O   1 
HETATM 1844 O O   . HOH B 2 .   ? 17.291 29.316  12.822  1.00 41.60 ? 334 HOH A O   1 
HETATM 1845 O O   . HOH B 2 .   ? 22.305 18.304  -9.870  1.00 37.36 ? 335 HOH A O   1 
HETATM 1846 O O   . HOH B 2 .   ? 35.930 -8.281  0.948   1.00 48.20 ? 336 HOH A O   1 
HETATM 1847 O O   . HOH B 2 .   ? 40.799 36.854  -1.108  1.00 39.62 ? 337 HOH A O   1 
HETATM 1848 O O   . HOH B 2 .   ? 20.213 7.148   -1.328  1.00 41.45 ? 338 HOH A O   1 
HETATM 1849 O O   . HOH B 2 .   ? 42.154 12.211  2.487   1.00 42.58 ? 339 HOH A O   1 
HETATM 1850 O O   . HOH B 2 .   ? 19.774 9.745   -5.036  1.00 37.92 ? 340 HOH A O   1 
HETATM 1851 O O   . HOH B 2 .   ? 19.497 29.272  13.991  1.00 34.83 ? 341 HOH A O   1 
HETATM 1852 O O   . HOH B 2 .   ? 22.402 17.368  21.295  1.00 36.41 ? 342 HOH A O   1 
HETATM 1853 O O   . HOH B 2 .   ? 39.597 5.476   3.993   1.00 32.50 ? 343 HOH A O   1 
HETATM 1854 O O   . HOH B 2 .   ? 39.023 18.809  18.577  1.00 46.24 ? 344 HOH A O   1 
HETATM 1855 O O   . HOH B 2 .   ? 32.662 -1.186  8.641   1.00 45.69 ? 345 HOH A O   1 
HETATM 1856 O O   . HOH B 2 .   ? 33.794 10.573  20.060  1.00 39.20 ? 346 HOH A O   1 
HETATM 1857 O O   . HOH B 2 .   ? 42.175 4.837   12.012  1.00 33.94 ? 347 HOH A O   1 
HETATM 1858 O O   . HOH B 2 .   ? 8.166  10.925  11.276  1.00 46.58 ? 348 HOH A O   1 
HETATM 1859 O O   . HOH B 2 .   ? 19.905 21.922  20.609  1.00 35.72 ? 349 HOH A O   1 
HETATM 1860 O O   . HOH B 2 .   ? 32.431 -10.571 -2.384  1.00 37.44 ? 350 HOH A O   1 
HETATM 1861 O O   . HOH B 2 .   ? 33.598 20.029  -3.592  1.00 46.18 ? 351 HOH A O   1 
HETATM 1862 O O   . HOH B 2 .   ? 37.303 9.704   -1.405  1.00 33.46 ? 352 HOH A O   1 
HETATM 1863 O O   . HOH B 2 .   ? 18.671 -21.650 -13.686 1.00 46.29 ? 353 HOH A O   1 
HETATM 1864 O O   . HOH B 2 .   ? 52.344 33.352  1.193   1.00 49.52 ? 354 HOH A O   1 
HETATM 1865 O O   . HOH B 2 .   ? 9.485  -0.617  2.085   1.00 39.67 ? 355 HOH A O   1 
HETATM 1866 O O   . HOH B 2 .   ? 50.878 21.098  7.381   1.00 39.15 ? 356 HOH A O   1 
HETATM 1867 O O   . HOH B 2 .   ? 40.778 -5.145  -1.637  1.00 38.43 ? 357 HOH A O   1 
HETATM 1868 O O   . HOH B 2 .   ? 10.235 6.797   15.608  1.00 52.57 ? 358 HOH A O   1 
HETATM 1869 O O   . HOH B 2 .   ? 8.113  6.956   1.227   1.00 36.31 ? 359 HOH A O   1 
HETATM 1870 O O   . HOH B 2 .   ? 22.036 4.375   -13.938 1.00 41.32 ? 360 HOH A O   1 
HETATM 1871 O O   . HOH B 2 .   ? 40.698 20.168  1.571   1.00 39.53 ? 361 HOH A O   1 
HETATM 1872 O O   . HOH B 2 .   ? 34.836 -0.309  5.184   1.00 43.16 ? 362 HOH A O   1 
HETATM 1873 O O   . HOH B 2 .   ? 37.309 5.460   0.605   1.00 31.43 ? 363 HOH A O   1 
HETATM 1874 O O   . HOH B 2 .   ? 37.758 34.236  14.249  1.00 39.34 ? 364 HOH A O   1 
