data_2GDZ
# 
_entry.id   2GDZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GDZ         
RCSB  RCSB037000   
WWPDB D_1000037000 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GDZ 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pilka, E.S.'                          1  
'Guo, K.'                              2  
'Kavanagh, K.'                         3  
'Von Delft, F.'                        4  
'Arrowsmith, C.'                       5  
'Weigelt, J.'                          6  
'Edwards, A.'                          7  
'Sundstrom, M.'                        8  
'Oppermann, U.'                        9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     
;High-Affinity Inhibitors of Human NAD-Dependent 15-Hydroxyprostaglandin Dehydrogenase: Mechanisms of Inhibition and Structure-Activity Relationships.
;
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            5 
_citation.page_first                e13719 
_citation.page_last                 e13719 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21072165 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0013719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Niesen, F.H.'    1  
primary 'Schultz, L.'     2  
primary 'Jadhav, A.'      3  
primary 'Bhatia, C.'      4  
primary 'Guo, K.'         5  
primary 'Maloney, D.J.'   6  
primary 'Pilka, E.S.'     7  
primary 'Wang, M.'        8  
primary 'Oppermann, U.'   9  
primary 'Heightman, T.D.' 10 
primary 'Simeonov, A.'    11 
# 
_cell.entry_id           2GDZ 
_cell.length_a           49.540 
_cell.length_b           49.540 
_cell.length_c           195.771 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2GDZ 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NAD+-dependent 15-hydroxyprostaglandin dehydrogenase' 29179.539 1   1.1.1.141 ? 'residues (-1)-265' ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                      663.425   1   ?         ? ?                   ? 
3 water       nat water                                                  18.015    299 ?         ? ?                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '15 hydroxyprostaglandin dehydrogenase type1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAHMVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALHEQFEPQKTLFIQCDVADQQQLRDTFRKV
VDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGI
VGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDAL
NGAIMKITTSKGIHFQDYGSKENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAHMVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALHEQFEPQKTLFIQCDVADQQQLRDTFRKV
VDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGI
VGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDAL
NGAIMKITTSKGIHFQDYGSKENLYFQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   HIS n 
1 4   MET n 
1 5   VAL n 
1 6   ASN n 
1 7   GLY n 
1 8   LYS n 
1 9   VAL n 
1 10  ALA n 
1 11  LEU n 
1 12  VAL n 
1 13  THR n 
1 14  GLY n 
1 15  ALA n 
1 16  ALA n 
1 17  GLN n 
1 18  GLY n 
1 19  ILE n 
1 20  GLY n 
1 21  ARG n 
1 22  ALA n 
1 23  PHE n 
1 24  ALA n 
1 25  GLU n 
1 26  ALA n 
1 27  LEU n 
1 28  LEU n 
1 29  LEU n 
1 30  LYS n 
1 31  GLY n 
1 32  ALA n 
1 33  LYS n 
1 34  VAL n 
1 35  ALA n 
1 36  LEU n 
1 37  VAL n 
1 38  ASP n 
1 39  TRP n 
1 40  ASN n 
1 41  LEU n 
1 42  GLU n 
1 43  ALA n 
1 44  GLY n 
1 45  VAL n 
1 46  GLN n 
1 47  CYS n 
1 48  LYS n 
1 49  ALA n 
1 50  ALA n 
1 51  LEU n 
1 52  HIS n 
1 53  GLU n 
1 54  GLN n 
1 55  PHE n 
1 56  GLU n 
1 57  PRO n 
1 58  GLN n 
1 59  LYS n 
1 60  THR n 
1 61  LEU n 
1 62  PHE n 
1 63  ILE n 
1 64  GLN n 
1 65  CYS n 
1 66  ASP n 
1 67  VAL n 
1 68  ALA n 
1 69  ASP n 
1 70  GLN n 
1 71  GLN n 
1 72  GLN n 
1 73  LEU n 
1 74  ARG n 
1 75  ASP n 
1 76  THR n 
1 77  PHE n 
1 78  ARG n 
1 79  LYS n 
1 80  VAL n 
1 81  VAL n 
1 82  ASP n 
1 83  HIS n 
1 84  PHE n 
1 85  GLY n 
1 86  ARG n 
1 87  LEU n 
1 88  ASP n 
1 89  ILE n 
1 90  LEU n 
1 91  VAL n 
1 92  ASN n 
1 93  ASN n 
1 94  ALA n 
1 95  GLY n 
1 96  VAL n 
1 97  ASN n 
1 98  ASN n 
1 99  GLU n 
1 100 LYS n 
1 101 ASN n 
1 102 TRP n 
1 103 GLU n 
1 104 LYS n 
1 105 THR n 
1 106 LEU n 
1 107 GLN n 
1 108 ILE n 
1 109 ASN n 
1 110 LEU n 
1 111 VAL n 
1 112 SER n 
1 113 VAL n 
1 114 ILE n 
1 115 SER n 
1 116 GLY n 
1 117 THR n 
1 118 TYR n 
1 119 LEU n 
1 120 GLY n 
1 121 LEU n 
1 122 ASP n 
1 123 TYR n 
1 124 MET n 
1 125 SER n 
1 126 LYS n 
1 127 GLN n 
1 128 ASN n 
1 129 GLY n 
1 130 GLY n 
1 131 GLU n 
1 132 GLY n 
1 133 GLY n 
1 134 ILE n 
1 135 ILE n 
1 136 ILE n 
1 137 ASN n 
1 138 MET n 
1 139 SER n 
1 140 SER n 
1 141 LEU n 
1 142 ALA n 
1 143 GLY n 
1 144 LEU n 
1 145 MET n 
1 146 PRO n 
1 147 VAL n 
1 148 ALA n 
1 149 GLN n 
1 150 GLN n 
1 151 PRO n 
1 152 VAL n 
1 153 TYR n 
1 154 CYS n 
1 155 ALA n 
1 156 SER n 
1 157 LYS n 
1 158 HIS n 
1 159 GLY n 
1 160 ILE n 
1 161 VAL n 
1 162 GLY n 
1 163 PHE n 
1 164 THR n 
1 165 ARG n 
1 166 SER n 
1 167 ALA n 
1 168 ALA n 
1 169 LEU n 
1 170 ALA n 
1 171 ALA n 
1 172 ASN n 
1 173 LEU n 
1 174 MET n 
1 175 ASN n 
1 176 SER n 
1 177 GLY n 
1 178 VAL n 
1 179 ARG n 
1 180 LEU n 
1 181 ASN n 
1 182 ALA n 
1 183 ILE n 
1 184 CYS n 
1 185 PRO n 
1 186 GLY n 
1 187 PHE n 
1 188 VAL n 
1 189 ASN n 
1 190 THR n 
1 191 ALA n 
1 192 ILE n 
1 193 LEU n 
1 194 GLU n 
1 195 SER n 
1 196 ILE n 
1 197 GLU n 
1 198 LYS n 
1 199 GLU n 
1 200 GLU n 
1 201 ASN n 
1 202 MET n 
1 203 GLY n 
1 204 GLN n 
1 205 TYR n 
1 206 ILE n 
1 207 GLU n 
1 208 TYR n 
1 209 LYS n 
1 210 ASP n 
1 211 HIS n 
1 212 ILE n 
1 213 LYS n 
1 214 ASP n 
1 215 MET n 
1 216 ILE n 
1 217 LYS n 
1 218 TYR n 
1 219 TYR n 
1 220 GLY n 
1 221 ILE n 
1 222 LEU n 
1 223 ASP n 
1 224 PRO n 
1 225 PRO n 
1 226 LEU n 
1 227 ILE n 
1 228 ALA n 
1 229 ASN n 
1 230 GLY n 
1 231 LEU n 
1 232 ILE n 
1 233 THR n 
1 234 LEU n 
1 235 ILE n 
1 236 GLU n 
1 237 ASP n 
1 238 ASP n 
1 239 ALA n 
1 240 LEU n 
1 241 ASN n 
1 242 GLY n 
1 243 ALA n 
1 244 ILE n 
1 245 MET n 
1 246 LYS n 
1 247 ILE n 
1 248 THR n 
1 249 THR n 
1 250 SER n 
1 251 LYS n 
1 252 GLY n 
1 253 ILE n 
1 254 HIS n 
1 255 PHE n 
1 256 GLN n 
1 257 ASP n 
1 258 TYR n 
1 259 GLY n 
1 260 SER n 
1 261 LYS n 
1 262 GLU n 
1 263 ASN n 
1 264 LEU n 
1 265 TYR n 
1 266 PHE n 
1 267 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21-R3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-SGC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PGDH_HUMAN 
_struct_ref.pdbx_db_accession          P15428 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2GDZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 258 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P15428 
_struct_ref_seq.db_align_beg                  3 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  256 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       256 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GDZ MET A 1   ? UNP P15428 ? ? 'EXPRESSION TAG' -1  1  
1 2GDZ ALA A 2   ? UNP P15428 ? ? 'EXPRESSION TAG' 0   2  
1 2GDZ HIS A 3   ? UNP P15428 ? ? 'EXPRESSION TAG' 1   3  
1 2GDZ MET A 4   ? UNP P15428 ? ? 'EXPRESSION TAG' 2   4  
1 2GDZ GLY A 259 ? UNP P15428 ? ? 'EXPRESSION TAG' 257 5  
1 2GDZ SER A 260 ? UNP P15428 ? ? 'EXPRESSION TAG' 258 6  
1 2GDZ LYS A 261 ? UNP P15428 ? ? 'EXPRESSION TAG' 259 7  
1 2GDZ GLU A 262 ? UNP P15428 ? ? 'EXPRESSION TAG' 260 8  
