data_2GC3
# 
_entry.id   2GC3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GC3         
RCSB  RCSB036940   
WWPDB D_1000036940 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1X7N 'The crystal structure of Pyrococcus furiosus phosphoglucose isomerase with bound 5-phospho-D-arabinonate and Manganese' 
unspecified 
PDB 1X8E 'Crystal structure of Pyrococcus furiosus phosphoglucose isomerase free enzyme' unspecified 
PDB 1X82 'CRYSTAL STRUCTURE OF PHOSPHOGLUCOSE ISOMERASE FROM PYROCOCCUS FURIOSUS WITH BOUND 5-phospho-D-arabinonate' unspecified 
PDB 2GC0 
;The crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with 5-phospho-D-arabinonohydroxamate  and zinc
;
unspecified 
PDB 2GC1 
'The crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with sorbitol 6-phosphate and zinc' 
unspecified 
PDB 2GC2 
'The crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with fructose 6-phosphate and zinc' 
unspecified 
# 
_pdbx_database_status.entry_id                        2GC3 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Berrisford, J.M.' 1 
'Rice, D.W.'       2 
'Baker, P.J.'      3 
# 
_citation.id                        primary 
_citation.title                     
'Evidence Supporting a cis-enediol-based Mechanism for Pyrococcus furiosus Phosphoglucose Isomerase' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            358 
_citation.page_first                1353 
_citation.page_last                 1366 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16580686 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2006.03.015 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Berrisford, J.M.'      1  ? 
primary 'Hounslow, A.M.'        2  ? 
primary 'Akerboom, J.'          3  ? 
primary 'Hagen, W.R.'           4  ? 
primary 'Brouns, S.J.'          5  ? 
primary 'van der Oost, J.'      6  ? 
primary 'Murray, I.A.'          7  ? 
primary 'Michael Blackburn, G.' 8  ? 
primary 'Waltho, J.P.'          9  ? 
primary 'Rice, D.W.'            10 ? 
primary 'Baker, P.J.'           11 ? 
# 
_cell.length_a           70.346 
_cell.length_b           74.016 
_cell.length_c           74.835 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.entry_id           2GC3 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         2GC3 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase'     21378.273 2   5.3.1.9 ? ? ? 
2 non-polymer syn 'ZINC ION'                          65.409    2   ?       ? ? ? 
3 non-polymer syn 6-O-phosphono-alpha-D-mannopyranose 260.136   2   ?       ? ? ? 
4 water       nat water                               18.015    353 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVG
KEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHD
YGTIAEKGFSKIVIEENGEVKVVDNPRW
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVG
KEFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHD
YGTIAEKGFSKIVIEENGEVKVVDNPRW
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   MET n 
1 3   TYR n 
1 4   LYS n 
1 5   GLU n 
1 6   PRO n 
1 7   PHE n 
1 8   GLY n 
1 9   VAL n 
1 10  LYS n 
1 11  VAL n 
1 12  ASP n 
1 13  PHE n 
1 14  GLU n 
1 15  THR n 
1 16  GLY n 
1 17  ILE n 
1 18  ILE n 
1 19  GLU n 
1 20  GLY n 
1 21  ALA n 
1 22  LYS n 
1 23  LYS n 
1 24  SER n 
1 25  VAL n 
1 26  ARG n 
1 27  ARG n 
1 28  LEU n 
1 29  SER n 
1 30  ASP n 
1 31  MET n 
1 32  GLU n 
1 33  GLY n 
1 34  TYR n 
1 35  PHE n 
1 36  VAL n 
1 37  ASP n 
1 38  GLU n 
1 39  ARG n 
1 40  ALA n 
1 41  TRP n 
1 42  LYS n 
1 43  GLU n 
1 44  LEU n 
1 45  VAL n 
1 46  GLU n 
1 47  LYS n 
1 48  GLU n 
1 49  ASP n 
1 50  PRO n 
1 51  VAL n 
1 52  VAL n 
1 53  TYR n 
1 54  GLU n 
1 55  VAL n 
1 56  TYR n 
1 57  ALA n 
1 58  VAL n 
1 59  GLU n 
1 60  GLN n 
1 61  GLU n 
1 62  GLU n 
1 63  LYS n 
1 64  GLU n 
1 65  GLY n 
1 66  ASP n 
1 67  LEU n 
1 68  ASN n 
1 69  PHE n 
1 70  ALA n 
1 71  THR n 
1 72  THR n 
1 73  VAL n 
1 74  LEU n 
1 75  TYR n 
1 76  PRO n 
1 77  GLY n 
1 78  LYS n 
1 79  VAL n 
1 80  GLY n 
1 81  LYS n 
1 82  GLU n 
1 83  PHE n 
1 84  PHE n 
1 85  PHE n 
1 86  THR n 
1 87  LYS n 
1 88  GLY n 
1 89  HIS n 
1 90  PHE n 
1 91  HIS n 
1 92  ALA n 
1 93  LYS n 
1 94  LEU n 
1 95  ASP n 
1 96  ARG n 
1 97  ALA n 
1 98  GLU n 
1 99  VAL n 
1 100 TYR n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 GLY n 
1 109 MET n 
1 110 LEU n 
1 111 LEU n 
1 112 GLN n 
1 113 THR n 
1 114 PRO n 
1 115 GLU n 
1 116 GLY n 
1 117 ASP n 
1 118 ALA n 
1 119 LYS n 
1 120 TRP n 
1 121 ILE n 
1 122 SER n 
1 123 MET n 
1 124 GLU n 
1 125 PRO n 
1 126 GLY n 
1 127 THR n 
1 128 VAL n 
1 129 VAL n 
1 130 TYR n 
1 131 VAL n 
1 132 PRO n 
1 133 PRO n 
1 134 TYR n 
1 135 TRP n 
1 136 ALA n 
1 137 HIS n 
1 138 ARG n 
1 139 THR n 
1 140 VAL n 
1 141 ASN n 
1 142 ILE n 
1 143 GLY n 
1 144 ASP n 
1 145 GLU n 
1 146 PRO n 
1 147 PHE n 
1 148 ILE n 
1 149 PHE n 
1 150 LEU n 
1 151 ALA n 
1 152 ILE n 
1 153 TYR n 
1 154 PRO n 
1 155 ALA n 
1 156 ASP n 
1 157 ALA n 
1 158 GLY n 
1 159 HIS n 
1 160 ASP n 
1 161 TYR n 
1 162 GLY n 
1 163 THR n 
1 164 ILE n 
1 165 ALA n 
1 166 GLU n 
1 167 LYS n 
1 168 GLY n 
1 169 PHE n 
1 170 SER n 
1 171 LYS n 
1 172 ILE n 
1 173 VAL n 
1 174 ILE n 
1 175 GLU n 
1 176 GLU n 
1 177 ASN n 
1 178 GLY n 
1 179 GLU n 
1 180 VAL n 
1 181 LYS n 
1 182 VAL n 
1 183 VAL n 
1 184 ASP n 
1 185 ASN n 
1 186 PRO n 
1 187 ARG n 
1 188 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 pgiA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pLUW557 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_PYRFU 
_struct_ref.pdbx_db_accession          P83194 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGK
EFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDY
GTIAEKGFSKIVIEENGEVKVVDNPRW
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GC3 A 2 ? 188 ? P83194 1 ? 187 ? 1 187 
2 1 2GC3 B 2 ? 188 ? P83194 1 ? 187 ? 1 187 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GC3 MET A 1 ? UNP P83194 ? ? 'cloning artifact' 0 1 
2 2GC3 MET B 1 ? UNP P83194 ? ? 'cloning artifact' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking'           y GLUTAMINE                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                               ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                              ? 'C6 H15 N2 O2 1' 147.195 
M6P 'D-saccharide, alpha linking' n 6-O-phosphono-alpha-D-mannopyranose ? 'C6 H13 O9 P'    260.136 
MET 'L-peptide linking'           y METHIONINE                          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'           y PHENYLALANINE                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                              ? 'C5 H11 N O2'    117.146 
ZN  non-polymer                   . 'ZINC ION'                          ? 'Zn 2'           65.409  
# 
_exptl.entry_id          2GC3 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   45.99 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;0.05 M ammonium sulphate, 0.1 M sodium acetate pH 4.6, 20% PEG monoethyl ether 2000, 5mM ZnCl2, 5mM mannose 6-phosphate, VAPOR DIFFUSION, HANGING DROP, temperature 290K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-03-29 
_diffrn_detector.details                'Osmic Varimax' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2GC3 
_reflns.d_resolution_high            2.100 
_reflns.d_resolution_low             74.835 
_reflns.number_obs                   23477 
_reflns.pdbx_Rmerge_I_obs            0.104 
_reflns.pdbx_netI_over_sigmaI        5.900 
_reflns.pdbx_Rsym_value              0.104 
_reflns.pdbx_redundancy              6.900 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   23477 
_reflns.B_iso_Wilson_estimate        22.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.21 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    22308 
_reflns_shell.number_unique_obs      3361 
_reflns_shell.Rmerge_I_obs           0.366 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_Rsym_value        0.366 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        6.60 
_reflns_shell.percent_possible_obs   100.00 
_reflns_shell.number_unique_all      3361 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             19.850 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.990 
_refine.ls_number_reflns_obs                     23440 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          0.162 
_refine.ls_R_factor_R_work                       0.158 
_refine.ls_R_factor_R_free                       0.235 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1202 
_refine.B_iso_mean                               25.049 
_refine.aniso_B[1][1]                            0.010 
_refine.aniso_B[2][2]                            -0.010 
_refine.aniso_B[3][3]                            0.000 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.909 
_refine.pdbx_overall_ESU_R                       0.212 
_refine.pdbx_overall_ESU_R_Free                  0.196 
_refine.overall_SU_ML                            0.135 
_refine.overall_SU_B                             5.066 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.entry_id                                 2GC3 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_obs                          0.162 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1X8E' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3020 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             353 
_refine_hist.number_atoms_total               3407 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        19.850 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         3136 0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      4248 1.246  1.965  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   374  6.472  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   148  32.343 24.459 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   524  15.800 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   12   14.372 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           444  0.081  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     2390 0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1330 0.181  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          2034 0.306  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    311  0.116  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      2    0.061  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   38   0.199  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 18   0.232  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1922 6.850  2.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             3004 7.819  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1415 9.139  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1244 12.173 3.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.940 
_refine_ls_shell.number_reflns_R_work             1596 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.194 
_refine_ls_shell.R_factor_R_free                  0.338 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             88 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1684 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2GC3 
_struct.title                     
'The crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with mannose 6-phosphate and zinc' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GC3 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'cupin, phosphoglucose isomerase, mannose 6-phosphate, ISOMERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 29  ? MET A 31  ? SER A 28  MET A 30  5 ? 3  
HELX_P HELX_P2 2 ASP A 37  ? GLU A 48  ? ASP A 36  GLU A 47  1 ? 12 
HELX_P HELX_P3 3 TYR A 161 ? GLY A 168 ? TYR A 160 GLY A 167 1 ? 8  
HELX_P HELX_P4 4 SER B 29  ? GLU B 32  ? SER B 28  GLU B 31  5 ? 4  
HELX_P HELX_P5 5 ASP B 37  ? GLU B 48  ? ASP B 36  GLU B 47  1 ? 12 
HELX_P HELX_P6 6 TYR B 161 ? GLY B 168 ? TYR B 160 GLY B 167 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A HIS 89  NE2 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 88  A ZN  402 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc2  metalc ? ? A HIS 91  NE2 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 90  A ZN  402 1_555 ? ? ? ? ? ? ? 2.231 ? ? 
metalc3  metalc ? ? A GLU 98  OE2 ? ? ? 1_555 C ZN  . ZN ? ? A GLU 97  A ZN  402 1_555 ? ? ? ? ? ? ? 1.944 ? ? 
metalc4  metalc ? ? A HIS 137 NE2 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 136 A ZN  402 1_555 ? ? ? ? ? ? ? 2.166 ? ? 
metalc5  metalc ? ? C ZN  .   ZN  ? ? ? 1_555 G HOH . O  ? ? A ZN  402 A HOH 676 1_555 ? ? ? ? ? ? ? 2.219 ? ? 
metalc6  metalc ? ? B HIS 89  NE2 ? ? ? 1_555 E ZN  . ZN ? ? B HIS 88  B ZN  401 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc7  metalc ? ? B HIS 91  NE2 ? ? ? 1_555 E ZN  . ZN ? ? B HIS 90  B ZN  401 1_555 ? ? ? ? ? ? ? 2.123 ? ? 
metalc8  metalc ? ? B GLU 98  OE1 ? ? ? 1_555 E ZN  . ZN ? ? B GLU 97  B ZN  401 1_555 ? ? ? ? ? ? ? 1.981 ? ? 
metalc9  metalc ? ? B HIS 137 NE2 ? ? ? 1_555 E ZN  . ZN ? ? B HIS 136 B ZN  401 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc10 metalc ? ? E ZN  .   ZN  ? ? ? 1_555 H HOH . O  ? ? B ZN  401 B HOH 669 1_555 ? ? ? ? ? ? ? 2.149 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 3 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 7   ? LYS A 10  ? PHE A 6   LYS A 9   
A 2 THR B 127 ? VAL B 131 ? THR B 126 VAL B 130 
A 3 GLU B 98  ? LYS B 104 ? GLU B 97  LYS B 103 
A 4 PHE B 147 ? PRO B 154 ? PHE B 146 PRO B 153 
A 5 LEU B 67  ? LEU B 74  ? LEU B 66  LEU B 73  
A 6 VAL B 51  ? VAL B 58  ? VAL B 50  VAL B 57  
A 7 LYS B 22  ? ARG B 27  ? LYS B 21  ARG B 26  
B 1 LYS A 22  ? ARG A 27  ? LYS A 21  ARG A 26  
B 2 VAL A 51  ? VAL A 58  ? VAL A 50  VAL A 57  
B 3 LEU A 67  ? LEU A 74  ? LEU A 66  LEU A 73  
B 4 PHE A 147 ? PRO A 154 ? PHE A 146 PRO A 153 
B 5 GLU A 98  ? LYS A 104 ? GLU A 97  LYS A 103 
B 6 THR A 127 ? VAL A 131 ? THR A 126 VAL A 130 
B 7 PHE B 7   ? LYS B 10  ? PHE B 6   LYS B 9   
C 1 LYS A 78  ? VAL A 79  ? LYS A 77  VAL A 78  
C 2 GLU A 82  ? PHE A 83  ? GLU A 81  PHE A 82  
D 1 ALA A 118 ? MET A 123 ? ALA A 117 MET A 122 
D 2 GLY A 107 ? GLN A 112 ? GLY A 106 GLN A 111 
D 3 ALA A 136 ? ASN A 141 ? ALA A 135 ASN A 140 
E 1 LYS A 171 ? GLU A 176 ? LYS A 170 GLU A 175 
E 2 GLU A 179 ? ASP A 184 ? GLU A 178 ASP A 183 
F 1 LYS B 78  ? VAL B 79  ? LYS B 77  VAL B 78  
F 2 GLU B 82  ? PHE B 83  ? GLU B 81  PHE B 82  
G 1 ALA B 118 ? MET B 123 ? ALA B 117 MET B 122 
G 2 GLY B 107 ? GLN B 112 ? GLY B 106 GLN B 111 
G 3 ALA B 136 ? ASN B 141 ? ALA B 135 ASN B 140 
H 1 LYS B 171 ? GLU B 176 ? LYS B 170 GLU B 175 
H 2 GLU B 179 ? ASP B 184 ? GLU B 178 ASP B 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 9   ? N VAL A 8   O VAL B 128 ? O VAL B 127 
A 2 3 O THR B 127 ? O THR B 126 N ALA B 102 ? N ALA B 101 
A 3 4 N VAL B 101 ? N VAL B 100 O LEU B 150 ? O LEU B 149 
A 4 5 O TYR B 153 ? O TYR B 152 N ASN B 68  ? N ASN B 67  
A 5 6 O PHE B 69  ? O PHE B 68  N VAL B 58  ? N VAL B 57  
A 6 7 O TYR B 53  ? O TYR B 52  N ARG B 26  ? N ARG B 25  
B 1 2 N ARG A 26  ? N ARG A 25  O VAL A 52  ? O VAL A 51  
B 2 3 N VAL A 58  ? N VAL A 57  O PHE A 69  ? O PHE A 68  
B 3 4 N ALA A 70  ? N ALA A 69  O ALA A 151 ? O ALA A 150 
B 4 5 O LEU A 150 ? O LEU A 149 N VAL A 101 ? N VAL A 100 
B 5 6 N ALA A 102 ? N ALA A 101 O THR A 127 ? O THR A 126 
B 6 7 N VAL A 128 ? N VAL A 127 O VAL B 9   ? O VAL B 8   
C 1 2 N VAL A 79  ? N VAL A 78  O GLU A 82  ? O GLU A 81  
D 1 2 O ILE A 121 ? O ILE A 120 N MET A 109 ? N MET A 108 
D 2 3 N GLN A 112 ? N GLN A 111 O ALA A 136 ? O ALA A 135 
E 1 2 N ILE A 172 ? N ILE A 171 O VAL A 183 ? O VAL A 182 
F 1 2 N VAL B 79  ? N VAL B 78  O GLU B 82  ? O GLU B 81  
G 1 2 O LYS B 119 ? O LYS B 118 N LEU B 111 ? N LEU B 110 
G 2 3 N GLN B 112 ? N GLN B 111 O ALA B 136 ? O ALA B 135 
H 1 2 N ILE B 172 ? N ILE B 171 O VAL B 183 ? O VAL B 182 
# 
_atom_sites.entry_id                    2GC3 
_atom_sites.fract_transf_matrix[1][1]   0.01421 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01351 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01336 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? -34.107 -29.519 27.809 1.00 67.66  ? 0   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? -34.549 -28.117 27.538 1.00 55.61  ? 0   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? -34.852 -27.874 26.052 1.00 39.79  ? 0   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? -34.762 -28.797 25.238 1.00 34.96  ? 0   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? -33.515 -27.113 28.062 1.00 57.66  ? 0   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? -32.190 -27.095 27.319 1.00 53.96  ? 0   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? -31.129 -25.732 27.846 1.00 54.07  ? 0   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? -32.039 -24.302 27.263 1.00 58.13  ? 0   MET A CE  1 
ATOM   9    N  N   . MET A 1 2   ? -35.231 -26.637 25.723 1.00 38.69  ? 1   MET A N   1 
ATOM   10   C  CA  . MET A 1 2   ? -35.475 -26.209 24.340 1.00 49.95  ? 1   MET A CA  1 
ATOM   11   C  C   . MET A 1 2   ? -34.165 -25.688 23.728 1.00 45.37  ? 1   MET A C   1 
ATOM   12   O  O   . MET A 1 2   ? -33.444 -24.908 24.357 1.00 40.44  ? 1   MET A O   1 
ATOM   13   C  CB  . MET A 1 2   ? -36.548 -25.099 24.292 1.00 48.30  ? 1   MET A CB  1 
ATOM   14   C  CG  . MET A 1 2   ? -38.027 -25.547 24.215 1.00 62.41  ? 1   MET A CG  1 
ATOM   15   S  SD  . MET A 1 2   ? -39.246 -24.227 24.602 1.00 52.29  ? 1   MET A SD  1 
ATOM   16   C  CE  . MET A 1 2   ? -40.534 -24.543 23.375 1.00 43.64  ? 1   MET A CE  1 
ATOM   17   N  N   . TYR A 1 3   ? -33.860 -26.128 22.509 1.00 34.70  ? 2   TYR A N   1 
ATOM   18   C  CA  . TYR A 1 3   ? -32.674 -25.660 21.776 1.00 35.40  ? 2   TYR A CA  1 
ATOM   19   C  C   . TYR A 1 3   ? -33.069 -24.912 20.517 1.00 24.56  ? 2   TYR A C   1 
ATOM   20   O  O   . TYR A 1 3   ? -34.007 -25.296 19.822 1.00 21.68  ? 2   TYR A O   1 
ATOM   21   C  CB  . TYR A 1 3   ? -31.748 -26.826 21.400 1.00 18.27  ? 2   TYR A CB  1 
ATOM   22   C  CG  . TYR A 1 3   ? -31.351 -27.682 22.572 1.00 10.71  ? 2   TYR A CG  1 
ATOM   23   C  CD1 . TYR A 1 3   ? -31.880 -28.958 22.737 1.00 15.35  ? 2   TYR A CD1 1 
ATOM   24   C  CD2 . TYR A 1 3   ? -30.458 -27.207 23.533 1.00 21.05  ? 2   TYR A CD2 1 
ATOM   25   C  CE1 . TYR A 1 3   ? -31.522 -29.749 23.837 1.00 16.55  ? 2   TYR A CE1 1 
ATOM   26   C  CE2 . TYR A 1 3   ? -30.096 -27.987 24.626 1.00 22.04  ? 2   TYR A CE2 1 
ATOM   27   C  CZ  . TYR A 1 3   ? -30.626 -29.254 24.768 1.00 21.30  ? 2   TYR A CZ  1 
ATOM   28   O  OH  . TYR A 1 3   ? -30.263 -30.017 25.850 1.00 21.13  ? 2   TYR A OH  1 
ATOM   29   N  N   . LYS A 1 4   ? -32.340 -23.848 20.216 1.00 24.90  ? 3   LYS A N   1 
ATOM   30   C  CA  . LYS A 1 4   ? -32.605 -23.080 19.003 1.00 31.86  ? 3   LYS A CA  1 
ATOM   31   C  C   . LYS A 1 4   ? -32.045 -23.813 17.791 1.00 13.73  ? 3   LYS A C   1 
ATOM   32   O  O   . LYS A 1 4   ? -31.117 -24.622 17.914 1.00 21.64  ? 3   LYS A O   1 
ATOM   33   C  CB  . LYS A 1 4   ? -32.016 -21.670 19.113 1.00 20.85  ? 3   LYS A CB  1 
ATOM   34   C  CG  . LYS A 1 4   ? -32.586 -20.853 20.261 1.00 25.24  ? 3   LYS A CG  1 
ATOM   35   C  CD  . LYS A 1 4   ? -31.559 -19.881 20.827 1.00 32.98  ? 3   LYS A CD  1 
ATOM   36   C  CE  . LYS A 1 4   ? -31.402 -18.697 19.930 1.00 19.26  ? 3   LYS A CE  1 
ATOM   37   N  NZ  . LYS A 1 4   ? -30.497 -17.657 20.490 1.00 18.03  ? 3   LYS A NZ  1 
ATOM   38   N  N   . GLU A 1 5   ? -32.616 -23.531 16.624 1.00 11.09  ? 4   GLU A N   1 
ATOM   39   C  CA  . GLU A 1 5   ? -32.195 -24.175 15.389 1.00 23.86  ? 4   GLU A CA  1 
ATOM   40   C  C   . GLU A 1 5   ? -30.918 -23.546 14.832 1.00 18.10  ? 4   GLU A C   1 
ATOM   41   O  O   . GLU A 1 5   ? -30.872 -22.333 14.622 1.00 18.42  ? 4   GLU A O   1 
ATOM   42   C  CB  . GLU A 1 5   ? -33.313 -24.107 14.342 1.00 21.36  ? 4   GLU A CB  1 
ATOM   43   C  CG  . GLU A 1 5   ? -33.141 -25.054 13.145 1.00 33.17  ? 4   GLU A CG  1 
ATOM   44   C  CD  . GLU A 1 5   ? -33.396 -26.525 13.484 1.00 49.92  ? 4   GLU A CD  1 
ATOM   45   O  OE1 . GLU A 1 5   ? -33.320 -27.362 12.559 1.00 62.80  ? 4   GLU A OE1 1 
ATOM   46   O  OE2 . GLU A 1 5   ? -33.668 -26.854 14.662 1.00 34.51  ? 4   GLU A OE2 1 
ATOM   47   N  N   . PRO A 1 6   ? -29.880 -24.372 14.584 1.00 24.99  ? 5   PRO A N   1 
ATOM   48   C  CA  . PRO A 1 6   ? -28.728 -23.900 13.815 1.00 18.53  ? 5   PRO A CA  1 
ATOM   49   C  C   . PRO A 1 6   ? -29.144 -23.612 12.379 1.00 17.46  ? 5   PRO A C   1 
ATOM   50   O  O   . PRO A 1 6   ? -30.044 -24.263 11.852 1.00 20.72  ? 5   PRO A O   1 
ATOM   51   C  CB  . PRO A 1 6   ? -27.763 -25.097 13.853 1.00 20.48  ? 5   PRO A CB  1 
ATOM   52   C  CG  . PRO A 1 6   ? -28.217 -25.924 15.021 1.00 13.67  ? 5   PRO A CG  1 
ATOM   53   C  CD  . PRO A 1 6   ? -29.704 -25.772 15.010 1.00 20.64  ? 5   PRO A CD  1 
ATOM   54   N  N   . PHE A 1 7   ? -28.516 -22.619 11.762 1.00 14.13  ? 6   PHE A N   1 
ATOM   55   C  CA  . PHE A 1 7   ? -28.812 -22.290 10.375 1.00 16.49  ? 6   PHE A CA  1 
ATOM   56   C  C   . PHE A 1 7   ? -27.589 -21.730 9.686  1.00 18.46  ? 6   PHE A C   1 
ATOM   57   O  O   . PHE A 1 7   ? -26.659 -21.248 10.346 1.00 13.63  ? 6   PHE A O   1 
ATOM   58   C  CB  . PHE A 1 7   ? -29.991 -21.312 10.268 1.00 21.42  ? 6   PHE A CB  1 
ATOM   59   C  CG  . PHE A 1 7   ? -29.769 -19.988 10.962 1.00 19.83  ? 6   PHE A CG  1 
ATOM   60   C  CD1 . PHE A 1 7   ? -30.205 -19.796 12.267 1.00 14.24  ? 6   PHE A CD1 1 
ATOM   61   C  CD2 . PHE A 1 7   ? -29.158 -18.925 10.298 1.00 20.95  ? 6   PHE A CD2 1 
ATOM   62   C  CE1 . PHE A 1 7   ? -30.028 -18.578 12.913 1.00 10.72  ? 6   PHE A CE1 1 
ATOM   63   C  CE2 . PHE A 1 7   ? -28.964 -17.699 10.943 1.00 8.83   ? 6   PHE A CE2 1 
ATOM   64   C  CZ  . PHE A 1 7   ? -29.401 -17.529 12.250 1.00 14.03  ? 6   PHE A CZ  1 
ATOM   65   N  N   . GLY A 1 8   ? -27.590 -21.823 8.361  1.00 15.73  ? 7   GLY A N   1 
ATOM   66   C  CA  . GLY A 1 8   ? -26.639 -21.092 7.532  1.00 17.29  ? 7   GLY A CA  1 
ATOM   67   C  C   . GLY A 1 8   ? -27.347 -20.076 6.656  1.00 20.87  ? 7   GLY A C   1 
ATOM   68   O  O   . GLY A 1 8   ? -28.461 -20.324 6.187  1.00 28.41  ? 7   GLY A O   1 
ATOM   69   N  N   . VAL A 1 9   ? -26.717 -18.918 6.463  1.00 23.37  ? 8   VAL A N   1 
ATOM   70   C  CA  . VAL A 1 9   ? -27.181 -17.926 5.484  1.00 24.18  ? 8   VAL A CA  1 
ATOM   71   C  C   . VAL A 1 9   ? -26.046 -17.582 4.538  1.00 21.54  ? 8   VAL A C   1 
ATOM   72   O  O   . VAL A 1 9   ? -24.877 -17.578 4.933  1.00 22.61  ? 8   VAL A O   1 
ATOM   73   C  CB  . VAL A 1 9   ? -27.716 -16.601 6.118  1.00 25.64  ? 8   VAL A CB  1 
ATOM   74   C  CG1 . VAL A 1 9   ? -29.068 -16.806 6.762  1.00 24.73  ? 8   VAL A CG1 1 
ATOM   75   C  CG2 . VAL A 1 9   ? -26.697 -15.979 7.101  1.00 22.22  ? 8   VAL A CG2 1 
ATOM   76   N  N   . LYS A 1 10  ? -26.397 -17.305 3.289  1.00 22.72  ? 9   LYS A N   1 
ATOM   77   C  CA  . LYS A 1 10  ? -25.430 -16.839 2.310  1.00 31.40  ? 9   LYS A CA  1 
ATOM   78   C  C   . LYS A 1 10  ? -25.255 -15.331 2.432  1.00 25.70  ? 9   LYS A C   1 
ATOM   79   O  O   . LYS A 1 10  ? -26.230 -14.580 2.486  1.00 25.57  ? 9   LYS A O   1 
ATOM   80   C  CB  . LYS A 1 10  ? -25.859 -17.218 0.890  1.00 37.43  ? 9   LYS A CB  1 
ATOM   81   C  CG  . LYS A 1 10  ? -25.572 -18.667 0.524  1.00 57.35  ? 9   LYS A CG  1 
ATOM   82   C  CD  . LYS A 1 10  ? -26.344 -19.112 -0.717 1.00 74.66  ? 9   LYS A CD  1 
ATOM   83   C  CE  . LYS A 1 10  ? -27.746 -19.600 -0.368 1.00 75.11  ? 9   LYS A CE  1 
ATOM   84   N  NZ  . LYS A 1 10  ? -28.463 -20.123 -1.561 1.00 71.44  ? 9   LYS A NZ  1 
ATOM   85   N  N   . VAL A 1 11  ? -23.999 -14.907 2.501  1.00 22.53  ? 10  VAL A N   1 
ATOM   86   C  CA  . VAL A 1 11  ? -23.638 -13.501 2.442  1.00 23.11  ? 10  VAL A CA  1 
ATOM   87   C  C   . VAL A 1 11  ? -23.053 -13.242 1.053  1.00 11.75  ? 10  VAL A C   1 
ATOM   88   O  O   . VAL A 1 11  ? -22.198 -13.995 0.573  1.00 27.23  ? 10  VAL A O   1 
ATOM   89   C  CB  . VAL A 1 11  ? -22.654 -13.114 3.579  1.00 27.58  ? 10  VAL A CB  1 
ATOM   90   C  CG1 . VAL A 1 11  ? -22.098 -11.712 3.383  1.00 31.71  ? 10  VAL A CG1 1 
ATOM   91   C  CG2 . VAL A 1 11  ? -23.345 -13.227 4.940  1.00 21.26  ? 10  VAL A CG2 1 
ATOM   92   N  N   . ASP A 1 12  ? -23.547 -12.194 0.400  1.00 21.94  ? 11  ASP A N   1 
ATOM   93   C  CA  . ASP A 1 12  ? -23.061 -11.804 -0.915 1.00 21.79  ? 11  ASP A CA  1 
ATOM   94   C  C   . ASP A 1 12  ? -21.908 -10.832 -0.715 1.00 12.90  ? 11  ASP A C   1 
ATOM   95   O  O   . ASP A 1 12  ? -22.111 -9.728  -0.237 1.00 22.44  ? 11  ASP A O   1 
ATOM   96   C  CB  . ASP A 1 12  ? -24.193 -11.151 -1.718 1.00 26.46  ? 11  ASP A CB  1 
ATOM   97   C  CG  . ASP A 1 12  ? -23.866 -11.006 -3.194 1.00 37.41  ? 11  ASP A CG  1 
ATOM   98   O  OD1 . ASP A 1 12  ? -22.743 -10.586 -3.533 1.00 32.26  ? 11  ASP A OD1 1 
ATOM   99   O  OD2 . ASP A 1 12  ? -24.744 -11.302 -4.026 1.00 43.10  ? 11  ASP A OD2 1 
ATOM   100  N  N   . PHE A 1 13  ? -20.697 -11.255 -1.076 1.00 19.39  ? 12  PHE A N   1 
ATOM   101  C  CA  . PHE A 1 13  ? -19.494 -10.446 -0.858 1.00 20.13  ? 12  PHE A CA  1 
ATOM   102  C  C   . PHE A 1 13  ? -19.412 -9.234  -1.793 1.00 31.20  ? 12  PHE A C   1 
ATOM   103  O  O   . PHE A 1 13  ? -18.713 -8.263  -1.495 1.00 47.25  ? 12  PHE A O   1 
ATOM   104  C  CB  . PHE A 1 13  ? -18.239 -11.306 -0.991 1.00 27.19  ? 12  PHE A CB  1 
ATOM   105  C  CG  . PHE A 1 13  ? -17.953 -12.194 0.206  1.00 28.99  ? 12  PHE A CG  1 
ATOM   106  C  CD1 . PHE A 1 13  ? -18.954 -12.560 1.101  1.00 22.48  ? 12  PHE A CD1 1 
ATOM   107  C  CD2 . PHE A 1 13  ? -16.669 -12.695 0.408  1.00 30.95  ? 12  PHE A CD2 1 
ATOM   108  C  CE1 . PHE A 1 13  ? -18.679 -13.395 2.190  1.00 12.25  ? 12  PHE A CE1 1 
ATOM   109  C  CE2 . PHE A 1 13  ? -16.385 -13.532 1.487  1.00 26.15  ? 12  PHE A CE2 1 
ATOM   110  C  CZ  . PHE A 1 13  ? -17.395 -13.885 2.380  1.00 30.91  ? 12  PHE A CZ  1 
ATOM   111  N  N   . GLU A 1 14  ? -20.136 -9.299  -2.910 1.00 21.76  ? 13  GLU A N   1 
ATOM   112  C  CA  . GLU A 1 14  ? -20.230 -8.188  -3.859 1.00 33.66  ? 13  GLU A CA  1 
ATOM   113  C  C   . GLU A 1 14  ? -21.168 -7.085  -3.374 1.00 25.30  ? 13  GLU A C   1 
ATOM   114  O  O   . GLU A 1 14  ? -20.905 -5.904  -3.600 1.00 28.41  ? 13  GLU A O   1 
ATOM   115  C  CB  . GLU A 1 14  ? -20.699 -8.681  -5.238 1.00 23.33  ? 13  GLU A CB  1 
ATOM   116  C  CG  . GLU A 1 14  ? -19.835 -9.780  -5.851 1.00 44.31  ? 13  GLU A CG  1 
ATOM   117  C  CD  . GLU A 1 14  ? -18.457 -9.295  -6.286 1.00 57.73  ? 13  GLU A CD  1 
ATOM   118  O  OE1 . GLU A 1 14  ? -18.345 -8.173  -6.830 1.00 60.89  ? 13  GLU A OE1 1 
ATOM   119  O  OE2 . GLU A 1 14  ? -17.481 -10.047 -6.088 1.00 67.20  ? 13  GLU A OE2 1 
ATOM   120  N  N   . THR A 1 15  ? -22.267 -7.472  -2.725 1.00 28.38  ? 14  THR A N   1 
ATOM   121  C  CA  . THR A 1 15  ? -23.315 -6.522  -2.346 1.00 29.06  ? 14  THR A CA  1 
ATOM   122  C  C   . THR A 1 15  ? -23.458 -6.334  -0.837 1.00 16.59  ? 14  THR A C   1 
ATOM   123  O  O   . THR A 1 15  ? -24.021 -5.335  -0.388 1.00 24.01  ? 14  THR A O   1 
ATOM   124  C  CB  . THR A 1 15  ? -24.697 -6.948  -2.884 1.00 17.31  ? 14  THR A CB  1 
ATOM   125  O  OG1 . THR A 1 15  ? -25.100 -8.158  -2.238 1.00 21.36  ? 14  THR A OG1 1 
ATOM   126  C  CG2 . THR A 1 15  ? -24.658 -7.173  -4.387 1.00 23.54  ? 14  THR A CG2 1 
ATOM   127  N  N   . GLY A 1 16  ? -22.982 -7.311  -0.070 1.00 21.61  ? 15  GLY A N   1 
ATOM   128  C  CA  . GLY A 1 16  ? -23.173 -7.330  1.378  1.00 19.21  ? 15  GLY A CA  1 
ATOM   129  C  C   . GLY A 1 16  ? -24.533 -7.821  1.842  1.00 30.73  ? 15  GLY A C   1 
ATOM   130  O  O   . GLY A 1 16  ? -24.787 -7.884  3.044  1.00 16.47  ? 15  GLY A O   1 
ATOM   131  N  N   . ILE A 1 17  ? -25.404 -8.195  0.904  1.00 21.42  ? 16  ILE A N   1 
ATOM   132  C  CA  . ILE A 1 17  ? -26.782 -8.573  1.250  1.00 23.58  ? 16  ILE A CA  1 
ATOM   133  C  C   . ILE A 1 17  ? -26.870 -9.934  1.942  1.00 24.64  ? 16  ILE A C   1 
ATOM   134  O  O   . ILE A 1 17  ? -26.205 -10.890 1.538  1.00 18.54  ? 16  ILE A O   1 
ATOM   135  C  CB  . ILE A 1 17  ? -27.744 -8.505  0.030  1.00 22.64  ? 16  ILE A CB  1 
ATOM   136  C  CG1 . ILE A 1 17  ? -27.879 -7.061  -0.462 1.00 16.74  ? 16  ILE A CG1 1 
ATOM   137  C  CG2 . ILE A 1 17  ? -29.138 -9.089  0.376  1.00 23.44  ? 16  ILE A CG2 1 
ATOM   138  C  CD1 . ILE A 1 17  ? -28.560 -6.914  -1.834 1.00 25.29  ? 16  ILE A CD1 1 
ATOM   139  N  N   . ILE A 1 18  ? -27.675 -9.975  3.008  1.00 17.39  ? 17  ILE A N   1 
ATOM   140  C  CA  . ILE A 1 18  ? -28.087 -11.206 3.686  1.00 17.60  ? 17  ILE A CA  1 
ATOM   141  C  C   . ILE A 1 18  ? -29.611 -11.310 3.555  1.00 15.12  ? 17  ILE A C   1 
ATOM   142  O  O   . ILE A 1 18  ? -30.340 -10.510 4.145  1.00 21.92  ? 17  ILE A O   1 
ATOM   143  C  CB  . ILE A 1 18  ? -27.711 -11.210 5.212  1.00 17.57  ? 17  ILE A CB  1 
ATOM   144  C  CG1 . ILE A 1 18  ? -26.208 -10.927 5.423  1.00 15.85  ? 17  ILE A CG1 1 
ATOM   145  C  CG2 . ILE A 1 18  ? -28.173 -12.535 5.906  1.00 13.40  ? 17  ILE A CG2 1 
ATOM   146  C  CD1 . ILE A 1 18  ? -25.766 -10.947 6.904  1.00 13.72  ? 17  ILE A CD1 1 
ATOM   147  N  N   . GLU A 1 19  ? -30.091 -12.286 2.785  1.00 39.12  ? 18  GLU A N   1 
ATOM   148  C  CA  . GLU A 1 19  ? -31.538 -12.486 2.612  1.00 36.05  ? 18  GLU A CA  1 
ATOM   149  C  C   . GLU A 1 19  ? -32.176 -12.955 3.921  1.00 37.94  ? 18  GLU A C   1 
ATOM   150  O  O   . GLU A 1 19  ? -31.629 -13.812 4.618  1.00 34.17  ? 18  GLU A O   1 
ATOM   151  C  CB  . GLU A 1 19  ? -31.845 -13.485 1.478  1.00 34.87  ? 18  GLU A CB  1 
ATOM   152  C  CG  . GLU A 1 19  ? -31.355 -13.074 0.073  1.00 37.93  ? 18  GLU A CG  1 
ATOM   153  C  CD  . GLU A 1 19  ? -32.140 -11.915 -0.545 1.00 58.92  ? 18  GLU A CD  1 
ATOM   154  O  OE1 . GLU A 1 19  ? -33.339 -11.744 -0.221 1.00 53.17  ? 18  GLU A OE1 1 
ATOM   155  O  OE2 . GLU A 1 19  ? -31.552 -11.176 -1.368 1.00 54.46  ? 18  GLU A OE2 1 
ATOM   156  N  N   . GLY A 1 20  ? -33.327 -12.375 4.252  1.00 37.83  ? 19  GLY A N   1 
ATOM   157  C  CA  . GLY A 1 20  ? -34.065 -12.738 5.459  1.00 36.37  ? 19  GLY A CA  1 
ATOM   158  C  C   . GLY A 1 20  ? -33.683 -11.937 6.690  1.00 28.40  ? 19  GLY A C   1 
ATOM   159  O  O   . GLY A 1 20  ? -34.400 -11.963 7.693  1.00 35.48  ? 19  GLY A O   1 
ATOM   160  N  N   . ALA A 1 21  ? -32.557 -11.228 6.611  1.00 26.64  ? 20  ALA A N   1 
ATOM   161  C  CA  . ALA A 1 21  ? -32.056 -10.405 7.719  1.00 25.05  ? 20  ALA A CA  1 
ATOM   162  C  C   . ALA A 1 21  ? -32.856 -9.109  7.889  1.00 28.10  ? 20  ALA A C   1 
ATOM   163  O  O   . ALA A 1 21  ? -33.572 -8.683  6.978  1.00 30.90  ? 20  ALA A O   1 
ATOM   164  C  CB  . ALA A 1 21  ? -30.571 -10.101 7.527  1.00 20.87  ? 20  ALA A CB  1 
ATOM   165  N  N   . LYS A 1 22  ? -32.741 -8.504  9.070  1.00 19.30  ? 21  LYS A N   1 
ATOM   166  C  CA  . LYS A 1 22  ? -33.345 -7.211  9.348  1.00 29.37  ? 21  LYS A CA  1 
ATOM   167  C  C   . LYS A 1 22  ? -32.499 -6.105  8.696  1.00 30.87  ? 21  LYS A C   1 
ATOM   168  O  O   . LYS A 1 22  ? -31.385 -5.810  9.146  1.00 21.77  ? 21  LYS A O   1 
ATOM   169  C  CB  . LYS A 1 22  ? -33.488 -7.007  10.867 1.00 20.59  ? 21  LYS A CB  1 
ATOM   170  C  CG  . LYS A 1 22  ? -34.247 -5.743  11.282 1.00 46.98  ? 21  LYS A CG  1 
ATOM   171  C  CD  . LYS A 1 22  ? -34.803 -5.877  12.695 1.00 61.23  ? 21  LYS A CD  1 
ATOM   172  C  CE  . LYS A 1 22  ? -35.695 -4.703  13.075 1.00 73.16  ? 21  LYS A CE  1 
ATOM   173  N  NZ  . LYS A 1 22  ? -34.909 -3.490  13.435 1.00 68.44  ? 21  LYS A NZ  1 
ATOM   174  N  N   . LYS A 1 23  ? -33.032 -5.521  7.622  1.00 25.10  ? 22  LYS A N   1 
ATOM   175  C  CA  . LYS A 1 23  ? -32.380 -4.421  6.911  1.00 20.47  ? 22  LYS A CA  1 
ATOM   176  C  C   . LYS A 1 23  ? -32.724 -3.049  7.508  1.00 27.21  ? 22  LYS A C   1 
ATOM   177  O  O   . LYS A 1 23  ? -33.894 -2.729  7.710  1.00 26.66  ? 22  LYS A O   1 
ATOM   178  C  CB  . LYS A 1 23  ? -32.743 -4.460  5.421  1.00 17.31  ? 22  LYS A CB  1 
ATOM   179  C  CG  . LYS A 1 23  ? -32.090 -3.375  4.578  1.00 24.39  ? 22  LYS A CG  1 
ATOM   180  C  CD  . LYS A 1 23  ? -32.670 -3.332  3.174  1.00 32.65  ? 22  LYS A CD  1 
ATOM   181  C  CE  . LYS A 1 23  ? -31.988 -2.268  2.329  1.00 32.95  ? 22  LYS A CE  1 
ATOM   182  N  NZ  . LYS A 1 23  ? -32.475 -2.258  0.913  1.00 36.75  ? 22  LYS A NZ  1 
ATOM   183  N  N   . SER A 1 24  ? -31.691 -2.260  7.801  1.00 17.56  ? 23  SER A N   1 
ATOM   184  C  CA  . SER A 1 24  ? -31.830 -0.845  8.155  1.00 15.78  ? 23  SER A CA  1 
ATOM   185  C  C   . SER A 1 24  ? -31.095 0.000   7.119  1.00 19.97  ? 23  SER A C   1 
ATOM   186  O  O   . SER A 1 24  ? -30.065 -0.420  6.580  1.00 21.99  ? 23  SER A O   1 
ATOM   187  C  CB  . SER A 1 24  ? -31.221 -0.553  9.528  1.00 20.26  ? 23  SER A CB  1 
ATOM   188  O  OG  . SER A 1 24  ? -31.663 -1.473  10.498 1.00 26.91  ? 23  SER A OG  1 
ATOM   189  N  N   . VAL A 1 25  ? -31.625 1.190   6.851  1.00 15.81  ? 24  VAL A N   1 
ATOM   190  C  CA  . VAL A 1 25  ? -30.981 2.156   5.957  1.00 17.28  ? 24  VAL A CA  1 
ATOM   191  C  C   . VAL A 1 25  ? -30.755 3.461   6.731  1.00 9.80   ? 24  VAL A C   1 
ATOM   192  O  O   . VAL A 1 25  ? -31.662 3.958   7.397  1.00 21.61  ? 24  VAL A O   1 
ATOM   193  C  CB  . VAL A 1 25  ? -31.841 2.430   4.681  1.00 23.71  ? 24  VAL A CB  1 
ATOM   194  C  CG1 . VAL A 1 25  ? -31.126 3.387   3.720  1.00 18.31  ? 24  VAL A CG1 1 
ATOM   195  C  CG2 . VAL A 1 25  ? -32.191 1.126   3.966  1.00 25.01  ? 24  VAL A CG2 1 
ATOM   196  N  N   . ARG A 1 26  ? -29.540 3.994   6.667  1.00 14.02  ? 25  ARG A N   1 
ATOM   197  C  CA  . ARG A 1 26  ? -29.272 5.312   7.208  1.00 18.98  ? 25  ARG A CA  1 
ATOM   198  C  C   . ARG A 1 26  ? -28.983 6.261   6.054  1.00 26.85  ? 25  ARG A C   1 
ATOM   199  O  O   . ARG A 1 26  ? -28.012 6.072   5.311  1.00 13.19  ? 25  ARG A O   1 
ATOM   200  C  CB  . ARG A 1 26  ? -28.101 5.292   8.201  1.00 25.83  ? 25  ARG A CB  1 
ATOM   201  C  CG  . ARG A 1 26  ? -28.232 4.253   9.307  1.00 40.49  ? 25  ARG A CG  1 
ATOM   202  C  CD  . ARG A 1 26  ? -28.962 4.789   10.516 1.00 48.47  ? 25  ARG A CD  1 
ATOM   203  N  NE  . ARG A 1 26  ? -29.443 3.709   11.374 1.00 54.18  ? 25  ARG A NE  1 
ATOM   204  C  CZ  . ARG A 1 26  ? -30.675 3.209   11.333 1.00 60.86  ? 25  ARG A CZ  1 
ATOM   205  N  NH1 . ARG A 1 26  ? -31.571 3.689   10.478 1.00 49.57  ? 25  ARG A NH1 1 
ATOM   206  N  NH2 . ARG A 1 26  ? -31.016 2.224   12.153 1.00 69.50  ? 25  ARG A NH2 1 
ATOM   207  N  N   . ARG A 1 27  ? -29.848 7.261   5.894  1.00 16.96  ? 26  ARG A N   1 
ATOM   208  C  CA  . ARG A 1 27  ? -29.594 8.344   4.949  1.00 16.28  ? 26  ARG A CA  1 
ATOM   209  C  C   . ARG A 1 27  ? -28.902 9.489   5.667  1.00 17.80  ? 26  ARG A C   1 
ATOM   210  O  O   . ARG A 1 27  ? -28.765 9.471   6.894  1.00 11.71  ? 26  ARG A O   1 
ATOM   211  C  CB  . ARG A 1 27  ? -30.895 8.804   4.276  1.00 17.58  ? 26  ARG A CB  1 
ATOM   212  C  CG  . ARG A 1 27  ? -31.418 7.804   3.254  1.00 22.05  ? 26  ARG A CG  1 
ATOM   213  C  CD  . ARG A 1 27  ? -32.661 8.278   2.513  1.00 17.78  ? 26  ARG A CD  1 
ATOM   214  N  NE  . ARG A 1 27  ? -33.102 7.262   1.552  1.00 27.65  ? 26  ARG A NE  1 
ATOM   215  C  CZ  . ARG A 1 27  ? -32.695 7.182   0.282  1.00 31.73  ? 26  ARG A CZ  1 
ATOM   216  N  NH1 . ARG A 1 27  ? -31.839 8.065   -0.219 1.00 17.79  ? 26  ARG A NH1 1 
ATOM   217  N  NH2 . ARG A 1 27  ? -33.154 6.217   -0.501 1.00 33.59  ? 26  ARG A NH2 1 
ATOM   218  N  N   . LEU A 1 28  ? -28.456 10.485  4.913  1.00 15.51  ? 27  LEU A N   1 
ATOM   219  C  CA  . LEU A 1 28  ? -27.799 11.626  5.526  1.00 9.66   ? 27  LEU A CA  1 
ATOM   220  C  C   . LEU A 1 28  ? -28.676 12.356  6.563  1.00 18.47  ? 27  LEU A C   1 
ATOM   221  O  O   . LEU A 1 28  ? -28.177 12.747  7.611  1.00 14.70  ? 27  LEU A O   1 
ATOM   222  C  CB  . LEU A 1 28  ? -27.228 12.573  4.473  1.00 14.86  ? 27  LEU A CB  1 
ATOM   223  C  CG  . LEU A 1 28  ? -25.969 13.361  4.852  1.00 28.42  ? 27  LEU A CG  1 
ATOM   224  C  CD1 . LEU A 1 28  ? -24.823 12.488  5.377  1.00 17.82  ? 27  LEU A CD1 1 
ATOM   225  C  CD2 . LEU A 1 28  ? -25.506 14.133  3.653  1.00 25.99  ? 27  LEU A CD2 1 
ATOM   226  N  N   . SER A 1 29  ? -29.972 12.492  6.280  1.00 14.93  ? 28  SER A N   1 
ATOM   227  C  CA  . SER A 1 29  ? -30.957 13.070  7.215  1.00 14.40  ? 28  SER A CA  1 
ATOM   228  C  C   . SER A 1 29  ? -31.055 12.349  8.574  1.00 12.87  ? 28  SER A C   1 
ATOM   229  O  O   . SER A 1 29  ? -31.572 12.914  9.543  1.00 14.37  ? 28  SER A O   1 
ATOM   230  C  CB  . SER A 1 29  ? -32.350 13.084  6.571  1.00 12.24  ? 28  SER A CB  1 
ATOM   231  O  OG  . SER A 1 29  ? -32.697 11.782  6.132  1.00 15.38  ? 28  SER A OG  1 
ATOM   232  N  N   . ASP A 1 30  ? -30.590 11.102  8.635  1.00 19.04  ? 29  ASP A N   1 
ATOM   233  C  CA  . ASP A 1 30  ? -30.571 10.338  9.892  1.00 14.66  ? 29  ASP A CA  1 
ATOM   234  C  C   . ASP A 1 30  ? -29.329 10.659  10.703 1.00 17.21  ? 29  ASP A C   1 
ATOM   235  O  O   . ASP A 1 30  ? -29.124 10.104  11.789 1.00 17.84  ? 29  ASP A O   1 
ATOM   236  C  CB  . ASP A 1 30  ? -30.608 8.829   9.615  1.00 17.55  ? 29  ASP A CB  1 
ATOM   237  C  CG  . ASP A 1 30  ? -31.899 8.392   8.963  1.00 25.28  ? 29  ASP A CG  1 
ATOM   238  O  OD1 . ASP A 1 30  ? -32.960 8.659   9.553  1.00 19.98  ? 29  ASP A OD1 1 
ATOM   239  O  OD2 . ASP A 1 30  ? -31.855 7.791   7.866  1.00 18.32  ? 29  ASP A OD2 1 
ATOM   240  N  N   . MET A 1 31  ? -28.497 11.550  10.174 1.00 12.53  ? 30  MET A N   1 
ATOM   241  C  CA  . MET A 1 31  ? -27.188 11.818  10.779 1.00 17.47  ? 30  MET A CA  1 
ATOM   242  C  C   . MET A 1 31  ? -26.926 13.303  11.057 1.00 17.22  ? 30  MET A C   1 
ATOM   243  O  O   . MET A 1 31  ? -25.805 13.809  10.874 1.00 17.21  ? 30  MET A O   1 
ATOM   244  C  CB  . MET A 1 31  ? -26.076 11.187  9.935  1.00 11.54  ? 30  MET A CB  1 
ATOM   245  C  CG  . MET A 1 31  ? -26.156 9.665   9.900  1.00 18.50  ? 30  MET A CG  1 
ATOM   246  S  SD  . MET A 1 31  ? -24.966 8.863   8.821  1.00 15.12  ? 30  MET A SD  1 
ATOM   247  C  CE  . MET A 1 31  ? -23.494 9.016   9.842  1.00 15.24  ? 30  MET A CE  1 
ATOM   248  N  N   . GLU A 1 32  ? -27.957 14.000  11.526 1.00 17.45  ? 31  GLU A N   1 
ATOM   249  C  CA  . GLU A 1 32  ? -27.764 15.364  11.997 1.00 22.46  ? 31  GLU A CA  1 
ATOM   250  C  C   . GLU A 1 32  ? -26.807 15.395  13.206 1.00 10.16  ? 31  GLU A C   1 
ATOM   251  O  O   . GLU A 1 32  ? -26.861 14.525  14.079 1.00 21.27  ? 31  GLU A O   1 
ATOM   252  C  CB  . GLU A 1 32  ? -29.102 16.022  12.329 1.00 16.70  ? 31  GLU A CB  1 
ATOM   253  C  CG  . GLU A 1 32  ? -28.986 17.518  12.661 1.00 20.90  ? 31  GLU A CG  1 
ATOM   254  C  CD  . GLU A 1 32  ? -30.300 18.266  12.539 1.00 36.31  ? 31  GLU A CD  1 
ATOM   255  O  OE1 . GLU A 1 32  ? -31.367 17.644  12.729 1.00 39.38  ? 31  GLU A OE1 1 
ATOM   256  O  OE2 . GLU A 1 32  ? -30.263 19.483  12.249 1.00 35.90  ? 31  GLU A OE2 1 
ATOM   257  N  N   . GLY A 1 33  ? -25.932 16.391  13.228 1.00 11.91  ? 32  GLY A N   1 
ATOM   258  C  CA  . GLY A 1 33  ? -25.010 16.609  14.343 1.00 21.32  ? 32  GLY A CA  1 
ATOM   259  C  C   . GLY A 1 33  ? -23.847 15.646  14.377 1.00 22.55  ? 32  GLY A C   1 
ATOM   260  O  O   . GLY A 1 33  ? -23.153 15.530  15.396 1.00 19.46  ? 32  GLY A O   1 
ATOM   261  N  N   . TYR A 1 34  ? -23.631 14.956  13.260 1.00 13.64  ? 33  TYR A N   1 
ATOM   262  C  CA  . TYR A 1 34  ? -22.559 13.962  13.151 1.00 10.62  ? 33  TYR A CA  1 
ATOM   263  C  C   . TYR A 1 34  ? -21.334 14.476  12.403 1.00 10.70  ? 33  TYR A C   1 
ATOM   264  O  O   . TYR A 1 34  ? -20.203 14.180  12.789 1.00 11.01  ? 33  TYR A O   1 
ATOM   265  C  CB  . TYR A 1 34  ? -23.089 12.652  12.533 1.00 7.29   ? 33  TYR A CB  1 
ATOM   266  C  CG  . TYR A 1 34  ? -23.714 11.733  13.563 1.00 16.22  ? 33  TYR A CG  1 
ATOM   267  C  CD1 . TYR A 1 34  ? -25.067 11.837  13.903 1.00 16.62  ? 33  TYR A CD1 1 
ATOM   268  C  CD2 . TYR A 1 34  ? -22.940 10.772  14.218 1.00 16.87  ? 33  TYR A CD2 1 
ATOM   269  C  CE1 . TYR A 1 34  ? -25.633 10.990  14.869 1.00 14.29  ? 33  TYR A CE1 1 
ATOM   270  C  CE2 . TYR A 1 34  ? -23.492 9.933   15.173 1.00 18.86  ? 33  TYR A CE2 1 
ATOM   271  C  CZ  . TYR A 1 34  ? -24.832 10.050  15.498 1.00 16.85  ? 33  TYR A CZ  1 
ATOM   272  O  OH  . TYR A 1 34  ? -25.353 9.205   16.439 1.00 15.33  ? 33  TYR A OH  1 
ATOM   273  N  N   . PHE A 1 35  ? -21.553 15.250  11.343 1.00 12.62  ? 34  PHE A N   1 
ATOM   274  C  CA  . PHE A 1 35  ? -20.448 15.704  10.486 1.00 12.80  ? 34  PHE A CA  1 
ATOM   275  C  C   . PHE A 1 35  ? -20.001 17.122  10.832 1.00 8.16   ? 34  PHE A C   1 
ATOM   276  O  O   . PHE A 1 35  ? -20.822 17.956  11.236 1.00 19.93  ? 34  PHE A O   1 
ATOM   277  C  CB  . PHE A 1 35  ? -20.830 15.603  8.996  1.00 15.63  ? 34  PHE A CB  1 
ATOM   278  C  CG  . PHE A 1 35  ? -21.025 14.186  8.505  1.00 10.07  ? 34  PHE A CG  1 
ATOM   279  C  CD1 . PHE A 1 35  ? -22.280 13.576  8.574  1.00 9.75   ? 34  PHE A CD1 1 
ATOM   280  C  CD2 . PHE A 1 35  ? -19.959 13.467  7.955  1.00 11.14  ? 34  PHE A CD2 1 
ATOM   281  C  CE1 . PHE A 1 35  ? -22.472 12.270  8.127  1.00 11.06  ? 34  PHE A CE1 1 
ATOM   282  C  CE2 . PHE A 1 35  ? -20.146 12.147  7.478  1.00 9.24   ? 34  PHE A CE2 1 
ATOM   283  C  CZ  . PHE A 1 35  ? -21.410 11.550  7.571  1.00 12.57  ? 34  PHE A CZ  1 
ATOM   284  N  N   . VAL A 1 36  ? -18.700 17.393  10.671 1.00 15.47  ? 35  VAL A N   1 
ATOM   285  C  CA  . VAL A 1 36  ? -18.102 18.699  11.020 1.00 10.58  ? 35  VAL A CA  1 
ATOM   286  C  C   . VAL A 1 36  ? -18.742 19.859  10.239 1.00 23.30  ? 35  VAL A C   1 
ATOM   287  O  O   . VAL A 1 36  ? -19.094 20.896  10.811 1.00 21.80  ? 35  VAL A O   1 
ATOM   288  C  CB  . VAL A 1 36  ? -16.547 18.705  10.797 1.00 23.36  ? 35  VAL A CB  1 
ATOM   289  C  CG1 . VAL A 1 36  ? -15.956 20.118  10.980 1.00 14.96  ? 35  VAL A CG1 1 
ATOM   290  C  CG2 . VAL A 1 36  ? -15.857 17.718  11.732 1.00 17.34  ? 35  VAL A CG2 1 
ATOM   291  N  N   . ASP A 1 37  ? -18.899 19.675  8.932  1.00 16.37  ? 36  ASP A N   1 
ATOM   292  C  CA  . ASP A 1 37  ? -19.413 20.730  8.060  1.00 16.51  ? 36  ASP A CA  1 
ATOM   293  C  C   . ASP A 1 37  ? -20.949 20.655  7.959  1.00 20.82  ? 36  ASP A C   1 
ATOM   294  O  O   . ASP A 1 37  ? -21.491 19.980  7.075  1.00 17.82  ? 36  ASP A O   1 
ATOM   295  C  CB  . ASP A 1 37  ? -18.746 20.629  6.673  1.00 9.48   ? 36  ASP A CB  1 
ATOM   296  C  CG  . ASP A 1 37  ? -19.005 21.852  5.799  1.00 25.68  ? 36  ASP A CG  1 
ATOM   297  O  OD1 . ASP A 1 37  ? -19.993 22.578  6.037  1.00 21.43  ? 36  ASP A OD1 1 
ATOM   298  O  OD2 . ASP A 1 37  ? -18.224 22.076  4.857  1.00 19.40  ? 36  ASP A OD2 1 
ATOM   299  N  N   . GLU A 1 38  ? -21.645 21.351  8.863  1.00 18.25  ? 37  GLU A N   1 
ATOM   300  C  CA  . GLU A 1 38  ? -23.121 21.261  8.959  1.00 19.68  ? 37  GLU A CA  1 
ATOM   301  C  C   . GLU A 1 38  ? -23.876 21.902  7.788  1.00 18.55  ? 37  GLU A C   1 
ATOM   302  O  O   . GLU A 1 38  ? -24.970 21.448  7.427  1.00 12.10  ? 37  GLU A O   1 
ATOM   303  C  CB  . GLU A 1 38  ? -23.633 21.825  10.301 1.00 31.04  ? 37  GLU A CB  1 
ATOM   304  C  CG  . GLU A 1 38  ? -24.907 21.132  10.851 1.00 29.51  ? 37  GLU A CG  1 
ATOM   305  C  CD  . GLU A 1 38  ? -24.700 19.648  11.262 1.00 65.34  ? 37  GLU A CD  1 
ATOM   306  O  OE1 . GLU A 1 38  ? -23.682 19.343  11.932 1.00 70.85  ? 37  GLU A OE1 1 
ATOM   307  O  OE2 . GLU A 1 38  ? -25.566 18.787  10.931 1.00 28.44  ? 37  GLU A OE2 1 
ATOM   308  N  N   . ARG A 1 39  ? -23.307 22.959  7.208  1.00 17.18  ? 38  ARG A N   1 
ATOM   309  C  CA  . ARG A 1 39  ? -23.876 23.571  6.004  1.00 22.97  ? 38  ARG A CA  1 
ATOM   310  C  C   . ARG A 1 39  ? -23.779 22.629  4.807  1.00 9.81   ? 38  ARG A C   1 
ATOM   311  O  O   . ARG A 1 39  ? -24.731 22.517  4.030  1.00 24.05  ? 38  ARG A O   1 
ATOM   312  C  CB  . ARG A 1 39  ? -23.230 24.926  5.677  1.00 17.16  ? 38  ARG A CB  1 
ATOM   313  C  CG  . ARG A 1 39  ? -23.657 26.064  6.603  1.00 25.49  ? 38  ARG A CG  1 