HETATM 1875 O O   . HOH B 2 .   ? 15.520 -4.004  -13.797 1.00 40.86 ? 365 HOH A O   1 
HETATM 1876 O O   . HOH B 2 .   ? 29.662 29.100  14.790  1.00 34.11 ? 366 HOH A O   1 
HETATM 1877 O O   . HOH B 2 .   ? 37.116 12.063  20.382  1.00 51.21 ? 367 HOH A O   1 
HETATM 1878 O O   . HOH B 2 .   ? 16.371 27.242  11.340  1.00 42.87 ? 368 HOH A O   1 
HETATM 1879 O O   . HOH B 2 .   ? 13.275 10.201  12.089  1.00 36.49 ? 369 HOH A O   1 
HETATM 1880 O O   . HOH B 2 .   ? 20.981 14.310  19.927  1.00 38.25 ? 370 HOH A O   1 
HETATM 1881 O O   . HOH B 2 .   ? 28.721 31.766  10.020  1.00 39.24 ? 371 HOH A O   1 
HETATM 1882 O O   . HOH B 2 .   ? 25.154 -14.614 -3.803  1.00 38.58 ? 372 HOH A O   1 
HETATM 1883 O O   . HOH B 2 .   ? 48.095 21.000  -0.963  1.00 36.48 ? 373 HOH A O   1 
HETATM 1884 O O   . HOH B 2 .   ? 28.021 1.584   10.755  1.00 35.52 ? 374 HOH A O   1 
HETATM 1885 O O   . HOH B 2 .   ? 29.394 15.852  -8.431  1.00 41.93 ? 375 HOH A O   1 
HETATM 1886 O O   . HOH B 2 .   ? 49.027 20.836  12.889  1.00 40.02 ? 376 HOH A O   1 
HETATM 1887 O O   . HOH B 2 .   ? 7.879  1.816   -3.784  1.00 44.04 ? 377 HOH A O   1 
HETATM 1888 O O   . HOH B 2 .   ? 18.672 -15.196 -4.404  1.00 45.59 ? 378 HOH A O   1 
HETATM 1889 O O   . HOH B 2 .   ? 45.933 2.983   10.623  1.00 41.87 ? 379 HOH A O   1 
HETATM 1890 O O   . HOH B 2 .   ? 28.567 27.760  16.607  1.00 34.47 ? 380 HOH A O   1 
HETATM 1891 O O   . HOH B 2 .   ? 13.939 4.449   7.483   1.00 38.20 ? 381 HOH A O   1 
HETATM 1892 O O   . HOH B 2 .   ? 29.990 -13.690 -3.402  1.00 43.90 ? 382 HOH A O   1 
HETATM 1893 O O   . HOH B 2 .   ? 22.989 11.405  18.847  1.00 50.75 ? 383 HOH A O   1 
HETATM 1894 O O   . HOH B 2 .   ? 36.292 5.490   -5.177  1.00 44.28 ? 384 HOH A O   1 
HETATM 1895 O O   . HOH B 2 .   ? 8.939  3.501   -12.067 1.00 47.94 ? 385 HOH A O   1 
HETATM 1896 O O   . HOH B 2 .   ? 21.251 15.767  7.407   1.00 53.28 ? 386 HOH A O   1 
HETATM 1897 O O   . HOH B 2 .   ? 36.485 2.800   0.028   1.00 46.97 ? 387 HOH A O   1 
HETATM 1898 O O   . HOH B 2 .   ? 8.721  -5.101  7.374   1.00 45.96 ? 388 HOH A O   1 
HETATM 1899 O O   . HOH B 2 .   ? 13.425 -11.750 -10.874 1.00 40.03 ? 389 HOH A O   1 
HETATM 1900 O O   . HOH B 2 .   ? 14.113 1.640   6.836   1.00 42.02 ? 390 HOH A O   1 
HETATM 1901 O O   . HOH B 2 .   ? 40.771 37.169  8.948   1.00 39.52 ? 391 HOH A O   1 
HETATM 1902 O O   . HOH B 2 .   ? 16.844 -17.998 -7.334  1.00 40.75 ? 392 HOH A O   1 
HETATM 1903 O O   . HOH B 2 .   ? 34.614 10.680  17.518  1.00 42.32 ? 393 HOH A O   1 
HETATM 1904 O O   . HOH B 2 .   ? 49.450 32.906  10.938  1.00 39.08 ? 394 HOH A O   1 
HETATM 1905 O O   . HOH B 2 .   ? 33.138 31.843  14.757  1.00 45.97 ? 395 HOH A O   1 
HETATM 1906 O O   . HOH B 2 .   ? 35.188 17.487  -2.363  1.00 50.42 ? 396 HOH A O   1 