1 2GDZ ASN A 263 ? UNP P15428 ? ? 'EXPRESSION TAG' 261 9  
1 2GDZ LEU A 264 ? UNP P15428 ? ? 'EXPRESSION TAG' 262 10 
1 2GDZ TYR A 265 ? UNP P15428 ? ? 'EXPRESSION TAG' 263 11 
1 2GDZ PHE A 266 ? UNP P15428 ? ? 'EXPRESSION TAG' 264 12 
1 2GDZ GLN A 267 ? UNP P15428 ? ? 'EXPRESSION TAG' 265 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2GDZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.06 
_exptl_crystal.density_percent_sol   40.23 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '0.1 PCB, 30% PEG 1000, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                OSMIC 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    OSMIC 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     2GDZ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             196.12 
_reflns.d_resolution_high            1.65 
_reflns.number_obs                   30422 
_reflns.number_all                   30422 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_netI_over_sigmaI        23.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              11.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.65 
_reflns_shell.d_res_low              1.74 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.688 
_reflns_shell.pdbx_Rsym_value        0.688 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        7.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2GDZ 
_refine.ls_number_reflns_obs                     28883 
_refine.ls_number_reflns_all                     28883 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             21.86 
_refine.ls_d_res_high                            1.65 
_refine.ls_percent_reflns_obs                    99.40 
_refine.ls_R_factor_obs                          0.17746 
_refine.ls_R_factor_all                          0.17746 
_refine.ls_R_factor_R_work                       0.17568 
_refine.ls_R_factor_R_free                       0.21214 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1538 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.965 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.B_iso_mean                               18.567 
_refine.aniso_B[1][1]                            0.38 
_refine.aniso_B[2][2]                            0.38 
_refine.aniso_B[3][3]                            -0.77 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1WMB, 1IY8, 1ZK3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.104 
_refine.pdbx_overall_ESU_R_Free                  0.103 
_refine.overall_SU_ML                            0.063 
_refine.overall_SU_B                             1.826 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2026 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             299 
_refine_hist.number_atoms_total               2369 
_refine_hist.d_res_high                       1.65 
_refine_hist.d_res_low                        21.86 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.022  ? 2136 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.627  1.981  ? 2899 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.284  5.000  ? 269  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.233 25.652 ? 92   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.522 15.000 ? 372  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.858 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.111  0.200  ? 332  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 1581 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.205  0.200  ? 1146 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.304  0.200  ? 1484 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.141  0.200  ? 241  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.185  0.200  ? 92   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.119  0.200  ? 30   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.054  1.500  ? 1365 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.489  2.000  ? 2116 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.482  3.000  ? 887  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.736  4.500  ? 781  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.650 
_refine_ls_shell.d_res_low                        1.74 
_refine_ls_shell.number_reflns_R_work             1952 
_refine_ls_shell.R_factor_R_work                  0.381 
_refine_ls_shell.percent_reflns_obs               94.71 
_refine_ls_shell.R_factor_R_free                  0.442 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2GDZ 
_struct.title                     'Crystal structure of 15-hydroxyprostaglandin dehydrogenase type1, complexed with NAD+' 
_struct.pdbx_descriptor           'NAD+-dependent 15-hydroxyprostaglandin dehydrogenase (E.C.1.1.1.141)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GDZ 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;hydroxyprostaglandin, dehydrogenase, Structural Genomics, SHORT-CHAIN DEHYDROGENASE/REDUCTASE, INFLAMMATION, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The second part of the biological assembly is generated 
by the following symmetry operation: Y, X, -Z + (0 0 1)
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 17  ? LYS A 30  ? GLN A 15  LYS A 28  1 ? 14 
HELX_P HELX_P2  2  ASN A 40  ? HIS A 52  ? ASN A 38  HIS A 50  1 ? 13 
HELX_P HELX_P3  3  GLU A 56  ? GLN A 58  ? GLU A 54  GLN A 56  5 ? 3  
HELX_P HELX_P4  4  ASP A 69  ? GLY A 85  ? ASP A 67  GLY A 83  1 ? 17 
HELX_P HELX_P5  5  ASN A 101 ? LEU A 110 ? ASN A 99  LEU A 108 1 ? 10 
HELX_P HELX_P6  6  LEU A 110 ? SER A 125 ? LEU A 108 SER A 123 1 ? 16 
HELX_P HELX_P7  7  LYS A 126 ? GLY A 129 ? LYS A 124 GLY A 127 5 ? 4  
HELX_P HELX_P8  8  SER A 140 ? LEU A 144 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P9  9  GLN A 150 ? ASN A 175 ? GLN A 148 ASN A 173 1 ? 26 
HELX_P HELX_P10 10 THR A 190 ? SER A 195 ? THR A 188 SER A 193 1 ? 6  
HELX_P HELX_P11 11 LYS A 198 ? GLY A 203 ? LYS A 196 GLY A 201 1 ? 6  
HELX_P HELX_P12 12 GLN A 204 ? GLU A 207 ? GLN A 202 GLU A 205 5 ? 4  
HELX_P HELX_P13 13 TYR A 208 ? GLY A 220 ? TYR A 206 GLY A 218 1 ? 13 
HELX_P HELX_P14 14 ASP A 223 ? ASP A 237 ? ASP A 221 ASP A 235 1 ? 15 
HELX_P HELX_P15 15 ASN A 263 ? GLN A 267 ? ASN A 261 GLN A 265 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 60  ? GLN A 64  ? THR A 58  GLN A 62  
A 2 LYS A 33  ? ASP A 38  ? LYS A 31  ASP A 36  
A 3 VAL A 9   ? THR A 13  ? VAL A 7   THR A 11  
A 4 ILE A 89  ? ASN A 92  ? ILE A 87  ASN A 90  
A 5 GLY A 133 ? MET A 138 ? GLY A 131 MET A 136 
A 6 VAL A 178 ? PRO A 185 ? VAL A 176 PRO A 183 
A 7 ILE A 244 ? THR A 248 ? ILE A 242 THR A 246 
A 8 GLY A 252 ? PHE A 255 ? GLY A 250 PHE A 253 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 61  ? O LEU A 59  N LEU A 36  ? N LEU A 34  
A 2 3 O ALA A 35  ? O ALA A 33  N ALA A 10  ? N ALA A 8   
A 3 4 N LEU A 11  ? N LEU A 9   O VAL A 91  ? O VAL A 89  
A 4 5 N LEU A 90  ? N LEU A 88  O ILE A 136 ? O ILE A 134 
A 5 6 N ILE A 135 ? N ILE A 133 O ARG A 179 ? O ARG A 177 
A 6 7 N CYS A 184 ? N CYS A 182 O MET A 245 ? O MET A 243 
A 7 8 N LYS A 246 ? N LYS A 244 O HIS A 254 ? O HIS A 252 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    32 
_struct_site.details              'BINDING SITE FOR RESIDUE NAD A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 32 GLY A 14  ? GLY A 12  . ? 1_555 ? 
2  AC1 32 GLN A 17  ? GLN A 15  . ? 1_555 ? 