ATOM   314  C  CD  . ARG A 1 39  ? -23.333 27.452  6.009  1.00 23.33  ? 38  ARG A CD  1 
ATOM   315  N  NE  . ARG A 1 39  ? -24.023 27.735  4.741  1.00 25.15  ? 38  ARG A NE  1 
ATOM   316  C  CZ  . ARG A 1 39  ? -25.306 28.087  4.633  1.00 25.57  ? 38  ARG A CZ  1 
ATOM   317  N  NH1 . ARG A 1 39  ? -26.072 28.186  5.711  1.00 34.55  ? 38  ARG A NH1 1 
ATOM   318  N  NH2 . ARG A 1 39  ? -25.830 28.335  3.437  1.00 22.63  ? 38  ARG A NH2 1 
ATOM   319  N  N   . ALA A 1 40  ? -22.634 21.959  4.666  1.00 17.82  ? 39  ALA A N   1 
ATOM   320  C  CA  . ALA A 1 40  ? -22.465 20.921  3.643  1.00 19.82  ? 39  ALA A CA  1 
ATOM   321  C  C   . ALA A 1 40  ? -23.487 19.820  3.861  1.00 23.95  ? 39  ALA A C   1 
ATOM   322  O  O   . ALA A 1 40  ? -24.133 19.365  2.906  1.00 18.70  ? 39  ALA A O   1 
ATOM   323  C  CB  . ALA A 1 40  ? -21.058 20.350  3.672  1.00 17.63  ? 39  ALA A CB  1 
ATOM   324  N  N   . TRP A 1 41  ? -23.637 19.415  5.125  1.00 15.71  ? 40  TRP A N   1 
ATOM   325  C  CA  . TRP A 1 41  ? -24.606 18.403  5.525  1.00 15.06  ? 40  TRP A CA  1 
ATOM   326  C  C   . TRP A 1 41  ? -26.005 18.813  5.101  1.00 11.95  ? 40  TRP A C   1 
ATOM   327  O  O   . TRP A 1 41  ? -26.719 18.028  4.481  1.00 17.91  ? 40  TRP A O   1 
ATOM   328  C  CB  . TRP A 1 41  ? -24.583 18.165  7.049  1.00 13.08  ? 40  TRP A CB  1 
ATOM   329  C  CG  . TRP A 1 41  ? -25.645 17.173  7.494  1.00 15.80  ? 40  TRP A CG  1 
ATOM   330  C  CD1 . TRP A 1 41  ? -25.548 15.816  7.483  1.00 17.27  ? 40  TRP A CD1 1 
ATOM   331  C  CD2 . TRP A 1 41  ? -26.965 17.477  7.973  1.00 18.08  ? 40  TRP A CD2 1 
ATOM   332  N  NE1 . TRP A 1 41  ? -26.720 15.250  7.929  1.00 16.14  ? 40  TRP A NE1 1 
ATOM   333  C  CE2 . TRP A 1 41  ? -27.606 16.247  8.240  1.00 26.64  ? 40  TRP A CE2 1 
ATOM   334  C  CE3 . TRP A 1 41  ? -27.671 18.671  8.200  1.00 23.63  ? 40  TRP A CE3 1 
ATOM   335  C  CZ2 . TRP A 1 41  ? -28.919 16.171  8.734  1.00 19.33  ? 40  TRP A CZ2 1 
ATOM   336  C  CZ3 . TRP A 1 41  ? -28.978 18.596  8.686  1.00 18.70  ? 40  TRP A CZ3 1 
ATOM   337  C  CH2 . TRP A 1 41  ? -29.584 17.352  8.949  1.00 20.21  ? 40  TRP A CH2 1 
ATOM   338  N  N   . LYS A 1 42  ? -26.378 20.042  5.456  1.00 15.19  ? 41  LYS A N   1 
ATOM   339  C  CA  . LYS A 1 42  ? -27.710 20.591  5.187  1.00 15.25  ? 41  LYS A CA  1 
ATOM   340  C  C   . LYS A 1 42  ? -28.008 20.647  3.684  1.00 16.03  ? 41  LYS A C   1 
ATOM   341  O  O   . LYS A 1 42  ? -29.088 20.247  3.252  1.00 15.81  ? 41  LYS A O   1 
ATOM   342  C  CB  . LYS A 1 42  ? -27.850 21.984  5.825  1.00 20.37  ? 41  LYS A CB  1 
ATOM   343  C  CG  . LYS A 1 42  ? -29.231 22.638  5.686  1.00 49.09  ? 41  LYS A CG  1 
ATOM   344  C  CD  . LYS A 1 42  ? -30.202 22.221  6.785  1.00 46.67  ? 41  LYS A CD  1 
ATOM   345  C  CE  . LYS A 1 42  ? -30.046 23.083  8.036  1.00 67.29  ? 41  LYS A CE  1 
ATOM   346  N  NZ  . LYS A 1 42  ? -30.968 22.656  9.132  1.00 68.57  ? 41  LYS A NZ  1 
ATOM   347  N  N   . GLU A 1 43  ? -27.049 21.133  2.898  1.00 20.57  ? 42  GLU A N   1 
ATOM   348  C  CA  . GLU A 1 43  ? -27.234 21.266  1.447  1.00 29.68  ? 42  GLU A CA  1 
ATOM   349  C  C   . GLU A 1 43  ? -27.424 19.902  0.792  1.00 20.15  ? 42  GLU A C   1 
ATOM   350  O  O   . GLU A 1 43  ? -28.276 19.732  -0.074 1.00 17.83  ? 42  GLU A O   1 
ATOM   351  C  CB  . GLU A 1 43  ? -26.041 21.992  0.816  1.00 33.07  ? 42  GLU A CB  1 
ATOM   352  C  CG  . GLU A 1 43  ? -26.207 22.295  -0.677 1.00 48.47  ? 42  GLU A CG  1 
ATOM   353  C  CD  . GLU A 1 43  ? -24.961 22.906  -1.302 1.00 58.26  ? 42  GLU A CD  1 
ATOM   354  O  OE1 . GLU A 1 43  ? -24.488 22.369  -2.331 1.00 48.90  ? 42  GLU A OE1 1 
ATOM   355  O  OE2 . GLU A 1 43  ? -24.451 23.917  -0.766 1.00 74.76  ? 42  GLU A OE2 1 
ATOM   356  N  N   . LEU A 1 44  ? -26.627 18.933  1.234  1.00 19.39  ? 43  LEU A N   1 
ATOM   357  C  CA  . LEU A 1 44  ? -26.666 17.570  0.707  1.00 19.04  ? 43  LEU A CA  1 
ATOM   358  C  C   . LEU A 1 44  ? -27.959 16.826  1.030  1.00 14.97  ? 43  LEU A C   1 
ATOM   359  O  O   . LEU A 1 44  ? -28.461 16.077  0.198  1.00 18.97  ? 43  LEU A O   1 
ATOM   360  C  CB  . LEU A 1 44  ? -25.461 16.800  1.218  1.00 25.32  ? 43  LEU A CB  1 
ATOM   361  C  CG  . LEU A 1 44  ? -24.930 15.597  0.455  1.00 29.97  ? 43  LEU A CG  1 
ATOM   362  C  CD1 . LEU A 1 44  ? -25.107 15.714  -1.061 1.00 27.18  ? 43  LEU A CD1 1 
ATOM   363  C  CD2 . LEU A 1 44  ? -23.477 15.467  0.852  1.00 22.14  ? 43  LEU A CD2 1 
ATOM   364  N  N   . VAL A 1 45  ? -28.491 17.032  2.236  1.00 16.36  ? 44  VAL A N   1 
ATOM   365  C  CA  . VAL A 1 45  ? -29.821 16.514  2.613  1.00 18.43  ? 44  VAL A CA  1 
ATOM   366  C  C   . VAL A 1 45  ? -30.930 17.152  1.757  1.00 13.71  ? 44  VAL A C   1 
ATOM   367  O  O   . VAL A 1 45  ? -31.843 16.461  1.293  1.00 25.05  ? 44  VAL A O   1 
ATOM   368  C  CB  . VAL A 1 45  ? -30.122 16.742  4.127  1.00 17.37  ? 44  VAL A CB  1 
ATOM   369  C  CG1 . VAL A 1 45  ? -31.598 16.507  4.445  1.00 21.56  ? 44  VAL A CG1 1 
ATOM   370  C  CG2 . VAL A 1 45  ? -29.260 15.839  4.977  1.00 19.49  ? 44  VAL A CG2 1 
ATOM   371  N  N   . GLU A 1 46  ? -30.839 18.465  1.541  1.00 19.42  ? 45  GLU A N   1 
ATOM   372  C  CA  . GLU A 1 46  ? -31.803 19.184  0.692  1.00 26.58  ? 45  GLU A CA  1 
ATOM   373  C  C   . GLU A 1 46  ? -31.770 18.781  -0.797 1.00 22.03  ? 45  GLU A C   1 
ATOM   374  O  O   . GLU A 1 46  ? -32.822 18.655  -1.434 1.00 21.21  ? 45  GLU A O   1 
ATOM   375  C  CB  . GLU A 1 46  ? -31.656 20.693  0.864  1.00 20.23  ? 45  GLU A CB  1 
ATOM   376  C  CG  . GLU A 1 46  ? -32.022 21.163  2.277  1.00 62.29  ? 45  GLU A CG  1 
ATOM   377  C  CD  . GLU A 1 46  ? -32.181 22.667  2.399  1.00 80.61  ? 45  GLU A CD  1 
ATOM   378  O  OE1 . GLU A 1 46  ? -32.882 23.266  1.553  1.00 97.46  ? 45  GLU A OE1 1 
ATOM   379  O  OE2 . GLU A 1 46  ? -31.619 23.248  3.354  1.00 70.37  ? 45  GLU A OE2 1 
ATOM   380  N  N   . LYS A 1 47  ? -30.574 18.558  -1.336 1.00 13.72  ? 46  LYS A N   1 
ATOM   381  C  CA  . LYS A 1 47  ? -30.419 18.209  -2.755 1.00 18.64  ? 46  LYS A CA  1 
ATOM   382  C  C   . LYS A 1 47  ? -30.798 16.776  -3.118 1.00 21.64  ? 46  LYS A C   1 
ATOM   383  O  O   . LYS A 1 47  ? -31.390 16.530  -4.171 1.00 30.99  ? 46  LYS A O   1 
ATOM   384  C  CB  . LYS A 1 47  ? -28.980 18.478  -3.220 1.00 23.81  ? 46  LYS A CB  1 
ATOM   385  C  CG  . LYS A 1 47  ? -28.696 19.929  -3.544 1.00 18.47  ? 46  LYS A CG  1 
ATOM   386  C  CD  . LYS A 1 47  ? -27.298 20.113  -4.133 1.00 32.53  ? 46  LYS A CD  1 
ATOM   387  C  CE  . LYS A 1 47  ? -27.120 21.529  -4.666 1.00 51.23  ? 46  LYS A CE  1 
ATOM   388  N  NZ  . LYS A 1 47  ? -25.708 21.843  -5.032 1.00 57.63  ? 46  LYS A NZ  1 
ATOM   389  N  N   . GLU A 1 48  ? -30.453 15.833  -2.245 1.00 9.48   ? 47  GLU A N   1 
ATOM   390  C  CA  . GLU A 1 48  ? -30.410 14.425  -2.608 1.00 11.06  ? 47  GLU A CA  1 
ATOM   391  C  C   . GLU A 1 48  ? -30.725 13.502  -1.431 1.00 18.60  ? 47  GLU A C   1 
ATOM   392  O  O   . GLU A 1 48  ? -31.315 12.437  -1.619 1.00 17.06  ? 47  GLU A O   1 
ATOM   393  C  CB  . GLU A 1 48  ? -29.022 14.111  -3.193 1.00 18.99  ? 47  GLU A CB  1 
ATOM   394  C  CG  . GLU A 1 48  ? -28.721 12.641  -3.473 1.00 41.97  ? 47  GLU A CG  1 
ATOM   395  C  CD  . GLU A 1 48  ? -27.246 12.385  -3.812 1.00 55.62  ? 47  GLU A CD  1 
ATOM   396  O  OE1 . GLU A 1 48  ? -26.923 11.247  -4.217 1.00 59.53  ? 47  GLU A OE1 1 
ATOM   397  O  OE2 . GLU A 1 48  ? -26.412 13.315  -3.685 1.00 49.80  ? 47  GLU A OE2 1 
ATOM   398  N  N   . ASP A 1 49  ? -30.338 13.914  -0.223 1.00 18.05  ? 48  ASP A N   1 
ATOM   399  C  CA  . ASP A 1 49  ? -30.363 13.027  0.953  1.00 13.04  ? 48  ASP A CA  1 
ATOM   400  C  C   . ASP A 1 49  ? -29.925 11.585  0.618  1.00 15.01  ? 48  ASP A C   1 
ATOM   401  O  O   . ASP A 1 49  ? -30.758 10.668  0.581  1.00 16.19  ? 48  ASP A O   1 
ATOM   402  C  CB  . ASP A 1 49  ? -31.741 13.050  1.646  1.00 16.33  ? 48  ASP A CB  1 
ATOM   403  C  CG  . ASP A 1 49  ? -31.713 12.387  3.014  1.00 13.08  ? 48  ASP A CG  1 
ATOM   404  O  OD1 . ASP A 1 49  ? -30.606 12.251  3.570  1.00 16.88  ? 48  ASP A OD1 1 
ATOM   405  O  OD2 . ASP A 1 49  ? -32.784 11.996  3.523  1.00 16.51  ? 48  ASP A OD2 1 
ATOM   406  N  N   . PRO A 1 50  ? -28.611 11.380  0.361  1.00 19.96  ? 49  PRO A N   1 
ATOM   407  C  CA  . PRO A 1 50  ? -28.134 10.055  -0.052 1.00 17.35  ? 49  PRO A CA  1 
ATOM   408  C  C   . PRO A 1 50  ? -28.093 9.022   1.076  1.00 11.26  ? 49  PRO A C   1 
ATOM   409  O  O   . PRO A 1 50  ? -28.060 9.380   2.257  1.00 8.03   ? 49  PRO A O   1 
ATOM   410  C  CB  . PRO A 1 50  ? -26.721 10.336  -0.575 1.00 19.17  ? 49  PRO A CB  1 
ATOM   411  C  CG  . PRO A 1 50  ? -26.283 11.562  0.151  1.00 15.45  ? 49  PRO A CG  1 
ATOM   412  C  CD  . PRO A 1 50  ? -27.520 12.371  0.418  1.00 14.56  ? 49  PRO A CD  1 
ATOM   413  N  N   . VAL A 1 51  ? -28.125 7.749   0.689  1.00 14.13  ? 50  VAL A N   1 
ATOM   414  C  CA  . VAL A 1 51  ? -27.863 6.646   1.598  1.00 24.70  ? 50  VAL A CA  1 
ATOM   415  C  C   . VAL A 1 51  ? -26.391 6.695   2.018  1.00 19.94  ? 50  VAL A C   1 
ATOM   416  O  O   . VAL A 1 51  ? -25.491 6.839   1.182  1.00 13.37  ? 50  VAL A O   1 
ATOM   417  C  CB  . VAL A 1 51  ? -28.180 5.272   0.953  1.00 24.42  ? 50  VAL A CB  1 
ATOM   418  C  CG1 . VAL A 1 51  ? -27.843 4.124   1.926  1.00 13.99  ? 50  VAL A CG1 1 
ATOM   419  C  CG2 . VAL A 1 51  ? -29.635 5.202   0.523  1.00 19.08  ? 50  VAL A CG2 1 
ATOM   420  N  N   . VAL A 1 52  ? -26.159 6.595   3.322  1.00 13.11  ? 51  VAL A N   1 
ATOM   421  C  CA  . VAL A 1 52  ? -24.810 6.566   3.856  1.00 8.84   ? 51  VAL A CA  1 
ATOM   422  C  C   . VAL A 1 52  ? -24.389 5.111   4.018  1.00 6.61   ? 51  VAL A C   1 
ATOM   423  O  O   . VAL A 1 52  ? -23.321 4.707   3.544  1.00 16.50  ? 51  VAL A O   1 
ATOM   424  C  CB  . VAL A 1 52  ? -24.712 7.344   5.180  1.00 10.10  ? 51  VAL A CB  1 
ATOM   425  C  CG1 . VAL A 1 52  ? -23.282 7.313   5.727  1.00 8.55   ? 51  VAL A CG1 1 
ATOM   426  C  CG2 . VAL A 1 52  ? -25.148 8.797   4.967  1.00 8.91   ? 51  VAL A CG2 1 
ATOM   427  N  N   . TYR A 1 53  ? -25.234 4.340   4.699  1.00 10.42  ? 52  TYR A N   1 
ATOM   428  C  CA  . TYR A 1 53  ? -25.049 2.903   4.838  1.00 8.20   ? 52  TYR A CA  1 
ATOM   429  C  C   . TYR A 1 53  ? -26.332 2.092   4.994  1.00 10.10  ? 52  TYR A C   1 
ATOM   430  O  O   . TYR A 1 53  ? -27.362 2.613   5.436  1.00 18.32  ? 52  TYR A O   1 
ATOM   431  C  CB  . TYR A 1 53  ? -24.085 2.572   5.980  1.00 13.24  ? 52  TYR A CB  1 
ATOM   432  C  CG  . TYR A 1 53  ? -24.436 3.067   7.378  1.00 5.80   ? 52  TYR A CG  1 
ATOM   433  C  CD1 . TYR A 1 53  ? -24.793 2.165   8.378  1.00 17.35  ? 52  TYR A CD1 1 
ATOM   434  C  CD2 . TYR A 1 53  ? -24.306 4.408   7.726  1.00 10.25  ? 52  TYR A CD2 1 
ATOM   435  C  CE1 . TYR A 1 53  ? -25.060 2.594   9.682  1.00 23.04  ? 52  TYR A CE1 1 
ATOM   436  C  CE2 . TYR A 1 53  ? -24.572 4.856   9.036  1.00 8.20   ? 52  TYR A CE2 1 
ATOM   437  C  CZ  . TYR A 1 53  ? -24.942 3.936   10.006 1.00 20.18  ? 52  TYR A CZ  1 
ATOM   438  O  OH  . TYR A 1 53  ? -25.211 4.352   11.294 1.00 17.87  ? 52  TYR A OH  1 
ATOM   439  N  N   . GLU A 1 54  ? -26.228 0.811   4.632  1.00 15.90  ? 53  GLU A N   1 
ATOM   440  C  CA  . GLU A 1 54  ? -27.243 -0.219  4.884  1.00 12.51  ? 53  GLU A CA  1 
ATOM   441  C  C   . GLU A 1 54  ? -26.682 -1.253  5.845  1.00 13.15  ? 53  GLU A C   1 
ATOM   442  O  O   . GLU A 1 54  ? -25.494 -1.556  5.790  1.00 15.78  ? 53  GLU A O   1 
ATOM   443  C  CB  . GLU A 1 54  ? -27.635 -0.931  3.583  1.00 7.78   ? 53  GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 54  ? -28.239 -0.011  2.529  1.00 15.36  ? 53  GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 54  ? -28.178 -0.588  1.118  1.00 23.54  ? 53  GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 54  ? -27.620 -1.687  0.917  1.00 26.76  ? 53  GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 54  ? -28.697 0.072   0.202  1.00 43.83  ? 53  GLU A OE2 1 
ATOM   448  N  N   . VAL A 1 55  ? -27.536 -1.780  6.724  1.00 13.50  ? 54  VAL A N   1 
ATOM   449  C  CA  . VAL A 1 55  ? -27.184 -2.872  7.642  1.00 8.40   ? 54  VAL A CA  1 
ATOM   450  C  C   . VAL A 1 55  ? -28.124 -4.060  7.400  1.00 11.97  ? 54  VAL A C   1 
ATOM   451  O  O   . VAL A 1 55  ? -29.333 -3.875  7.241  1.00 18.90  ? 54  VAL A O   1 
ATOM   452  C  CB  . VAL A 1 55  ? -27.298 -2.421  9.140  1.00 7.75   ? 54  VAL A CB  1 
ATOM   453  C  CG1 . VAL A 1 55  ? -26.966 -3.563  10.102 1.00 4.36   ? 54  VAL A CG1 1 
ATOM   454  C  CG2 . VAL A 1 55  ? -26.436 -1.187  9.424  1.00 9.28   ? 54  VAL A CG2 1 
ATOM   455  N  N   . TYR A 1 56  ? -27.568 -5.269  7.366  1.00 10.75  ? 55  TYR A N   1 
ATOM   456  C  CA  . TYR A 1 56  ? -28.365 -6.504  7.315  1.00 9.42   ? 55  TYR A CA  1 
ATOM   457  C  C   . TYR A 1 56  ? -28.008 -7.327  8.550  1.00 7.32   ? 55  TYR A C   1 
ATOM   458  O  O   . TYR A 1 56  ? -26.959 -7.955  8.593  1.00 13.77  ? 55  TYR A O   1 
ATOM   459  C  CB  . TYR A 1 56  ? -28.102 -7.293  6.017  1.00 9.23   ? 55  TYR A CB  1 
ATOM   460  C  CG  . TYR A 1 56  ? -28.391 -6.502  4.746  1.00 10.90  ? 55  TYR A CG  1 
ATOM   461  C  CD1 . TYR A 1 56  ? -27.429 -5.649  4.197  1.00 15.91  ? 55  TYR A CD1 1 
ATOM   462  C  CD2 . TYR A 1 56  ? -29.633 -6.593  4.109  1.00 19.50  ? 55  TYR A CD2 1 
ATOM   463  C  CE1 . TYR A 1 56  ? -27.682 -4.918  3.035  1.00 14.42  ? 55  TYR A CE1 1 
ATOM   464  C  CE2 . TYR A 1 56  ? -29.894 -5.864  2.941  1.00 23.67  ? 55  TYR A CE2 1 
ATOM   465  C  CZ  . TYR A 1 56  ? -28.915 -5.024  2.419  1.00 19.51  ? 55  TYR A CZ  1 
ATOM   466  O  OH  . TYR A 1 56  ? -29.157 -4.293  1.280  1.00 28.69  ? 55  TYR A OH  1 
ATOM   467  N  N   . ALA A 1 57  ? -28.883 -7.290  9.555  1.00 14.18  ? 56  ALA A N   1 
ATOM   468  C  CA  . ALA A 1 57  ? -28.593 -7.837  10.878 1.00 11.12  ? 56  ALA A CA  1 
ATOM   469  C  C   . ALA A 1 57  ? -29.342 -9.131  11.180 1.00 19.98  ? 56  ALA A C   1 
ATOM   470  O  O   . ALA A 1 57  ? -30.544 -9.255  10.907 1.00 14.40  ? 56  ALA A O   1 
ATOM   471  C  CB  . ALA A 1 57  ? -28.881 -6.786  11.967 1.00 15.43  ? 56  ALA A CB  1 
ATOM   472  N  N   . VAL A 1 58  ? -28.607 -10.092 11.736 1.00 14.45  ? 57  VAL A N   1 
ATOM   473  C  CA  . VAL A 1 58  ? -29.169 -11.350 12.232 1.00 9.13   ? 57  VAL A CA  1 
ATOM   474  C  C   . VAL A 1 58  ? -28.952 -11.400 13.747 1.00 14.68  ? 57  VAL A C   1 
ATOM   475  O  O   . VAL A 1 58  ? -27.860 -11.717 14.232 1.00 17.70  ? 57  VAL A O   1 
ATOM   476  C  CB  . VAL A 1 58  ? -28.556 -12.588 11.527 1.00 8.54   ? 57  VAL A CB  1 
ATOM   477  C  CG1 . VAL A 1 58  ? -29.235 -13.864 12.009 1.00 14.91  ? 57  VAL A CG1 1 
ATOM   478  C  CG2 . VAL A 1 58  ? -28.672 -12.473 10.000 1.00 14.83  ? 57  VAL A CG2 1 
ATOM   479  N  N   . GLU A 1 59  ? -30.006 -11.076 14.486 1.00 17.98  ? 58  GLU A N   1 
ATOM   480  C  CA  . GLU A 1 59  ? -29.909 -10.859 15.926 1.00 19.09  ? 58  GLU A CA  1 
ATOM   481  C  C   . GLU A 1 59  ? -30.657 -11.901 16.741 1.00 18.70  ? 58  GLU A C   1 
ATOM   482  O  O   . GLU A 1 59  ? -31.699 -12.420 16.316 1.00 18.07  ? 58  GLU A O   1 
ATOM   483  C  CB  . GLU A 1 59  ? -30.386 -9.443  16.282 1.00 25.57  ? 58  GLU A CB  1 
ATOM   484  C  CG  . GLU A 1 59  ? -29.552 -8.347  15.612 1.00 26.76  ? 58  GLU A CG  1 
ATOM   485  C  CD  . GLU A 1 59  ? -29.844 -6.945  16.135 1.00 38.86  ? 58  GLU A CD  1 
ATOM   486  O  OE1 . GLU A 1 59  ? -31.028 -6.552  16.162 1.00 32.05  ? 58  GLU A OE1 1 
ATOM   487  O  OE2 . GLU A 1 59  ? -28.880 -6.230  16.496 1.00 45.52  ? 58  GLU A OE2 1 
ATOM   488  N  N   . GLN A 1 60  ? -30.079 -12.239 17.892 1.00 15.10  ? 59  GLN A N   1 
ATOM   489  C  CA  . GLN A 1 60  ? -30.699 -13.152 18.849 1.00 27.07  ? 59  GLN A CA  1 
ATOM   490  C  C   . GLN A 1 60  ? -31.242 -12.306 19.993 1.00 11.63  ? 59  GLN A C   1 
ATOM   491  O  O   . GLN A 1 60  ? -30.986 -11.103 20.048 1.00 18.35  ? 59  GLN A O   1 
ATOM   492  C  CB  . GLN A 1 60  ? -29.670 -14.163 19.378 1.00 19.99  ? 59  GLN A CB  1 
ATOM   493  C  CG  . GLN A 1 60  ? -28.893 -14.936 18.292 1.00 14.27  ? 59  GLN A CG  1 
ATOM   494  C  CD  . GLN A 1 60  ? -29.795 -15.681 17.304 1.00 17.87  ? 59  GLN A CD  1 
ATOM   495  O  OE1 . GLN A 1 60  ? -30.745 -16.363 17.692 1.00 17.42  ? 59  GLN A OE1 1 
ATOM   496  N  NE2 . GLN A 1 60  ? -29.493 -15.547 16.022 1.00 16.60  ? 59  GLN A NE2 1 
ATOM   497  N  N   . GLU A 1 61  ? -31.985 -12.925 20.903 1.00 22.56  ? 60  GLU A N   1 
ATOM   498  C  CA  . GLU A 1 61  ? -32.360 -12.233 22.132 1.00 26.22  ? 60  GLU A CA  1 
ATOM   499  C  C   . GLU A 1 61  ? -31.103 -11.886 22.933 1.00 20.51  ? 60  GLU A C   1 
ATOM   500  O  O   . GLU A 1 61  ? -30.071 -12.561 22.824 1.00 20.56  ? 60  GLU A O   1 
ATOM   501  C  CB  . GLU A 1 61  ? -33.402 -13.013 22.956 1.00 33.17  ? 60  GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 61  ? -33.197 -14.518 23.058 1.00 70.36  ? 60  GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 61  ? -34.509 -15.310 23.026 1.00 81.93  ? 60  GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 61  ? -35.533 -14.811 23.549 1.00 79.98  ? 60  GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 61  ? -34.510 -16.438 22.476 1.00 61.07  ? 60  GLU A OE2 1 
ATOM   506  N  N   . GLU A 1 62  ? -31.191 -10.812 23.709 1.00 16.30  ? 61  GLU A N   1 
ATOM   507  C  CA  . GLU A 1 62  ? -30.057 -10.286 24.456 1.00 27.67  ? 61  GLU A CA  1 
ATOM   508  C  C   . GLU A 1 62  ? -29.739 -11.157 25.672 1.00 29.97  ? 61  GLU A C   1 
ATOM   509  O  O   . GLU A 1 62  ? -30.196 -10.889 26.785 1.00 37.84  ? 61  GLU A O   1 
ATOM   510  C  CB  . GLU A 1 62  ? -30.322 -8.836  24.875 1.00 23.76  ? 61  GLU A CB  1 
ATOM   511  C  CG  . GLU A 1 62  ? -30.518 -7.858  23.719 1.00 38.36  ? 61  GLU A CG  1 
ATOM   512  C  CD  . GLU A 1 62  ? -30.727 -6.429  24.196 1.00 49.73  ? 61  GLU A CD  1 
ATOM   513  O  OE1 . GLU A 1 62  ? -31.719 -6.179  24.916 1.00 65.59  ? 61  GLU A OE1 1 
ATOM   514  O  OE2 . GLU A 1 62  ? -29.906 -5.553  23.845 1.00 47.56  ? 61  GLU A OE2 1 
ATOM   515  N  N   . LYS A 1 63  ? -28.954 -12.206 25.435 1.00 20.93  ? 62  LYS A N   1 
ATOM   516  C  CA  . LYS A 1 63  ? -28.554 -13.153 26.474 1.00 23.72  ? 62  LYS A CA  1 
ATOM   517  C  C   . LYS A 1 63  ? -27.041 -13.288 26.499 1.00 26.87  ? 62  LYS A C   1 
ATOM   518  O  O   . LYS A 1 63  ? -26.387 -13.224 25.449 1.00 16.41  ? 62  LYS A O   1 
ATOM   519  C  CB  . LYS A 1 63  ? -29.175 -14.534 26.238 1.00 22.40  ? 62  LYS A CB  1 
ATOM   520  C  CG  . LYS A 1 63  ? -30.679 -14.601 26.431 1.00 38.78  ? 62  LYS A CG  1 
ATOM   521  C  CD  . LYS A 1 63  ? -31.108 -15.982 26.911 1.00 54.79  ? 62  LYS A CD  1 
ATOM   522  C  CE  . LYS A 1 63  ? -32.603 -16.214 26.707 1.00 70.21  ? 62  LYS A CE  1 
ATOM   523  N  NZ  . LYS A 1 63  ? -33.452 -15.143 27.309 1.00 67.38  ? 62  LYS A NZ  1 
ATOM   524  N  N   . GLU A 1 64  ? -26.505 -13.479 27.703 1.00 20.04  ? 63  GLU A N   1 
ATOM   525  C  CA  . GLU A 1 64  ? -25.082 -13.725 27.924 1.00 20.24  ? 63  GLU A CA  1 
ATOM   526  C  C   . GLU A 1 64  ? -24.667 -14.970 27.160 1.00 14.86  ? 63  GLU A C   1 
ATOM   527  O  O   . GLU A 1 64  ? -25.352 -15.997 27.209 1.00 21.28  ? 63  GLU A O   1 
ATOM   528  C  CB  . GLU A 1 64  ? -24.785 -13.888 29.431 1.00 18.18  ? 63  GLU A CB  1 
ATOM   529  C  CG  . GLU A 1 64  ? -25.005 -12.600 30.248 1.00 26.68  ? 63  GLU A CG  1 
ATOM   530  C  CD  . GLU A 1 64  ? -24.847 -12.758 31.773 1.00 37.90  ? 63  GLU A CD  1 
ATOM   531  O  OE1 . GLU A 1 64  ? -25.111 -11.770 32.484 1.00 35.56  ? 63  GLU A OE1 1 
ATOM   532  O  OE2 . GLU A 1 64  ? -24.466 -13.838 32.274 1.00 27.40  ? 63  GLU A OE2 1 
ATOM   533  N  N   . GLY A 1 65  ? -23.570 -14.863 26.421 1.00 11.70  ? 64  GLY A N   1 
ATOM   534  C  CA  . GLY A 1 65  ? -22.977 -16.014 25.748 1.00 12.77  ? 64  GLY A CA  1 
ATOM   535  C  C   . GLY A 1 65  ? -23.373 -16.175 24.293 1.00 11.40  ? 64  GLY A C   1 
ATOM   536  O  O   . GLY A 1 65  ? -22.705 -16.893 23.551 1.00 11.71  ? 64  GLY A O   1 
ATOM   537  N  N   . ASP A 1 66  ? -24.452 -15.509 23.882 1.00 15.37  ? 65  ASP A N   1 
ATOM   538  C  CA  . ASP A 1 66  ? -24.997 -15.684 22.528 1.00 14.11  ? 65  ASP A CA  1 
ATOM   539  C  C   . ASP A 1 66  ? -24.378 -14.645 21.583 1.00 11.73  ? 65  ASP A C   1 
ATOM   540  O  O   . ASP A 1 66  ? -23.705 -13.715 22.035 1.00 13.21  ? 65  ASP A O   1 
ATOM   541  C  CB  . ASP A 1 66  ? -26.540 -15.608 22.549 1.00 10.33  ? 65  ASP A CB  1 
ATOM   542  C  CG  . ASP A 1 66  ? -27.191 -16.418 21.434 1.00 19.30  ? 65  ASP A CG  1 
ATOM   543  O  OD1 . ASP A 1 66  ? -26.517 -16.803 20.448 1.00 14.20  ? 65  ASP A OD1 1 
ATOM   544  O  OD2 . ASP A 1 66  ? -28.402 -16.670 21.538 1.00 12.49  ? 65  ASP A OD2 1 
ATOM   545  N  N   . LEU A 1 67  ? -24.581 -14.811 20.277 1.00 15.85  ? 66  LEU A N   1 
ATOM   546  C  CA  . LEU A 1 67  ? -23.903 -13.963 19.291 1.00 10.71  ? 66  LEU A CA  1 
ATOM   547  C  C   . LEU A 1 67  ? -24.828 -13.448 18.196 1.00 13.16  ? 66  LEU A C   1 
ATOM   548  O  O   . LEU A 1 67  ? -25.673 -14.186 17.692 1.00 17.76  ? 66  LEU A O   1 
ATOM   549  C  CB  . LEU A 1 67  ? -22.734 -14.711 18.641 1.00 11.45  ? 66  LEU A CB  1 
ATOM   550  C  CG  . LEU A 1 67  ? -21.510 -15.040 19.491 1.00 10.30  ? 66  LEU A CG  1 
ATOM   551  C  CD1 . LEU A 1 67  ? -20.518 -15.816 18.644 1.00 8.55   ? 66  LEU A CD1 1 
ATOM   552  C  CD2 . LEU A 1 67  ? -20.865 -13.772 20.078 1.00 7.56   ? 66  LEU A CD2 1 
ATOM   553  N  N   . ASN A 1 68  ? -24.648 -12.174 17.851 1.00 12.03  ? 67  ASN A N   1 
ATOM   554  C  CA  . ASN A 1 68  ? -25.264 -11.543 16.687 1.00 15.71  ? 67  ASN A CA  1 
ATOM   555  C  C   . ASN A 1 68  ? -24.250 -11.381 15.573 1.00 19.28  ? 67  ASN A C   1 
ATOM   556  O  O   . ASN A 1 68  ? -23.043 -11.337 15.817 1.00 13.36  ? 67  ASN A O   1 
ATOM   557  C  CB  . ASN A 1 68  ? -25.759 -10.131 17.028 1.00 14.12  ? 67  ASN A CB  1 
ATOM   558  C  CG  . ASN A 1 68  ? -26.953 -10.126 17.955 1.00 14.69  ? 67  ASN A CG  1 
ATOM   559  O  OD1 . ASN A 1 68  ? -27.519 -11.167 18.267 1.00 11.40  ? 67  ASN A OD1 1 
ATOM   560  N  ND2 . ASN A 1 68  ? -27.325 -8.943  18.419 1.00 11.17  ? 67  ASN A ND2 1 
ATOM   561  N  N   . PHE A 1 69  ? -24.745 -11.263 14.350 1.00 13.47  ? 68  PHE A N   1 
ATOM   562  C  CA  . PHE A 1 69  ? -23.886 -10.871 13.234 1.00 19.63  ? 68  PHE A CA  1 
ATOM   563  C  C   . PHE A 1 69  ? -24.642 -9.978  12.257 1.00 18.17  ? 68  PHE A C   1 
ATOM   564  O  O   . PHE A 1 69  ? -25.870 -10.035 12.167 1.00 9.76   ? 68  PHE A O   1 
ATOM   565  C  CB  . PHE A 1 69  ? -23.189 -12.077 12.561 1.00 7.30   ? 68  PHE A CB  1 
ATOM   566  C  CG  . PHE A 1 69  ? -24.123 -13.024 11.839 1.00 17.15  ? 68  PHE A CG  1 
ATOM   567  C  CD1 . PHE A 1 69  ? -24.375 -12.868 10.472 1.00 12.61  ? 68  PHE A CD1 1 
ATOM   568  C  CD2 . PHE A 1 69  ? -24.708 -14.092 12.510 1.00 13.20  ? 68  PHE A CD2 1 
ATOM   569  C  CE1 . PHE A 1 69  ? -25.223 -13.741 9.792  1.00 15.87  ? 68  PHE A CE1 1 
ATOM   570  C  CE2 . PHE A 1 69  ? -25.562 -14.982 11.839 1.00 17.99  ? 68  PHE A CE2 1 
ATOM   571  C  CZ  . PHE A 1 69  ? -25.813 -14.805 10.473 1.00 18.27  ? 68  PHE A CZ  1 
ATOM   572  N  N   . ALA A 1 70  ? -23.899 -9.137  11.550 1.00 12.35  ? 69  ALA A N   1 
ATOM   573  C  CA  . ALA A 1 70  ? -24.490 -8.185  10.629 1.00 14.29  ? 69  ALA A CA  1 
ATOM   574  C  C   . ALA A 1 70  ? -23.462 -7.810  9.589  1.00 14.77  ? 69  ALA A C   1 
ATOM   575  O  O   . ALA A 1 70  ? -22.281 -7.722  9.897  1.00 15.93  ? 69  ALA A O   1 
ATOM   576  C  CB  . ALA A 1 70  ? -24.950 -6.925  11.385 1.00 10.23  ? 69  ALA A CB  1 
ATOM   577  N  N   . THR A 1 71  ? -23.912 -7.605  8.356  1.00 9.73   ? 70  THR A N   1 
ATOM   578  C  CA  . THR A 1 71  ? -23.087 -6.938  7.363  1.00 12.18  ? 70  THR A CA  1 
ATOM   579  C  C   . THR A 1 71  ? -23.518 -5.481  7.313  1.00 11.11  ? 70  THR A C   1 
ATOM   580  O  O   . THR A 1 71  ? -24.655 -5.140  7.637  1.00 11.64  ? 70  THR A O   1 
ATOM   581  C  CB  . THR A 1 71  ? -23.233 -7.542  5.943  1.00 26.67  ? 70  THR A CB  1 
ATOM   582  O  OG1 . THR A 1 71  ? -24.604 -7.469  5.534  1.00 10.05  ? 70  THR A OG1 1 
ATOM   583  C  CG2 . THR A 1 71  ? -22.749 -8.996  5.891  1.00 12.93  ? 70  THR A CG2 1 
ATOM   584  N  N   . THR A 1 72  ? -22.592 -4.621  6.916  1.00 5.09   ? 71  THR A N   1 
ATOM   585  C  CA  . THR A 1 72  ? -22.890 -3.237  6.679  1.00 4.69   ? 71  THR A CA  1 
ATOM   586  C  C   . THR A 1 72  ? -22.324 -2.868  5.305  1.00 6.86   ? 71  THR A C   1 
ATOM   587  O  O   . THR A 1 72  ? -21.228 -3.302  4.936  1.00 12.16  ? 71  THR A O   1 
ATOM   588  C  CB  . THR A 1 72  ? -22.287 -2.358  7.780  1.00 16.60  ? 71  THR A CB  1 
ATOM   589  O  OG1 . THR A 1 72  ? -22.894 -2.695  9.030  1.00 18.15  ? 71  THR A OG1 1 
ATOM   590  C  CG2 . THR A 1 72  ? -22.477 -0.865  7.498  1.00 7.27   ? 71  THR A CG2 1 
ATOM   591  N  N   . VAL A 1 73  ? -23.092 -2.080  4.561  1.00 13.90  ? 72  VAL A N   1 
ATOM   592  C  CA  . VAL A 1 73  ? -22.685 -1.581  3.259  1.00 15.89  ? 72  VAL A CA  1 
ATOM   593  C  C   . VAL A 1 73  ? -22.560 -0.063  3.397  1.00 12.33  ? 72  VAL A C   1 
ATOM   594  O  O   . VAL A 1 73  ? -23.556 0.643   3.471  1.00 12.12  ? 72  VAL A O   1 
ATOM   595  C  CB  . VAL A 1 73  ? -23.697 -1.982  2.138  1.00 13.47  ? 72  VAL A CB  1 
ATOM   596  C  CG1 . VAL A 1 73  ? -23.184 -1.581  0.741  1.00 9.38   ? 72  VAL A CG1 1 
ATOM   597  C  CG2 . VAL A 1 73  ? -23.983 -3.480  2.174  1.00 9.39   ? 72  VAL A CG2 1 
ATOM   598  N  N   . LEU A 1 74  ? -21.321 0.418   3.451  1.00 10.21  ? 73  LEU A N   1 
ATOM   599  C  CA  . LEU A 1 74  ? -21.031 1.830   3.658  1.00 19.63  ? 73  LEU A CA  1 
ATOM   600  C  C   . LEU A 1 74  ? -20.687 2.458   2.307  1.00 9.62   ? 73  LEU A C   1 
ATOM   601  O  O   . LEU A 1 74  ? -19.638 2.164   1.737  1.00 15.49  ? 73  LEU A O   1 
ATOM   602  C  CB  . LEU A 1 74  ? -19.842 1.985   4.617  1.00 10.95  ? 73  LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 74  ? -19.787 3.069   5.700  1.00 23.03  ? 73  LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 74  ? -18.349 3.296   6.145  1.00 10.71  ? 73  LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 74  ? -20.395 4.361   5.265  1.00 10.42  ? 73  LEU A CD2 1 
ATOM   606  N  N   . TYR A 1 75  ? -21.573 3.329   1.823  1.00 11.83  ? 74  TYR A N   1 
ATOM   607  C  CA  . TYR A 1 75  ? -21.463 3.917   0.489  1.00 18.75  ? 74  TYR A CA  1 
ATOM   608  C  C   . TYR A 1 75  ? -20.333 4.934   0.438  1.00 15.56  ? 74  TYR A C   1 
ATOM   609  O  O   . TYR A 1 75  ? -20.007 5.537   1.480  1.00 14.53  ? 74  TYR A O   1 
ATOM   610  C  CB  . TYR A 1 75  ? -22.790 4.559   0.087  1.00 12.93  ? 74  TYR A CB  1 
ATOM   611  C  CG  . TYR A 1 75  ? -23.868 3.569   -0.297 1.00 17.06  ? 74  TYR A CG  1 
ATOM   612  C  CD1 . TYR A 1 75  ? -24.377 3.549   -1.590 1.00 37.82  ? 74  TYR A CD1 1 
ATOM   613  C  CD2 . TYR A 1 75  ? -24.386 2.653   0.630  1.00 20.70  ? 74  TYR A CD2 1 
ATOM   614  C  CE1 . TYR A 1 75  ? -25.369 2.656   -1.961 1.00 44.24  ? 74  TYR A CE1 1 
ATOM   615  C  CE2 . TYR A 1 75  ? -25.384 1.739   0.262  1.00 14.76  ? 74  TYR A CE2 1 
ATOM   616  C  CZ  . TYR A 1 75  ? -25.863 1.751   -1.041 1.00 31.22  ? 74  TYR A CZ  1 
ATOM   617  O  OH  . TYR A 1 75  ? -26.841 0.872   -1.445 1.00 37.49  ? 74  TYR A OH  1 
ATOM   618  N  N   . PRO A 1 76  ? -19.699 5.098   -0.753 1.00 11.27  ? 75  PRO A N   1 
ATOM   619  C  CA  . PRO A 1 76  ? -18.646 6.103   -0.870 1.00 11.09  ? 75  PRO A CA  1 
ATOM   620  C  C   . PRO A 1 76  ? -19.226 7.515   -0.901 1.00 16.74  ? 75  PRO A C   1 
ATOM   621  O  O   . PRO A 1 76  ? -20.320 7.723   -1.430 1.00 10.28  ? 75  PRO A O   1 
ATOM   622  C  CB  . PRO A 1 76  ? -17.964 5.751   -2.191 1.00 7.85   ? 75  PRO A CB  1 
ATOM   623  C  CG  . PRO A 1 76  ? -19.033 5.108   -2.998 1.00 9.78   ? 75  PRO A CG  1 
ATOM   624  C  CD  . PRO A 1 76  ? -19.894 4.356   -2.020 1.00 5.76   ? 75  PRO A CD  1 
ATOM   625  N  N   . GLY A 1 77  ? -18.514 8.465   -0.305 1.00 13.42  ? 76  GLY A N   1 
ATOM   626  C  CA  . GLY A 1 77  ? -18.972 9.848   -0.298 1.00 10.01  ? 76  GLY A CA  1 
ATOM   627  C  C   . GLY A 1 77  ? -18.304 10.693  0.760  1.00 17.09  ? 76  GLY A C   1 
ATOM   628  O  O   . GLY A 1 77  ? -17.618 10.173  1.658  1.00 11.47  ? 76  GLY A O   1 
ATOM   629  N  N   . LYS A 1 78  ? -18.515 12.001  0.644  1.00 17.26  ? 77  LYS A N   1 
ATOM   630  C  CA  . LYS A 1 78  ? -18.010 12.988  1.592  1.00 18.08  ? 77  LYS A CA  1 
ATOM   631  C  C   . LYS A 1 78  ? -19.098 13.974  1.982  1.00 21.55  ? 77  LYS A C   1 
ATOM   632  O  O   . LYS A 1 78  ? -19.972 14.275  1.172  1.00 11.70  ? 77  LYS A O   1 
ATOM   633  C  CB  . LYS A 1 78  ? -16.867 13.780  0.971  1.00 16.93  ? 77  LYS A CB  1 
ATOM   634  C  CG  . LYS A 1 78  ? -15.580 13.010  0.784  1.00 14.46  ? 77  LYS A CG  1 
ATOM   635  C  CD  . LYS A 1 78  ? -14.547 13.947  0.218  1.00 23.04  ? 77  LYS A CD  1 
ATOM   636  C  CE  . LYS A 1 78  ? -13.504 13.196  -0.543 1.00 31.43  ? 77  LYS A CE  1 
ATOM   637  N  NZ  . LYS A 1 78  ? -14.028 12.714  -1.837 1.00 27.47  ? 77  LYS A NZ  1 
ATOM   638  N  N   . VAL A 1 79  ? -19.045 14.463  3.226  1.00 10.66  ? 78  VAL A N   1 
ATOM   639  C  CA  . VAL A 1 79  ? -19.817 15.635  3.646  1.00 13.58  ? 78  VAL A CA  1 
ATOM   640  C  C   . VAL A 1 79  ? -18.779 16.728  3.817  1.00 15.70  ? 78  VAL A C   1 
ATOM   641  O  O   . VAL A 1 79  ? -18.037 16.742  4.803  1.00 20.29  ? 78  VAL A O   1 
ATOM   642  C  CB  . VAL A 1 79  ? -20.612 15.394  4.968  1.00 15.55  ? 78  VAL A CB  1 
ATOM   643  C  CG1 . VAL A 1 79  ? -21.220 16.700  5.498  1.00 8.50   ? 78  VAL A CG1 1 
ATOM   644  C  CG2 . VAL A 1 79  ? -21.693 14.346  4.753  1.00 13.05  ? 78  VAL A CG2 1 
ATOM   645  N  N   . GLY A 1 80  ? -18.710 17.628  2.837  1.00 21.96  ? 79  GLY A N   1 
ATOM   646  C  CA  . GLY A 1 80  ? -17.574 18.536  2.718  1.00 11.31  ? 79  GLY A CA  1 
ATOM   647  C  C   . GLY A 1 80  ? -16.347 17.723  2.353  1.00 19.67  ? 79  GLY A C   1 
ATOM   648  O  O   . GLY A 1 80  ? -16.308 17.099  1.290  1.00 19.01  ? 79  GLY A O   1 
ATOM   649  N  N   . LYS A 1 81  ? -15.362 17.716  3.251  1.00 12.41  ? 80  LYS A N   1 
ATOM   650  C  CA  . LYS A 1 81  ? -14.088 17.017  3.064  1.00 24.64  ? 80  LYS A CA  1 
ATOM   651  C  C   . LYS A 1 81  ? -14.090 15.684  3.821  1.00 17.16  ? 80  LYS A C   1 
ATOM   652  O  O   . LYS A 1 81  ? -13.182 14.856  3.669  1.00 15.15  ? 80  LYS A O   1 
ATOM   653  C  CB  . LYS A 1 81  ? -12.932 17.885  3.587  1.00 20.97  ? 80  LYS A CB  1 
ATOM   654  C  CG  . LYS A 1 81  ? -12.577 19.128  2.773  1.00 33.44  ? 80  LYS A CG  1 
ATOM   655  C  CD  . LYS A 1 81  ? -11.522 19.950  3.522  1.00 42.28  ? 80  LYS A CD  1 
ATOM   656  C  CE  . LYS A 1 81  ? -11.209 21.281  2.841  1.00 52.66  ? 80  LYS A CE  1 
ATOM   657  N  NZ  . LYS A 1 81  ? -9.976  21.215  2.005  1.00 59.50  ? 80  LYS A NZ  1 
ATOM   658  N  N   . GLU A 1 82  ? -15.124 15.490  4.632  1.00 12.95  ? 81  GLU A N   1 
ATOM   659  C  CA  . GLU A 1 82  ? -15.205 14.376  5.569  1.00 11.66  ? 81  GLU A CA  1 
ATOM   660  C  C   . GLU A 1 82  ? -15.882 13.126  4.982  1.00 11.78  ? 81  GLU A C   1 
ATOM   661  O  O   . GLU A 1 82  ? -17.054 13.169  4.593  1.00 11.19  ? 81  GLU A O   1 
ATOM   662  C  CB  . GLU A 1 82  ? -15.950 14.859  6.810  1.00 11.17  ? 81  GLU A CB  1 
ATOM   663  C  CG  . GLU A 1 82  ? -15.856 13.952  8.007  1.00 15.02  ? 81  GLU A CG  1 
ATOM   664  C  CD  . GLU A 1 82  ? -16.433 14.591  9.258  1.00 17.98  ? 81  GLU A CD  1 
ATOM   665  O  OE1 . GLU A 1 82  ? -17.203 15.564  9.133  1.00 17.06  ? 81  GLU A OE1 1 
ATOM   666  O  OE2 . GLU A 1 82  ? -16.128 14.105  10.365 1.00 14.67  ? 81  GLU A OE2 1 
ATOM   667  N  N   . PHE A 1 83  ? -15.149 12.012  4.937  1.00 11.35  ? 82  PHE A N   1 
ATOM   668  C  CA  . PHE A 1 83  ? -15.670 10.765  4.370  1.00 17.05  ? 82  PHE A CA  1 
ATOM   669  C  C   . PHE A 1 83  ? -16.908 10.246  5.123  1.00 20.91  ? 82  PHE A C   1 
ATOM   670  O  O   . PHE A 1 83  ? -17.032 10.438  6.348  1.00 8.87   ? 82  PHE A O   1 
ATOM   671  C  CB  . PHE A 1 83  ? -14.593 9.676   4.353  1.00 7.12   ? 82  PHE A CB  1 
ATOM   672  C  CG  . PHE A 1 83  ? -13.468 9.930   3.381  1.00 10.14  ? 82  PHE A CG  1 
ATOM   673  C  CD1 . PHE A 1 83  ? -12.195 10.275  3.842  1.00 16.57  ? 82  PHE A CD1 1 
ATOM   674  C  CD2 . PHE A 1 83  ? -13.669 9.791   2.005  1.00 10.86  ? 82  PHE A CD2 1 
ATOM   675  C  CE1 . PHE A 1 83  ? -11.131 10.496  2.943  1.00 13.62  ? 82  PHE A CE1 1 
ATOM   676  C  CE2 . PHE A 1 83  ? -12.628 10.010  1.102  1.00 9.10   ? 82  PHE A CE2 1 
ATOM   677  C  CZ  . PHE A 1 83  ? -11.356 10.360  1.567  1.00 8.62   ? 82  PHE A CZ  1 
ATOM   678  N  N   . PHE A 1 84  ? -17.811 9.607   4.372  1.00 9.23   ? 83  PHE A N   1 
ATOM   679  C  CA  . PHE A 1 84  ? -18.989 8.909   4.905  1.00 17.79  ? 83  PHE A CA  1 
ATOM   680  C  C   . PHE A 1 84  ? -18.557 7.888   5.964  1.00 22.82  ? 83  PHE A C   1 
ATOM   681  O  O   . PHE A 1 84  ? -17.536 7.199   5.817  1.00 10.53  ? 83  PHE A O   1 
ATOM   682  C  CB  . PHE A 1 84  ? -19.740 8.159   3.783  1.00 8.71   ? 83  PHE A CB  1 
ATOM   683  C  CG  . PHE A 1 84  ? -20.733 9.004   2.995  1.00 11.74  ? 83  PHE A CG  1 
ATOM   684  C  CD1 . PHE A 1 84  ? -20.705 10.412  3.039  1.00 8.08   ? 83  PHE A CD1 1 
ATOM   685  C  CD2 . PHE A 1 84  ? -21.678 8.376   2.166  1.00 19.21  ? 83  PHE A CD2 1 
ATOM   686  C  CE1 . PHE A 1 84  ? -21.617 11.181  2.280  1.00 10.10  ? 83  PHE A CE1 1 
ATOM   687  C  CE2 . PHE A 1 84  ? -22.601 9.134   1.402  1.00 8.09   ? 83  PHE A CE2 1 
ATOM   688  C  CZ  . PHE A 1 84  ? -22.567 10.535  1.463  1.00 11.79  ? 83  PHE A CZ  1 
ATOM   689  N  N   . PHE A 1 85  ? -19.346 7.791   7.026  1.00 10.49  ? 84  PHE A N   1 
ATOM   690  C  CA  . PHE A 1 85  ? -19.041 6.896   8.142  1.00 11.33  ? 84  PHE A CA  1 
ATOM   691  C  C   . PHE A 1 85  ? -20.327 6.397   8.795  1.00 10.35  ? 84  PHE A C   1 
ATOM   692  O  O   . PHE A 1 85  ? -21.408 6.913   8.502  1.00 14.12  ? 84  PHE A O   1 
ATOM   693  C  CB  . PHE A 1 85  ? -18.089 7.567   9.167  1.00 6.11   ? 84  PHE A CB  1 
ATOM   694  C  CG  . PHE A 1 85  ? -18.592 8.889   9.747  1.00 6.54   ? 84  PHE A CG  1 
ATOM   695  C  CD1 . PHE A 1 85  ? -19.841 8.988   10.362 1.00 15.92  ? 84  PHE A CD1 1 
ATOM   696  C  CD2 . PHE A 1 85  ? -17.787 10.021  9.711  1.00 19.69  ? 84  PHE A CD2 1 
ATOM   697  C  CE1 . PHE A 1 85  ? -20.285 10.194  10.899 1.00 15.64  ? 84  PHE A CE1 1 
ATOM   698  C  CE2 . PHE A 1 85  ? -18.225 11.229  10.255 1.00 11.02  ? 84  PHE A CE2 1 
ATOM   699  C  CZ  . PHE A 1 85  ? -19.470 11.312  10.857 1.00 18.53  ? 84  PHE A CZ  1 
ATOM   700  N  N   . THR A 1 86  ? -20.208 5.369   9.638  1.00 8.45   ? 85  THR A N   1 
ATOM   701  C  CA  . THR A 1 86  ? -21.313 4.920   10.485 1.00 17.36  ? 85  THR A CA  1 
ATOM   702  C  C   . THR A 1 86  ? -21.423 5.825   11.713 1.00 17.99  ? 85  THR A C   1 
ATOM   703  O  O   . THR A 1 86  ? -20.439 6.445   12.127 1.00 13.68  ? 85  THR A O   1 
ATOM   704  C  CB  . THR A 1 86  ? -21.147 3.448   10.962 1.00 20.87  ? 85  THR A CB  1 
ATOM   705  O  OG1 . THR A 1 86  ? -19.907 3.299   11.671 1.00 9.61   ? 85  THR A OG1 1 
ATOM   706  C  CG2 . THR A 1 86  ? -21.200 2.465   9.786  1.00 12.93  ? 85  THR A CG2 1 
ATOM   707  N  N   . LYS A 1 87  ? -22.622 5.905   12.287 1.00 10.55  ? 86  LYS A N   1 
ATOM   708  C  CA  . LYS A 1 87  ? -22.863 6.717   13.491 1.00 7.10   ? 86  LYS A CA  1 
ATOM   709  C  C   . LYS A 1 87  ? -21.790 6.490   14.570 1.00 8.69   ? 86  LYS A C   1 
ATOM   710  O  O   . LYS A 1 87  ? -21.212 7.441   15.097 1.00 16.40  ? 86  LYS A O   1 
ATOM   711  C  CB  . LYS A 1 87  ? -24.246 6.388   14.062 1.00 18.52  ? 86  LYS A CB  1 
ATOM   712  C  CG  . LYS A 1 87  ? -25.415 7.057   13.329 1.00 16.79  ? 86  LYS A CG  1 
ATOM   713  C  CD  . LYS A 1 87  ? -26.733 6.665   13.980 1.00 25.00  ? 86  LYS A CD  1 
ATOM   714  C  CE  . LYS A 1 87  ? -27.821 7.667   13.666 1.00 50.67  ? 86  LYS A CE  1 
ATOM   715  N  NZ  . LYS A 1 87  ? -29.096 7.315   14.346 1.00 58.18  ? 86  LYS A NZ  1 
ATOM   716  N  N   . GLY A 1 88  ? -21.517 5.221   14.872 1.00 9.19   ? 87  GLY A N   1 
ATOM   717  C  CA  . GLY A 1 88  ? -20.577 4.867   15.921 1.00 17.73  ? 87  GLY A CA  1 
ATOM   718  C  C   . GLY A 1 88  ? -21.295 4.716   17.244 1.00 17.75  ? 87  GLY A C   1 
ATOM   719  O  O   . GLY A 1 88  ? -22.286 5.403   17.509 1.00 19.59  ? 87  GLY A O   1 
ATOM   720  N  N   . HIS A 1 89  ? -20.795 3.806   18.073 1.00 13.77  ? 88  HIS A N   1 
ATOM   721  C  CA  . HIS A 1 89  ? -21.407 3.517   19.361 1.00 12.07  ? 88  HIS A CA  1 
ATOM   722  C  C   . HIS A 1 89  ? -20.434 2.808   20.286 1.00 16.44  ? 88  HIS A C   1 
ATOM   723  O  O   . HIS A 1 89  ? -19.505 2.136   19.841 1.00 15.57  ? 88  HIS A O   1 
ATOM   724  C  CB  . HIS A 1 89  ? -22.658 2.639   19.194 1.00 12.28  ? 88  HIS A CB  1 
ATOM   725  C  CG  . HIS A 1 89  ? -22.382 1.311   18.560 1.00 16.00  ? 88  HIS A CG  1 
ATOM   726  N  ND1 . HIS A 1 89  ? -22.332 1.133   17.192 1.00 13.84  ? 88  HIS A ND1 1 
ATOM   727  C  CD2 . HIS A 1 89  ? -22.129 0.099   19.106 1.00 11.02  ? 88  HIS A CD2 1 
ATOM   728  C  CE1 . HIS A 1 89  ? -22.059 -0.131  16.924 1.00 12.89  ? 88  HIS A CE1 1 
ATOM   729  N  NE2 . HIS A 1 89  ? -21.939 -0.783  18.067 1.00 19.20  ? 88  HIS A NE2 1 
ATOM   730  N  N   . PHE A 1 90  ? -20.671 2.989   21.579 1.00 13.96  ? 89  PHE A N   1 
ATOM   731  C  CA  . PHE A 1 90  ? -20.182 2.098   22.617 1.00 13.89  ? 89  PHE A CA  1 
ATOM   732  C  C   . PHE A 1 90  ? -21.225 0.994   22.751 1.00 15.59  ? 89  PHE A C   1 
ATOM   733  O  O   . PHE A 1 90  ? -22.337 1.111   22.221 1.00 12.96  ? 89  PHE A O   1 
ATOM   734  C  CB  . PHE A 1 90  ? -20.107 2.840   23.958 1.00 9.67   ? 89  PHE A CB  1 
ATOM   735  C  CG  . PHE A 1 90  ? -18.951 3.801   24.076 1.00 9.31   ? 89  PHE A CG  1 
ATOM   736  C  CD1 . PHE A 1 90  ? -17.685 3.350   24.422 1.00 18.04  ? 89  PHE A CD1 1 
ATOM   737  C  CD2 . PHE A 1 90  ? -19.147 5.167   23.890 1.00 8.39   ? 89  PHE A CD2 1 
ATOM   738  C  CE1 . PHE A 1 90  ? -16.613 4.245   24.556 1.00 8.35   ? 89  PHE A CE1 1 
ATOM   739  C  CE2 . PHE A 1 90  ? -18.087 6.068   24.029 1.00 17.50  ? 89  PHE A CE2 1 
ATOM   740  C  CZ  . PHE A 1 90  ? -16.823 5.601   24.369 1.00 12.54  ? 89  PHE A CZ  1 
ATOM   741  N  N   . HIS A 1 91  ? -20.889 -0.071  23.467 1.00 14.08  ? 90  HIS A N   1 
ATOM   742  C  CA  . HIS A 1 91  ? -21.894 -1.068  23.797 1.00 18.99  ? 90  HIS A CA  1 
ATOM   743  C  C   . HIS A 1 91  ? -22.575 -0.694  25.106 1.00 25.38  ? 90  HIS A C   1 
ATOM   744  O  O   . HIS A 1 91  ? -21.968 -0.036  25.956 1.00 12.83  ? 90  HIS A O   1 
ATOM   745  C  CB  . HIS A 1 91  ? -21.277 -2.462  23.839 1.00 12.69  ? 90  HIS A CB  1 
ATOM   746  C  CG  . HIS A 1 91  ? -20.774 -2.925  22.507 1.00 21.10  ? 90  HIS A CG  1 
ATOM   747  N  ND1 . HIS A 1 91  ? -19.635 -3.689  22.360 1.00 10.09  ? 90  HIS A ND1 1 
ATOM   748  C  CD2 . HIS A 1 91  ? -21.244 -2.709  21.254 1.00 11.18  ? 90  HIS A CD2 1 
ATOM   749  C  CE1 . HIS A 1 91  ? -19.437 -3.938  21.079 1.00 21.20  ? 90  HIS A CE1 1 
ATOM   750  N  NE2 . HIS A 1 91  ? -20.403 -3.362  20.389 1.00 15.39  ? 90  HIS A NE2 1 
ATOM   751  N  N   . ALA A 1 92  ? -23.844 -1.079  25.245 1.00 18.01  ? 91  ALA A N   1 
ATOM   752  C  CA  . ALA A 1 92  ? -24.601 -0.829  26.470 1.00 16.82  ? 91  ALA A CA  1 
ATOM   753  C  C   . ALA A 1 92  ? -23.995 -1.604  27.644 1.00 14.64  ? 91  ALA A C   1 
ATOM   754  O  O   . ALA A 1 92  ? -23.869 -1.070  28.758 1.00 14.88  ? 91  ALA A O   1 
ATOM   755  C  CB  . ALA A 1 92  ? -26.073 -1.177  26.271 1.00 9.24   ? 91  ALA A CB  1 
ATOM   756  N  N   . LYS A 1 93  ? -23.630 -2.862  27.396 1.00 13.41  ? 92  LYS A N   1 
ATOM   757  C  CA  . LYS A 1 93  ? -22.730 -3.586  28.292 1.00 13.96  ? 92  LYS A CA  1 
ATOM   758  C  C   . LYS A 1 93  ? -21.339 -3.238  27.822 1.00 19.93  ? 92  LYS A C   1 
ATOM   759  O  O   . LYS A 1 93  ? -20.870 -3.738  26.798 1.00 9.54   ? 92  LYS A O   1 
ATOM   760  C  CB  . LYS A 1 93  ? -22.993 -5.093  28.277 1.00 14.66  ? 92  LYS A CB  1 
ATOM   761  C  CG  . LYS A 1 93  ? -24.360 -5.451  28.845 1.00 18.31  ? 92  LYS A CG  1 
ATOM   762  C  CD  . LYS A 1 93  ? -24.571 -6.946  28.920 1.00 14.01  ? 92  LYS A CD  1 
ATOM   763  C  CE  . LYS A 1 93  ? -25.896 -7.291  29.592 1.00 14.49  ? 92  LYS A CE  1 
ATOM   764  N  NZ  . LYS A 1 93  ? -25.946 -8.739  29.946 1.00 18.41  ? 92  LYS A NZ  1 
ATOM   765  N  N   . LEU A 1 94  ? -20.699 -2.341  28.564 1.00 15.39  ? 93  LEU A N   1 
ATOM   766  C  CA  . LEU A 1 94  ? -19.547 -1.610  28.064 1.00 8.49   ? 93  LEU A CA  1 
ATOM   767  C  C   . LEU A 1 94  ? -18.352 -2.501  27.732 1.00 15.69  ? 93  LEU A C   1 
ATOM   768  O  O   . LEU A 1 94  ? -17.585 -2.190  26.814 1.00 14.73  ? 93  LEU A O   1 
ATOM   769  C  CB  . LEU A 1 94  ? -19.142 -0.524  29.064 1.00 4.94   ? 93  LEU A CB  1 
ATOM   770  C  CG  . LEU A 1 94  ? -18.954 0.961   28.722 1.00 19.14  ? 93  LEU A CG  1 
ATOM   771  C  CD1 . LEU A 1 94  ? -17.804 1.539   29.551 1.00 11.08  ? 93  LEU A CD1 1 
ATOM   772  C  CD2 . LEU A 1 94  ? -18.762 1.265   27.240 1.00 15.52  ? 93  LEU A CD2 1 
ATOM   773  N  N   . ASP A 1 95  ? -18.194 -3.602  28.465 1.00 12.22  ? 94  ASP A N   1 
ATOM   774  C  CA  . ASP A 1 95  ? -17.036 -4.487  28.267 1.00 16.97  ? 94  ASP A CA  1 
ATOM   775  C  C   . ASP A 1 95  ? -17.197 -5.546  27.166 1.00 11.36  ? 94  ASP A C   1 
ATOM   776  O  O   . ASP A 1 95  ? -16.392 -6.469  27.064 1.00 10.92  ? 94  ASP A O   1 
ATOM   777  C  CB  . ASP A 1 95  ? -16.587 -5.128  29.602 1.00 16.21  ? 94  ASP A CB  1 
ATOM   778  C  CG  . ASP A 1 95  ? -17.614 -6.077  30.183 1.00 25.46  ? 94  ASP A CG  1 
ATOM   779  O  OD1 . ASP A 1 95  ? -17.356 -6.621  31.280 1.00 17.15  ? 94  ASP A OD1 1 
ATOM   780  O  OD2 . ASP A 1 95  ? -18.673 -6.290  29.554 1.00 10.22  ? 94  ASP A OD2 1 
ATOM   781  N  N   . ARG A 1 96  ? -18.238 -5.422  26.346 1.00 13.13  ? 95  ARG A N   1 
ATOM   782  C  CA  . ARG A 1 96  ? -18.429 -6.353  25.223 1.00 9.67   ? 95  ARG A CA  1 
ATOM   783  C  C   . ARG A 1 96  ? -17.515 -5.964  24.058 1.00 7.23   ? 95  ARG A C   1 
ATOM   784  O  O   . ARG A 1 96  ? -17.465 -4.792  23.668 1.00 12.37  ? 95  ARG A O   1 
ATOM   785  C  CB  . ARG A 1 96  ? -19.914 -6.417  24.798 1.00 5.90   ? 95  ARG A CB  1 
ATOM   786  C  CG  . ARG A 1 96  ? -20.720 -7.551  25.479 1.00 8.13   ? 95  ARG A CG  1 
ATOM   787  C  CD  . ARG A 1 96  ? -20.645 -7.551  27.025 1.00 8.83   ? 95  ARG A CD  1 
ATOM   788  N  NE  . ARG A 1 96  ? -21.511 -8.587  27.594 1.00 8.31   ? 95  ARG A NE  1 
ATOM   789  C  CZ  . ARG A 1 96  ? -21.363 -9.130  28.799 1.00 8.35   ? 95  ARG A CZ  1 
ATOM   790  N  NH1 . ARG A 1 96  ? -20.366 -8.748  29.583 1.00 6.76   ? 95  ARG A NH1 1 
ATOM   791  N  NH2 . ARG A 1 96  ? -22.205 -10.081 29.209 1.00 9.12   ? 95  ARG A NH2 1 
ATOM   792  N  N   . ALA A 1 97  ? -16.778 -6.955  23.551 1.00 11.94  ? 96  ALA A N   1 
ATOM   793  C  CA  . ALA A 1 97  ? -15.882 -6.823  22.401 1.00 10.04  ? 96  ALA A CA  1 
ATOM   794  C  C   . ALA A 1 97  ? -16.630 -6.999  21.074 1.00 16.93  ? 96  ALA A C   1 
ATOM   795  O  O   . ALA A 1 97  ? -17.832 -7.251  21.054 1.00 10.70  ? 96  ALA A O   1 
ATOM   796  C  CB  . ALA A 1 97  ? -14.748 -7.853  22.497 1.00 2.03   ? 96  ALA A CB  1 
ATOM   797  N  N   . GLU A 1 98  ? -15.915 -6.867  19.962 1.00 9.68   ? 97  GLU A N   1 
ATOM   798  C  CA  . GLU A 1 98  ? -16.523 -7.050  18.641 1.00 6.37   ? 97  GLU A CA  1 
ATOM   799  C  C   . GLU A 1 98  ? -15.469 -7.462  17.633 1.00 11.96  ? 97  GLU A C   1 
ATOM   800  O  O   . GLU A 1 98  ? -14.297 -7.127  17.788 1.00 13.13  ? 97  GLU A O   1 
ATOM   801  C  CB  . GLU A 1 98  ? -17.271 -5.784  18.180 1.00 10.24  ? 97  GLU A CB  1 
ATOM   802  C  CG  . GLU A 1 98  ? -18.219 -6.050  16.998 1.00 15.26  ? 97  GLU A CG  1 
ATOM   803  C  CD  . GLU A 1 98  ? -19.284 -4.991  16.811 1.00 25.30  ? 97  GLU A CD  1 
ATOM   804  O  OE1 . GLU A 1 98  ? -20.040 -5.123  15.833 1.00 24.13  ? 97  GLU A OE1 1 
ATOM   805  O  OE2 . GLU A 1 98  ? -19.382 -4.043  17.634 1.00 17.69  ? 97  GLU A OE2 1 
ATOM   806  N  N   . VAL A 1 99  ? -15.876 -8.225  16.621 1.00 10.78  ? 98  VAL A N   1 