HETATM 1907 O O   . HOH B 2 .   ? 8.614  0.516   -0.474  1.00 37.06 ? 397 HOH A O   1 
HETATM 1908 O O   . HOH B 2 .   ? 39.360 1.796   9.143   1.00 36.82 ? 398 HOH A O   1 
HETATM 1909 O O   . HOH B 2 .   ? 10.735 2.120   5.842   1.00 53.92 ? 399 HOH A O   1 
HETATM 1910 O O   . HOH B 2 .   ? 8.053  -0.395  -5.249  1.00 41.89 ? 400 HOH A O   1 
HETATM 1911 O O   . HOH B 2 .   ? 46.143 14.308  2.138   1.00 46.89 ? 401 HOH A O   1 
HETATM 1912 O O   . HOH B 2 .   ? 40.189 16.685  19.254  1.00 42.25 ? 402 HOH A O   1 
HETATM 1913 O O   . HOH B 2 .   ? 6.566  3.651   -5.094  1.00 61.40 ? 403 HOH A O   1 
HETATM 1914 O O   . HOH B 2 .   ? 27.817 -4.946  -16.893 1.00 53.02 ? 404 HOH A O   1 
HETATM 1915 O O   . HOH B 2 .   ? 51.648 34.951  3.571   1.00 42.02 ? 405 HOH A O   1 
HETATM 1916 O O   . HOH B 2 .   ? 38.002 36.473  12.442  1.00 45.03 ? 406 HOH A O   1 
HETATM 1917 O O   . HOH B 2 .   ? 48.937 19.349  0.760   1.00 36.91 ? 407 HOH A O   1 
HETATM 1918 O O   . HOH B 2 .   ? 24.547 -6.317  10.270  1.00 50.87 ? 408 HOH A O   1 
HETATM 1919 O O   . HOH B 2 .   ? 21.922 3.483   10.965  1.00 43.12 ? 409 HOH A O   1 
HETATM 1920 O O   . HOH B 2 .   ? 25.863 16.384  23.109  1.00 51.44 ? 410 HOH A O   1 
HETATM 1921 O O   . HOH B 2 .   ? 21.806 22.570  9.507   1.00 21.05 ? 411 HOH A O   1 
HETATM 1922 O O   . HOH B 2 .   ? 15.932 11.139  14.368  1.00 39.48 ? 412 HOH A O   1 
HETATM 1923 O O   . HOH B 2 .   ? 13.468 5.233   14.966  1.00 34.98 ? 413 HOH A O   1 
HETATM 1924 O O   . HOH B 2 .   ? 51.282 18.529  9.047   1.00 39.56 ? 414 HOH A O   1 
HETATM 1925 O O   . HOH B 2 .   ? 24.843 8.605   19.164  1.00 38.37 ? 415 HOH A O   1 
HETATM 1926 O O   . HOH B 2 .   ? 38.225 14.740  20.650  1.00 52.09 ? 416 HOH A O   1 
HETATM 1927 O O   . HOH B 2 .   ? 52.404 19.901  10.742  1.00 51.66 ? 417 HOH A O   1 
HETATM 1928 O O   . HOH B 2 .   ? 44.309 8.552   3.044   1.00 65.00 ? 418 HOH A O   1 
HETATM 1929 O O   . HOH B 2 .   ? 29.518 -5.554  -14.733 1.00 47.26 ? 419 HOH A O   1 
HETATM 1930 O O   . HOH B 2 .   ? 10.543 2.743   -3.201  1.00 27.72 ? 420 HOH A O   1 
HETATM 1931 O O   . HOH B 2 .   ? 40.721 10.483  14.226  1.00 38.57 ? 421 HOH A O   1 
HETATM 1932 O O   . HOH B 2 .   ? 25.126 -15.602 -6.265  1.00 42.80 ? 422 HOH A O   1 
HETATM 1933 O O   . HOH B 2 .   ? 9.384  4.803   14.630  1.00 45.35 ? 423 HOH A O   1 
HETATM 1934 O O   . HOH B 2 .   ? 20.245 -14.185 -2.423  1.00 44.06 ? 424 HOH A O   1 
HETATM 1935 O O   . HOH B 2 .   ? 22.968 -0.854  11.581  1.00 47.21 ? 425 HOH A O   1 
HETATM 1936 O O   . HOH B 2 .   ? 37.159 1.070   1.577   1.00 41.74 ? 426 HOH A O   1 
HETATM 1937 O O   . HOH B 2 .   ? 40.844 5.694   14.175  1.00 42.80 ? 427 HOH A O   1 