3  AC1 32 GLY A 18  ? GLY A 16  . ? 1_555 ? 
4  AC1 32 ILE A 19  ? ILE A 17  . ? 1_555 ? 
5  AC1 32 ASP A 38  ? ASP A 36  . ? 1_555 ? 
6  AC1 32 TRP A 39  ? TRP A 37  . ? 1_555 ? 
7  AC1 32 CYS A 65  ? CYS A 63  . ? 1_555 ? 
8  AC1 32 ASP A 66  ? ASP A 64  . ? 1_555 ? 
9  AC1 32 VAL A 67  ? VAL A 65  . ? 1_555 ? 
10 AC1 32 ASN A 93  ? ASN A 91  . ? 1_555 ? 
11 AC1 32 ALA A 94  ? ALA A 92  . ? 1_555 ? 
12 AC1 32 GLY A 95  ? GLY A 93  . ? 1_555 ? 
13 AC1 32 VAL A 96  ? VAL A 94  . ? 1_555 ? 
14 AC1 32 ILE A 108 ? ILE A 106 . ? 1_555 ? 
15 AC1 32 SER A 139 ? SER A 137 . ? 1_555 ? 
16 AC1 32 SER A 140 ? SER A 138 . ? 1_555 ? 
17 AC1 32 TYR A 153 ? TYR A 151 . ? 1_555 ? 
18 AC1 32 LYS A 157 ? LYS A 155 . ? 1_555 ? 
19 AC1 32 PRO A 185 ? PRO A 183 . ? 1_555 ? 
20 AC1 32 GLY A 186 ? GLY A 184 . ? 1_555 ? 
21 AC1 32 PHE A 187 ? PHE A 185 . ? 1_555 ? 
22 AC1 32 VAL A 188 ? VAL A 186 . ? 1_555 ? 
23 AC1 32 THR A 190 ? THR A 188 . ? 1_555 ? 
24 AC1 32 ALA A 191 ? ALA A 189 . ? 1_555 ? 
25 AC1 32 ILE A 192 ? ILE A 190 . ? 1_555 ? 
26 AC1 32 HOH C .   ? HOH A 304 . ? 1_555 ? 
27 AC1 32 HOH C .   ? HOH A 313 . ? 1_555 ? 
28 AC1 32 HOH C .   ? HOH A 325 . ? 1_555 ? 
29 AC1 32 HOH C .   ? HOH A 378 . ? 1_555 ? 
30 AC1 32 HOH C .   ? HOH A 383 . ? 1_555 ? 
31 AC1 32 HOH C .   ? HOH A 434 . ? 1_555 ? 
32 AC1 32 HOH C .   ? HOH A 441 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2GDZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GDZ 
_atom_sites.fract_transf_matrix[1][1]   0.020186 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020186 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005108 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 2   ? 1.820  21.383 71.552  1.00 29.32 ? 0   ALA A N   1 
ATOM   2    C CA  . ALA A 1 2   ? 3.304  21.399 71.777  1.00 29.07 ? 0   ALA A CA  1 
ATOM   3    C C   . ALA A 1 2   ? 3.942  22.685 71.229  1.00 29.22 ? 0   ALA A C   1 
ATOM   4    O O   . ALA A 1 2   ? 3.438  23.252 70.246  1.00 29.20 ? 0   ALA A O   1 
ATOM   5    C CB  . ALA A 1 2   ? 3.934  20.174 71.135  1.00 28.68 ? 0   ALA A CB  1 
ATOM   6    N N   . HIS A 1 3   ? 5.023  23.133 71.880  1.00 29.25 ? 1   HIS A N   1 
ATOM   7    C CA  . HIS A 1 3   ? 5.923  24.198 71.386  1.00 30.56 ? 1   HIS A CA  1 
ATOM   8    C C   . HIS A 1 3   ? 6.834  23.660 70.297  1.00 30.22 ? 1   HIS A C   1 
ATOM   9    O O   . HIS A 1 3   ? 7.340  22.546 70.389  1.00 30.85 ? 1   HIS A O   1 
ATOM   10   C CB  . HIS A 1 3   ? 6.871  24.711 72.494  1.00 31.35 ? 1   HIS A CB  1 
ATOM   11   C CG  . HIS A 1 3   ? 6.186  25.344 73.664  1.00 33.88 ? 1   HIS A CG  1 
ATOM   12   N ND1 . HIS A 1 3   ? 5.666  26.623 73.627  1.00 36.20 ? 1   HIS A ND1 1 
ATOM   13   C CD2 . HIS A 1 3   ? 5.952  24.879 74.916  1.00 36.53 ? 1   HIS A CD2 1 
ATOM   14   C CE1 . HIS A 1 3   ? 5.133  26.915 74.802  1.00 36.08 ? 1   HIS A CE1 1 
ATOM   15   N NE2 . HIS A 1 3   ? 5.297  25.875 75.604  1.00 36.91 ? 1   HIS A NE2 1 
ATOM   16   N N   . MET A 1 4   ? 7.070  24.467 69.278  1.00 29.92 ? 2   MET A N   1 
ATOM   17   C CA  . MET A 1 4   ? 8.024  24.123 68.237  1.00 30.13 ? 2   MET A CA  1 
ATOM   18   C C   . MET A 1 4   ? 9.387  24.744 68.609  1.00 26.97 ? 2   MET A C   1 
ATOM   19   O O   . MET A 1 4   ? 9.467  25.913 69.000  1.00 26.33 ? 2   MET A O   1 
ATOM   20   C CB  . MET A 1 4   ? 7.492  24.633 66.881  1.00 30.12 ? 2   MET A CB  1 
ATOM   21   C CG  . MET A 1 4   ? 6.035  24.131 66.639  1.00 33.29 ? 2   MET A CG  1 
ATOM   22   S SD  . MET A 1 4   ? 5.074  24.619 65.172  1.00 37.48 ? 2   MET A SD  1 
ATOM   23   C CE  . MET A 1 4   ? 3.977  25.845 65.889  1.00 37.64 ? 2   MET A CE  1 
ATOM   24   N N   . VAL A 1 5   ? 10.441 23.944 68.506  1.00 24.12 ? 3   VAL A N   1 
ATOM   25   C CA  . VAL A 1 5   ? 11.800 24.380 68.828  1.00 22.39 ? 3   VAL A CA  1 
ATOM   26   C C   . VAL A 1 5   ? 12.356 25.335 67.738  1.00 21.37 ? 3   VAL A C   1 
ATOM   27   O O   . VAL A 1 5   ? 13.079 26.289 68.049  1.00 20.90 ? 3   VAL A O   1 
ATOM   28   C CB  . VAL A 1 5   ? 12.742 23.173 69.011  1.00 21.39 ? 3   VAL A CB  1 
ATOM   29   C CG1 . VAL A 1 5   ? 14.178 23.609 69.218  1.00 21.90 ? 3   VAL A CG1 1 
ATOM   30   C CG2 . VAL A 1 5   ? 12.269 22.230 70.167  1.00 22.38 ? 3   VAL A CG2 1 
ATOM   31   N N   . ASN A 1 6   ? 11.976 25.096 66.479  1.00 21.28 ? 4   ASN A N   1 
ATOM   32   C CA  . ASN A 1 6   ? 12.512 25.873 65.361  1.00 21.23 ? 4   ASN A CA  1 
ATOM   33   C C   . ASN A 1 6   ? 12.455 27.381 65.586  1.00 20.30 ? 4   ASN A C   1 
ATOM   34   O O   . ASN A 1 6   ? 11.387 27.926 65.872  1.00 19.24 ? 4   ASN A O   1 
ATOM   35   C CB  . ASN A 1 6   ? 11.774 25.570 64.058  1.00 22.06 ? 4   ASN A CB  1 
ATOM   36   C CG  . ASN A 1 6   ? 12.438 26.255 62.870  1.00 24.64 ? 4   ASN A CG  1 
ATOM   37   O OD1 . ASN A 1 6   ? 12.062 27.367 62.477  1.00 31.83 ? 4   ASN A OD1 1 
ATOM   38   N ND2 . ASN A 1 6   ? 13.476 25.633 62.347  1.00 29.30 ? 4   ASN A ND2 1 
ATOM   39   N N   . GLY A 1 7   ? 13.601 28.038 65.419  1.00 20.37 ? 5   GLY A N   1 
ATOM   40   C CA  . GLY A 1 7   ? 13.673 29.475 65.526  1.00 18.71 ? 5   GLY A CA  1 
ATOM   41   C C   . GLY A 1 7   ? 13.864 30.010 66.940  1.00 18.32 ? 5   GLY A C   1 
ATOM   42   O O   . GLY A 1 7   ? 14.152 31.170 67.094  1.00 18.93 ? 5   GLY A O   1 
ATOM   43   N N   . LYS A 1 8   ? 13.718 29.163 67.967  1.00 17.14 ? 6   LYS A N   1 
ATOM   44   C CA  . LYS A 1 8   ? 13.982 29.603 69.343  1.00 15.88 ? 6   LYS A CA  1 
ATOM   45   C C   . LYS A 1 8   ? 15.479 29.827 69.561  1.00 14.77 ? 6   LYS A C   1 
ATOM   46   O O   . LYS A 1 8   ? 16.318 29.154 68.926  1.00 15.08 ? 6   LYS A O   1 
ATOM   47   C CB  . LYS A 1 8   ? 13.454 28.609 70.358  1.00 16.38 ? 6   LYS A CB  1 
ATOM   48   C CG  . LYS A 1 8   ? 11.906 28.567 70.354  1.00 19.15 ? 6   LYS A CG  1 
ATOM   49   C CD  . LYS A 1 8   ? 11.281 27.802 71.490  1.00 24.18 ? 6   LYS A CD  1 
ATOM   50   C CE  . LYS A 1 8   ? 9.758  28.050 71.454  1.00 28.60 ? 6   LYS A CE  1 
ATOM   51   N NZ  . LYS A 1 8   ? 9.073  27.468 72.636  1.00 34.54 ? 6   LYS A NZ  1 
ATOM   52   N N   . VAL A 1 9   ? 15.808 30.683 70.521  1.00 13.90 ? 7   VAL A N   1 
ATOM   53   C CA  . VAL A 1 9   ? 17.197 30.931 70.855  1.00 12.39 ? 7   VAL A CA  1 
ATOM   54   C C   . VAL A 1 9   ? 17.541 30.273 72.204  1.00 12.44 ? 7   VAL A C   1 
ATOM   55   O O   . VAL A 1 9   ? 16.843 30.548 73.209  1.00 12.90 ? 7   VAL A O   1 
ATOM   56   C CB  . VAL A 1 9   ? 17.482 32.455 70.905  1.00 13.50 ? 7   VAL A CB  1 
ATOM   57   C CG1 . VAL A 1 9   ? 18.858 32.710 71.457  1.00 12.88 ? 7   VAL A CG1 1 
ATOM   58   C CG2 . VAL A 1 9   ? 17.330 33.062 69.477  1.00 14.64 ? 7   VAL A CG2 1 
ATOM   59   N N   . ALA A 1 10  ? 18.563 29.413 72.187  1.00 11.55 ? 8   ALA A N   1 
ATOM   60   C CA  . ALA A 1 10  ? 18.976 28.656 73.396  1.00 12.05 ? 8   ALA A CA  1 
ATOM   61   C C   . ALA A 1 10  ? 20.349 29.138 73.852  1.00 12.08 ? 8   ALA A C   1 
ATOM   62   O O   . ALA A 1 10  ? 21.233 29.347 73.026  1.00 13.48 ? 8   ALA A O   1 
ATOM   63   C CB  . ALA A 1 10  ? 19.000 27.159 73.113  1.00 11.75 ? 8   ALA A CB  1 
ATOM   64   N N   . LEU A 1 11  ? 20.538 29.294 75.157  1.00 10.33 ? 9   LEU A N   1 
ATOM   65   C CA  . LEU A 1 11  ? 21.871 29.537 75.733  1.00 10.48 ? 9   LEU A CA  1 
ATOM   66   C C   . LEU A 1 11  ? 22.215 28.272 76.555  1.00 11.03 ? 9   LEU A C   1 