ATOM   807  C  CA  . VAL A 1 99  ? -14.950 -8.647  15.561 1.00 5.69   ? 98  VAL A CA  1 
ATOM   808  C  C   . VAL A 1 99  ? -15.517 -8.244  14.190 1.00 14.82  ? 98  VAL A C   1 
ATOM   809  O  O   . VAL A 1 99  ? -16.662 -8.556  13.885 1.00 7.19   ? 98  VAL A O   1 
ATOM   810  C  CB  . VAL A 1 99  ? -14.677 -10.177 15.629 1.00 10.37  ? 98  VAL A CB  1 
ATOM   811  C  CG1 . VAL A 1 99  ? -13.826 -10.644 14.440 1.00 15.23  ? 98  VAL A CG1 1 
ATOM   812  C  CG2 . VAL A 1 99  ? -14.007 -10.550 16.962 1.00 9.17   ? 98  VAL A CG2 1 
ATOM   813  N  N   . TYR A 1 100 ? -14.717 -7.536  13.391 1.00 12.65  ? 99  TYR A N   1 
ATOM   814  C  CA  . TYR A 1 100 ? -15.109 -7.090  12.045 1.00 8.53   ? 99  TYR A CA  1 
ATOM   815  C  C   . TYR A 1 100 ? -14.247 -7.755  10.989 1.00 16.81  ? 99  TYR A C   1 
ATOM   816  O  O   . TYR A 1 100 ? -13.024 -7.833  11.148 1.00 13.98  ? 99  TYR A O   1 
ATOM   817  C  CB  . TYR A 1 100 ? -14.877 -5.594  11.883 1.00 10.68  ? 99  TYR A CB  1 
ATOM   818  C  CG  . TYR A 1 100 ? -15.871 -4.666  12.520 1.00 16.07  ? 99  TYR A CG  1 
ATOM   819  C  CD1 . TYR A 1 100 ? -16.007 -4.578  13.916 1.00 16.04  ? 99  TYR A CD1 1 
ATOM   820  C  CD2 . TYR A 1 100 ? -16.631 -3.810  11.726 1.00 14.48  ? 99  TYR A CD2 1 
ATOM   821  C  CE1 . TYR A 1 100 ? -16.915 -3.673  14.495 1.00 16.38  ? 99  TYR A CE1 1 
ATOM   822  C  CE2 . TYR A 1 100 ? -17.522 -2.917  12.284 1.00 12.07  ? 99  TYR A CE2 1 
ATOM   823  C  CZ  . TYR A 1 100 ? -17.666 -2.848  13.666 1.00 15.01  ? 99  TYR A CZ  1 
ATOM   824  O  OH  . TYR A 1 100 ? -18.560 -1.933  14.193 1.00 16.61  ? 99  TYR A OH  1 
ATOM   825  N  N   . VAL A 1 101 ? -14.875 -8.197  9.903  1.00 15.71  ? 100 VAL A N   1 
ATOM   826  C  CA  . VAL A 1 101 ? -14.159 -8.806  8.776  1.00 12.31  ? 100 VAL A CA  1 
ATOM   827  C  C   . VAL A 1 101 ? -14.426 -7.969  7.531  1.00 23.84  ? 100 VAL A C   1 
ATOM   828  O  O   . VAL A 1 101 ? -15.572 -7.855  7.094  1.00 8.25   ? 100 VAL A O   1 
ATOM   829  C  CB  . VAL A 1 101 ? -14.609 -10.262 8.497  1.00 14.64  ? 100 VAL A CB  1 
ATOM   830  C  CG1 . VAL A 1 101 ? -13.732 -10.895 7.409  1.00 15.56  ? 100 VAL A CG1 1 
ATOM   831  C  CG2 . VAL A 1 101 ? -14.607 -11.112 9.775  1.00 12.44  ? 100 VAL A CG2 1 
ATOM   832  N  N   . ALA A 1 102 ? -13.381 -7.371  6.965  1.00 7.70   ? 101 ALA A N   1 
ATOM   833  C  CA  . ALA A 1 102 ? -13.573 -6.537  5.774  1.00 8.51   ? 101 ALA A CA  1 
ATOM   834  C  C   . ALA A 1 102 ? -13.689 -7.425  4.533  1.00 9.48   ? 101 ALA A C   1 
ATOM   835  O  O   . ALA A 1 102 ? -12.874 -8.322  4.339  1.00 10.80  ? 101 ALA A O   1 
ATOM   836  C  CB  . ALA A 1 102 ? -12.444 -5.514  5.634  1.00 12.16  ? 101 ALA A CB  1 
ATOM   837  N  N   . LEU A 1 103 ? -14.723 -7.190  3.720  1.00 13.50  ? 102 LEU A N   1 
ATOM   838  C  CA  . LEU A 1 103 ? -15.012 -8.047  2.555  1.00 20.48  ? 102 LEU A CA  1 
ATOM   839  C  C   . LEU A 1 103 ? -14.770 -7.382  1.196  1.00 17.99  ? 102 LEU A C   1 
ATOM   840  O  O   . LEU A 1 103 ? -14.309 -8.031  0.263  1.00 12.10  ? 102 LEU A O   1 
ATOM   841  C  CB  . LEU A 1 103 ? -16.456 -8.567  2.607  1.00 17.34  ? 102 LEU A CB  1 
ATOM   842  C  CG  . LEU A 1 103 ? -16.923 -9.295  3.878  1.00 13.18  ? 102 LEU A CG  1 
ATOM   843  C  CD1 . LEU A 1 103 ? -18.436 -9.510  3.874  1.00 15.11  ? 102 LEU A CD1 1 
ATOM   844  C  CD2 . LEU A 1 103 ? -16.191 -10.606 4.044  1.00 15.67  ? 102 LEU A CD2 1 
ATOM   845  N  N   . LYS A 1 104 ? -15.122 -6.104  1.076  1.00 19.06  ? 103 LYS A N   1 
ATOM   846  C  CA  . LYS A 1 104 ? -14.965 -5.375  -0.181 1.00 19.48  ? 103 LYS A CA  1 
ATOM   847  C  C   . LYS A 1 104 ? -14.759 -3.894  0.082  1.00 20.22  ? 103 LYS A C   1 
ATOM   848  O  O   . LYS A 1 104 ? -15.291 -3.338  1.056  1.00 13.43  ? 103 LYS A O   1 
ATOM   849  C  CB  . LYS A 1 104 ? -16.178 -5.583  -1.108 1.00 20.62  ? 103 LYS A CB  1 
ATOM   850  C  CG  . LYS A 1 104 ? -15.789 -5.572  -2.600 1.00 29.28  ? 103 LYS A CG  1 
ATOM   851  C  CD  . LYS A 1 104 ? -16.984 -5.587  -3.554 1.00 29.23  ? 103 LYS A CD  1 
ATOM   852  C  CE  . LYS A 1 104 ? -16.512 -5.837  -5.000 1.00 31.94  ? 103 LYS A CE  1 
ATOM   853  N  NZ  . LYS A 1 104 ? -17.548 -5.547  -6.037 1.00 51.25  ? 103 LYS A NZ  1 
ATOM   854  N  N   . GLY A 1 105 ? -13.973 -3.261  -0.785 1.00 14.38  ? 104 GLY A N   1 
ATOM   855  C  CA  . GLY A 1 105 ? -13.773 -1.825  -0.720 1.00 11.23  ? 104 GLY A CA  1 
ATOM   856  C  C   . GLY A 1 105 ? -12.618 -1.446  0.182  1.00 14.45  ? 104 GLY A C   1 
ATOM   857  O  O   . GLY A 1 105 ? -11.820 -2.288  0.585  1.00 13.69  ? 104 GLY A O   1 
ATOM   858  N  N   . LYS A 1 106 ? -12.549 -0.167  0.516  1.00 11.93  ? 105 LYS A N   1 
ATOM   859  C  CA  . LYS A 1 106 ? -11.372 0.386   1.148  1.00 21.81  ? 105 LYS A CA  1 
ATOM   860  C  C   . LYS A 1 106 ? -11.830 1.345   2.232  1.00 13.03  ? 105 LYS A C   1 
ATOM   861  O  O   . LYS A 1 106 ? -12.629 2.234   1.982  1.00 11.78  ? 105 LYS A O   1 
ATOM   862  C  CB  . LYS A 1 106 ? -10.540 1.105   0.087  1.00 21.00  ? 105 LYS A CB  1 
ATOM   863  C  CG  . LYS A 1 106 ? -9.209  1.625   0.531  1.00 33.68  ? 105 LYS A CG  1 
ATOM   864  C  CD  . LYS A 1 106 ? -8.464  2.216   -0.658 1.00 44.59  ? 105 LYS A CD  1 
ATOM   865  C  CE  . LYS A 1 106 ? -7.261  3.027   -0.203 1.00 58.77  ? 105 LYS A CE  1 
ATOM   866  N  NZ  . LYS A 1 106 ? -6.545  2.383   0.936  1.00 46.16  ? 105 LYS A NZ  1 
ATOM   867  N  N   . GLY A 1 107 ? -11.343 1.149   3.447  1.00 20.47  ? 106 GLY A N   1 
ATOM   868  C  CA  . GLY A 1 107 ? -11.753 2.018   4.532  1.00 10.12  ? 106 GLY A CA  1 
ATOM   869  C  C   . GLY A 1 107 ? -10.935 1.832   5.783  1.00 15.04  ? 106 GLY A C   1 
ATOM   870  O  O   . GLY A 1 107 ? -9.714  1.674   5.734  1.00 13.27  ? 106 GLY A O   1 
ATOM   871  N  N   . GLY A 1 108 ? -11.619 1.844   6.915  1.00 7.40   ? 107 GLY A N   1 
ATOM   872  C  CA  . GLY A 1 108 ? -10.942 1.727   8.182  1.00 9.52   ? 107 GLY A CA  1 
ATOM   873  C  C   . GLY A 1 108 ? -11.872 1.949   9.343  1.00 13.45  ? 107 GLY A C   1 
ATOM   874  O  O   . GLY A 1 108 ? -13.064 2.227   9.173  1.00 15.15  ? 107 GLY A O   1 
ATOM   875  N  N   . MET A 1 109 ? -11.318 1.821   10.538 1.00 7.71   ? 108 MET A N   1 
ATOM   876  C  CA  . MET A 1 109 ? -12.118 1.973   11.726 1.00 16.53  ? 108 MET A CA  1 
ATOM   877  C  C   . MET A 1 109 ? -11.526 2.998   12.681 1.00 11.98  ? 108 MET A C   1 
ATOM   878  O  O   . MET A 1 109 ? -10.325 2.979   12.963 1.00 15.34  ? 108 MET A O   1 
ATOM   879  C  CB  . MET A 1 109 ? -12.273 0.630   12.432 1.00 7.54   ? 108 MET A CB  1 
ATOM   880  C  CG  . MET A 1 109 ? -13.414 0.647   13.444 1.00 15.90  ? 108 MET A CG  1 
ATOM   881  S  SD  . MET A 1 109 ? -13.377 -0.762  14.514 1.00 21.60  ? 108 MET A SD  1 
ATOM   882  C  CE  . MET A 1 109 ? -13.893 -2.004  13.328 1.00 24.38  ? 108 MET A CE  1 
ATOM   883  N  N   . LEU A 1 110 ? -12.385 3.896   13.157 1.00 13.66  ? 109 LEU A N   1 
ATOM   884  C  CA  . LEU A 1 110 ? -12.054 4.771   14.274 1.00 18.78  ? 109 LEU A CA  1 
ATOM   885  C  C   . LEU A 1 110 ? -12.610 4.177   15.550 1.00 12.50  ? 109 LEU A C   1 
ATOM   886  O  O   . LEU A 1 110 ? -13.786 3.792   15.602 1.00 13.53  ? 109 LEU A O   1 
ATOM   887  C  CB  . LEU A 1 110 ? -12.636 6.167   14.080 1.00 19.29  ? 109 LEU A CB  1 
ATOM   888  C  CG  . LEU A 1 110 ? -11.884 7.146   13.193 1.00 28.00  ? 109 LEU A CG  1 
ATOM   889  C  CD1 . LEU A 1 110 ? -12.716 8.408   13.088 1.00 25.37  ? 109 LEU A CD1 1 
ATOM   890  C  CD2 . LEU A 1 110 ? -10.474 7.433   13.748 1.00 18.51  ? 109 LEU A CD2 1 
ATOM   891  N  N   . LEU A 1 111 ? -11.761 4.118   16.569 1.00 14.49  ? 110 LEU A N   1 
ATOM   892  C  CA  . LEU A 1 111 ? -12.108 3.562   17.881 1.00 11.66  ? 110 LEU A CA  1 
ATOM   893  C  C   . LEU A 1 111 ? -11.725 4.571   18.957 1.00 14.09  ? 110 LEU A C   1 
ATOM   894  O  O   . LEU A 1 111 ? -10.754 5.298   18.803 1.00 18.93  ? 110 LEU A O   1 
ATOM   895  C  CB  . LEU A 1 111 ? -11.369 2.240   18.143 1.00 8.59   ? 110 LEU A CB  1 
ATOM   896  C  CG  . LEU A 1 111 ? -11.502 1.084   17.143 1.00 12.64  ? 110 LEU A CG  1 
ATOM   897  C  CD1 . LEU A 1 111 ? -10.253 0.945   16.281 1.00 10.79  ? 110 LEU A CD1 1 
ATOM   898  C  CD2 . LEU A 1 111 ? -11.744 -0.206  17.879 1.00 13.65  ? 110 LEU A CD2 1 
ATOM   899  N  N   . GLN A 1 112 ? -12.490 4.628   20.040 1.00 15.49  ? 111 GLN A N   1 
ATOM   900  C  CA  . GLN A 1 112 ? -12.087 5.452   21.170 1.00 15.26  ? 111 GLN A CA  1 
ATOM   901  C  C   . GLN A 1 112 ? -12.632 4.994   22.517 1.00 14.18  ? 111 GLN A C   1 
ATOM   902  O  O   . GLN A 1 112 ? -13.741 4.460   22.604 1.00 17.93  ? 111 GLN A O   1 
ATOM   903  C  CB  . GLN A 1 112 ? -12.320 6.954   20.917 1.00 22.43  ? 111 GLN A CB  1 
ATOM   904  C  CG  . GLN A 1 112 ? -13.724 7.501   21.114 1.00 26.50  ? 111 GLN A CG  1 
ATOM   905  C  CD  . GLN A 1 112 ? -13.773 9.029   20.979 1.00 31.44  ? 111 GLN A CD  1 
ATOM   906  O  OE1 . GLN A 1 112 ? -13.024 9.629   20.199 1.00 21.66  ? 111 GLN A OE1 1 
ATOM   907  N  NE2 . GLN A 1 112 ? -14.655 9.658   21.740 1.00 32.30  ? 111 GLN A NE2 1 
ATOM   908  N  N   . THR A 1 113 ? -11.802 5.180   23.545 1.00 17.73  ? 112 THR A N   1 
ATOM   909  C  CA  . THR A 1 113 ? -12.123 4.829   24.933 1.00 26.75  ? 112 THR A CA  1 
ATOM   910  C  C   . THR A 1 113 ? -13.005 5.917   25.550 1.00 18.86  ? 112 THR A C   1 
ATOM   911  O  O   . THR A 1 113 ? -13.104 7.015   24.995 1.00 16.45  ? 112 THR A O   1 
ATOM   912  C  CB  . THR A 1 113 ? -10.840 4.733   25.786 1.00 22.86  ? 112 THR A CB  1 
ATOM   913  O  OG1 . THR A 1 113 ? -10.218 6.022   25.841 1.00 16.97  ? 112 THR A OG1 1 
ATOM   914  C  CG2 . THR A 1 113 ? -9.854  3.733   25.191 1.00 18.79  ? 112 THR A CG2 1 
ATOM   915  N  N   . PRO A 1 114 ? -13.638 5.621   26.703 1.00 18.85  ? 113 PRO A N   1 
ATOM   916  C  CA  . PRO A 1 114 ? -14.424 6.628   27.415 1.00 21.87  ? 113 PRO A CA  1 
ATOM   917  C  C   . PRO A 1 114 ? -13.607 7.872   27.796 1.00 23.62  ? 113 PRO A C   1 
ATOM   918  O  O   . PRO A 1 114 ? -14.188 8.939   27.978 1.00 30.61  ? 113 PRO A O   1 
ATOM   919  C  CB  . PRO A 1 114 ? -14.914 5.870   28.659 1.00 23.64  ? 113 PRO A CB  1 
ATOM   920  C  CG  . PRO A 1 114 ? -14.950 4.435   28.209 1.00 24.16  ? 113 PRO A CG  1 
ATOM   921  C  CD  . PRO A 1 114 ? -13.695 4.315   27.396 1.00 18.65  ? 113 PRO A CD  1 
ATOM   922  N  N   . GLU A 1 115 ? -12.281 7.734   27.896 1.00 21.81  ? 114 GLU A N   1 
ATOM   923  C  CA  . GLU A 1 115 ? -11.375 8.885   28.082 1.00 20.58  ? 114 GLU A CA  1 
ATOM   924  C  C   . GLU A 1 115 ? -11.316 9.808   26.858 1.00 39.66  ? 114 GLU A C   1 
ATOM   925  O  O   . GLU A 1 115 ? -11.029 11.002  26.989 1.00 32.85  ? 114 GLU A O   1 
ATOM   926  C  CB  . GLU A 1 115 ? -9.956  8.433   28.412 1.00 29.88  ? 114 GLU A CB  1 
ATOM   927  C  CG  . GLU A 1 115 ? -9.840  7.448   29.551 1.00 54.40  ? 114 GLU A CG  1 
ATOM   928  C  CD  . GLU A 1 115 ? -8.452  7.448   30.170 1.00 75.72  ? 114 GLU A CD  1 
ATOM   929  O  OE1 . GLU A 1 115 ? -7.765  6.405   30.103 1.00 73.07  ? 114 GLU A OE1 1 
ATOM   930  O  OE2 . GLU A 1 115 ? -8.046  8.497   30.718 1.00 81.08  ? 114 GLU A OE2 1 
ATOM   931  N  N   . GLY A 1 116 ? -11.570 9.247   25.675 1.00 28.88  ? 115 GLY A N   1 
ATOM   932  C  CA  . GLY A 1 116 ? -11.578 10.023  24.436 1.00 23.42  ? 115 GLY A CA  1 
ATOM   933  C  C   . GLY A 1 116 ? -10.345 9.834   23.568 1.00 23.30  ? 115 GLY A C   1 
ATOM   934  O  O   . GLY A 1 116 ? -10.186 10.520  22.555 1.00 34.47  ? 115 GLY A O   1 
ATOM   935  N  N   . ASP A 1 117 ? -9.474  8.909   23.964 1.00 27.30  ? 116 ASP A N   1 
ATOM   936  C  CA  . ASP A 1 117 ? -8.295  8.542   23.175 1.00 36.82  ? 116 ASP A CA  1 
ATOM   937  C  C   . ASP A 1 117 ? -8.685  7.677   21.974 1.00 31.23  ? 116 ASP A C   1 
ATOM   938  O  O   . ASP A 1 117 ? -9.357  6.657   22.131 1.00 22.64  ? 116 ASP A O   1 
ATOM   939  C  CB  . ASP A 1 117 ? -7.287  7.797   24.048 1.00 36.10  ? 116 ASP A CB  1 
ATOM   940  C  CG  . ASP A 1 117 ? -6.865  8.598   25.257 1.00 40.57  ? 116 ASP A CG  1 
ATOM   941  O  OD1 . ASP A 1 117 ? -6.772  8.011   26.349 1.00 44.65  ? 116 ASP A OD1 1 
ATOM   942  O  OD2 . ASP A 1 117 ? -6.635  9.817   25.117 1.00 48.13  ? 116 ASP A OD2 1 
ATOM   943  N  N   . ALA A 1 118 ? -8.252  8.091   20.787 1.00 30.90  ? 117 ALA A N   1 
ATOM   944  C  CA  . ALA A 1 118 ? -8.708  7.485   19.537 1.00 25.08  ? 117 ALA A CA  1 
ATOM   945  C  C   . ALA A 1 118 ? -7.632  6.670   18.848 1.00 24.31  ? 117 ALA A C   1 
ATOM   946  O  O   . ALA A 1 118 ? -6.442  6.931   19.007 1.00 41.63  ? 117 ALA A O   1 
ATOM   947  C  CB  . ALA A 1 118 ? -9.265  8.548   18.591 1.00 36.12  ? 117 ALA A CB  1 
ATOM   948  N  N   . LYS A 1 119 ? -8.073  5.673   18.090 1.00 16.39  ? 118 LYS A N   1 
ATOM   949  C  CA  . LYS A 1 119 ? -7.198  4.838   17.285 1.00 19.51  ? 118 LYS A CA  1 
ATOM   950  C  C   . LYS A 1 119 ? -7.802  4.699   15.888 1.00 14.74  ? 118 LYS A C   1 
ATOM   951  O  O   . LYS A 1 119 ? -9.027  4.590   15.745 1.00 16.88  ? 118 LYS A O   1 
ATOM   952  C  CB  . LYS A 1 119 ? -7.048  3.462   17.943 1.00 17.85  ? 118 LYS A CB  1 
ATOM   953  C  CG  . LYS A 1 119 ? -6.126  2.476   17.238 1.00 29.71  ? 118 LYS A CG  1 
ATOM   954  C  CD  . LYS A 1 119 ? -4.673  2.746   17.544 1.00 41.84  ? 118 LYS A CD  1 
ATOM   955  C  CE  . LYS A 1 119 ? -3.780  1.676   16.948 1.00 50.09  ? 118 LYS A CE  1 
ATOM   956  N  NZ  . LYS A 1 119 ? -3.913  0.394   17.690 1.00 59.22  ? 118 LYS A NZ  1 
ATOM   957  N  N   . TRP A 1 120 ? -6.940  4.728   14.875 1.00 15.52  ? 119 TRP A N   1 
ATOM   958  C  CA  . TRP A 1 120 ? -7.324  4.473   13.479 1.00 14.77  ? 119 TRP A CA  1 
ATOM   959  C  C   . TRP A 1 120 ? -6.693  3.175   12.978 1.00 11.43  ? 119 TRP A C   1 
ATOM   960  O  O   . TRP A 1 120 ? -5.479  2.965   13.128 1.00 14.39  ? 119 TRP A O   1 
ATOM   961  C  CB  . TRP A 1 120 ? -6.897  5.640   12.582 1.00 18.05  ? 119 TRP A CB  1 
ATOM   962  C  CG  . TRP A 1 120 ? -6.989  5.335   11.092 1.00 14.43  ? 119 TRP A CG  1 
ATOM   963  C  CD1 . TRP A 1 120 ? -5.949  5.050   10.240 1.00 20.51  ? 119 TRP A CD1 1 
ATOM   964  C  CD2 . TRP A 1 120 ? -8.184  5.273   10.301 1.00 11.52  ? 119 TRP A CD2 1 
ATOM   965  N  NE1 . TRP A 1 120 ? -6.427  4.830   8.966  1.00 14.24  ? 119 TRP A NE1 1 
ATOM   966  C  CE2 . TRP A 1 120 ? -7.792  4.961   8.972  1.00 16.36  ? 119 TRP A CE2 1 
ATOM   967  C  CE3 . TRP A 1 120 ? -9.551  5.459   10.581 1.00 11.89  ? 119 TRP A CE3 1 
ATOM   968  C  CZ2 . TRP A 1 120 ? -8.719  4.829   7.928  1.00 14.10  ? 119 TRP A CZ2 1 
ATOM   969  C  CZ3 . TRP A 1 120 ? -10.478 5.335   9.532  1.00 12.74  ? 119 TRP A CZ3 1 
ATOM   970  C  CH2 . TRP A 1 120 ? -10.052 5.033   8.225  1.00 12.62  ? 119 TRP A CH2 1 
ATOM   971  N  N   . ILE A 1 121 ? -7.520  2.305   12.395 1.00 9.88   ? 120 ILE A N   1 
ATOM   972  C  CA  . ILE A 1 121 ? -7.065  1.029   11.828 1.00 10.82  ? 120 ILE A CA  1 
ATOM   973  C  C   . ILE A 1 121 ? -7.538  0.927   10.376 1.00 20.75  ? 120 ILE A C   1 
ATOM   974  O  O   . ILE A 1 121 ? -8.747  0.871   10.142 1.00 13.08  ? 120 ILE A O   1 
ATOM   975  C  CB  . ILE A 1 121 ? -7.671  -0.196  12.585 1.00 15.06  ? 120 ILE A CB  1 
ATOM   976  C  CG1 . ILE A 1 121 ? -7.431  -0.118  14.105 1.00 24.93  ? 120 ILE A CG1 1 
ATOM   977  C  CG2 . ILE A 1 121 ? -7.192  -1.535  11.970 1.00 18.09  ? 120 ILE A CG2 1 
ATOM   978  C  CD1 . ILE A 1 121 ? -6.125  -0.649  14.570 1.00 22.85  ? 120 ILE A CD1 1 
ATOM   979  N  N   . SER A 1 122 ? -6.598  0.891   9.420  1.00 13.69  ? 121 SER A N   1 
ATOM   980  C  CA  . SER A 1 122 ? -6.927  0.689   7.995  1.00 13.77  ? 121 SER A CA  1 
ATOM   981  C  C   . SER A 1 122 ? -7.579  -0.671  7.755  1.00 13.75  ? 121 SER A C   1 
ATOM   982  O  O   . SER A 1 122 ? -7.217  -1.666  8.393  1.00 17.63  ? 121 SER A O   1 
ATOM   983  C  CB  . SER A 1 122 ? -5.678  0.818   7.106  1.00 12.87  ? 121 SER A CB  1 
ATOM   984  O  OG  . SER A 1 122 ? -5.380  2.176   6.867  1.00 40.37  ? 121 SER A OG  1 
ATOM   985  N  N   . MET A 1 123 ? -8.541  -0.699  6.832  1.00 17.47  ? 122 MET A N   1 
ATOM   986  C  CA  . MET A 1 123 ? -9.238  -1.922  6.455  1.00 5.88   ? 122 MET A CA  1 
ATOM   987  C  C   . MET A 1 123 ? -9.317  -2.101  4.932  1.00 18.09  ? 122 MET A C   1 
ATOM   988  O  O   . MET A 1 123 ? -9.781  -1.227  4.214  1.00 16.03  ? 122 MET A O   1 
ATOM   989  C  CB  . MET A 1 123 ? -10.638 -1.969  7.084  1.00 13.23  ? 122 MET A CB  1 
ATOM   990  C  CG  . MET A 1 123 ? -10.622 -2.057  8.628  1.00 12.24  ? 122 MET A CG  1 
ATOM   991  S  SD  . MET A 1 123 ? -12.229 -1.835  9.399  1.00 12.37  ? 122 MET A SD  1 
ATOM   992  C  CE  . MET A 1 123 ? -12.978 -3.417  9.057  1.00 15.76  ? 122 MET A CE  1 
ATOM   993  N  N   . GLU A 1 124 ? -8.829  -3.245  4.466  1.00 17.94  ? 123 GLU A N   1 
ATOM   994  C  CA  . GLU A 1 124 ? -8.928  -3.668  3.076  1.00 25.15  ? 123 GLU A CA  1 
ATOM   995  C  C   . GLU A 1 124 ? -9.559  -5.057  3.091  1.00 19.10  ? 123 GLU A C   1 
ATOM   996  O  O   . GLU A 1 124 ? -9.641  -5.666  4.165  1.00 17.21  ? 123 GLU A O   1 
ATOM   997  C  CB  . GLU A 1 124 ? -7.536  -3.704  2.425  1.00 20.47  ? 123 GLU A CB  1 
ATOM   998  C  CG  . GLU A 1 124 ? -7.189  -2.465  1.616  1.00 32.36  ? 123 GLU A CG  1 
ATOM   999  C  CD  . GLU A 1 124 ? -6.246  -1.522  2.328  1.00 62.15  ? 123 GLU A CD  1 
ATOM   1000 O  OE1 . GLU A 1 124 ? -6.214  -1.511  3.581  1.00 69.06  ? 123 GLU A OE1 1 
ATOM   1001 O  OE2 . GLU A 1 124 ? -5.531  -0.781  1.619  1.00 71.28  ? 123 GLU A OE2 1 
ATOM   1002 N  N   . PRO A 1 125 ? -10.008 -5.573  1.918  1.00 21.46  ? 124 PRO A N   1 
ATOM   1003 C  CA  . PRO A 1 125 ? -10.616 -6.899  1.957  1.00 12.56  ? 124 PRO A CA  1 
ATOM   1004 C  C   . PRO A 1 125 ? -9.692  -7.919  2.634  1.00 19.54  ? 124 PRO A C   1 
ATOM   1005 O  O   . PRO A 1 125 ? -8.493  -7.949  2.356  1.00 11.23  ? 124 PRO A O   1 
ATOM   1006 C  CB  . PRO A 1 125 ? -10.819 -7.231  0.470  1.00 12.69  ? 124 PRO A CB  1 
ATOM   1007 C  CG  . PRO A 1 125 ? -10.992 -5.905  -0.170 1.00 10.35  ? 124 PRO A CG  1 
ATOM   1008 C  CD  . PRO A 1 125 ? -9.999  -5.028  0.544  1.00 12.34  ? 124 PRO A CD  1 
ATOM   1009 N  N   . GLY A 1 126 ? -10.245 -8.725  3.538  1.00 12.13  ? 125 GLY A N   1 
ATOM   1010 C  CA  . GLY A 1 126 ? -9.426  -9.674  4.310  1.00 14.61  ? 125 GLY A CA  1 
ATOM   1011 C  C   . GLY A 1 126 ? -8.928  -9.191  5.670  1.00 13.91  ? 125 GLY A C   1 
ATOM   1012 O  O   . GLY A 1 126 ? -8.452  -9.998  6.457  1.00 13.57  ? 125 GLY A O   1 
ATOM   1013 N  N   . THR A 1 127 ? -9.012  -7.886  5.946  1.00 14.05  ? 126 THR A N   1 
ATOM   1014 C  CA  . THR A 1 127 ? -8.621  -7.345  7.262  1.00 22.33  ? 126 THR A CA  1 
ATOM   1015 C  C   . THR A 1 127 ? -9.662  -7.751  8.305  1.00 14.12  ? 126 THR A C   1 
ATOM   1016 O  O   . THR A 1 127 ? -10.860 -7.495  8.122  1.00 13.97  ? 126 THR A O   1 
ATOM   1017 C  CB  . THR A 1 127 ? -8.458  -5.787  7.256  1.00 17.91  ? 126 THR A CB  1 
ATOM   1018 O  OG1 . THR A 1 127 ? -7.438  -5.400  6.330  1.00 16.44  ? 126 THR A OG1 1 
ATOM   1019 C  CG2 . THR A 1 127 ? -8.054  -5.245  8.637  1.00 6.25   ? 126 THR A CG2 1 
ATOM   1020 N  N   . VAL A 1 128 ? -9.203  -8.418  9.364  1.00 14.19  ? 127 VAL A N   1 
ATOM   1021 C  CA  . VAL A 1 128 ? -10.023 -8.668  10.564 1.00 9.11   ? 127 VAL A CA  1 
ATOM   1022 C  C   . VAL A 1 128 ? -9.616  -7.682  11.670 1.00 15.15  ? 127 VAL A C   1 
ATOM   1023 O  O   . VAL A 1 128 ? -8.434  -7.543  12.009 1.00 7.76   ? 127 VAL A O   1 
ATOM   1024 C  CB  . VAL A 1 128 ? -9.949  -10.154 11.063 1.00 16.98  ? 127 VAL A CB  1 
ATOM   1025 C  CG1 . VAL A 1 128 ? -10.792 -10.372 12.340 1.00 8.77   ? 127 VAL A CG1 1 
ATOM   1026 C  CG2 . VAL A 1 128 ? -10.425 -11.108 9.991  1.00 11.33  ? 127 VAL A CG2 1 
ATOM   1027 N  N   . VAL A 1 129 ? -10.604 -6.982  12.216 1.00 8.40   ? 128 VAL A N   1 
ATOM   1028 C  CA  . VAL A 1 129 ? -10.363 -6.013  13.266 1.00 7.06   ? 128 VAL A CA  1 
ATOM   1029 C  C   . VAL A 1 129 ? -10.972 -6.486  14.577 1.00 12.67  ? 128 VAL A C   1 
ATOM   1030 O  O   . VAL A 1 129 ? -12.160 -6.826  14.644 1.00 7.44   ? 128 VAL A O   1 
ATOM   1031 C  CB  . VAL A 1 129 ? -10.898 -4.610  12.900 1.00 8.29   ? 128 VAL A CB  1 
ATOM   1032 C  CG1 . VAL A 1 129 ? -10.603 -3.600  14.021 1.00 10.83  ? 128 VAL A CG1 1 
ATOM   1033 C  CG2 . VAL A 1 129 ? -10.248 -4.127  11.611 1.00 11.41  ? 128 VAL A CG2 1 
ATOM   1034 N  N   . TYR A 1 130 ? -10.129 -6.523  15.605 1.00 11.07  ? 129 TYR A N   1 
ATOM   1035 C  CA  . TYR A 1 130 ? -10.558 -6.798  16.971 1.00 11.50  ? 129 TYR A CA  1 
ATOM   1036 C  C   . TYR A 1 130 ? -10.928 -5.501  17.702 1.00 11.14  ? 129 TYR A C   1 
ATOM   1037 O  O   . TYR A 1 130 ? -10.075 -4.661  17.976 1.00 13.18  ? 129 TYR A O   1 
ATOM   1038 C  CB  . TYR A 1 130 ? -9.461  -7.573  17.721 1.00 10.03  ? 129 TYR A CB  1 
ATOM   1039 C  CG  . TYR A 1 130 ? -9.734  -7.742  19.200 1.00 8.49   ? 129 TYR A CG  1 
ATOM   1040 C  CD1 . TYR A 1 130 ? -9.031  -7.001  20.137 1.00 17.39  ? 129 TYR A CD1 1 
ATOM   1041 C  CD2 . TYR A 1 130 ? -10.706 -8.634  19.657 1.00 18.19  ? 129 TYR A CD2 1 
ATOM   1042 C  CE1 . TYR A 1 130 ? -9.274  -7.147  21.496 1.00 6.07   ? 129 TYR A CE1 1 
ATOM   1043 C  CE2 . TYR A 1 130 ? -10.969 -8.774  21.021 1.00 7.30   ? 129 TYR A CE2 1 
ATOM   1044 C  CZ  . TYR A 1 130 ? -10.241 -8.022  21.927 1.00 12.37  ? 129 TYR A CZ  1 
ATOM   1045 O  OH  . TYR A 1 130 ? -10.464 -8.143  23.274 1.00 11.69  ? 129 TYR A OH  1 
ATOM   1046 N  N   . VAL A 1 131 ? -12.211 -5.334  18.006 1.00 9.51   ? 130 VAL A N   1 
ATOM   1047 C  CA  . VAL A 1 131 ? -12.659 -4.194  18.799 1.00 8.39   ? 130 VAL A CA  1 
ATOM   1048 C  C   . VAL A 1 131 ? -12.684 -4.655  20.270 1.00 13.08  ? 130 VAL A C   1 
ATOM   1049 O  O   . VAL A 1 131 ? -13.498 -5.489  20.625 1.00 11.85  ? 130 VAL A O   1 
ATOM   1050 C  CB  . VAL A 1 131 ? -14.064 -3.723  18.346 1.00 12.69  ? 130 VAL A CB  1 
ATOM   1051 C  CG1 . VAL A 1 131 ? -14.554 -2.607  19.191 1.00 8.05   ? 130 VAL A CG1 1 
ATOM   1052 C  CG2 . VAL A 1 131 ? -14.050 -3.300  16.871 1.00 13.72  ? 130 VAL A CG2 1 
ATOM   1053 N  N   . PRO A 1 132 ? -11.782 -4.126  21.123 1.00 14.89  ? 131 PRO A N   1 
ATOM   1054 C  CA  . PRO A 1 132 ? -11.754 -4.625  22.504 1.00 15.63  ? 131 PRO A CA  1 
ATOM   1055 C  C   . PRO A 1 132 ? -12.896 -4.068  23.370 1.00 11.57  ? 131 PRO A C   1 
ATOM   1056 O  O   . PRO A 1 132 ? -13.554 -3.104  22.975 1.00 7.82   ? 131 PRO A O   1 
ATOM   1057 C  CB  . PRO A 1 132 ? -10.389 -4.130  23.044 1.00 10.73  ? 131 PRO A CB  1 
ATOM   1058 C  CG  . PRO A 1 132 ? -9.697  -3.432  21.864 1.00 8.25   ? 131 PRO A CG  1 
ATOM   1059 C  CD  . PRO A 1 132 ? -10.790 -3.060  20.914 1.00 9.93   ? 131 PRO A CD  1 
ATOM   1060 N  N   . PRO A 1 133 ? -13.118 -4.664  24.561 1.00 11.20  ? 132 PRO A N   1 
ATOM   1061 C  CA  . PRO A 1 133 ? -14.011 -4.064  25.549 1.00 8.91   ? 132 PRO A CA  1 
ATOM   1062 C  C   . PRO A 1 133 ? -13.737 -2.563  25.742 1.00 4.87   ? 132 PRO A C   1 
ATOM   1063 O  O   . PRO A 1 133 ? -12.579 -2.142  25.755 1.00 15.11  ? 132 PRO A O   1 
ATOM   1064 C  CB  . PRO A 1 133 ? -13.655 -4.825  26.836 1.00 13.07  ? 132 PRO A CB  1 
ATOM   1065 C  CG  . PRO A 1 133 ? -13.231 -6.166  26.371 1.00 10.61  ? 132 PRO A CG  1 
ATOM   1066 C  CD  . PRO A 1 133 ? -12.514 -5.920  25.054 1.00 6.58   ? 132 PRO A CD  1 
ATOM   1067 N  N   . TYR A 1 134 ? -14.806 -1.776  25.882 1.00 6.29   ? 133 TYR A N   1 
ATOM   1068 C  CA  . TYR A 1 134 ? -14.742 -0.350  26.242 1.00 10.43  ? 133 TYR A CA  1 
ATOM   1069 C  C   . TYR A 1 134 ? -14.480 0.643   25.096 1.00 13.74  ? 133 TYR A C   1 
ATOM   1070 O  O   . TYR A 1 134 ? -14.560 1.842   25.311 1.00 9.71   ? 133 TYR A O   1 
ATOM   1071 C  CB  . TYR A 1 134 ? -13.752 -0.101  27.403 1.00 21.91  ? 133 TYR A CB  1 
ATOM   1072 C  CG  . TYR A 1 134 ? -13.992 -0.963  28.629 1.00 17.89  ? 133 TYR A CG  1 
ATOM   1073 C  CD1 . TYR A 1 134 ? -15.166 -0.848  29.364 1.00 16.46  ? 133 TYR A CD1 1 
ATOM   1074 C  CD2 . TYR A 1 134 ? -13.045 -1.896  29.050 1.00 10.44  ? 133 TYR A CD2 1 
ATOM   1075 C  CE1 . TYR A 1 134 ? -15.402 -1.643  30.489 1.00 18.86  ? 133 TYR A CE1 1 
ATOM   1076 C  CE2 . TYR A 1 134 ? -13.268 -2.701  30.187 1.00 8.47   ? 133 TYR A CE2 1 
ATOM   1077 C  CZ  . TYR A 1 134 ? -14.451 -2.555  30.900 1.00 16.74  ? 133 TYR A CZ  1 
ATOM   1078 O  OH  . TYR A 1 134 ? -14.696 -3.323  32.022 1.00 16.32  ? 133 TYR A OH  1 
ATOM   1079 N  N   . TRP A 1 135 ? -14.168 0.156   23.897 1.00 13.65  ? 134 TRP A N   1 
ATOM   1080 C  CA  . TRP A 1 135 ? -13.886 1.056   22.778 1.00 14.07  ? 134 TRP A CA  1 
ATOM   1081 C  C   . TRP A 1 135 ? -15.119 1.289   21.912 1.00 2.72   ? 134 TRP A C   1 
ATOM   1082 O  O   . TRP A 1 135 ? -15.696 0.351   21.368 1.00 9.50   ? 134 TRP A O   1 
ATOM   1083 C  CB  . TRP A 1 135 ? -12.743 0.533   21.897 1.00 11.95  ? 134 TRP A CB  1 
ATOM   1084 C  CG  . TRP A 1 135 ? -11.390 0.487   22.551 1.00 11.94  ? 134 TRP A CG  1 
ATOM   1085 C  CD1 . TRP A 1 135 ? -10.952 -0.432  23.465 1.00 11.49  ? 134 TRP A CD1 1 
ATOM   1086 C  CD2 . TRP A 1 135 ? -10.282 1.381   22.318 1.00 7.89   ? 134 TRP A CD2 1 
ATOM   1087 N  NE1 . TRP A 1 135 ? -9.644  -0.169  23.809 1.00 10.78  ? 134 TRP A NE1 1 
ATOM   1088 C  CE2 . TRP A 1 135 ? -9.213  0.940   23.127 1.00 13.46  ? 134 TRP A CE2 1 
ATOM   1089 C  CE3 . TRP A 1 135 ? -10.093 2.512   21.500 1.00 6.27   ? 134 TRP A CE3 1 
ATOM   1090 C  CZ2 . TRP A 1 135 ? -7.963  1.588   23.145 1.00 11.71  ? 134 TRP A CZ2 1 
ATOM   1091 C  CZ3 . TRP A 1 135 ? -8.845  3.162   21.519 1.00 9.28   ? 134 TRP A CZ3 1 
ATOM   1092 C  CH2 . TRP A 1 135 ? -7.799  2.691   22.338 1.00 12.11  ? 134 TRP A CH2 1 
ATOM   1093 N  N   . ALA A 1 136 ? -15.512 2.555   21.809 1.00 16.20  ? 135 ALA A N   1 
ATOM   1094 C  CA  . ALA A 1 136 ? -16.488 2.986   20.827 1.00 13.49  ? 135 ALA A CA  1 
ATOM   1095 C  C   . ALA A 1 136 ? -15.875 2.738   19.453 1.00 22.62  ? 135 ALA A C   1 
ATOM   1096 O  O   . ALA A 1 136 ? -14.658 2.759   19.302 1.00 11.45  ? 135 ALA A O   1 
ATOM   1097 C  CB  . ALA A 1 136 ? -16.817 4.464   21.015 1.00 10.73  ? 135 ALA A CB  1 
ATOM   1098 N  N   . HIS A 1 137 ? -16.705 2.473   18.456 1.00 12.59  ? 136 HIS A N   1 
ATOM   1099 C  CA  . HIS A 1 137 ? -16.173 2.067   17.152 1.00 11.53  ? 136 HIS A CA  1 
ATOM   1100 C  C   . HIS A 1 137 ? -17.049 2.614   16.050 1.00 16.13  ? 136 HIS A C   1 
ATOM   1101 O  O   . HIS A 1 137 ? -18.278 2.583   16.150 1.00 15.06  ? 136 HIS A O   1 
ATOM   1102 C  CB  . HIS A 1 137 ? -16.012 0.536   17.054 1.00 11.30  ? 136 HIS A CB  1 
ATOM   1103 C  CG  . HIS A 1 137 ? -17.104 -0.239  17.734 1.00 14.68  ? 136 HIS A CG  1 
ATOM   1104 N  ND1 . HIS A 1 137 ? -17.150 -0.420  19.103 1.00 16.70  ? 136 HIS A ND1 1 
ATOM   1105 C  CD2 . HIS A 1 137 ? -18.181 -0.889  17.234 1.00 11.73  ? 136 HIS A CD2 1 
ATOM   1106 C  CE1 . HIS A 1 137 ? -18.214 -1.140  19.417 1.00 9.67   ? 136 HIS A CE1 1 
ATOM   1107 N  NE2 . HIS A 1 137 ? -18.854 -1.443  18.301 1.00 17.67  ? 136 HIS A NE2 1 
ATOM   1108 N  N   . ARG A 1 138 ? -16.393 3.152   15.023 1.00 14.07  ? 137 ARG A N   1 
ATOM   1109 C  CA  . ARG A 1 138 ? -17.047 3.737   13.863 1.00 11.12  ? 137 ARG A CA  1 
ATOM   1110 C  C   . ARG A 1 138 ? -16.251 3.353   12.613 1.00 17.65  ? 137 ARG A C   1 
ATOM   1111 O  O   . ARG A 1 138 ? -15.025 3.416   12.621 1.00 12.67  ? 137 ARG A O   1 
ATOM   1112 C  CB  . ARG A 1 138 ? -17.114 5.256   14.004 1.00 10.63  ? 137 ARG A CB  1 
ATOM   1113 C  CG  . ARG A 1 138 ? -17.253 6.025   12.682 1.00 10.70  ? 137 ARG A CG  1 
ATOM   1114 C  CD  . ARG A 1 138 ? -17.164 7.532   12.865 1.00 14.83  ? 137 ARG A CD  1 
ATOM   1115 N  NE  . ARG A 1 138 ? -18.331 8.054   13.571 1.00 11.51  ? 137 ARG A NE  1 
ATOM   1116 C  CZ  . ARG A 1 138 ? -18.449 9.296   14.022 1.00 17.20  ? 137 ARG A CZ  1 
ATOM   1117 N  NH1 . ARG A 1 138 ? -17.460 10.171  13.856 1.00 11.50  ? 137 ARG A NH1 1 
ATOM   1118 N  NH2 . ARG A 1 138 ? -19.558 9.658   14.658 1.00 13.53  ? 137 ARG A NH2 1 
ATOM   1119 N  N   . THR A 1 139 ? -16.942 2.954   11.547 1.00 14.43  ? 138 THR A N   1 
ATOM   1120 C  CA  . THR A 1 139 ? -16.269 2.639   10.287 1.00 15.88  ? 138 THR A CA  1 
ATOM   1121 C  C   . THR A 1 139 ? -16.401 3.782   9.266  1.00 3.33   ? 138 THR A C   1 
ATOM   1122 O  O   . THR A 1 139 ? -17.412 4.475   9.226  1.00 13.21  ? 138 THR A O   1 
ATOM   1123 C  CB  . THR A 1 139 ? -16.736 1.301   9.692  1.00 18.93  ? 138 THR A CB  1 
ATOM   1124 O  OG1 . THR A 1 139 ? -18.157 1.307   9.577  1.00 15.29  ? 138 THR A OG1 1 
ATOM   1125 C  CG2 . THR A 1 139 ? -16.313 0.133   10.584 1.00 12.60  ? 138 THR A CG2 1 
ATOM   1126 N  N   . VAL A 1 140 ? -15.352 3.955   8.471  1.00 9.92   ? 139 VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 140 ? -15.195 5.064   7.536  1.00 8.43   ? 139 VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 140 ? -14.854 4.480   6.148  1.00 16.13  ? 139 VAL A C   1 
ATOM   1129 O  O   . VAL A 1 140 ? -14.012 3.580   6.046  1.00 14.03  ? 139 VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 140 ? -14.036 6.002   7.966  1.00 10.77  ? 139 VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 140 ? -13.872 7.153   6.981  1.00 7.60   ? 139 VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 140 ? -14.246 6.554   9.400  1.00 11.60  ? 139 VAL A CG2 1 
ATOM   1133 N  N   . ASN A 1 141 ? -15.520 4.982   5.106  1.00 8.76   ? 140 ASN A N   1 
ATOM   1134 C  CA  . ASN A 1 141 ? -15.241 4.597   3.707  1.00 9.54   ? 140 ASN A CA  1 
ATOM   1135 C  C   . ASN A 1 141 ? -14.367 5.665   3.049  1.00 6.95   ? 140 ASN A C   1 
ATOM   1136 O  O   . ASN A 1 141 ? -14.822 6.778   2.796  1.00 14.06  ? 140 ASN A O   1 
ATOM   1137 C  CB  . ASN A 1 141 ? -16.556 4.403   2.927  1.00 8.67   ? 140 ASN A CB  1 
ATOM   1138 C  CG  . ASN A 1 141 ? -16.343 3.873   1.505  1.00 7.03   ? 140 ASN A CG  1 
ATOM   1139 O  OD1 . ASN A 1 141 ? -15.239 3.871   0.982  1.00 9.81   ? 140 ASN A OD1 1 
ATOM   1140 N  ND2 . ASN A 1 141 ? -17.423 3.422   0.881  1.00 8.89   ? 140 ASN A ND2 1 
ATOM   1141 N  N   . ILE A 1 142 ? -13.110 5.322   2.788  1.00 5.05   ? 141 ILE A N   1 
ATOM   1142 C  CA  . ILE A 1 142 ? -12.182 6.262   2.155  1.00 9.27   ? 141 ILE A CA  1 
ATOM   1143 C  C   . ILE A 1 142 ? -11.983 6.002   0.638  1.00 16.20  ? 141 ILE A C   1 
ATOM   1144 O  O   . ILE A 1 142 ? -11.206 6.698   -0.015 1.00 19.92  ? 141 ILE A O   1 
ATOM   1145 C  CB  . ILE A 1 142 ? -10.818 6.309   2.889  1.00 11.32  ? 141 ILE A CB  1 
ATOM   1146 C  CG1 . ILE A 1 142 ? -10.000 5.041   2.603  1.00 17.61  ? 141 ILE A CG1 1 
ATOM   1147 C  CG2 . ILE A 1 142 ? -11.035 6.534   4.407  1.00 11.78  ? 141 ILE A CG2 1 
ATOM   1148 C  CD1 . ILE A 1 142 ? -8.612  5.010   3.237  1.00 14.08  ? 141 ILE A CD1 1 
ATOM   1149 N  N   . GLY A 1 143 ? -12.714 5.032   0.090  1.00 14.76  ? 142 GLY A N   1 
ATOM   1150 C  CA  . GLY A 1 143 ? -12.590 4.662   -1.330 1.00 15.22  ? 142 GLY A CA  1 
ATOM   1151 C  C   . GLY A 1 143 ? -13.743 5.096   -2.226 1.00 11.94  ? 142 GLY A C   1 
ATOM   1152 O  O   . GLY A 1 143 ? -14.574 5.925   -1.842 1.00 14.00  ? 142 GLY A O   1 
ATOM   1153 N  N   . ASP A 1 144 ? -13.792 4.527   -3.430 1.00 17.09  ? 143 ASP A N   1 
ATOM   1154 C  CA  . ASP A 1 144 ? -14.750 4.947   -4.463 1.00 14.75  ? 143 ASP A CA  1 
ATOM   1155 C  C   . ASP A 1 144 ? -15.689 3.822   -4.863 1.00 19.90  ? 143 ASP A C   1 
ATOM   1156 O  O   . ASP A 1 144 ? -16.073 3.668   -6.029 1.00 12.33  ? 143 ASP A O   1 
ATOM   1157 C  CB  . ASP A 1 144 ? -13.986 5.497   -5.664 1.00 15.83  ? 143 ASP A CB  1 
ATOM   1158 C  CG  . ASP A 1 144 ? -13.030 6.598   -5.264 1.00 15.10  ? 143 ASP A CG  1 
ATOM   1159 O  OD1 . ASP A 1 144 ? -13.494 7.690   -4.908 1.00 14.79  ? 143 ASP A OD1 1 
ATOM   1160 O  OD2 . ASP A 1 144 ? -11.820 6.359   -5.285 1.00 18.97  ? 143 ASP A OD2 1 
ATOM   1161 N  N   . GLU A 1 145 ? -16.043 3.026   -3.864 1.00 11.84  ? 144 GLU A N   1 
ATOM   1162 C  CA  . GLU A 1 145 ? -17.002 1.939   -4.009 1.00 12.55  ? 144 GLU A CA  1 
ATOM   1163 C  C   . GLU A 1 145 ? -17.496 1.614   -2.602 1.00 17.89  ? 144 GLU A C   1 
ATOM   1164 O  O   . GLU A 1 145 ? -16.848 2.015   -1.623 1.00 11.04  ? 144 GLU A O   1 
ATOM   1165 C  CB  . GLU A 1 145 ? -16.354 0.718   -4.676 1.00 9.86   ? 144 GLU A CB  1 
ATOM   1166 C  CG  . GLU A 1 145 ? -15.268 0.022   -3.881 1.00 14.48  ? 144 GLU A CG  1 
ATOM   1167 C  CD  . GLU A 1 145 ? -14.687 -1.163  -4.628 1.00 16.23  ? 144 GLU A CD  1 
ATOM   1168 O  OE1 . GLU A 1 145 ? -15.151 -2.302  -4.401 1.00 17.57  ? 144 GLU A OE1 1 
ATOM   1169 O  OE2 . GLU A 1 145 ? -13.791 -0.947  -5.463 1.00 24.23  ? 144 GLU A OE2 1 
ATOM   1170 N  N   . PRO A 1 146 ? -18.649 0.925   -2.485 1.00 9.85   ? 145 PRO A N   1 
ATOM   1171 C  CA  . PRO A 1 146 ? -19.087 0.502   -1.144 1.00 17.38  ? 145 PRO A CA  1 
ATOM   1172 C  C   . PRO A 1 146 ? -18.012 -0.249  -0.340 1.00 15.95  ? 145 PRO A C   1 
ATOM   1173 O  O   . PRO A 1 146 ? -17.341 -1.141  -0.854 1.00 9.94   ? 145 PRO A O   1 
ATOM   1174 C  CB  . PRO A 1 146 ? -20.294 -0.393  -1.441 1.00 9.07   ? 145 PRO A CB  1 
ATOM   1175 C  CG  . PRO A 1 146 ? -20.865 0.198   -2.708 1.00 14.15  ? 145 PRO A CG  1 
ATOM   1176 C  CD  . PRO A 1 146 ? -19.629 0.535   -3.523 1.00 14.61  ? 145 PRO A CD  1 
ATOM   1177 N  N   . PHE A 1 147 ? -17.849 0.159   0.909  1.00 9.16   ? 146 PHE A N   1 
ATOM   1178 C  CA  . PHE A 1 147 ? -17.009 -0.529  1.873  1.00 10.40  ? 146 PHE A CA  1 
ATOM   1179 C  C   . PHE A 1 147 ? -17.926 -1.516  2.592  1.00 16.62  ? 146 PHE A C   1 
ATOM   1180 O  O   . PHE A 1 147 ? -18.886 -1.115  3.253  1.00 10.45  ? 146 PHE A O   1 
ATOM   1181 C  CB  . PHE A 1 147 ? -16.386 0.494   2.848  1.00 9.79   ? 146 PHE A CB  1 
ATOM   1182 C  CG  . PHE A 1 147 ? -15.535 -0.120  3.933  1.00 19.59  ? 146 PHE A CG  1 
ATOM   1183 C  CD1 . PHE A 1 147 ? -14.617 -1.125  3.642  1.00 12.01  ? 146 PHE A CD1 1 
ATOM   1184 C  CD2 . PHE A 1 147 ? -15.644 0.329   5.254  1.00 17.22  ? 146 PHE A CD2 1 
ATOM   1185 C  CE1 . PHE A 1 147 ? -13.821 -1.685  4.658  1.00 19.11  ? 146 PHE A CE1 1 
ATOM   1186 C  CE2 . PHE A 1 147 ? -14.855 -0.222  6.272  1.00 20.99  ? 146 PHE A CE2 1 
ATOM   1187 C  CZ  . PHE A 1 147 ? -13.950 -1.226  5.978  1.00 9.70   ? 146 PHE A CZ  1 
ATOM   1188 N  N   . ILE A 1 148 ? -17.646 -2.806  2.419  1.00 18.02  ? 147 ILE A N   1 
ATOM   1189 C  CA  . ILE A 1 148 ? -18.538 -3.859  2.875  1.00 19.25  ? 147 ILE A CA  1 
ATOM   1190 C  C   . ILE A 1 148 ? -17.817 -4.760  3.879  1.00 14.84  ? 147 ILE A C   1 
ATOM   1191 O  O   . ILE A 1 148 ? -16.716 -5.246  3.614  1.00 12.59  ? 147 ILE A O   1 
ATOM   1192 C  CB  . ILE A 1 148 ? -19.094 -4.700  1.683  1.00 16.83  ? 147 ILE A CB  1 
ATOM   1193 C  CG1 . ILE A 1 148 ? -19.723 -3.784  0.623  1.00 12.02  ? 147 ILE A CG1 1 
ATOM   1194 C  CG2 . ILE A 1 148 ? -20.099 -5.739  2.185  1.00 10.57  ? 147 ILE A CG2 1 
ATOM   1195 C  CD1 . ILE A 1 148 ? -20.255 -4.522  -0.626 1.00 12.24  ? 147 ILE A CD1 1 
ATOM   1196 N  N   . PHE A 1 149 ? -18.442 -4.962  5.036  1.00 12.70  ? 148 PHE A N   1 
ATOM   1197 C  CA  . PHE A 1 149 ? -17.846 -5.765  6.103  1.00 6.36   ? 148 PHE A CA  1 
ATOM   1198 C  C   . PHE A 1 149 ? -18.897 -6.550  6.872  1.00 14.81  ? 148 PHE A C   1 
ATOM   1199 O  O   . PHE A 1 149 ? -20.073 -6.218  6.848  1.00 13.19  ? 148 PHE A O   1 
ATOM   1200 C  CB  . PHE A 1 149 ? -17.027 -4.891  7.066  1.00 10.55  ? 148 PHE A CB  1 
ATOM   1201 C  CG  . PHE A 1 149 ? -17.797 -3.737  7.659  1.00 17.59  ? 148 PHE A CG  1 
ATOM   1202 C  CD1 . PHE A 1 149 ? -17.745 -2.481  7.070  1.00 11.40  ? 148 PHE A CD1 1 
ATOM   1203 C  CD2 . PHE A 1 149 ? -18.561 -3.909  8.811  1.00 16.57  ? 148 PHE A CD2 1 
ATOM   1204 C  CE1 . PHE A 1 149 ? -18.437 -1.413  7.602  1.00 18.50  ? 148 PHE A CE1 1 
ATOM   1205 C  CE2 . PHE A 1 149 ? -19.263 -2.842  9.354  1.00 10.64  ? 148 PHE A CE2 1 
ATOM   1206 C  CZ  . PHE A 1 149 ? -19.193 -1.592  8.754  1.00 15.88  ? 148 PHE A CZ  1 
ATOM   1207 N  N   . LEU A 1 150 ? -18.450 -7.604  7.539  1.00 12.91  ? 149 LEU A N   1 
ATOM   1208 C  CA  . LEU A 1 150 ? -19.300 -8.388  8.402  1.00 7.73   ? 149 LEU A CA  1 
ATOM   1209 C  C   . LEU A 1 150 ? -18.805 -8.227  9.842  1.00 14.16  ? 149 LEU A C   1 
ATOM   1210 O  O   . LEU A 1 150 ? -17.608 -8.344  10.114 1.00 13.93  ? 149 LEU A O   1 
ATOM   1211 C  CB  . LEU A 1 150 ? -19.266 -9.856  7.974  1.00 6.88   ? 149 LEU A CB  1 
ATOM   1212 C  CG  . LEU A 1 150 ? -19.858 -10.919 8.908  1.00 16.54  ? 149 LEU A CG  1 
ATOM   1213 C  CD1 . LEU A 1 150 ? -21.382 -11.041 8.787  1.00 6.46   ? 149 LEU A CD1 1 
ATOM   1214 C  CD2 . LEU A 1 150 ? -19.202 -12.231 8.597  1.00 15.15  ? 149 LEU A CD2 1 
ATOM   1215 N  N   . ALA A 1 151 ? -19.737 -7.948  10.747 1.00 11.03  ? 150 ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 151 ? -19.438 -7.738  12.166 1.00 12.29  ? 150 ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 151 ? -20.095 -8.813  13.015 1.00 13.88  ? 150 ALA A C   1 
ATOM   1218 O  O   . ALA A 1 151 ? -21.262 -9.154  12.795 1.00 11.06  ? 150 ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 151 ? -19.913 -6.349  12.599 1.00 10.63  ? 150 ALA A CB  1 
ATOM   1220 N  N   . ILE A 1 152 ? -19.342 -9.359  13.969 1.00 13.74  ? 151 ILE A N   1 
ATOM   1221 C  CA  . ILE A 1 152 ? -19.860 -10.370 14.904 1.00 11.31  ? 151 ILE A CA  1 
ATOM   1222 C  C   . ILE A 1 152 ? -19.689 -9.822  16.321 1.00 16.88  ? 151 ILE A C   1 
ATOM   1223 O  O   . ILE A 1 152 ? -18.588 -9.440  16.711 1.00 4.89   ? 151 ILE A O   1 
ATOM   1224 C  CB  . ILE A 1 152 ? -19.157 -11.756 14.740 1.00 11.81  ? 151 ILE A CB  1 
ATOM   1225 C  CG1 . ILE A 1 152 ? -19.493 -12.385 13.385 1.00 13.69  ? 151 ILE A CG1 1 
ATOM   1226 C  CG2 . ILE A 1 152 ? -19.565 -12.733 15.844 1.00 7.18   ? 151 ILE A CG2 1 
ATOM   1227 C  CD1 . ILE A 1 152 ? -18.447 -12.137 12.303 1.00 20.92  ? 151 ILE A CD1 1 
ATOM   1228 N  N   . TYR A 1 153 ? -20.787 -9.759  17.069 1.00 9.44   ? 152 TYR A N   1 
ATOM   1229 C  CA  . TYR A 1 153 ? -20.819 -9.125  18.402 1.00 8.37   ? 152 TYR A CA  1 
ATOM   1230 C  C   . TYR A 1 153 ? -21.726 -9.905  19.371 1.00 17.94  ? 152 TYR A C   1 
ATOM   1231 O  O   . TYR A 1 153 ? -22.655 -10.598 18.935 1.00 12.16  ? 152 TYR A O   1 
ATOM   1232 C  CB  . TYR A 1 153 ? -21.288 -7.658  18.297 1.00 17.19  ? 152 TYR A CB  1 
ATOM   1233 C  CG  . TYR A 1 153 ? -22.538 -7.427  17.455 1.00 22.37  ? 152 TYR A CG  1 
ATOM   1234 C  CD1 . TYR A 1 153 ? -22.476 -7.476  16.060 1.00 18.61  ? 152 TYR A CD1 1 
ATOM   1235 C  CD2 . TYR A 1 153 ? -23.772 -7.127  18.052 1.00 23.45  ? 152 TYR A CD2 1 
ATOM   1236 C  CE1 . TYR A 1 153 ? -23.601 -7.261  15.271 1.00 20.97  ? 152 TYR A CE1 1 
ATOM   1237 C  CE2 . TYR A 1 153 ? -24.922 -6.895  17.267 1.00 15.81  ? 152 TYR A CE2 1 
ATOM   1238 C  CZ  . TYR A 1 153 ? -24.817 -6.975  15.872 1.00 23.58  ? 152 TYR A CZ  1 
ATOM   1239 O  OH  . TYR A 1 153 ? -25.906 -6.771  15.064 1.00 21.89  ? 152 TYR A OH  1 
ATOM   1240 N  N   . PRO A 1 154 ? -21.464 -9.795  20.689 1.00 17.58  ? 153 PRO A N   1 
ATOM   1241 C  CA  . PRO A 1 154 ? -22.360 -10.425 21.668 1.00 10.77  ? 153 PRO A CA  1 
ATOM   1242 C  C   . PRO A 1 154 ? -23.814 -9.955  21.558 1.00 5.09   ? 153 PRO A C   1 
ATOM   1243 O  O   . PRO A 1 154 ? -24.081 -8.758  21.425 1.00 13.00  ? 153 PRO A O   1 
ATOM   1244 C  CB  . PRO A 1 154 ? -21.756 -10.003 23.014 1.00 11.55  ? 153 PRO A CB  1 
ATOM   1245 C  CG  . PRO A 1 154 ? -20.275 -9.759  22.679 1.00 9.74   ? 153 PRO A CG  1 
ATOM   1246 C  CD  . PRO A 1 154 ? -20.325 -9.115  21.339 1.00 8.77   ? 153 PRO A CD  1 
ATOM   1247 N  N   . ALA A 1 155 ? -24.738 -10.905 21.615 1.00 11.84  ? 154 ALA A N   1 
ATOM   1248 C  CA  . ALA A 1 155 ? -26.170 -10.627 21.552 1.00 9.81   ? 154 ALA A CA  1 
ATOM   1249 C  C   . ALA A 1 155 ? -26.640 -9.621  22.614 1.00 11.30  ? 154 ALA A C   1 
ATOM   1250 O  O   . ALA A 1 155 ? -27.640 -8.938  22.411 1.00 18.85  ? 154 ALA A O   1 
ATOM   1251 C  CB  . ALA A 1 155 ? -26.962 -11.941 21.664 1.00 7.59   ? 154 ALA A CB  1 
ATOM   1252 N  N   . ASP A 1 156 ? -25.921 -9.542  23.737 1.00 17.45  ? 155 ASP A N   1 
ATOM   1253 C  CA  . ASP A 1 156 ? -26.271 -8.635  24.841 1.00 20.87  ? 155 ASP A CA  1 
ATOM   1254 C  C   . ASP A 1 156 ? -25.407 -7.359  24.897 1.00 23.01  ? 155 ASP A C   1 
ATOM   1255 O  O   . ASP A 1 156 ? -25.465 -6.609  25.866 1.00 15.02  ? 155 ASP A O   1 
ATOM   1256 C  CB  . ASP A 1 156 ? -26.274 -9.386  26.200 1.00 14.68  ? 155 ASP A CB  1 
ATOM   1257 C  CG  . ASP A 1 156 ? -24.856 -9.755  26.707 1.00 20.48  ? 155 ASP A CG  1 
ATOM   1258 O  OD1 . ASP A 1 156 ? -23.879 -9.729  25.930 1.00 15.54  ? 155 ASP A OD1 1 
ATOM   1259 O  OD2 . ASP A 1 156 ? -24.719 -10.089 27.909 1.00 25.27  ? 155 ASP A OD2 1 
ATOM   1260 N  N   . ALA A 1 157 ? -24.623 -7.094  23.854 1.00 5.34   ? 156 ALA A N   1 
ATOM   1261 C  CA  . ALA A 1 157 ? -23.744 -5.918  23.864 1.00 10.32  ? 156 ALA A CA  1 
ATOM   1262 C  C   . ALA A 1 157 ? -24.550 -4.625  23.841 1.00 14.99  ? 156 ALA A C   1 
ATOM   1263 O  O   . ALA A 1 157 ? -24.241 -3.652  24.556 1.00 11.14  ? 156 ALA A O   1 
ATOM   1264 C  CB  . ALA A 1 157 ? -22.735 -5.964  22.696 1.00 2.17   ? 156 ALA A CB  1 
ATOM   1265 N  N   . GLY A 1 158 ? -25.607 -4.630  23.040 1.00 19.10  ? 157 GLY A N   1 
ATOM   1266 C  CA  . GLY A 1 158 ? -26.428 -3.456  22.858 1.00 10.88  ? 157 GLY A CA  1 
ATOM   1267 C  C   . GLY A 1 158 ? -25.665 -2.326  22.203 1.00 26.43  ? 157 GLY A C   1 
ATOM   1268 O  O   . GLY A 1 158 ? -24.494 -2.476  21.814 1.00 18.14  ? 157 GLY A O   1 
ATOM   1269 N  N   . HIS A 1 159 ? -26.338 -1.186  22.093 1.00 15.31  ? 158 HIS A N   1 
ATOM   1270 C  CA  . HIS A 1 159 ? -25.781 -0.006  21.444 1.00 31.01  ? 158 HIS A CA  1 
ATOM   1271 C  C   . HIS A 1 159 ? -26.000 1.210   22.333 1.00 25.82  ? 158 HIS A C   1 
ATOM   1272 O  O   . HIS A 1 159 ? -27.095 1.430   22.851 1.00 28.77  ? 158 HIS A O   1 
ATOM   1273 C  CB  . HIS A 1 159 ? -26.436 0.234   20.075 1.00 20.50  ? 158 HIS A CB  1 
ATOM   1274 C  CG  . HIS A 1 159 ? -26.204 -0.864  19.081 1.00 26.78  ? 158 HIS A CG  1 
ATOM   1275 N  ND1 . HIS A 1 159 ? -26.938 -2.031  19.075 1.00 29.61  ? 158 HIS A ND1 1 
ATOM   1276 C  CD2 . HIS A 1 159 ? -25.322 -0.970  18.058 1.00 25.94  ? 158 HIS A CD2 1 
ATOM   1277 C  CE1 . HIS A 1 159 ? -26.514 -2.813  18.097 1.00 32.06  ? 158 HIS A CE1 1 
ATOM   1278 N  NE2 . HIS A 1 159 ? -25.536 -2.191  17.462 1.00 25.29  ? 158 HIS A NE2 1 
ATOM   1279 N  N   . ASP A 1 160 ? -24.938 1.985   22.507 1.00 18.10  ? 159 ASP A N   1 
ATOM   1280 C  CA  . ASP A 1 160 ? -24.978 3.247   23.231 1.00 18.77  ? 159 ASP A CA  1 
ATOM   1281 C  C   . ASP A 1 160 ? -24.484 4.347   22.272 1.00 22.19  ? 159 ASP A C   1 
ATOM   1282 O  O   . ASP A 1 160 ? -23.276 4.549   22.121 1.00 14.86  ? 159 ASP A O   1 
ATOM   1283 C  CB  . ASP A 1 160 ? -24.113 3.128   24.501 1.00 25.99  ? 159 ASP A CB  1 
ATOM   1284 C  CG  . ASP A 1 160 ? -24.096 4.399   25.354 1.00 32.75  ? 159 ASP A CG  1 
ATOM   1285 O  OD1 . ASP A 1 160 ? -23.344 4.411   26.346 1.00 39.57  ? 159 ASP A OD1 1 
ATOM   1286 O  OD2 . ASP A 1 160 ? -24.806 5.380   25.051 1.00 41.31  ? 159 ASP A OD2 1 
ATOM   1287 N  N   . TYR A 1 161 ? -25.437 5.029   21.624 1.00 17.59  ? 160 TYR A N   1 
ATOM   1288 C  CA  . TYR A 1 161 ? -25.178 6.074   20.608 1.00 23.42  ? 160 TYR A CA  1 
ATOM   1289 C  C   . TYR A 1 161 ? -24.999 7.507   21.116 1.00 20.94  ? 160 TYR A C   1 
ATOM   1290 O  O   . TYR A 1 161 ? -24.405 8.337   20.417 1.00 21.58  ? 160 TYR A O   1 
ATOM   1291 C  CB  . TYR A 1 161 ? -26.314 6.101   19.571 1.00 15.17  ? 160 TYR A CB  1 
ATOM   1292 C  CG  . TYR A 1 161 ? -26.398 4.866   18.704 1.00 17.97  ? 160 TYR A CG  1 
ATOM   1293 C  CD1 . TYR A 1 161 ? -27.358 3.894   18.953 1.00 21.86  ? 160 TYR A CD1 1 
ATOM   1294 C  CD2 . TYR A 1 161 ? -25.513 4.672   17.635 1.00 16.55  ? 160 TYR A CD2 1 
ATOM   1295 C  CE1 . TYR A 1 161 ? -27.442 2.758   18.174 1.00 20.67  ? 160 TYR A CE1 1 
ATOM   1296 C  CE2 . TYR A 1 161 ? -25.586 3.530   16.845 1.00 14.33  ? 160 TYR A CE2 1 
ATOM   1297 C  CZ  . TYR A 1 161 ? -26.553 2.577   17.125 1.00 17.61  ? 160 TYR A CZ  1 
ATOM   1298 O  OH  . TYR A 1 161 ? -26.648 1.439   16.358 1.00 15.51  ? 160 TYR A OH  1 
ATOM   1299 N  N   . GLY A 1 162 ? -25.521 7.795   22.311 1.00 27.83  ? 161 GLY A N   1 
ATOM   1300 C  CA  . GLY A 1 162 ? -25.697 9.171   22.812 1.00 14.37  ? 161 GLY A CA  1 