HETATM 1938 O O   . HOH B 2 .   ? 53.113 25.912  10.516  1.00 51.19 ? 428 HOH A O   1 
HETATM 1939 O O   . HOH B 2 .   ? 33.979 3.420   -8.780  1.00 40.23 ? 429 HOH A O   1 
HETATM 1940 O O   . HOH B 2 .   ? 39.515 6.522   19.565  1.00 50.90 ? 430 HOH A O   1 
HETATM 1941 O O   . HOH B 2 .   ? 43.536 34.579  7.916   1.00 45.41 ? 431 HOH A O   1 
HETATM 1942 O O   . HOH B 2 .   ? 26.913 9.412   -7.874  1.00 38.47 ? 432 HOH A O   1 
HETATM 1943 O O   . HOH B 2 .   ? 36.008 20.839  -7.182  1.00 41.93 ? 433 HOH A O   1 
HETATM 1944 O O   . HOH B 2 .   ? 14.795 16.653  10.420  1.00 44.57 ? 434 HOH A O   1 
HETATM 1945 O O   . HOH B 2 .   ? 16.665 8.075   -13.307 1.00 51.40 ? 435 HOH A O   1 
HETATM 1946 O O   . HOH B 2 .   ? 36.541 23.396  -5.683  1.00 49.25 ? 436 HOH A O   1 
HETATM 1947 O O   . HOH B 2 .   ? 11.530 -6.289  -4.172  1.00 43.59 ? 437 HOH A O   1 
HETATM 1948 O O   . HOH B 2 .   ? 41.414 18.535  -6.539  1.00 52.83 ? 438 HOH A O   1 
HETATM 1949 O O   . HOH B 2 .   ? 25.859 -8.874  1.273   1.00 48.61 ? 439 HOH A O   1 
HETATM 1950 O O   . HOH B 2 .   ? 19.111 9.788   -9.696  1.00 45.50 ? 440 HOH A O   1 
HETATM 1951 O O   . HOH B 2 .   ? 29.801 24.443  23.299  1.00 41.21 ? 441 HOH A O   1 
HETATM 1952 O O   . HOH B 2 .   ? 7.889  7.129   13.988  1.00 46.33 ? 442 HOH A O   1 
HETATM 1953 O O   . HOH B 2 .   ? 35.786 -11.672 -6.387  1.00 48.12 ? 443 HOH A O   1 
HETATM 1954 O O   . HOH B 2 .   ? 17.246 20.312  14.072  1.00 51.27 ? 444 HOH A O   1 
HETATM 1955 O O   . HOH B 2 .   ? 15.214 23.901  -5.343  1.00 42.21 ? 445 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   TRP 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   ALA 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   ASP 7   7   ?   ?   ?   A . n 
A 1 8   LYS 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  TRP 18  18  18  TRP TRP A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  ARG 66  66  66  ARG ARG A . n 
A 1 67  GLU 67  67  ?   ?   ?   A . n 
A 1 68  GLY 68  68  ?   ?   ?   A . n 
A 1 69  VAL 69  69  ?   ?   ?   A . n 
A 1 70  TYR 70  70  ?   ?   ?   A . n 
A 1 71  GLY 71  71  ?   ?   ?   A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 PRO 112 112 112 PRO PRO A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 TYR 129 129 129 TYR TYR A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 THR 149 149 149 THR THR A . n 
A 1 150 GLN 150 150 150 GLN GLN A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 HIS 152 152 152 HIS HIS A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 PHE 168 168 168 PHE PHE A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 MET 192 192 192 MET MET A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ASN 196 196 196 ASN ASN A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 SER 206 206 206 SER SER A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 ARG 208 208 208 ARG ARG A . n 