ATOM   67   O O   . LEU A 1 11  ? 21.463 27.954 77.507  1.00 10.63 ? 9   LEU A O   1 
ATOM   68   C CB  . LEU A 1 11  ? 21.839 30.805 76.623  1.00 10.99 ? 9   LEU A CB  1 
ATOM   69   C CG  . LEU A 1 11  ? 23.161 31.310 77.247  1.00 10.79 ? 9   LEU A CG  1 
ATOM   70   C CD1 . LEU A 1 11  ? 22.914 32.697 77.927  1.00 11.04 ? 9   LEU A CD1 1 
ATOM   71   C CD2 . LEU A 1 11  ? 23.811 30.354 78.268  1.00 11.16 ? 9   LEU A CD2 1 
ATOM   72   N N   . VAL A 1 12  ? 23.246 27.539 76.147  1.00 10.46 ? 10  VAL A N   1 
ATOM   73   C CA  . VAL A 1 12  ? 23.628 26.285 76.808  1.00 10.63 ? 10  VAL A CA  1 
ATOM   74   C C   . VAL A 1 12  ? 24.950 26.462 77.514  1.00 11.12 ? 10  VAL A C   1 
ATOM   75   O O   . VAL A 1 12  ? 25.967 26.684 76.855  1.00 11.08 ? 10  VAL A O   1 
ATOM   76   C CB  . VAL A 1 12  ? 23.700 25.065 75.804  1.00 10.59 ? 10  VAL A CB  1 
ATOM   77   C CG1 . VAL A 1 12  ? 24.187 23.800 76.548  1.00 12.39 ? 10  VAL A CG1 1 
ATOM   78   C CG2 . VAL A 1 12  ? 22.309 24.855 75.096  1.00 10.18 ? 10  VAL A CG2 1 
ATOM   79   N N   . THR A 1 13  ? 24.979 26.359 78.846  1.00 10.18 ? 11  THR A N   1 
ATOM   80   C CA  . THR A 1 13  ? 26.290 26.435 79.533  1.00 10.55 ? 11  THR A CA  1 
ATOM   81   C C   . THR A 1 13  ? 26.993 25.058 79.515  1.00 10.67 ? 11  THR A C   1 
ATOM   82   O O   . THR A 1 13  ? 26.321 23.998 79.521  1.00 10.87 ? 11  THR A O   1 
ATOM   83   C CB  . THR A 1 13  ? 26.182 26.956 81.002  1.00 10.33 ? 11  THR A CB  1 
ATOM   84   O OG1 . THR A 1 13  ? 25.568 25.941 81.834  1.00 9.45  ? 11  THR A OG1 1 
ATOM   85   C CG2 . THR A 1 13  ? 25.417 28.276 81.044  1.00 12.04 ? 11  THR A CG2 1 
ATOM   86   N N   . GLY A 1 14  ? 28.325 25.073 79.561  1.00 10.69 ? 12  GLY A N   1 
ATOM   87   C CA  . GLY A 1 14  ? 29.095 23.851 79.442  1.00 10.33 ? 12  GLY A CA  1 
ATOM   88   C C   . GLY A 1 14  ? 28.867 23.144 78.107  1.00 12.16 ? 12  GLY A C   1 
ATOM   89   O O   . GLY A 1 14  ? 28.885 21.902 78.034  1.00 11.77 ? 12  GLY A O   1 
ATOM   90   N N   . ALA A 1 15  ? 28.658 23.954 77.067  1.00 11.62 ? 13  ALA A N   1 
ATOM   91   C CA  . ALA A 1 15  ? 28.290 23.435 75.750  1.00 12.59 ? 13  ALA A CA  1 
ATOM   92   C C   . ALA A 1 15  ? 29.465 22.899 74.923  1.00 13.27 ? 13  ALA A C   1 
ATOM   93   O O   . ALA A 1 15  ? 29.233 22.324 73.845  1.00 12.99 ? 13  ALA A O   1 
ATOM   94   C CB  . ALA A 1 15  ? 27.512 24.544 74.934  1.00 12.81 ? 13  ALA A CB  1 
ATOM   95   N N   . ALA A 1 16  ? 30.701 23.099 75.366  1.00 12.94 ? 14  ALA A N   1 
ATOM   96   C CA  . ALA A 1 16  ? 31.856 22.694 74.526  1.00 13.63 ? 14  ALA A CA  1 
ATOM   97   C C   . ALA A 1 16  ? 31.994 21.204 74.348  1.00 14.28 ? 14  ALA A C   1 
ATOM   98   O O   . ALA A 1 16  ? 32.588 20.748 73.376  1.00 15.32 ? 14  ALA A O   1 
ATOM   99   C CB  . ALA A 1 16  ? 33.169 23.262 75.070  1.00 14.89 ? 14  ALA A CB  1 
ATOM   100  N N   . GLN A 1 17  ? 31.543 20.437 75.330  1.00 13.14 ? 15  GLN A N   1 
ATOM   101  C CA  . GLN A 1 17  ? 31.689 18.979 75.298  1.00 14.94 ? 15  GLN A CA  1 
ATOM   102  C C   . GLN A 1 17  ? 30.591 18.239 76.045  1.00 13.81 ? 15  GLN A C   1 
ATOM   103  O O   . GLN A 1 17  ? 29.724 18.866 76.659  1.00 13.57 ? 15  GLN A O   1 
ATOM   104  C CB  . GLN A 1 17  ? 33.032 18.540 75.845  1.00 16.68 ? 15  GLN A CB  1 
ATOM   105  C CG  . GLN A 1 17  ? 33.172 18.754 77.318  1.00 19.79 ? 15  GLN A CG  1 
ATOM   106  C CD  . GLN A 1 17  ? 34.603 18.501 77.782  1.00 27.08 ? 15  GLN A CD  1 
ATOM   107  O OE1 . GLN A 1 17  ? 35.552 19.074 77.229  1.00 26.82 ? 15  GLN A OE1 1 
ATOM   108  N NE2 . GLN A 1 17  ? 34.763 17.625 78.808  1.00 28.15 ? 15  GLN A NE2 1 
ATOM   109  N N   . GLY A 1 18  ? 30.663 16.900 75.974  1.00 13.65 ? 16  GLY A N   1 
ATOM   110  C CA  . GLY A 1 18  ? 29.823 16.015 76.819  1.00 14.09 ? 16  GLY A CA  1 
ATOM   111  C C   . GLY A 1 18  ? 28.348 16.327 76.588  1.00 13.50 ? 16  GLY A C   1 
ATOM   112  O O   . GLY A 1 18  ? 27.891 16.554 75.435  1.00 11.61 ? 16  GLY A O   1 
ATOM   113  N N   . ILE A 1 19  ? 27.562 16.351 77.670  1.00 12.57 ? 17  ILE A N   1 
ATOM   114  C CA  . ILE A 1 19  ? 26.093 16.469 77.518  1.00 11.03 ? 17  ILE A CA  1 
ATOM   115  C C   . ILE A 1 19  ? 25.709 17.839 76.899  1.00 10.61 ? 17  ILE A C   1 
ATOM   116  O O   . ILE A 1 19  ? 24.797 17.914 76.054  1.00 10.98 ? 17  ILE A O   1 
ATOM   117  C CB  . ILE A 1 19  ? 25.376 16.245 78.883  1.00 8.96  ? 17  ILE A CB  1 
ATOM   118  C CG1 . ILE A 1 19  ? 25.551 14.786 79.305  1.00 9.81  ? 17  ILE A CG1 1 
ATOM   119  C CG2 . ILE A 1 19  ? 23.903 16.658 78.816  1.00 12.17 ? 17  ILE A CG2 1 
ATOM   120  C CD1 . ILE A 1 19  ? 25.098 14.502 80.776  1.00 10.86 ? 17  ILE A CD1 1 
ATOM   121  N N   . GLY A 1 20  ? 26.426 18.899 77.322  1.00 11.19 ? 18  GLY A N   1 
ATOM   122  C CA  . GLY A 1 20  ? 26.185 20.256 76.815  1.00 11.18 ? 18  GLY A CA  1 
ATOM   123  C C   . GLY A 1 20  ? 26.297 20.289 75.291  1.00 12.10 ? 18  GLY A C   1 
ATOM   124  O O   . GLY A 1 20  ? 25.398 20.826 74.602  1.00 11.81 ? 18  GLY A O   1 
ATOM   125  N N   . ARG A 1 21  ? 27.334 19.628 74.773  1.00 10.81 ? 19  ARG A N   1 
ATOM   126  C CA  . ARG A 1 21  ? 27.534 19.627 73.319  1.00 13.10 ? 19  ARG A CA  1 
ATOM   127  C C   . ARG A 1 21  ? 26.403 18.812 72.636  1.00 12.87 ? 19  ARG A C   1 
ATOM   128  O O   . ARG A 1 21  ? 25.872 19.219 71.593  1.00 12.66 ? 19  ARG A O   1 
ATOM   129  C CB  . ARG A 1 21  ? 28.908 19.080 72.969  1.00 12.52 ? 19  ARG A CB  1 
ATOM   130  C CG  . ARG A 1 21  ? 29.180 19.241 71.413  1.00 14.25 ? 19  ARG A CG  1 
ATOM   131  C CD  . ARG A 1 21  ? 30.489 18.683 70.976  1.00 16.68 ? 19  ARG A CD  1 
ATOM   132  N NE  . ARG A 1 21  ? 30.571 18.728 69.495  1.00 19.49 ? 19  ARG A NE  1 
ATOM   133  C CZ  . ARG A 1 21  ? 31.720 18.863 68.816  1.00 22.35 ? 19  ARG A CZ  1 
ATOM   134  N NH1 . ARG A 1 21  ? 32.869 19.002 69.456  1.00 23.17 ? 19  ARG A NH1 1 
ATOM   135  N NH2 . ARG A 1 21  ? 31.717 18.907 67.483  1.00 23.76 ? 19  ARG A NH2 1 
ATOM   136  N N   . ALA A 1 22  ? 26.036 17.669 73.223  1.00 12.43 ? 20  ALA A N   1 
ATOM   137  C CA  . ALA A 1 22  ? 24.855 16.941 72.745  1.00 11.73 ? 20  ALA A CA  1 
ATOM   138  C C   . ALA A 1 22  ? 23.575 17.805 72.687  1.00 12.28 ? 20  ALA A C   1 
ATOM   139  O O   . ALA A 1 22  ? 22.780 17.699 71.739  1.00 11.88 ? 20  ALA A O   1 
ATOM   140  C CB  . ALA A 1 22  ? 24.597 15.667 73.586  1.00 11.75 ? 20  ALA A CB  1 
ATOM   141  N N   . PHE A 1 23  ? 23.349 18.607 73.746  1.00 11.51 ? 21  PHE A N   1 
ATOM   142  C CA  . PHE A 1 23  ? 22.244 19.529 73.787  1.00 12.44 ? 21  PHE A CA  1 
ATOM   143  C C   . PHE A 1 23  ? 22.306 20.518 72.602  1.00 11.83 ? 21  PHE A C   1 
ATOM   144  O O   . PHE A 1 23  ? 21.295 20.665 71.853  1.00 12.20 ? 21  PHE A O   1 
ATOM   145  C CB  . PHE A 1 23  ? 22.246 20.325 75.089  1.00 11.52 ? 21  PHE A CB  1 
ATOM   146  C CG  . PHE A 1 23  ? 21.822 19.522 76.310  1.00 11.09 ? 21  PHE A CG  1 
ATOM   147  C CD1 . PHE A 1 23  ? 21.151 18.301 76.182  1.00 12.74 ? 21  PHE A CD1 1 
ATOM   148  C CD2 . PHE A 1 23  ? 22.091 20.020 77.588  1.00 11.69 ? 21  PHE A CD2 1 
ATOM   149  C CE1 . PHE A 1 23  ? 20.704 17.578 77.339  1.00 11.44 ? 21  PHE A CE1 1 
ATOM   150  C CE2 . PHE A 1 23  ? 21.688 19.325 78.728  1.00 9.71  ? 21  PHE A CE2 1 
ATOM   151  C CZ  . PHE A 1 23  ? 21.009 18.082 78.603  1.00 10.20 ? 21  PHE A CZ  1 