ATOM   1301 C  C   . GLY A 1 162 ? -24.472 10.058  22.991 1.00 26.61  ? 161 GLY A C   1 
ATOM   1302 O  O   . GLY A 1 162 ? -24.452 11.200  22.508 1.00 18.99  ? 161 GLY A O   1 
ATOM   1303 N  N   . THR A 1 163 ? -23.467 9.551   23.703 1.00 18.72  ? 162 THR A N   1 
ATOM   1304 C  CA  . THR A 1 163 ? -22.174 10.241  23.853 1.00 29.71  ? 162 THR A CA  1 
ATOM   1305 C  C   . THR A 1 163 ? -21.563 10.654  22.498 1.00 24.02  ? 162 THR A C   1 
ATOM   1306 O  O   . THR A 1 163 ? -21.131 11.799  22.324 1.00 21.33  ? 162 THR A O   1 
ATOM   1307 C  CB  . THR A 1 163 ? -21.156 9.352   24.609 1.00 29.51  ? 162 THR A CB  1 
ATOM   1308 O  OG1 . THR A 1 163 ? -21.741 8.890   25.833 1.00 57.97  ? 162 THR A OG1 1 
ATOM   1309 C  CG2 . THR A 1 163 ? -19.875 10.119  24.916 1.00 45.45  ? 162 THR A CG2 1 
ATOM   1310 N  N   . ILE A 1 164 ? -21.524 9.707   21.559 1.00 16.34  ? 163 ILE A N   1 
ATOM   1311 C  CA  . ILE A 1 164 ? -20.941 9.925   20.230 1.00 16.43  ? 163 ILE A CA  1 
ATOM   1312 C  C   . ILE A 1 164 ? -21.786 10.913  19.425 1.00 15.80  ? 163 ILE A C   1 
ATOM   1313 O  O   . ILE A 1 164 ? -21.248 11.785  18.742 1.00 25.09  ? 163 ILE A O   1 
ATOM   1314 C  CB  . ILE A 1 164 ? -20.790 8.581   19.442 1.00 20.69  ? 163 ILE A CB  1 
ATOM   1315 C  CG1 . ILE A 1 164 ? -19.907 7.564   20.199 1.00 26.95  ? 163 ILE A CG1 1 
ATOM   1316 C  CG2 . ILE A 1 164 ? -20.294 8.823   18.009 1.00 10.77  ? 163 ILE A CG2 1 
ATOM   1317 C  CD1 . ILE A 1 164 ? -18.504 8.066   20.595 1.00 27.41  ? 163 ILE A CD1 1 
ATOM   1318 N  N   . ALA A 1 165 ? -23.112 10.784  19.524 1.00 19.97  ? 164 ALA A N   1 
ATOM   1319 C  CA  . ALA A 1 165 ? -24.044 11.674  18.812 1.00 19.05  ? 164 ALA A CA  1 
ATOM   1320 C  C   . ALA A 1 165 ? -23.841 13.148  19.178 1.00 24.34  ? 164 ALA A C   1 
ATOM   1321 O  O   . ALA A 1 165 ? -24.024 14.030  18.339 1.00 26.76  ? 164 ALA A O   1 
ATOM   1322 C  CB  . ALA A 1 165 ? -25.492 11.250  19.064 1.00 18.43  ? 164 ALA A CB  1 
ATOM   1323 N  N   . GLU A 1 166 ? -23.448 13.393  20.428 1.00 20.58  ? 165 GLU A N   1 
ATOM   1324 C  CA  . GLU A 1 166 ? -23.233 14.746  20.951 1.00 32.03  ? 165 GLU A CA  1 
ATOM   1325 C  C   . GLU A 1 166 ? -21.827 15.315  20.707 1.00 23.47  ? 165 GLU A C   1 
ATOM   1326 O  O   . GLU A 1 166 ? -21.692 16.485  20.328 1.00 35.37  ? 165 GLU A O   1 
ATOM   1327 C  CB  . GLU A 1 166 ? -23.563 14.795  22.449 1.00 41.22  ? 165 GLU A CB  1 
ATOM   1328 C  CG  . GLU A 1 166 ? -25.054 14.896  22.763 1.00 70.14  ? 165 GLU A CG  1 
ATOM   1329 C  CD  . GLU A 1 166 ? -25.397 14.482  24.193 1.00 80.10  ? 165 GLU A CD  1 
ATOM   1330 O  OE1 . GLU A 1 166 ? -26.565 14.105  24.439 1.00 86.45  ? 165 GLU A OE1 1 
ATOM   1331 O  OE2 . GLU A 1 166 ? -24.508 14.530  25.072 1.00 88.95  ? 165 GLU A OE2 1 
ATOM   1332 N  N   . LYS A 1 167 ? -20.792 14.499  20.917 1.00 28.60  ? 166 LYS A N   1 
ATOM   1333 C  CA  . LYS A 1 167 ? -19.399 14.987  20.877 1.00 38.16  ? 166 LYS A CA  1 
ATOM   1334 C  C   . LYS A 1 167 ? -18.580 14.459  19.701 1.00 28.16  ? 166 LYS A C   1 
ATOM   1335 O  O   . LYS A 1 167 ? -17.559 15.053  19.332 1.00 26.34  ? 166 LYS A O   1 
ATOM   1336 C  CB  . LYS A 1 167 ? -18.654 14.654  22.176 1.00 41.69  ? 166 LYS A CB  1 
ATOM   1337 C  CG  . LYS A 1 167 ? -19.356 15.059  23.456 1.00 62.41  ? 166 LYS A CG  1 
ATOM   1338 C  CD  . LYS A 1 167 ? -18.509 14.690  24.664 1.00 70.70  ? 166 LYS A CD  1 
ATOM   1339 C  CE  . LYS A 1 167 ? -19.375 14.410  25.876 1.00 82.16  ? 166 LYS A CE  1 
ATOM   1340 N  NZ  . LYS A 1 167 ? -18.561 14.068  27.071 1.00 86.99  ? 166 LYS A NZ  1 
ATOM   1341 N  N   . GLY A 1 168 ? -19.018 13.341  19.129 1.00 28.66  ? 167 GLY A N   1 
ATOM   1342 C  CA  . GLY A 1 168 ? -18.309 12.705  18.016 1.00 16.06  ? 167 GLY A CA  1 
ATOM   1343 C  C   . GLY A 1 168 ? -17.030 12.011  18.459 1.00 23.36  ? 167 GLY A C   1 
ATOM   1344 O  O   . GLY A 1 168 ? -16.874 11.646  19.624 1.00 21.26  ? 167 GLY A O   1 
ATOM   1345 N  N   . PHE A 1 169 ? -16.121 11.801  17.516 1.00 12.04  ? 168 PHE A N   1 
ATOM   1346 C  CA  . PHE A 1 169 ? -14.847 11.183  17.817 1.00 14.02  ? 168 PHE A CA  1 
ATOM   1347 C  C   . PHE A 1 169 ? -13.797 12.292  17.890 1.00 22.11  ? 168 PHE A C   1 
ATOM   1348 O  O   . PHE A 1 169 ? -13.966 13.350  17.277 1.00 18.04  ? 168 PHE A O   1 
ATOM   1349 C  CB  . PHE A 1 169 ? -14.487 10.115  16.759 1.00 15.64  ? 168 PHE A CB  1 
ATOM   1350 C  CG  . PHE A 1 169 ? -15.097 8.749   17.015 1.00 23.84  ? 168 PHE A CG  1 
ATOM   1351 C  CD1 . PHE A 1 169 ? -16.468 8.528   16.843 1.00 8.15   ? 168 PHE A CD1 1 
ATOM   1352 C  CD2 . PHE A 1 169 ? -14.292 7.673   17.394 1.00 8.11   ? 168 PHE A CD2 1 
ATOM   1353 C  CE1 . PHE A 1 169 ? -17.031 7.269   17.075 1.00 12.82  ? 168 PHE A CE1 1 
ATOM   1354 C  CE2 . PHE A 1 169 ? -14.849 6.405   17.622 1.00 9.30   ? 168 PHE A CE2 1 
ATOM   1355 C  CZ  . PHE A 1 169 ? -16.230 6.210   17.465 1.00 11.28  ? 168 PHE A CZ  1 
ATOM   1356 N  N   . SER A 1 170 ? -12.735 12.062  18.659 1.00 14.36  ? 169 SER A N   1 
ATOM   1357 C  CA  . SER A 1 170 ? -11.666 13.046  18.815 1.00 22.24  ? 169 SER A CA  1 
ATOM   1358 C  C   . SER A 1 170 ? -10.792 13.167  17.562 1.00 18.90  ? 169 SER A C   1 
ATOM   1359 O  O   . SER A 1 170 ? -9.999  14.091  17.454 1.00 12.13  ? 169 SER A O   1 
ATOM   1360 C  CB  . SER A 1 170 ? -10.805 12.726  20.045 1.00 17.54  ? 169 SER A CB  1 
ATOM   1361 O  OG  . SER A 1 170 ? -10.099 11.507  19.882 1.00 16.54  ? 169 SER A OG  1 
ATOM   1362 N  N   . LYS A 1 171 ? -10.931 12.222  16.632 1.00 16.86  ? 170 LYS A N   1 
ATOM   1363 C  CA  . LYS A 1 171 ? -10.264 12.290  15.327 1.00 14.82  ? 170 LYS A CA  1 
ATOM   1364 C  C   . LYS A 1 171 ? -11.299 12.229  14.214 1.00 21.22  ? 170 LYS A C   1 
ATOM   1365 O  O   . LYS A 1 171 ? -12.305 11.530  14.344 1.00 17.88  ? 170 LYS A O   1 
ATOM   1366 C  CB  . LYS A 1 171 ? -9.257  11.145  15.152 1.00 14.25  ? 170 LYS A CB  1 
ATOM   1367 C  CG  . LYS A 1 171 ? -8.135  11.120  16.180 1.00 21.75  ? 170 LYS A CG  1 
ATOM   1368 C  CD  . LYS A 1 171 ? -7.022  12.074  15.832 1.00 39.12  ? 170 LYS A CD  1 
ATOM   1369 C  CE  . LYS A 1 171 ? -5.854  11.912  16.787 1.00 50.21  ? 170 LYS A CE  1 
ATOM   1370 N  NZ  . LYS A 1 171 ? -4.690  12.715  16.320 1.00 50.48  ? 170 LYS A NZ  1 
ATOM   1371 N  N   . ILE A 1 172 ? -11.055 12.979  13.139 1.00 21.80  ? 171 ILE A N   1 
ATOM   1372 C  CA  . ILE A 1 172 ? -11.883 12.915  11.921 1.00 11.78  ? 171 ILE A CA  1 
ATOM   1373 C  C   . ILE A 1 172 ? -11.070 12.397  10.743 1.00 18.78  ? 171 ILE A C   1 
ATOM   1374 O  O   . ILE A 1 172 ? -9.834  12.479  10.743 1.00 12.25  ? 171 ILE A O   1 
ATOM   1375 C  CB  . ILE A 1 172 ? -12.583 14.276  11.562 1.00 18.64  ? 171 ILE A CB  1 
ATOM   1376 C  CG1 . ILE A 1 172 ? -11.558 15.395  11.343 1.00 13.31  ? 171 ILE A CG1 1 
ATOM   1377 C  CG2 . ILE A 1 172 ? -13.631 14.653  12.630 1.00 8.94   ? 171 ILE A CG2 1 
ATOM   1378 C  CD1 . ILE A 1 172 ? -12.103 16.644  10.657 1.00 16.24  ? 171 ILE A CD1 1 
ATOM   1379 N  N   . VAL A 1 173 ? -11.759 11.846  9.747  1.00 11.47  ? 172 VAL A N   1 
ATOM   1380 C  CA  . VAL A 1 173 ? -11.082 11.309  8.557  1.00 13.10  ? 172 VAL A CA  1 
ATOM   1381 C  C   . VAL A 1 173 ? -11.576 12.100  7.345  1.00 11.88  ? 172 VAL A C   1 
ATOM   1382 O  O   . VAL A 1 173 ? -12.762 12.079  7.013  1.00 14.17  ? 172 VAL A O   1 
ATOM   1383 C  CB  . VAL A 1 173 ? -11.308 9.770   8.365  1.00 14.77  ? 172 VAL A CB  1 
ATOM   1384 C  CG1 . VAL A 1 173 ? -10.434 9.211   7.226  1.00 11.02  ? 172 VAL A CG1 1 
ATOM   1385 C  CG2 . VAL A 1 173 ? -11.044 8.995   9.658  1.00 14.48  ? 172 VAL A CG2 1 
ATOM   1386 N  N   . ILE A 1 174 ? -10.652 12.795  6.693  1.00 19.57  ? 173 ILE A N   1 
ATOM   1387 C  CA  . ILE A 1 174 ? -10.997 13.754  5.644  1.00 18.64  ? 173 ILE A CA  1 
ATOM   1388 C  C   . ILE A 1 174 ? -10.143 13.569  4.396  1.00 12.76  ? 173 ILE A C   1 
ATOM   1389 O  O   . ILE A 1 174 ? -9.112  12.888  4.432  1.00 18.20  ? 173 ILE A O   1 
ATOM   1390 C  CB  . ILE A 1 174 ? -10.831 15.227  6.136  1.00 21.28  ? 173 ILE A CB  1 
ATOM   1391 C  CG1 . ILE A 1 174 ? -9.365  15.532  6.507  1.00 16.21  ? 173 ILE A CG1 1 
ATOM   1392 C  CG2 . ILE A 1 174 ? -11.784 15.529  7.281  1.00 18.11  ? 173 ILE A CG2 1 
ATOM   1393 C  CD1 . ILE A 1 174 ? -9.030  17.029  6.637  1.00 12.69  ? 173 ILE A CD1 1 
ATOM   1394 N  N   . GLU A 1 175 ? -10.579 14.165  3.286  1.00 17.31  ? 174 GLU A N   1 
ATOM   1395 C  CA  . GLU A 1 175 ? -9.695  14.313  2.139  1.00 21.19  ? 174 GLU A CA  1 
ATOM   1396 C  C   . GLU A 1 175 ? -9.268  15.766  2.012  1.00 20.63  ? 174 GLU A C   1 
ATOM   1397 O  O   . GLU A 1 175 ? -10.103 16.671  1.967  1.00 18.43  ? 174 GLU A O   1 
ATOM   1398 C  CB  . GLU A 1 175 ? -10.314 13.811  0.826  1.00 22.25  ? 174 GLU A CB  1 
ATOM   1399 C  CG  . GLU A 1 175 ? -9.240  13.568  -0.240 1.00 32.30  ? 174 GLU A CG  1 
ATOM   1400 C  CD  . GLU A 1 175 ? -9.764  12.995  -1.545 1.00 43.18  ? 174 GLU A CD  1 
ATOM   1401 O  OE1 . GLU A 1 175 ? -10.794 12.291  -1.546 1.00 38.95  ? 174 GLU A OE1 1 
ATOM   1402 O  OE2 . GLU A 1 175 ? -9.115  13.232  -2.582 1.00 39.21  ? 174 GLU A OE2 1 
ATOM   1403 N  N   . GLU A 1 176 ? -7.955  15.970  1.970  1.00 20.72  ? 175 GLU A N   1 
ATOM   1404 C  CA  . GLU A 1 176 ? -7.367  17.292  1.832  1.00 26.73  ? 175 GLU A CA  1 
ATOM   1405 C  C   . GLU A 1 176 ? -6.207  17.165  0.849  1.00 25.63  ? 175 GLU A C   1 
ATOM   1406 O  O   . GLU A 1 176 ? -5.344  16.298  1.019  1.00 34.02  ? 175 GLU A O   1 
ATOM   1407 C  CB  . GLU A 1 176 ? -6.861  17.768  3.191  1.00 26.83  ? 175 GLU A CB  1 
ATOM   1408 C  CG  . GLU A 1 176 ? -7.171  19.207  3.534  1.00 33.82  ? 175 GLU A CG  1 
ATOM   1409 C  CD  . GLU A 1 176 ? -6.725  19.561  4.940  1.00 28.06  ? 175 GLU A CD  1 
ATOM   1410 O  OE1 . GLU A 1 176 ? -5.563  19.252  5.292  1.00 26.66  ? 175 GLU A OE1 1 
ATOM   1411 O  OE2 . GLU A 1 176 ? -7.536  20.135  5.698  1.00 36.70  ? 175 GLU A OE2 1 
ATOM   1412 N  N   . ASN A 1 177 ? -6.207  18.010  -0.184 1.00 39.84  ? 176 ASN A N   1 
ATOM   1413 C  CA  . ASN A 1 177 ? -5.158  18.017  -1.224 1.00 40.68  ? 176 ASN A CA  1 
ATOM   1414 C  C   . ASN A 1 177 ? -4.992  16.680  -1.963 1.00 30.04  ? 176 ASN A C   1 
ATOM   1415 O  O   . ASN A 1 177 ? -3.869  16.252  -2.236 1.00 39.69  ? 176 ASN A O   1 
ATOM   1416 C  CB  . ASN A 1 177 ? -3.801  18.480  -0.655 1.00 47.83  ? 176 ASN A CB  1 
ATOM   1417 C  CG  . ASN A 1 177 ? -3.918  19.696  0.263  1.00 61.37  ? 176 ASN A CG  1 
ATOM   1418 O  OD1 . ASN A 1 177 ? -3.415  19.680  1.388  1.00 58.94  ? 176 ASN A OD1 1 
ATOM   1419 N  ND2 . ASN A 1 177 ? -4.581  20.749  -0.210 1.00 52.55  ? 176 ASN A ND2 1 
ATOM   1420 N  N   . GLY A 1 178 ? -6.111  16.025  -2.278 1.00 35.83  ? 177 GLY A N   1 
ATOM   1421 C  CA  . GLY A 1 178 ? -6.101  14.715  -2.951 1.00 32.13  ? 177 GLY A CA  1 
ATOM   1422 C  C   . GLY A 1 178 ? -5.542  13.578  -2.108 1.00 41.62  ? 177 GLY A C   1 
ATOM   1423 O  O   . GLY A 1 178 ? -5.038  12.581  -2.640 1.00 32.52  ? 177 GLY A O   1 
ATOM   1424 N  N   . GLU A 1 179 ? -5.663  13.722  -0.789 1.00 29.08  ? 178 GLU A N   1 
ATOM   1425 C  CA  . GLU A 1 179 ? -4.995  12.851  0.168  1.00 28.96  ? 178 GLU A CA  1 
ATOM   1426 C  C   . GLU A 1 179 ? -5.920  12.536  1.350  1.00 16.55  ? 178 GLU A C   1 
ATOM   1427 O  O   . GLU A 1 179 ? -6.556  13.435  1.891  1.00 17.42  ? 178 GLU A O   1 
ATOM   1428 C  CB  . GLU A 1 179 ? -3.744  13.580  0.658  1.00 33.99  ? 178 GLU A CB  1 
ATOM   1429 C  CG  . GLU A 1 179 ? -2.737  12.773  1.429  1.00 57.30  ? 178 GLU A CG  1 
ATOM   1430 C  CD  . GLU A 1 179 ? -1.497  13.592  1.746  1.00 61.59  ? 178 GLU A CD  1 
ATOM   1431 O  OE1 . GLU A 1 179 ? -1.263  13.880  2.939  1.00 72.85  ? 178 GLU A OE1 1 
ATOM   1432 O  OE2 . GLU A 1 179 ? -0.768  13.966  0.801  1.00 62.71  ? 178 GLU A OE2 1 
ATOM   1433 N  N   . VAL A 1 180 ? -5.970  11.266  1.751  1.00 19.68  ? 179 VAL A N   1 
ATOM   1434 C  CA  . VAL A 1 180 ? -6.683  10.842  2.954  1.00 18.95  ? 179 VAL A CA  1 
ATOM   1435 C  C   . VAL A 1 180 ? -5.872  11.203  4.206  1.00 19.12  ? 179 VAL A C   1 
ATOM   1436 O  O   . VAL A 1 180 ? -4.706  10.824  4.331  1.00 23.20  ? 179 VAL A O   1 
ATOM   1437 C  CB  . VAL A 1 180 ? -6.998  9.315   2.925  1.00 25.54  ? 179 VAL A CB  1 
ATOM   1438 C  CG1 . VAL A 1 180 ? -7.692  8.872   4.215  1.00 19.77  ? 179 VAL A CG1 1 
ATOM   1439 C  CG2 . VAL A 1 180 ? -7.846  8.963   1.708  1.00 15.02  ? 179 VAL A CG2 1 
ATOM   1440 N  N   . LYS A 1 181 ? -6.497  11.946  5.118  1.00 17.71  ? 180 LYS A N   1 
ATOM   1441 C  CA  . LYS A 1 181 ? -5.857  12.366  6.367  1.00 15.22  ? 180 LYS A CA  1 
ATOM   1442 C  C   . LYS A 1 181 ? -6.716  12.048  7.582  1.00 25.16  ? 180 LYS A C   1 
ATOM   1443 O  O   . LYS A 1 181 ? -7.908  12.357  7.601  1.00 18.38  ? 180 LYS A O   1 
ATOM   1444 C  CB  . LYS A 1 181 ? -5.568  13.871  6.351  1.00 20.47  ? 180 LYS A CB  1 
ATOM   1445 C  CG  . LYS A 1 181 ? -4.596  14.346  5.278  1.00 19.48  ? 180 LYS A CG  1 
ATOM   1446 C  CD  . LYS A 1 181 ? -4.251  15.810  5.500  1.00 26.00  ? 180 LYS A CD  1 
ATOM   1447 C  CE  . LYS A 1 181 ? -3.423  16.387  4.353  1.00 25.21  ? 180 LYS A CE  1 
ATOM   1448 N  NZ  . LYS A 1 181 ? -3.360  17.875  4.445  1.00 21.40  ? 180 LYS A NZ  1 
ATOM   1449 N  N   . VAL A 1 182 ? -6.094  11.449  8.597  1.00 18.69  ? 181 VAL A N   1 
ATOM   1450 C  CA  . VAL A 1 182 ? -6.704  11.285  9.910  1.00 19.43  ? 181 VAL A CA  1 
ATOM   1451 C  C   . VAL A 1 182 ? -6.170  12.403  10.811 1.00 26.44  ? 181 VAL A C   1 
ATOM   1452 O  O   . VAL A 1 182 ? -4.972  12.478  11.102 1.00 17.48  ? 181 VAL A O   1 
ATOM   1453 C  CB  . VAL A 1 182 ? -6.401  9.882   10.519 1.00 20.22  ? 181 VAL A CB  1 
ATOM   1454 C  CG1 . VAL A 1 182 ? -6.982  9.757   11.926 1.00 11.75  ? 181 VAL A CG1 1 
ATOM   1455 C  CG2 . VAL A 1 182 ? -6.934  8.779   9.615  1.00 14.01  ? 181 VAL A CG2 1 
ATOM   1456 N  N   . VAL A 1 183 ? -7.057  13.285  11.248 1.00 16.62  ? 182 VAL A N   1 
ATOM   1457 C  CA  . VAL A 1 183 ? -6.614  14.466  11.979 1.00 19.00  ? 182 VAL A CA  1 
ATOM   1458 C  C   . VAL A 1 183 ? -7.510  14.715  13.175 1.00 18.03  ? 182 VAL A C   1 
ATOM   1459 O  O   . VAL A 1 183 ? -8.626  14.188  13.239 1.00 19.62  ? 182 VAL A O   1 
ATOM   1460 C  CB  . VAL A 1 183 ? -6.533  15.746  11.069 1.00 21.79  ? 182 VAL A CB  1 
ATOM   1461 C  CG1 . VAL A 1 183 ? -5.509  15.559  9.927  1.00 13.97  ? 182 VAL A CG1 1 
ATOM   1462 C  CG2 . VAL A 1 183 ? -7.896  16.143  10.519 1.00 14.89  ? 182 VAL A CG2 1 
ATOM   1463 N  N   . ASP A 1 184 ? -7.008  15.512  14.119 1.00 17.38  ? 183 ASP A N   1 
ATOM   1464 C  CA  . ASP A 1 184 ? -7.786  15.939  15.277 1.00 18.40  ? 183 ASP A CA  1 
ATOM   1465 C  C   . ASP A 1 184 ? -9.096  16.550  14.819 1.00 21.62  ? 183 ASP A C   1 
ATOM   1466 O  O   . ASP A 1 184 ? -9.134  17.328  13.862 1.00 26.15  ? 183 ASP A O   1 
ATOM   1467 C  CB  . ASP A 1 184 ? -7.026  16.987  16.096 1.00 25.25  ? 183 ASP A CB  1 
ATOM   1468 C  CG  . ASP A 1 184 ? -5.938  16.389  16.971 1.00 30.28  ? 183 ASP A CG  1 
ATOM   1469 O  OD1 . ASP A 1 184 ? -5.698  15.166  16.907 1.00 29.89  ? 183 ASP A OD1 1 
ATOM   1470 O  OD2 . ASP A 1 184 ? -5.319  17.160  17.730 1.00 42.27  ? 183 ASP A OD2 1 
ATOM   1471 N  N   . ASN A 1 185 ? -10.167 16.190  15.511 1.00 16.26  ? 184 ASN A N   1 
ATOM   1472 C  CA  . ASN A 1 185 ? -11.461 16.804  15.297 1.00 15.44  ? 184 ASN A CA  1 
ATOM   1473 C  C   . ASN A 1 185 ? -11.432 18.246  15.824 1.00 27.73  ? 184 ASN A C   1 
ATOM   1474 O  O   . ASN A 1 185 ? -11.152 18.458  17.008 1.00 28.38  ? 184 ASN A O   1 
ATOM   1475 C  CB  . ASN A 1 185 ? -12.533 15.984  16.017 1.00 15.27  ? 184 ASN A CB  1 
ATOM   1476 C  CG  . ASN A 1 185 ? -13.946 16.457  15.710 1.00 21.32  ? 184 ASN A CG  1 
ATOM   1477 O  OD1 . ASN A 1 185 ? -14.147 17.554  15.202 1.00 21.78  ? 184 ASN A OD1 1 
ATOM   1478 N  ND2 . ASN A 1 185 ? -14.934 15.624  16.028 1.00 18.20  ? 184 ASN A ND2 1 
ATOM   1479 N  N   . PRO A 1 186 ? -11.696 19.242  14.945 1.00 36.80  ? 185 PRO A N   1 
ATOM   1480 C  CA  . PRO A 1 186 ? -11.739 20.644  15.377 1.00 40.59  ? 185 PRO A CA  1 
ATOM   1481 C  C   . PRO A 1 186 ? -12.704 20.883  16.545 1.00 43.97  ? 185 PRO A C   1 
ATOM   1482 O  O   . PRO A 1 186 ? -12.352 21.584  17.490 1.00 43.11  ? 185 PRO A O   1 
ATOM   1483 C  CB  . PRO A 1 186 ? -12.226 21.385  14.128 1.00 43.86  ? 185 PRO A CB  1 
ATOM   1484 C  CG  . PRO A 1 186 ? -11.879 20.512  12.996 1.00 34.00  ? 185 PRO A CG  1 
ATOM   1485 C  CD  . PRO A 1 186 ? -11.960 19.108  13.499 1.00 42.07  ? 185 PRO A CD  1 
ATOM   1486 N  N   . ARG A 1 187 ? -13.890 20.277  16.485 1.00 48.50  ? 186 ARG A N   1 
ATOM   1487 C  CA  . ARG A 1 187 ? -14.946 20.474  17.491 1.00 59.09  ? 186 ARG A CA  1 
ATOM   1488 C  C   . ARG A 1 187 ? -14.742 19.690  18.800 1.00 67.09  ? 186 ARG A C   1 
ATOM   1489 O  O   . ARG A 1 187 ? -15.651 19.633  19.634 1.00 73.16  ? 186 ARG A O   1 
ATOM   1490 C  CB  . ARG A 1 187 ? -16.324 20.115  16.909 1.00 68.69  ? 186 ARG A CB  1 
ATOM   1491 C  CG  . ARG A 1 187 ? -16.648 20.704  15.531 1.00 80.42  ? 186 ARG A CG  1 
ATOM   1492 C  CD  . ARG A 1 187 ? -17.761 19.899  14.853 1.00 90.59  ? 186 ARG A CD  1 
ATOM   1493 N  NE  . ARG A 1 187 ? -17.438 18.470  14.809 1.00 83.00  ? 186 ARG A NE  1 
ATOM   1494 C  CZ  . ARG A 1 187 ? -18.329 17.479  14.778 1.00 69.92  ? 186 ARG A CZ  1 
ATOM   1495 N  NH1 . ARG A 1 187 ? -17.899 16.222  14.754 1.00 18.81  ? 186 ARG A NH1 1 
ATOM   1496 N  NH2 . ARG A 1 187 ? -19.639 17.730  14.789 1.00 44.68  ? 186 ARG A NH2 1 
ATOM   1497 N  N   . TRP A 1 188 ? -13.568 19.083  18.977 1.00 64.91  ? 187 TRP A N   1 
ATOM   1498 C  CA  . TRP A 1 188 ? -13.272 18.318  20.192 1.00 64.48  ? 187 TRP A CA  1 
ATOM   1499 C  C   . TRP A 1 188 ? -12.472 19.153  21.193 1.00 69.06  ? 187 TRP A C   1 
ATOM   1500 O  O   . TRP A 1 188 ? -11.501 19.823  20.832 1.00 70.72  ? 187 TRP A O   1 
ATOM   1501 C  CB  . TRP A 1 188 ? -12.536 17.007  19.861 1.00 47.56  ? 187 TRP A CB  1 
ATOM   1502 C  CG  . TRP A 1 188 ? -12.329 16.111  21.067 1.00 52.65  ? 187 TRP A CG  1 
ATOM   1503 C  CD1 . TRP A 1 188 ? -11.290 16.160  21.965 1.00 52.09  ? 187 TRP A CD1 1 
ATOM   1504 C  CD2 . TRP A 1 188 ? -13.187 15.049  21.510 1.00 37.28  ? 187 TRP A CD2 1 
ATOM   1505 N  NE1 . TRP A 1 188 ? -11.451 15.194  22.935 1.00 50.83  ? 187 TRP A NE1 1 
ATOM   1506 C  CE2 . TRP A 1 188 ? -12.604 14.499  22.681 1.00 46.14  ? 187 TRP A CE2 1 
ATOM   1507 C  CE3 . TRP A 1 188 ? -14.386 14.505  21.031 1.00 33.90  ? 187 TRP A CE3 1 
ATOM   1508 C  CZ2 . TRP A 1 188 ? -13.184 13.437  23.379 1.00 29.69  ? 187 TRP A CZ2 1 
ATOM   1509 C  CZ3 . TRP A 1 188 ? -14.959 13.447  21.725 1.00 36.70  ? 187 TRP A CZ3 1 
ATOM   1510 C  CH2 . TRP A 1 188 ? -14.356 12.925  22.887 1.00 43.40  ? 187 TRP A CH2 1 
ATOM   1511 N  N   . MET B 1 1   ? -7.104  3.156   34.428 1.00 31.04  ? 0   MET B N   1 
ATOM   1512 C  CA  . MET B 1 1   ? -7.980  2.181   33.711 1.00 35.32  ? 0   MET B CA  1 
ATOM   1513 C  C   . MET B 1 1   ? -7.198  1.399   32.670 1.00 28.16  ? 0   MET B C   1 
ATOM   1514 O  O   . MET B 1 1   ? -6.474  1.985   31.870 1.00 31.27  ? 0   MET B O   1 
ATOM   1515 C  CB  . MET B 1 1   ? -9.165  2.896   33.060 1.00 29.64  ? 0   MET B CB  1 
ATOM   1516 C  CG  . MET B 1 1   ? -10.512 2.580   33.697 1.00 53.50  ? 0   MET B CG  1 
ATOM   1517 S  SD  . MET B 1 1   ? -11.400 1.246   32.857 1.00 69.65  ? 0   MET B SD  1 
ATOM   1518 C  CE  . MET B 1 1   ? -10.716 -0.212  33.614 1.00 43.69  ? 0   MET B CE  1 
ATOM   1519 N  N   . MET B 1 2   ? -7.332  0.075   32.699 1.00 26.80  ? 1   MET B N   1 
ATOM   1520 C  CA  . MET B 1 2   ? -6.694  -0.773  31.695 1.00 39.28  ? 1   MET B CA  1 
ATOM   1521 C  C   . MET B 1 2   ? -7.610  -0.955  30.478 1.00 19.58  ? 1   MET B C   1 
ATOM   1522 O  O   . MET B 1 2   ? -8.714  -1.507  30.588 1.00 24.89  ? 1   MET B O   1 
ATOM   1523 C  CB  . MET B 1 2   ? -6.290  -2.125  32.298 1.00 50.11  ? 1   MET B CB  1 
ATOM   1524 C  CG  . MET B 1 2   ? -5.122  -2.817  31.580 1.00 71.45  ? 1   MET B CG  1 
ATOM   1525 S  SD  . MET B 1 2   ? -5.572  -4.210  30.517 1.00 77.99  ? 1   MET B SD  1 
ATOM   1526 C  CE  . MET B 1 2   ? -5.856  -5.492  31.738 1.00 80.15  ? 1   MET B CE  1 
ATOM   1527 N  N   . TYR B 1 3   ? -7.158  -0.456  29.329 1.00 23.33  ? 2   TYR B N   1 
ATOM   1528 C  CA  . TYR B 1 3   ? -7.818  -0.738  28.060 1.00 24.10  ? 2   TYR B CA  1 
ATOM   1529 C  C   . TYR B 1 3   ? -6.855  -1.492  27.158 1.00 25.86  ? 2   TYR B C   1 
ATOM   1530 O  O   . TYR B 1 3   ? -5.701  -1.098  27.009 1.00 30.96  ? 2   TYR B O   1 
ATOM   1531 C  CB  . TYR B 1 3   ? -8.276  0.544   27.359 1.00 10.97  ? 2   TYR B CB  1 
ATOM   1532 C  CG  . TYR B 1 3   ? -9.188  1.431   28.159 1.00 19.90  ? 2   TYR B CG  1 
ATOM   1533 C  CD1 . TYR B 1 3   ? -8.782  2.707   28.555 1.00 18.30  ? 2   TYR B CD1 1 
ATOM   1534 C  CD2 . TYR B 1 3   ? -10.462 1.003   28.514 1.00 11.81  ? 2   TYR B CD2 1 
ATOM   1535 C  CE1 . TYR B 1 3   ? -9.633  3.541   29.293 1.00 24.60  ? 2   TYR B CE1 1 
ATOM   1536 C  CE2 . TYR B 1 3   ? -11.308 1.818   29.259 1.00 13.20  ? 2   TYR B CE2 1 
ATOM   1537 C  CZ  . TYR B 1 3   ? -10.891 3.080   29.636 1.00 16.35  ? 2   TYR B CZ  1 
ATOM   1538 O  OH  . TYR B 1 3   ? -11.744 3.867   30.357 1.00 20.47  ? 2   TYR B OH  1 
ATOM   1539 N  N   . LYS B 1 4   ? -7.331  -2.585  26.572 1.00 17.49  ? 3   LYS B N   1 
ATOM   1540 C  CA  . LYS B 1 4   ? -6.564  -3.328  25.571 1.00 17.35  ? 3   LYS B CA  1 
ATOM   1541 C  C   . LYS B 1 4   ? -6.521  -2.551  24.260 1.00 18.38  ? 3   LYS B C   1 
ATOM   1542 O  O   . LYS B 1 4   ? -7.430  -1.792  23.945 1.00 13.94  ? 3   LYS B O   1 
ATOM   1543 C  CB  . LYS B 1 4   ? -7.157  -4.717  25.327 1.00 16.14  ? 3   LYS B CB  1 
ATOM   1544 C  CG  . LYS B 1 4   ? -7.006  -5.689  26.499 1.00 23.35  ? 3   LYS B CG  1 
ATOM   1545 C  CD  . LYS B 1 4   ? -8.217  -6.604  26.620 1.00 17.76  ? 3   LYS B CD  1 
ATOM   1546 C  CE  . LYS B 1 4   ? -8.203  -7.682  25.592 1.00 23.01  ? 3   LYS B CE  1 
ATOM   1547 N  NZ  . LYS B 1 4   ? -9.185  -8.756  25.901 1.00 14.91  ? 3   LYS B NZ  1 
ATOM   1548 N  N   . GLU B 1 5   ? -5.447  -2.740  23.511 1.00 15.51  ? 4   GLU B N   1 
ATOM   1549 C  CA  . GLU B 1 5   ? -5.249  -2.015  22.272 1.00 14.15  ? 4   GLU B CA  1 
ATOM   1550 C  C   . GLU B 1 5   ? -5.999  -2.706  21.125 1.00 5.43   ? 4   GLU B C   1 
ATOM   1551 O  O   . GLU B 1 5   ? -5.870  -3.920  20.934 1.00 15.49  ? 4   GLU B O   1 
ATOM   1552 C  CB  . GLU B 1 5   ? -3.745  -1.888  21.990 1.00 14.87  ? 4   GLU B CB  1 
ATOM   1553 C  CG  . GLU B 1 5   ? -3.343  -0.760  21.033 1.00 38.42  ? 4   GLU B CG  1 
ATOM   1554 C  CD  . GLU B 1 5   ? -3.716  0.634   21.532 1.00 41.14  ? 4   GLU B CD  1 
ATOM   1555 O  OE1 . GLU B 1 5   ? -3.771  0.863   22.764 1.00 37.90  ? 4   GLU B OE1 1 
ATOM   1556 O  OE2 . GLU B 1 5   ? -3.953  1.509   20.675 1.00 46.01  ? 4   GLU B OE2 1 
ATOM   1557 N  N   . PRO B 1 6   ? -6.826  -1.948  20.380 1.00 17.62  ? 5   PRO B N   1 
ATOM   1558 C  CA  . PRO B 1 6   ? -7.442  -2.512  19.177 1.00 12.20  ? 5   PRO B CA  1 
ATOM   1559 C  C   . PRO B 1 6   ? -6.369  -2.917  18.179 1.00 15.86  ? 5   PRO B C   1 
ATOM   1560 O  O   . PRO B 1 6   ? -5.299  -2.320  18.167 1.00 15.92  ? 5   PRO B O   1 
ATOM   1561 C  CB  . PRO B 1 6   ? -8.234  -1.342  18.600 1.00 12.44  ? 5   PRO B CB  1 
ATOM   1562 C  CG  . PRO B 1 6   ? -8.465  -0.419  19.759 1.00 17.04  ? 5   PRO B CG  1 
ATOM   1563 C  CD  . PRO B 1 6   ? -7.229  -0.549  20.600 1.00 10.12  ? 5   PRO B CD  1 
ATOM   1564 N  N   . PHE B 1 7   ? -6.657  -3.917  17.348 1.00 17.30  ? 6   PHE B N   1 
ATOM   1565 C  CA  . PHE B 1 7   ? -5.735  -4.292  16.277 1.00 9.36   ? 6   PHE B CA  1 
ATOM   1566 C  C   . PHE B 1 7   ? -6.462  -4.813  15.049 1.00 11.94  ? 6   PHE B C   1 
ATOM   1567 O  O   . PHE B 1 7   ? -7.629  -5.218  15.117 1.00 11.40  ? 6   PHE B O   1 
ATOM   1568 C  CB  . PHE B 1 7   ? -4.641  -5.271  16.768 1.00 9.34   ? 6   PHE B CB  1 
ATOM   1569 C  CG  . PHE B 1 7   ? -5.158  -6.623  17.183 1.00 11.95  ? 6   PHE B CG  1 
ATOM   1570 C  CD1 . PHE B 1 7   ? -5.404  -6.902  18.520 1.00 20.45  ? 6   PHE B CD1 1 
ATOM   1571 C  CD2 . PHE B 1 7   ? -5.386  -7.622  16.232 1.00 13.20  ? 6   PHE B CD2 1 
ATOM   1572 C  CE1 . PHE B 1 7   ? -5.868  -8.140  18.910 1.00 21.20  ? 6   PHE B CE1 1 
ATOM   1573 C  CE2 . PHE B 1 7   ? -5.857  -8.859  16.611 1.00 16.31  ? 6   PHE B CE2 1 
ATOM   1574 C  CZ  . PHE B 1 7   ? -6.095  -9.123  17.960 1.00 23.92  ? 6   PHE B CZ  1 
ATOM   1575 N  N   . GLY B 1 8   ? -5.766  -4.769  13.920 1.00 17.91  ? 7   GLY B N   1 
ATOM   1576 C  CA  . GLY B 1 8   ? -6.242  -5.360  12.681 1.00 14.88  ? 7   GLY B CA  1 
ATOM   1577 C  C   . GLY B 1 8   ? -5.230  -6.387  12.224 1.00 23.45  ? 7   GLY B C   1 
ATOM   1578 O  O   . GLY B 1 8   ? -4.031  -6.238  12.475 1.00 14.43  ? 7   GLY B O   1 
ATOM   1579 N  N   . VAL B 1 9   ? -5.711  -7.447  11.586 1.00 21.16  ? 8   VAL B N   1 
ATOM   1580 C  CA  . VAL B 1 9   ? -4.831  -8.459  11.003 1.00 16.25  ? 8   VAL B CA  1 
ATOM   1581 C  C   . VAL B 1 9   ? -5.369  -8.855  9.633  1.00 19.42  ? 8   VAL B C   1 
ATOM   1582 O  O   . VAL B 1 9   ? -6.578  -8.963  9.438  1.00 15.23  ? 8   VAL B O   1 
ATOM   1583 C  CB  . VAL B 1 9   ? -4.675  -9.745  11.896 1.00 26.92  ? 8   VAL B CB  1 
ATOM   1584 C  CG1 . VAL B 1 9   ? -3.780  -9.492  13.091 1.00 39.69  ? 8   VAL B CG1 1 
ATOM   1585 C  CG2 . VAL B 1 9   ? -6.035  -10.306 12.346 1.00 27.51  ? 8   VAL B CG2 1 
ATOM   1586 N  N   . LYS B 1 10  ? -4.461  -9.076  8.693  1.00 18.15  ? 9   LYS B N   1 
ATOM   1587 C  CA  . LYS B 1 10  ? -4.817  -9.544  7.369  1.00 29.16  ? 9   LYS B CA  1 
ATOM   1588 C  C   . LYS B 1 10  ? -5.003  -11.061 7.394  1.00 29.01  ? 9   LYS B C   1 
ATOM   1589 O  O   . LYS B 1 10  ? -4.141  -11.806 7.872  1.00 37.69  ? 9   LYS B O   1 
ATOM   1590 C  CB  . LYS B 1 10  ? -3.740  -9.133  6.355  1.00 47.65  ? 9   LYS B CB  1 
ATOM   1591 C  CG  . LYS B 1 10  ? -3.504  -7.618  6.287  1.00 78.34  ? 9   LYS B CG  1 
ATOM   1592 C  CD  . LYS B 1 10  ? -2.055  -7.254  5.941  1.00 83.27  ? 9   LYS B CD  1 
ATOM   1593 C  CE  . LYS B 1 10  ? -1.883  -6.842  4.482  1.00 92.70  ? 9   LYS B CE  1 
ATOM   1594 N  NZ  . LYS B 1 10  ? -2.061  -7.967  3.521  1.00 97.23  ? 9   LYS B NZ  1 
ATOM   1595 N  N   . VAL B 1 11  ? -6.158  -11.508 6.916  1.00 22.48  ? 10  VAL B N   1 
ATOM   1596 C  CA  . VAL B 1 11  ? -6.440  -12.931 6.743  1.00 18.18  ? 10  VAL B CA  1 
ATOM   1597 C  C   . VAL B 1 11  ? -6.485  -13.175 5.230  1.00 28.05  ? 10  VAL B C   1 
ATOM   1598 O  O   . VAL B 1 11  ? -7.212  -12.494 4.505  1.00 22.42  ? 10  VAL B O   1 
ATOM   1599 C  CB  . VAL B 1 11  ? -7.781  -13.337 7.427  1.00 16.35  ? 10  VAL B CB  1 
ATOM   1600 C  CG1 . VAL B 1 11  ? -8.075  -14.817 7.230  1.00 21.28  ? 10  VAL B CG1 1 
ATOM   1601 C  CG2 . VAL B 1 11  ? -7.749  -12.999 8.917  1.00 19.70  ? 10  VAL B CG2 1 
ATOM   1602 N  N   . ASP B 1 12  ? -5.670  -14.111 4.760  1.00 27.38  ? 11  ASP B N   1 
ATOM   1603 C  CA  . ASP B 1 12  ? -5.645  -14.484 3.351  1.00 27.17  ? 11  ASP B CA  1 
ATOM   1604 C  C   . ASP B 1 12  ? -6.750  -15.510 3.132  1.00 10.75  ? 11  ASP B C   1 
ATOM   1605 O  O   . ASP B 1 12  ? -6.648  -16.646 3.599  1.00 18.37  ? 11  ASP B O   1 
ATOM   1606 C  CB  . ASP B 1 12  ? -4.273  -15.077 2.995  1.00 32.35  ? 11  ASP B CB  1 
ATOM   1607 C  CG  . ASP B 1 12  ? -4.059  -15.251 1.492  1.00 37.61  ? 11  ASP B CG  1 
ATOM   1608 O  OD1 . ASP B 1 12  ? -5.047  -15.354 0.731  1.00 32.05  ? 11  ASP B OD1 1 
ATOM   1609 O  OD2 . ASP B 1 12  ? -2.878  -15.298 1.072  1.00 38.16  ? 11  ASP B OD2 1 
ATOM   1610 N  N   . PHE B 1 13  ? -7.821  -15.097 2.452  1.00 17.15  ? 12  PHE B N   1 
ATOM   1611 C  CA  . PHE B 1 13  ? -8.974  -15.972 2.216  1.00 24.03  ? 12  PHE B CA  1 
ATOM   1612 C  C   . PHE B 1 13  ? -8.601  -17.194 1.364  1.00 35.84  ? 12  PHE B C   1 
ATOM   1613 O  O   . PHE B 1 13  ? -9.312  -18.197 1.385  1.00 30.59  ? 12  PHE B O   1 
ATOM   1614 C  CB  . PHE B 1 13  ? -10.142 -15.203 1.566  1.00 26.45  ? 12  PHE B CB  1 
ATOM   1615 C  CG  . PHE B 1 13  ? -10.901 -14.274 2.507  1.00 22.97  ? 12  PHE B CG  1 
ATOM   1616 C  CD1 . PHE B 1 13  ? -10.423 -13.963 3.780  1.00 14.27  ? 12  PHE B CD1 1 
ATOM   1617 C  CD2 . PHE B 1 13  ? -12.091 -13.680 2.086  1.00 31.88  ? 12  PHE B CD2 1 
ATOM   1618 C  CE1 . PHE B 1 13  ? -11.130 -13.092 4.626  1.00 19.23  ? 12  PHE B CE1 1 
ATOM   1619 C  CE2 . PHE B 1 13  ? -12.800 -12.807 2.918  1.00 34.62  ? 12  PHE B CE2 1 
ATOM   1620 C  CZ  . PHE B 1 13  ? -12.315 -12.511 4.192  1.00 28.12  ? 12  PHE B CZ  1 
ATOM   1621 N  N   . GLU B 1 14  ? -7.480  -17.103 0.639  1.00 36.09  ? 13  GLU B N   1 
ATOM   1622 C  CA  . GLU B 1 14  ? -6.989  -18.190 -0.223 1.00 29.65  ? 13  GLU B CA  1 
ATOM   1623 C  C   . GLU B 1 14  ? -6.147  -19.224 0.525  1.00 25.99  ? 13  GLU B C   1 
ATOM   1624 O  O   . GLU B 1 14  ? -6.013  -20.359 0.071  1.00 33.16  ? 13  GLU B O   1 
ATOM   1625 C  CB  . GLU B 1 14  ? -6.179  -17.642 -1.414 1.00 39.46  ? 13  GLU B CB  1 
ATOM   1626 C  CG  . GLU B 1 14  ? -6.909  -16.624 -2.304 1.00 56.33  ? 13  GLU B CG  1 
ATOM   1627 C  CD  . GLU B 1 14  ? -8.052  -17.237 -3.101 1.00 63.02  ? 13  GLU B CD  1 
ATOM   1628 O  OE1 . GLU B 1 14  ? -7.822  -18.256 -3.787 1.00 70.35  ? 13  GLU B OE1 1 
ATOM   1629 O  OE2 . GLU B 1 14  ? -9.179  -16.693 -3.044 1.00 45.81  ? 13  GLU B OE2 1 
ATOM   1630 N  N   . THR B 1 15  ? -5.554  -18.830 1.650  1.00 24.53  ? 14  THR B N   1 
ATOM   1631 C  CA  . THR B 1 15  ? -4.760  -19.765 2.451  1.00 28.67  ? 14  THR B CA  1 
ATOM   1632 C  C   . THR B 1 15  ? -5.318  -19.976 3.860  1.00 16.92  ? 14  THR B C   1 
ATOM   1633 O  O   . THR B 1 15  ? -5.067  -21.008 4.486  1.00 19.05  ? 14  THR B O   1 
ATOM   1634 C  CB  . THR B 1 15  ? -3.277  -19.327 2.576  1.00 25.42  ? 14  THR B CB  1 
ATOM   1635 O  OG1 . THR B 1 15  ? -3.194  -18.147 3.378  1.00 27.66  ? 14  THR B OG1 1 
ATOM   1636 C  CG2 . THR B 1 15  ? -2.646  -19.074 1.205  1.00 26.67  ? 14  THR B CG2 1 
ATOM   1637 N  N   . GLY B 1 16  ? -6.051  -18.987 4.362  1.00 23.21  ? 15  GLY B N   1 
ATOM   1638 C  CA  . GLY B 1 16  ? -6.548  -19.008 5.741  1.00 30.23  ? 15  GLY B CA  1 
ATOM   1639 C  C   . GLY B 1 16  ? -5.478  -18.703 6.773  1.00 21.33  ? 15  GLY B C   1 
ATOM   1640 O  O   . GLY B 1 16  ? -5.726  -18.786 7.970  1.00 26.85  ? 15  GLY B O   1 
ATOM   1641 N  N   . ILE B 1 17  ? -4.281  -18.341 6.318  1.00 23.86  ? 16  ILE B N   1 
ATOM   1642 C  CA  . ILE B 1 17  ? -3.186  -18.028 7.235  1.00 24.52  ? 16  ILE B CA  1 
ATOM   1643 C  C   . ILE B 1 17  ? -3.450  -16.685 7.912  1.00 18.82  ? 16  ILE B C   1 
ATOM   1644 O  O   . ILE B 1 17  ? -3.752  -15.703 7.240  1.00 17.62  ? 16  ILE B O   1 
ATOM   1645 C  CB  . ILE B 1 17  ? -1.805  -18.016 6.508  1.00 25.48  ? 16  ILE B CB  1 
ATOM   1646 C  CG1 . ILE B 1 17  ? -1.463  -19.419 5.991  1.00 16.42  ? 16  ILE B CG1 1 
ATOM   1647 C  CG2 . ILE B 1 17  ? -0.693  -17.489 7.430  1.00 16.93  ? 16  ILE B CG2 1 
ATOM   1648 C  CD1 . ILE B 1 17  ? -0.278  -19.466 5.032  1.00 25.52  ? 16  ILE B CD1 1 
ATOM   1649 N  N   . ILE B 1 18  ? -3.375  -16.664 9.243  1.00 24.63  ? 17  ILE B N   1 
ATOM   1650 C  CA  . ILE B 1 18  ? -3.323  -15.408 9.996  1.00 23.31  ? 17  ILE B CA  1 
ATOM   1651 C  C   . ILE B 1 18  ? -1.882  -15.281 10.512 1.00 29.36  ? 17  ILE B C   1 
ATOM   1652 O  O   . ILE B 1 18  ? -1.435  -16.107 11.313 1.00 33.88  ? 17  ILE B O   1 
ATOM   1653 C  CB  . ILE B 1 18  ? -4.342  -15.372 11.194 1.00 15.22  ? 17  ILE B CB  1 
ATOM   1654 C  CG1 . ILE B 1 18  ? -5.784  -15.598 10.727 1.00 20.45  ? 17  ILE B CG1 1 
ATOM   1655 C  CG2 . ILE B 1 18  ? -4.228  -14.048 11.978 1.00 20.86  ? 17  ILE B CG2 1 
ATOM   1656 C  CD1 . ILE B 1 18  ? -6.812  -15.718 11.890 1.00 10.50  ? 17  ILE B CD1 1 
ATOM   1657 N  N   . GLU B 1 19  ? -1.145  -14.275 10.035 1.00 35.15  ? 18  GLU B N   1 
ATOM   1658 C  CA  . GLU B 1 19  ? 0.213   -14.040 10.538 1.00 42.46  ? 18  GLU B CA  1 
ATOM   1659 C  C   . GLU B 1 19  ? 0.195   -13.555 11.987 1.00 42.73  ? 18  GLU B C   1 
ATOM   1660 O  O   . GLU B 1 19  ? -0.518  -12.606 12.328 1.00 36.04  ? 18  GLU B O   1 
ATOM   1661 C  CB  . GLU B 1 19  ? 0.989   -13.063 9.654  1.00 49.72  ? 18  GLU B CB  1 
ATOM   1662 C  CG  . GLU B 1 19  ? 1.807   -13.736 8.560  1.00 70.34  ? 18  GLU B CG  1 
ATOM   1663 C  CD  . GLU B 1 19  ? 2.903   -12.835 8.005  1.00 88.47  ? 18  GLU B CD  1 
ATOM   1664 O  OE1 . GLU B 1 19  ? 4.095   -13.179 8.169  1.00 93.77  ? 18  GLU B OE1 1 
ATOM   1665 O  OE2 . GLU B 1 19  ? 2.578   -11.781 7.414  1.00 82.18  ? 18  GLU B OE2 1 
ATOM   1666 N  N   . GLY B 1 20  ? 0.966   -14.234 12.834 1.00 36.37  ? 19  GLY B N   1 
ATOM   1667 C  CA  . GLY B 1 20  ? 1.047   -13.895 14.252 1.00 32.97  ? 19  GLY B CA  1 
ATOM   1668 C  C   . GLY B 1 20  ? 0.133   -14.674 15.181 1.00 40.23  ? 19  GLY B C   1 
ATOM   1669 O  O   . GLY B 1 20  ? 0.230   -14.525 16.403 1.00 45.82  ? 19  GLY B O   1 
ATOM   1670 N  N   . ALA B 1 21  ? -0.750  -15.503 14.617 1.00 30.42  ? 20  ALA B N   1 
ATOM   1671 C  CA  . ALA B 1 21  ? -1.701  -16.293 15.415 1.00 33.04  ? 20  ALA B CA  1 
ATOM   1672 C  C   . ALA B 1 21  ? -1.035  -17.487 16.097 1.00 28.41  ? 20  ALA B C   1 
ATOM   1673 O  O   . ALA B 1 21  ? 0.078   -17.869 15.740 1.00 28.43  ? 20  ALA B O   1 
ATOM   1674 C  CB  . ALA B 1 21  ? -2.869  -16.767 14.541 1.00 13.98  ? 20  ALA B CB  1 
ATOM   1675 N  N   . LYS B 1 22  ? -1.719  -18.073 17.078 1.00 27.38  ? 21  LYS B N   1 
ATOM   1676 C  CA  . LYS B 1 22  ? -1.296  -19.350 17.649 1.00 28.16  ? 21  LYS B CA  1 
ATOM   1677 C  C   . LYS B 1 22  ? -1.684  -20.487 16.693 1.00 35.60  ? 21  LYS B C   1 
ATOM   1678 O  O   . LYS B 1 22  ? -2.871  -20.796 16.527 1.00 25.22  ? 21  LYS B O   1 
ATOM   1679 C  CB  . LYS B 1 22  ? -1.927  -19.575 19.030 1.00 33.24  ? 21  LYS B CB  1 
ATOM   1680 C  CG  . LYS B 1 22  ? -1.337  -20.758 19.789 1.00 46.98  ? 21  LYS B CG  1 
ATOM   1681 C  CD  . LYS B 1 22  ? -2.253  -21.236 20.901 1.00 44.64  ? 21  LYS B CD  1 
ATOM   1682 C  CE  . LYS B 1 22  ? -1.636  -22.394 21.673 1.00 65.93  ? 21  LYS B CE  1 
ATOM   1683 N  NZ  . LYS B 1 22  ? -2.548  -22.915 22.732 1.00 69.48  ? 21  LYS B NZ  1 
ATOM   1684 N  N   . LYS B 1 23  ? -0.680  -21.098 16.066 1.00 33.29  ? 22  LYS B N   1 
ATOM   1685 C  CA  . LYS B 1 23  ? -0.912  -22.174 15.101 1.00 36.46  ? 22  LYS B CA  1 
ATOM   1686 C  C   . LYS B 1 23  ? -0.959  -23.561 15.757 1.00 33.16  ? 22  LYS B C   1 
ATOM   1687 O  O   . LYS B 1 23  ? -0.035  -23.962 16.463 1.00 33.80  ? 22  LYS B O   1 
ATOM   1688 C  CB  . LYS B 1 23  ? 0.114   -22.129 13.963 1.00 29.29  ? 22  LYS B CB  1 
ATOM   1689 C  CG  . LYS B 1 23  ? -0.185  -23.102 12.831 1.00 44.17  ? 22  LYS B CG  1 
ATOM   1690 C  CD  . LYS B 1 23  ? 0.897   -23.088 11.766 1.00 37.32  ? 22  LYS B CD  1 
ATOM   1691 C  CE  . LYS B 1 23  ? 0.654   -24.174 10.734 1.00 32.91  ? 22  LYS B CE  1 
ATOM   1692 N  NZ  . LYS B 1 23  ? 1.721   -24.181 9.699  1.00 40.34  ? 22  LYS B NZ  1 
ATOM   1693 N  N   . SER B 1 24  ? -2.066  -24.270 15.531 1.00 19.19  ? 23  SER B N   1 
ATOM   1694 C  CA  . SER B 1 24  ? -2.228  -25.652 15.952 1.00 12.08  ? 23  SER B CA  1 
ATOM   1695 C  C   . SER B 1 24  ? -2.269  -26.530 14.705 1.00 27.05  ? 23  SER B C   1 
ATOM   1696 O  O   . SER B 1 24  ? -2.896  -26.166 13.710 1.00 20.23  ? 23  SER B O   1 
ATOM   1697 C  CB  . SER B 1 24  ? -3.525  -25.833 16.741 1.00 21.88  ? 23  SER B CB  1 
ATOM   1698 O  OG  . SER B 1 24  ? -3.470  -25.181 17.994 1.00 38.80  ? 23  SER B OG  1 
ATOM   1699 N  N   . VAL B 1 25  ? -1.592  -27.675 14.764 1.00 23.40  ? 24  VAL B N   1 
ATOM   1700 C  CA  . VAL B 1 25  ? -1.625  -28.674 13.688 1.00 25.39  ? 24  VAL B CA  1 
ATOM   1701 C  C   . VAL B 1 25  ? -2.225  -29.969 14.251 1.00 22.01  ? 24  VAL B C   1 
ATOM   1702 O  O   . VAL B 1 25  ? -1.848  -30.407 15.337 1.00 22.07  ? 24  VAL B O   1 
ATOM   1703 C  CB  . VAL B 1 25  ? -0.211  -28.919 13.050 1.00 27.56  ? 24  VAL B CB  1 
ATOM   1704 C  CG1 . VAL B 1 25  ? -0.260  -30.010 11.976 1.00 28.00  ? 24  VAL B CG1 1 
ATOM   1705 C  CG2 . VAL B 1 25  ? 0.349   -27.632 12.437 1.00 20.02  ? 24  VAL B CG2 1 
ATOM   1706 N  N   . ARG B 1 26  ? -3.187  -30.549 13.532 1.00 20.86  ? 25  ARG B N   1 
ATOM   1707 C  CA  . ARG B 1 26  ? -3.740  -31.852 13.901 1.00 23.33  ? 25  ARG B CA  1 
ATOM   1708 C  C   . ARG B 1 26  ? -3.532  -32.851 12.768 1.00 18.87  ? 25  ARG B C   1 
ATOM   1709 O  O   . ARG B 1 26  ? -4.083  -32.706 11.675 1.00 22.23  ? 25  ARG B O   1 
ATOM   1710 C  CB  . ARG B 1 26  ? -5.227  -31.767 14.283 1.00 21.77  ? 25  ARG B CB  1 
ATOM   1711 C  CG  . ARG B 1 26  ? -5.559  -30.730 15.347 1.00 44.03  ? 25  ARG B CG  1 
ATOM   1712 C  CD  . ARG B 1 26  ? -5.263  -31.211 16.752 1.00 48.40  ? 25  ARG B CD  1 
ATOM   1713 N  NE  . ARG B 1 26  ? -4.775  -30.110 17.578 1.00 58.56  ? 25  ARG B NE  1 
ATOM   1714 C  CZ  . ARG B 1 26  ? -4.549  -30.186 18.887 1.00 68.03  ? 25  ARG B CZ  1 
ATOM   1715 N  NH1 . ARG B 1 26  ? -4.780  -31.316 19.547 1.00 73.75  ? 25  ARG B NH1 1 
ATOM   1716 N  NH2 . ARG B 1 26  ? -4.094  -29.123 19.540 1.00 48.39  ? 25  ARG B NH2 1 
ATOM   1717 N  N   . ARG B 1 27  ? -2.718  -33.860 13.049 1.00 17.55  ? 26  ARG B N   1 
ATOM   1718 C  CA  . ARG B 1 27  ? -2.495  -34.965 12.133 1.00 20.76  ? 26  ARG B CA  1 
ATOM   1719 C  C   . ARG B 1 27  ? -3.468  -36.085 12.456 1.00 22.37  ? 26  ARG B C   1 
ATOM   1720 O  O   . ARG B 1 27  ? -4.031  -36.144 13.561 1.00 18.95  ? 26  ARG B O   1 
ATOM   1721 C  CB  . ARG B 1 27  ? -1.061  -35.476 12.253 1.00 24.97  ? 26  ARG B CB  1 
ATOM   1722 C  CG  . ARG B 1 27  ? -0.019  -34.398 12.151 1.00 22.01  ? 26  ARG B CG  1 
ATOM   1723 C  CD  . ARG B 1 27  ? 1.352   -34.985 11.897 1.00 40.62  ? 26  ARG B CD  1 
ATOM   1724 N  NE  . ARG B 1 27  ? 1.631   -35.069 10.466 1.00 58.22  ? 26  ARG B NE  1 
ATOM   1725 C  CZ  . ARG B 1 27  ? 2.153   -34.080 9.739  1.00 74.83  ? 26  ARG B CZ  1 
ATOM   1726 N  NH1 . ARG B 1 27  ? 2.463   -32.917 10.305 1.00 69.28  ? 26  ARG B NH1 1 
ATOM   1727 N  NH2 . ARG B 1 27  ? 2.368   -34.251 8.439  1.00 72.58  ? 26  ARG B NH2 1 
ATOM   1728 N  N   . LEU B 1 28  ? -3.656  -36.978 11.492 1.00 16.25  ? 27  LEU B N   1 
ATOM   1729 C  CA  . LEU B 1 28  ? -4.515  -38.134 11.677 1.00 12.59  ? 27  LEU B CA  1 
ATOM   1730 C  C   . LEU B 1 28  ? -4.189  -38.946 12.941 1.00 13.67  ? 27  LEU B C   1 
ATOM   1731 O  O   . LEU B 1 28  ? -5.085  -39.487 13.587 1.00 17.80  ? 27  LEU B O   1 
ATOM   1732 C  CB  . LEU B 1 28  ? -4.469  -39.021 10.429 1.00 16.82  ? 27  LEU B CB  1 
ATOM   1733 C  CG  . LEU B 1 28  ? -5.627  -40.012 10.281 1.00 28.15  ? 27  LEU B CG  1 
ATOM   1734 C  CD1 . LEU B 1 28  ? -6.963  -39.294 10.256 1.00 13.46  ? 27  LEU B CD1 1 
ATOM   1735 C  CD2 . LEU B 1 28  ? -5.439  -40.834 9.032  1.00 22.22  ? 27  LEU B CD2 1 
ATOM   1736 N  N   . SER B 1 29  ? -2.911  -39.010 13.305 1.00 15.95  ? 28  SER B N   1 
ATOM   1737 C  CA  . SER B 1 29  ? -2.497  -39.733 14.511 1.00 22.49  ? 28  SER B CA  1 
ATOM   1738 C  C   . SER B 1 29  ? -3.013  -39.098 15.815 1.00 18.93  ? 28  SER B C   1 
ATOM   1739 O  O   . SER B 1 29  ? -3.082  -39.769 16.850 1.00 25.26  ? 28  SER B O   1 
ATOM   1740 C  CB  . SER B 1 29  ? -0.974  -39.908 14.549 1.00 13.80  ? 28  SER B CB  1 
ATOM   1741 O  OG  . SER B 1 29  ? -0.307  -38.672 14.324 1.00 23.71  ? 28  SER B OG  1 
ATOM   1742 N  N   . ASP B 1 30  ? -3.376  -37.814 15.756 1.00 19.51  ? 29  ASP B N   1 
ATOM   1743 C  CA  . ASP B 1 30  ? -3.947  -37.101 16.908 1.00 24.58  ? 29  ASP B CA  1 
ATOM   1744 C  C   . ASP B 1 30  ? -5.443  -37.377 17.021 1.00 24.34  ? 29  ASP B C   1 
ATOM   1745 O  O   . ASP B 1 30  ? -6.113  -36.852 17.912 1.00 26.25  ? 29  ASP B O   1 
ATOM   1746 C  CB  . ASP B 1 30  ? -3.729  -35.586 16.787 1.00 23.84  ? 29  ASP B CB  1 
ATOM   1747 C  CG  . ASP B 1 30  ? -2.257  -35.193 16.745 1.00 40.39  ? 29  ASP B CG  1 
ATOM   1748 O  OD1 . ASP B 1 30  ? -1.484  -35.612 17.635 1.00 40.93  ? 29  ASP B OD1 1 
ATOM   1749 O  OD2 . ASP B 1 30  ? -1.877  -34.441 15.820 1.00 25.54  ? 29  ASP B OD2 1 
ATOM   1750 N  N   . MET B 1 31  ? -5.962  -38.204 16.117 1.00 20.27  ? 30  MET B N   1 
ATOM   1751 C  CA  . MET B 1 31  ? -7.398  -38.423 16.015 1.00 17.51  ? 30  MET B CA  1 
ATOM   1752 C  C   . MET B 1 31  ? -7.789  -39.898 16.145 1.00 15.51  ? 30  MET B C   1 
ATOM   1753 O  O   . MET B 1 31  ? -8.726  -40.368 15.490 1.00 27.35  ? 30  MET B O   1 
ATOM   1754 C  CB  . MET B 1 31  ? -7.938  -37.799 14.724 1.00 9.89   ? 30  MET B CB  1 
ATOM   1755 C  CG  . MET B 1 31  ? -7.841  -36.276 14.681 1.00 24.28  ? 30  MET B CG  1 
ATOM   1756 S  SD  . MET B 1 31  ? -8.422  -35.542 13.135 1.00 18.83  ? 30  MET B SD  1 
ATOM   1757 C  CE  . MET B 1 31  ? -10.194 -35.752 13.311 1.00 16.65  ? 30  MET B CE  1 
ATOM   1758 N  N   . GLU B 1 32  ? -7.081  -40.618 17.016 1.00 24.51  ? 31  GLU B N   1 
ATOM   1759 C  CA  . GLU B 1 32  ? -7.446  -41.989 17.348 1.00 26.14  ? 31  GLU B CA  1 
ATOM   1760 C  C   . GLU B 1 32  ? -8.818  -42.017 18.016 1.00 33.50  ? 31  GLU B C   1 
ATOM   1761 O  O   . GLU B 1 32  ? -9.115  -41.194 18.884 1.00 35.99  ? 31  GLU B O   1 
ATOM   1762 C  CB  . GLU B 1 32  ? -6.395  -42.649 18.251 1.00 40.10  ? 31  GLU B CB  1 
ATOM   1763 C  CG  . GLU B 1 32  ? -6.647  -44.147 18.486 1.00 42.72  ? 31  GLU B CG  1 
ATOM   1764 C  CD  . GLU B 1 32  ? -5.425  -44.910 18.980 1.00 50.10  ? 31  GLU B CD  1 
ATOM   1765 O  OE1 . GLU B 1 32  ? -4.492  -44.286 19.530 1.00 48.79  ? 31  GLU B OE1 1 
ATOM   1766 O  OE2 . GLU B 1 32  ? -5.404  -46.149 18.820 1.00 56.27  ? 31  GLU B OE2 1 
ATOM   1767 N  N   . GLY B 1 33  ? -9.646  -42.961 17.586 1.00 22.98  ? 32  GLY B N   1 
ATOM   1768 C  CA  . GLY B 1 33  ? -10.963 -43.180 18.178 1.00 26.27  ? 32  GLY B CA  1 
ATOM   1769 C  C   . GLY B 1 33  ? -12.029 -42.252 17.635 1.00 23.55  ? 32  GLY B C   1 
ATOM   1770 O  O   . GLY B 1 33  ? -13.134 -42.191 18.179 1.00 28.15  ? 32  GLY B O   1 
ATOM   1771 N  N   . TYR B 1 34  ? -11.703 -41.541 16.554 1.00 19.11  ? 33  TYR B N   1 
ATOM   1772 C  CA  . TYR B 1 34  ? -12.610 -40.557 15.959 1.00 26.38  ? 33  TYR B CA  1 
ATOM   1773 C  C   . TYR B 1 34  ? -13.296 -41.051 14.686 1.00 23.55  ? 33  TYR B C   1 
ATOM   1774 O  O   . TYR B 1 34  ? -14.427 -40.656 14.392 1.00 19.20  ? 33  TYR B O   1 
ATOM   1775 C  CB  . TYR B 1 34  ? -11.872 -39.243 15.685 1.00 26.03  ? 33  TYR B CB  1 
ATOM   1776 C  CG  . TYR B 1 34  ? -11.787 -38.338 16.889 1.00 24.39  ? 33  TYR B CG  1 
ATOM   1777 C  CD1 . TYR B 1 34  ? -10.710 -38.419 17.774 1.00 23.37  ? 33  TYR B CD1 1 
ATOM   1778 C  CD2 . TYR B 1 34  ? -12.786 -37.396 17.144 1.00 26.75  ? 33  TYR B CD2 1 
ATOM   1779 C  CE1 . TYR B 1 34  ? -10.630 -37.578 18.894 1.00 26.69  ? 33  TYR B CE1 1 
ATOM   1780 C  CE2 . TYR B 1 34  ? -12.719 -36.558 18.253 1.00 22.31  ? 33  TYR B CE2 1 
ATOM   1781 C  CZ  . TYR B 1 34  ? -11.640 -36.656 19.122 1.00 20.44  ? 33  TYR B CZ  1 
ATOM   1782 O  OH  . TYR B 1 34  ? -11.577 -35.830 20.218 1.00 29.73  ? 33  TYR B OH  1 
ATOM   1783 N  N   . PHE B 1 35  ? -12.621 -41.920 13.938 1.00 20.39  ? 34  PHE B N   1 
ATOM   1784 C  CA  . PHE B 1 35  ? -13.179 -42.422 12.683 1.00 21.96  ? 34  PHE B CA  1 
ATOM   1785 C  C   . PHE B 1 35  ? -13.769 -43.833 12.813 1.00 21.40  ? 34  PHE B C   1 
ATOM   1786 O  O   . PHE B 1 35  ? -13.254 -44.669 13.552 1.00 24.62  ? 34  PHE B O   1 
ATOM   1787 C  CB  . PHE B 1 35  ? -12.141 -42.343 11.564 1.00 14.51  ? 34  PHE B CB  1 
ATOM   1788 C  CG  . PHE B 1 35  ? -11.780 -40.934 11.175 1.00 23.14  ? 34  PHE B CG  1 
ATOM   1789 C  CD1 . PHE B 1 35  ? -10.760 -40.251 11.839 1.00 20.58  ? 34  PHE B CD1 1 
ATOM   1790 C  CD2 . PHE B 1 35  ? -12.467 -40.282 10.152 1.00 9.91   ? 34  PHE B CD2 1 
ATOM   1791 C  CE1 . PHE B 1 35  ? -10.430 -38.952 11.488 1.00 18.43  ? 34  PHE B CE1 1 
ATOM   1792 C  CE2 . PHE B 1 35  ? -12.140 -38.977 9.785  1.00 12.99  ? 34  PHE B CE2 1 
ATOM   1793 C  CZ  . PHE B 1 35  ? -11.122 -38.308 10.451 1.00 13.82  ? 34  PHE B CZ  1 
ATOM   1794 N  N   . VAL B 1 36  ? -14.859 -44.070 12.087 1.00 27.40  ? 35  VAL B N   1 
ATOM   1795 C  CA  . VAL B 1 36  ? -15.576 -45.347 12.091 1.00 26.11  ? 35  VAL B CA  1 