A 1 209 MET 209 209 209 MET MET A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 ASP 213 213 213 ASP ASP A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 LYS 215 215 215 LYS LYS A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 LYS 218 218 218 LYS LYS A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 ASP 221 221 221 ASP ASP A . n 
A 1 222 CYS 222 222 222 CYS CYS A . n 
A 1 223 ASP 223 223 223 ASP ASP A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 GLN 226 226 226 GLN GLN A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 ARG 230 230 230 ARG ARG A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Midwest Center for Structural Genomics' 
_pdbx_SG_project.initial_of_center     MCSG 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-04-11 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      refinement        5.2.0005 ? 1  
SBC-Collect 'data collection' .        ? 2  
HKL-2000    'data scaling'    .        ? 3  
HKL-3000    phasing           .        ? 4  
SHELXD      phasing           .        ? 5  
SHELXE      'model building'  .        ? 6  
MLPHARE     phasing           .        ? 7  
DM          phasing           .        ? 8  
SOLVE       phasing           .        ? 9  
RESOLVE     phasing           .        ? 10 
O           'model building'  .        ? 11 
Coot        'model building'  .        ? 12 
CCP4        phasing           .        ? 13 
ARP/wARP    'model building'  .        ? 14 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  A HOH 308 ? ? O A HOH 411 ? ? 1.96 
2 1 O  A HOH 234 ? ? O A HOH 308 ? ? 2.02 
3 1 CZ A ARG 156 ? ? O A HOH 420 ? ? 2.05 
4 1 NE A ARG 156 ? ? O A HOH 420 ? ? 2.11 
5 1 O  A HOH 294 ? ? O A HOH 429 ? ? 2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 41  ? ? 78.66   -5.96  
2 1 ALA A 175 ? ? -144.36 -27.64 
3 1 ASP A 213 ? ? -153.77 86.62  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? A MET 1  
2  1 Y 1 A TRP 2  ? A TRP 2  
3  1 Y 1 A LYS 3  ? A LYS 3  
4  1 Y 1 A THR 4  ? A THR 4  
5  1 Y 1 A ALA 5  ? A ALA 5  
6  1 Y 1 A SER 6  ? A SER 6  
7  1 Y 1 A ASP 7  ? A ASP 7  
8  1 Y 1 A LYS 8  ? A LYS 8  
9  1 Y 1 A GLY 9  ? A GLY 9  
10 1 Y 1 A GLU 67 ? A GLU 67 
11 1 Y 1 A GLY 68 ? A GLY 68 
12 1 Y 1 A VAL 69 ? A VAL 69 
13 1 Y 1 A TYR 70 ? A TYR 70 
14 1 Y 1 A GLY 71 ? A GLY 71 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   233 1   HOH HOH A . 
B 2 HOH 2   234 2   HOH HOH A . 
B 2 HOH 3   235 3   HOH HOH A . 
B 2 HOH 4   236 4   HOH HOH A . 
B 2 HOH 5   237 5   HOH HOH A . 
B 2 HOH 6   238 6   HOH HOH A . 
B 2 HOH 7   239 7   HOH HOH A . 
B 2 HOH 8   240 8   HOH HOH A . 