ATOM   152  N N   . ALA A 1 24  ? 23.478 21.138 72.416  1.00 11.73 ? 22  ALA A N   1 
ATOM   153  C CA  . ALA A 1 24  ? 23.671 22.133 71.341  1.00 12.11 ? 22  ALA A CA  1 
ATOM   154  C C   . ALA A 1 24  ? 23.322 21.437 69.987  1.00 13.58 ? 22  ALA A C   1 
ATOM   155  O O   . ALA A 1 24  ? 22.537 21.994 69.178  1.00 12.51 ? 22  ALA A O   1 
ATOM   156  C CB  . ALA A 1 24  ? 25.089 22.671 71.365  1.00 13.78 ? 22  ALA A CB  1 
ATOM   157  N N   . GLU A 1 25  ? 23.853 20.225 69.784  1.00 13.83 ? 23  GLU A N   1 
ATOM   158  C CA  . GLU A 1 25  ? 23.662 19.499 68.487  1.00 15.07 ? 23  GLU A CA  1 
ATOM   159  C C   . GLU A 1 25  ? 22.172 19.193 68.259  1.00 14.13 ? 23  GLU A C   1 
ATOM   160  O O   . GLU A 1 25  ? 21.616 19.446 67.159  1.00 14.92 ? 23  GLU A O   1 
ATOM   161  C CB  . GLU A 1 25  ? 24.525 18.235 68.426  1.00 14.78 ? 23  GLU A CB  1 
ATOM   162  C CG  . GLU A 1 25  ? 26.031 18.507 68.405  1.00 16.04 ? 23  GLU A CG  1 
ATOM   163  C CD  . GLU A 1 25  ? 26.887 17.262 68.551  1.00 19.79 ? 23  GLU A CD  1 
ATOM   164  O OE1 . GLU A 1 25  ? 26.341 16.209 68.975  1.00 26.57 ? 23  GLU A OE1 1 
ATOM   165  O OE2 . GLU A 1 25  ? 28.111 17.375 68.312  1.00 22.92 ? 23  GLU A OE2 1 
ATOM   166  N N   . ALA A 1 26  ? 21.495 18.687 69.296  1.00 12.93 ? 24  ALA A N   1 
ATOM   167  C CA  . ALA A 1 26  ? 20.069 18.345 69.219  1.00 13.98 ? 24  ALA A CA  1 
ATOM   168  C C   . ALA A 1 26  ? 19.246 19.605 68.920  1.00 13.93 ? 24  ALA A C   1 
ATOM   169  O O   . ALA A 1 26  ? 18.327 19.572 68.079  1.00 16.13 ? 24  ALA A O   1 
ATOM   170  C CB  . ALA A 1 26  ? 19.581 17.713 70.505  1.00 13.74 ? 24  ALA A CB  1 
ATOM   171  N N   . LEU A 1 27  ? 19.562 20.690 69.624  1.00 13.36 ? 25  LEU A N   1 
ATOM   172  C CA  . LEU A 1 27  ? 18.843 21.960 69.448  1.00 12.86 ? 25  LEU A CA  1 
ATOM   173  C C   . LEU A 1 27  ? 19.008 22.468 67.993  1.00 13.06 ? 25  LEU A C   1 
ATOM   174  O O   . LEU A 1 27  ? 18.029 22.844 67.354  1.00 13.86 ? 25  LEU A O   1 
ATOM   175  C CB  . LEU A 1 27  ? 19.291 23.000 70.471  1.00 12.87 ? 25  LEU A CB  1 
ATOM   176  C CG  . LEU A 1 27  ? 18.799 22.718 71.907  1.00 11.21 ? 25  LEU A CG  1 
ATOM   177  C CD1 . LEU A 1 27  ? 19.713 23.460 72.971  1.00 12.46 ? 25  LEU A CD1 1 
ATOM   178  C CD2 . LEU A 1 27  ? 17.287 23.031 72.057  1.00 16.83 ? 25  LEU A CD2 1 
ATOM   179  N N   . LEU A 1 28  ? 20.241 22.406 67.504  1.00 13.17 ? 26  LEU A N   1 
ATOM   180  C CA  . LEU A 1 28  ? 20.573 22.872 66.137  1.00 13.53 ? 26  LEU A CA  1 
ATOM   181  C C   . LEU A 1 28  ? 19.812 22.038 65.103  1.00 14.21 ? 26  LEU A C   1 
ATOM   182  O O   . LEU A 1 28  ? 19.228 22.585 64.166  1.00 13.58 ? 26  LEU A O   1 
ATOM   183  C CB  . LEU A 1 28  ? 22.080 22.883 65.886  1.00 12.59 ? 26  LEU A CB  1 
ATOM   184  C CG  . LEU A 1 28  ? 22.861 23.969 66.640  1.00 13.58 ? 26  LEU A CG  1 
ATOM   185  C CD1 . LEU A 1 28  ? 24.345 23.639 66.710  1.00 15.27 ? 26  LEU A CD1 1 
ATOM   186  C CD2 . LEU A 1 28  ? 22.556 25.397 65.996  1.00 13.80 ? 26  LEU A CD2 1 
ATOM   187  N N   . LEU A 1 29  ? 19.784 20.722 65.291  1.00 15.28 ? 27  LEU A N   1 
ATOM   188  C CA  . LEU A 1 29  ? 19.050 19.866 64.369  1.00 18.15 ? 27  LEU A CA  1 
ATOM   189  C C   . LEU A 1 29  ? 17.543 20.223 64.343  1.00 18.00 ? 27  LEU A C   1 
ATOM   190  O O   . LEU A 1 29  ? 16.876 20.127 63.290  1.00 19.21 ? 27  LEU A O   1 
ATOM   191  C CB  . LEU A 1 29  ? 19.277 18.396 64.750  1.00 18.17 ? 27  LEU A CB  1 
ATOM   192  C CG  . LEU A 1 29  ? 19.064 17.385 63.618  1.00 23.01 ? 27  LEU A CG  1 
ATOM   193  C CD1 . LEU A 1 29  ? 19.948 17.745 62.406  1.00 25.64 ? 27  LEU A CD1 1 
ATOM   194  C CD2 . LEU A 1 29  ? 19.389 15.980 64.110  1.00 21.21 ? 27  LEU A CD2 1 
ATOM   195  N N   . LYS A 1 30  ? 17.018 20.647 65.494  1.00 17.15 ? 28  LYS A N   1 
ATOM   196  C CA  . LYS A 1 30  ? 15.613 21.042 65.634  1.00 18.64 ? 28  LYS A CA  1 
ATOM   197  C C   . LYS A 1 30  ? 15.321 22.487 65.182  1.00 19.21 ? 28  LYS A C   1 
ATOM   198  O O   . LYS A 1 30  ? 14.171 22.960 65.276  1.00 21.35 ? 28  LYS A O   1 
ATOM   199  C CB  . LYS A 1 30  ? 15.154 20.843 67.081  1.00 18.73 ? 28  LYS A CB  1 
ATOM   200  C CG  . LYS A 1 30  ? 15.087 19.368 67.503  1.00 20.04 ? 28  LYS A CG  1 
ATOM   201  C CD  . LYS A 1 30  ? 13.884 18.682 66.879  1.00 24.70 ? 28  LYS A CD  1 
ATOM   202  C CE  . LYS A 1 30  ? 12.764 18.667 67.866  1.00 26.45 ? 28  LYS A CE  1 
ATOM   203  N NZ  . LYS A 1 30  ? 11.646 17.719 67.542  1.00 26.61 ? 28  LYS A NZ  1 
ATOM   204  N N   . GLY A 1 31  ? 16.345 23.179 64.691  1.00 17.85 ? 29  GLY A N   1 
ATOM   205  C CA  . GLY A 1 31  ? 16.150 24.517 64.110  1.00 18.55 ? 29  GLY A CA  1 
ATOM   206  C C   . GLY A 1 31  ? 16.365 25.695 65.060  1.00 17.83 ? 29  GLY A C   1 
ATOM   207  O O   . GLY A 1 31  ? 16.071 26.852 64.717  1.00 17.09 ? 29  GLY A O   1 
ATOM   208  N N   . ALA A 1 32  ? 16.836 25.400 66.282  1.00 16.60 ? 30  ALA A N   1 
ATOM   209  C CA  . ALA A 1 32  ? 17.131 26.451 67.203  1.00 16.43 ? 30  ALA A CA  1 
ATOM   210  C C   . ALA A 1 32  ? 18.449 27.149 66.826  1.00 16.03 ? 30  ALA A C   1 
ATOM   211  O O   . ALA A 1 32  ? 19.305 26.588 66.095  1.00 16.48 ? 30  ALA A O   1 
ATOM   212  C CB  . ALA A 1 32  ? 17.161 25.925 68.704  1.00 17.78 ? 30  ALA A CB  1 
ATOM   213  N N   . LYS A 1 33  ? 18.596 28.375 67.314  1.00 14.83 ? 31  LYS A N   1 
ATOM   214  C CA  . LYS A 1 33  ? 19.897 29.052 67.329  1.00 14.13 ? 31  LYS A CA  1 
ATOM   215  C C   . LYS A 1 33  ? 20.471 28.841 68.713  1.00 15.13 ? 31  LYS A C   1 
ATOM   216  O O   . LYS A 1 33  ? 19.723 28.878 69.693  1.00 15.41 ? 31  LYS A O   1 
ATOM   217  C CB  . LYS A 1 33  ? 19.735 30.520 67.101  1.00 16.47 ? 31  LYS A CB  1 
ATOM   218  C CG  . LYS A 1 33  ? 19.031 30.826 65.779  1.00 18.04 ? 31  LYS A CG  1 
ATOM   219  C CD  . LYS A 1 33  ? 18.732 32.296 65.699  1.00 26.75 ? 31  LYS A CD  1 
ATOM   220  C CE  . LYS A 1 33  ? 17.509 32.521 64.845  1.00 29.83 ? 31  LYS A CE  1 
ATOM   221  N NZ  . LYS A 1 33  ? 17.665 31.871 63.522  1.00 30.84 ? 31  LYS A NZ  1 
ATOM   222  N N   . VAL A 1 34  ? 21.771 28.656 68.798  1.00 12.98 ? 32  VAL A N   1 
ATOM   223  C CA  . VAL A 1 34  ? 22.364 28.235 70.087  1.00 12.82 ? 32  VAL A CA  1 
ATOM   224  C C   . VAL A 1 34  ? 23.568 29.086 70.435  1.00 13.08 ? 32  VAL A C   1 
ATOM   225  O O   . VAL A 1 34  ? 24.548 29.165 69.639  1.00 13.61 ? 32  VAL A O   1 
ATOM   226  C CB  . VAL A 1 34  ? 22.771 26.725 70.085  1.00 12.32 ? 32  VAL A CB  1 
ATOM   227  C CG1 . VAL A 1 34  ? 23.334 26.338 71.458  1.00 12.77 ? 32  VAL A CG1 1 
ATOM   228  C CG2 . VAL A 1 34  ? 21.583 25.806 69.778  1.00 11.55 ? 32  VAL A CG2 1 
ATOM   229  N N   . ALA A 1 35  ? 23.545 29.689 71.631  1.00 11.96 ? 33  ALA A N   1 
ATOM   230  C CA  . ALA A 1 35  ? 24.758 30.282 72.195  1.00 12.79 ? 33  ALA A CA  1 
ATOM   231  C C   . ALA A 1 35  ? 25.440 29.197 73.049  1.00 13.36 ? 33  ALA A C   1 
ATOM   232  O O   . ALA A 1 35  ? 24.895 28.720 74.063  1.00 12.54 ? 33  ALA A O   1 
ATOM   233  C CB  . ALA A 1 35  ? 24.453 31.530 73.026  1.00 13.19 ? 33  ALA A CB  1 
ATOM   234  N N   . LEU A 1 36  ? 26.608 28.777 72.591  1.00 11.63 ? 34  LEU A N   1 
ATOM   235  C CA  . LEU A 1 36  ? 27.433 27.785 73.299  1.00 13.15 ? 34  LEU A CA  1 
ATOM   236  C C   . LEU A 1 36  ? 28.261 28.557 74.311  1.00 12.88 ? 34  LEU A C   1 
ATOM   237  O O   . LEU A 1 36  ? 29.025 29.444 73.931  1.00 13.61 ? 34  LEU A O   1 