ATOM   1796 C  C   . VAL B 1 36  ? -14.685 -46.510 11.625 1.00 26.08  ? 35  VAL B C   1 
ATOM   1797 O  O   . VAL B 1 36  ? -14.674 -47.577 12.241 1.00 32.46  ? 35  VAL B O   1 
ATOM   1798 C  CB  . VAL B 1 36  ? -16.883 -45.259 11.234 1.00 30.25  ? 35  VAL B CB  1 
ATOM   1799 C  CG1 . VAL B 1 36  ? -17.448 -46.639 10.921 1.00 45.11  ? 35  VAL B CG1 1 
ATOM   1800 C  CG2 . VAL B 1 36  ? -17.932 -44.411 11.936 1.00 22.13  ? 35  VAL B CG2 1 
ATOM   1801 N  N   . ASP B 1 37  ? -13.935 -46.297 10.548 1.00 23.57  ? 36  ASP B N   1 
ATOM   1802 C  CA  . ASP B 1 37  ? -13.087 -47.353 9.995  1.00 22.47  ? 36  ASP B CA  1 
ATOM   1803 C  C   . ASP B 1 37  ? -11.680 -47.356 10.628 1.00 16.73  ? 36  ASP B C   1 
ATOM   1804 O  O   . ASP B 1 37  ? -10.736 -46.750 10.101 1.00 19.46  ? 36  ASP B O   1 
ATOM   1805 C  CB  . ASP B 1 37  ? -13.032 -47.240 8.468  1.00 22.91  ? 36  ASP B CB  1 
ATOM   1806 C  CG  . ASP B 1 37  ? -12.508 -48.497 7.804  1.00 26.29  ? 36  ASP B CG  1 
ATOM   1807 O  OD1 . ASP B 1 37  ? -11.894 -49.334 8.498  1.00 24.62  ? 36  ASP B OD1 1 
ATOM   1808 O  OD2 . ASP B 1 37  ? -12.694 -48.633 6.578  1.00 16.68  ? 36  ASP B OD2 1 
ATOM   1809 N  N   . GLU B 1 38  ? -11.568 -48.061 11.754 1.00 24.16  ? 37  GLU B N   1 
ATOM   1810 C  CA  . GLU B 1 38  ? -10.364 -48.090 12.601 1.00 26.83  ? 37  GLU B CA  1 
ATOM   1811 C  C   . GLU B 1 38  ? -9.134  -48.665 11.889 1.00 29.83  ? 37  GLU B C   1 
ATOM   1812 O  O   . GLU B 1 38  ? -8.015  -48.190 12.099 1.00 28.18  ? 37  GLU B O   1 
ATOM   1813 C  CB  . GLU B 1 38  ? -10.659 -48.880 13.892 1.00 43.65  ? 37  GLU B CB  1 
ATOM   1814 C  CG  . GLU B 1 38  ? -9.565  -48.847 14.964 1.00 58.34  ? 37  GLU B CG  1 
ATOM   1815 C  CD  . GLU B 1 38  ? -9.421  -47.488 15.645 1.00 78.66  ? 37  GLU B CD  1 
ATOM   1816 O  OE1 . GLU B 1 38  ? -8.299  -47.168 16.095 1.00 87.53  ? 37  GLU B OE1 1 
ATOM   1817 O  OE2 . GLU B 1 38  ? -10.421 -46.740 15.736 1.00 81.03  ? 37  GLU B OE2 1 
ATOM   1818 N  N   . ARG B 1 39  ? -9.351  -49.686 11.058 1.00 20.94  ? 38  ARG B N   1 
ATOM   1819 C  CA  . ARG B 1 39  ? -8.286  -50.270 10.247 1.00 23.98  ? 38  ARG B CA  1 
ATOM   1820 C  C   . ARG B 1 39  ? -7.811  -49.312 9.169  1.00 19.37  ? 38  ARG B C   1 
ATOM   1821 O  O   . ARG B 1 39  ? -6.608  -49.198 8.926  1.00 25.33  ? 38  ARG B O   1 
ATOM   1822 C  CB  . ARG B 1 39  ? -8.725  -51.596 9.604  1.00 29.58  ? 38  ARG B CB  1 
ATOM   1823 C  CG  . ARG B 1 39  ? -8.441  -52.821 10.449 1.00 39.13  ? 38  ARG B CG  1 
ATOM   1824 C  CD  . ARG B 1 39  ? -8.527  -54.121 9.636  1.00 30.50  ? 38  ARG B CD  1 
ATOM   1825 N  NE  . ARG B 1 39  ? -7.402  -54.317 8.711  1.00 13.03  ? 38  ARG B NE  1 
ATOM   1826 C  CZ  . ARG B 1 39  ? -6.189  -54.748 9.062  1.00 19.76  ? 38  ARG B CZ  1 
ATOM   1827 N  NH1 . ARG B 1 39  ? -5.896  -55.017 10.330 1.00 23.17  ? 38  ARG B NH1 1 
ATOM   1828 N  NH2 . ARG B 1 39  ? -5.252  -54.896 8.141  1.00 22.47  ? 38  ARG B NH2 1 
ATOM   1829 N  N   . ALA B 1 40  ? -8.750  -48.633 8.514  1.00 19.63  ? 39  ALA B N   1 
ATOM   1830 C  CA  . ALA B 1 40  ? -8.397  -47.635 7.504  1.00 23.06  ? 39  ALA B CA  1 
ATOM   1831 C  C   . ALA B 1 40  ? -7.672  -46.433 8.114  1.00 20.37  ? 39  ALA B C   1 
ATOM   1832 O  O   . ALA B 1 40  ? -6.822  -45.831 7.458  1.00 19.34  ? 39  ALA B O   1 
ATOM   1833 C  CB  . ALA B 1 40  ? -9.636  -47.181 6.722  1.00 13.80  ? 39  ALA B CB  1 
ATOM   1834 N  N   . TRP B 1 41  ? -8.026  -46.085 9.356  1.00 20.81  ? 40  TRP B N   1 
ATOM   1835 C  CA  . TRP B 1 41  ? -7.349  -45.020 10.098 1.00 18.15  ? 40  TRP B CA  1 
ATOM   1836 C  C   . TRP B 1 41  ? -5.899  -45.418 10.351 1.00 15.75  ? 40  TRP B C   1 
ATOM   1837 O  O   . TRP B 1 41  ? -4.975  -44.673 10.011 1.00 23.97  ? 40  TRP B O   1 
ATOM   1838 C  CB  . TRP B 1 41  ? -8.069  -44.723 11.425 1.00 19.32  ? 40  TRP B CB  1 
ATOM   1839 C  CG  . TRP B 1 41  ? -7.326  -43.752 12.295 1.00 23.07  ? 40  TRP B CG  1 
ATOM   1840 C  CD1 . TRP B 1 41  ? -7.396  -42.388 12.246 1.00 20.60  ? 40  TRP B CD1 1 
ATOM   1841 C  CD2 . TRP B 1 41  ? -6.384  -44.070 13.335 1.00 26.85  ? 40  TRP B CD2 1 
ATOM   1842 N  NE1 . TRP B 1 41  ? -6.556  -41.838 13.185 1.00 24.88  ? 40  TRP B NE1 1 
ATOM   1843 C  CE2 . TRP B 1 41  ? -5.923  -42.845 13.866 1.00 25.91  ? 40  TRP B CE2 1 
ATOM   1844 C  CE3 . TRP B 1 41  ? -5.884  -45.272 13.866 1.00 23.11  ? 40  TRP B CE3 1 
ATOM   1845 C  CZ2 . TRP B 1 41  ? -4.987  -42.783 14.907 1.00 17.69  ? 40  TRP B CZ2 1 
ATOM   1846 C  CZ3 . TRP B 1 41  ? -4.952  -45.209 14.903 1.00 27.32  ? 40  TRP B CZ3 1 
ATOM   1847 C  CH2 . TRP B 1 41  ? -4.519  -43.972 15.414 1.00 28.00  ? 40  TRP B CH2 1 
ATOM   1848 N  N   . LYS B 1 42  ? -5.722  -46.603 10.936 1.00 25.10  ? 41  LYS B N   1 
ATOM   1849 C  CA  . LYS B 1 42  ? -4.401  -47.152 11.268 1.00 26.03  ? 41  LYS B CA  1 
ATOM   1850 C  C   . LYS B 1 42  ? -3.500  -47.273 10.043 1.00 17.99  ? 41  LYS B C   1 
ATOM   1851 O  O   . LYS B 1 42  ? -2.309  -46.978 10.125 1.00 29.32  ? 41  LYS B O   1 
ATOM   1852 C  CB  . LYS B 1 42  ? -4.544  -48.510 11.979 1.00 22.28  ? 41  LYS B CB  1 
ATOM   1853 C  CG  . LYS B 1 42  ? -3.307  -48.968 12.745 1.00 43.37  ? 41  LYS B CG  1 
ATOM   1854 C  CD  . LYS B 1 42  ? -3.118  -48.174 14.032 1.00 63.50  ? 41  LYS B CD  1 
ATOM   1855 C  CE  . LYS B 1 42  ? -1.687  -48.245 14.537 1.00 69.19  ? 41  LYS B CE  1 
ATOM   1856 N  NZ  . LYS B 1 42  ? -1.413  -47.158 15.519 1.00 64.79  ? 41  LYS B NZ  1 
ATOM   1857 N  N   . GLU B 1 43  ? -4.071  -47.688 8.911  1.00 23.63  ? 42  GLU B N   1 
ATOM   1858 C  CA  . GLU B 1 43  ? -3.316  -47.791 7.653  1.00 21.51  ? 42  GLU B CA  1 
ATOM   1859 C  C   . GLU B 1 43  ? -2.860  -46.443 7.111  1.00 17.91  ? 42  GLU B C   1 
ATOM   1860 O  O   . GLU B 1 43  ? -1.716  -46.307 6.663  1.00 20.83  ? 42  GLU B O   1 
ATOM   1861 C  CB  . GLU B 1 43  ? -4.106  -48.544 6.571  1.00 27.55  ? 42  GLU B CB  1 
ATOM   1862 C  CG  . GLU B 1 43  ? -3.531  -48.340 5.152  1.00 59.92  ? 42  GLU B CG  1 
ATOM   1863 C  CD  . GLU B 1 43  ? -3.488  -49.596 4.291  1.00 77.85  ? 42  GLU B CD  1 
ATOM   1864 O  OE1 . GLU B 1 43  ? -3.005  -49.493 3.141  1.00 80.24  ? 42  GLU B OE1 1 
ATOM   1865 O  OE2 . GLU B 1 43  ? -3.922  -50.677 4.748  1.00 85.83  ? 42  GLU B OE2 1 
ATOM   1866 N  N   . LEU B 1 44  ? -3.756  -45.455 7.139  1.00 20.93  ? 43  LEU B N   1 
ATOM   1867 C  CA  . LEU B 1 44  ? -3.429  -44.122 6.641  1.00 16.41  ? 43  LEU B CA  1 
ATOM   1868 C  C   . LEU B 1 44  ? -2.405  -43.421 7.539  1.00 15.88  ? 43  LEU B C   1 
ATOM   1869 O  O   . LEU B 1 44  ? -1.533  -42.692 7.038  1.00 18.49  ? 43  LEU B O   1 
ATOM   1870 C  CB  . LEU B 1 44  ? -4.695  -43.281 6.440  1.00 16.72  ? 43  LEU B CB  1 
ATOM   1871 C  CG  . LEU B 1 44  ? -4.625  -41.983 5.626  1.00 22.57  ? 43  LEU B CG  1 
ATOM   1872 C  CD1 . LEU B 1 44  ? -4.017  -42.197 4.231  1.00 26.65  ? 43  LEU B CD1 1 
ATOM   1873 C  CD2 . LEU B 1 44  ? -6.011  -41.390 5.510  1.00 15.61  ? 43  LEU B CD2 1 
ATOM   1874 N  N   . VAL B 1 45  ? -2.505  -43.652 8.851  1.00 17.68  ? 44  VAL B N   1 
ATOM   1875 C  CA  . VAL B 1 45  ? -1.495  -43.170 9.815  1.00 21.79  ? 44  VAL B CA  1 
ATOM   1876 C  C   . VAL B 1 45  ? -0.103  -43.759 9.494  1.00 23.28  ? 44  VAL B C   1 
ATOM   1877 O  O   . VAL B 1 45  ? 0.880   -43.019 9.393  1.00 26.43  ? 44  VAL B O   1 
ATOM   1878 C  CB  . VAL B 1 45  ? -1.926  -43.417 11.307 1.00 19.29  ? 44  VAL B CB  1 
ATOM   1879 C  CG1 . VAL B 1 45  ? -0.807  -43.105 12.274 1.00 14.66  ? 44  VAL B CG1 1 
ATOM   1880 C  CG2 . VAL B 1 45  ? -3.134  -42.553 11.666 1.00 12.90  ? 44  VAL B CG2 1 
ATOM   1881 N  N   . GLU B 1 46  ? -0.038  -45.076 9.290  1.00 27.48  ? 45  GLU B N   1 
ATOM   1882 C  CA  . GLU B 1 46  ? 1.226   -45.764 8.988  1.00 34.55  ? 45  GLU B CA  1 
ATOM   1883 C  C   . GLU B 1 46  ? 1.823   -45.347 7.641  1.00 27.05  ? 45  GLU B C   1 
ATOM   1884 O  O   . GLU B 1 46  ? 3.036   -45.153 7.522  1.00 42.25  ? 45  GLU B O   1 
ATOM   1885 C  CB  . GLU B 1 46  ? 1.039   -47.284 9.051  1.00 26.19  ? 45  GLU B CB  1 
ATOM   1886 C  CG  . GLU B 1 46  ? 0.938   -47.830 10.476 1.00 50.48  ? 45  GLU B CG  1 
ATOM   1887 C  CD  . GLU B 1 46  ? 0.435   -49.270 10.563 1.00 55.02  ? 45  GLU B CD  1 
ATOM   1888 O  OE1 . GLU B 1 46  ? 0.473   -50.007 9.550  1.00 53.29  ? 45  GLU B OE1 1 
ATOM   1889 O  OE2 . GLU B 1 46  ? 0.002   -49.670 11.666 1.00 65.19  ? 45  GLU B OE2 1 
ATOM   1890 N  N   . LYS B 1 47  ? 0.955   -45.184 6.646  1.00 25.60  ? 46  LYS B N   1 
ATOM   1891 C  CA  . LYS B 1 47  ? 1.345   -44.888 5.267  1.00 28.79  ? 46  LYS B CA  1 
ATOM   1892 C  C   . LYS B 1 47  ? 1.704   -43.424 5.022  1.00 29.05  ? 46  LYS B C   1 
ATOM   1893 O  O   . LYS B 1 47  ? 2.588   -43.128 4.217  1.00 48.78  ? 46  LYS B O   1 
ATOM   1894 C  CB  . LYS B 1 47  ? 0.213   -45.303 4.319  1.00 39.21  ? 46  LYS B CB  1 
ATOM   1895 C  CG  . LYS B 1 47  ? 0.604   -45.420 2.856  1.00 55.42  ? 46  LYS B CG  1 
ATOM   1896 C  CD  . LYS B 1 47  ? -0.587  -45.795 1.974  1.00 54.47  ? 46  LYS B CD  1 
ATOM   1897 C  CE  . LYS B 1 47  ? -1.283  -44.569 1.400  1.00 63.77  ? 46  LYS B CE  1 
ATOM   1898 N  NZ  . LYS B 1 47  ? -1.957  -44.851 0.092  1.00 40.42  ? 46  LYS B NZ  1 
ATOM   1899 N  N   . GLU B 1 48  ? 1.012   -42.512 5.706  1.00 31.13  ? 47  GLU B N   1 
ATOM   1900 C  CA  . GLU B 1 48  ? 1.151   -41.081 5.443  1.00 35.79  ? 47  GLU B CA  1 
ATOM   1901 C  C   . GLU B 1 48  ? 1.052   -40.205 6.701  1.00 35.56  ? 47  GLU B C   1 
ATOM   1902 O  O   . GLU B 1 48  ? 1.853   -39.280 6.876  1.00 32.57  ? 47  GLU B O   1 
ATOM   1903 C  CB  . GLU B 1 48  ? 0.104   -40.641 4.412  1.00 24.25  ? 47  GLU B CB  1 
ATOM   1904 C  CG  . GLU B 1 48  ? 0.361   -39.285 3.783  1.00 28.18  ? 47  GLU B CG  1 
ATOM   1905 C  CD  . GLU B 1 48  ? -0.834  -38.766 2.997  1.00 42.01  ? 47  GLU B CD  1 
ATOM   1906 O  OE1 . GLU B 1 48  ? -0.729  -37.656 2.435  1.00 41.32  ? 47  GLU B OE1 1 
ATOM   1907 O  OE2 . GLU B 1 48  ? -1.877  -39.461 2.937  1.00 32.69  ? 47  GLU B OE2 1 
ATOM   1908 N  N   . ASP B 1 49  ? 0.078   -40.508 7.563  1.00 23.02  ? 48  ASP B N   1 
ATOM   1909 C  CA  . ASP B 1 49  ? -0.300  -39.658 8.706  1.00 22.04  ? 48  ASP B CA  1 
ATOM   1910 C  C   . ASP B 1 49  ? -0.495  -38.213 8.258  1.00 16.08  ? 48  ASP B C   1 
ATOM   1911 O  O   . ASP B 1 49  ? 0.258   -37.327 8.669  1.00 20.28  ? 48  ASP B O   1 
ATOM   1912 C  CB  . ASP B 1 49  ? 0.737   -39.745 9.845  1.00 32.84  ? 48  ASP B CB  1 
ATOM   1913 C  CG  . ASP B 1 49  ? 0.222   -39.172 11.163 1.00 36.24  ? 48  ASP B CG  1 
ATOM   1914 O  OD1 . ASP B 1 49  ? -0.998  -38.944 11.281 1.00 23.71  ? 48  ASP B OD1 1 
ATOM   1915 O  OD2 . ASP B 1 49  ? 1.040   -38.952 12.087 1.00 29.29  ? 48  ASP B OD2 1 
ATOM   1916 N  N   . PRO B 1 50  ? -1.506  -37.960 7.401  1.00 14.93  ? 49  PRO B N   1 
ATOM   1917 C  CA  . PRO B 1 50  ? -1.592  -36.612 6.850  1.00 18.15  ? 49  PRO B CA  1 
ATOM   1918 C  C   . PRO B 1 50  ? -2.045  -35.588 7.899  1.00 14.26  ? 49  PRO B C   1 
ATOM   1919 O  O   . PRO B 1 50  ? -2.563  -35.975 8.959  1.00 16.04  ? 49  PRO B O   1 
ATOM   1920 C  CB  . PRO B 1 50  ? -2.647  -36.751 5.750  1.00 20.05  ? 49  PRO B CB  1 
ATOM   1921 C  CG  . PRO B 1 50  ? -3.509  -37.902 6.195  1.00 16.08  ? 49  PRO B CG  1 
ATOM   1922 C  CD  . PRO B 1 50  ? -2.599  -38.834 6.927  1.00 16.37  ? 49  PRO B CD  1 
ATOM   1923 N  N   . VAL B 1 51  ? -1.819  -34.310 7.602  1.00 12.31  ? 50  VAL B N   1 
ATOM   1924 C  CA  . VAL B 1 51  ? -2.418  -33.200 8.345  1.00 21.58  ? 50  VAL B CA  1 
ATOM   1925 C  C   . VAL B 1 51  ? -3.913  -33.182 7.990  1.00 24.25  ? 50  VAL B C   1 
ATOM   1926 O  O   . VAL B 1 51  ? -4.270  -33.077 6.819  1.00 13.35  ? 50  VAL B O   1 
ATOM   1927 C  CB  . VAL B 1 51  ? -1.754  -31.831 7.980  1.00 20.42  ? 50  VAL B CB  1 
ATOM   1928 C  CG1 . VAL B 1 51  ? -2.456  -30.651 8.677  1.00 15.63  ? 50  VAL B CG1 1 
ATOM   1929 C  CG2 . VAL B 1 51  ? -0.272  -31.827 8.338  1.00 26.87  ? 50  VAL B CG2 1 
ATOM   1930 N  N   . VAL B 1 52  ? -4.777  -33.312 8.995  1.00 19.08  ? 51  VAL B N   1 
ATOM   1931 C  CA  . VAL B 1 52  ? -6.231  -33.201 8.778  1.00 7.82   ? 51  VAL B CA  1 
ATOM   1932 C  C   . VAL B 1 52  ? -6.660  -31.726 8.766  1.00 9.67   ? 51  VAL B C   1 
ATOM   1933 O  O   . VAL B 1 52  ? -7.361  -31.278 7.853  1.00 15.33  ? 51  VAL B O   1 
ATOM   1934 C  CB  . VAL B 1 52  ? -7.035  -34.006 9.834  1.00 14.04  ? 51  VAL B CB  1 
ATOM   1935 C  CG1 . VAL B 1 52  ? -8.543  -33.963 9.534  1.00 13.91  ? 51  VAL B CG1 1 
ATOM   1936 C  CG2 . VAL B 1 52  ? -6.546  -35.459 9.877  1.00 14.66  ? 51  VAL B CG2 1 
ATOM   1937 N  N   . TYR B 1 53  ? -6.241  -30.980 9.786  1.00 9.03   ? 52  TYR B N   1 
ATOM   1938 C  CA  . TYR B 1 53  ? -6.501  -29.548 9.842  1.00 17.22  ? 52  TYR B CA  1 
ATOM   1939 C  C   . TYR B 1 53  ? -5.432  -28.753 10.590 1.00 14.12  ? 52  TYR B C   1 
ATOM   1940 O  O   . TYR B 1 53  ? -4.672  -29.298 11.392 1.00 15.24  ? 52  TYR B O   1 
ATOM   1941 C  CB  . TYR B 1 53  ? -7.910  -29.251 10.390 1.00 16.55  ? 52  TYR B CB  1 
ATOM   1942 C  CG  . TYR B 1 53  ? -8.211  -29.733 11.799 1.00 13.06  ? 52  TYR B CG  1 
ATOM   1943 C  CD1 . TYR B 1 53  ? -8.262  -28.832 12.868 1.00 14.74  ? 52  TYR B CD1 1 
ATOM   1944 C  CD2 . TYR B 1 53  ? -8.487  -31.074 12.056 1.00 6.17   ? 52  TYR B CD2 1 
ATOM   1945 C  CE1 . TYR B 1 53  ? -8.568  -29.264 14.166 1.00 13.78  ? 52  TYR B CE1 1 
ATOM   1946 C  CE2 . TYR B 1 53  ? -8.781  -31.521 13.339 1.00 10.27  ? 52  TYR B CE2 1 
ATOM   1947 C  CZ  . TYR B 1 53  ? -8.827  -30.608 14.386 1.00 14.93  ? 52  TYR B CZ  1 
ATOM   1948 O  OH  . TYR B 1 53  ? -9.110  -31.052 15.652 1.00 21.29  ? 52  TYR B OH  1 
ATOM   1949 N  N   . GLU B 1 54  ? -5.378  -27.466 10.270 1.00 15.70  ? 53  GLU B N   1 
ATOM   1950 C  CA  . GLU B 1 54  ? -4.541  -26.487 10.945 1.00 27.20  ? 53  GLU B CA  1 
ATOM   1951 C  C   . GLU B 1 54  ? -5.416  -25.329 11.397 1.00 19.53  ? 53  GLU B C   1 
ATOM   1952 O  O   . GLU B 1 54  ? -6.276  -24.863 10.649 1.00 17.30  ? 53  GLU B O   1 
ATOM   1953 C  CB  . GLU B 1 54  ? -3.464  -25.956 9.995  1.00 14.98  ? 53  GLU B CB  1 
ATOM   1954 C  CG  . GLU B 1 54  ? -2.292  -26.893 9.790  1.00 29.20  ? 53  GLU B CG  1 
ATOM   1955 C  CD  . GLU B 1 54  ? -1.557  -26.631 8.487  1.00 39.17  ? 53  GLU B CD  1 
ATOM   1956 O  OE1 . GLU B 1 54  ? -2.131  -25.958 7.595  1.00 26.30  ? 53  GLU B OE1 1 
ATOM   1957 O  OE2 . GLU B 1 54  ? -0.408  -27.106 8.353  1.00 44.31  ? 53  GLU B OE2 1 
ATOM   1958 N  N   . VAL B 1 55  ? -5.178  -24.859 12.614 1.00 19.30  ? 54  VAL B N   1 
ATOM   1959 C  CA  . VAL B 1 55  ? -5.905  -23.727 13.171 1.00 17.02  ? 54  VAL B CA  1 
ATOM   1960 C  C   . VAL B 1 55  ? -4.963  -22.537 13.387 1.00 17.47  ? 54  VAL B C   1 
ATOM   1961 O  O   . VAL B 1 55  ? -3.845  -22.701 13.864 1.00 17.74  ? 54  VAL B O   1 
ATOM   1962 C  CB  . VAL B 1 55  ? -6.605  -24.110 14.508 1.00 17.54  ? 54  VAL B CB  1 
ATOM   1963 C  CG1 . VAL B 1 55  ? -7.340  -22.919 15.114 1.00 11.59  ? 54  VAL B CG1 1 
ATOM   1964 C  CG2 . VAL B 1 55  ? -7.568  -25.254 14.295 1.00 11.76  ? 54  VAL B CG2 1 
ATOM   1965 N  N   . TYR B 1 56  ? -5.426  -21.348 13.012 1.00 14.58  ? 55  TYR B N   1 
ATOM   1966 C  CA  . TYR B 1 56  ? -4.754  -20.106 13.356 1.00 14.53  ? 55  TYR B CA  1 
ATOM   1967 C  C   . TYR B 1 56  ? -5.665  -19.313 14.283 1.00 18.24  ? 55  TYR B C   1 
ATOM   1968 O  O   . TYR B 1 56  ? -6.635  -18.713 13.820 1.00 15.74  ? 55  TYR B O   1 
ATOM   1969 C  CB  . TYR B 1 56  ? -4.427  -19.305 12.087 1.00 18.56  ? 55  TYR B CB  1 
ATOM   1970 C  CG  . TYR B 1 56  ? -3.518  -20.027 11.108 1.00 22.18  ? 55  TYR B CG  1 
ATOM   1971 C  CD1 . TYR B 1 56  ? -4.043  -20.902 10.153 1.00 15.86  ? 55  TYR B CD1 1 
ATOM   1972 C  CD2 . TYR B 1 56  ? -2.130  -19.834 11.140 1.00 32.36  ? 55  TYR B CD2 1 
ATOM   1973 C  CE1 . TYR B 1 56  ? -3.211  -21.564 9.248  1.00 17.86  ? 55  TYR B CE1 1 
ATOM   1974 C  CE2 . TYR B 1 56  ? -1.282  -20.499 10.238 1.00 13.76  ? 55  TYR B CE2 1 
ATOM   1975 C  CZ  . TYR B 1 56  ? -1.832  -21.357 9.300  1.00 28.52  ? 55  TYR B CZ  1 
ATOM   1976 O  OH  . TYR B 1 56  ? -1.009  -22.007 8.412  1.00 27.75  ? 55  TYR B OH  1 
ATOM   1977 N  N   . ALA B 1 57  ? -5.357  -19.329 15.583 1.00 14.70  ? 56  ALA B N   1 
ATOM   1978 C  CA  . ALA B 1 57  ? -6.223  -18.732 16.616 1.00 13.47  ? 56  ALA B CA  1 
ATOM   1979 C  C   . ALA B 1 57  ? -5.704  -17.419 17.196 1.00 25.70  ? 56  ALA B C   1 
ATOM   1980 O  O   . ALA B 1 57  ? -4.521  -17.302 17.522 1.00 22.01  ? 56  ALA B O   1 
ATOM   1981 C  CB  . ALA B 1 57  ? -6.474  -19.737 17.753 1.00 4.50   ? 56  ALA B CB  1 
ATOM   1982 N  N   . VAL B 1 58  ? -6.598  -16.437 17.322 1.00 11.91  ? 57  VAL B N   1 
ATOM   1983 C  CA  . VAL B 1 58  ? -6.311  -15.182 18.042 1.00 8.90   ? 57  VAL B CA  1 
ATOM   1984 C  C   . VAL B 1 58  ? -7.222  -15.078 19.268 1.00 21.88  ? 57  VAL B C   1 
ATOM   1985 O  O   . VAL B 1 58  ? -8.407  -14.764 19.157 1.00 15.21  ? 57  VAL B O   1 
ATOM   1986 C  CB  . VAL B 1 58  ? -6.413  -13.913 17.150 1.00 13.54  ? 57  VAL B CB  1 
ATOM   1987 C  CG1 . VAL B 1 58  ? -6.065  -12.673 17.946 1.00 14.80  ? 57  VAL B CG1 1 
ATOM   1988 C  CG2 . VAL B 1 58  ? -5.475  -14.004 15.928 1.00 15.89  ? 57  VAL B CG2 1 
ATOM   1989 N  N   . GLU B 1 59  ? -6.645  -15.336 20.438 1.00 12.34  ? 58  GLU B N   1 
ATOM   1990 C  CA  . GLU B 1 59  ? -7.421  -15.544 21.659 1.00 19.85  ? 58  GLU B CA  1 
ATOM   1991 C  C   . GLU B 1 59  ? -7.120  -14.536 22.756 1.00 20.77  ? 58  GLU B C   1 
ATOM   1992 O  O   . GLU B 1 59  ? -5.966  -14.139 22.962 1.00 19.31  ? 58  GLU B O   1 
ATOM   1993 C  CB  . GLU B 1 59  ? -7.211  -16.971 22.176 1.00 17.64  ? 58  GLU B CB  1 
ATOM   1994 C  CG  . GLU B 1 59  ? -7.670  -18.037 21.185 1.00 26.88  ? 58  GLU B CG  1 
ATOM   1995 C  CD  . GLU B 1 59  ? -7.649  -19.445 21.750 1.00 41.33  ? 58  GLU B CD  1 
ATOM   1996 O  OE1 . GLU B 1 59  ? -6.693  -19.790 22.476 1.00 34.82  ? 58  GLU B OE1 1 
ATOM   1997 O  OE2 . GLU B 1 59  ? -8.593  -20.213 21.452 1.00 52.49  ? 58  GLU B OE2 1 
ATOM   1998 N  N   . GLN B 1 60  ? -8.176  -14.119 23.446 1.00 11.79  ? 59  GLN B N   1 
ATOM   1999 C  CA  . GLN B 1 60  ? -8.063  -13.212 24.582 1.00 13.33  ? 59  GLN B CA  1 
ATOM   2000 C  C   . GLN B 1 60  ? -8.088  -14.013 25.871 1.00 16.38  ? 59  GLN B C   1 
ATOM   2001 O  O   . GLN B 1 60  ? -8.156  -15.246 25.846 1.00 17.79  ? 59  GLN B O   1 
ATOM   2002 C  CB  . GLN B 1 60  ? -9.212  -12.195 24.581 1.00 5.20   ? 59  GLN B CB  1 
ATOM   2003 C  CG  . GLN B 1 60  ? -9.385  -11.427 23.268 1.00 11.04  ? 59  GLN B CG  1 
ATOM   2004 C  CD  . GLN B 1 60  ? -8.127  -10.683 22.844 1.00 16.70  ? 59  GLN B CD  1 
ATOM   2005 O  OE1 . GLN B 1 60  ? -7.476  -10.011 23.655 1.00 16.91  ? 59  GLN B OE1 1 
ATOM   2006 N  NE2 . GLN B 1 60  ? -7.774  -10.807 21.566 1.00 13.36  ? 59  GLN B NE2 1 
ATOM   2007 N  N   . GLU B 1 61  ? -8.037  -13.306 26.996 1.00 20.46  ? 60  GLU B N   1 
ATOM   2008 C  CA  . GLU B 1 61  ? -8.240  -13.916 28.303 1.00 32.91  ? 60  GLU B CA  1 
ATOM   2009 C  C   . GLU B 1 61  ? -9.691  -14.370 28.396 1.00 28.45  ? 60  GLU B C   1 
ATOM   2010 O  O   . GLU B 1 61  ? -10.559 -13.816 27.710 1.00 15.66  ? 60  GLU B O   1 
ATOM   2011 C  CB  . GLU B 1 61  ? -7.920  -12.915 29.414 1.00 27.43  ? 60  GLU B CB  1 
ATOM   2012 C  CG  . GLU B 1 61  ? -7.116  -13.507 30.554 1.00 65.59  ? 60  GLU B CG  1 
ATOM   2013 C  CD  . GLU B 1 61  ? -5.628  -13.637 30.248 1.00 70.90  ? 60  GLU B CD  1 
ATOM   2014 O  OE1 . GLU B 1 61  ? -5.139  -12.963 29.315 1.00 80.28  ? 60  GLU B OE1 1 
ATOM   2015 O  OE2 . GLU B 1 61  ? -4.943  -14.408 30.954 1.00 61.42  ? 60  GLU B OE2 1 
ATOM   2016 N  N   . GLU B 1 62  ? -9.949  -15.376 29.231 1.00 21.60  ? 61  GLU B N   1 
ATOM   2017 C  CA  . GLU B 1 62  ? -11.286 -15.951 29.356 1.00 23.09  ? 61  GLU B CA  1 
ATOM   2018 C  C   . GLU B 1 62  ? -12.197 -15.019 30.136 1.00 26.26  ? 61  GLU B C   1 
ATOM   2019 O  O   . GLU B 1 62  ? -12.387 -15.169 31.346 1.00 30.80  ? 61  GLU B O   1 
ATOM   2020 C  CB  . GLU B 1 62  ? -11.239 -17.331 30.014 1.00 12.21  ? 61  GLU B CB  1 
ATOM   2021 C  CG  . GLU B 1 62  ? -10.503 -18.396 29.224 1.00 21.69  ? 61  GLU B CG  1 
ATOM   2022 C  CD  . GLU B 1 62  ? -10.517 -19.751 29.926 1.00 36.76  ? 61  GLU B CD  1 
ATOM   2023 O  OE1 . GLU B 1 62  ? -11.138 -19.869 31.007 1.00 57.25  ? 61  GLU B OE1 1 
ATOM   2024 O  OE2 . GLU B 1 62  ? -9.904  -20.700 29.400 1.00 47.62  ? 61  GLU B OE2 1 
ATOM   2025 N  N   . LYS B 1 63  ? -12.746 -14.039 29.432 1.00 28.63  ? 62  LYS B N   1 
ATOM   2026 C  CA  . LYS B 1 63  ? -13.582 -13.043 30.067 1.00 25.53  ? 62  LYS B CA  1 
ATOM   2027 C  C   . LYS B 1 63  ? -14.942 -12.979 29.393 1.00 30.65  ? 62  LYS B C   1 
ATOM   2028 O  O   . LYS B 1 63  ? -15.063 -13.042 28.167 1.00 15.14  ? 62  LYS B O   1 
ATOM   2029 C  CB  . LYS B 1 63  ? -12.888 -11.671 30.067 1.00 34.57  ? 62  LYS B CB  1 
ATOM   2030 C  CG  . LYS B 1 63  ? -13.535 -10.593 30.950 1.00 41.86  ? 62  LYS B CG  1 
ATOM   2031 C  CD  . LYS B 1 63  ? -13.616 -10.999 32.430 1.00 60.17  ? 62  LYS B CD  1 
ATOM   2032 C  CE  . LYS B 1 63  ? -14.117 -9.852  33.316 1.00 48.99  ? 62  LYS B CE  1 
ATOM   2033 N  NZ  . LYS B 1 63  ? -15.472 -9.356  32.947 1.00 51.76  ? 62  LYS B NZ  1 
ATOM   2034 N  N   . GLU B 1 64  ? -15.966 -12.876 30.225 1.00 17.77  ? 63  GLU B N   1 
ATOM   2035 C  CA  . GLU B 1 64  ? -17.326 -12.653 29.777 1.00 14.89  ? 63  GLU B CA  1 
ATOM   2036 C  C   . GLU B 1 64  ? -17.405 -11.409 28.877 1.00 11.39  ? 63  GLU B C   1 
ATOM   2037 O  O   . GLU B 1 64  ? -16.886 -10.339 29.218 1.00 19.95  ? 63  GLU B O   1 
ATOM   2038 C  CB  . GLU B 1 64  ? -18.227 -12.504 31.007 1.00 13.00  ? 63  GLU B CB  1 
ATOM   2039 C  CG  . GLU B 1 64  ? -19.611 -11.997 30.716 1.00 41.40  ? 63  GLU B CG  1 
ATOM   2040 C  CD  . GLU B 1 64  ? -20.473 -11.886 31.957 1.00 50.80  ? 63  GLU B CD  1 
ATOM   2041 O  OE1 . GLU B 1 64  ? -20.223 -12.650 32.930 1.00 31.09  ? 63  GLU B OE1 1 
ATOM   2042 O  OE2 . GLU B 1 64  ? -21.408 -11.040 31.933 1.00 28.47  ? 63  GLU B OE2 1 
ATOM   2043 N  N   . GLY B 1 65  ? -18.024 -11.569 27.711 1.00 11.44  ? 64  GLY B N   1 
ATOM   2044 C  CA  . GLY B 1 65  ? -18.264 -10.443 26.803 1.00 8.12   ? 64  GLY B CA  1 
ATOM   2045 C  C   . GLY B 1 65  ? -17.202 -10.204 25.759 1.00 10.03  ? 64  GLY B C   1 
ATOM   2046 O  O   . GLY B 1 65  ? -17.426 -9.452  24.809 1.00 10.11  ? 64  GLY B O   1 
ATOM   2047 N  N   . ASP B 1 66  ? -16.042 -10.832 25.944 1.00 11.44  ? 65  ASP B N   1 
ATOM   2048 C  CA  . ASP B 1 66  ? -14.913 -10.676 25.041 1.00 12.38  ? 65  ASP B CA  1 
ATOM   2049 C  C   . ASP B 1 66  ? -14.996 -11.776 23.966 1.00 11.49  ? 65  ASP B C   1 
ATOM   2050 O  O   . ASP B 1 66  ? -15.817 -12.688 24.073 1.00 11.18  ? 65  ASP B O   1 
ATOM   2051 C  CB  . ASP B 1 66  ? -13.601 -10.743 25.842 1.00 9.11   ? 65  ASP B CB  1 
ATOM   2052 C  CG  . ASP B 1 66  ? -12.464 -9.996  25.182 1.00 18.24  ? 65  ASP B CG  1 
ATOM   2053 O  OD1 . ASP B 1 66  ? -12.501 -9.759  23.953 1.00 22.40  ? 65  ASP B OD1 1 
ATOM   2054 O  OD2 . ASP B 1 66  ? -11.509 -9.646  25.904 1.00 6.47   ? 65  ASP B OD2 1 
ATOM   2055 N  N   . LEU B 1 67  ? -14.168 -11.676 22.923 1.00 13.59  ? 66  LEU B N   1 
ATOM   2056 C  CA  . LEU B 1 67  ? -14.280 -12.582 21.774 1.00 13.80  ? 66  LEU B CA  1 
ATOM   2057 C  C   . LEU B 1 67  ? -12.939 -13.093 21.283 1.00 21.42  ? 66  LEU B C   1 
ATOM   2058 O  O   . LEU B 1 67  ? -11.975 -12.335 21.229 1.00 8.17   ? 66  LEU B O   1 
ATOM   2059 C  CB  . LEU B 1 67  ? -14.975 -11.878 20.602 1.00 17.53  ? 66  LEU B CB  1 
ATOM   2060 C  CG  . LEU B 1 67  ? -16.439 -11.468 20.727 1.00 10.83  ? 66  LEU B CG  1 
ATOM   2061 C  CD1 . LEU B 1 67  ? -16.816 -10.614 19.531 1.00 10.54  ? 66  LEU B CD1 1 
ATOM   2062 C  CD2 . LEU B 1 67  ? -17.347 -12.713 20.823 1.00 10.29  ? 66  LEU B CD2 1 
ATOM   2063 N  N   . ASN B 1 68  ? -12.910 -14.378 20.926 1.00 19.68  ? 67  ASN B N   1 
ATOM   2064 C  CA  . ASN B 1 68  ? -11.812 -14.994 20.178 1.00 21.38  ? 67  ASN B CA  1 
ATOM   2065 C  C   . ASN B 1 68  ? -12.204 -15.187 18.708 1.00 18.31  ? 67  ASN B C   1 
ATOM   2066 O  O   . ASN B 1 68  ? -13.390 -15.225 18.365 1.00 13.54  ? 67  ASN B O   1 
ATOM   2067 C  CB  . ASN B 1 68  ? -11.452 -16.373 20.753 1.00 6.59   ? 67  ASN B CB  1 
ATOM   2068 C  CG  . ASN B 1 68  ? -10.919 -16.313 22.178 1.00 12.06  ? 67  ASN B CG  1 
ATOM   2069 O  OD1 . ASN B 1 68  ? -10.623 -15.248 22.710 1.00 9.13   ? 67  ASN B OD1 1 
ATOM   2070 N  ND2 . ASN B 1 68  ? -10.792 -17.475 22.800 1.00 10.06  ? 67  ASN B ND2 1 
ATOM   2071 N  N   . PHE B 1 69  ? -11.201 -15.303 17.847 1.00 17.84  ? 68  PHE B N   1 
ATOM   2072 C  CA  . PHE B 1 69  ? -11.430 -15.719 16.467 1.00 13.66  ? 68  PHE B CA  1 
ATOM   2073 C  C   . PHE B 1 69  ? -10.302 -16.628 15.977 1.00 21.18  ? 68  PHE B C   1 
ATOM   2074 O  O   . PHE B 1 69  ? -9.175  -16.593 16.504 1.00 11.92  ? 68  PHE B O   1 
ATOM   2075 C  CB  . PHE B 1 69  ? -11.730 -14.524 15.532 1.00 10.92  ? 68  PHE B CB  1 
ATOM   2076 C  CG  . PHE B 1 69  ? -10.565 -13.589 15.312 1.00 19.17  ? 68  PHE B CG  1 
ATOM   2077 C  CD1 . PHE B 1 69  ? -9.719  -13.758 14.211 1.00 9.80   ? 68  PHE B CD1 1 
ATOM   2078 C  CD2 . PHE B 1 69  ? -10.330 -12.526 16.185 1.00 9.54   ? 68  PHE B CD2 1 
ATOM   2079 C  CE1 . PHE B 1 69  ? -8.643  -12.886 13.993 1.00 19.26  ? 68  PHE B CE1 1 
ATOM   2080 C  CE2 . PHE B 1 69  ? -9.257  -11.659 15.986 1.00 16.42  ? 68  PHE B CE2 1 
ATOM   2081 C  CZ  . PHE B 1 69  ? -8.413  -11.832 14.882 1.00 21.51  ? 68  PHE B CZ  1 
ATOM   2082 N  N   . ALA B 1 70  ? -10.626 -17.477 15.008 1.00 19.20  ? 69  ALA B N   1 
ATOM   2083 C  CA  . ALA B 1 70  ? -9.650  -18.407 14.444 1.00 14.26  ? 69  ALA B CA  1 
ATOM   2084 C  C   . ALA B 1 70  ? -10.055 -18.811 13.036 1.00 21.84  ? 69  ALA B C   1 
ATOM   2085 O  O   . ALA B 1 70  ? -11.238 -19.004 12.762 1.00 13.93  ? 69  ALA B O   1 
ATOM   2086 C  CB  . ALA B 1 70  ? -9.533  -19.645 15.329 1.00 11.51  ? 69  ALA B CB  1 
ATOM   2087 N  N   . THR B 1 71  ? -9.083  -18.928 12.140 1.00 19.11  ? 70  THR B N   1 
ATOM   2088 C  CA  . THR B 1 71  ? -9.324  -19.617 10.878 1.00 9.73   ? 70  THR B CA  1 
ATOM   2089 C  C   . THR B 1 71  ? -8.938  -21.079 10.998 1.00 11.85  ? 70  THR B C   1 
ATOM   2090 O  O   . THR B 1 71  ? -8.080  -21.444 11.804 1.00 21.08  ? 70  THR B O   1 
ATOM   2091 C  CB  . THR B 1 71  ? -8.529  -19.036 9.686  1.00 16.90  ? 70  THR B CB  1 
ATOM   2092 O  OG1 . THR B 1 71  ? -7.144  -18.964 10.035 1.00 18.85  ? 70  THR B OG1 1 
ATOM   2093 C  CG2 . THR B 1 71  ? -9.054  -17.665 9.281  1.00 9.77   ? 70  THR B CG2 1 
ATOM   2094 N  N   . THR B 1 72  ? -9.563  -21.910 10.166 1.00 11.80  ? 71  THR B N   1 
ATOM   2095 C  CA  . THR B 1 72  ? -9.191  -23.313 10.071 1.00 8.06   ? 71  THR B CA  1 
ATOM   2096 C  C   . THR B 1 72  ? -9.026  -23.706 8.609  1.00 20.36  ? 71  THR B C   1 
ATOM   2097 O  O   . THR B 1 72  ? -9.801  -23.284 7.741  1.00 15.66  ? 71  THR B O   1 
ATOM   2098 C  CB  . THR B 1 72  ? -10.214 -24.215 10.796 1.00 11.82  ? 71  THR B CB  1 
ATOM   2099 O  OG1 . THR B 1 72  ? -10.311 -23.817 12.174 1.00 16.75  ? 71  THR B OG1 1 
ATOM   2100 C  CG2 . THR B 1 72  ? -9.832  -25.690 10.722 1.00 10.56  ? 71  THR B CG2 1 
ATOM   2101 N  N   . VAL B 1 73  ? -7.979  -24.481 8.347  1.00 21.13  ? 72  VAL B N   1 
ATOM   2102 C  CA  . VAL B 1 73  ? -7.748  -25.081 7.043  1.00 22.58  ? 72  VAL B CA  1 
ATOM   2103 C  C   . VAL B 1 73  ? -7.967  -26.581 7.216  1.00 16.23  ? 72  VAL B C   1 
ATOM   2104 O  O   . VAL B 1 73  ? -7.158  -27.267 7.846  1.00 11.58  ? 72  VAL B O   1 
ATOM   2105 C  CB  . VAL B 1 73  ? -6.310  -24.811 6.516  1.00 17.07  ? 72  VAL B CB  1 
ATOM   2106 C  CG1 . VAL B 1 73  ? -6.153  -25.324 5.080  1.00 10.07  ? 72  VAL B CG1 1 
ATOM   2107 C  CG2 . VAL B 1 73  ? -5.980  -23.332 6.598  1.00 19.25  ? 72  VAL B CG2 1 
ATOM   2108 N  N   . LEU B 1 74  ? -9.078  -27.072 6.674  1.00 14.18  ? 73  LEU B N   1 
ATOM   2109 C  CA  . LEU B 1 74  ? -9.417  -28.480 6.752  1.00 18.09  ? 73  LEU B CA  1 
ATOM   2110 C  C   . LEU B 1 74  ? -9.067  -29.113 5.413  1.00 13.52  ? 73  LEU B C   1 
ATOM   2111 O  O   . LEU B 1 74  ? -9.701  -28.827 4.397  1.00 14.20  ? 73  LEU B O   1 
ATOM   2112 C  CB  . LEU B 1 74  ? -10.912 -28.664 7.049  1.00 13.36  ? 73  LEU B CB  1 
ATOM   2113 C  CG  . LEU B 1 74  ? -11.441 -29.696 8.052  1.00 26.69  ? 73  LEU B CG  1 
ATOM   2114 C  CD1 . LEU B 1 74  ? -12.936 -29.938 7.821  1.00 21.03  ? 73  LEU B CD1 1 
ATOM   2115 C  CD2 . LEU B 1 74  ? -10.695 -31.001 8.030  1.00 5.27   ? 73  LEU B CD2 1 
ATOM   2116 N  N   . TYR B 1 75  ? -8.060  -29.979 5.431  1.00 17.02  ? 74  TYR B N   1 
ATOM   2117 C  CA  . TYR B 1 75  ? -7.558  -30.619 4.222  1.00 28.59  ? 74  TYR B CA  1 
ATOM   2118 C  C   . TYR B 1 75  ? -8.488  -31.694 3.665  1.00 28.82  ? 74  TYR B C   1 
ATOM   2119 O  O   . TYR B 1 75  ? -9.216  -32.349 4.425  1.00 16.78  ? 74  TYR B O   1 
ATOM   2120 C  CB  . TYR B 1 75  ? -6.134  -31.138 4.454  1.00 18.84  ? 74  TYR B CB  1 
ATOM   2121 C  CG  . TYR B 1 75  ? -5.170  -29.989 4.623  1.00 16.01  ? 74  TYR B CG  1 
ATOM   2122 C  CD1 . TYR B 1 75  ? -4.692  -29.288 3.516  1.00 25.26  ? 74  TYR B CD1 1 
ATOM   2123 C  CD2 . TYR B 1 75  ? -4.783  -29.563 5.891  1.00 22.18  ? 74  TYR B CD2 1 
ATOM   2124 C  CE1 . TYR B 1 75  ? -3.822  -28.209 3.667  1.00 26.02  ? 74  TYR B CE1 1 
ATOM   2125 C  CE2 . TYR B 1 75  ? -3.921  -28.491 6.052  1.00 20.25  ? 74  TYR B CE2 1 
ATOM   2126 C  CZ  . TYR B 1 75  ? -3.444  -27.820 4.939  1.00 27.77  ? 74  TYR B CZ  1 
ATOM   2127 O  OH  . TYR B 1 75  ? -2.588  -26.759 5.106  1.00 30.11  ? 74  TYR B OH  1 
ATOM   2128 N  N   . PRO B 1 76  ? -8.483  -31.865 2.327  1.00 23.21  ? 75  PRO B N   1 
ATOM   2129 C  CA  . PRO B 1 76  ? -9.335  -32.886 1.714  1.00 16.96  ? 75  PRO B CA  1 
ATOM   2130 C  C   . PRO B 1 76  ? -8.803  -34.294 1.961  1.00 14.81  ? 75  PRO B C   1 
ATOM   2131 O  O   . PRO B 1 76  ? -7.588  -34.510 2.025  1.00 17.97  ? 75  PRO B O   1 
ATOM   2132 C  CB  . PRO B 1 76  ? -9.285  -32.537 0.228  1.00 17.93  ? 75  PRO B CB  1 
ATOM   2133 C  CG  . PRO B 1 76  ? -7.922  -31.909 0.048  1.00 22.36  ? 75  PRO B CG  1 
ATOM   2134 C  CD  . PRO B 1 76  ? -7.692  -31.123 1.322  1.00 12.45  ? 75  PRO B CD  1 
ATOM   2135 N  N   . GLY B 1 77  ? -9.718  -35.243 2.105  1.00 19.78  ? 76  GLY B N   1 
ATOM   2136 C  CA  . GLY B 1 77  ? -9.351  -36.619 2.394  1.00 15.48  ? 76  GLY B CA  1 
ATOM   2137 C  C   . GLY B 1 77  ? -10.493 -37.415 2.989  1.00 15.40  ? 76  GLY B C   1 
ATOM   2138 O  O   . GLY B 1 77  ? -11.519 -36.860 3.404  1.00 19.92  ? 76  GLY B O   1 
ATOM   2139 N  N   . LYS B 1 78  ? -10.298 -38.724 3.021  1.00 18.16  ? 77  LYS B N   1 
ATOM   2140 C  CA  . LYS B 1 78  ? -11.232 -39.667 3.609  1.00 30.13  ? 77  LYS B CA  1 
ATOM   2141 C  C   . LYS B 1 78  ? -10.450 -40.693 4.411  1.00 14.93  ? 77  LYS B C   1 
ATOM   2142 O  O   . LYS B 1 78  ? -9.320  -41.037 4.053  1.00 18.72  ? 77  LYS B O   1 
ATOM   2143 C  CB  . LYS B 1 78  ? -12.022 -40.391 2.517  1.00 22.40  ? 77  LYS B CB  1 
ATOM   2144 C  CG  . LYS B 1 78  ? -13.004 -39.513 1.761  1.00 25.74  ? 77  LYS B CG  1 
ATOM   2145 C  CD  . LYS B 1 78  ? -13.660 -40.270 0.625  1.00 26.95  ? 77  LYS B CD  1 
ATOM   2146 C  CE  . LYS B 1 78  ? -12.943 -40.013 -0.677 1.00 44.62  ? 77  LYS B CE  1 
ATOM   2147 N  NZ  . LYS B 1 78  ? -13.409 -40.934 -1.743 1.00 73.50  ? 77  LYS B NZ  1 
ATOM   2148 N  N   . VAL B 1 79  ? -11.048 -41.154 5.506  1.00 16.27  ? 78  VAL B N   1 
ATOM   2149 C  CA  . VAL B 1 79  ? -10.598 -42.354 6.215  1.00 22.94  ? 78  VAL B CA  1 
ATOM   2150 C  C   . VAL B 1 79  ? -11.650 -43.408 5.890  1.00 27.73  ? 78  VAL B C   1 
ATOM   2151 O  O   . VAL B 1 79  ? -12.761 -43.374 6.429  1.00 24.12  ? 78  VAL B O   1 
ATOM   2152 C  CB  . VAL B 1 79  ? -10.484 -42.135 7.751  1.00 21.18  ? 78  VAL B CB  1 
ATOM   2153 C  CG1 . VAL B 1 79  ? -10.164 -43.452 8.485  1.00 15.04  ? 78  VAL B CG1 1 
ATOM   2154 C  CG2 . VAL B 1 79  ? -9.434  -41.074 8.070  1.00 18.03  ? 78  VAL B CG2 1 
ATOM   2155 N  N   . GLY B 1 80  ? -11.311 -44.325 4.986  1.00 19.20  ? 79  GLY B N   1 
ATOM   2156 C  CA  . GLY B 1 80  ? -12.314 -45.229 4.422  1.00 19.54  ? 79  GLY B CA  1 
ATOM   2157 C  C   . GLY B 1 80  ? -13.214 -44.412 3.515  1.00 16.75  ? 79  GLY B C   1 
ATOM   2158 O  O   . GLY B 1 80  ? -12.736 -43.781 2.574  1.00 24.07  ? 79  GLY B O   1 
ATOM   2159 N  N   . LYS B 1 81  ? -14.512 -44.409 3.812  1.00 27.20  ? 80  LYS B N   1 
ATOM   2160 C  CA  . LYS B 1 81  ? -15.495 -43.616 3.076  1.00 21.14  ? 80  LYS B CA  1 
ATOM   2161 C  C   . LYS B 1 81  ? -15.758 -42.268 3.767  1.00 19.39  ? 80  LYS B C   1 
ATOM   2162 O  O   . LYS B 1 81  ? -16.371 -41.373 3.185  1.00 21.52  ? 80  LYS B O   1 
ATOM   2163 C  CB  . LYS B 1 81  ? -16.830 -44.369 2.993  1.00 33.34  ? 80  LYS B CB  1 
ATOM   2164 C  CG  . LYS B 1 81  ? -16.831 -45.710 2.261  1.00 34.58  ? 80  LYS B CG  1 
ATOM   2165 C  CD  . LYS B 1 81  ? -18.282 -46.205 2.117  1.00 30.56  ? 80  LYS B CD  1 
ATOM   2166 C  CE  . LYS B 1 81  ? -18.420 -47.333 1.116  1.00 36.48  ? 80  LYS B CE  1 
ATOM   2167 N  NZ  . LYS B 1 81  ? -17.985 -48.634 1.688  1.00 52.05  ? 80  LYS B NZ  1 
ATOM   2168 N  N   . GLU B 1 82  ? -15.305 -42.143 5.012  1.00 14.93  ? 81  GLU B N   1 
ATOM   2169 C  CA  . GLU B 1 82  ? -15.647 -41.004 5.873  1.00 22.70  ? 81  GLU B CA  1 
ATOM   2170 C  C   . GLU B 1 82  ? -14.725 -39.808 5.635  1.00 19.40  ? 81  GLU B C   1 
ATOM   2171 O  O   . GLU B 1 82  ? -13.509 -39.913 5.813  1.00 20.75  ? 81  GLU B O   1 
ATOM   2172 C  CB  . GLU B 1 82  ? -15.598 -41.447 7.337  1.00 13.20  ? 81  GLU B CB  1 
ATOM   2173 C  CG  . GLU B 1 82  ? -16.142 -40.455 8.356  1.00 18.72  ? 81  GLU B CG  1 
ATOM   2174 C  CD  . GLU B 1 82  ? -16.233 -41.051 9.768  1.00 26.23  ? 81  GLU B CD  1 
ATOM   2175 O  OE1 . GLU B 1 82  ? -15.470 -41.988 10.078 1.00 20.51  ? 81  GLU B OE1 1 
ATOM   2176 O  OE2 . GLU B 1 82  ? -17.064 -40.579 10.572 1.00 21.06  ? 81  GLU B OE2 1 
ATOM   2177 N  N   . PHE B 1 83  ? -15.312 -38.683 5.222  1.00 18.27  ? 82  PHE B N   1 
ATOM   2178 C  CA  . PHE B 1 83  ? -14.563 -37.462 4.915  1.00 21.58  ? 82  PHE B CA  1 
ATOM   2179 C  C   . PHE B 1 83  ? -13.823 -36.925 6.146  1.00 25.64  ? 82  PHE B C   1 
ATOM   2180 O  O   . PHE B 1 83  ? -14.289 -37.091 7.286  1.00 13.98  ? 82  PHE B O   1 
ATOM   2181 C  CB  . PHE B 1 83  ? -15.494 -36.364 4.390  1.00 17.04  ? 82  PHE B CB  1 
ATOM   2182 C  CG  . PHE B 1 83  ? -16.047 -36.606 2.996  1.00 16.15  ? 82  PHE B CG  1 
ATOM   2183 C  CD1 . PHE B 1 83  ? -17.380 -36.975 2.817  1.00 19.68  ? 82  PHE B CD1 1 
ATOM   2184 C  CD2 . PHE B 1 83  ? -15.256 -36.411 1.871  1.00 20.90  ? 82  PHE B CD2 1 
ATOM   2185 C  CE1 . PHE B 1 83  ? -17.905 -37.177 1.544  1.00 16.59  ? 82  PHE B CE1 1 
ATOM   2186 C  CE2 . PHE B 1 83  ? -15.775 -36.604 0.590  1.00 23.43  ? 82  PHE B CE2 1 
ATOM   2187 C  CZ  . PHE B 1 83  ? -17.105 -36.986 0.425  1.00 13.17  ? 82  PHE B CZ  1 
ATOM   2188 N  N   . PHE B 1 84  ? -12.677 -36.284 5.903  1.00 20.31  ? 83  PHE B N   1 
ATOM   2189 C  CA  . PHE B 1 84  ? -11.897 -35.600 6.943  1.00 18.29  ? 83  PHE B CA  1 
ATOM   2190 C  C   . PHE B 1 84  ? -12.749 -34.559 7.648  1.00 23.36  ? 83  PHE B C   1 
ATOM   2191 O  O   . PHE B 1 84  ? -13.528 -33.854 7.014  1.00 11.10  ? 83  PHE B O   1 
ATOM   2192 C  CB  . PHE B 1 84  ? -10.683 -34.886 6.324  1.00 10.43  ? 83  PHE B CB  1 
ATOM   2193 C  CG  . PHE B 1 84  ? -9.484  -35.771 6.109  1.00 16.41  ? 83  PHE B CG  1 
ATOM   2194 C  CD1 . PHE B 1 84  ? -9.559  -37.153 6.292  1.00 18.16  ? 83  PHE B CD1 1 
ATOM   2195 C  CD2 . PHE B 1 84  ? -8.274  -35.216 5.697  1.00 12.18  ? 83  PHE B CD2 1 
ATOM   2196 C  CE1 . PHE B 1 84  ? -8.444  -37.961 6.084  1.00 18.29  ? 83  PHE B CE1 1 
ATOM   2197 C  CE2 . PHE B 1 84  ? -7.160  -36.019 5.478  1.00 13.17  ? 83  PHE B CE2 1 
ATOM   2198 C  CZ  . PHE B 1 84  ? -7.246  -37.390 5.670  1.00 15.43  ? 83  PHE B CZ  1 
ATOM   2199 N  N   . PHE B 1 85  ? -12.585 -34.463 8.962  1.00 12.60  ? 84  PHE B N   1 
ATOM   2200 C  CA  . PHE B 1 85  ? -13.337 -33.513 9.766  1.00 12.84  ? 84  PHE B CA  1 
ATOM   2201 C  C   . PHE B 1 85  ? -12.513 -33.008 10.952 1.00 15.80  ? 84  PHE B C   1 
ATOM   2202 O  O   . PHE B 1 85  ? -11.429 -33.541 11.237 1.00 15.92  ? 84  PHE B O   1 
ATOM   2203 C  CB  . PHE B 1 85  ? -14.686 -34.118 10.226 1.00 18.01  ? 84  PHE B CB  1 
ATOM   2204 C  CG  . PHE B 1 85  ? -14.575 -35.445 10.964 1.00 11.85  ? 84  PHE B CG  1 
ATOM   2205 C  CD1 . PHE B 1 85  ? -13.890 -35.545 12.175 1.00 19.46  ? 84  PHE B CD1 1 
ATOM   2206 C  CD2 . PHE B 1 85  ? -15.211 -36.580 10.465 1.00 17.47  ? 84  PHE B CD2 1 
ATOM   2207 C  CE1 . PHE B 1 85  ? -13.809 -36.762 12.862 1.00 21.59  ? 84  PHE B CE1 1 
ATOM   2208 C  CE2 . PHE B 1 85  ? -15.147 -37.793 11.143 1.00 20.28  ? 84  PHE B CE2 1 
ATOM   2209 C  CZ  . PHE B 1 85  ? -14.445 -37.884 12.346 1.00 12.85  ? 84  PHE B CZ  1 
ATOM   2210 N  N   . THR B 1 86  ? -13.013 -31.970 11.621 1.00 12.89  ? 85  THR B N   1 
ATOM   2211 C  CA  . THR B 1 86  ? -12.432 -31.525 12.891 1.00 13.82  ? 85  THR B CA  1 
ATOM   2212 C  C   . THR B 1 86  ? -12.856 -32.448 14.041 1.00 15.11  ? 85  THR B C   1 
ATOM   2213 O  O   . THR B 1 86  ? -13.887 -33.115 13.966 1.00 16.84  ? 85  THR B O   1 
ATOM   2214 C  CB  . THR B 1 86  ? -12.763 -30.037 13.222 1.00 14.14  ? 85  THR B CB  1 
ATOM   2215 O  OG1 . THR B 1 86  ? -14.182 -29.860 13.328 1.00 12.37  ? 85  THR B OG1 1 
ATOM   2216 C  CG2 . THR B 1 86  ? -12.208 -29.102 12.147 1.00 7.94   ? 85  THR B CG2 1 
ATOM   2217 N  N   . LYS B 1 87  ? -12.053 -32.502 15.103 1.00 13.61  ? 86  LYS B N   1 
ATOM   2218 C  CA  . LYS B 1 87  ? -12.404 -33.318 16.267 1.00 13.03  ? 86  LYS B CA  1 
ATOM   2219 C  C   . LYS B 1 87  ? -13.854 -33.047 16.726 1.00 23.72  ? 86  LYS B C   1 
ATOM   2220 O  O   . LYS B 1 87  ? -14.626 -33.982 16.966 1.00 26.32  ? 86  LYS B O   1 
ATOM   2221 C  CB  . LYS B 1 87  ? -11.421 -33.070 17.422 1.00 10.82  ? 86  LYS B CB  1 
ATOM   2222 C  CG  . LYS B 1 87  ? -10.049 -33.707 17.244 1.00 23.49  ? 86  LYS B CG  1 
ATOM   2223 C  CD  . LYS B 1 87  ? -9.173  -33.482 18.482 1.00 23.38  ? 86  LYS B CD  1 
ATOM   2224 C  CE  . LYS B 1 87  ? -7.843  -34.215 18.352 1.00 49.41  ? 86  LYS B CE  1 
ATOM   2225 N  NZ  . LYS B 1 87  ? -6.951  -34.074 19.542 1.00 46.18  ? 86  LYS B NZ  1 
ATOM   2226 N  N   . GLY B 1 88  ? -14.220 -31.767 16.815 1.00 18.49  ? 87  GLY B N   1 
ATOM   2227 C  CA  . GLY B 1 88  ? -15.559 -31.367 17.254 1.00 22.47  ? 87  GLY B CA  1 
ATOM   2228 C  C   . GLY B 1 88  ? -15.611 -31.223 18.766 1.00 23.08  ? 87  GLY B C   1 
ATOM   2229 O  O   . GLY B 1 88  ? -14.862 -31.887 19.475 1.00 25.02  ? 87  GLY B O   1 
ATOM   2230 N  N   . HIS B 1 89  ? -16.491 -30.357 19.261 1.00 27.02  ? 88  HIS B N   1 
ATOM   2231 C  CA  . HIS B 1 89  ? -16.575 -30.071 20.700 1.00 22.87  ? 88  HIS B CA  1 
ATOM   2232 C  C   . HIS B 1 89  ? -17.866 -29.359 21.101 1.00 21.43  ? 88  HIS B C   1 
ATOM   2233 O  O   . HIS B 1 89  ? -18.469 -28.648 20.297 1.00 24.54  ? 88  HIS B O   1 
ATOM   2234 C  CB  . HIS B 1 89  ? -15.380 -29.211 21.152 1.00 18.92  ? 88  HIS B CB  1 
ATOM   2235 C  CG  . HIS B 1 89  ? -15.265 -27.908 20.420 1.00 34.57  ? 88  HIS B CG  1 
ATOM   2236 N  ND1 . HIS B 1 89  ? -14.518 -27.764 19.271 1.00 42.39  ? 88  HIS B ND1 1 
ATOM   2237 C  CD2 . HIS B 1 89  ? -15.821 -26.696 20.661 1.00 36.10  ? 88  HIS B CD2 1 
ATOM   2238 C  CE1 . HIS B 1 89  ? -14.609 -26.519 18.841 1.00 28.40  ? 88  HIS B CE1 1 
ATOM   2239 N  NE2 . HIS B 1 89  ? -15.394 -25.850 19.668 1.00 39.54  ? 88  HIS B NE2 1 
ATOM   2240 N  N   . PHE B 1 90  ? -18.281 -29.574 22.349 1.00 26.86  ? 89  PHE B N   1 
ATOM   2241 C  CA  . PHE B 1 90  ? -19.189 -28.665 23.043 1.00 28.50  ? 89  PHE B CA  1 
ATOM   2242 C  C   . PHE B 1 90  ? -18.311 -27.569 23.649 1.00 31.74  ? 89  PHE B C   1 
ATOM   2243 O  O   . PHE B 1 90  ? -17.090 -27.717 23.728 1.00 23.25  ? 89  PHE B O   1 
ATOM   2244 C  CB  . PHE B 1 90  ? -19.935 -29.383 24.182 1.00 28.94  ? 89  PHE B CB  1 
ATOM   2245 C  CG  . PHE B 1 90  ? -21.053 -30.287 23.724 1.00 29.39  ? 89  PHE B CG  1 
ATOM   2246 C  CD1 . PHE B 1 90  ? -22.335 -29.781 23.502 1.00 18.16  ? 89  PHE B CD1 1 
ATOM   2247 C  CD2 . PHE B 1 90  ? -20.832 -31.654 23.551 1.00 24.53  ? 89  PHE B CD2 1 
ATOM   2248 C  CE1 . PHE B 1 90  ? -23.377 -30.620 23.093 1.00 20.02  ? 89  PHE B CE1 1 
ATOM   2249 C  CE2 . PHE B 1 90  ? -21.868 -32.499 23.141 1.00 26.70  ? 89  PHE B CE2 1 
ATOM   2250 C  CZ  . PHE B 1 90  ? -23.144 -31.978 22.915 1.00 17.89  ? 89  PHE B CZ  1 
ATOM   2251 N  N   . HIS B 1 91  ? -18.920 -26.473 24.082 1.00 21.43  ? 90  HIS B N   1 
ATOM   2252 C  CA  . HIS B 1 91  ? -18.173 -25.471 24.822 1.00 28.66  ? 90  HIS B CA  1 
ATOM   2253 C  C   . HIS B 1 91  ? -18.221 -25.791 26.313 1.00 26.57  ? 90  HIS B C   1 
ATOM   2254 O  O   . HIS B 1 91  ? -19.225 -26.313 26.801 1.00 25.76  ? 90  HIS B O   1 
ATOM   2255 C  CB  . HIS B 1 91  ? -18.705 -24.073 24.518 1.00 20.99  ? 90  HIS B CB  1 
ATOM   2256 C  CG  . HIS B 1 91  ? -18.448 -23.631 23.112 1.00 22.63  ? 90  HIS B CG  1 
ATOM   2257 N  ND1 . HIS B 1 91  ? -19.400 -22.995 22.345 1.00 30.94  ? 90  HIS B ND1 1 
ATOM   2258 C  CD2 . HIS B 1 91  ? -17.348 -23.749 22.328 1.00 15.05  ? 90  HIS B CD2 1 
ATOM   2259 C  CE1 . HIS B 1 91  ? -18.892 -22.723 21.155 1.00 27.05  ? 90  HIS B CE1 1 
ATOM   2260 N  NE2 . HIS B 1 91  ? -17.648 -23.166 21.121 1.00 26.99  ? 90  HIS B NE2 1 
ATOM   2261 N  N   . ALA B 1 92  ? -17.128 -25.506 27.021 1.00 21.56  ? 91  ALA B N   1 
ATOM   2262 C  CA  . ALA B 1 92  ? -17.057 -25.729 28.473 1.00 31.02  ? 91  ALA B CA  1 
ATOM   2263 C  C   . ALA B 1 92  ? -18.178 -24.986 29.207 1.00 21.72  ? 91  ALA B C   1 
ATOM   2264 O  O   . ALA B 1 92  ? -18.856 -25.563 30.059 1.00 26.43  ? 91  ALA B O   1 
ATOM   2265 C  CB  . ALA B 1 92  ? -15.682 -25.354 29.023 1.00 19.31  ? 91  ALA B CB  1 
ATOM   2266 N  N   . LYS B 1 93  ? -18.384 -23.717 28.855 1.00 27.15  ? 92  LYS B N   1 
ATOM   2267 C  CA  . LYS B 1 93  ? -19.620 -23.023 29.204 1.00 27.54  ? 92  LYS B CA  1 
ATOM   2268 C  C   . LYS B 1 93  ? -20.615 -23.303 28.080 1.00 30.61  ? 92  LYS B C   1 
ATOM   2269 O  O   . LYS B 1 93  ? -20.535 -22.705 26.998 1.00 24.19  ? 92  LYS B O   1 
ATOM   2270 C  CB  . LYS B 1 93  ? -19.388 -21.524 29.418 1.00 20.77  ? 92  LYS B CB  1 
ATOM   2271 C  CG  . LYS B 1 93  ? -18.537 -21.218 30.641 1.00 30.23  ? 92  LYS B CG  1 
ATOM   2272 C  CD  . LYS B 1 93  ? -18.300 -19.726 30.801 1.00 31.32  ? 92  LYS B CD  1 
ATOM   2273 C  CE  . LYS B 1 93  ? -18.444 -19.282 32.256 1.00 49.55  ? 92  LYS B CE  1 
ATOM   2274 N  NZ  . LYS B 1 93  ? -17.439 -19.874 33.187 1.00 43.91  ? 92  LYS B NZ  1 
ATOM   2275 N  N   . LEU B 1 94  ? -21.532 -24.234 28.348 1.00 25.73  ? 93  LEU B N   1 
ATOM   2276 C  CA  . LEU B 1 94  ? -22.397 -24.830 27.322 1.00 28.37  ? 93  LEU B CA  1 
ATOM   2277 C  C   . LEU B 1 94  ? -23.252 -23.856 26.522 1.00 24.34  ? 93  LEU B C   1 
ATOM   2278 O  O   . LEU B 1 94  ? -23.487 -24.083 25.337 1.00 23.71  ? 93  LEU B O   1 
ATOM   2279 C  CB  . LEU B 1 94  ? -23.298 -25.915 27.931 1.00 31.33  ? 93  LEU B CB  1 
ATOM   2280 C  CG  . LEU B 1 94  ? -22.755 -27.339 28.044 1.00 35.58  ? 93  LEU B CG  1 
ATOM   2281 C  CD1 . LEU B 1 94  ? -23.668 -28.167 28.931 1.00 31.93  ? 93  LEU B CD1 1 
ATOM   2282 C  CD2 . LEU B 1 94  ? -22.606 -27.980 26.659 1.00 30.75  ? 93  LEU B CD2 1 
ATOM   2283 N  N   . ASP B 1 95  ? -23.725 -22.788 27.164 1.00 21.92  ? 94  ASP B N   1 
ATOM   2284 C  CA  . ASP B 1 95  ? -24.648 -21.856 26.498 1.00 28.65  ? 94  ASP B CA  1 
ATOM   2285 C  C   . ASP B 1 95  ? -23.970 -20.846 25.554 1.00 21.74  ? 94  ASP B C   1 
ATOM   2286 O  O   . ASP B 1 95  ? -24.618 -19.930 25.051 1.00 31.85  ? 94  ASP B O   1 
ATOM   2287 C  CB  . ASP B 1 95  ? -25.556 -21.143 27.518 1.00 29.14  ? 94  ASP B CB  1 
ATOM   2288 C  CG  . ASP B 1 95  ? -24.796 -20.183 28.423 1.00 37.61  ? 94  ASP B CG  1 
ATOM   2289 O  OD1 . ASP B 1 95  ? -25.419 -19.629 29.354 1.00 35.18  ? 94  ASP B OD1 1 