B 2 HOH 9   241 9   HOH HOH A . 
B 2 HOH 10  242 10  HOH HOH A . 
B 2 HOH 11  243 11  HOH HOH A . 
B 2 HOH 12  244 12  HOH HOH A . 
B 2 HOH 13  245 13  HOH HOH A . 
B 2 HOH 14  246 14  HOH HOH A . 
B 2 HOH 15  247 15  HOH HOH A . 
B 2 HOH 16  248 16  HOH HOH A . 
B 2 HOH 17  249 17  HOH HOH A . 
B 2 HOH 18  250 18  HOH HOH A . 
B 2 HOH 19  251 19  HOH HOH A . 
B 2 HOH 20  252 20  HOH HOH A . 
B 2 HOH 21  253 21  HOH HOH A . 
B 2 HOH 22  254 22  HOH HOH A . 
B 2 HOH 23  255 23  HOH HOH A . 
B 2 HOH 24  256 24  HOH HOH A . 
B 2 HOH 25  257 25  HOH HOH A . 
B 2 HOH 26  258 26  HOH HOH A . 
B 2 HOH 27  259 27  HOH HOH A . 
B 2 HOH 28  260 28  HOH HOH A . 
B 2 HOH 29  261 29  HOH HOH A . 
B 2 HOH 30  262 30  HOH HOH A . 
B 2 HOH 31  263 31  HOH HOH A . 
B 2 HOH 32  264 32  HOH HOH A . 
B 2 HOH 33  265 33  HOH HOH A . 
B 2 HOH 34  266 34  HOH HOH A . 
B 2 HOH 35  267 35  HOH HOH A . 
B 2 HOH 36  268 36  HOH HOH A . 
B 2 HOH 37  269 37  HOH HOH A . 
B 2 HOH 38  270 38  HOH HOH A . 
B 2 HOH 39  271 39  HOH HOH A . 
B 2 HOH 40  272 40  HOH HOH A . 
B 2 HOH 41  273 41  HOH HOH A . 
B 2 HOH 42  274 42  HOH HOH A . 
B 2 HOH 43  275 43  HOH HOH A . 
B 2 HOH 44  276 44  HOH HOH A . 
B 2 HOH 45  277 45  HOH HOH A . 
B 2 HOH 46  278 46  HOH HOH A . 
B 2 HOH 47  279 47  HOH HOH A . 
B 2 HOH 48  280 48  HOH HOH A . 
B 2 HOH 49  281 49  HOH HOH A . 
B 2 HOH 50  282 50  HOH HOH A . 
B 2 HOH 51  283 51  HOH HOH A . 
B 2 HOH 52  284 52  HOH HOH A . 
B 2 HOH 53  285 53  HOH HOH A . 
B 2 HOH 54  286 54  HOH HOH A . 
B 2 HOH 55  287 55  HOH HOH A . 
B 2 HOH 56  288 56  HOH HOH A . 
B 2 HOH 57  289 57  HOH HOH A . 
B 2 HOH 58  290 58  HOH HOH A . 
B 2 HOH 59  291 59  HOH HOH A . 
B 2 HOH 60  292 60  HOH HOH A . 
B 2 HOH 61  293 61  HOH HOH A . 
B 2 HOH 62  294 62  HOH HOH A . 
B 2 HOH 63  295 63  HOH HOH A . 
B 2 HOH 64  296 64  HOH HOH A . 
B 2 HOH 65  297 65  HOH HOH A . 
B 2 HOH 66  298 66  HOH HOH A . 
B 2 HOH 67  299 67  HOH HOH A . 
B 2 HOH 68  300 68  HOH HOH A . 
B 2 HOH 69  301 69  HOH HOH A . 
B 2 HOH 70  302 70  HOH HOH A . 
B 2 HOH 71  303 71  HOH HOH A . 
B 2 HOH 72  304 72  HOH HOH A . 
B 2 HOH 73  305 73  HOH HOH A . 
B 2 HOH 74  306 74  HOH HOH A . 
B 2 HOH 75  307 75  HOH HOH A . 
B 2 HOH 76  308 76  HOH HOH A . 