ATOM   238  C CB  . LEU A 1 36  ? 28.332 27.054 72.312  1.00 13.62 ? 34  LEU A CB  1 
ATOM   239  C CG  . LEU A 1 36  ? 27.554 26.048 71.451  1.00 16.60 ? 34  LEU A CG  1 
ATOM   240  C CD1 . LEU A 1 36  ? 27.090 26.737 70.177  1.00 20.57 ? 34  LEU A CD1 1 
ATOM   241  C CD2 . LEU A 1 36  ? 28.416 24.816 71.146  1.00 20.67 ? 34  LEU A CD2 1 
ATOM   242  N N   . VAL A 1 37  ? 28.119 28.229 75.597  1.00 11.75 ? 35  VAL A N   1 
ATOM   243  C CA  . VAL A 1 37  ? 28.824 28.972 76.632  1.00 11.65 ? 35  VAL A CA  1 
ATOM   244  C C   . VAL A 1 37  ? 29.717 28.013 77.442  1.00 11.59 ? 35  VAL A C   1 
ATOM   245  O O   . VAL A 1 37  ? 29.235 26.996 77.914  1.00 11.48 ? 35  VAL A O   1 
ATOM   246  C CB  . VAL A 1 37  ? 27.831 29.768 77.562  1.00 12.40 ? 35  VAL A CB  1 
ATOM   247  C CG1 . VAL A 1 37  ? 28.563 30.360 78.776  1.00 13.40 ? 35  VAL A CG1 1 
ATOM   248  C CG2 . VAL A 1 37  ? 27.091 30.868 76.759  1.00 13.10 ? 35  VAL A CG2 1 
ATOM   249  N N   . ASP A 1 38  ? 30.996 28.322 77.625  1.00 10.95 ? 36  ASP A N   1 
ATOM   250  C CA  . ASP A 1 38  ? 31.912 27.350 78.292  1.00 12.05 ? 36  ASP A CA  1 
ATOM   251  C C   . ASP A 1 38  ? 33.151 28.083 78.754  1.00 12.71 ? 36  ASP A C   1 
ATOM   252  O O   . ASP A 1 38  ? 33.526 29.110 78.162  1.00 13.56 ? 36  ASP A O   1 
ATOM   253  C CB  . ASP A 1 38  ? 32.327 26.212 77.329  1.00 11.37 ? 36  ASP A CB  1 
ATOM   254  C CG  . ASP A 1 38  ? 32.677 24.900 78.058  1.00 12.14 ? 36  ASP A CG  1 
ATOM   255  O OD1 . ASP A 1 38  ? 33.797 24.776 78.630  1.00 14.35 ? 36  ASP A OD1 1 
ATOM   256  O OD2 . ASP A 1 38  ? 31.805 24.005 78.050  1.00 13.53 ? 36  ASP A OD2 1 
ATOM   257  N N   . TRP A 1 39  ? 33.799 27.579 79.795  1.00 14.50 ? 37  TRP A N   1 
ATOM   258  C CA  . TRP A 1 39  ? 35.026 28.258 80.210  1.00 16.00 ? 37  TRP A CA  1 
ATOM   259  C C   . TRP A 1 39  ? 36.258 27.767 79.452  1.00 16.06 ? 37  TRP A C   1 
ATOM   260  O O   . TRP A 1 39  ? 37.330 28.396 79.509  1.00 18.15 ? 37  TRP A O   1 
ATOM   261  C CB  . TRP A 1 39  ? 35.178 28.237 81.730  1.00 17.85 ? 37  TRP A CB  1 
ATOM   262  C CG  . TRP A 1 39  ? 35.425 26.927 82.384  1.00 18.43 ? 37  TRP A CG  1 
ATOM   263  C CD1 . TRP A 1 39  ? 35.300 25.648 81.854  1.00 19.07 ? 37  TRP A CD1 1 
ATOM   264  C CD2 . TRP A 1 39  ? 35.796 26.759 83.764  1.00 20.74 ? 37  TRP A CD2 1 
ATOM   265  N NE1 . TRP A 1 39  ? 35.588 24.708 82.841  1.00 19.46 ? 37  TRP A NE1 1 
ATOM   266  C CE2 . TRP A 1 39  ? 35.891 25.370 84.013  1.00 19.45 ? 37  TRP A CE2 1 
ATOM   267  C CE3 . TRP A 1 39  ? 36.059 27.665 84.813  1.00 23.70 ? 37  TRP A CE3 1 
ATOM   268  C CZ2 . TRP A 1 39  ? 36.254 24.850 85.289  1.00 20.95 ? 37  TRP A CZ2 1 
ATOM   269  C CZ3 . TRP A 1 39  ? 36.428 27.141 86.089  1.00 20.40 ? 37  TRP A CZ3 1 
ATOM   270  C CH2 . TRP A 1 39  ? 36.535 25.752 86.288  1.00 18.63 ? 37  TRP A CH2 1 
ATOM   271  N N   . ASN A 1 40  ? 36.085 26.655 78.731  1.00 16.31 ? 38  ASN A N   1 
ATOM   272  C CA  . ASN A 1 40  ? 37.162 26.054 77.953  1.00 16.66 ? 38  ASN A CA  1 
ATOM   273  C C   . ASN A 1 40  ? 37.199 26.734 76.585  1.00 16.15 ? 38  ASN A C   1 
ATOM   274  O O   . ASN A 1 40  ? 36.420 26.398 75.694  1.00 13.92 ? 38  ASN A O   1 
ATOM   275  C CB  . ASN A 1 40  ? 36.984 24.556 77.807  1.00 15.98 ? 38  ASN A CB  1 
ATOM   276  C CG  . ASN A 1 40  ? 38.218 23.871 77.203  1.00 19.26 ? 38  ASN A CG  1 
ATOM   277  O OD1 . ASN A 1 40  ? 38.939 24.463 76.391  1.00 18.15 ? 38  ASN A OD1 1 
ATOM   278  N ND2 . ASN A 1 40  ? 38.436 22.611 77.569  1.00 18.13 ? 38  ASN A ND2 1 
ATOM   279  N N   . LEU A 1 41  ? 38.099 27.708 76.456  1.00 18.02 ? 39  LEU A N   1 
ATOM   280  C CA  . LEU A 1 41  ? 38.205 28.502 75.226  1.00 18.91 ? 39  LEU A CA  1 
ATOM   281  C C   . LEU A 1 41  ? 38.510 27.628 73.985  1.00 17.93 ? 39  LEU A C   1 
ATOM   282  O O   . LEU A 1 41  ? 37.794 27.684 72.975  1.00 17.11 ? 39  LEU A O   1 
ATOM   283  C CB  . LEU A 1 41  ? 39.288 29.568 75.385  1.00 19.94 ? 39  LEU A CB  1 
ATOM   284  C CG  . LEU A 1 41  ? 39.566 30.363 74.100  1.00 21.42 ? 39  LEU A CG  1 
ATOM   285  C CD1 . LEU A 1 41  ? 38.361 31.119 73.607  1.00 22.93 ? 39  LEU A CD1 1 
ATOM   286  C CD2 . LEU A 1 41  ? 40.842 31.255 74.277  1.00 20.39 ? 39  LEU A CD2 1 
ATOM   287  N N   . GLU A 1 42  ? 39.562 26.826 74.070  1.00 17.60 ? 40  GLU A N   1 
ATOM   288  C CA  . GLU A 1 42  ? 39.946 25.973 72.927  1.00 18.65 ? 40  GLU A CA  1 
ATOM   289  C C   . GLU A 1 42  ? 38.850 24.992 72.492  1.00 17.32 ? 40  GLU A C   1 
ATOM   290  O O   . GLU A 1 42  ? 38.504 24.918 71.287  1.00 17.24 ? 40  GLU A O   1 
ATOM   291  C CB  . GLU A 1 42  ? 41.249 25.238 73.230  1.00 19.35 ? 40  GLU A CB  1 
ATOM   292  C CG  . GLU A 1 42  ? 41.683 24.290 72.118  1.00 24.84 ? 40  GLU A CG  1 
ATOM   293  C CD  . GLU A 1 42  ? 43.136 23.864 72.263  1.00 31.70 ? 40  GLU A CD  1 
ATOM   294  O OE1 . GLU A 1 42  ? 43.896 24.051 71.292  1.00 35.16 ? 40  GLU A OE1 1 
ATOM   295  O OE2 . GLU A 1 42  ? 43.507 23.356 73.344  1.00 34.45 ? 40  GLU A OE2 1 
ATOM   296  N N   . ALA A 1 43  ? 38.295 24.240 73.451  1.00 16.60 ? 41  ALA A N   1 
ATOM   297  C CA  . ALA A 1 43  ? 37.253 23.249 73.136  1.00 16.73 ? 41  ALA A CA  1 
ATOM   298  C C   . ALA A 1 43  ? 36.012 23.978 72.618  1.00 15.84 ? 41  ALA A C   1 
ATOM   299  O O   . ALA A 1 43  ? 35.358 23.501 71.706  1.00 14.78 ? 41  ALA A O   1 
ATOM   300  C CB  . ALA A 1 43  ? 36.901 22.412 74.379  1.00 17.39 ? 41  ALA A CB  1 
ATOM   301  N N   . GLY A 1 44  ? 35.680 25.138 73.201  1.00 14.65 ? 42  GLY A N   1 
ATOM   302  C CA  . GLY A 1 44  ? 34.542 25.917 72.717  1.00 16.19 ? 42  GLY A CA  1 
ATOM   303  C C   . GLY A 1 44  ? 34.654 26.379 71.268  1.00 15.70 ? 42  GLY A C   1 
ATOM   304  O O   . GLY A 1 44  ? 33.704 26.211 70.481  1.00 15.53 ? 42  GLY A O   1 
ATOM   305  N N   . VAL A 1 45  ? 35.831 26.903 70.904  1.00 15.78 ? 43  VAL A N   1 
ATOM   306  C CA  . VAL A 1 45  ? 36.068 27.445 69.546  1.00 16.87 ? 43  VAL A CA  1 
ATOM   307  C C   . VAL A 1 45  ? 36.068 26.265 68.539  1.00 16.08 ? 43  VAL A C   1 
ATOM   308  O O   . VAL A 1 45  ? 35.445 26.348 67.437  1.00 16.07 ? 43  VAL A O   1 
ATOM   309  C CB  . VAL A 1 45  ? 37.387 28.310 69.477  1.00 17.46 ? 43  VAL A CB  1 
ATOM   310  C CG1 . VAL A 1 45  ? 37.827 28.566 68.009  1.00 18.44 ? 43  VAL A CG1 1 
ATOM   311  C CG2 . VAL A 1 45  ? 37.233 29.657 70.275  1.00 17.69 ? 43  VAL A CG2 1 
ATOM   312  N N   . GLN A 1 46  ? 36.717 25.168 68.939  1.00 15.20 ? 44  GLN A N   1 
ATOM   313  C CA  . GLN A 1 46  ? 36.747 23.963 68.086  1.00 15.73 ? 44  GLN A CA  1 
ATOM   314  C C   . GLN A 1 46  ? 35.342 23.386 67.886  1.00 16.20 ? 44  GLN A C   1 
ATOM   315  O O   . GLN A 1 46  ? 34.986 22.964 66.774  1.00 15.94 ? 44  GLN A O   1 
ATOM   316  C CB  . GLN A 1 46  ? 37.692 22.918 68.664  1.00 15.44 ? 44  GLN A CB  1 
ATOM   317  C CG  . GLN A 1 46  ? 39.165 23.345 68.663  1.00 17.07 ? 44  GLN A CG  1 
ATOM   318  C CD  . GLN A 1 46  ? 40.041 22.229 69.267  1.00 16.37 ? 44  GLN A CD  1 
ATOM   319  O OE1 . GLN A 1 46  ? 39.607 21.529 70.179  1.00 22.51 ? 44  GLN A OE1 1 
ATOM   320  N NE2 . GLN A 1 46  ? 41.252 22.091 68.786  1.00 18.44 ? 44  GLN A NE2 1 
ATOM   321  N N   . CYS A 1 47  ? 34.556 23.354 68.961  1.00 15.53 ? 45  CYS A N   1 
ATOM   322  C CA  . CYS A 1 47  ? 33.161 22.904 68.885  1.00 15.80 ? 45  CYS A CA  1 