ATOM   2290 O  OD2 . ASP B 1 95  ? -23.581 -19.973 28.209 1.00 38.11  ? 94  ASP B OD2 1 
ATOM   2291 N  N   . ARG B 1 96  ? -22.673 -21.013 25.316 1.00 24.37  ? 95  ARG B N   1 
ATOM   2292 C  CA  . ARG B 1 96  ? -21.946 -20.128 24.414 1.00 17.42  ? 95  ARG B CA  1 
ATOM   2293 C  C   . ARG B 1 96  ? -22.200 -20.510 22.944 1.00 11.75  ? 95  ARG B C   1 
ATOM   2294 O  O   . ARG B 1 96  ? -22.091 -21.683 22.574 1.00 18.68  ? 95  ARG B O   1 
ATOM   2295 C  CB  . ARG B 1 96  ? -20.450 -20.144 24.751 1.00 15.29  ? 95  ARG B CB  1 
ATOM   2296 C  CG  . ARG B 1 96  ? -19.972 -19.022 25.697 1.00 18.08  ? 95  ARG B CG  1 
ATOM   2297 C  CD  . ARG B 1 96  ? -20.796 -18.890 26.944 1.00 16.63  ? 95  ARG B CD  1 
ATOM   2298 N  NE  . ARG B 1 96  ? -20.288 -17.864 27.858 1.00 18.48  ? 95  ARG B NE  1 
ATOM   2299 C  CZ  . ARG B 1 96  ? -20.978 -17.353 28.878 1.00 18.77  ? 95  ARG B CZ  1 
ATOM   2300 N  NH1 . ARG B 1 96  ? -22.225 -17.753 29.124 1.00 18.48  ? 95  ARG B NH1 1 
ATOM   2301 N  NH2 . ARG B 1 96  ? -20.425 -16.433 29.653 1.00 14.91  ? 95  ARG B NH2 1 
ATOM   2302 N  N   . ALA B 1 97  ? -22.561 -19.510 22.137 1.00 13.75  ? 96  ALA B N   1 
ATOM   2303 C  CA  . ALA B 1 97  ? -22.751 -19.648 20.691 1.00 18.33  ? 96  ALA B CA  1 
ATOM   2304 C  C   . ALA B 1 97  ? -21.441 -19.466 19.926 1.00 17.25  ? 96  ALA B C   1 
ATOM   2305 O  O   . ALA B 1 97  ? -20.417 -19.131 20.514 1.00 19.31  ? 96  ALA B O   1 
ATOM   2306 C  CB  . ALA B 1 97  ? -23.783 -18.638 20.197 1.00 7.17   ? 96  ALA B CB  1 
ATOM   2307 N  N   . GLU B 1 98  ? -21.487 -19.705 18.613 1.00 9.96   ? 97  GLU B N   1 
ATOM   2308 C  CA  . GLU B 1 98  ? -20.364 -19.461 17.711 1.00 14.26  ? 97  GLU B CA  1 
ATOM   2309 C  C   . GLU B 1 98  ? -20.883 -19.036 16.337 1.00 17.87  ? 97  GLU B C   1 
ATOM   2310 O  O   . GLU B 1 98  ? -21.995 -19.392 15.954 1.00 13.67  ? 97  GLU B O   1 
ATOM   2311 C  CB  . GLU B 1 98  ? -19.463 -20.703 17.598 1.00 12.81  ? 97  GLU B CB  1 
ATOM   2312 C  CG  . GLU B 1 98  ? -18.069 -20.407 16.999 1.00 17.43  ? 97  GLU B CG  1 
ATOM   2313 C  CD  . GLU B 1 98  ? -17.029 -21.486 17.303 1.00 29.71  ? 97  GLU B CD  1 
ATOM   2314 O  OE1 . GLU B 1 98  ? -17.258 -22.325 18.198 1.00 27.52  ? 97  GLU B OE1 1 
ATOM   2315 O  OE2 . GLU B 1 98  ? -15.970 -21.491 16.645 1.00 35.63  ? 97  GLU B OE2 1 
ATOM   2316 N  N   . VAL B 1 99  ? -20.088 -18.245 15.617 1.00 12.50  ? 98  VAL B N   1 
ATOM   2317 C  CA  . VAL B 1 99  ? -20.391 -17.874 14.222 1.00 13.33  ? 98  VAL B CA  1 
ATOM   2318 C  C   . VAL B 1 99  ? -19.228 -18.304 13.321 1.00 16.26  ? 98  VAL B C   1 
ATOM   2319 O  O   . VAL B 1 99  ? -18.057 -18.014 13.622 1.00 11.32  ? 98  VAL B O   1 
ATOM   2320 C  CB  . VAL B 1 99  ? -20.694 -16.348 14.059 1.00 12.63  ? 98  VAL B CB  1 
ATOM   2321 C  CG1 . VAL B 1 99  ? -20.974 -15.972 12.571 1.00 7.95   ? 98  VAL B CG1 1 
ATOM   2322 C  CG2 . VAL B 1 99  ? -21.896 -15.928 14.935 1.00 9.97   ? 98  VAL B CG2 1 
ATOM   2323 N  N   . TYR B 1 100 ? -19.550 -19.022 12.244 1.00 14.34  ? 99  TYR B N   1 
ATOM   2324 C  CA  . TYR B 1 100 ? -18.551 -19.452 11.249 1.00 8.95   ? 99  TYR B CA  1 
ATOM   2325 C  C   . TYR B 1 100 ? -18.805 -18.774 9.916  1.00 19.22  ? 99  TYR B C   1 
ATOM   2326 O  O   . TYR B 1 100 ? -19.954 -18.673 9.488  1.00 14.44  ? 99  TYR B O   1 
ATOM   2327 C  CB  . TYR B 1 100 ? -18.651 -20.954 11.010 1.00 12.00  ? 99  TYR B CB  1 
ATOM   2328 C  CG  . TYR B 1 100 ? -18.053 -21.869 12.062 1.00 12.73  ? 99  TYR B CG  1 
ATOM   2329 C  CD1 . TYR B 1 100 ? -18.600 -21.965 13.348 1.00 11.91  ? 99  TYR B CD1 1 
ATOM   2330 C  CD2 . TYR B 1 100 ? -16.967 -22.689 11.744 1.00 17.56  ? 99  TYR B CD2 1 
ATOM   2331 C  CE1 . TYR B 1 100 ? -18.057 -22.842 14.294 1.00 10.14  ? 99  TYR B CE1 1 
ATOM   2332 C  CE2 . TYR B 1 100 ? -16.420 -23.562 12.675 1.00 14.19  ? 99  TYR B CE2 1 
ATOM   2333 C  CZ  . TYR B 1 100 ? -16.964 -23.632 13.947 1.00 21.55  ? 99  TYR B CZ  1 
ATOM   2334 O  OH  . TYR B 1 100 ? -16.412 -24.510 14.852 1.00 24.24  ? 99  TYR B OH  1 
ATOM   2335 N  N   . VAL B 1 101 ? -17.736 -18.333 9.252  1.00 7.97   ? 100 VAL B N   1 
ATOM   2336 C  CA  . VAL B 1 101 ? -17.818 -17.795 7.891  1.00 12.51  ? 100 VAL B CA  1 
ATOM   2337 C  C   . VAL B 1 101 ? -16.978 -18.655 6.939  1.00 17.95  ? 100 VAL B C   1 
ATOM   2338 O  O   . VAL B 1 101 ? -15.767 -18.749 7.100  1.00 15.23  ? 100 VAL B O   1 
ATOM   2339 C  CB  . VAL B 1 101 ? -17.288 -16.335 7.809  1.00 15.85  ? 100 VAL B CB  1 
ATOM   2340 C  CG1 . VAL B 1 101 ? -17.756 -15.668 6.504  1.00 14.23  ? 100 VAL B CG1 1 
ATOM   2341 C  CG2 . VAL B 1 101 ? -17.703 -15.516 9.045  1.00 20.98  ? 100 VAL B CG2 1 
ATOM   2342 N  N   . ALA B 1 102 ? -17.620 -19.287 5.960  1.00 11.15  ? 101 ALA B N   1 
ATOM   2343 C  CA  . ALA B 1 102 ? -16.912 -20.132 5.011  1.00 17.19  ? 101 ALA B CA  1 
ATOM   2344 C  C   . ALA B 1 102 ? -16.235 -19.276 3.951  1.00 8.60   ? 101 ALA B C   1 
ATOM   2345 O  O   . ALA B 1 102 ? -16.848 -18.349 3.394  1.00 14.05  ? 101 ALA B O   1 
ATOM   2346 C  CB  . ALA B 1 102 ? -17.850 -21.152 4.383  1.00 13.47  ? 101 ALA B CB  1 
ATOM   2347 N  N   . LEU B 1 103 ? -14.963 -19.589 3.691  1.00 15.74  ? 102 LEU B N   1 
ATOM   2348 C  CA  . LEU B 1 103 ? -14.113 -18.759 2.844  1.00 16.56  ? 102 LEU B CA  1 
ATOM   2349 C  C   . LEU B 1 103 ? -13.712 -19.424 1.529  1.00 18.61  ? 102 LEU B C   1 
ATOM   2350 O  O   . LEU B 1 103 ? -13.673 -18.762 0.489  1.00 22.78  ? 102 LEU B O   1 
ATOM   2351 C  CB  . LEU B 1 103 ? -12.857 -18.313 3.609  1.00 13.78  ? 102 LEU B CB  1 
ATOM   2352 C  CG  . LEU B 1 103 ? -13.066 -17.493 4.882  1.00 20.81  ? 102 LEU B CG  1 
ATOM   2353 C  CD1 . LEU B 1 103 ? -11.725 -17.131 5.512  1.00 27.60  ? 102 LEU B CD1 1 
ATOM   2354 C  CD2 . LEU B 1 103 ? -13.904 -16.256 4.611  1.00 8.18   ? 102 LEU B CD2 1 
ATOM   2355 N  N   . LYS B 1 104 ? -13.408 -20.721 1.580  1.00 18.73  ? 103 LYS B N   1 
ATOM   2356 C  CA  . LYS B 1 104 ? -12.941 -21.454 0.397  1.00 19.22  ? 103 LYS B CA  1 
ATOM   2357 C  C   . LYS B 1 104 ? -13.267 -22.938 0.508  1.00 23.29  ? 103 LYS B C   1 
ATOM   2358 O  O   . LYS B 1 104 ? -13.316 -23.488 1.614  1.00 13.48  ? 103 LYS B O   1 
ATOM   2359 C  CB  . LYS B 1 104 ? -11.429 -21.269 0.215  1.00 18.31  ? 103 LYS B CB  1 
ATOM   2360 C  CG  . LYS B 1 104 ? -10.964 -21.382 -1.231 1.00 28.14  ? 103 LYS B CG  1 
ATOM   2361 C  CD  . LYS B 1 104 ? -9.463  -21.271 -1.331 1.00 32.46  ? 103 LYS B CD  1 
ATOM   2362 C  CE  . LYS B 1 104 ? -9.007  -21.245 -2.781 1.00 27.62  ? 103 LYS B CE  1 
ATOM   2363 N  NZ  . LYS B 1 104 ? -7.529  -21.114 -2.860 1.00 51.72  ? 103 LYS B NZ  1 
ATOM   2364 N  N   . GLY B 1 105 ? -13.494 -23.574 -0.642 1.00 21.53  ? 104 GLY B N   1 
ATOM   2365 C  CA  . GLY B 1 105 ? -13.695 -25.020 -0.716 1.00 15.72  ? 104 GLY B CA  1 
ATOM   2366 C  C   . GLY B 1 105 ? -15.149 -25.407 -0.551 1.00 15.87  ? 104 GLY B C   1 
ATOM   2367 O  O   . GLY B 1 105 ? -16.037 -24.560 -0.637 1.00 24.01  ? 104 GLY B O   1 
ATOM   2368 N  N   . LYS B 1 106 ? -15.382 -26.695 -0.309 1.00 18.77  ? 105 LYS B N   1 
ATOM   2369 C  CA  . LYS B 1 106 ? -16.725 -27.226 -0.137 1.00 18.39  ? 105 LYS B CA  1 
ATOM   2370 C  C   . LYS B 1 106 ? -16.754 -28.124 1.098  1.00 16.98  ? 105 LYS B C   1 
ATOM   2371 O  O   . LYS B 1 106 ? -15.928 -29.021 1.262  1.00 18.03  ? 105 LYS B O   1 
ATOM   2372 C  CB  . LYS B 1 106 ? -17.157 -28.003 -1.379 1.00 30.23  ? 105 LYS B CB  1 
ATOM   2373 C  CG  . LYS B 1 106 ? -18.627 -27.840 -1.710 1.00 55.84  ? 105 LYS B CG  1 
ATOM   2374 C  CD  . LYS B 1 106 ? -19.088 -28.828 -2.772 1.00 67.02  ? 105 LYS B CD  1 
ATOM   2375 C  CE  . LYS B 1 106 ? -20.586 -28.706 -3.032 1.00 67.78  ? 105 LYS B CE  1 
ATOM   2376 N  NZ  . LYS B 1 106 ? -21.403 -28.903 -1.795 1.00 47.16  ? 105 LYS B NZ  1 
ATOM   2377 N  N   . GLY B 1 107 ? -17.700 -27.865 1.982  1.00 13.82  ? 106 GLY B N   1 
ATOM   2378 C  CA  . GLY B 1 107 ? -17.754 -28.594 3.232  1.00 9.33   ? 106 GLY B CA  1 
ATOM   2379 C  C   . GLY B 1 107 ? -19.092 -28.427 3.892  1.00 20.31  ? 106 GLY B C   1 
ATOM   2380 O  O   . GLY B 1 107 ? -20.107 -28.224 3.232  1.00 16.79  ? 106 GLY B O   1 
ATOM   2381 N  N   . GLY B 1 108 ? -19.088 -28.505 5.210  1.00 14.01  ? 107 GLY B N   1 
ATOM   2382 C  CA  . GLY B 1 108 ? -20.303 -28.359 5.969  1.00 12.74  ? 107 GLY B CA  1 
ATOM   2383 C  C   . GLY B 1 108 ? -20.036 -28.571 7.438  1.00 17.56  ? 107 GLY B C   1 
ATOM   2384 O  O   . GLY B 1 108 ? -18.922 -28.924 7.854  1.00 9.20   ? 107 GLY B O   1 
ATOM   2385 N  N   . MET B 1 109 ? -21.078 -28.367 8.222  1.00 9.61   ? 108 MET B N   1 
ATOM   2386 C  CA  . MET B 1 109 ? -20.998 -28.539 9.661  1.00 22.19  ? 108 MET B CA  1 
ATOM   2387 C  C   . MET B 1 109 ? -22.025 -29.529 10.173 1.00 16.69  ? 108 MET B C   1 
ATOM   2388 O  O   . MET B 1 109 ? -23.199 -29.465 9.792  1.00 15.30  ? 108 MET B O   1 
ATOM   2389 C  CB  . MET B 1 109 ? -21.197 -27.205 10.365 1.00 15.19  ? 108 MET B CB  1 
ATOM   2390 C  CG  . MET B 1 109 ? -20.923 -27.287 11.857 1.00 16.27  ? 108 MET B CG  1 
ATOM   2391 S  SD  . MET B 1 109 ? -21.134 -25.714 12.650 1.00 30.51  ? 108 MET B SD  1 
ATOM   2392 C  CE  . MET B 1 109 ? -20.030 -24.709 11.661 1.00 19.92  ? 108 MET B CE  1 
ATOM   2393 N  N   . LEU B 1 110 ? -21.563 -30.452 11.017 1.00 12.27  ? 109 LEU B N   1 
ATOM   2394 C  CA  . LEU B 1 110 ? -22.440 -31.325 11.797 1.00 13.09  ? 109 LEU B CA  1 
ATOM   2395 C  C   . LEU B 1 110 ? -22.624 -30.732 13.179 1.00 17.19  ? 109 LEU B C   1 
ATOM   2396 O  O   . LEU B 1 110 ? -21.644 -30.407 13.860 1.00 9.05   ? 109 LEU B O   1 
ATOM   2397 C  CB  . LEU B 1 110 ? -21.847 -32.730 11.960 1.00 19.22  ? 109 LEU B CB  1 
ATOM   2398 C  CG  . LEU B 1 110 ? -21.909 -33.749 10.825 1.00 35.66  ? 109 LEU B CG  1 
ATOM   2399 C  CD1 . LEU B 1 110 ? -21.016 -34.926 11.177 1.00 38.88  ? 109 LEU B CD1 1 
ATOM   2400 C  CD2 . LEU B 1 110 ? -23.342 -34.213 10.538 1.00 29.28  ? 109 LEU B CD2 1 
ATOM   2401 N  N   . LEU B 1 111 ? -23.878 -30.612 13.596 1.00 14.21  ? 110 LEU B N   1 
ATOM   2402 C  CA  . LEU B 1 111 ? -24.201 -30.083 14.919 1.00 25.40  ? 110 LEU B CA  1 
ATOM   2403 C  C   . LEU B 1 111 ? -25.014 -31.107 15.706 1.00 26.08  ? 110 LEU B C   1 
ATOM   2404 O  O   . LEU B 1 111 ? -25.709 -31.923 15.112 1.00 14.38  ? 110 LEU B O   1 
ATOM   2405 C  CB  . LEU B 1 111 ? -24.953 -28.753 14.809 1.00 26.22  ? 110 LEU B CB  1 
ATOM   2406 C  CG  . LEU B 1 111 ? -24.231 -27.594 14.116 1.00 14.66  ? 110 LEU B CG  1 
ATOM   2407 C  CD1 . LEU B 1 111 ? -24.735 -27.434 12.686 1.00 13.84  ? 110 LEU B CD1 1 
ATOM   2408 C  CD2 . LEU B 1 111 ? -24.446 -26.316 14.902 1.00 14.58  ? 110 LEU B CD2 1 
ATOM   2409 N  N   . GLN B 1 112 ? -24.916 -31.054 17.035 1.00 19.69  ? 111 GLN B N   1 
ATOM   2410 C  CA  . GLN B 1 112 ? -25.537 -32.044 17.909 1.00 22.04  ? 111 GLN B CA  1 
ATOM   2411 C  C   . GLN B 1 112 ? -25.830 -31.491 19.313 1.00 12.44  ? 111 GLN B C   1 
ATOM   2412 O  O   . GLN B 1 112 ? -24.995 -30.814 19.905 1.00 19.65  ? 111 GLN B O   1 
ATOM   2413 C  CB  . GLN B 1 112 ? -24.608 -33.252 18.001 1.00 30.85  ? 111 GLN B CB  1 
ATOM   2414 C  CG  . GLN B 1 112 ? -25.111 -34.395 18.832 1.00 36.67  ? 111 GLN B CG  1 
ATOM   2415 C  CD  . GLN B 1 112 ? -24.383 -35.667 18.514 1.00 36.30  ? 111 GLN B CD  1 
ATOM   2416 O  OE1 . GLN B 1 112 ? -24.348 -36.093 17.362 1.00 19.35  ? 111 GLN B OE1 1 
ATOM   2417 N  NE2 . GLN B 1 112 ? -23.787 -36.279 19.525 1.00 33.44  ? 111 GLN B NE2 1 
ATOM   2418 N  N   . THR B 1 113 ? -27.020 -31.788 19.833 1.00 17.23  ? 112 THR B N   1 
ATOM   2419 C  CA  . THR B 1 113 ? -27.419 -31.379 21.190 1.00 21.46  ? 112 THR B CA  1 
ATOM   2420 C  C   . THR B 1 113 ? -26.862 -32.392 22.184 1.00 19.83  ? 112 THR B C   1 
ATOM   2421 O  O   . THR B 1 113 ? -26.455 -33.480 21.773 1.00 31.61  ? 112 THR B O   1 
ATOM   2422 C  CB  . THR B 1 113 ? -28.963 -31.379 21.355 1.00 11.42  ? 112 THR B CB  1 
ATOM   2423 O  OG1 . THR B 1 113 ? -29.445 -32.731 21.301 1.00 20.39  ? 112 THR B OG1 1 
ATOM   2424 C  CG2 . THR B 1 113 ? -29.631 -30.566 20.269 1.00 19.21  ? 112 THR B CG2 1 
ATOM   2425 N  N   . PRO B 1 114 ? -26.846 -32.053 23.495 1.00 34.00  ? 113 PRO B N   1 
ATOM   2426 C  CA  . PRO B 1 114 ? -26.461 -33.048 24.506 1.00 35.36  ? 113 PRO B CA  1 
ATOM   2427 C  C   . PRO B 1 114 ? -27.267 -34.356 24.440 1.00 31.48  ? 113 PRO B C   1 
ATOM   2428 O  O   . PRO B 1 114 ? -26.797 -35.380 24.939 1.00 40.91  ? 113 PRO B O   1 
ATOM   2429 C  CB  . PRO B 1 114 ? -26.722 -32.319 25.831 1.00 29.53  ? 113 PRO B CB  1 
ATOM   2430 C  CG  . PRO B 1 114 ? -26.567 -30.879 25.493 1.00 34.51  ? 113 PRO B CG  1 
ATOM   2431 C  CD  . PRO B 1 114 ? -27.144 -30.745 24.112 1.00 28.88  ? 113 PRO B CD  1 
ATOM   2432 N  N   . GLU B 1 115 ? -28.454 -34.315 23.824 1.00 29.13  ? 114 GLU B N   1 
ATOM   2433 C  CA  . GLU B 1 115 ? -29.298 -35.508 23.611 1.00 38.79  ? 114 GLU B CA  1 
ATOM   2434 C  C   . GLU B 1 115 ? -29.005 -36.265 22.303 1.00 48.39  ? 114 GLU B C   1 
ATOM   2435 O  O   . GLU B 1 115 ? -29.617 -37.299 22.018 1.00 37.73  ? 114 GLU B O   1 
ATOM   2436 C  CB  . GLU B 1 115 ? -30.789 -35.144 23.674 1.00 32.79  ? 114 GLU B CB  1 
ATOM   2437 C  CG  . GLU B 1 115 ? -31.309 -34.883 25.078 1.00 48.05  ? 114 GLU B CG  1 
ATOM   2438 C  CD  . GLU B 1 115 ? -30.844 -33.554 25.634 1.00 51.75  ? 114 GLU B CD  1 
ATOM   2439 O  OE1 . GLU B 1 115 ? -31.058 -32.528 24.961 1.00 69.12  ? 114 GLU B OE1 1 
ATOM   2440 O  OE2 . GLU B 1 115 ? -30.263 -33.534 26.741 1.00 44.68  ? 114 GLU B OE2 1 
ATOM   2441 N  N   . GLY B 1 116 ? -28.077 -35.750 21.504 1.00 49.05  ? 115 GLY B N   1 
ATOM   2442 C  CA  . GLY B 1 116 ? -27.697 -36.424 20.268 1.00 33.83  ? 115 GLY B CA  1 
ATOM   2443 C  C   . GLY B 1 116 ? -28.541 -36.097 19.051 1.00 36.14  ? 115 GLY B C   1 
ATOM   2444 O  O   . GLY B 1 116 ? -28.369 -36.719 17.997 1.00 35.45  ? 115 GLY B O   1 
ATOM   2445 N  N   . ASP B 1 117 ? -29.456 -35.135 19.189 1.00 34.33  ? 116 ASP B N   1 
ATOM   2446 C  CA  . ASP B 1 117 ? -30.227 -34.628 18.044 1.00 35.09  ? 116 ASP B CA  1 
ATOM   2447 C  C   . ASP B 1 117 ? -29.239 -33.958 17.088 1.00 24.35  ? 116 ASP B C   1 
ATOM   2448 O  O   . ASP B 1 117 ? -28.528 -33.033 17.481 1.00 22.04  ? 116 ASP B O   1 
ATOM   2449 C  CB  . ASP B 1 117 ? -31.283 -33.601 18.485 1.00 27.80  ? 116 ASP B CB  1 
ATOM   2450 C  CG  . ASP B 1 117 ? -31.996 -33.986 19.786 1.00 65.51  ? 116 ASP B CG  1 
ATOM   2451 O  OD1 . ASP B 1 117 ? -32.104 -33.119 20.694 1.00 43.44  ? 116 ASP B OD1 1 
ATOM   2452 O  OD2 . ASP B 1 117 ? -32.452 -35.147 19.899 1.00 66.44  ? 116 ASP B OD2 1 
ATOM   2453 N  N   . ALA B 1 118 ? -29.193 -34.431 15.845 1.00 37.04  ? 117 ALA B N   1 
ATOM   2454 C  CA  . ALA B 1 118 ? -28.177 -33.990 14.891 1.00 37.50  ? 117 ALA B CA  1 
ATOM   2455 C  C   . ALA B 1 118 ? -28.713 -33.090 13.776 1.00 47.91  ? 117 ALA B C   1 
ATOM   2456 O  O   . ALA B 1 118 ? -29.899 -33.142 13.429 1.00 48.81  ? 117 ALA B O   1 
ATOM   2457 C  CB  . ALA B 1 118 ? -27.443 -35.189 14.304 1.00 41.89  ? 117 ALA B CB  1 
ATOM   2458 N  N   . LYS B 1 119 ? -27.821 -32.269 13.224 1.00 22.84  ? 118 LYS B N   1 
ATOM   2459 C  CA  . LYS B 1 119 ? -28.148 -31.372 12.116 1.00 24.63  ? 118 LYS B CA  1 
ATOM   2460 C  C   . LYS B 1 119 ? -26.953 -31.252 11.169 1.00 23.48  ? 118 LYS B C   1 
ATOM   2461 O  O   . LYS B 1 119 ? -25.807 -31.302 11.613 1.00 24.48  ? 118 LYS B O   1 
ATOM   2462 C  CB  . LYS B 1 119 ? -28.572 -30.000 12.664 1.00 28.80  ? 118 LYS B CB  1 
ATOM   2463 C  CG  . LYS B 1 119 ? -28.833 -28.939 11.605 1.00 45.27  ? 118 LYS B CG  1 
ATOM   2464 C  CD  . LYS B 1 119 ? -30.239 -28.369 11.694 1.00 46.99  ? 118 LYS B CD  1 
ATOM   2465 C  CE  . LYS B 1 119 ? -30.613 -27.648 10.401 1.00 48.34  ? 118 LYS B CE  1 
ATOM   2466 N  NZ  . LYS B 1 119 ? -32.072 -27.667 10.127 1.00 37.97  ? 118 LYS B NZ  1 
ATOM   2467 N  N   . TRP B 1 120 ? -27.224 -31.120 9.873  1.00 20.93  ? 119 TRP B N   1 
ATOM   2468 C  CA  . TRP B 1 120 ? -26.180 -30.874 8.874  1.00 18.71  ? 119 TRP B CA  1 
ATOM   2469 C  C   . TRP B 1 120 ? -26.426 -29.569 8.111  1.00 21.05  ? 119 TRP B C   1 
ATOM   2470 O  O   . TRP B 1 120 ? -27.519 -29.346 7.589  1.00 19.44  ? 119 TRP B O   1 
ATOM   2471 C  CB  . TRP B 1 120 ? -26.080 -32.046 7.895  1.00 18.23  ? 119 TRP B CB  1 
ATOM   2472 C  CG  . TRP B 1 120 ? -25.224 -31.781 6.670  1.00 19.38  ? 119 TRP B CG  1 
ATOM   2473 C  CD1 . TRP B 1 120 ? -25.662 -31.493 5.406  1.00 12.09  ? 119 TRP B CD1 1 
ATOM   2474 C  CD2 . TRP B 1 120 ? -23.791 -31.793 6.604  1.00 16.05  ? 119 TRP B CD2 1 
ATOM   2475 N  NE1 . TRP B 1 120 ? -24.587 -31.317 4.557  1.00 16.81  ? 119 TRP B NE1 1 
ATOM   2476 C  CE2 . TRP B 1 120 ? -23.429 -31.503 5.267  1.00 15.53  ? 119 TRP B CE2 1 
ATOM   2477 C  CE3 . TRP B 1 120 ? -22.776 -32.025 7.546  1.00 16.41  ? 119 TRP B CE3 1 
ATOM   2478 C  CZ2 . TRP B 1 120 ? -22.098 -31.435 4.850  1.00 19.60  ? 119 TRP B CZ2 1 
ATOM   2479 C  CZ3 . TRP B 1 120 ? -21.452 -31.956 7.130  1.00 12.48  ? 119 TRP B CZ3 1 
ATOM   2480 C  CH2 . TRP B 1 120 ? -21.127 -31.669 5.796  1.00 8.03   ? 119 TRP B CH2 1 
ATOM   2481 N  N   . ILE B 1 121 ? -25.399 -28.719 8.046  1.00 20.60  ? 120 ILE B N   1 
ATOM   2482 C  CA  . ILE B 1 121 ? -25.463 -27.455 7.311  1.00 25.07  ? 120 ILE B CA  1 
ATOM   2483 C  C   . ILE B 1 121 ? -24.384 -27.431 6.239  1.00 26.56  ? 120 ILE B C   1 
ATOM   2484 O  O   . ILE B 1 121 ? -23.189 -27.467 6.567  1.00 14.07  ? 120 ILE B O   1 
ATOM   2485 C  CB  . ILE B 1 121 ? -25.238 -26.207 8.236  1.00 21.54  ? 120 ILE B CB  1 
ATOM   2486 C  CG1 . ILE B 1 121 ? -25.997 -26.321 9.568  1.00 29.59  ? 120 ILE B CG1 1 
ATOM   2487 C  CG2 . ILE B 1 121 ? -25.552 -24.892 7.486  1.00 18.79  ? 120 ILE B CG2 1 
ATOM   2488 C  CD1 . ILE B 1 121 ? -27.482 -26.122 9.490  1.00 15.23  ? 120 ILE B CD1 1 
ATOM   2489 N  N   . SER B 1 122 ? -24.807 -27.375 4.973  1.00 14.22  ? 121 SER B N   1 
ATOM   2490 C  CA  . SER B 1 122 ? -23.898 -27.165 3.838  1.00 20.34  ? 121 SER B CA  1 
ATOM   2491 C  C   . SER B 1 122 ? -23.170 -25.834 3.959  1.00 20.48  ? 121 SER B C   1 
ATOM   2492 O  O   . SER B 1 122 ? -23.759 -24.824 4.365  1.00 18.26  ? 121 SER B O   1 
ATOM   2493 C  CB  . SER B 1 122 ? -24.655 -27.176 2.506  1.00 18.08  ? 121 SER B CB  1 
ATOM   2494 O  OG  . SER B 1 122 ? -25.239 -28.438 2.262  1.00 58.16  ? 121 SER B OG  1 
ATOM   2495 N  N   . MET B 1 123 ? -21.890 -25.844 3.590  1.00 21.98  ? 122 MET B N   1 
ATOM   2496 C  CA  . MET B 1 123 ? -21.054 -24.649 3.598  1.00 17.54  ? 122 MET B CA  1 
ATOM   2497 C  C   . MET B 1 123 ? -20.246 -24.510 2.309  1.00 14.01  ? 122 MET B C   1 
ATOM   2498 O  O   . MET B 1 123 ? -19.536 -25.427 1.888  1.00 17.50  ? 122 MET B O   1 
ATOM   2499 C  CB  . MET B 1 123 ? -20.120 -24.640 4.814  1.00 13.61  ? 122 MET B CB  1 
ATOM   2500 C  CG  . MET B 1 123 ? -20.836 -24.474 6.156  1.00 14.13  ? 122 MET B CG  1 
ATOM   2501 S  SD  . MET B 1 123 ? -19.749 -24.795 7.561  1.00 16.00  ? 122 MET B SD  1 
ATOM   2502 C  CE  . MET B 1 123 ? -18.846 -23.245 7.646  1.00 18.56  ? 122 MET B CE  1 
ATOM   2503 N  N   . GLU B 1 124 ? -20.387 -23.347 1.686  1.00 16.28  ? 123 GLU B N   1 
ATOM   2504 C  CA  . GLU B 1 124 ? -19.650 -22.972 0.485  1.00 16.01  ? 123 GLU B CA  1 
ATOM   2505 C  C   . GLU B 1 124 ? -19.184 -21.549 0.727  1.00 17.18  ? 123 GLU B C   1 
ATOM   2506 O  O   . GLU B 1 124 ? -19.677 -20.916 1.662  1.00 15.70  ? 123 GLU B O   1 
ATOM   2507 C  CB  . GLU B 1 124 ? -20.544 -23.064 -0.748 1.00 20.14  ? 123 GLU B CB  1 
ATOM   2508 C  CG  . GLU B 1 124 ? -20.476 -24.418 -1.431 1.00 44.71  ? 123 GLU B CG  1 
ATOM   2509 C  CD  . GLU B 1 124 ? -21.836 -24.911 -1.875 1.00 68.28  ? 123 GLU B CD  1 
ATOM   2510 O  OE1 . GLU B 1 124 ? -22.673 -25.225 -0.999 1.00 69.45  ? 123 GLU B OE1 1 
ATOM   2511 O  OE2 . GLU B 1 124 ? -22.063 -24.996 -3.100 1.00 75.60  ? 123 GLU B OE2 1 
ATOM   2512 N  N   . PRO B 1 125 ? -18.228 -21.042 -0.082 1.00 20.66  ? 124 PRO B N   1 
ATOM   2513 C  CA  . PRO B 1 125 ? -17.737 -19.692 0.200  1.00 21.84  ? 124 PRO B CA  1 
ATOM   2514 C  C   . PRO B 1 125 ? -18.886 -18.697 0.351  1.00 25.89  ? 124 PRO B C   1 
ATOM   2515 O  O   . PRO B 1 125 ? -19.835 -18.728 -0.431 1.00 21.38  ? 124 PRO B O   1 
ATOM   2516 C  CB  . PRO B 1 125 ? -16.878 -19.370 -1.021 1.00 18.88  ? 124 PRO B CB  1 
ATOM   2517 C  CG  . PRO B 1 125 ? -16.371 -20.721 -1.468 1.00 18.64  ? 124 PRO B CG  1 
ATOM   2518 C  CD  . PRO B 1 125 ? -17.557 -21.631 -1.261 1.00 13.39  ? 124 PRO B CD  1 
ATOM   2519 N  N   . GLY B 1 126 ? -18.814 -17.858 1.383  1.00 13.06  ? 125 GLY B N   1 
ATOM   2520 C  CA  . GLY B 1 126 ? -19.876 -16.905 1.669  1.00 14.16  ? 125 GLY B CA  1 
ATOM   2521 C  C   . GLY B 1 126 ? -20.971 -17.377 2.609  1.00 15.04  ? 125 GLY B C   1 
ATOM   2522 O  O   . GLY B 1 126 ? -21.760 -16.558 3.077  1.00 19.53  ? 125 GLY B O   1 
ATOM   2523 N  N   . THR B 1 127 ? -21.041 -18.686 2.884  1.00 14.53  ? 126 THR B N   1 
ATOM   2524 C  CA  . THR B 1 127 ? -22.001 -19.210 3.874  1.00 15.90  ? 126 THR B CA  1 
ATOM   2525 C  C   . THR B 1 127 ? -21.609 -18.794 5.292  1.00 13.25  ? 126 THR B C   1 
ATOM   2526 O  O   . THR B 1 127 ? -20.468 -19.003 5.710  1.00 11.10  ? 126 THR B O   1 
ATOM   2527 C  CB  . THR B 1 127 ? -22.100 -20.757 3.851  1.00 24.16  ? 126 THR B CB  1 
ATOM   2528 O  OG1 . THR B 1 127 ? -22.620 -21.196 2.594  1.00 21.09  ? 126 THR B OG1 1 
ATOM   2529 C  CG2 . THR B 1 127 ? -23.017 -21.259 4.971  1.00 13.24  ? 126 THR B CG2 1 
ATOM   2530 N  N   . VAL B 1 128 ? -22.558 -18.220 6.026  1.00 19.70  ? 127 VAL B N   1 
ATOM   2531 C  CA  . VAL B 1 128 ? -22.370 -17.926 7.454  1.00 18.16  ? 127 VAL B CA  1 
ATOM   2532 C  C   . VAL B 1 128 ? -23.250 -18.871 8.286  1.00 23.53  ? 127 VAL B C   1 
ATOM   2533 O  O   . VAL B 1 128 ? -24.450 -18.999 8.038  1.00 12.15  ? 127 VAL B O   1 
ATOM   2534 C  CB  . VAL B 1 128 ? -22.647 -16.433 7.794  1.00 9.51   ? 127 VAL B CB  1 
ATOM   2535 C  CG1 . VAL B 1 128 ? -22.575 -16.189 9.321  1.00 15.06  ? 127 VAL B CG1 1 
ATOM   2536 C  CG2 . VAL B 1 128 ? -21.647 -15.530 7.087  1.00 11.89  ? 127 VAL B CG2 1 
ATOM   2537 N  N   . VAL B 1 129 ? -22.636 -19.544 9.254  1.00 7.64   ? 128 VAL B N   1 
ATOM   2538 C  CA  . VAL B 1 129 ? -23.331 -20.524 10.091 1.00 16.78  ? 128 VAL B CA  1 
ATOM   2539 C  C   . VAL B 1 129 ? -23.504 -20.024 11.522 1.00 16.86  ? 128 VAL B C   1 
ATOM   2540 O  O   . VAL B 1 129 ? -22.543 -19.630 12.177 1.00 15.71  ? 128 VAL B O   1 
ATOM   2541 C  CB  . VAL B 1 129 ? -22.589 -21.893 10.118 1.00 14.93  ? 128 VAL B CB  1 
ATOM   2542 C  CG1 . VAL B 1 129 ? -23.282 -22.888 11.072 1.00 14.55  ? 128 VAL B CG1 1 
ATOM   2543 C  CG2 . VAL B 1 129 ? -22.501 -22.477 8.712  1.00 12.49  ? 128 VAL B CG2 1 
ATOM   2544 N  N   . TYR B 1 130 ? -24.738 -20.061 12.009 1.00 18.66  ? 129 TYR B N   1 
ATOM   2545 C  CA  . TYR B 1 130 ? -24.994 -19.765 13.407 1.00 16.68  ? 129 TYR B CA  1 
ATOM   2546 C  C   . TYR B 1 130 ? -25.038 -21.053 14.227 1.00 12.57  ? 129 TYR B C   1 
ATOM   2547 O  O   . TYR B 1 130 ? -25.899 -21.909 14.018 1.00 12.38  ? 129 TYR B O   1 
ATOM   2548 C  CB  . TYR B 1 130 ? -26.273 -18.934 13.564 1.00 17.16  ? 129 TYR B CB  1 
ATOM   2549 C  CG  . TYR B 1 130 ? -26.716 -18.750 15.004 1.00 20.01  ? 129 TYR B CG  1 
ATOM   2550 C  CD1 . TYR B 1 130 ? -27.842 -19.410 15.489 1.00 8.02   ? 129 TYR B CD1 1 
ATOM   2551 C  CD2 . TYR B 1 130 ? -26.011 -17.917 15.875 1.00 12.12  ? 129 TYR B CD2 1 
ATOM   2552 C  CE1 . TYR B 1 130 ? -28.254 -19.251 16.804 1.00 10.43  ? 129 TYR B CE1 1 
ATOM   2553 C  CE2 . TYR B 1 130 ? -26.411 -17.763 17.208 1.00 17.27  ? 129 TYR B CE2 1 
ATOM   2554 C  CZ  . TYR B 1 130 ? -27.544 -18.434 17.656 1.00 20.77  ? 129 TYR B CZ  1 
ATOM   2555 O  OH  . TYR B 1 130 ? -27.984 -18.292 18.951 1.00 15.11  ? 129 TYR B OH  1 
ATOM   2556 N  N   . VAL B 1 131 ? -24.073 -21.196 15.132 1.00 12.16  ? 130 VAL B N   1 
ATOM   2557 C  CA  . VAL B 1 131 ? -24.015 -22.321 16.060 1.00 14.17  ? 130 VAL B CA  1 
ATOM   2558 C  C   . VAL B 1 131 ? -24.643 -21.825 17.363 1.00 20.08  ? 130 VAL B C   1 
ATOM   2559 O  O   . VAL B 1 131 ? -24.035 -21.018 18.059 1.00 11.33  ? 130 VAL B O   1 
ATOM   2560 C  CB  . VAL B 1 131 ? -22.557 -22.787 16.345 1.00 21.32  ? 130 VAL B CB  1 
ATOM   2561 C  CG1 . VAL B 1 131 ? -22.551 -23.990 17.284 1.00 10.51  ? 130 VAL B CG1 1 
ATOM   2562 C  CG2 . VAL B 1 131 ? -21.803 -23.107 15.046 1.00 12.15  ? 130 VAL B CG2 1 
ATOM   2563 N  N   . PRO B 1 132 ? -25.868 -22.289 17.684 1.00 15.25  ? 131 PRO B N   1 
ATOM   2564 C  CA  . PRO B 1 132 ? -26.566 -21.848 18.903 1.00 21.27  ? 131 PRO B CA  1 
ATOM   2565 C  C   . PRO B 1 132 ? -25.948 -22.384 20.193 1.00 8.27   ? 131 PRO B C   1 
ATOM   2566 O  O   . PRO B 1 132 ? -25.164 -23.342 20.157 1.00 13.41  ? 131 PRO B O   1 
ATOM   2567 C  CB  . PRO B 1 132 ? -27.997 -22.407 18.731 1.00 12.03  ? 131 PRO B CB  1 
ATOM   2568 C  CG  . PRO B 1 132 ? -28.082 -22.885 17.295 1.00 15.56  ? 131 PRO B CG  1 
ATOM   2569 C  CD  . PRO B 1 132 ? -26.681 -23.243 16.904 1.00 21.73  ? 131 PRO B CD  1 
ATOM   2570 N  N   . PRO B 1 133 ? -26.291 -21.767 21.340 1.00 17.69  ? 132 PRO B N   1 
ATOM   2571 C  CA  . PRO B 1 133 ? -25.952 -22.338 22.646 1.00 15.19  ? 132 PRO B CA  1 
ATOM   2572 C  C   . PRO B 1 133 ? -26.299 -23.828 22.727 1.00 16.43  ? 132 PRO B C   1 
ATOM   2573 O  O   . PRO B 1 133 ? -27.324 -24.249 22.189 1.00 21.97  ? 132 PRO B O   1 
ATOM   2574 C  CB  . PRO B 1 133 ? -26.847 -21.547 23.606 1.00 9.41   ? 132 PRO B CB  1 
ATOM   2575 C  CG  . PRO B 1 133 ? -26.977 -20.201 22.942 1.00 15.53  ? 132 PRO B CG  1 
ATOM   2576 C  CD  . PRO B 1 133 ? -27.022 -20.491 21.466 1.00 14.11  ? 132 PRO B CD  1 
ATOM   2577 N  N   . TYR B 1 134 ? -25.437 -24.602 23.387 1.00 15.72  ? 133 TYR B N   1 
ATOM   2578 C  CA  . TYR B 1 134 ? -25.656 -26.034 23.688 1.00 19.41  ? 133 TYR B CA  1 
ATOM   2579 C  C   . TYR B 1 134 ? -25.380 -27.029 22.549 1.00 19.13  ? 133 TYR B C   1 
ATOM   2580 O  O   . TYR B 1 134 ? -25.427 -28.237 22.772 1.00 21.09  ? 133 TYR B O   1 
ATOM   2581 C  CB  . TYR B 1 134 ? -27.055 -26.288 24.284 1.00 23.24  ? 133 TYR B CB  1 
ATOM   2582 C  CG  . TYR B 1 134 ? -27.308 -25.573 25.596 1.00 33.58  ? 133 TYR B CG  1 
ATOM   2583 C  CD1 . TYR B 1 134 ? -26.927 -26.145 26.809 1.00 21.20  ? 133 TYR B CD1 1 
ATOM   2584 C  CD2 . TYR B 1 134 ? -27.934 -24.325 25.623 1.00 32.29  ? 133 TYR B CD2 1 
ATOM   2585 C  CE1 . TYR B 1 134 ? -27.149 -25.485 28.017 1.00 27.25  ? 133 TYR B CE1 1 
ATOM   2586 C  CE2 . TYR B 1 134 ? -28.162 -23.657 26.824 1.00 37.41  ? 133 TYR B CE2 1 
ATOM   2587 C  CZ  . TYR B 1 134 ? -27.769 -24.245 28.014 1.00 23.32  ? 133 TYR B CZ  1 
ATOM   2588 O  OH  . TYR B 1 134 ? -27.993 -23.591 29.204 1.00 37.27  ? 133 TYR B OH  1 
ATOM   2589 N  N   . TRP B 1 135 ? -25.108 -26.545 21.339 1.00 17.19  ? 134 TRP B N   1 
ATOM   2590 C  CA  . TRP B 1 135 ? -24.843 -27.462 20.226 1.00 19.94  ? 134 TRP B CA  1 
ATOM   2591 C  C   . TRP B 1 135 ? -23.351 -27.758 20.076 1.00 16.86  ? 134 TRP B C   1 
ATOM   2592 O  O   . TRP B 1 135 ? -22.543 -26.836 19.910 1.00 15.20  ? 134 TRP B O   1 
ATOM   2593 C  CB  . TRP B 1 135 ? -25.402 -26.923 18.906 1.00 14.60  ? 134 TRP B CB  1 
ATOM   2594 C  CG  . TRP B 1 135 ? -26.920 -26.892 18.795 1.00 23.15  ? 134 TRP B CG  1 
ATOM   2595 C  CD1 . TRP B 1 135 ? -27.754 -25.955 19.326 1.00 7.89   ? 134 TRP B CD1 1 
ATOM   2596 C  CD2 . TRP B 1 135 ? -27.763 -27.824 18.087 1.00 11.70  ? 134 TRP B CD2 1 
ATOM   2597 N  NE1 . TRP B 1 135 ? -29.063 -26.236 18.994 1.00 25.53  ? 134 TRP B NE1 1 
ATOM   2598 C  CE2 . TRP B 1 135 ? -29.097 -27.380 18.239 1.00 18.83  ? 134 TRP B CE2 1 
ATOM   2599 C  CE3 . TRP B 1 135 ? -27.521 -28.996 17.347 1.00 12.83  ? 134 TRP B CE3 1 
ATOM   2600 C  CZ2 . TRP B 1 135 ? -30.191 -28.063 17.675 1.00 18.78  ? 134 TRP B CZ2 1 
ATOM   2601 C  CZ3 . TRP B 1 135 ? -28.611 -29.671 16.774 1.00 23.19  ? 134 TRP B CZ3 1 
ATOM   2602 C  CH2 . TRP B 1 135 ? -29.929 -29.198 16.945 1.00 15.71  ? 134 TRP B CH2 1 
ATOM   2603 N  N   . ALA B 1 136 ? -22.990 -29.041 20.146 1.00 17.53  ? 135 ALA B N   1 
ATOM   2604 C  CA  . ALA B 1 136 ? -21.657 -29.494 19.719 1.00 18.38  ? 135 ALA B CA  1 
ATOM   2605 C  C   . ALA B 1 136 ? -21.546 -29.285 18.215 1.00 17.87  ? 135 ALA B C   1 
ATOM   2606 O  O   . ALA B 1 136 ? -22.551 -29.308 17.519 1.00 18.03  ? 135 ALA B O   1 
ATOM   2607 C  CB  . ALA B 1 136 ? -21.444 -30.951 20.054 1.00 19.53  ? 135 ALA B CB  1 
ATOM   2608 N  N   . HIS B 1 137 ? -20.333 -29.050 17.722 1.00 20.89  ? 136 HIS B N   1 
ATOM   2609 C  CA  . HIS B 1 137 ? -20.138 -28.713 16.308 1.00 18.85  ? 136 HIS B CA  1 
ATOM   2610 C  C   . HIS B 1 137 ? -18.835 -29.263 15.748 1.00 19.87  ? 136 HIS B C   1 
ATOM   2611 O  O   . HIS B 1 137 ? -17.787 -29.206 16.397 1.00 17.57  ? 136 HIS B O   1 
ATOM   2612 C  CB  . HIS B 1 137 ? -20.249 -27.197 16.063 1.00 14.33  ? 136 HIS B CB  1 
ATOM   2613 C  CG  . HIS B 1 137 ? -19.600 -26.360 17.118 1.00 20.58  ? 136 HIS B CG  1 
ATOM   2614 N  ND1 . HIS B 1 137 ? -20.148 -26.184 18.371 1.00 22.58  ? 136 HIS B ND1 1 
ATOM   2615 C  CD2 . HIS B 1 137 ? -18.448 -25.646 17.107 1.00 18.56  ? 136 HIS B CD2 1 
ATOM   2616 C  CE1 . HIS B 1 137 ? -19.358 -25.408 19.092 1.00 26.14  ? 136 HIS B CE1 1 
ATOM   2617 N  NE2 . HIS B 1 137 ? -18.320 -25.068 18.348 1.00 25.61  ? 136 HIS B NE2 1 
ATOM   2618 N  N   . ARG B 1 138 ? -18.929 -29.794 14.532 1.00 17.71  ? 137 ARG B N   1 
ATOM   2619 C  CA  . ARG B 1 138 ? -17.797 -30.362 13.810 1.00 18.59  ? 137 ARG B CA  1 
ATOM   2620 C  C   . ARG B 1 138 ? -17.898 -29.955 12.341 1.00 13.58  ? 137 ARG B C   1 
ATOM   2621 O  O   . ARG B 1 138 ? -18.974 -30.025 11.750 1.00 13.01  ? 137 ARG B O   1 
ATOM   2622 C  CB  . ARG B 1 138 ? -17.807 -31.891 13.974 1.00 13.72  ? 137 ARG B CB  1 
ATOM   2623 C  CG  . ARG B 1 138 ? -17.184 -32.692 12.841 1.00 12.70  ? 137 ARG B CG  1 
ATOM   2624 C  CD  . ARG B 1 138 ? -17.323 -34.172 13.083 1.00 12.73  ? 137 ARG B CD  1 
ATOM   2625 N  NE  . ARG B 1 138 ? -16.543 -34.622 14.243 1.00 15.64  ? 137 ARG B NE  1 
ATOM   2626 C  CZ  . ARG B 1 138 ? -16.563 -35.859 14.734 1.00 23.24  ? 137 ARG B CZ  1 
ATOM   2627 N  NH1 . ARG B 1 138 ? -17.327 -36.791 14.166 1.00 21.84  ? 137 ARG B NH1 1 
ATOM   2628 N  NH2 . ARG B 1 138 ? -15.820 -36.165 15.796 1.00 16.10  ? 137 ARG B NH2 1 
ATOM   2629 N  N   . THR B 1 139 ? -16.789 -29.510 11.757 1.00 13.15  ? 138 THR B N   1 
ATOM   2630 C  CA  . THR B 1 139 ? -16.763 -29.175 10.327 1.00 16.12  ? 138 THR B CA  1 
ATOM   2631 C  C   . THR B 1 139 ? -16.230 -30.345 9.493  1.00 13.41  ? 138 THR B C   1 
ATOM   2632 O  O   . THR B 1 139 ? -15.384 -31.105 9.949  1.00 12.85  ? 138 THR B O   1 
ATOM   2633 C  CB  . THR B 1 139 ? -15.988 -27.863 10.021 1.00 15.35  ? 138 THR B CB  1 
ATOM   2634 O  OG1 . THR B 1 139 ? -14.698 -27.903 10.648 1.00 30.46  ? 138 THR B OG1 1 
ATOM   2635 C  CG2 . THR B 1 139 ? -16.745 -26.649 10.555 1.00 8.41   ? 138 THR B CG2 1 
ATOM   2636 N  N   . VAL B 1 140 ? -16.734 -30.479 8.269  1.00 21.46  ? 139 VAL B N   1 
ATOM   2637 C  CA  . VAL B 1 140 ? -16.391 -31.603 7.401  1.00 11.26  ? 139 VAL B CA  1 
ATOM   2638 C  C   . VAL B 1 140 ? -16.004 -31.063 6.025  1.00 16.23  ? 139 VAL B C   1 
ATOM   2639 O  O   . VAL B 1 140 ? -16.643 -30.149 5.528  1.00 13.40  ? 139 VAL B O   1 
ATOM   2640 C  CB  . VAL B 1 140 ? -17.584 -32.591 7.259  1.00 15.11  ? 139 VAL B CB  1 
ATOM   2641 C  CG1 . VAL B 1 140 ? -17.242 -33.744 6.306  1.00 13.26  ? 139 VAL B CG1 1 
ATOM   2642 C  CG2 . VAL B 1 140 ? -18.013 -33.139 8.624  1.00 12.72  ? 139 VAL B CG2 1 
ATOM   2643 N  N   . ASN B 1 141 ? -14.941 -31.612 5.435  1.00 13.74  ? 140 ASN B N   1 
ATOM   2644 C  CA  . ASN B 1 141 ? -14.538 -31.278 4.072  1.00 13.80  ? 140 ASN B CA  1 
ATOM   2645 C  C   . ASN B 1 141 ? -15.039 -32.362 3.127  1.00 19.98  ? 140 ASN B C   1 
ATOM   2646 O  O   . ASN B 1 141 ? -14.583 -33.508 3.195  1.00 19.92  ? 140 ASN B O   1 
ATOM   2647 C  CB  . ASN B 1 141 ? -13.004 -31.134 3.960  1.00 7.81   ? 140 ASN B CB  1 
ATOM   2648 C  CG  . ASN B 1 141 ? -12.570 -30.553 2.614  1.00 23.53  ? 140 ASN B CG  1 
ATOM   2649 O  OD1 . ASN B 1 141 ? -13.333 -30.546 1.661  1.00 12.69  ? 140 ASN B OD1 1 
ATOM   2650 N  ND2 . ASN B 1 141 ? -11.351 -30.056 2.542  1.00 15.33  ? 140 ASN B ND2 1 
ATOM   2651 N  N   . ILE B 1 142 ? -15.975 -32.000 2.253  1.00 16.94  ? 141 ILE B N   1 
ATOM   2652 C  CA  . ILE B 1 142 ? -16.557 -32.949 1.301  1.00 16.04  ? 141 ILE B CA  1 
ATOM   2653 C  C   . ILE B 1 142 ? -16.017 -32.820 -0.139 1.00 20.97  ? 141 ILE B C   1 
ATOM   2654 O  O   . ILE B 1 142 ? -16.531 -33.455 -1.057 1.00 23.44  ? 141 ILE B O   1 
ATOM   2655 C  CB  . ILE B 1 142 ? -18.122 -32.899 1.299  1.00 13.97  ? 141 ILE B CB  1 
ATOM   2656 C  CG1 . ILE B 1 142 ? -18.634 -31.496 0.929  1.00 21.05  ? 141 ILE B CG1 1 
ATOM   2657 C  CG2 . ILE B 1 142 ? -18.689 -33.374 2.662  1.00 14.24  ? 141 ILE B CG2 1 
ATOM   2658 C  CD1 . ILE B 1 142 ? -20.103 -31.442 0.465  1.00 21.13  ? 141 ILE B CD1 1 
ATOM   2659 N  N   . GLY B 1 143 ? -14.980 -32.008 -0.330 1.00 20.25  ? 142 GLY B N   1 
ATOM   2660 C  CA  . GLY B 1 143 ? -14.428 -31.759 -1.668 1.00 16.40  ? 142 GLY B CA  1 
ATOM   2661 C  C   . GLY B 1 143 ? -12.993 -32.215 -1.811 1.00 22.61  ? 142 GLY B C   1 
ATOM   2662 O  O   . GLY B 1 143 ? -12.471 -32.901 -0.935 1.00 24.88  ? 142 GLY B O   1 
ATOM   2663 N  N   . ASP B 1 144 ? -12.349 -31.829 -2.912 1.00 15.91  ? 143 ASP B N   1 
ATOM   2664 C  CA  . ASP B 1 144 ? -10.982 -32.281 -3.197 1.00 25.32  ? 143 ASP B CA  1 
ATOM   2665 C  C   . ASP B 1 144 ? -9.922  -31.191 -2.987 1.00 24.86  ? 143 ASP B C   1 
ATOM   2666 O  O   . ASP B 1 144 ? -8.725  -31.403 -3.246 1.00 31.34  ? 143 ASP B O   1 
ATOM   2667 C  CB  . ASP B 1 144 ? -10.883 -32.915 -4.596 1.00 40.34  ? 143 ASP B CB  1 
ATOM   2668 C  CG  . ASP B 1 144 ? -11.572 -32.091 -5.669 1.00 48.57  ? 143 ASP B CG  1 
ATOM   2669 O  OD1 . ASP B 1 144 ? -11.318 -30.870 -5.761 1.00 60.35  ? 143 ASP B OD1 1 
ATOM   2670 O  OD2 . ASP B 1 144 ? -12.369 -32.674 -6.431 1.00 71.71  ? 143 ASP B OD2 1 
ATOM   2671 N  N   . GLU B 1 145 ? -10.366 -30.034 -2.504 1.00 20.60  ? 144 GLU B N   1 
ATOM   2672 C  CA  . GLU B 1 145 ? -9.457  -28.950 -2.127 1.00 30.22  ? 144 GLU B CA  1 
ATOM   2673 C  C   . GLU B 1 145 ? -9.689  -28.542 -0.656 1.00 20.80  ? 144 GLU B C   1 
ATOM   2674 O  O   . GLU B 1 145 ? -10.696 -28.950 -0.061 1.00 22.00  ? 144 GLU B O   1 
ATOM   2675 C  CB  . GLU B 1 145 ? -9.603  -27.758 -3.088 1.00 36.43  ? 144 GLU B CB  1 
ATOM   2676 C  CG  . GLU B 1 145 ? -10.869 -26.918 -2.914 1.00 43.23  ? 144 GLU B CG  1 
ATOM   2677 C  CD  . GLU B 1 145 ? -10.598 -25.419 -3.021 1.00 48.79  ? 144 GLU B CD  1 
ATOM   2678 O  OE1 . GLU B 1 145 ? -9.963  -24.847 -2.098 1.00 50.30  ? 144 GLU B OE1 1 
ATOM   2679 O  OE2 . GLU B 1 145 ? -11.028 -24.812 -4.021 1.00 36.19  ? 144 GLU B OE2 1 
ATOM   2680 N  N   . PRO B 1 146 ? -8.766  -27.744 -0.071 1.00 19.75  ? 145 PRO B N   1 
ATOM   2681 C  CA  . PRO B 1 146 ? -8.927  -27.332 1.329  1.00 26.22  ? 145 PRO B CA  1 
ATOM   2682 C  C   . PRO B 1 146 ? -10.230 -26.572 1.590  1.00 27.30  ? 145 PRO B C   1 
ATOM   2683 O  O   . PRO B 1 146 ? -10.644 -25.733 0.787  1.00 22.96  ? 145 PRO B O   1 
ATOM   2684 C  CB  . PRO B 1 146 ? -7.696  -26.449 1.576  1.00 21.93  ? 145 PRO B CB  1 
ATOM   2685 C  CG  . PRO B 1 146 ? -6.668  -26.963 0.550  1.00 13.87  ? 145 PRO B CG  1 
ATOM   2686 C  CD  . PRO B 1 146 ? -7.519  -27.197 -0.651 1.00 18.86  ? 145 PRO B CD  1 
ATOM   2687 N  N   . PHE B 1 147 ? -10.889 -26.926 2.690  1.00 22.76  ? 146 PHE B N   1 
ATOM   2688 C  CA  . PHE B 1 147 ? -12.056 -26.212 3.185  1.00 21.16  ? 146 PHE B CA  1 
ATOM   2689 C  C   . PHE B 1 147 ? -11.553 -25.208 4.223  1.00 18.27  ? 146 PHE B C   1 
ATOM   2690 O  O   . PHE B 1 147 ? -10.998 -25.598 5.255  1.00 14.35  ? 146 PHE B O   1 
ATOM   2691 C  CB  . PHE B 1 147 ? -13.056 -27.209 3.795  1.00 9.75   ? 146 PHE B CB  1 
ATOM   2692 C  CG  . PHE B 1 147 ? -14.335 -26.581 4.305  1.00 13.90  ? 146 PHE B CG  1 
ATOM   2693 C  CD1 . PHE B 1 147 ? -15.077 -25.712 3.505  1.00 6.91   ? 146 PHE B CD1 1 
ATOM   2694 C  CD2 . PHE B 1 147 ? -14.820 -26.903 5.575  1.00 19.33  ? 146 PHE B CD2 1 
ATOM   2695 C  CE1 . PHE B 1 147 ? -16.265 -25.139 3.979  1.00 21.66  ? 146 PHE B CE1 1 
ATOM   2696 C  CE2 . PHE B 1 147 ? -15.999 -26.344 6.054  1.00 17.21  ? 146 PHE B CE2 1 
ATOM   2697 C  CZ  . PHE B 1 147 ? -16.724 -25.464 5.254  1.00 20.69  ? 146 PHE B CZ  1 
ATOM   2698 N  N   . ILE B 1 148 ? -11.714 -23.919 3.927  1.00 18.12  ? 147 ILE B N   1 
ATOM   2699 C  CA  . ILE B 1 148 ? -11.194 -22.838 4.781  1.00 18.84  ? 147 ILE B CA  1 
ATOM   2700 C  C   . ILE B 1 148 ? -12.333 -21.975 5.315  1.00 17.14  ? 147 ILE B C   1 
ATOM   2701 O  O   . ILE B 1 148 ? -13.253 -21.612 4.584  1.00 18.82  ? 147 ILE B O   1 
ATOM   2702 C  CB  . ILE B 1 148 ? -10.155 -21.934 4.032  1.00 19.72  ? 147 ILE B CB  1 
ATOM   2703 C  CG1 . ILE B 1 148 ? -8.989  -22.769 3.478  1.00 17.42  ? 147 ILE B CG1 1 
ATOM   2704 C  CG2 . ILE B 1 148 ? -9.643  -20.811 4.943  1.00 14.02  ? 147 ILE B CG2 1 
ATOM   2705 C  CD1 . ILE B 1 148 ? -8.086  -22.017 2.489  1.00 14.60  ? 147 ILE B CD1 1 
ATOM   2706 N  N   . PHE B 1 149 ? -12.267 -21.655 6.603  1.00 21.13  ? 148 PHE B N   1 
ATOM   2707 C  CA  . PHE B 1 149 ? -13.315 -20.877 7.252  1.00 13.65  ? 148 PHE B CA  1 
ATOM   2708 C  C   . PHE B 1 149 ? -12.783 -20.113 8.459  1.00 18.56  ? 148 PHE B C   1 
ATOM   2709 O  O   . PHE B 1 149 ? -11.727 -20.437 8.987  1.00 13.72  ? 148 PHE B O   1 
ATOM   2710 C  CB  . PHE B 1 149 ? -14.487 -21.780 7.677  1.00 13.66  ? 148 PHE B CB  1 
ATOM   2711 C  CG  . PHE B 1 149 ? -14.100 -22.903 8.608  1.00 17.68  ? 148 PHE B CG  1 
ATOM   2712 C  CD1 . PHE B 1 149 ? -13.849 -24.169 8.109  1.00 11.29  ? 148 PHE B CD1 1 
ATOM   2713 C  CD2 . PHE B 1 149 ? -14.003 -22.693 9.985  1.00 12.85  ? 148 PHE B CD2 1 
ATOM   2714 C  CE1 . PHE B 1 149 ? -13.504 -25.214 8.953  1.00 19.81  ? 148 PHE B CE1 1 
ATOM   2715 C  CE2 . PHE B 1 149 ? -13.663 -23.733 10.836 1.00 19.28  ? 148 PHE B CE2 1 
ATOM   2716 C  CZ  . PHE B 1 149 ? -13.416 -24.997 10.317 1.00 17.04  ? 148 PHE B CZ  1 
ATOM   2717 N  N   . LEU B 1 150 ? -13.536 -19.101 8.882  1.00 8.36   ? 149 LEU B N   1 
ATOM   2718 C  CA  . LEU B 1 150 ? -13.201 -18.299 10.042 1.00 12.27  ? 149 LEU B CA  1 
ATOM   2719 C  C   . LEU B 1 150 ? -14.274 -18.532 11.095 1.00 21.26  ? 149 LEU B C   1 
ATOM   2720 O  O   . LEU B 1 150 ? -15.449 -18.624 10.760 1.00 14.59  ? 149 LEU B O   1 
ATOM   2721 C  CB  . LEU B 1 150 ? -13.152 -16.817 9.638  1.00 15.20  ? 149 LEU B CB  1 
ATOM   2722 C  CG  . LEU B 1 150 ? -12.958 -15.675 10.648 1.00 14.47  ? 149 LEU B CG  1 
ATOM   2723 C  CD1 . LEU B 1 150 ? -11.564 -15.653 11.207 1.00 12.03  ? 149 LEU B CD1 1 
ATOM   2724 C  CD2 . LEU B 1 150 ? -13.218 -14.380 9.920  1.00 20.34  ? 149 LEU B CD2 1 
ATOM   2725 N  N   . ALA B 1 151 ? -13.868 -18.613 12.361 1.00 11.90  ? 150 ALA B N   1 
ATOM   2726 C  CA  . ALA B 1 151 ? -14.802 -18.772 13.467 1.00 17.06  ? 150 ALA B CA  1 
ATOM   2727 C  C   . ALA B 1 151 ? -14.590 -17.698 14.526 1.00 16.07  ? 150 ALA B C   1 
ATOM   2728 O  O   . ALA B 1 151 ? -13.453 -17.373 14.878 1.00 11.31  ? 150 ALA B O   1 
ATOM   2729 C  CB  . ALA B 1 151 ? -14.670 -20.158 14.078 1.00 11.75  ? 150 ALA B CB  1 
ATOM   2730 N  N   . ILE B 1 152 ? -15.693 -17.155 15.032 1.00 10.91  ? 151 ILE B N   1 
ATOM   2731 C  CA  . ILE B 1 152 ? -15.664 -16.137 16.087 1.00 7.61   ? 151 ILE B CA  1 
ATOM   2732 C  C   . ILE B 1 152 ? -16.474 -16.701 17.241 1.00 16.53  ? 151 ILE B C   1 
ATOM   2733 O  O   . ILE B 1 152 ? -17.621 -17.095 17.052 1.00 14.40  ? 151 ILE B O   1 
ATOM   2734 C  CB  . ILE B 1 152 ? -16.262 -14.781 15.607 1.00 10.11  ? 151 ILE B CB  1 
ATOM   2735 C  CG1 . ILE B 1 152 ? -15.499 -14.221 14.397 1.00 10.60  ? 151 ILE B CG1 1 
ATOM   2736 C  CG2 . ILE B 1 152 ? -16.258 -13.738 16.735 1.00 10.11  ? 151 ILE B CG2 1 
ATOM   2737 C  CD1 . ILE B 1 152 ? -15.985 -14.732 13.058 1.00 18.34  ? 151 ILE B CD1 1 
ATOM   2738 N  N   . TYR B 1 153 ? -15.876 -16.762 18.428 1.00 15.82  ? 152 TYR B N   1 
ATOM   2739 C  CA  . TYR B 1 153 ? -16.526 -17.409 19.575 1.00 11.73  ? 152 TYR B CA  1 
ATOM   2740 C  C   . TYR B 1 153 ? -16.226 -16.650 20.863 1.00 11.98  ? 152 TYR B C   1 
ATOM   2741 O  O   . TYR B 1 153 ? -15.211 -15.948 20.950 1.00 12.65  ? 152 TYR B O   1 
ATOM   2742 C  CB  . TYR B 1 153 ? -16.119 -18.889 19.696 1.00 10.29  ? 152 TYR B CB  1 
ATOM   2743 C  CG  . TYR B 1 153 ? -14.615 -19.146 19.538 1.00 16.29  ? 152 TYR B CG  1 
ATOM   2744 C  CD1 . TYR B 1 153 ? -14.005 -19.060 18.282 1.00 22.62  ? 152 TYR B CD1 1 
ATOM   2745 C  CD2 . TYR B 1 153 ? -13.813 -19.476 20.635 1.00 24.19  ? 152 TYR B CD2 1 
ATOM   2746 C  CE1 . TYR B 1 153 ? -12.640 -19.293 18.114 1.00 11.67  ? 152 TYR B CE1 1 
ATOM   2747 C  CE2 . TYR B 1 153 ? -12.432 -19.715 20.482 1.00 17.11  ? 152 TYR B CE2 1 
ATOM   2748 C  CZ  . TYR B 1 153 ? -11.863 -19.618 19.205 1.00 22.43  ? 152 TYR B CZ  1 
ATOM   2749 O  OH  . TYR B 1 153 ? -10.520 -19.836 18.993 1.00 24.76  ? 152 TYR B OH  1 
ATOM   2750 N  N   . PRO B 1 154 ? -17.129 -16.755 21.857 1.00 16.04  ? 153 PRO B N   1 
ATOM   2751 C  CA  . PRO B 1 154 ? -16.879 -16.074 23.124 1.00 18.86  ? 153 PRO B CA  1 
ATOM   2752 C  C   . PRO B 1 154 ? -15.571 -16.536 23.745 1.00 9.90   ? 153 PRO B C   1 
ATOM   2753 O  O   . PRO B 1 154 ? -15.239 -17.726 23.690 1.00 17.16  ? 153 PRO B O   1 
ATOM   2754 C  CB  . PRO B 1 154 ? -18.095 -16.468 23.982 1.00 10.83  ? 153 PRO B CB  1 
ATOM   2755 C  CG  . PRO B 1 154 ? -19.179 -16.757 22.958 1.00 13.68  ? 153 PRO B CG  1 
ATOM   2756 C  CD  . PRO B 1 154 ? -18.428 -17.453 21.859 1.00 14.05  ? 153 PRO B CD  1 
ATOM   2757 N  N   . ALA B 1 155 ? -14.838 -15.590 24.324 1.00 23.76  ? 154 ALA B N   1 
ATOM   2758 C  CA  . ALA B 1 155 ? -13.525 -15.851 24.911 1.00 16.20  ? 154 ALA B CA  1 
ATOM   2759 C  C   . ALA B 1 155 ? -13.573 -16.789 26.120 1.00 18.13  ? 154 ALA B C   1 
ATOM   2760 O  O   . ALA B 1 155 ? -12.561 -17.394 26.479 1.00 18.38  ? 154 ALA B O   1 
ATOM   2761 C  CB  . ALA B 1 155 ? -12.851 -14.538 25.284 1.00 11.92  ? 154 ALA B CB  1 
ATOM   2762 N  N   . ASP B 1 156 ? -14.743 -16.900 26.747 1.00 16.13  ? 155 ASP B N   1 
ATOM   2763 C  CA  . ASP B 1 156 ? -14.915 -17.779 27.910 1.00 25.05  ? 155 ASP B CA  1 
ATOM   2764 C  C   . ASP B 1 156 ? -15.676 -19.066 27.564 1.00 31.46  ? 155 ASP B C   1 
ATOM   2765 O  O   . ASP B 1 156 ? -16.080 -19.820 28.459 1.00 15.63  ? 155 ASP B O   1 
ATOM   2766 C  CB  . ASP B 1 156 ? -15.592 -17.025 29.070 1.00 18.69  ? 155 ASP B CB  1 
ATOM   2767 C  CG  . ASP B 1 156 ? -17.022 -16.593 28.750 1.00 15.24  ? 155 ASP B CG  1 
ATOM   2768 O  OD1 . ASP B 1 156 ? -17.463 -16.680 27.576 1.00 21.19  ? 155 ASP B OD1 1 
ATOM   2769 O  OD2 . ASP B 1 156 ? -17.719 -16.156 29.682 1.00 13.91  ? 155 ASP B OD2 1 
ATOM   2770 N  N   . ALA B 1 157 ? -15.860 -19.321 26.266 1.00 16.01  ? 156 ALA B N   1 
ATOM   2771 C  CA  . ALA B 1 157 ? -16.560 -20.523 25.812 1.00 21.18  ? 156 ALA B CA  1 
ATOM   2772 C  C   . ALA B 1 157 ? -15.869 -21.814 26.253 1.00 19.14  ? 156 ALA B C   1 
ATOM   2773 O  O   . ALA B 1 157 ? -16.524 -22.755 26.713 1.00 16.40  ? 156 ALA B O   1 
ATOM   2774 C  CB  . ALA B 1 157 ? -16.758 -20.504 24.282 1.00 18.93  ? 156 ALA B CB  1 
ATOM   2775 N  N   . GLY B 1 158 ? -14.551 -21.862 26.106 1.00 25.14  ? 157 GLY B N   1 
ATOM   2776 C  CA  . GLY B 1 158 ? -13.802 -23.087 26.369 1.00 19.83  ? 157 GLY B CA  1 
ATOM   2777 C  C   . GLY B 1 158 ? -14.090 -24.181 25.357 1.00 33.99  ? 157 GLY B C   1 
ATOM   2778 O  O   . GLY B 1 158 ? -14.859 -23.991 24.403 1.00 26.16  ? 157 GLY B O   1 
ATOM   2779 N  N   . HIS B 1 159 ? -13.461 -25.332 25.565 1.00 32.62  ? 158 HIS B N   1 
ATOM   2780 C  CA  . HIS B 1 159 ? -13.632 -26.484 24.687 1.00 39.28  ? 158 HIS B CA  1 
ATOM   2781 C  C   . HIS B 1 159 ? -13.913 -27.733 25.522 1.00 48.06  ? 158 HIS B C   1 
ATOM   2782 O  O   . HIS B 1 159 ? -13.229 -27.994 26.516 1.00 42.03  ? 158 HIS B O   1 
ATOM   2783 C  CB  . HIS B 1 159 ? -12.381 -26.689 23.819 1.00 39.10  ? 158 HIS B CB  1 
ATOM   2784 C  CG  . HIS B 1 159 ? -12.153 -25.605 22.807 1.00 43.15  ? 158 HIS B CG  1 