B 2 HOH 77  309 77  HOH HOH A . 
B 2 HOH 78  310 78  HOH HOH A . 
B 2 HOH 79  311 79  HOH HOH A . 
B 2 HOH 80  312 80  HOH HOH A . 
B 2 HOH 81  313 81  HOH HOH A . 
B 2 HOH 82  314 82  HOH HOH A . 
B 2 HOH 83  315 83  HOH HOH A . 
B 2 HOH 84  316 84  HOH HOH A . 
B 2 HOH 85  317 85  HOH HOH A . 
B 2 HOH 86  318 86  HOH HOH A . 
B 2 HOH 87  319 87  HOH HOH A . 
B 2 HOH 88  320 88  HOH HOH A . 
B 2 HOH 89  321 89  HOH HOH A . 
B 2 HOH 90  322 90  HOH HOH A . 
B 2 HOH 91  323 91  HOH HOH A . 
B 2 HOH 92  324 92  HOH HOH A . 
B 2 HOH 93  325 93  HOH HOH A . 
B 2 HOH 94  326 94  HOH HOH A . 
B 2 HOH 95  327 95  HOH HOH A . 
B 2 HOH 96  328 96  HOH HOH A . 
B 2 HOH 97  329 97  HOH HOH A . 
B 2 HOH 98  330 98  HOH HOH A . 
B 2 HOH 99  331 99  HOH HOH A . 
B 2 HOH 100 332 100 HOH HOH A . 
B 2 HOH 101 333 101 HOH HOH A . 
B 2 HOH 102 334 102 HOH HOH A . 
B 2 HOH 103 335 103 HOH HOH A . 
B 2 HOH 104 336 104 HOH HOH A . 
B 2 HOH 105 337 105 HOH HOH A . 
B 2 HOH 106 338 106 HOH HOH A . 
B 2 HOH 107 339 107 HOH HOH A . 
B 2 HOH 108 340 108 HOH HOH A . 
B 2 HOH 109 341 109 HOH HOH A . 
B 2 HOH 110 342 110 HOH HOH A . 
B 2 HOH 111 343 111 HOH HOH A . 
B 2 HOH 112 344 112 HOH HOH A . 
B 2 HOH 113 345 113 HOH HOH A . 
B 2 HOH 114 346 114 HOH HOH A . 
B 2 HOH 115 347 115 HOH HOH A . 
B 2 HOH 116 348 116 HOH HOH A . 
B 2 HOH 117 349 117 HOH HOH A . 
B 2 HOH 118 350 118 HOH HOH A . 
B 2 HOH 119 351 119 HOH HOH A . 
B 2 HOH 120 352 120 HOH HOH A . 
B 2 HOH 121 353 121 HOH HOH A . 
B 2 HOH 122 354 122 HOH HOH A . 
B 2 HOH 123 355 123 HOH HOH A . 
B 2 HOH 124 356 124 HOH HOH A . 
B 2 HOH 125 357 125 HOH HOH A . 
B 2 HOH 126 358 126 HOH HOH A . 
B 2 HOH 127 359 127 HOH HOH A . 
B 2 HOH 128 360 128 HOH HOH A . 
B 2 HOH 129 361 129 HOH HOH A . 
B 2 HOH 130 362 130 HOH HOH A . 
B 2 HOH 131 363 131 HOH HOH A . 
B 2 HOH 132 364 132 HOH HOH A . 
B 2 HOH 133 365 133 HOH HOH A . 
B 2 HOH 134 366 134 HOH HOH A . 
B 2 HOH 135 367 135 HOH HOH A . 
B 2 HOH 136 368 136 HOH HOH A . 
B 2 HOH 137 369 137 HOH HOH A . 
B 2 HOH 138 370 138 HOH HOH A . 
B 2 HOH 139 371 139 HOH HOH A . 
B 2 HOH 140 372 140 HOH HOH A . 
B 2 HOH 141 373 141 HOH HOH A . 
B 2 HOH 142 374 142 HOH HOH A . 
B 2 HOH 143 375 143 HOH HOH A . 
B 2 HOH 144 376 144 HOH HOH A . 
B 2 HOH 145 377 145 HOH HOH A . 