ATOM   323  C C   . CYS A 1 47  ? 32.335 23.705 67.861  1.00 15.63 ? 45  CYS A C   1 
ATOM   324  O O   . CYS A 1 47  ? 31.711 23.104 66.977  1.00 16.65 ? 45  CYS A O   1 
ATOM   325  C CB  . CYS A 1 47  ? 32.504 22.920 70.270  1.00 16.06 ? 45  CYS A CB  1 
ATOM   326  S SG  . CYS A 1 47  ? 30.765 22.478 70.196  1.00 19.02 ? 45  CYS A SG  1 
ATOM   327  N N   . LYS A 1 48  ? 32.350 25.044 67.966  1.00 15.00 ? 46  LYS A N   1 
ATOM   328  C CA  . LYS A 1 48  ? 31.627 25.896 66.994  1.00 16.73 ? 46  LYS A CA  1 
ATOM   329  C C   . LYS A 1 48  ? 32.140 25.613 65.561  1.00 16.93 ? 46  LYS A C   1 
ATOM   330  O O   . LYS A 1 48  ? 31.335 25.424 64.645  1.00 15.69 ? 46  LYS A O   1 
ATOM   331  C CB  . LYS A 1 48  ? 31.743 27.395 67.334  1.00 18.28 ? 46  LYS A CB  1 
ATOM   332  C CG  . LYS A 1 48  ? 31.027 28.282 66.297  1.00 18.17 ? 46  LYS A CG  1 
ATOM   333  C CD  . LYS A 1 48  ? 30.668 29.715 66.774  1.00 18.34 ? 46  LYS A CD  1 
ATOM   334  C CE  . LYS A 1 48  ? 30.358 30.656 65.580  1.00 17.73 ? 46  LYS A CE  1 
ATOM   335  N NZ  . LYS A 1 48  ? 29.372 30.163 64.585  1.00 16.19 ? 46  LYS A NZ  1 
ATOM   336  N N   . ALA A 1 49  ? 33.471 25.560 65.415  1.00 16.85 ? 47  ALA A N   1 
ATOM   337  C CA  . ALA A 1 49  ? 34.099 25.313 64.089  1.00 17.04 ? 47  ALA A CA  1 
ATOM   338  C C   . ALA A 1 49  ? 33.581 23.974 63.520  1.00 17.31 ? 47  ALA A C   1 
ATOM   339  O O   . ALA A 1 49  ? 33.196 23.875 62.330  1.00 18.47 ? 47  ALA A O   1 
ATOM   340  C CB  . ALA A 1 49  ? 35.639 25.314 64.196  1.00 17.63 ? 47  ALA A CB  1 
ATOM   341  N N   . ALA A 1 50  ? 33.547 22.949 64.369  1.00 16.90 ? 48  ALA A N   1 
ATOM   342  C CA  . ALA A 1 50  ? 33.119 21.629 63.885  1.00 17.62 ? 48  ALA A CA  1 
ATOM   343  C C   . ALA A 1 50  ? 31.643 21.683 63.497  1.00 18.18 ? 48  ALA A C   1 
ATOM   344  O O   . ALA A 1 50  ? 31.245 21.090 62.490  1.00 19.00 ? 48  ALA A O   1 
ATOM   345  C CB  . ALA A 1 50  ? 33.372 20.584 64.905  1.00 16.36 ? 48  ALA A CB  1 
ATOM   346  N N   . LEU A 1 51  ? 30.833 22.429 64.266  1.00 18.36 ? 49  LEU A N   1 
ATOM   347  C CA  . LEU A 1 51  ? 29.384 22.511 63.997  1.00 18.51 ? 49  LEU A CA  1 
ATOM   348  C C   . LEU A 1 51  ? 29.048 23.240 62.676  1.00 19.14 ? 49  LEU A C   1 
ATOM   349  O O   . LEU A 1 51  ? 27.983 23.013 62.089  1.00 20.62 ? 49  LEU A O   1 
ATOM   350  C CB  . LEU A 1 51  ? 28.615 23.089 65.213  1.00 17.94 ? 49  LEU A CB  1 
ATOM   351  C CG  . LEU A 1 51  ? 28.610 22.130 66.428  1.00 18.04 ? 49  LEU A CG  1 
ATOM   352  C CD1 . LEU A 1 51  ? 28.161 22.848 67.726  1.00 21.55 ? 49  LEU A CD1 1 
ATOM   353  C CD2 . LEU A 1 51  ? 27.745 20.912 66.167  1.00 19.09 ? 49  LEU A CD2 1 
ATOM   354  N N   . HIS A 1 52  ? 29.945 24.110 62.207  1.00 19.82 ? 50  HIS A N   1 
ATOM   355  C CA  . HIS A 1 52  ? 29.794 24.756 60.884  1.00 21.10 ? 50  HIS A CA  1 
ATOM   356  C C   . HIS A 1 52  ? 29.640 23.810 59.710  1.00 23.11 ? 50  HIS A C   1 
ATOM   357  O O   . HIS A 1 52  ? 29.057 24.165 58.677  1.00 22.72 ? 50  HIS A O   1 
ATOM   358  C CB  . HIS A 1 52  ? 30.967 25.651 60.613  1.00 22.04 ? 50  HIS A CB  1 
ATOM   359  C CG  . HIS A 1 52  ? 30.949 26.888 61.436  1.00 21.37 ? 50  HIS A CG  1 
ATOM   360  N ND1 . HIS A 1 52  ? 31.841 27.923 61.241  1.00 27.75 ? 50  HIS A ND1 1 
ATOM   361  C CD2 . HIS A 1 52  ? 30.114 27.285 62.427  1.00 24.49 ? 50  HIS A CD2 1 
ATOM   362  C CE1 . HIS A 1 52  ? 31.583 28.889 62.109  1.00 26.32 ? 50  HIS A CE1 1 
ATOM   363  N NE2 . HIS A 1 52  ? 30.544 28.527 62.839  1.00 25.35 ? 50  HIS A NE2 1 
ATOM   364  N N   . GLU A 1 53  ? 30.144 22.599 59.880  1.00 23.91 ? 51  GLU A N   1 
ATOM   365  C CA  . GLU A 1 53  ? 30.062 21.611 58.824  1.00 26.25 ? 51  GLU A CA  1 
ATOM   366  C C   . GLU A 1 53  ? 28.657 21.059 58.659  1.00 26.17 ? 51  GLU A C   1 
ATOM   367  O O   . GLU A 1 53  ? 28.270 20.721 57.541  1.00 27.67 ? 51  GLU A O   1 
ATOM   368  C CB  . GLU A 1 53  ? 31.051 20.498 59.115  1.00 25.84 ? 51  GLU A CB  1 
ATOM   369  C CG  . GLU A 1 53  ? 32.450 21.068 59.183  1.00 29.89 ? 51  GLU A CG  1 
ATOM   370  C CD  . GLU A 1 53  ? 33.462 20.109 58.661  1.00 32.62 ? 51  GLU A CD  1 
ATOM   371  O OE1 . GLU A 1 53  ? 34.082 20.412 57.634  1.00 33.16 ? 51  GLU A OE1 1 
ATOM   372  O OE2 . GLU A 1 53  ? 33.607 19.041 59.271  1.00 35.23 ? 51  GLU A OE2 1 
ATOM   373  N N   . GLN A 1 54  ? 27.897 21.000 59.761  1.00 25.25 ? 52  GLN A N   1 
ATOM   374  C CA  . GLN A 1 54  ? 26.503 20.505 59.734  1.00 25.41 ? 52  GLN A CA  1 
ATOM   375  C C   . GLN A 1 54  ? 25.444 21.623 59.720  1.00 24.15 ? 52  GLN A C   1 
ATOM   376  O O   . GLN A 1 54  ? 24.337 21.442 59.182  1.00 25.16 ? 52  GLN A O   1 
ATOM   377  C CB  . GLN A 1 54  ? 26.258 19.554 60.913  1.00 25.90 ? 52  GLN A CB  1 
ATOM   378  C CG  . GLN A 1 54  ? 27.389 18.545 61.157  1.00 30.29 ? 52  GLN A CG  1 
ATOM   379  C CD  . GLN A 1 54  ? 27.500 18.134 62.630  1.00 34.79 ? 52  GLN A CD  1 
ATOM   380  O OE1 . GLN A 1 54  ? 26.513 17.691 63.235  1.00 38.36 ? 52  GLN A OE1 1 
ATOM   381  N NE2 . GLN A 1 54  ? 28.704 18.292 63.217  1.00 34.57 ? 52  GLN A NE2 1 
ATOM   382  N N   . PHE A 1 55  ? 25.772 22.781 60.289  1.00 22.62 ? 53  PHE A N   1 
ATOM   383  C CA  . PHE A 1 55  ? 24.783 23.870 60.463  1.00 22.05 ? 53  PHE A CA  1 
ATOM   384  C C   . PHE A 1 55  ? 25.324 25.186 59.974  1.00 22.56 ? 53  PHE A C   1 
ATOM   385  O O   . PHE A 1 55  ? 26.519 25.426 60.086  1.00 21.64 ? 53  PHE A O   1 
ATOM   386  C CB  . PHE A 1 55  ? 24.424 23.986 61.953  1.00 21.68 ? 53  PHE A CB  1 
ATOM   387  C CG  . PHE A 1 55  ? 23.881 22.735 62.494  1.00 21.61 ? 53  PHE A CG  1 
ATOM   388  C CD1 . PHE A 1 55  ? 22.597 22.345 62.145  1.00 21.74 ? 53  PHE A CD1 1 
ATOM   389  C CD2 . PHE A 1 55  ? 24.672 21.887 63.278  1.00 19.14 ? 53  PHE A CD2 1 
ATOM   390  C CE1 . PHE A 1 55  ? 22.070 21.132 62.621  1.00 23.23 ? 53  PHE A CE1 1 
ATOM   391  C CE2 . PHE A 1 55  ? 24.166 20.669 63.739  1.00 21.73 ? 53  PHE A CE2 1 
ATOM   392  C CZ  . PHE A 1 55  ? 22.863 20.292 63.399  1.00 20.97 ? 53  PHE A CZ  1 
ATOM   393  N N   . GLU A 1 56  ? 24.444 26.041 59.453  1.00 23.26 ? 54  GLU A N   1 
ATOM   394  C CA  . GLU A 1 56  ? 24.861 27.360 58.996  1.00 25.01 ? 54  GLU A CA  1 
ATOM   395  C C   . GLU A 1 56  ? 25.532 28.083 60.163  1.00 24.93 ? 54  GLU A C   1 
ATOM   396  O O   . GLU A 1 56  ? 25.009 28.019 61.290  1.00 24.34 ? 54  GLU A O   1 
ATOM   397  C CB  . GLU A 1 56  ? 23.655 28.139 58.456  1.00 25.69 ? 54  GLU A CB  1 
ATOM   398  C CG  . GLU A 1 56  ? 23.036 27.433 57.246  1.00 27.43 ? 54  GLU A CG  1 
ATOM   399  N N   . PRO A 1 57  ? 26.712 28.691 59.925  1.00 25.74 ? 55  PRO A N   1 
ATOM   400  C CA  . PRO A 1 57  ? 27.454 29.430 60.967  1.00 25.82 ? 55  PRO A CA  1 
ATOM   401  C C   . PRO A 1 57  ? 26.575 30.403 61.763  1.00 25.53 ? 55  PRO A C   1 
ATOM   402  O O   . PRO A 1 57  ? 26.798 30.551 62.968  1.00 25.55 ? 55  PRO A O   1 
ATOM   403  C CB  . PRO A 1 57  ? 28.515 30.198 60.175  1.00 26.87 ? 55  PRO A CB  1 
ATOM   404  C CG  . PRO A 1 57  ? 28.732 29.391 58.964  1.00 26.20 ? 55  PRO A CG  1 
ATOM   405  C CD  . PRO A 1 57  ? 27.442 28.689 58.637  1.00 25.71 ? 55  PRO A CD  1 
ATOM   406  N N   . GLN A 1 58  ? 25.575 31.023 61.124  1.00 24.76 ? 56  GLN A N   1 
ATOM   407  C CA  . GLN A 1 58  ? 24.726 31.996 61.824  1.00 25.31 ? 56  GLN A CA  1 