ATOM   2785 N  ND1 . HIS B 1 159 ? -11.454 -24.452 23.094 1.00 43.23  ? 158 HIS B ND1 1 
ATOM   2786 C  CD2 . HIS B 1 159 ? -12.527 -25.502 21.508 1.00 38.04  ? 158 HIS B CD2 1 
ATOM   2787 C  CE1 . HIS B 1 159 ? -11.414 -23.683 22.021 1.00 42.14  ? 158 HIS B CE1 1 
ATOM   2788 N  NE2 . HIS B 1 159 ? -12.058 -24.296 21.045 1.00 30.26  ? 158 HIS B NE2 1 
ATOM   2789 N  N   . ASP B 1 160 ? -14.943 -28.482 25.138 1.00 31.91  ? 159 ASP B N   1 
ATOM   2790 C  CA  . ASP B 1 160 ? -15.203 -29.785 25.748 1.00 37.73  ? 159 ASP B CA  1 
ATOM   2791 C  C   . ASP B 1 160 ? -15.185 -30.887 24.679 1.00 43.63  ? 159 ASP B C   1 
ATOM   2792 O  O   . ASP B 1 160 ? -16.157 -31.069 23.940 1.00 47.26  ? 159 ASP B O   1 
ATOM   2793 C  CB  . ASP B 1 160 ? -16.525 -29.775 26.522 1.00 38.24  ? 159 ASP B CB  1 
ATOM   2794 C  CG  . ASP B 1 160 ? -16.768 -31.067 27.288 1.00 53.06  ? 159 ASP B CG  1 
ATOM   2795 O  OD1 . ASP B 1 160 ? -15.808 -31.618 27.872 1.00 64.72  ? 159 ASP B OD1 1 
ATOM   2796 O  OD2 . ASP B 1 160 ? -17.928 -31.530 27.304 1.00 61.72  ? 159 ASP B OD2 1 
ATOM   2797 N  N   . TYR B 1 161 ? -14.065 -31.605 24.599 1.00 43.59  ? 160 TYR B N   1 
ATOM   2798 C  CA  . TYR B 1 161 ? -13.869 -32.652 23.593 1.00 41.03  ? 160 TYR B CA  1 
ATOM   2799 C  C   . TYR B 1 161 ? -14.337 -34.036 24.046 1.00 39.12  ? 160 TYR B C   1 
ATOM   2800 O  O   . TYR B 1 161 ? -14.767 -34.843 23.218 1.00 40.14  ? 160 TYR B O   1 
ATOM   2801 C  CB  . TYR B 1 161 ? -12.394 -32.730 23.176 1.00 35.08  ? 160 TYR B CB  1 
ATOM   2802 C  CG  . TYR B 1 161 ? -11.871 -31.480 22.510 1.00 43.68  ? 160 TYR B CG  1 
ATOM   2803 C  CD1 . TYR B 1 161 ? -11.112 -30.548 23.223 1.00 40.77  ? 160 TYR B CD1 1 
ATOM   2804 C  CD2 . TYR B 1 161 ? -12.134 -31.227 21.162 1.00 39.04  ? 160 TYR B CD2 1 
ATOM   2805 C  CE1 . TYR B 1 161 ? -10.628 -29.394 22.604 1.00 32.51  ? 160 TYR B CE1 1 
ATOM   2806 C  CE2 . TYR B 1 161 ? -11.661 -30.078 20.537 1.00 36.09  ? 160 TYR B CE2 1 
ATOM   2807 C  CZ  . TYR B 1 161 ? -10.912 -29.168 21.262 1.00 29.63  ? 160 TYR B CZ  1 
ATOM   2808 O  OH  . TYR B 1 161 ? -10.454 -28.040 20.636 1.00 30.44  ? 160 TYR B OH  1 
ATOM   2809 N  N   . GLY B 1 162 ? -14.249 -34.290 25.355 1.00 34.53  ? 161 GLY B N   1 
ATOM   2810 C  CA  . GLY B 1 162 ? -14.391 -35.632 25.943 1.00 33.06  ? 161 GLY B CA  1 
ATOM   2811 C  C   . GLY B 1 162 ? -15.516 -36.510 25.427 1.00 41.11  ? 161 GLY B C   1 
ATOM   2812 O  O   . GLY B 1 162 ? -15.275 -37.636 24.964 1.00 26.99  ? 161 GLY B O   1 
ATOM   2813 N  N   . THR B 1 163 ? -16.742 -35.990 25.507 1.00 37.46  ? 162 THR B N   1 
ATOM   2814 C  CA  . THR B 1 163 ? -17.947 -36.706 25.079 1.00 39.35  ? 162 THR B CA  1 
ATOM   2815 C  C   . THR B 1 163 ? -17.874 -37.120 23.608 1.00 47.79  ? 162 THR B C   1 
ATOM   2816 O  O   . THR B 1 163 ? -18.206 -38.257 23.260 1.00 45.83  ? 162 THR B O   1 
ATOM   2817 C  CB  . THR B 1 163 ? -19.208 -35.844 25.303 1.00 40.11  ? 162 THR B CB  1 
ATOM   2818 O  OG1 . THR B 1 163 ? -19.160 -35.262 26.610 1.00 60.74  ? 162 THR B OG1 1 
ATOM   2819 C  CG2 . THR B 1 163 ? -20.477 -36.676 25.168 1.00 47.95  ? 162 THR B CG2 1 
ATOM   2820 N  N   . ILE B 1 164 ? -17.433 -36.193 22.758 1.00 35.75  ? 163 ILE B N   1 
ATOM   2821 C  CA  . ILE B 1 164 ? -17.306 -36.439 21.320 1.00 35.90  ? 163 ILE B CA  1 
ATOM   2822 C  C   . ILE B 1 164 ? -16.159 -37.413 21.029 1.00 32.27  ? 163 ILE B C   1 
ATOM   2823 O  O   . ILE B 1 164 ? -16.242 -38.222 20.101 1.00 30.14  ? 163 ILE B O   1 
ATOM   2824 C  CB  . ILE B 1 164 ? -17.079 -35.117 20.518 1.00 32.29  ? 163 ILE B CB  1 
ATOM   2825 C  CG1 . ILE B 1 164 ? -18.107 -34.024 20.889 1.00 28.04  ? 163 ILE B CG1 1 
ATOM   2826 C  CG2 . ILE B 1 164 ? -17.030 -35.389 19.008 1.00 33.45  ? 163 ILE B CG2 1 
ATOM   2827 C  CD1 . ILE B 1 164 ? -19.583 -34.351 20.583 1.00 31.89  ? 163 ILE B CD1 1 
ATOM   2828 N  N   . ALA B 1 165 ? -15.093 -37.325 21.825 1.00 29.21  ? 164 ALA B N   1 
ATOM   2829 C  CA  . ALA B 1 165 ? -13.934 -38.205 21.676 1.00 37.73  ? 164 ALA B CA  1 
ATOM   2830 C  C   . ALA B 1 165 ? -14.322 -39.671 21.857 1.00 45.66  ? 164 ALA B C   1 
ATOM   2831 O  O   . ALA B 1 165 ? -13.920 -40.527 21.059 1.00 36.22  ? 164 ALA B O   1 
ATOM   2832 C  CB  . ALA B 1 165 ? -12.829 -37.809 22.655 1.00 28.36  ? 164 ALA B CB  1 
ATOM   2833 N  N   . GLU B 1 166 ? -15.120 -39.942 22.894 1.00 40.06  ? 165 GLU B N   1 
ATOM   2834 C  CA  . GLU B 1 166 ? -15.532 -41.305 23.240 1.00 48.90  ? 165 GLU B CA  1 
ATOM   2835 C  C   . GLU B 1 166 ? -16.743 -41.831 22.453 1.00 44.71  ? 165 GLU B C   1 
ATOM   2836 O  O   . GLU B 1 166 ? -16.788 -43.011 22.113 1.00 48.94  ? 165 GLU B O   1 
ATOM   2837 C  CB  . GLU B 1 166 ? -15.761 -41.441 24.756 1.00 56.19  ? 165 GLU B CB  1 
ATOM   2838 C  CG  . GLU B 1 166 ? -16.873 -40.559 25.328 1.00 78.54  ? 165 GLU B CG  1 
ATOM   2839 C  CD  . GLU B 1 166 ? -16.781 -40.368 26.837 1.00 82.75  ? 165 GLU B CD  1 
ATOM   2840 O  OE1 . GLU B 1 166 ? -15.687 -40.018 27.339 1.00 84.44  ? 165 GLU B OE1 1 
ATOM   2841 O  OE2 . GLU B 1 166 ? -17.813 -40.548 27.519 1.00 91.62  ? 165 GLU B OE2 1 
ATOM   2842 N  N   . LYS B 1 167 ? -17.707 -40.960 22.153 1.00 43.27  ? 166 LYS B N   1 
ATOM   2843 C  CA  . LYS B 1 167 ? -18.985 -41.393 21.568 1.00 55.43  ? 166 LYS B CA  1 
ATOM   2844 C  C   . LYS B 1 167 ? -19.211 -40.924 20.132 1.00 39.03  ? 166 LYS B C   1 
ATOM   2845 O  O   . LYS B 1 167 ? -19.974 -41.544 19.391 1.00 45.03  ? 166 LYS B O   1 
ATOM   2846 C  CB  . LYS B 1 167 ? -20.158 -40.963 22.458 1.00 73.40  ? 166 LYS B CB  1 
ATOM   2847 C  CG  . LYS B 1 167 ? -20.243 -41.709 23.783 1.00 80.77  ? 166 LYS B CG  1 
ATOM   2848 C  CD  . LYS B 1 167 ? -21.159 -40.993 24.762 1.00 89.80  ? 166 LYS B CD  1 
ATOM   2849 C  CE  . LYS B 1 167 ? -21.197 -41.705 26.107 1.00 89.79  ? 166 LYS B CE  1 
ATOM   2850 N  NZ  . LYS B 1 167 ? -22.056 -40.984 27.086 1.00 75.83  ? 166 LYS B NZ  1 
ATOM   2851 N  N   . GLY B 1 168 ? -18.549 -39.831 19.751 1.00 44.78  ? 167 GLY B N   1 
ATOM   2852 C  CA  . GLY B 1 168 ? -18.657 -39.269 18.402 1.00 26.40  ? 167 GLY B CA  1 
ATOM   2853 C  C   . GLY B 1 168 ? -19.971 -38.552 18.163 1.00 25.06  ? 167 GLY B C   1 
ATOM   2854 O  O   . GLY B 1 168 ? -20.705 -38.245 19.101 1.00 31.76  ? 167 GLY B O   1 
ATOM   2855 N  N   . PHE B 1 169 ? -20.261 -38.276 16.897 1.00 36.60  ? 168 PHE B N   1 
ATOM   2856 C  CA  . PHE B 1 169 ? -21.540 -37.698 16.518 1.00 30.35  ? 168 PHE B CA  1 
ATOM   2857 C  C   . PHE B 1 169 ? -22.498 -38.824 16.132 1.00 34.44  ? 168 PHE B C   1 
ATOM   2858 O  O   . PHE B 1 169 ? -22.064 -39.921 15.798 1.00 39.79  ? 168 PHE B O   1 
ATOM   2859 C  CB  . PHE B 1 169 ? -21.359 -36.673 15.386 1.00 29.48  ? 168 PHE B CB  1 
ATOM   2860 C  CG  . PHE B 1 169 ? -20.891 -35.319 15.863 1.00 24.21  ? 168 PHE B CG  1 
ATOM   2861 C  CD1 . PHE B 1 169 ? -19.600 -35.144 16.357 1.00 20.88  ? 168 PHE B CD1 1 
ATOM   2862 C  CD2 . PHE B 1 169 ? -21.746 -34.219 15.828 1.00 18.40  ? 168 PHE B CD2 1 
ATOM   2863 C  CE1 . PHE B 1 169 ? -19.165 -33.897 16.811 1.00 28.72  ? 168 PHE B CE1 1 
ATOM   2864 C  CE2 . PHE B 1 169 ? -21.317 -32.970 16.279 1.00 20.06  ? 168 PHE B CE2 1 
ATOM   2865 C  CZ  . PHE B 1 169 ? -20.018 -32.814 16.772 1.00 13.45  ? 168 PHE B CZ  1 
ATOM   2866 N  N   . SER B 1 170 ? -23.798 -38.552 16.208 1.00 25.17  ? 169 SER B N   1 
ATOM   2867 C  CA  . SER B 1 170 ? -24.824 -39.542 15.912 1.00 24.25  ? 169 SER B CA  1 
ATOM   2868 C  C   . SER B 1 170 ? -25.004 -39.710 14.404 1.00 26.67  ? 169 SER B C   1 
ATOM   2869 O  O   . SER B 1 170 ? -25.643 -40.658 13.951 1.00 39.07  ? 169 SER B O   1 
ATOM   2870 C  CB  . SER B 1 170 ? -26.150 -39.147 16.582 1.00 22.26  ? 169 SER B CB  1 
ATOM   2871 O  OG  . SER B 1 170 ? -26.741 -38.028 15.941 1.00 24.84  ? 169 SER B OG  1 
ATOM   2872 N  N   . LYS B 1 171 ? -24.447 -38.774 13.637 1.00 22.78  ? 170 LYS B N   1 
ATOM   2873 C  CA  . LYS B 1 171 ? -24.425 -38.855 12.177 1.00 23.13  ? 170 LYS B CA  1 
ATOM   2874 C  C   . LYS B 1 171 ? -22.985 -38.848 11.657 1.00 36.23  ? 170 LYS B C   1 
ATOM   2875 O  O   . LYS B 1 171 ? -22.087 -38.297 12.308 1.00 26.98  ? 170 LYS B O   1 
ATOM   2876 C  CB  . LYS B 1 171 ? -25.218 -37.698 11.553 1.00 25.91  ? 170 LYS B CB  1 
ATOM   2877 C  CG  . LYS B 1 171 ? -26.730 -37.711 11.830 1.00 37.03  ? 170 LYS B CG  1 
ATOM   2878 C  CD  . LYS B 1 171 ? -27.450 -38.789 11.038 1.00 46.39  ? 170 LYS B CD  1 
ATOM   2879 C  CE  . LYS B 1 171 ? -28.952 -38.531 10.947 1.00 56.19  ? 170 LYS B CE  1 
ATOM   2880 N  NZ  . LYS B 1 171 ? -29.597 -39.426 9.927  1.00 49.05  ? 170 LYS B NZ  1 
ATOM   2881 N  N   . ILE B 1 172 ? -22.769 -39.480 10.502 1.00 30.83  ? 171 ILE B N   1 
ATOM   2882 C  CA  . ILE B 1 172 ? -21.470 -39.429 9.815  1.00 25.44  ? 171 ILE B CA  1 
ATOM   2883 C  C   . ILE B 1 172 ? -21.636 -38.982 8.367  1.00 18.65  ? 171 ILE B C   1 
ATOM   2884 O  O   . ILE B 1 172 ? -22.697 -39.160 7.764  1.00 27.69  ? 171 ILE B O   1 
ATOM   2885 C  CB  . ILE B 1 172 ? -20.654 -40.765 9.894  1.00 23.19  ? 171 ILE B CB  1 
ATOM   2886 C  CG1 . ILE B 1 172 ? -21.420 -41.934 9.257  1.00 22.22  ? 171 ILE B CG1 1 
ATOM   2887 C  CG2 . ILE B 1 172 ? -20.234 -41.066 11.338 1.00 19.58  ? 171 ILE B CG2 1 
ATOM   2888 C  CD1 . ILE B 1 172 ? -20.585 -43.201 9.075  1.00 27.71  ? 171 ILE B CD1 1 
ATOM   2889 N  N   . VAL B 1 173 ? -20.583 -38.388 7.819  1.00 23.35  ? 172 VAL B N   1 
ATOM   2890 C  CA  . VAL B 1 173 ? -20.614 -37.874 6.453  1.00 18.03  ? 172 VAL B CA  1 
ATOM   2891 C  C   . VAL B 1 173 ? -19.603 -38.653 5.630  1.00 21.00  ? 172 VAL B C   1 
ATOM   2892 O  O   . VAL B 1 173 ? -18.408 -38.637 5.912  1.00 19.29  ? 172 VAL B O   1 
ATOM   2893 C  CB  . VAL B 1 173 ? -20.344 -36.353 6.404  1.00 22.93  ? 172 VAL B CB  1 
ATOM   2894 C  CG1 . VAL B 1 173 ? -20.611 -35.788 4.999  1.00 19.25  ? 172 VAL B CG1 1 
ATOM   2895 C  CG2 . VAL B 1 173 ? -21.196 -35.633 7.441  1.00 13.51  ? 172 VAL B CG2 1 
ATOM   2896 N  N   . ILE B 1 174 ? -20.110 -39.364 4.631  1.00 19.73  ? 173 ILE B N   1 
ATOM   2897 C  CA  . ILE B 1 174 ? -19.330 -40.346 3.891  1.00 22.40  ? 173 ILE B CA  1 
ATOM   2898 C  C   . ILE B 1 174 ? -19.523 -40.163 2.395  1.00 25.25  ? 173 ILE B C   1 
ATOM   2899 O  O   . ILE B 1 174 ? -20.460 -39.480 1.960  1.00 23.05  ? 173 ILE B O   1 
ATOM   2900 C  CB  . ILE B 1 174 ? -19.721 -41.808 4.287  1.00 22.22  ? 173 ILE B CB  1 
ATOM   2901 C  CG1 . ILE B 1 174 ? -21.202 -42.085 3.977  1.00 17.41  ? 173 ILE B CG1 1 
ATOM   2902 C  CG2 . ILE B 1 174 ? -19.402 -42.069 5.767  1.00 15.34  ? 173 ILE B CG2 1 
ATOM   2903 C  CD1 . ILE B 1 174 ? -21.579 -43.556 3.961  1.00 18.99  ? 173 ILE B CD1 1 
ATOM   2904 N  N   . GLU B 1 175 ? -18.619 -40.746 1.613  1.00 26.08  ? 174 GLU B N   1 
ATOM   2905 C  CA  . GLU B 1 175 ? -18.828 -40.879 0.174  1.00 31.84  ? 174 GLU B CA  1 
ATOM   2906 C  C   . GLU B 1 175 ? -19.204 -42.325 -0.127 1.00 32.66  ? 174 GLU B C   1 
ATOM   2907 O  O   . GLU B 1 175 ? -18.414 -43.243 0.092  1.00 27.68  ? 174 GLU B O   1 
ATOM   2908 C  CB  . GLU B 1 175 ? -17.586 -40.464 -0.611 1.00 33.02  ? 174 GLU B CB  1 
ATOM   2909 C  CG  . GLU B 1 175 ? -17.767 -40.540 -2.119 1.00 54.77  ? 174 GLU B CG  1 
ATOM   2910 C  CD  . GLU B 1 175 ? -16.977 -39.485 -2.868 1.00 68.87  ? 174 GLU B CD  1 
ATOM   2911 O  OE1 . GLU B 1 175 ? -15.771 -39.300 -2.584 1.00 73.04  ? 174 GLU B OE1 1 
ATOM   2912 O  OE2 . GLU B 1 175 ? -17.574 -38.843 -3.757 1.00 79.32  ? 174 GLU B OE2 1 
ATOM   2913 N  N   . GLU B 1 176 ? -20.426 -42.516 -0.610 1.00 33.12  ? 175 GLU B N   1 
ATOM   2914 C  CA  . GLU B 1 176 ? -20.931 -43.845 -0.930 1.00 34.10  ? 175 GLU B CA  1 
ATOM   2915 C  C   . GLU B 1 176 ? -21.577 -43.816 -2.314 1.00 47.08  ? 175 GLU B C   1 
ATOM   2916 O  O   . GLU B 1 176 ? -22.486 -43.020 -2.568 1.00 36.50  ? 175 GLU B O   1 
ATOM   2917 C  CB  . GLU B 1 176 ? -21.933 -44.288 0.134  1.00 40.92  ? 175 GLU B CB  1 
ATOM   2918 C  CG  . GLU B 1 176 ? -22.095 -45.788 0.280  1.00 37.71  ? 175 GLU B CG  1 
ATOM   2919 C  CD  . GLU B 1 176 ? -22.952 -46.153 1.471  1.00 41.26  ? 175 GLU B CD  1 
ATOM   2920 O  OE1 . GLU B 1 176 ? -24.147 -45.781 1.482  1.00 37.93  ? 175 GLU B OE1 1 
ATOM   2921 O  OE2 . GLU B 1 176 ? -22.430 -46.809 2.399  1.00 57.07  ? 175 GLU B OE2 1 
ATOM   2922 N  N   . ASN B 1 177 ? -21.083 -44.673 -3.207 1.00 56.55  ? 176 ASN B N   1 
ATOM   2923 C  CA  . ASN B 1 177 ? -21.565 -44.753 -4.592 1.00 70.16  ? 176 ASN B CA  1 
ATOM   2924 C  C   . ASN B 1 177 ? -21.501 -43.413 -5.327 1.00 64.73  ? 176 ASN B C   1 
ATOM   2925 O  O   . ASN B 1 177 ? -22.474 -42.981 -5.950 1.00 65.94  ? 176 ASN B O   1 
ATOM   2926 C  CB  . ASN B 1 177 ? -22.978 -45.360 -4.656 1.00 65.18  ? 176 ASN B CB  1 
ATOM   2927 C  CG  . ASN B 1 177 ? -23.033 -46.779 -4.109 1.00 63.68  ? 176 ASN B CG  1 
ATOM   2928 O  OD1 . ASN B 1 177 ? -23.852 -47.090 -3.239 1.00 55.20  ? 176 ASN B OD1 1 
ATOM   2929 N  ND2 . ASN B 1 177 ? -22.154 -47.645 -4.611 1.00 62.12  ? 176 ASN B ND2 1 
ATOM   2930 N  N   . GLY B 1 178 ? -20.345 -42.758 -5.230 1.00 66.50  ? 177 GLY B N   1 
ATOM   2931 C  CA  . GLY B 1 178 ? -20.081 -41.505 -5.934 1.00 64.30  ? 177 GLY B CA  1 
ATOM   2932 C  C   . GLY B 1 178 ? -20.814 -40.270 -5.433 1.00 55.54  ? 177 GLY B C   1 
ATOM   2933 O  O   . GLY B 1 178 ? -20.770 -39.225 -6.085 1.00 47.30  ? 177 GLY B O   1 
ATOM   2934 N  N   . GLU B 1 179 ? -21.486 -40.373 -4.284 1.00 45.83  ? 178 GLU B N   1 
ATOM   2935 C  CA  . GLU B 1 179 ? -22.185 -39.218 -3.713 1.00 55.37  ? 178 GLU B CA  1 
ATOM   2936 C  C   . GLU B 1 179 ? -22.008 -39.035 -2.201 1.00 48.50  ? 178 GLU B C   1 
ATOM   2937 O  O   . GLU B 1 179 ? -21.809 -40.006 -1.461 1.00 40.12  ? 178 GLU B O   1 
ATOM   2938 C  CB  . GLU B 1 179 ? -23.673 -39.230 -4.088 1.00 63.25  ? 178 GLU B CB  1 
ATOM   2939 C  CG  . GLU B 1 179 ? -24.529 -40.235 -3.334 1.00 66.60  ? 178 GLU B CG  1 
ATOM   2940 C  CD  . GLU B 1 179 ? -26.001 -40.109 -3.674 1.00 68.65  ? 178 GLU B CD  1 
ATOM   2941 O  OE1 . GLU B 1 179 ? -26.831 -40.111 -2.739 1.00 66.40  ? 178 GLU B OE1 1 
ATOM   2942 O  OE2 . GLU B 1 179 ? -26.328 -39.997 -4.876 1.00 68.00  ? 178 GLU B OE2 1 
ATOM   2943 N  N   . VAL B 1 180 ? -22.091 -37.779 -1.762 1.00 31.46  ? 179 VAL B N   1 
ATOM   2944 C  CA  . VAL B 1 180 ? -21.976 -37.430 -0.342 1.00 30.62  ? 179 VAL B CA  1 
ATOM   2945 C  C   . VAL B 1 180 ? -23.281 -37.771 0.367  1.00 28.01  ? 179 VAL B C   1 
ATOM   2946 O  O   . VAL B 1 180 ? -24.361 -37.372 -0.078 1.00 36.12  ? 179 VAL B O   1 
ATOM   2947 C  CB  . VAL B 1 180 ? -21.615 -35.923 -0.136 1.00 26.24  ? 179 VAL B CB  1 
ATOM   2948 C  CG1 . VAL B 1 180 ? -21.487 -35.575 1.348  1.00 27.36  ? 179 VAL B CG1 1 
ATOM   2949 C  CG2 . VAL B 1 180 ? -20.335 -35.566 -0.876 1.00 18.51  ? 179 VAL B CG2 1 
ATOM   2950 N  N   . LYS B 1 181 ? -23.176 -38.513 1.466  1.00 26.74  ? 180 LYS B N   1 
ATOM   2951 C  CA  . LYS B 1 181 ? -24.343 -38.892 2.260  1.00 17.49  ? 180 LYS B CA  1 
ATOM   2952 C  C   . LYS B 1 181 ? -24.132 -38.550 3.724  1.00 30.15  ? 180 LYS B C   1 
ATOM   2953 O  O   . LYS B 1 181 ? -23.062 -38.825 4.278  1.00 28.97  ? 180 LYS B O   1 
ATOM   2954 C  CB  . LYS B 1 181 ? -24.626 -40.400 2.136  1.00 22.20  ? 180 LYS B CB  1 
ATOM   2955 C  CG  . LYS B 1 181 ? -24.743 -40.922 0.706  1.00 25.22  ? 180 LYS B CG  1 
ATOM   2956 C  CD  . LYS B 1 181 ? -25.277 -42.358 0.680  1.00 28.76  ? 180 LYS B CD  1 
ATOM   2957 C  CE  . LYS B 1 181 ? -25.334 -42.881 -0.759 1.00 44.64  ? 180 LYS B CE  1 
ATOM   2958 N  NZ  . LYS B 1 181 ? -25.628 -44.342 -0.844 1.00 36.52  ? 180 LYS B NZ  1 
ATOM   2959 N  N   . VAL B 1 182 ? -25.145 -37.942 4.342  1.00 27.75  ? 181 VAL B N   1 
ATOM   2960 C  CA  . VAL B 1 182 ? -25.203 -37.840 5.800  1.00 28.75  ? 181 VAL B CA  1 
ATOM   2961 C  C   . VAL B 1 182 ? -26.080 -38.986 6.295  1.00 30.48  ? 181 VAL B C   1 
ATOM   2962 O  O   . VAL B 1 182 ? -27.293 -39.002 6.063  1.00 45.46  ? 181 VAL B O   1 
ATOM   2963 C  CB  . VAL B 1 182 ? -25.760 -36.477 6.309  1.00 19.45  ? 181 VAL B CB  1 
ATOM   2964 C  CG1 . VAL B 1 182 ? -25.649 -36.386 7.826  1.00 27.79  ? 181 VAL B CG1 1 
ATOM   2965 C  CG2 . VAL B 1 182 ? -25.046 -35.311 5.644  1.00 22.30  ? 181 VAL B CG2 1 
ATOM   2966 N  N   . VAL B 1 183 ? -25.454 -39.945 6.969  1.00 37.71  ? 182 VAL B N   1 
ATOM   2967 C  CA  . VAL B 1 183 ? -26.133 -41.163 7.406  1.00 24.17  ? 182 VAL B CA  1 
ATOM   2968 C  C   . VAL B 1 183 ? -25.910 -41.381 8.894  1.00 16.46  ? 182 VAL B C   1 
ATOM   2969 O  O   . VAL B 1 183 ? -25.067 -40.722 9.508  1.00 33.31  ? 182 VAL B O   1 
ATOM   2970 C  CB  . VAL B 1 183 ? -25.682 -42.419 6.587  1.00 18.06  ? 182 VAL B CB  1 
ATOM   2971 C  CG1 . VAL B 1 183 ? -25.941 -42.218 5.101  1.00 18.13  ? 182 VAL B CG1 1 
ATOM   2972 C  CG2 . VAL B 1 183 ? -24.206 -42.731 6.825  1.00 20.07  ? 182 VAL B CG2 1 
ATOM   2973 N  N   . ASP B 1 184 ? -26.690 -42.286 9.479  1.00 30.68  ? 183 ASP B N   1 
ATOM   2974 C  CA  . ASP B 1 184 ? -26.543 -42.641 10.884 1.00 33.27  ? 183 ASP B CA  1 
ATOM   2975 C  C   . ASP B 1 184 ? -25.156 -43.219 11.144 1.00 26.58  ? 183 ASP B C   1 
ATOM   2976 O  O   . ASP B 1 184 ? -24.663 -44.045 10.371 1.00 37.95  ? 183 ASP B O   1 
ATOM   2977 C  CB  . ASP B 1 184 ? -27.608 -43.671 11.299 1.00 48.22  ? 183 ASP B CB  1 
ATOM   2978 C  CG  . ASP B 1 184 ? -29.006 -43.075 11.412 1.00 51.27  ? 183 ASP B CG  1 
ATOM   2979 O  OD1 . ASP B 1 184 ? -29.214 -41.906 11.023 1.00 55.17  ? 183 ASP B OD1 1 
ATOM   2980 O  OD2 . ASP B 1 184 ? -29.908 -43.791 11.892 1.00 59.38  ? 183 ASP B OD2 1 
ATOM   2981 N  N   . ASN B 1 185 ? -24.533 -42.776 12.230 1.00 31.12  ? 184 ASN B N   1 
ATOM   2982 C  CA  . ASN B 1 185 ? -23.308 -43.383 12.727 1.00 31.80  ? 184 ASN B CA  1 
ATOM   2983 C  C   . ASN B 1 185 ? -23.637 -44.796 13.226 1.00 41.36  ? 184 ASN B C   1 
ATOM   2984 O  O   . ASN B 1 185 ? -24.415 -44.945 14.172 1.00 62.29  ? 184 ASN B O   1 
ATOM   2985 C  CB  . ASN B 1 185 ? -22.723 -42.513 13.848 1.00 18.81  ? 184 ASN B CB  1 
ATOM   2986 C  CG  . ASN B 1 185 ? -21.381 -43.020 14.377 1.00 36.18  ? 184 ASN B CG  1 
ATOM   2987 O  OD1 . ASN B 1 185 ? -21.005 -44.174 14.178 1.00 43.03  ? 184 ASN B OD1 1 
ATOM   2988 N  ND2 . ASN B 1 185 ? -20.655 -42.145 15.068 1.00 30.02  ? 184 ASN B ND2 1 
ATOM   2989 N  N   . PRO B 1 186 ? -23.060 -45.838 12.585 1.00 58.85  ? 185 PRO B N   1 
ATOM   2990 C  CA  . PRO B 1 186 ? -23.348 -47.226 12.979 1.00 64.86  ? 185 PRO B CA  1 
ATOM   2991 C  C   . PRO B 1 186 ? -22.740 -47.612 14.333 1.00 60.93  ? 185 PRO B C   1 
ATOM   2992 O  O   . PRO B 1 186 ? -23.121 -48.628 14.914 1.00 73.60  ? 185 PRO B O   1 
ATOM   2993 C  CB  . PRO B 1 186 ? -22.710 -48.059 11.852 1.00 67.72  ? 185 PRO B CB  1 
ATOM   2994 C  CG  . PRO B 1 186 ? -22.361 -47.078 10.760 1.00 59.27  ? 185 PRO B CG  1 
ATOM   2995 C  CD  . PRO B 1 186 ? -22.106 -45.786 11.463 1.00 50.95  ? 185 PRO B CD  1 
ATOM   2996 N  N   . ARG B 1 187 ? -21.813 -46.792 14.825 1.00 55.76  ? 186 ARG B N   1 
ATOM   2997 C  CA  . ARG B 1 187 ? -21.102 -47.049 16.074 1.00 61.77  ? 186 ARG B CA  1 
ATOM   2998 C  C   . ARG B 1 187 ? -21.717 -46.257 17.240 1.00 60.60  ? 186 ARG B C   1 
ATOM   2999 O  O   . ARG B 1 187 ? -21.171 -46.240 18.345 1.00 60.65  ? 186 ARG B O   1 
ATOM   3000 C  CB  . ARG B 1 187 ? -19.624 -46.678 15.895 1.00 77.19  ? 186 ARG B CB  1 
ATOM   3001 C  CG  . ARG B 1 187 ? -18.632 -47.632 16.537 1.00 92.95  ? 186 ARG B CG  1 
ATOM   3002 C  CD  . ARG B 1 187 ? -17.225 -47.061 16.460 1.00 101.04 ? 186 ARG B CD  1 
ATOM   3003 N  NE  . ARG B 1 187 ? -16.205 -48.000 16.929 1.00 111.15 ? 186 ARG B NE  1 
ATOM   3004 C  CZ  . ARG B 1 187 ? -15.284 -48.573 16.156 1.00 108.08 ? 186 ARG B CZ  1 
ATOM   3005 N  NH1 . ARG B 1 187 ? -15.231 -48.310 14.855 1.00 96.52  ? 186 ARG B NH1 1 
ATOM   3006 N  NH2 . ARG B 1 187 ? -14.405 -49.411 16.688 1.00 102.11 ? 186 ARG B NH2 1 
ATOM   3007 N  N   . TRP B 1 188 ? -22.858 -45.615 16.983 1.00 68.66  ? 187 TRP B N   1 
ATOM   3008 C  CA  . TRP B 1 188 ? -23.525 -44.743 17.959 1.00 74.85  ? 187 TRP B CA  1 
ATOM   3009 C  C   . TRP B 1 188 ? -24.595 -45.501 18.742 1.00 65.70  ? 187 TRP B C   1 
ATOM   3010 O  O   . TRP B 1 188 ? -25.421 -46.205 18.159 1.00 64.71  ? 187 TRP B O   1 
ATOM   3011 C  CB  . TRP B 1 188 ? -24.129 -43.516 17.251 1.00 62.96  ? 187 TRP B CB  1 
ATOM   3012 C  CG  . TRP B 1 188 ? -24.950 -42.597 18.131 1.00 62.63  ? 187 TRP B CG  1 
ATOM   3013 C  CD1 . TRP B 1 188 ? -26.312 -42.603 18.280 1.00 63.10  ? 187 TRP B CD1 1 
ATOM   3014 C  CD2 . TRP B 1 188 ? -24.464 -41.536 18.965 1.00 61.93  ? 187 TRP B CD2 1 
ATOM   3015 N  NE1 . TRP B 1 188 ? -26.701 -41.617 19.159 1.00 53.29  ? 187 TRP B NE1 1 
ATOM   3016 C  CE2 . TRP B 1 188 ? -25.587 -40.950 19.596 1.00 62.13  ? 187 TRP B CE2 1 
ATOM   3017 C  CE3 . TRP B 1 188 ? -23.190 -41.028 19.246 1.00 49.75  ? 187 TRP B CE3 1 
ATOM   3018 C  CZ2 . TRP B 1 188 ? -25.474 -39.878 20.487 1.00 53.58  ? 187 TRP B CZ2 1 
ATOM   3019 C  CZ3 . TRP B 1 188 ? -23.082 -39.963 20.138 1.00 55.57  ? 187 TRP B CZ3 1 
ATOM   3020 C  CH2 . TRP B 1 188 ? -24.217 -39.400 20.743 1.00 40.15  ? 187 TRP B CH2 1 
HETATM 3021 ZN ZN  . ZN  C 2 .   ? -20.624 -2.691  18.273 1.00 18.57  ? 402 ZN  A ZN  1 
HETATM 3022 C  C1  . M6P D 3 .   ? -21.955 -3.310  12.286 0.75 20.13  ? 501 M6P A C1  1 
HETATM 3023 C  C2  . M6P D 3 .   ? -22.287 -3.718  13.731 0.75 16.73  ? 501 M6P A C2  1 
HETATM 3024 C  C3  . M6P D 3 .   ? -23.712 -3.352  14.133 0.75 21.68  ? 501 M6P A C3  1 
HETATM 3025 C  C4  . M6P D 3 .   ? -23.987 -1.875  13.920 0.75 23.58  ? 501 M6P A C4  1 
HETATM 3026 C  C5  . M6P D 3 .   ? -23.357 -1.260  12.661 0.75 41.96  ? 501 M6P A C5  1 
HETATM 3027 C  C6  . M6P D 3 .   ? -22.573 -0.050  13.110 0.75 41.83  ? 501 M6P A C6  1 
HETATM 3028 O  O1  . M6P D 3 .   ? -22.483 -4.254  11.335 0.75 19.14  ? 501 M6P A O1  1 
HETATM 3029 O  O2  . M6P D 3 .   ? -21.331 -3.177  14.665 0.75 19.88  ? 501 M6P A O2  1 
HETATM 3030 O  O3  . M6P D 3 .   ? -23.899 -3.635  15.523 0.75 14.90  ? 501 M6P A O3  1 
HETATM 3031 O  O4  . M6P D 3 .   ? -25.403 -1.632  13.925 0.75 26.04  ? 501 M6P A O4  1 
HETATM 3032 O  O5  . M6P D 3 .   ? -22.402 -2.008  11.895 0.75 27.81  ? 501 M6P A O5  1 
HETATM 3033 O  O6  . M6P D 3 .   ? -23.352 1.083   12.813 0.75 12.64  ? 501 M6P A O6  1 
HETATM 3034 P  P   . M6P D 3 .   ? -23.889 1.991   14.004 0.75 11.24  ? 501 M6P A P   1 
HETATM 3035 O  O1P . M6P D 3 .   ? -22.665 2.497   14.725 0.75 8.64   ? 501 M6P A O1P 1 
HETATM 3036 O  O2P . M6P D 3 .   ? -24.733 1.057   14.833 0.75 14.59  ? 501 M6P A O2P 1 
HETATM 3037 O  O3P . M6P D 3 .   ? -24.664 3.026   13.229 0.75 13.10  ? 501 M6P A O3P 1 
HETATM 3038 ZN ZN  . ZN  E 2 .   ? -16.683 -23.830 19.351 1.00 25.88  ? 401 ZN  B ZN  1 
HETATM 3039 C  C1  . M6P F 3 .   ? -12.692 -23.334 14.798 0.75 25.84  ? 502 M6P B C1  1 
HETATM 3040 C  C2  . M6P F 3 .   ? -12.965 -22.844 16.232 0.75 19.62  ? 502 M6P B C2  1 
HETATM 3041 C  C3  . M6P F 3 .   ? -11.884 -23.280 17.221 0.75 29.36  ? 502 M6P B C3  1 
HETATM 3042 C  C4  . M6P F 3 .   ? -11.613 -24.779 17.085 0.75 27.05  ? 502 M6P B C4  1 
HETATM 3043 C  C5  . M6P F 3 .   ? -11.250 -25.140 15.634 0.75 35.76  ? 502 M6P B C5  1 
HETATM 3044 C  C6  . M6P F 3 .   ? -10.890 -26.618 15.418 0.75 37.56  ? 502 M6P B C6  1 
HETATM 3045 O  O1  . M6P F 3 .   ? -11.717 -22.487 14.151 0.75 20.16  ? 502 M6P B O1  1 
HETATM 3046 O  O2  . M6P F 3 .   ? -14.238 -23.326 16.698 0.75 23.30  ? 502 M6P B O2  1 
HETATM 3047 O  O3  . M6P F 3 .   ? -12.303 -22.974 18.561 0.75 14.24  ? 502 M6P B O3  1 
HETATM 3048 O  O4  . M6P F 3 .   ? -10.571 -25.151 17.993 0.75 35.24  ? 502 M6P B O4  1 
HETATM 3049 O  O5  . M6P F 3 .   ? -12.297 -24.723 14.736 0.75 34.66  ? 502 M6P B O5  1 
HETATM 3050 O  O6  . M6P F 3 .   ? -11.922 -27.538 15.795 0.75 35.37  ? 502 M6P B O6  1 
HETATM 3051 P  P   . M6P F 3 .   ? -11.791 -28.519 17.081 0.75 22.78  ? 502 M6P B P   1 
HETATM 3052 O  O1P . M6P F 3 .   ? -13.128 -29.193 17.148 0.75 13.77  ? 502 M6P B O1P 1 
HETATM 3053 O  O2P . M6P F 3 .   ? -11.520 -27.565 18.226 0.75 28.37  ? 502 M6P B O2P 1 
HETATM 3054 O  O3P . M6P F 3 .   ? -10.655 -29.462 16.808 0.75 20.15  ? 502 M6P B O3P 1 
HETATM 3055 O  O   . HOH G 4 .   ? -18.081 -0.784  24.365 1.00 12.69  ? 502 HOH A O   1 
HETATM 3056 O  O   . HOH G 4 .   ? -14.782 10.513  7.987  1.00 6.05   ? 503 HOH A O   1 
HETATM 3057 O  O   . HOH G 4 .   ? -16.979 -7.656  -9.649 1.00 54.70  ? 504 HOH A O   1 
HETATM 3058 O  O   . HOH G 4 .   ? -24.964 7.234   -1.404 1.00 18.90  ? 505 HOH A O   1 
HETATM 3059 O  O   . HOH G 4 .   ? -19.728 12.498  14.946 1.00 18.15  ? 506 HOH A O   1 
HETATM 3060 O  O   . HOH G 4 .   ? -34.043 15.376  0.104  1.00 36.74  ? 507 HOH A O   1 
HETATM 3061 O  O   . HOH G 4 .   ? -32.342 -10.054 12.942 1.00 22.84  ? 508 HOH A O   1 
HETATM 3062 O  O   . HOH G 4 .   ? -32.555 -17.779 16.253 1.00 25.45  ? 509 HOH A O   1 
HETATM 3063 O  O   . HOH G 4 .   ? -24.153 -4.386  19.703 1.00 16.08  ? 510 HOH A O   1 
HETATM 3064 O  O   . HOH G 4 .   ? -20.158 1.864   14.003 1.00 16.23  ? 511 HOH A O   1 
HETATM 3065 O  O   . HOH G 4 .   ? -20.577 24.332  7.980  1.00 23.61  ? 512 HOH A O   1 
HETATM 3066 O  O   . HOH G 4 .   ? -14.941 10.933  13.141 1.00 14.42  ? 513 HOH A O   1 
HETATM 3067 O  O   . HOH G 4 .   ? -16.478 12.733  14.866 1.00 11.34  ? 514 HOH A O   1 
HETATM 3068 O  O   . HOH G 4 .   ? -11.989 2.325   -4.197 1.00 20.48  ? 515 HOH A O   1 
HETATM 3069 O  O   . HOH G 4 .   ? -13.970 -4.448  -5.381 1.00 31.37  ? 516 HOH A O   1 
HETATM 3070 O  O   . HOH G 4 .   ? -26.474 -17.973 25.650 1.00 21.14  ? 517 HOH A O   1 
HETATM 3071 O  O   . HOH G 4 .   ? -13.079 1.369   -6.420 1.00 17.80  ? 518 HOH A O   1 
HETATM 3072 O  O   . HOH G 4 .   ? -14.381 1.727   -0.731 1.00 7.48   ? 519 HOH A O   1 
HETATM 3073 O  O   . HOH G 4 .   ? -26.059 15.837  -4.479 1.00 29.49  ? 520 HOH A O   1 
HETATM 3074 O  O   . HOH G 4 .   ? -18.989 -8.371  32.343 1.00 13.33  ? 521 HOH A O   1 
HETATM 3075 O  O   . HOH G 4 .   ? -34.114 11.014  -0.859 1.00 49.21  ? 522 HOH A O   1 
HETATM 3076 O  O   . HOH G 4 .   ? -27.149 -14.394 15.270 1.00 13.64  ? 523 HOH A O   1 
HETATM 3077 O  O   . HOH G 4 .   ? -29.367 -8.949  20.426 1.00 17.50  ? 524 HOH A O   1 
HETATM 3078 O  O   . HOH G 4 .   ? -19.854 -3.356  -4.326 1.00 35.34  ? 525 HOH A O   1 
HETATM 3079 O  O   . HOH G 4 .   ? -17.564 -2.404  -3.223 1.00 11.45  ? 526 HOH A O   1 
HETATM 3080 O  O   . HOH G 4 .   ? -12.409 8.834   -2.507 1.00 32.53  ? 527 HOH A O   1 
HETATM 3081 O  O   . HOH G 4 .   ? -22.225 -12.034 26.131 1.00 10.68  ? 528 HOH A O   1 
HETATM 3082 O  O   . HOH G 4 .   ? -21.303 -13.357 24.056 1.00 11.63  ? 529 HOH A O   1 
HETATM 3083 O  O   . HOH G 4 .   ? -27.644 -2.977  14.210 1.00 45.42  ? 530 HOH A O   1 
HETATM 3084 O  O   . HOH G 4 .   ? -3.193  10.799  8.276  1.00 33.36  ? 531 HOH A O   1 
HETATM 3085 O  O   . HOH G 4 .   ? -29.756 -23.587 7.219  1.00 24.32  ? 532 HOH A O   1 
HETATM 3086 O  O   . HOH G 4 .   ? -23.409 16.911  17.737 1.00 20.63  ? 533 HOH A O   1 
HETATM 3087 O  O   . HOH G 4 .   ? -19.895 18.701  19.720 1.00 35.04  ? 534 HOH A O   1 
HETATM 3088 O  O   . HOH G 4 .   ? -35.704 -6.021  7.076  1.00 24.25  ? 535 HOH A O   1 
HETATM 3089 O  O   . HOH G 4 .   ? -27.271 -12.550 -0.429 1.00 31.13  ? 536 HOH A O   1 
HETATM 3090 O  O   . HOH G 4 .   ? -17.539 14.462  12.696 1.00 13.30  ? 537 HOH A O   1 
HETATM 3091 O  O   . HOH G 4 .   ? -8.373  20.257  -0.352 1.00 38.81  ? 538 HOH A O   1 
HETATM 3092 O  O   . HOH G 4 .   ? -22.714 19.626  0.473  1.00 21.71  ? 539 HOH A O   1 
HETATM 3093 O  O   . HOH G 4 .   ? -32.997 -15.692 20.347 1.00 20.18  ? 540 HOH A O   1 
HETATM 3094 O  O   . HOH G 4 .   ? -4.834  -4.700  7.281  1.00 41.76  ? 541 HOH A O   1 
HETATM 3095 O  O   . HOH G 4 .   ? -25.650 1.274   29.547 1.00 34.73  ? 542 HOH A O   1 
HETATM 3096 O  O   . HOH G 4 .   ? -28.173 4.838   22.717 1.00 26.71  ? 543 HOH A O   1 
HETATM 3097 O  O   . HOH G 4 .   ? -28.956 -1.271  23.406 1.00 24.19  ? 544 HOH A O   1 
HETATM 3098 O  O   . HOH G 4 .   ? -21.866 6.806   22.535 1.00 21.98  ? 545 HOH A O   1 
HETATM 3099 O  O   . HOH G 4 .   ? -24.115 19.635  -1.727 1.00 33.83  ? 546 HOH A O   1 
HETATM 3100 O  O   . HOH G 4 .   ? -27.750 9.104   17.329 1.00 28.19  ? 547 HOH A O   1 
HETATM 3101 O  O   . HOH G 4 .   ? -31.408 -4.832  -0.173 1.00 25.63  ? 548 HOH A O   1 
HETATM 3102 O  O   . HOH G 4 .   ? -26.111 14.008  16.736 1.00 28.04  ? 549 HOH A O   1 
HETATM 3103 O  O   . HOH G 4 .   ? -30.773 -3.749  10.754 1.00 16.38  ? 550 HOH A O   1 
HETATM 3104 O  O   . HOH G 4 .   ? -12.858 -10.874 0.235  1.00 37.47  ? 551 HOH A O   1 
HETATM 3105 O  O   . HOH G 4 .   ? -4.292  11.667  13.932 1.00 32.52  ? 552 HOH A O   1 
HETATM 3106 O  O   . HOH G 4 .   ? -4.224  5.810   15.383 1.00 19.94  ? 553 HOH A O   1 
HETATM 3107 O  O   . HOH G 4 .   ? -29.209 -9.365  28.940 1.00 40.49  ? 554 HOH A O   1 
HETATM 3108 O  O   . HOH G 4 .   ? -29.014 -19.771 25.783 1.00 44.32  ? 555 HOH A O   1 
HETATM 3109 O  O   . HOH G 4 .   ? -8.512  17.060  -1.805 1.00 34.73  ? 556 HOH A O   1 
HETATM 3110 O  O   . HOH G 4 .   ? -7.631  1.741   4.010  1.00 23.78  ? 557 HOH A O   1 
HETATM 3111 O  O   . HOH G 4 .   ? -25.940 -15.023 -2.200 1.00 48.35  ? 558 HOH A O   1 
HETATM 3112 O  O   . HOH G 4 .   ? -1.833  11.763  4.524  1.00 43.95  ? 559 HOH A O   1 
HETATM 3113 O  O   . HOH G 4 .   ? -23.857 7.644   17.782 1.00 20.79  ? 560 HOH A O   1 
HETATM 3114 O  O   . HOH G 4 .   ? -20.480 17.902  0.616  1.00 21.27  ? 561 HOH A O   1 
HETATM 3115 O  O   . HOH G 4 .   ? -27.058 6.519   24.414 1.00 28.33  ? 562 HOH A O   1 
HETATM 3116 O  O   . HOH G 4 .   ? -28.341 -13.269 30.175 1.00 27.32  ? 563 HOH A O   1 
HETATM 3117 O  O   . HOH G 4 .   ? -34.910 -21.724 16.696 1.00 23.41  ? 564 HOH A O   1 
HETATM 3118 O  O   . HOH G 4 .   ? -24.688 -8.890  32.227 1.00 31.24  ? 565 HOH A O   1 
HETATM 3119 O  O   . HOH G 4 .   ? -14.568 22.649  3.099  1.00 37.06  ? 566 HOH A O   1 
HETATM 3120 O  O   . HOH G 4 .   ? -5.841  8.829   32.215 1.00 47.93  ? 567 HOH A O   1 
HETATM 3121 O  O   . HOH G 4 .   ? -34.427 1.656   8.324  1.00 32.35  ? 568 HOH A O   1 
HETATM 3122 O  O   . HOH G 4 .   ? -34.419 17.979  -4.002 1.00 47.17  ? 569 HOH A O   1 
HETATM 3123 O  O   . HOH G 4 .   ? -19.512 24.742  4.583  1.00 29.02  ? 570 HOH A O   1 
HETATM 3124 O  O   . HOH G 4 .   ? -7.027  -7.233  0.145  1.00 29.05  ? 571 HOH A O   1 
HETATM 3125 O  O   . HOH G 4 .   ? -20.878 21.815  0.462  1.00 39.10  ? 572 HOH A O   1 
HETATM 3126 O  O   . HOH G 4 .   ? -32.738 -13.651 14.151 1.00 40.65  ? 573 HOH A O   1 
HETATM 3127 O  O   . HOH G 4 .   ? -12.680 -4.096  2.819  1.00 31.69  ? 574 HOH A O   1 
HETATM 3128 O  O   . HOH G 4 .   ? -27.492 -4.889  26.464 1.00 18.86  ? 575 HOH A O   1 
HETATM 3129 O  O   . HOH G 4 .   ? -8.363  13.333  23.346 1.00 48.93  ? 576 HOH A O   1 
HETATM 3130 O  O   . HOH G 4 .   ? -23.938 18.021  22.405 1.00 42.65  ? 577 HOH A O   1 
HETATM 3131 O  O   . HOH G 4 .   ? -32.034 -17.485 23.626 1.00 42.64  ? 578 HOH A O   1 
HETATM 3132 O  O   . HOH G 4 .   ? -17.571 11.399  22.050 1.00 31.10  ? 579 HOH A O   1 
HETATM 3133 O  O   . HOH G 4 .   ? -28.458 -0.302  16.364 1.00 34.27  ? 580 HOH A O   1 
HETATM 3134 O  O   . HOH G 4 .   ? -27.160 -9.880  -3.553 1.00 26.30  ? 581 HOH A O   1 
HETATM 3135 O  O   . HOH G 4 .   ? -15.877 21.000  4.674  1.00 27.98  ? 582 HOH A O   1 
HETATM 3136 O  O   . HOH G 4 .   ? -26.839 12.444  22.116 1.00 46.61  ? 583 HOH A O   1 
HETATM 3137 O  O   . HOH G 4 .   ? -22.649 2.085   27.671 1.00 25.67  ? 584 HOH A O   1 
HETATM 3138 O  O   . HOH G 4 .   ? -33.781 7.215   6.204  1.00 35.97  ? 585 HOH A O   1 
HETATM 3139 O  O   . HOH G 4 .   ? -30.004 -15.184 23.034 1.00 21.73  ? 586 HOH A O   1 
HETATM 3140 O  O   . HOH G 4 .   ? -33.038 21.902  -2.079 1.00 34.63  ? 587 HOH A O   1 
HETATM 3141 O  O   . HOH G 4 .   ? -22.372 -12.075 -5.844 1.00 43.94  ? 588 HOH A O   1 
HETATM 3142 O  O   . HOH G 4 .   ? -23.519 12.202  -1.661 1.00 29.63  ? 589 HOH A O   1 
HETATM 3143 O  O   . HOH G 4 .   ? -34.135 4.272   9.728  1.00 55.32  ? 590 HOH A O   1 
HETATM 3144 O  O   . HOH G 4 .   ? -18.171 11.569  28.028 1.00 43.77  ? 591 HOH A O   1 
HETATM 3145 O  O   . HOH G 4 .   ? -8.700  6.317   -0.732 1.00 41.41  ? 592 HOH A O   1 
HETATM 3146 O  O   . HOH G 4 .   ? -35.757 22.973  2.553  1.00 44.32  ? 593 HOH A O   1 
HETATM 3147 O  O   . HOH G 4 .   ? -5.435  5.651   21.362 1.00 35.30  ? 594 HOH A O   1 
HETATM 3148 O  O   . HOH G 4 .   ? -32.524 -20.174 15.189 1.00 23.97  ? 595 HOH A O   1 
HETATM 3149 O  O   . HOH G 4 .   ? -29.229 -2.352  20.548 1.00 28.95  ? 596 HOH A O   1 
HETATM 3150 O  O   . HOH G 4 .   ? -8.053  6.011   26.975 1.00 31.19  ? 597 HOH A O   1 
HETATM 3151 O  O   . HOH G 4 .   ? -15.956 -9.242  -4.088 1.00 44.86  ? 598 HOH A O   1 
HETATM 3152 O  O   . HOH G 4 .   ? -3.189  1.490   13.133 1.00 52.75  ? 599 HOH A O   1 
HETATM 3153 O  O   . HOH G 4 .   ? -14.509 11.674  10.492 1.00 12.30  ? 600 HOH A O   1 
HETATM 3154 O  O   . HOH G 4 .   ? -16.681 -2.146  22.520 1.00 13.73  ? 601 HOH A O   1 
HETATM 3155 O  O   . HOH G 4 .   ? -28.237 7.203   -2.425 1.00 21.94  ? 602 HOH A O   1 
HETATM 3156 O  O   . HOH G 4 .   ? -21.361 13.862  16.707 1.00 21.27  ? 603 HOH A O   1 
HETATM 3157 O  O   . HOH G 4 .   ? -24.214 15.790  10.319 1.00 15.39  ? 604 HOH A O   1 
HETATM 3158 O  O   . HOH G 4 .   ? -34.994 15.395  -3.518 1.00 50.26  ? 605 HOH A O   1 
HETATM 3159 O  O   . HOH G 4 .   ? -32.315 -16.316 14.098 1.00 20.15  ? 606 HOH A O   1 
HETATM 3160 O  O   . HOH G 4 .   ? -4.883  5.508   6.458  1.00 34.89  ? 607 HOH A O   1 
HETATM 3161 O  O   . HOH G 4 .   ? -12.622 -4.374  -3.048 1.00 21.52  ? 608 HOH A O   1 
HETATM 3162 O  O   . HOH G 4 .   ? -21.044 -13.241 28.112 1.00 30.72  ? 609 HOH A O   1 
HETATM 3163 O  O   . HOH G 4 .   ? -10.211 4.304   -4.887 1.00 24.81  ? 610 HOH A O   1 
HETATM 3164 O  O   . HOH G 4 .   ? -28.543 -14.129 1.280  1.00 35.65  ? 611 HOH A O   1 
HETATM 3165 O  O   . HOH G 4 .   ? -19.974 24.141  10.643 1.00 28.20  ? 612 HOH A O   1 
HETATM 3166 O  O   . HOH G 4 .   ? -34.778 11.049  1.729  1.00 26.05  ? 613 HOH A O   1 
HETATM 3167 O  O   . HOH G 4 .   ? -16.069 -5.419  -9.127 1.00 30.00  ? 614 HOH A O   1 
HETATM 3168 O  O   . HOH G 4 .   ? -27.284 2.322   13.260 1.00 31.44  ? 615 HOH A O   1 
HETATM 3169 O  O   . HOH G 4 .   ? -35.870 14.621  -1.119 1.00 48.80  ? 616 HOH A O   1 
HETATM 3170 O  O   . HOH G 4 .   ? -15.813 7.523   0.347  1.00 9.75   ? 617 HOH A O   1 
HETATM 3171 O  O   . HOH G 4 .   ? -15.386 9.657   -1.152 1.00 10.07  ? 618 HOH A O   1 
HETATM 3172 O  O   . HOH G 4 .   ? -22.389 6.806   -2.790 1.00 14.45  ? 619 HOH A O   1 
HETATM 3173 O  O   . HOH G 4 .   ? -17.926 17.361  7.462  1.00 16.78  ? 620 HOH A O   1 
HETATM 3174 O  O   . HOH G 4 .   ? -21.943 -13.949 30.943 1.00 26.12  ? 621 HOH A O   1 
HETATM 3175 O  O   . HOH G 4 .   ? -23.786 10.097  -2.582 1.00 29.76  ? 622 HOH A O   1 
HETATM 3176 O  O   . HOH G 4 .   ? -19.281 27.367  6.821  1.00 33.26  ? 623 HOH A O   1 
HETATM 3177 O  O   . HOH G 4 .   ? -20.995 12.853  -1.583 1.00 28.80  ? 624 HOH A O   1 
HETATM 3178 O  O   . HOH G 4 .   ? -20.378 -14.153 -2.300 1.00 38.73  ? 625 HOH A O   1 
HETATM 3179 O  O   . HOH G 4 .   ? -4.273  16.895  13.584 1.00 22.90  ? 626 HOH A O   1 
HETATM 3180 O  O   . HOH G 4 .   ? -25.924 -6.607  20.476 1.00 25.19  ? 627 HOH A O   1 
HETATM 3181 O  O   . HOH G 4 .   ? -6.473  -6.916  3.916  1.00 31.07  ? 628 HOH A O   1 
HETATM 3182 O  O   . HOH G 4 .   ? -35.444 -24.509 27.611 1.00 40.92  ? 629 HOH A O   1 
HETATM 3183 O  O   . HOH G 4 .   ? -6.191  6.183   -0.070 1.00 34.27  ? 630 HOH A O   1 
HETATM 3184 O  O   . HOH G 4 .   ? -22.385 13.162  26.016 1.00 35.50  ? 631 HOH A O   1 
HETATM 3185 O  O   . HOH G 4 .   ? -24.822 -10.423 -6.415 1.00 40.16  ? 632 HOH A O   1 
HETATM 3186 O  O   . HOH G 4 .   ? -15.410 18.578  6.673  1.00 26.06  ? 633 HOH A O   1 
HETATM 3187 O  O   . HOH G 4 .   ? -29.348 29.364  4.831  1.00 38.75  ? 634 HOH A O   1 
HETATM 3188 O  O   . HOH G 4 .   ? -3.749  0.759   10.358 1.00 24.51  ? 635 HOH A O   1 
HETATM 3189 O  O   . HOH G 4 .   ? -33.141 -11.843 11.263 1.00 29.57  ? 636 HOH A O   1 
HETATM 3190 O  O   . HOH G 4 .   ? -11.182 -0.295  -3.467 1.00 34.07  ? 637 HOH A O   1 
HETATM 3191 O  O   . HOH G 4 .   ? -13.560 20.058  7.741  1.00 36.63  ? 638 HOH A O   1 
HETATM 3192 O  O   . HOH G 4 .   ? -28.912 -11.589 -2.392 1.00 30.60  ? 639 HOH A O   1 
HETATM 3193 O  O   . HOH G 4 .   ? -33.814 -20.250 12.788 1.00 30.86  ? 640 HOH A O   1 
HETATM 3194 O  O   . HOH G 4 .   ? -10.083 -4.506  32.170 1.00 23.86  ? 641 HOH A O   1 
HETATM 3195 O  O   . HOH G 4 .   ? -29.931 -1.437  -1.735 1.00 32.53  ? 642 HOH A O   1 
HETATM 3196 O  O   . HOH G 4 .   ? -27.716 20.556  11.700 1.00 35.12  ? 643 HOH A O   1 
HETATM 3197 O  O   . HOH G 4 .   ? -17.406 16.998  -1.231 1.00 32.04  ? 644 HOH A O   1 
HETATM 3198 O  O   . HOH G 4 .   ? -32.068 11.736  -3.962 1.00 39.01  ? 645 HOH A O   1 
HETATM 3199 O  O   . HOH G 4 .   ? -29.714 -3.263  25.037 1.00 45.38  ? 646 HOH A O   1 
HETATM 3200 O  O   . HOH G 4 .   ? -8.437  15.788  19.192 1.00 38.23  ? 647 HOH A O   1 
HETATM 3201 O  O   . HOH G 4 .   ? -17.832 16.572  27.882 1.00 47.55  ? 648 HOH A O   1 
HETATM 3202 O  O   . HOH G 4 .   ? -12.703 -4.946  32.545 1.00 27.68  ? 649 HOH A O   1 
HETATM 3203 O  O   . HOH G 4 .   ? -2.091  4.846   17.212 1.00 46.22  ? 650 HOH A O   1 
HETATM 3204 O  O   . HOH G 4 .   ? -19.524 16.307  17.039 1.00 23.78  ? 651 HOH A O   1 
HETATM 3205 O  O   . HOH G 4 .   ? -17.962 -15.291 -2.477 1.00 38.20  ? 652 HOH A O   1 
HETATM 3206 O  O   . HOH G 4 .   ? -32.435 15.192  13.370 1.00 33.56  ? 653 HOH A O   1 
HETATM 3207 O  O   . HOH G 4 .   ? -19.632 -0.162  12.348 1.00 15.43  ? 654 HOH A O   1 
HETATM 3208 O  O   . HOH G 4 .   ? -33.706 -9.368  23.646 1.00 30.40  ? 655 HOH A O   1 
HETATM 3209 O  O   . HOH G 4 .   ? -13.450 -2.778  -7.402 1.00 28.06  ? 656 HOH A O   1 
HETATM 3210 O  O   . HOH G 4 .   ? -31.849 -14.794 9.054  1.00 34.18  ? 657 HOH A O   1 
HETATM 3211 O  O   . HOH G 4 .   ? -19.240 12.856  -3.158 1.00 44.36  ? 658 HOH A O   1 
HETATM 3212 O  O   . HOH G 4 .   ? -34.137 -27.298 17.308 1.00 29.13  ? 659 HOH A O   1 
HETATM 3213 O  O   . HOH G 4 .   ? -32.385 19.511  7.130  1.00 44.45  ? 660 HOH A O   1 
HETATM 3214 O  O   . HOH G 4 .   ? -3.901  7.795   6.432  1.00 46.94  ? 661 HOH A O   1 
HETATM 3215 O  O   . HOH G 4 .   ? -27.517 -3.341  28.639 1.00 27.02  ? 662 HOH A O   1 
HETATM 3216 O  O   . HOH G 4 .   ? -32.398 -7.459  14.152 1.00 49.77  ? 663 HOH A O   1 
HETATM 3217 O  O   . HOH G 4 .   ? -29.076 3.844   14.613 1.00 45.41  ? 664 HOH A O   1 
HETATM 3218 O  O   . HOH G 4 .   ? -9.758  -3.767  -3.124 1.00 35.14  ? 665 HOH A O   1 
HETATM 3219 O  O   . HOH G 4 .   ? -20.289 17.510  25.423 1.00 36.53  ? 666 HOH A O   1 
HETATM 3220 O  O   . HOH G 4 .   ? -4.510  9.013   0.562  1.00 36.44  ? 667 HOH A O   1 
HETATM 3221 O  O   . HOH G 4 .   ? -33.256 16.540  7.711  1.00 33.47  ? 668 HOH A O   1 
HETATM 3222 O  O   . HOH G 4 .   ? -35.123 -28.244 21.357 1.00 32.45  ? 669 HOH A O   1 
HETATM 3223 O  O   . HOH G 4 .   ? -16.707 11.101  24.641 1.00 52.96  ? 670 HOH A O   1 
HETATM 3224 O  O   . HOH G 4 .   ? -4.830  -2.618  5.572  1.00 39.82  ? 671 HOH A O   1 
HETATM 3225 O  O   . HOH G 4 .   ? -29.252 -17.953 2.219  1.00 45.74  ? 672 HOH A O   1 
HETATM 3226 O  O   . HOH G 4 .   ? -32.787 -16.699 11.087 1.00 38.74  ? 673 HOH A O   1 
HETATM 3227 O  O   . HOH G 4 .   ? -26.593 24.684  3.428  1.00 32.06  ? 674 HOH A O   1 
HETATM 3228 O  O   . HOH G 4 .   ? -34.119 19.061  3.627  1.00 33.93  ? 675 HOH A O   1 
HETATM 3229 O  O   . HOH G 4 .   ? -22.346 -3.972  17.711 1.00 10.48  ? 676 HOH A O   1 
HETATM 3230 O  O   . HOH G 4 .   ? -21.019 6.256   27.287 1.00 39.96  ? 677 HOH A O   1 
HETATM 3231 O  O   . HOH G 4 .   ? -34.951 10.396  6.792  1.00 41.07  ? 678 HOH A O   1 
HETATM 3232 O  O   . HOH G 4 .   ? -4.723  -2.924  9.357  1.00 36.68  ? 679 HOH A O   1 
HETATM 3233 O  O   . HOH G 4 .   ? -7.935  9.764   -2.370 1.00 43.47  ? 680 HOH A O   1 
HETATM 3234 O  O   . HOH G 4 .   ? -7.399  10.956  -5.378 1.00 42.51  ? 681 HOH A O   1 
HETATM 3235 O  O   . HOH G 4 .   ? -28.455 -0.738  13.064 1.00 42.83  ? 682 HOH A O   1 
HETATM 3236 O  O   . HOH G 4 .   ? -29.416 17.056  16.335 1.00 41.98  ? 683 HOH A O   1 
HETATM 3237 O  O   . HOH H 4 .   ? -18.323 -38.276 9.704  1.00 16.57  ? 503 HOH B O   1 
HETATM 3238 O  O   . HOH H 4 .   ? 4.531   -40.628 2.756  1.00 40.48  ? 504 HOH B O   1 
HETATM 3239 O  O   . HOH H 4 .   ? -15.929 -39.049 16.396 1.00 26.55  ? 505 HOH B O   1 
HETATM 3240 O  O   . HOH H 4 .   ? -15.512 -44.392 16.450 1.00 49.21  ? 506 HOH B O   1 
HETATM 3241 O  O   . HOH H 4 .   ? -12.475 -34.169 1.434  1.00 17.24  ? 507 HOH B O   1 
HETATM 3242 O  O   . HOH H 4 .   ? -19.068 -14.292 26.904 1.00 15.80  ? 508 HOH B O   1 
HETATM 3243 O  O   . HOH H 4 .   ? -14.938 -28.408 15.537 1.00 20.99  ? 509 HOH B O   1 
HETATM 3244 O  O   . HOH H 4 .   ? -30.015 -23.201 21.871 1.00 13.42  ? 510 HOH B O   1 
HETATM 3245 O  O   . HOH H 4 .   ? -7.263  -39.543 2.113  1.00 27.84  ? 511 HOH B O   1 
HETATM 3246 O  O   . HOH H 4 .   ? -8.669  -44.573 3.838  1.00 20.27  ? 512 HOH B O   1 
HETATM 3247 O  O   . HOH H 4 .   ? -9.971  -17.353 25.734 1.00 15.05  ? 513 HOH B O   1 
HETATM 3248 O  O   . HOH H 4 .   ? -11.124 -40.770 21.201 1.00 23.79  ? 514 HOH B O   1 
HETATM 3249 O  O   . HOH H 4 .   ? -18.645 -13.022 24.567 1.00 10.98  ? 515 HOH B O   1 
HETATM 3250 O  O   . HOH H 4 .   ? -10.086 -3.019  26.725 1.00 14.46  ? 516 HOH B O   1 
HETATM 3251 O  O   . HOH H 4 .   ? -4.572  -6.131  22.108 1.00 26.68  ? 517 HOH B O   1 
HETATM 3252 O  O   . HOH H 4 .   ? -3.388  -2.902  13.950 1.00 17.17  ? 518 HOH B O   1 
HETATM 3253 O  O   . HOH H 4 .   ? -9.554  -12.130 19.756 1.00 12.14  ? 519 HOH B O   1 
HETATM 3254 O  O   . HOH H 4 .   ? -3.722  -0.024  26.003 1.00 30.67  ? 520 HOH B O   1 
HETATM 3255 O  O   . HOH H 4 .   ? -21.230 -28.177 0.924  1.00 18.91  ? 521 HOH B O   1 
HETATM 3256 O  O   . HOH H 4 .   ? -18.564 -39.473 14.554 1.00 20.17  ? 522 HOH B O   1 
HETATM 3257 O  O   . HOH H 4 .   ? 3.133   -36.818 5.474  1.00 39.33  ? 523 HOH B O   1 
HETATM 3258 O  O   . HOH H 4 .   ? -0.308  -33.660 5.286  1.00 28.29  ? 524 HOH B O   1 
HETATM 3259 O  O   . HOH H 4 .   ? -13.504 -28.575 -0.084 1.00 18.12  ? 525 HOH B O   1 
HETATM 3260 O  O   . HOH H 4 .   ? -0.926  -16.626 3.218  1.00 32.73  ? 526 HOH B O   1 
HETATM 3261 O  O   . HOH H 4 .   ? -3.860  -12.893 20.916 1.00 32.70  ? 527 HOH B O   1 
HETATM 3262 O  O   . HOH H 4 .   ? -9.828  -42.814 14.448 1.00 20.38  ? 528 HOH B O   1 
HETATM 3263 O  O   . HOH H 4 .   ? -16.766 -40.962 13.125 1.00 17.42  ? 529 HOH B O   1 
HETATM 3264 O  O   . HOH H 4 .   ? -18.595 -51.248 2.085  1.00 27.71  ? 530 HOH B O   1 
HETATM 3265 O  O   . HOH H 4 .   ? 1.517   -21.282 8.187  1.00 32.02  ? 531 HOH B O   1 
HETATM 3266 O  O   . HOH H 4 .   ? -3.343  -33.273 4.406  1.00 25.49  ? 532 HOH B O   1 
HETATM 3267 O  O   . HOH H 4 .   ? -18.151 -9.984  34.270 1.00 19.79  ? 533 HOH B O   1 
HETATM 3268 O  O   . HOH H 4 .   ? -13.741 -22.320 -3.180 1.00 17.34  ? 534 HOH B O   1 
HETATM 3269 O  O   . HOH H 4 .   ? -26.247 -23.466 4.293  1.00 23.42  ? 535 HOH B O   1 
HETATM 3270 O  O   . HOH H 4 .   ? -22.185 -24.304 21.137 1.00 21.69  ? 536 HOH B O   1 
HETATM 3271 O  O   . HOH H 4 .   ? -1.657  -8.143  9.049  1.00 33.14  ? 537 HOH B O   1 
HETATM 3272 O  O   . HOH H 4 .   ? -14.387 -43.606 20.330 1.00 30.56  ? 538 HOH B O   1 
HETATM 3273 O  O   . HOH H 4 .   ? -13.935 -44.059 8.641  1.00 19.78  ? 539 HOH B O   1 
HETATM 3274 O  O   . HOH H 4 .   ? -1.670  -36.416 0.035  1.00 42.10  ? 540 HOH B O   1 
HETATM 3275 O  O   . HOH H 4 .   ? -27.838 -27.248 4.280  1.00 29.42  ? 541 HOH B O   1 
HETATM 3276 O  O   . HOH H 4 .   ? -13.108 -19.941 23.662 1.00 28.62  ? 542 HOH B O   1 
HETATM 3277 O  O   . HOH H 4 .   ? -11.632 -49.097 3.690  1.00 32.70  ? 543 HOH B O   1 
HETATM 3278 O  O   . HOH H 4 .   ? -3.892  -33.037 21.588 1.00 49.53  ? 544 HOH B O   1 
HETATM 3279 O  O   . HOH H 4 .   ? -7.713  -16.681 31.016 1.00 36.56  ? 545 HOH B O   1 