B 2 HOH 146 378 146 HOH HOH A . 
B 2 HOH 147 379 147 HOH HOH A . 
B 2 HOH 148 380 148 HOH HOH A . 
B 2 HOH 149 381 149 HOH HOH A . 
B 2 HOH 150 382 150 HOH HOH A . 
B 2 HOH 151 383 151 HOH HOH A . 
B 2 HOH 152 384 152 HOH HOH A . 
B 2 HOH 153 385 153 HOH HOH A . 
B 2 HOH 154 386 154 HOH HOH A . 
B 2 HOH 155 387 155 HOH HOH A . 
B 2 HOH 156 388 156 HOH HOH A . 
B 2 HOH 157 389 157 HOH HOH A . 
B 2 HOH 158 390 158 HOH HOH A . 
B 2 HOH 159 391 159 HOH HOH A . 
B 2 HOH 160 392 160 HOH HOH A . 
B 2 HOH 161 393 161 HOH HOH A . 
B 2 HOH 162 394 162 HOH HOH A . 
B 2 HOH 163 395 163 HOH HOH A . 
B 2 HOH 164 396 164 HOH HOH A . 
B 2 HOH 165 397 165 HOH HOH A . 
B 2 HOH 166 398 166 HOH HOH A . 
B 2 HOH 167 399 167 HOH HOH A . 
B 2 HOH 168 400 168 HOH HOH A . 
B 2 HOH 169 401 169 HOH HOH A . 
B 2 HOH 170 402 170 HOH HOH A . 
B 2 HOH 171 403 171 HOH HOH A . 
B 2 HOH 172 404 172 HOH HOH A . 
B 2 HOH 173 405 173 HOH HOH A . 
B 2 HOH 174 406 174 HOH HOH A . 
B 2 HOH 175 407 175 HOH HOH A . 
B 2 HOH 176 408 176 HOH HOH A . 
B 2 HOH 177 409 177 HOH HOH A . 
B 2 HOH 178 410 178 HOH HOH A . 
B 2 HOH 179 411 179 HOH HOH A . 
B 2 HOH 180 412 180 HOH HOH A . 
B 2 HOH 181 413 181 HOH HOH A . 
B 2 HOH 182 414 182 HOH HOH A . 
B 2 HOH 183 415 183 HOH HOH A . 
B 2 HOH 184 416 184 HOH HOH A . 
B 2 HOH 185 417 185 HOH HOH A . 
B 2 HOH 186 418 186 HOH HOH A . 
B 2 HOH 187 419 187 HOH HOH A . 
B 2 HOH 188 420 188 HOH HOH A . 
B 2 HOH 189 421 189 HOH HOH A . 
B 2 HOH 190 422 190 HOH HOH A . 
B 2 HOH 191 423 191 HOH HOH A . 
B 2 HOH 192 424 192 HOH HOH A . 
B 2 HOH 193 425 193 HOH HOH A . 
B 2 HOH 194 426 194 HOH HOH A . 
B 2 HOH 195 427 195 HOH HOH A . 
B 2 HOH 196 428 196 HOH HOH A . 
B 2 HOH 197 429 197 HOH HOH A . 
B 2 HOH 198 430 198 HOH HOH A . 
B 2 HOH 199 431 199 HOH HOH A . 
B 2 HOH 200 432 200 HOH HOH A . 
B 2 HOH 201 433 201 HOH HOH A . 
B 2 HOH 202 434 202 HOH HOH A . 
B 2 HOH 203 435 203 HOH HOH A . 
B 2 HOH 204 436 204 HOH HOH A . 
B 2 HOH 205 437 205 HOH HOH A . 
B 2 HOH 206 438 206 HOH HOH A . 
B 2 HOH 207 439 207 HOH HOH A . 
B 2 HOH 208 440 208 HOH HOH A . 
B 2 HOH 209 441 209 HOH HOH A . 
B 2 HOH 210 442 210 HOH HOH A . 
B 2 HOH 211 443 211 HOH HOH A . 
B 2 HOH 212 444 212 HOH HOH A . 
B 2 HOH 213 445 213 HOH HOH A . 
#