HETATM 3280 O  O   . HOH H 4 .   ? -8.397  3.720   36.613 1.00 28.81  ? 546 HOH B O   1 
HETATM 3281 O  O   . HOH H 4 .   ? -12.097 -25.412 28.025 1.00 31.66  ? 547 HOH B O   1 
HETATM 3282 O  O   . HOH H 4 .   ? 0.946   -32.076 15.044 1.00 37.06  ? 548 HOH B O   1 
HETATM 3283 O  O   . HOH H 4 .   ? -4.069  -16.490 20.679 1.00 26.98  ? 549 HOH B O   1 
HETATM 3284 O  O   . HOH H 4 .   ? -12.363 -51.063 10.625 1.00 32.80  ? 550 HOH B O   1 
HETATM 3285 O  O   . HOH H 4 .   ? -10.165 -23.784 25.737 1.00 26.65  ? 551 HOH B O   1 
HETATM 3286 O  O   . HOH H 4 .   ? -2.444  -55.814 8.285  1.00 35.94  ? 552 HOH B O   1 
HETATM 3287 O  O   . HOH H 4 .   ? 2.106   -20.606 17.032 1.00 32.31  ? 553 HOH B O   1 
HETATM 3288 O  O   . HOH H 4 .   ? -4.908  3.647   24.343 1.00 45.71  ? 554 HOH B O   1 
HETATM 3289 O  O   . HOH H 4 .   ? -2.548  -14.335 5.597  1.00 37.97  ? 555 HOH B O   1 
HETATM 3290 O  O   . HOH H 4 .   ? -2.046  -23.585 6.603  1.00 27.23  ? 556 HOH B O   1 
HETATM 3291 O  O   . HOH H 4 .   ? -4.887  -34.424 2.759  1.00 37.91  ? 557 HOH B O   1 
HETATM 3292 O  O   . HOH H 4 .   ? -4.997  -39.517 19.245 1.00 37.52  ? 558 HOH B O   1 
HETATM 3293 O  O   . HOH H 4 .   ? -7.765  -11.936 1.728  1.00 27.20  ? 559 HOH B O   1 
HETATM 3294 O  O   . HOH H 4 .   ? -22.964 -11.238 33.896 1.00 34.14  ? 560 HOH B O   1 
HETATM 3295 O  O   . HOH H 4 .   ? -19.975 -19.340 -3.025 1.00 20.60  ? 561 HOH B O   1 
HETATM 3296 O  O   . HOH H 4 .   ? -8.244  -29.130 18.092 1.00 45.22  ? 562 HOH B O   1 
HETATM 3297 O  O   . HOH H 4 .   ? -18.728 -32.378 -3.082 1.00 38.06  ? 563 HOH B O   1 
HETATM 3298 O  O   . HOH H 4 .   ? -6.656  -46.158 4.845  1.00 24.81  ? 564 HOH B O   1 
HETATM 3299 O  O   . HOH H 4 .   ? -21.932 -25.634 23.508 1.00 20.96  ? 565 HOH B O   1 
HETATM 3300 O  O   . HOH H 4 .   ? -15.231 -8.369  28.610 1.00 19.24  ? 566 HOH B O   1 
HETATM 3301 O  O   . HOH H 4 .   ? -15.840 -35.531 -3.058 1.00 32.95  ? 567 HOH B O   1 
HETATM 3302 O  O   . HOH H 4 .   ? 0.134   -28.088 17.311 1.00 23.60  ? 568 HOH B O   1 
HETATM 3303 O  O   . HOH H 4 .   ? -24.168 -35.290 22.117 1.00 41.83  ? 569 HOH B O   1 
HETATM 3304 O  O   . HOH H 4 .   ? -9.755  -35.659 22.148 1.00 37.66  ? 570 HOH B O   1 
HETATM 3305 O  O   . HOH H 4 .   ? -24.596 -24.220 0.533  1.00 39.04  ? 571 HOH B O   1 
HETATM 3306 O  O   . HOH H 4 .   ? 1.145   -18.022 13.118 1.00 35.95  ? 572 HOH B O   1 
HETATM 3307 O  O   . HOH H 4 .   ? -13.906 -34.276 20.442 1.00 22.03  ? 573 HOH B O   1 
HETATM 3308 O  O   . HOH H 4 .   ? -7.063  -25.812 18.612 1.00 45.94  ? 574 HOH B O   1 
HETATM 3309 O  O   . HOH H 4 .   ? -25.709 -37.702 23.646 1.00 44.59  ? 575 HOH B O   1 
HETATM 3310 O  O   . HOH H 4 .   ? -12.383 -23.085 29.749 1.00 40.78  ? 576 HOH B O   1 
HETATM 3311 O  O   . HOH H 4 .   ? -33.599 -32.678 24.028 1.00 44.41  ? 577 HOH B O   1 
HETATM 3312 O  O   . HOH H 4 .   ? -2.700  -2.153  17.226 1.00 30.92  ? 578 HOH B O   1 
HETATM 3313 O  O   . HOH H 4 .   ? -28.991 -20.986 29.001 1.00 36.21  ? 579 HOH B O   1 
HETATM 3314 O  O   . HOH H 4 .   ? -17.027 -16.317 32.081 1.00 24.70  ? 580 HOH B O   1 
HETATM 3315 O  O   . HOH H 4 .   ? 0.929   -34.021 18.585 1.00 46.18  ? 581 HOH B O   1 
HETATM 3316 O  O   . HOH H 4 .   ? -18.347 -43.733 -3.833 1.00 43.29  ? 582 HOH B O   1 
HETATM 3317 O  O   . HOH H 4 .   ? -21.174 -37.539 21.670 1.00 48.44  ? 583 HOH B O   1 
HETATM 3318 O  O   . HOH H 4 .   ? -13.926 2.458   31.093 1.00 27.63  ? 584 HOH B O   1 
HETATM 3319 O  O   . HOH H 4 .   ? -27.348 -37.609 -0.529 1.00 39.80  ? 585 HOH B O   1 
HETATM 3320 O  O   . HOH H 4 .   ? -10.854 -43.768 0.806  1.00 36.31  ? 586 HOH B O   1 
HETATM 3321 O  O   . HOH H 4 .   ? -2.035  -6.791  13.846 1.00 45.48  ? 587 HOH B O   1 
HETATM 3322 O  O   . HOH H 4 .   ? -25.615 -21.570 2.743  1.00 41.65  ? 588 HOH B O   1 
HETATM 3323 O  O   . HOH H 4 .   ? -4.474  -52.253 2.784  1.00 43.63  ? 589 HOH B O   1 
HETATM 3324 O  O   . HOH H 4 .   ? -23.849 -22.870 30.227 1.00 30.09  ? 590 HOH B O   1 
HETATM 3325 O  O   . HOH H 4 .   ? -24.463 -17.885 31.233 1.00 29.71  ? 591 HOH B O   1 
HETATM 3326 O  O   . HOH H 4 .   ? -11.828 -20.498 26.386 1.00 39.27  ? 592 HOH B O   1 
HETATM 3327 O  O   . HOH H 4 .   ? -2.243  -42.242 17.458 1.00 27.13  ? 593 HOH B O   1 
HETATM 3328 O  O   . HOH H 4 .   ? -14.729 -21.822 29.655 1.00 45.68  ? 594 HOH B O   1 
HETATM 3329 O  O   . HOH H 4 .   ? -8.682  -23.251 19.112 1.00 39.07  ? 595 HOH B O   1 
HETATM 3330 O  O   . HOH H 4 .   ? -7.307  -54.721 12.820 1.00 27.93  ? 596 HOH B O   1 
HETATM 3331 O  O   . HOH H 4 .   ? -22.211 -20.150 31.979 1.00 48.82  ? 597 HOH B O   1 
HETATM 3332 O  O   . HOH H 4 .   ? -3.507  4.018   20.437 1.00 39.19  ? 598 HOH B O   1 
HETATM 3333 O  O   . HOH H 4 .   ? -27.712 -37.404 2.134  1.00 32.93  ? 599 HOH B O   1 
HETATM 3334 O  O   . HOH H 4 .   ? -14.159 -22.218 22.332 1.00 25.41  ? 600 HOH B O   1 
HETATM 3335 O  O   . HOH H 4 .   ? -16.507 -41.481 -5.235 1.00 42.19  ? 601 HOH B O   1 
HETATM 3336 O  O   . HOH H 4 .   ? -11.988 -39.802 -3.806 1.00 57.60  ? 602 HOH B O   1 
HETATM 3337 O  O   . HOH H 4 .   ? -19.191 -37.368 12.233 1.00 15.84  ? 603 HOH B O   1 
HETATM 3338 O  O   . HOH H 4 .   ? -17.051 -37.127 7.813  1.00 12.28  ? 604 HOH B O   1 
HETATM 3339 O  O   . HOH H 4 .   ? -14.465 -26.423 13.883 1.00 21.11  ? 605 HOH B O   1 
HETATM 3340 O  O   . HOH H 4 .   ? -15.215 -40.102 18.644 1.00 31.84  ? 606 HOH B O   1 
HETATM 3341 O  O   . HOH H 4 .   ? -17.494 -42.955 15.229 1.00 26.16  ? 607 HOH B O   1 
HETATM 3342 O  O   . HOH H 4 .   ? -11.989 -36.276 -0.161 1.00 26.13  ? 608 HOH B O   1 
HETATM 3343 O  O   . HOH H 4 .   ? -5.456  -8.294  23.076 1.00 24.71  ? 609 HOH B O   1 
HETATM 3344 O  O   . HOH H 4 .   ? -17.186 -42.827 17.886 1.00 37.50  ? 610 HOH B O   1 
HETATM 3345 O  O   . HOH H 4 .   ? 4.473   -44.941 2.957  1.00 23.80  ? 611 HOH B O   1 
HETATM 3346 O  O   . HOH H 4 .   ? 2.805   -40.951 12.680 1.00 16.20  ? 612 HOH B O   1 
HETATM 3347 O  O   . HOH H 4 .   ? -16.205 -45.327 7.103  1.00 28.60  ? 613 HOH B O   1 
HETATM 3348 O  O   . HOH H 4 .   ? -30.665 -21.481 23.697 1.00 29.05  ? 614 HOH B O   1 
HETATM 3349 O  O   . HOH H 4 .   ? -7.420  -10.460 27.207 1.00 24.54  ? 615 HOH B O   1 
HETATM 3350 O  O   . HOH H 4 .   ? -4.308  -22.666 17.582 1.00 22.43  ? 616 HOH B O   1 
HETATM 3351 O  O   . HOH H 4 .   ? -14.777 -47.458 5.369  1.00 30.70  ? 617 HOH B O   1 
HETATM 3352 O  O   . HOH H 4 .   ? -2.429  -56.209 10.936 1.00 27.42  ? 618 HOH B O   1 
HETATM 3353 O  O   . HOH H 4 .   ? 3.246   -42.679 10.620 1.00 23.74  ? 619 HOH B O   1 
HETATM 3354 O  O   . HOH H 4 .   ? -2.782  -12.093 30.396 1.00 62.49  ? 620 HOH B O   1 
HETATM 3355 O  O   . HOH H 4 .   ? -5.061  -9.698  3.421  1.00 47.24  ? 621 HOH B O   1 
HETATM 3356 O  O   . HOH H 4 .   ? -1.808  -12.310 8.199  1.00 39.05  ? 622 HOH B O   1 
HETATM 3357 O  O   . HOH H 4 .   ? -4.453  -5.580  2.744  1.00 35.96  ? 623 HOH B O   1 
HETATM 3358 O  O   . HOH H 4 .   ? -11.898 -31.490 26.848 1.00 34.73  ? 624 HOH B O   1 
HETATM 3359 O  O   . HOH H 4 .   ? -4.675  -38.282 2.608  1.00 29.38  ? 625 HOH B O   1 
HETATM 3360 O  O   . HOH H 4 .   ? 1.987   -42.439 14.713 1.00 34.21  ? 626 HOH B O   1 
HETATM 3361 O  O   . HOH H 4 .   ? -4.215  -51.197 8.493  1.00 28.86  ? 627 HOH B O   1 
HETATM 3362 O  O   . HOH H 4 .   ? -22.966 -38.351 23.596 1.00 46.46  ? 628 HOH B O   1 
HETATM 3363 O  O   . HOH H 4 .   ? -10.347 -4.950  28.743 1.00 30.73  ? 629 HOH B O   1 
HETATM 3364 O  O   . HOH H 4 .   ? -29.279 -43.203 7.299  1.00 34.30  ? 630 HOH B O   1 
HETATM 3365 O  O   . HOH H 4 .   ? 0.174   -37.667 16.883 1.00 34.60  ? 631 HOH B O   1 
HETATM 3366 O  O   . HOH H 4 .   ? -29.747 -32.061 8.898  1.00 31.70  ? 632 HOH B O   1 
HETATM 3367 O  O   . HOH H 4 .   ? 2.751   -31.325 12.930 1.00 42.39  ? 633 HOH B O   1 
HETATM 3368 O  O   . HOH H 4 .   ? 0.520   -12.655 31.269 1.00 48.94  ? 634 HOH B O   1 
HETATM 3369 O  O   . HOH H 4 .   ? -5.656  -51.654 6.333  1.00 33.69  ? 635 HOH B O   1 
HETATM 3370 O  O   . HOH H 4 .   ? -4.440  -45.809 3.480  1.00 35.14  ? 636 HOH B O   1 
HETATM 3371 O  O   . HOH H 4 .   ? -19.481 -28.664 28.736 1.00 28.63  ? 637 HOH B O   1 
HETATM 3372 O  O   . HOH H 4 .   ? -4.545  -10.271 21.167 1.00 30.05  ? 638 HOH B O   1 
HETATM 3373 O  O   . HOH H 4 .   ? -10.080 -11.159 0.645  1.00 33.66  ? 639 HOH B O   1 
HETATM 3374 O  O   . HOH H 4 .   ? -21.908 -25.169 31.444 1.00 30.67  ? 640 HOH B O   1 
HETATM 3375 O  O   . HOH H 4 .   ? -12.461 -6.721  29.949 1.00 35.12  ? 641 HOH B O   1 
HETATM 3376 O  O   . HOH H 4 .   ? 3.560   -45.273 11.960 1.00 29.47  ? 642 HOH B O   1 
HETATM 3377 O  O   . HOH H 4 .   ? -25.465 -45.811 8.560  1.00 38.19  ? 643 HOH B O   1 
HETATM 3378 O  O   . HOH H 4 .   ? -13.853 -26.520 -4.413 1.00 37.38  ? 644 HOH B O   1 
HETATM 3379 O  O   . HOH H 4 .   ? -22.338 -35.941 -4.349 1.00 41.19  ? 645 HOH B O   1 
HETATM 3380 O  O   . HOH H 4 .   ? -1.565  -41.438 1.522  1.00 52.53  ? 646 HOH B O   1 
HETATM 3381 O  O   . HOH H 4 .   ? -19.035 -46.897 -2.382 1.00 38.86  ? 647 HOH B O   1 
HETATM 3382 O  O   . HOH H 4 .   ? -8.011  -34.538 -2.991 1.00 32.10  ? 648 HOH B O   1 
HETATM 3383 O  O   . HOH H 4 .   ? -13.128 -35.834 -2.502 1.00 36.57  ? 649 HOH B O   1 
HETATM 3384 O  O   . HOH H 4 .   ? -14.530 -16.117 -0.192 1.00 32.25  ? 650 HOH B O   1 
HETATM 3385 O  O   . HOH H 4 .   ? -2.859  -22.784 4.244  1.00 27.73  ? 651 HOH B O   1 
HETATM 3386 O  O   . HOH H 4 .   ? -12.307 -38.826 25.739 1.00 38.90  ? 652 HOH B O   1 
HETATM 3387 O  O   . HOH H 4 .   ? -7.694  -39.070 20.336 1.00 34.86  ? 653 HOH B O   1 
HETATM 3388 O  O   . HOH H 4 .   ? 1.091   -46.319 13.399 1.00 38.96  ? 654 HOH B O   1 
HETATM 3389 O  O   . HOH H 4 .   ? -14.463 -50.706 12.320 1.00 37.49  ? 655 HOH B O   1 
HETATM 3390 O  O   . HOH H 4 .   ? -21.266 -17.943 33.320 1.00 39.69  ? 656 HOH B O   1 
HETATM 3391 O  O   . HOH H 4 .   ? -22.524 -19.507 -0.082 1.00 39.17  ? 657 HOH B O   1 
HETATM 3392 O  O   . HOH H 4 .   ? 1.266   -24.917 6.330  1.00 40.60  ? 658 HOH B O   1 
HETATM 3393 O  O   . HOH H 4 .   ? -21.494 -49.349 2.130  1.00 48.29  ? 659 HOH B O   1 
HETATM 3394 O  O   . HOH H 4 .   ? -4.318  -19.028 21.806 1.00 46.00  ? 660 HOH B O   1 
HETATM 3395 O  O   . HOH H 4 .   ? -24.763 -31.296 1.800  1.00 37.28  ? 661 HOH B O   1 
HETATM 3396 O  O   . HOH H 4 .   ? -25.422 -33.703 1.032  1.00 39.36  ? 662 HOH B O   1 
HETATM 3397 O  O   . HOH H 4 .   ? -16.224 -50.442 8.752  1.00 35.90  ? 663 HOH B O   1 
HETATM 3398 O  O   . HOH H 4 .   ? -21.444 -31.675 27.736 1.00 45.41  ? 664 HOH B O   1 
HETATM 3399 O  O   . HOH H 4 .   ? -6.867  -8.103  30.083 1.00 45.48  ? 665 HOH B O   1 
HETATM 3400 O  O   . HOH H 4 .   ? -2.179  -10.601 17.203 1.00 45.31  ? 666 HOH B O   1 
HETATM 3401 O  O   . HOH H 4 .   ? -4.589  -11.976 25.084 1.00 36.75  ? 667 HOH B O   1 
HETATM 3402 O  O   . HOH H 4 .   ? -7.523  -30.700 20.655 1.00 45.53  ? 668 HOH B O   1 
HETATM 3403 O  O   . HOH H 4 .   ? -14.875 -22.672 19.451 1.00 18.10  ? 669 HOH B O   1 
HETATM 3404 O  O   . HOH H 4 .   ? -4.668  -30.228 0.143  1.00 34.38  ? 670 HOH B O   1 
HETATM 3405 O  O   . HOH H 4 .   ? 1.818   -15.750 5.796  1.00 45.58  ? 671 HOH B O   1 
HETATM 3406 O  O   . HOH H 4 .   ? 3.784   -11.235 11.020 1.00 42.71  ? 672 HOH B O   1 
HETATM 3407 O  O   . HOH H 4 .   ? 6.902   -6.496  9.968  1.00 31.46  ? 673 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   0   MET MET A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   TYR 3   2   2   TYR TYR A . n 
A 1 4   LYS 4   3   3   LYS LYS A . n 
A 1 5   GLU 5   4   4   GLU GLU A . n 
A 1 6   PRO 6   5   5   PRO PRO A . n 
A 1 7   PHE 7   6   6   PHE PHE A . n 
A 1 8   GLY 8   7   7   GLY GLY A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  LYS 10  9   9   LYS LYS A . n 
A 1 11  VAL 11  10  10  VAL VAL A . n 
A 1 12  ASP 12  11  11  ASP ASP A . n 
A 1 13  PHE 13  12  12  PHE PHE A . n 
A 1 14  GLU 14  13  13  GLU GLU A . n 
A 1 15  THR 15  14  14  THR THR A . n 
A 1 16  GLY 16  15  15  GLY GLY A . n 
A 1 17  ILE 17  16  16  ILE ILE A . n 
A 1 18  ILE 18  17  17  ILE ILE A . n 
A 1 19  GLU 19  18  18  GLU GLU A . n 
A 1 20  GLY 20  19  19  GLY GLY A . n 
A 1 21  ALA 21  20  20  ALA ALA A . n 
A 1 22  LYS 22  21  21  LYS LYS A . n 
A 1 23  LYS 23  22  22  LYS LYS A . n 
A 1 24  SER 24  23  23  SER SER A . n 
A 1 25  VAL 25  24  24  VAL VAL A . n 
A 1 26  ARG 26  25  25  ARG ARG A . n 
A 1 27  ARG 27  26  26  ARG ARG A . n 
A 1 28  LEU 28  27  27  LEU LEU A . n 
A 1 29  SER 29  28  28  SER SER A . n 
A 1 30  ASP 30  29  29  ASP ASP A . n 
A 1 31  MET 31  30  30  MET MET A . n 
A 1 32  GLU 32  31  31  GLU GLU A . n 
A 1 33  GLY 33  32  32  GLY GLY A . n 
A 1 34  TYR 34  33  33  TYR TYR A . n 
A 1 35  PHE 35  34  34  PHE PHE A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  ASP 37  36  36  ASP ASP A . n 
A 1 38  GLU 38  37  37  GLU GLU A . n 
A 1 39  ARG 39  38  38  ARG ARG A . n 
A 1 40  ALA 40  39  39  ALA ALA A . n 
A 1 41  TRP 41  40  40  TRP TRP A . n 
A 1 42  LYS 42  41  41  LYS LYS A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  VAL 45  44  44  VAL VAL A . n 
A 1 46  GLU 46  45  45  GLU GLU A . n 
A 1 47  LYS 47  46  46  LYS LYS A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  ASP 49  48  48  ASP ASP A . n 
A 1 50  PRO 50  49  49  PRO PRO A . n 
A 1 51  VAL 51  50  50  VAL VAL A . n 
A 1 52  VAL 52  51  51  VAL VAL A . n 
A 1 53  TYR 53  52  52  TYR TYR A . n 
A 1 54  GLU 54  53  53  GLU GLU A . n 
A 1 55  VAL 55  54  54  VAL VAL A . n 
A 1 56  TYR 56  55  55  TYR TYR A . n 
A 1 57  ALA 57  56  56  ALA ALA A . n 
A 1 58  VAL 58  57  57  VAL VAL A . n 
A 1 59  GLU 59  58  58  GLU GLU A . n 
A 1 60  GLN 60  59  59  GLN GLN A . n 
A 1 61  GLU 61  60  60  GLU GLU A . n 
A 1 62  GLU 62  61  61  GLU GLU A . n 
A 1 63  LYS 63  62  62  LYS LYS A . n 
A 1 64  GLU 64  63  63  GLU GLU A . n 
A 1 65  GLY 65  64  64  GLY GLY A . n 
A 1 66  ASP 66  65  65  ASP ASP A . n 
A 1 67  LEU 67  66  66  LEU LEU A . n 
A 1 68  ASN 68  67  67  ASN ASN A . n 
A 1 69  PHE 69  68  68  PHE PHE A . n 
A 1 70  ALA 70  69  69  ALA ALA A . n 
A 1 71  THR 71  70  70  THR THR A . n 
A 1 72  THR 72  71  71  THR THR A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  LEU 74  73  73  LEU LEU A . n 
A 1 75  TYR 75  74  74  TYR TYR A . n 
A 1 76  PRO 76  75  75  PRO PRO A . n 
A 1 77  GLY 77  76  76  GLY GLY A . n 
A 1 78  LYS 78  77  77  LYS LYS A . n 
A 1 79  VAL 79  78  78  VAL VAL A . n 
A 1 80  GLY 80  79  79  GLY GLY A . n 
A 1 81  LYS 81  80  80  LYS LYS A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  PHE 83  82  82  PHE PHE A . n 
A 1 84  PHE 84  83  83  PHE PHE A . n 
A 1 85  PHE 85  84  84  PHE PHE A . n 
A 1 86  THR 86  85  85  THR THR A . n 
A 1 87  LYS 87  86  86  LYS LYS A . n 
A 1 88  GLY 88  87  87  GLY GLY A . n 
A 1 89  HIS 89  88  88  HIS HIS A . n 
A 1 90  PHE 90  89  89  PHE PHE A . n 
A 1 91  HIS 91  90  90  HIS HIS A . n 
A 1 92  ALA 92  91  91  ALA ALA A . n 
A 1 93  LYS 93  92  92  LYS LYS A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  ASP 95  94  94  ASP ASP A . n 
A 1 96  ARG 96  95  95  ARG ARG A . n 
A 1 97  ALA 97  96  96  ALA ALA A . n 
A 1 98  GLU 98  97  97  GLU GLU A . n 
A 1 99  VAL 99  98  98  VAL VAL A . n 
A 1 100 TYR 100 99  99  TYR TYR A . n 
A 1 101 VAL 101 100 100 VAL VAL A . n 
A 1 102 ALA 102 101 101 ALA ALA A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 LYS 104 103 103 LYS LYS A . n 
A 1 105 GLY 105 104 104 GLY GLY A . n 
A 1 106 LYS 106 105 105 LYS LYS A . n 
A 1 107 GLY 107 106 106 GLY GLY A . n 
A 1 108 GLY 108 107 107 GLY GLY A . n 
A 1 109 MET 109 108 108 MET MET A . n 
A 1 110 LEU 110 109 109 LEU LEU A . n 
A 1 111 LEU 111 110 110 LEU LEU A . n 
A 1 112 GLN 112 111 111 GLN GLN A . n 
A 1 113 THR 113 112 112 THR THR A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 GLU 115 114 114 GLU GLU A . n 
A 1 116 GLY 116 115 115 GLY GLY A . n 
A 1 117 ASP 117 116 116 ASP ASP A . n 
A 1 118 ALA 118 117 117 ALA ALA A . n 
A 1 119 LYS 119 118 118 LYS LYS A . n 
A 1 120 TRP 120 119 119 TRP TRP A . n 
A 1 121 ILE 121 120 120 ILE ILE A . n 
A 1 122 SER 122 121 121 SER SER A . n 
A 1 123 MET 123 122 122 MET MET A . n 
A 1 124 GLU 124 123 123 GLU GLU A . n 
A 1 125 PRO 125 124 124 PRO PRO A . n 
A 1 126 GLY 126 125 125 GLY GLY A . n 
A 1 127 THR 127 126 126 THR THR A . n 
A 1 128 VAL 128 127 127 VAL VAL A . n 
A 1 129 VAL 129 128 128 VAL VAL A . n 
A 1 130 TYR 130 129 129 TYR TYR A . n 
A 1 131 VAL 131 130 130 VAL VAL A . n 
A 1 132 PRO 132 131 131 PRO PRO A . n 
A 1 133 PRO 133 132 132 PRO PRO A . n 
A 1 134 TYR 134 133 133 TYR TYR A . n 
A 1 135 TRP 135 134 134 TRP TRP A . n 
A 1 136 ALA 136 135 135 ALA ALA A . n 
A 1 137 HIS 137 136 136 HIS HIS A . n 
A 1 138 ARG 138 137 137 ARG ARG A . n 
A 1 139 THR 139 138 138 THR THR A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 ASN 141 140 140 ASN ASN A . n 
A 1 142 ILE 142 141 141 ILE ILE A . n 
A 1 143 GLY 143 142 142 GLY GLY A . n 
A 1 144 ASP 144 143 143 ASP ASP A . n 
A 1 145 GLU 145 144 144 GLU GLU A . n 
A 1 146 PRO 146 145 145 PRO PRO A . n 
A 1 147 PHE 147 146 146 PHE PHE A . n 
A 1 148 ILE 148 147 147 ILE ILE A . n 
A 1 149 PHE 149 148 148 PHE PHE A . n 
A 1 150 LEU 150 149 149 LEU LEU A . n 
A 1 151 ALA 151 150 150 ALA ALA A . n 
A 1 152 ILE 152 151 151 ILE ILE A . n 
A 1 153 TYR 153 152 152 TYR TYR A . n 
A 1 154 PRO 154 153 153 PRO PRO A . n 
A 1 155 ALA 155 154 154 ALA ALA A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 ALA 157 156 156 ALA ALA A . n 
A 1 158 GLY 158 157 157 GLY GLY A . n 
A 1 159 HIS 159 158 158 HIS HIS A . n 
A 1 160 ASP 160 159 159 ASP ASP A . n 
A 1 161 TYR 161 160 160 TYR TYR A . n 
A 1 162 GLY 162 161 161 GLY GLY A . n 
A 1 163 THR 163 162 162 THR THR A . n 
A 1 164 ILE 164 163 163 ILE ILE A . n 
A 1 165 ALA 165 164 164 ALA ALA A . n 
A 1 166 GLU 166 165 165 GLU GLU A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 GLY 168 167 167 GLY GLY A . n 
A 1 169 PHE 169 168 168 PHE PHE A . n 
A 1 170 SER 170 169 169 SER SER A . n 
A 1 171 LYS 171 170 170 LYS LYS A . n 
A 1 172 ILE 172 171 171 ILE ILE A . n 
A 1 173 VAL 173 172 172 VAL VAL A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 GLU 175 174 174 GLU GLU A . n 
A 1 176 GLU 176 175 175 GLU GLU A . n 
A 1 177 ASN 177 176 176 ASN ASN A . n 
A 1 178 GLY 178 177 177 GLY GLY A . n 
A 1 179 GLU 179 178 178 GLU GLU A . n 
A 1 180 VAL 180 179 179 VAL VAL A . n 
A 1 181 LYS 181 180 180 LYS LYS A . n 
A 1 182 VAL 182 181 181 VAL VAL A . n 
A 1 183 VAL 183 182 182 VAL VAL A . n 
A 1 184 ASP 184 183 183 ASP ASP A . n 
A 1 185 ASN 185 184 184 ASN ASN A . n 
A 1 186 PRO 186 185 185 PRO PRO A . n 
A 1 187 ARG 187 186 186 ARG ARG A . n 
A 1 188 TRP 188 187 187 TRP TRP A . n 
B 1 1   MET 1   0   0   MET MET B . n 
B 1 2   MET 2   1   1   MET MET B . n 
B 1 3   TYR 3   2   2   TYR TYR B . n 
B 1 4   LYS 4   3   3   LYS LYS B . n 
B 1 5   GLU 5   4   4   GLU GLU B . n 
B 1 6   PRO 6   5   5   PRO PRO B . n 
B 1 7   PHE 7   6   6   PHE PHE B . n 
B 1 8   GLY 8   7   7   GLY GLY B . n 
B 1 9   VAL 9   8   8   VAL VAL B . n 
B 1 10  LYS 10  9   9   LYS LYS B . n 
B 1 11  VAL 11  10  10  VAL VAL B . n 
B 1 12  ASP 12  11  11  ASP ASP B . n 
B 1 13  PHE 13  12  12  PHE PHE B . n 
B 1 14  GLU 14  13  13  GLU GLU B . n 
B 1 15  THR 15  14  14  THR THR B . n 
B 1 16  GLY 16  15  15  GLY GLY B . n 
B 1 17  ILE 17  16  16  ILE ILE B . n 
B 1 18  ILE 18  17  17  ILE ILE B . n 
B 1 19  GLU 19  18  18  GLU GLU B . n 
B 1 20  GLY 20  19  19  GLY GLY B . n 
B 1 21  ALA 21  20  20  ALA ALA B . n 
B 1 22  LYS 22  21  21  LYS LYS B . n 
B 1 23  LYS 23  22  22  LYS LYS B . n 
B 1 24  SER 24  23  23  SER SER B . n 
B 1 25  VAL 25  24  24  VAL VAL B . n 
B 1 26  ARG 26  25  25  ARG ARG B . n 
B 1 27  ARG 27  26  26  ARG ARG B . n 
B 1 28  LEU 28  27  27  LEU LEU B . n 
B 1 29  SER 29  28  28  SER SER B . n 
B 1 30  ASP 30  29  29  ASP ASP B . n 
B 1 31  MET 31  30  30  MET MET B . n 
B 1 32  GLU 32  31  31  GLU GLU B . n 
B 1 33  GLY 33  32  32  GLY GLY B . n 
B 1 34  TYR 34  33  33  TYR TYR B . n 
B 1 35  PHE 35  34  34  PHE PHE B . n 
B 1 36  VAL 36  35  35  VAL VAL B . n 
B 1 37  ASP 37  36  36  ASP ASP B . n 
B 1 38  GLU 38  37  37  GLU GLU B . n 
B 1 39  ARG 39  38  38  ARG ARG B . n 
B 1 40  ALA 40  39  39  ALA ALA B . n 
B 1 41  TRP 41  40  40  TRP TRP B . n 
B 1 42  LYS 42  41  41  LYS LYS B . n 
B 1 43  GLU 43  42  42  GLU GLU B . n 
B 1 44  LEU 44  43  43  LEU LEU B . n 
B 1 45  VAL 45  44  44  VAL VAL B . n 
B 1 46  GLU 46  45  45  GLU GLU B . n 
B 1 47  LYS 47  46  46  LYS LYS B . n 
B 1 48  GLU 48  47  47  GLU GLU B . n 
B 1 49  ASP 49  48  48  ASP ASP B . n 
B 1 50  PRO 50  49  49  PRO PRO B . n 
B 1 51  VAL 51  50  50  VAL VAL B . n 
B 1 52  VAL 52  51  51  VAL VAL B . n 
B 1 53  TYR 53  52  52  TYR TYR B . n 
B 1 54  GLU 54  53  53  GLU GLU B . n 
B 1 55  VAL 55  54  54  VAL VAL B . n 
B 1 56  TYR 56  55  55  TYR TYR B . n 
B 1 57  ALA 57  56  56  ALA ALA B . n 
B 1 58  VAL 58  57  57  VAL VAL B . n 
B 1 59  GLU 59  58  58  GLU GLU B . n 
B 1 60  GLN 60  59  59  GLN GLN B . n 
B 1 61  GLU 61  60  60  GLU GLU B . n 
B 1 62  GLU 62  61  61  GLU GLU B . n 
B 1 63  LYS 63  62  62  LYS LYS B . n 
B 1 64  GLU 64  63  63  GLU GLU B . n 
B 1 65  GLY 65  64  64  GLY GLY B . n 
B 1 66  ASP 66  65  65  ASP ASP B . n 
B 1 67  LEU 67  66  66  LEU LEU B . n 
B 1 68  ASN 68  67  67  ASN ASN B . n 
B 1 69  PHE 69  68  68  PHE PHE B . n 
B 1 70  ALA 70  69  69  ALA ALA B . n 
B 1 71  THR 71  70  70  THR THR B . n 
B 1 72  THR 72  71  71  THR THR B . n 
B 1 73  VAL 73  72  72  VAL VAL B . n 
B 1 74  LEU 74  73  73  LEU LEU B . n 
B 1 75  TYR 75  74  74  TYR TYR B . n 
B 1 76  PRO 76  75  75  PRO PRO B . n 
B 1 77  GLY 77  76  76  GLY GLY B . n 
B 1 78  LYS 78  77  77  LYS LYS B . n 
B 1 79  VAL 79  78  78  VAL VAL B . n 
B 1 80  GLY 80  79  79  GLY GLY B . n 
B 1 81  LYS 81  80  80  LYS LYS B . n 
B 1 82  GLU 82  81  81  GLU GLU B . n 
B 1 83  PHE 83  82  82  PHE PHE B . n 
B 1 84  PHE 84  83  83  PHE PHE B . n 
B 1 85  PHE 85  84  84  PHE PHE B . n 
B 1 86  THR 86  85  85  THR THR B . n 
B 1 87  LYS 87  86  86  LYS LYS B . n 
B 1 88  GLY 88  87  87  GLY GLY B . n 
B 1 89  HIS 89  88  88  HIS HIS B . n 
B 1 90  PHE 90  89  89  PHE PHE B . n 
B 1 91  HIS 91  90  90  HIS HIS B . n 
B 1 92  ALA 92  91  91  ALA ALA B . n 
B 1 93  LYS 93  92  92  LYS LYS B . n 
B 1 94  LEU 94  93  93  LEU LEU B . n 
B 1 95  ASP 95  94  94  ASP ASP B . n 
B 1 96  ARG 96  95  95  ARG ARG B . n 
B 1 97  ALA 97  96  96  ALA ALA B . n 
B 1 98  GLU 98  97  97  GLU GLU B . n 
B 1 99  VAL 99  98  98  VAL VAL B . n 
B 1 100 TYR 100 99  99  TYR TYR B . n 
B 1 101 VAL 101 100 100 VAL VAL B . n 
B 1 102 ALA 102 101 101 ALA ALA B . n 
B 1 103 LEU 103 102 102 LEU LEU B . n 
B 1 104 LYS 104 103 103 LYS LYS B . n 
B 1 105 GLY 105 104 104 GLY GLY B . n 
B 1 106 LYS 106 105 105 LYS LYS B . n 
B 1 107 GLY 107 106 106 GLY GLY B . n 
B 1 108 GLY 108 107 107 GLY GLY B . n 
B 1 109 MET 109 108 108 MET MET B . n 
B 1 110 LEU 110 109 109 LEU LEU B . n 
B 1 111 LEU 111 110 110 LEU LEU B . n 
B 1 112 GLN 112 111 111 GLN GLN B . n 
B 1 113 THR 113 112 112 THR THR B . n 
B 1 114 PRO 114 113 113 PRO PRO B . n 
B 1 115 GLU 115 114 114 GLU GLU B . n 
B 1 116 GLY 116 115 115 GLY GLY B . n 
B 1 117 ASP 117 116 116 ASP ASP B . n 
B 1 118 ALA 118 117 117 ALA ALA B . n 
B 1 119 LYS 119 118 118 LYS LYS B . n 
B 1 120 TRP 120 119 119 TRP TRP B . n 
B 1 121 ILE 121 120 120 ILE ILE B . n 
B 1 122 SER 122 121 121 SER SER B . n 
B 1 123 MET 123 122 122 MET MET B . n 
B 1 124 GLU 124 123 123 GLU GLU B . n 
B 1 125 PRO 125 124 124 PRO PRO B . n 
B 1 126 GLY 126 125 125 GLY GLY B . n 
B 1 127 THR 127 126 126 THR THR B . n 
B 1 128 VAL 128 127 127 VAL VAL B . n 
B 1 129 VAL 129 128 128 VAL VAL B . n 
B 1 130 TYR 130 129 129 TYR TYR B . n 
B 1 131 VAL 131 130 130 VAL VAL B . n 
B 1 132 PRO 132 131 131 PRO PRO B . n 
B 1 133 PRO 133 132 132 PRO PRO B . n 
B 1 134 TYR 134 133 133 TYR TYR B . n 
B 1 135 TRP 135 134 134 TRP TRP B . n 
B 1 136 ALA 136 135 135 ALA ALA B . n 
B 1 137 HIS 137 136 136 HIS HIS B . n 
B 1 138 ARG 138 137 137 ARG ARG B . n 
B 1 139 THR 139 138 138 THR THR B . n 
B 1 140 VAL 140 139 139 VAL VAL B . n 
B 1 141 ASN 141 140 140 ASN ASN B . n 
B 1 142 ILE 142 141 141 ILE ILE B . n 
B 1 143 GLY 143 142 142 GLY GLY B . n 
B 1 144 ASP 144 143 143 ASP ASP B . n 
B 1 145 GLU 145 144 144 GLU GLU B . n 
B 1 146 PRO 146 145 145 PRO PRO B . n 
B 1 147 PHE 147 146 146 PHE PHE B . n 
B 1 148 ILE 148 147 147 ILE ILE B . n 
B 1 149 PHE 149 148 148 PHE PHE B . n 
B 1 150 LEU 150 149 149 LEU LEU B . n 
B 1 151 ALA 151 150 150 ALA ALA B . n 
B 1 152 ILE 152 151 151 ILE ILE B . n 
B 1 153 TYR 153 152 152 TYR TYR B . n 
B 1 154 PRO 154 153 153 PRO PRO B . n 
B 1 155 ALA 155 154 154 ALA ALA B . n 
B 1 156 ASP 156 155 155 ASP ASP B . n 
B 1 157 ALA 157 156 156 ALA ALA B . n 
B 1 158 GLY 158 157 157 GLY GLY B . n 
B 1 159 HIS 159 158 158 HIS HIS B . n 
B 1 160 ASP 160 159 159 ASP ASP B . n 
B 1 161 TYR 161 160 160 TYR TYR B . n 
B 1 162 GLY 162 161 161 GLY GLY B . n 
B 1 163 THR 163 162 162 THR THR B . n 
B 1 164 ILE 164 163 163 ILE ILE B . n 
B 1 165 ALA 165 164 164 ALA ALA B . n 
B 1 166 GLU 166 165 165 GLU GLU B . n 
B 1 167 LYS 167 166 166 LYS LYS B . n 
B 1 168 GLY 168 167 167 GLY GLY B . n 
B 1 169 PHE 169 168 168 PHE PHE B . n 
B 1 170 SER 170 169 169 SER SER B . n 
B 1 171 LYS 171 170 170 LYS LYS B . n 
B 1 172 ILE 172 171 171 ILE ILE B . n 
B 1 173 VAL 173 172 172 VAL VAL B . n 
B 1 174 ILE 174 173 173 ILE ILE B . n 
B 1 175 GLU 175 174 174 GLU GLU B . n 
B 1 176 GLU 176 175 175 GLU GLU B . n 
B 1 177 ASN 177 176 176 ASN ASN B . n 
B 1 178 GLY 178 177 177 GLY GLY B . n 
B 1 179 GLU 179 178 178 GLU GLU B . n 
B 1 180 VAL 180 179 179 VAL VAL B . n 
B 1 181 LYS 181 180 180 LYS LYS B . n 
B 1 182 VAL 182 181 181 VAL VAL B . n 
B 1 183 VAL 183 182 182 VAL VAL B . n 
B 1 184 ASP 184 183 183 ASP ASP B . n 
B 1 185 ASN 185 184 184 ASN ASN B . n 
B 1 186 PRO 186 185 185 PRO PRO B . n 
B 1 187 ARG 187 186 186 ARG ARG B . n 
B 1 188 TRP 188 187 187 TRP TRP B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   402 402 ZN  ZN  A . 
D 3 M6P 1   501 501 M6P M6P A . 
E 2 ZN  1   401 401 ZN  ZN  B . 
F 3 M6P 1   502 502 M6P M6P B . 
G 4 HOH 1   502 1   HOH HOH A . 
G 4 HOH 2   503 3   HOH HOH A . 
G 4 HOH 3   504 4   HOH HOH A . 
G 4 HOH 4   505 6   HOH HOH A . 
G 4 HOH 5   506 8   HOH HOH A . 
G 4 HOH 6   507 9   HOH HOH A . 
G 4 HOH 7   508 14  HOH HOH A . 
G 4 HOH 8   509 15  HOH HOH A . 
G 4 HOH 9   510 17  HOH HOH A . 
G 4 HOH 10  511 18  HOH HOH A . 
G 4 HOH 11  512 20  HOH HOH A . 
G 4 HOH 12  513 22  HOH HOH A . 
G 4 HOH 13  514 24  HOH HOH A . 
G 4 HOH 14  515 27  HOH HOH A . 
G 4 HOH 15  516 32  HOH HOH A . 
G 4 HOH 16  517 33  HOH HOH A . 
G 4 HOH 17  518 34  HOH HOH A . 
G 4 HOH 18  519 35  HOH HOH A . 
G 4 HOH 19  520 39  HOH HOH A . 
G 4 HOH 20  521 40  HOH HOH A . 
G 4 HOH 21  522 41  HOH HOH A . 
G 4 HOH 22  523 43  HOH HOH A . 
G 4 HOH 23  524 44  HOH HOH A . 
G 4 HOH 24  525 46  HOH HOH A . 
G 4 HOH 25  526 47  HOH HOH A . 
G 4 HOH 26  527 48  HOH HOH A . 
G 4 HOH 27  528 51  HOH HOH A . 
G 4 HOH 28  529 53  HOH HOH A . 
G 4 HOH 29  530 56  HOH HOH A . 
G 4 HOH 30  531 57  HOH HOH A . 
G 4 HOH 31  532 58  HOH HOH A . 
G 4 HOH 32  533 59  HOH HOH A . 
G 4 HOH 33  534 60  HOH HOH A . 
G 4 HOH 34  535 63  HOH HOH A . 
G 4 HOH 35  536 64  HOH HOH A . 
G 4 HOH 36  537 66  HOH HOH A . 
G 4 HOH 37  538 67  HOH HOH A . 
G 4 HOH 38  539 70  HOH HOH A . 
G 4 HOH 39  540 71  HOH HOH A . 
G 4 HOH 40  541 73  HOH HOH A . 
G 4 HOH 41  542 76  HOH HOH A . 
G 4 HOH 42  543 79  HOH HOH A . 
G 4 HOH 43  544 80  HOH HOH A . 
G 4 HOH 44  545 82  HOH HOH A . 
G 4 HOH 45  546 83  HOH HOH A . 
G 4 HOH 46  547 84  HOH HOH A . 
G 4 HOH 47  548 85  HOH HOH A . 
G 4 HOH 48  549 86  HOH HOH A . 
G 4 HOH 49  550 87  HOH HOH A . 
G 4 HOH 50  551 88  HOH HOH A . 
G 4 HOH 51  552 90  HOH HOH A . 
G 4 HOH 52  553 91  HOH HOH A . 
G 4 HOH 53  554 92  HOH HOH A . 
G 4 HOH 54  555 93  HOH HOH A . 
G 4 HOH 55  556 97  HOH HOH A . 
G 4 HOH 56  557 98  HOH HOH A . 
G 4 HOH 57  558 100 HOH HOH A . 
G 4 HOH 58  559 103 HOH HOH A . 
G 4 HOH 59  560 104 HOH HOH A . 
G 4 HOH 60  561 105 HOH HOH A . 
G 4 HOH 61  562 107 HOH HOH A . 
G 4 HOH 62  563 110 HOH HOH A . 
G 4 HOH 63  564 113 HOH HOH A . 
G 4 HOH 64  565 116 HOH HOH A . 
G 4 HOH 65  566 117 HOH HOH A . 
G 4 HOH 66  567 118 HOH HOH A . 
G 4 HOH 67  568 119 HOH HOH A . 
G 4 HOH 68  569 120 HOH HOH A . 
G 4 HOH 69  570 121 HOH HOH A . 
G 4 HOH 70  571 122 HOH HOH A . 
G 4 HOH 71  572 124 HOH HOH A . 
G 4 HOH 72  573 128 HOH HOH A . 
G 4 HOH 73  574 131 HOH HOH A . 
G 4 HOH 74  575 134 HOH HOH A . 
G 4 HOH 75  576 136 HOH HOH A . 
G 4 HOH 76  577 137 HOH HOH A . 
G 4 HOH 77  578 138 HOH HOH A . 
G 4 HOH 78  579 141 HOH HOH A . 
G 4 HOH 79  580 144 HOH HOH A . 
G 4 HOH 80  581 145 HOH HOH A . 
G 4 HOH 81  582 146 HOH HOH A . 
G 4 HOH 82  583 151 HOH HOH A . 
G 4 HOH 83  584 155 HOH HOH A . 
G 4 HOH 84  585 159 HOH HOH A . 
G 4 HOH 85  586 161 HOH HOH A . 
G 4 HOH 86  587 163 HOH HOH A . 
G 4 HOH 87  588 164 HOH HOH A . 
G 4 HOH 88  589 169 HOH HOH A . 
G 4 HOH 89  590 172 HOH HOH A . 
G 4 HOH 90  591 173 HOH HOH A . 
G 4 HOH 91  592 174 HOH HOH A . 
G 4 HOH 92  593 175 HOH HOH A . 
G 4 HOH 93  594 179 HOH HOH A . 
G 4 HOH 94  595 183 HOH HOH A . 
G 4 HOH 95  596 186 HOH HOH A . 
G 4 HOH 96  597 187 HOH HOH A . 
G 4 HOH 97  598 193 HOH HOH A . 
G 4 HOH 98  599 197 HOH HOH A . 
G 4 HOH 99  600 199 HOH HOH A . 
G 4 HOH 100 601 201 HOH HOH A . 
G 4 HOH 101 602 202 HOH HOH A . 
G 4 HOH 102 603 203 HOH HOH A . 
G 4 HOH 103 604 204 HOH HOH A . 
G 4 HOH 104 605 208 HOH HOH A . 
G 4 HOH 105 606 209 HOH HOH A . 
G 4 HOH 106 607 211 HOH HOH A . 
G 4 HOH 107 608 212 HOH HOH A . 
G 4 HOH 108 609 214 HOH HOH A . 
G 4 HOH 109 610 215 HOH HOH A . 
G 4 HOH 110 611 217 HOH HOH A . 
G 4 HOH 111 612 218 HOH HOH A . 
G 4 HOH 112 613 220 HOH HOH A . 
G 4 HOH 113 614 221 HOH HOH A . 
G 4 HOH 114 615 223 HOH HOH A . 
G 4 HOH 115 616 224 HOH HOH A . 
G 4 HOH 116 617 225 HOH HOH A . 
G 4 HOH 117 618 226 HOH HOH A . 
G 4 HOH 118 619 227 HOH HOH A . 
G 4 HOH 119 620 228 HOH HOH A . 
G 4 HOH 120 621 229 HOH HOH A . 
G 4 HOH 121 622 232 HOH HOH A . 
G 4 HOH 122 623 233 HOH HOH A . 
G 4 HOH 123 624 234 HOH HOH A . 
G 4 HOH 124 625 235 HOH HOH A . 
G 4 HOH 125 626 239 HOH HOH A . 
G 4 HOH 126 627 240 HOH HOH A . 
G 4 HOH 127 628 241 HOH HOH A . 
G 4 HOH 128 629 244 HOH HOH A . 
G 4 HOH 129 630 246 HOH HOH A . 
G 4 HOH 130 631 247 HOH HOH A . 
G 4 HOH 131 632 248 HOH HOH A . 
G 4 HOH 132 633 250 HOH HOH A . 
G 4 HOH 133 634 251 HOH HOH A . 
G 4 HOH 134 635 252 HOH HOH A . 
G 4 HOH 135 636 253 HOH HOH A . 
G 4 HOH 136 637 254 HOH HOH A . 
G 4 HOH 137 638 255 HOH HOH A . 
G 4 HOH 138 639 261 HOH HOH A . 
G 4 HOH 139 640 262 HOH HOH A . 
G 4 HOH 140 641 263 HOH HOH A . 
G 4 HOH 141 642 265 HOH HOH A . 
G 4 HOH 142 643 266 HOH HOH A . 
G 4 HOH 143 644 267 HOH HOH A . 
G 4 HOH 144 645 270 HOH HOH A . 
G 4 HOH 145 646 273 HOH HOH A . 
G 4 HOH 146 647 277 HOH HOH A . 
G 4 HOH 147 648 280 HOH HOH A . 
G 4 HOH 148 649 281 HOH HOH A . 
G 4 HOH 149 650 282 HOH HOH A . 
G 4 HOH 150 651 283 HOH HOH A . 
G 4 HOH 151 652 284 HOH HOH A . 
G 4 HOH 152 653 285 HOH HOH A . 
G 4 HOH 153 654 286 HOH HOH A . 
G 4 HOH 154 655 288 HOH HOH A . 
G 4 HOH 155 656 290 HOH HOH A . 
G 4 HOH 156 657 292 HOH HOH A . 
G 4 HOH 157 658 295 HOH HOH A . 
G 4 HOH 158 659 296 HOH HOH A . 
G 4 HOH 159 660 299 HOH HOH A . 
G 4 HOH 160 661 300 HOH HOH A . 
G 4 HOH 161 662 304 HOH HOH A . 
G 4 HOH 162 663 305 HOH HOH A . 
G 4 HOH 163 664 306 HOH HOH A . 
G 4 HOH 164 665 309 HOH HOH A . 
G 4 HOH 165 666 312 HOH HOH A . 
G 4 HOH 166 667 313 HOH HOH A . 
G 4 HOH 167 668 314 HOH HOH A . 
G 4 HOH 168 669 315 HOH HOH A . 
G 4 HOH 169 670 317 HOH HOH A . 
G 4 HOH 170 671 319 HOH HOH A . 
G 4 HOH 171 672 320 HOH HOH A . 
G 4 HOH 172 673 321 HOH HOH A . 
G 4 HOH 173 674 325 HOH HOH A . 
G 4 HOH 174 675 330 HOH HOH A . 
G 4 HOH 175 676 332 HOH HOH A . 
G 4 HOH 176 677 333 HOH HOH A . 
G 4 HOH 177 678 334 HOH HOH A . 
G 4 HOH 178 679 338 HOH HOH A . 
G 4 HOH 179 680 346 HOH HOH A . 
G 4 HOH 180 681 347 HOH HOH A . 
G 4 HOH 181 682 348 HOH HOH A . 
G 4 HOH 182 683 353 HOH HOH A . 
H 4 HOH 1   503 2   HOH HOH B . 
H 4 HOH 2   504 5   HOH HOH B . 
H 4 HOH 3   505 7   HOH HOH B . 
H 4 HOH 4   506 10  HOH HOH B . 
H 4 HOH 5   507 11  HOH HOH B . 
H 4 HOH 6   508 12  HOH HOH B . 
H 4 HOH 7   509 13  HOH HOH B . 
H 4 HOH 8   510 16  HOH HOH B . 
H 4 HOH 9   511 19  HOH HOH B . 
H 4 HOH 10  512 21  HOH HOH B . 
H 4 HOH 11  513 23  HOH HOH B . 
H 4 HOH 12  514 25  HOH HOH B . 
H 4 HOH 13  515 26  HOH HOH B . 
H 4 HOH 14  516 28  HOH HOH B . 
H 4 HOH 15  517 29  HOH HOH B . 
H 4 HOH 16  518 30  HOH HOH B . 
H 4 HOH 17  519 31  HOH HOH B . 
H 4 HOH 18  520 36  HOH HOH B . 
H 4 HOH 19  521 37  HOH HOH B . 
H 4 HOH 20  522 38  HOH HOH B . 
H 4 HOH 21  523 42  HOH HOH B . 
H 4 HOH 22  524 45  HOH HOH B . 
H 4 HOH 23  525 49  HOH HOH B . 
H 4 HOH 24  526 50  HOH HOH B . 
H 4 HOH 25  527 52  HOH HOH B . 
H 4 HOH 26  528 54  HOH HOH B . 
H 4 HOH 27  529 55  HOH HOH B . 
H 4 HOH 28  530 61  HOH HOH B . 
H 4 HOH 29  531 62  HOH HOH B . 
H 4 HOH 30  532 65  HOH HOH B . 
H 4 HOH 31  533 68  HOH HOH B . 
H 4 HOH 32  534 69  HOH HOH B . 
H 4 HOH 33  535 72  HOH HOH B . 
H 4 HOH 34  536 74  HOH HOH B . 
H 4 HOH 35  537 75  HOH HOH B . 
H 4 HOH 36  538 77  HOH HOH B . 
H 4 HOH 37  539 78  HOH HOH B . 
H 4 HOH 38  540 81  HOH HOH B . 
H 4 HOH 39  541 89  HOH HOH B . 
H 4 HOH 40  542 94  HOH HOH B . 
H 4 HOH 41  543 95  HOH HOH B . 
H 4 HOH 42  544 96  HOH HOH B . 
H 4 HOH 43  545 99  HOH HOH B . 
H 4 HOH 44  546 101 HOH HOH B . 
H 4 HOH 45  547 102 HOH HOH B . 
H 4 HOH 46  548 106 HOH HOH B . 
H 4 HOH 47  549 108 HOH HOH B . 
H 4 HOH 48  550 109 HOH HOH B . 
H 4 HOH 49  551 111 HOH HOH B . 
H 4 HOH 50  552 112 HOH HOH B . 
H 4 HOH 51  553 114 HOH HOH B . 
H 4 HOH 52  554 115 HOH HOH B . 
H 4 HOH 53  555 123 HOH HOH B . 
H 4 HOH 54  556 125 HOH HOH B . 
H 4 HOH 55  557 126 HOH HOH B . 
H 4 HOH 56  558 127 HOH HOH B . 
H 4 HOH 57  559 129 HOH HOH B . 
H 4 HOH 58  560 130 HOH HOH B . 
H 4 HOH 59  561 132 HOH HOH B . 
H 4 HOH 60  562 133 HOH HOH B . 
H 4 HOH 61  563 135 HOH HOH B . 
H 4 HOH 62  564 139 HOH HOH B . 
H 4 HOH 63  565 140 HOH HOH B . 
H 4 HOH 64  566 142 HOH HOH B . 
H 4 HOH 65  567 143 HOH HOH B . 
H 4 HOH 66  568 147 HOH HOH B . 
H 4 HOH 67  569 148 HOH HOH B . 
H 4 HOH 68  570 149 HOH HOH B . 
H 4 HOH 69  571 150 HOH HOH B . 
H 4 HOH 70  572 152 HOH HOH B . 
H 4 HOH 71  573 153 HOH HOH B . 
H 4 HOH 72  574 154 HOH HOH B . 
H 4 HOH 73  575 156 HOH HOH B . 
H 4 HOH 74  576 157 HOH HOH B . 
H 4 HOH 75  577 158 HOH HOH B . 
H 4 HOH 76  578 160 HOH HOH B . 
H 4 HOH 77  579 162 HOH HOH B . 
H 4 HOH 78  580 165 HOH HOH B . 
H 4 HOH 79  581 166 HOH HOH B . 
H 4 HOH 80  582 167 HOH HOH B . 
H 4 HOH 81  583 168 HOH HOH B . 
H 4 HOH 82  584 170 HOH HOH B . 
H 4 HOH 83  585 171 HOH HOH B . 
H 4 HOH 84  586 176 HOH HOH B . 
H 4 HOH 85  587 177 HOH HOH B . 
H 4 HOH 86  588 178 HOH HOH B . 
H 4 HOH 87  589 180 HOH HOH B . 
H 4 HOH 88  590 181 HOH HOH B . 
H 4 HOH 89  591 182 HOH HOH B . 
H 4 HOH 90  592 184 HOH HOH B . 
H 4 HOH 91  593 185 HOH HOH B . 
H 4 HOH 92  594 188 HOH HOH B . 
H 4 HOH 93  595 189 HOH HOH B . 
H 4 HOH 94  596 190 HOH HOH B . 
H 4 HOH 95  597 191 HOH HOH B . 
H 4 HOH 96  598 192 HOH HOH B . 
H 4 HOH 97  599 194 HOH HOH B . 
H 4 HOH 98  600 195 HOH HOH B . 
H 4 HOH 99  601 196 HOH HOH B . 
H 4 HOH 100 602 198 HOH HOH B . 
H 4 HOH 101 603 200 HOH HOH B . 
H 4 HOH 102 604 205 HOH HOH B . 
H 4 HOH 103 605 206 HOH HOH B . 
H 4 HOH 104 606 207 HOH HOH B . 
H 4 HOH 105 607 210 HOH HOH B . 
H 4 HOH 106 608 213 HOH HOH B . 
H 4 HOH 107 609 216 HOH HOH B . 
H 4 HOH 108 610 219 HOH HOH B . 
H 4 HOH 109 611 222 HOH HOH B . 
H 4 HOH 110 612 230 HOH HOH B . 
H 4 HOH 111 613 231 HOH HOH B . 
H 4 HOH 112 614 236 HOH HOH B . 
H 4 HOH 113 615 237 HOH HOH B . 
H 4 HOH 114 616 238 HOH HOH B . 
H 4 HOH 115 617 242 HOH HOH B . 
H 4 HOH 116 618 243 HOH HOH B . 
H 4 HOH 117 619 245 HOH HOH B . 
H 4 HOH 118 620 249 HOH HOH B . 
H 4 HOH 119 621 256 HOH HOH B . 
H 4 HOH 120 622 257 HOH HOH B . 
H 4 HOH 121 623 258 HOH HOH B . 
H 4 HOH 122 624 259 HOH HOH B . 
H 4 HOH 123 625 260 HOH HOH B . 
H 4 HOH 124 626 264 HOH HOH B . 
H 4 HOH 125 627 268 HOH HOH B . 
H 4 HOH 126 628 269 HOH HOH B . 
H 4 HOH 127 629 271 HOH HOH B . 
H 4 HOH 128 630 272 HOH HOH B . 
H 4 HOH 129 631 274 HOH HOH B . 
H 4 HOH 130 632 275 HOH HOH B . 
H 4 HOH 131 633 276 HOH HOH B . 
H 4 HOH 132 634 278 HOH HOH B . 
H 4 HOH 133 635 279 HOH HOH B . 
H 4 HOH 134 636 287 HOH HOH B . 
H 4 HOH 135 637 289 HOH HOH B . 
H 4 HOH 136 638 291 HOH HOH B . 
H 4 HOH 137 639 293 HOH HOH B . 
H 4 HOH 138 640 294 HOH HOH B . 
H 4 HOH 139 641 297 HOH HOH B . 
H 4 HOH 140 642 298 HOH HOH B . 
H 4 HOH 141 643 301 HOH HOH B . 
H 4 HOH 142 644 302 HOH HOH B . 
H 4 HOH 143 645 303 HOH HOH B . 
H 4 HOH 144 646 307 HOH HOH B . 
H 4 HOH 145 647 308 HOH HOH B . 
H 4 HOH 146 648 310 HOH HOH B . 
H 4 HOH 147 649 311 HOH HOH B . 
H 4 HOH 148 650 316 HOH HOH B . 
H 4 HOH 149 651 318 HOH HOH B . 
H 4 HOH 150 652 322 HOH HOH B . 
H 4 HOH 151 653 323 HOH HOH B . 
H 4 HOH 152 654 324 HOH HOH B . 
H 4 HOH 153 655 326 HOH HOH B . 
H 4 HOH 154 656 327 HOH HOH B . 
H 4 HOH 155 657 328 HOH HOH B . 
H 4 HOH 156 658 329 HOH HOH B . 
H 4 HOH 157 659 331 HOH HOH B . 
H 4 HOH 158 660 335 HOH HOH B . 
H 4 HOH 159 661 336 HOH HOH B . 
H 4 HOH 160 662 337 HOH HOH B . 
H 4 HOH 161 663 339 HOH HOH B . 
H 4 HOH 162 664 340 HOH HOH B . 
H 4 HOH 163 665 341 HOH HOH B . 
H 4 HOH 164 666 342 HOH HOH B . 
H 4 HOH 165 667 343 HOH HOH B . 
H 4 HOH 166 668 344 HOH HOH B . 
H 4 HOH 167 669 345 HOH HOH B . 
H 4 HOH 168 670 349 HOH HOH B . 
H 4 HOH 169 671 350 HOH HOH B . 
H 4 HOH 170 672 351 HOH HOH B . 
H 4 HOH 171 673 352 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5020  ? 
1 MORE         -112  ? 
1 'SSA (A^2)'  16160 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 89  ? A HIS 88  ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 91  ? A HIS 90  ? 1_555 112.7 ? 
2  NE2 ? A HIS 89  ? A HIS 88  ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 OE2 ? A GLU 98  ? A GLU 97  ? 1_555 154.5 ? 
3  NE2 ? A HIS 91  ? A HIS 90  ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 OE2 ? A GLU 98  ? A GLU 97  ? 1_555 92.3  ? 
4  NE2 ? A HIS 89  ? A HIS 88  ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 137 ? A HIS 136 ? 1_555 89.5  ? 
5  NE2 ? A HIS 91  ? A HIS 90  ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 137 ? A HIS 136 ? 1_555 94.6  ? 
6  OE2 ? A GLU 98  ? A GLU 97  ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 137 ? A HIS 136 ? 1_555 83.3  ? 
7  NE2 ? A HIS 89  ? A HIS 88  ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 O   ? G HOH .   ? A HOH 676 ? 1_555 90.7  ? 
8  NE2 ? A HIS 91  ? A HIS 90  ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 O   ? G HOH .   ? A HOH 676 ? 1_555 98.3  ? 
9  OE2 ? A GLU 98  ? A GLU 97  ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 O   ? G HOH .   ? A HOH 676 ? 1_555 90.6  ? 
10 NE2 ? A HIS 137 ? A HIS 136 ? 1_555 ZN ? C ZN . ? A ZN 402 ? 1_555 O   ? G HOH .   ? A HOH 676 ? 1_555 166.0 ? 
11 NE2 ? B HIS 89  ? B HIS 88  ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 NE2 ? B HIS 91  ? B HIS 90  ? 1_555 113.2 ? 
12 NE2 ? B HIS 89  ? B HIS 88  ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 OE1 ? B GLU 98  ? B GLU 97  ? 1_555 150.0 ? 
13 NE2 ? B HIS 91  ? B HIS 90  ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 OE1 ? B GLU 98  ? B GLU 97  ? 1_555 96.6  ? 
14 NE2 ? B HIS 89  ? B HIS 88  ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 NE2 ? B HIS 137 ? B HIS 136 ? 1_555 89.2  ? 
15 NE2 ? B HIS 91  ? B HIS 90  ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 NE2 ? B HIS 137 ? B HIS 136 ? 1_555 102.1 ? 
16 OE1 ? B GLU 98  ? B GLU 97  ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 NE2 ? B HIS 137 ? B HIS 136 ? 1_555 87.0  ? 
17 NE2 ? B HIS 89  ? B HIS 88  ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 O   ? H HOH .   ? B HOH 669 ? 1_555 89.7  ? 
18 NE2 ? B HIS 91  ? B HIS 90  ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 O   ? H HOH .   ? B HOH 669 ? 1_555 100.1 ? 
19 OE1 ? B GLU 98  ? B GLU 97  ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 O   ? H HOH .   ? B HOH 669 ? 1_555 82.1  ? 
20 NE2 ? B HIS 137 ? B HIS 136 ? 1_555 ZN ? E ZN . ? B ZN 401 ? 1_555 O   ? H HOH .   ? B HOH 669 ? 1_555 156.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-04-11 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_entity_nonpoly       
5 4 'Structure model' pdbx_struct_conn_angle    
6 4 'Structure model' struct_conn               
7 4 'Structure model' struct_ref_seq_dif        
8 4 'Structure model' struct_site               
9 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_chem_comp.mon_nstd_flag'                    
2  4 'Structure model' '_chem_comp.name'                             
3  4 'Structure model' '_chem_comp.type'                             
4  4 'Structure model' '_entity.pdbx_description'                    
5  4 'Structure model' '_pdbx_entity_nonpoly.name'                   
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
18 4 'Structure model' '_pdbx_struct_conn_angle.value'               
19 4 'Structure model' '_struct_conn.pdbx_dist_value'                
20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
22 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
23 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
24 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
25 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
26 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
27 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
28 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
29 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
30 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
31 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
32 4 'Structure model' '_struct_ref_seq_dif.details'                 
# 
_pdbx_phasing_MR.entry_id                     2GC3 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     0.420 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   0.597 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.000 
_pdbx_phasing_MR.d_res_low_rotation           42.140 
_pdbx_phasing_MR.d_res_high_translation       3.000 
_pdbx_phasing_MR.d_res_low_translation        42.140 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SCALA       .         ?              program 'Phil Evans'      pre@mrc-lmb.cam.ac.uk    'data scaling'    
http://www.ccp4.ac.uk/dist/html/INDEX.html  Fortran ? 1 
MOLREP      .         ?              program 'A. Vagin'        alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html Fortran ? 2 
REFMAC      .         ?              program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html             Fortran ? 3 
PDB_EXTRACT 1.701     'Nov. 1, 2005' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/            C++     ? 4 
MOSFLM      .         ?              ?       ?                 ?                        'data reduction'  ? ?       ? 5 
CCP4        '(SCALA)' ?              ?       ?                 ?                        'data scaling'    ? ?       ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 47  ? ? -149.65 -32.97 
2 1 ASP A 48  ? ? 39.02   72.07  
3 1 TYR A 133 ? ? 83.23   -8.04  
4 1 GLU B 47  ? ? -144.18 -44.04 
5 1 TYR B 133 ? ? 79.86   -7.17  
# 
_pdbx_chem_comp_identifier.comp_id           M6P 
_pdbx_chem_comp_identifier.type              'IUPAC CARBOHYDRATE SYMBOL' 
_pdbx_chem_comp_identifier.program           PDB-CARE 
_pdbx_chem_comp_identifier.program_version   1.0 
_pdbx_chem_comp_identifier.identifier        a-D-Manp6PO3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                          ZN  
3 6-O-phosphono-alpha-D-mannopyranose M6P 
4 water                               HOH 
#