ATOM   408  C C   . GLN A 1 58  ? 23.803 31.378 62.878  1.00 23.22 ? 56  GLN A C   1 
ATOM   409  O O   . GLN A 1 58  ? 23.174 32.110 63.651  1.00 22.52 ? 56  GLN A O   1 
ATOM   410  C CB  . GLN A 1 58  ? 23.922 32.913 60.893  1.00 26.32 ? 56  GLN A CB  1 
ATOM   411  C CG  . GLN A 1 58  ? 23.187 32.225 59.737  1.00 31.69 ? 56  GLN A CG  1 
ATOM   412  C CD  . GLN A 1 58  ? 21.834 31.606 60.102  1.00 37.13 ? 56  GLN A CD  1 
ATOM   413  O OE1 . GLN A 1 58  ? 21.165 32.021 61.063  1.00 38.38 ? 56  GLN A OE1 1 
ATOM   414  N NE2 . GLN A 1 58  ? 21.410 30.620 59.301  1.00 37.79 ? 56  GLN A NE2 1 
ATOM   415  N N   . LYS A 1 59  ? 23.743 30.045 62.903  1.00 19.95 ? 57  LYS A N   1 
ATOM   416  C CA  . LYS A 1 59  ? 22.956 29.366 63.936  1.00 18.78 ? 57  LYS A CA  1 
ATOM   417  C C   . LYS A 1 59  ? 23.666 29.334 65.293  1.00 17.74 ? 57  LYS A C   1 
ATOM   418  O O   . LYS A 1 59  ? 23.006 29.045 66.314  1.00 17.45 ? 57  LYS A O   1 
ATOM   419  C CB  . LYS A 1 59  ? 22.581 27.940 63.507  1.00 19.86 ? 57  LYS A CB  1 
ATOM   420  C CG  . LYS A 1 59  ? 21.760 27.851 62.204  1.00 20.67 ? 57  LYS A CG  1 
ATOM   421  C CD  . LYS A 1 59  ? 20.325 28.380 62.378  1.00 24.43 ? 57  LYS A CD  1 
ATOM   422  C CE  . LYS A 1 59  ? 19.369 27.821 61.264  1.00 27.26 ? 57  LYS A CE  1 
ATOM   423  N NZ  . LYS A 1 59  ? 19.402 26.328 61.067  1.00 29.42 ? 57  LYS A NZ  1 
ATOM   424  N N   . THR A 1 60  ? 24.974 29.599 65.330  1.00 15.82 ? 58  THR A N   1 
ATOM   425  C CA  . THR A 1 60  ? 25.704 29.448 66.602  1.00 15.22 ? 58  THR A CA  1 
ATOM   426  C C   . THR A 1 60  ? 26.556 30.644 66.986  1.00 15.56 ? 58  THR A C   1 
ATOM   427  O O   . THR A 1 60  ? 27.037 31.388 66.130  1.00 14.82 ? 58  THR A O   1 
ATOM   428  C CB  . THR A 1 60  ? 26.612 28.204 66.612  1.00 15.99 ? 58  THR A CB  1 
ATOM   429  O OG1 . THR A 1 60  ? 27.589 28.306 65.550  1.00 17.24 ? 58  THR A OG1 1 
ATOM   430  C CG2 . THR A 1 60  ? 25.785 26.926 66.450  1.00 17.01 ? 58  THR A CG2 1 
ATOM   431  N N   . LEU A 1 61  ? 26.783 30.782 68.281  1.00 13.88 ? 59  LEU A N   1 
ATOM   432  C CA  . LEU A 1 61  ? 27.667 31.814 68.809  1.00 15.30 ? 59  LEU A CA  1 
ATOM   433  C C   . LEU A 1 61  ? 28.413 31.139 69.933  1.00 15.54 ? 59  LEU A C   1 
ATOM   434  O O   . LEU A 1 61  ? 27.778 30.392 70.708  1.00 16.41 ? 59  LEU A O   1 
ATOM   435  C CB  . LEU A 1 61  ? 26.834 32.971 69.366  1.00 16.29 ? 59  LEU A CB  1 
ATOM   436  C CG  . LEU A 1 61  ? 27.617 34.103 70.009  1.00 16.85 ? 59  LEU A CG  1 
ATOM   437  C CD1 . LEU A 1 61  ? 28.281 34.994 68.927  1.00 18.36 ? 59  LEU A CD1 1 
ATOM   438  C CD2 . LEU A 1 61  ? 26.710 34.925 70.926  1.00 17.69 ? 59  LEU A CD2 1 
ATOM   439  N N   . PHE A 1 62  ? 29.704 31.387 70.064  1.00 13.89 ? 60  PHE A N   1 
ATOM   440  C CA  . PHE A 1 62  ? 30.436 30.868 71.204  1.00 13.62 ? 60  PHE A CA  1 
ATOM   441  C C   . PHE A 1 62  ? 30.812 32.044 72.121  1.00 14.70 ? 60  PHE A C   1 
ATOM   442  O O   . PHE A 1 62  ? 31.280 33.062 71.616  1.00 13.90 ? 60  PHE A O   1 
ATOM   443  C CB  . PHE A 1 62  ? 31.731 30.111 70.829  1.00 14.88 ? 60  PHE A CB  1 
ATOM   444  C CG  . PHE A 1 62  ? 32.529 29.739 72.031  1.00 14.92 ? 60  PHE A CG  1 
ATOM   445  C CD1 . PHE A 1 62  ? 31.991 28.824 72.968  1.00 15.51 ? 60  PHE A CD1 1 
ATOM   446  C CD2 . PHE A 1 62  ? 33.735 30.367 72.330  1.00 15.82 ? 60  PHE A CD2 1 
ATOM   447  C CE1 . PHE A 1 62  ? 32.698 28.513 74.138  1.00 16.04 ? 60  PHE A CE1 1 
ATOM   448  C CE2 . PHE A 1 62  ? 34.462 30.055 73.504  1.00 15.36 ? 60  PHE A CE2 1 
ATOM   449  C CZ  . PHE A 1 62  ? 33.928 29.118 74.412  1.00 17.13 ? 60  PHE A CZ  1 
ATOM   450  N N   . ILE A 1 63  ? 30.629 31.879 73.440  1.00 14.11 ? 61  ILE A N   1 
ATOM   451  C CA  . ILE A 1 63  ? 31.069 32.913 74.423  1.00 15.02 ? 61  ILE A CA  1 
ATOM   452  C C   . ILE A 1 63  ? 31.839 32.218 75.546  1.00 15.90 ? 61  ILE A C   1 
ATOM   453  O O   . ILE A 1 63  ? 31.305 31.289 76.216  1.00 15.26 ? 61  ILE A O   1 
ATOM   454  C CB  . ILE A 1 63  ? 29.908 33.771 75.025  1.00 15.12 ? 61  ILE A CB  1 
ATOM   455  C CG1 A ILE A 1 63  ? 28.978 34.393 73.945  0.65 16.15 ? 61  ILE A CG1 1 
ATOM   456  C CG1 B ILE A 1 63  ? 29.147 34.493 73.908  0.35 15.15 ? 61  ILE A CG1 1 
ATOM   457  C CG2 . ILE A 1 63  ? 30.462 34.818 76.034  1.00 14.99 ? 61  ILE A CG2 1 
ATOM   458  C CD1 A ILE A 1 63  ? 29.589 35.469 73.087  0.65 17.60 ? 61  ILE A CD1 1 
ATOM   459  C CD1 B ILE A 1 63  ? 27.881 35.115 74.361  0.35 13.83 ? 61  ILE A CD1 1 
ATOM   460  N N   . GLN A 1 64  ? 33.092 32.622 75.741  1.00 16.42 ? 62  GLN A N   1 
ATOM   461  C CA  . GLN A 1 64  ? 33.902 32.086 76.825  1.00 17.13 ? 62  GLN A CA  1 
ATOM   462  C C   . GLN A 1 64  ? 33.371 32.687 78.144  1.00 15.90 ? 62  GLN A C   1 
ATOM   463  O O   . GLN A 1 64  ? 33.178 33.898 78.255  1.00 15.44 ? 62  GLN A O   1 
ATOM   464  C CB  . GLN A 1 64  ? 35.338 32.508 76.600  1.00 17.99 ? 62  GLN A CB  1 
ATOM   465  C CG  . GLN A 1 64  ? 36.398 31.840 77.405  1.00 21.86 ? 62  GLN A CG  1 
ATOM   466  C CD  . GLN A 1 64  ? 37.748 32.621 77.264  1.00 21.43 ? 62  GLN A CD  1 
ATOM   467  O OE1 . GLN A 1 64  ? 38.697 32.363 78.005  1.00 29.39 ? 62  GLN A OE1 1 
ATOM   468  N NE2 . GLN A 1 64  ? 37.801 33.608 76.320  1.00 25.73 ? 62  GLN A NE2 1 
ATOM   469  N N   . CYS A 1 65  ? 33.153 31.850 79.146  1.00 15.95 ? 63  CYS A N   1 
ATOM   470  C CA  . CYS A 1 65  ? 32.574 32.340 80.403  1.00 14.84 ? 63  CYS A CA  1 
ATOM   471  C C   . CYS A 1 65  ? 32.789 31.323 81.510  1.00 15.67 ? 63  CYS A C   1 
ATOM   472  O O   . CYS A 1 65  ? 32.511 30.116 81.333  1.00 14.34 ? 63  CYS A O   1 
ATOM   473  C CB  . CYS A 1 65  ? 31.070 32.628 80.233  1.00 14.12 ? 63  CYS A CB  1 
ATOM   474  S SG  . CYS A 1 65  ? 30.309 33.268 81.782  1.00 18.40 ? 63  CYS A SG  1 
ATOM   475  N N   . ASP A 1 66  ? 33.252 31.809 82.668  1.00 15.62 ? 64  ASP A N   1 
ATOM   476  C CA  . ASP A 1 66  ? 33.288 30.983 83.860  1.00 16.23 ? 64  ASP A CA  1 
ATOM   477  C C   . ASP A 1 66  ? 31.958 31.256 84.545  1.00 15.18 ? 64  ASP A C   1 
ATOM   478  O O   . ASP A 1 66  ? 31.710 32.372 85.019  1.00 14.45 ? 64  ASP A O   1 
ATOM   479  C CB  . ASP A 1 66  ? 34.451 31.359 84.778  1.00 16.47 ? 64  ASP A CB  1 
ATOM   480  C CG  . ASP A 1 66  ? 34.447 30.576 86.109  1.00 19.34 ? 64  ASP A CG  1 
ATOM   481  O OD1 . ASP A 1 66  ? 33.473 29.825 86.429  1.00 15.46 ? 64  ASP A OD1 1 
ATOM   482  O OD2 . ASP A 1 66  ? 35.437 30.725 86.872  1.00 21.96 ? 64  ASP A OD2 1 
ATOM   483  N N   . VAL A 1 67  ? 31.092 30.239 84.600  1.00 14.43 ? 65  VAL A N   1 
ATOM   484  C CA  . VAL A 1 67  ? 29.715 30.505 85.087  1.00 14.46 ? 65  VAL A CA  1 
ATOM   485  C C   . VAL A 1 67  ? 29.688 30.946 86.548  1.00 15.03 ? 65  VAL A C   1 
ATOM   486  O O   . VAL A 1 67  ? 28.707 31.542 87.003  1.00 15.38 ? 65  VAL A O   1 
ATOM   487  C CB  . VAL A 1 67  ? 28.769 29.305 84.871  1.00 14.53 ? 65  VAL A CB  1 
ATOM   488  C CG1 . VAL A 1 67  ? 28.589 29.064 83.362  1.00 16.08 ? 65  VAL A CG1 1 
ATOM   489  C CG2 . VAL A 1 67  ? 29.252 28.088 85.653  1.00 14.69 ? 65  VAL A CG2 1 
ATOM   490  N N   . ALA A 1 68  ? 30.770 30.653 87.259  1.00 16.28 ? 66  ALA A N   1 
ATOM   491  C CA  . ALA A 1 68  ? 30.835 31.001 88.688  1.00 16.98 ? 66  ALA A CA  1 
ATOM   492  C C   . ALA A 1 68  ? 31.270 32.458 88.912  1.00 17.98 ? 66  ALA A C   1 
ATOM   493  O O   . ALA A 1 68  ? 31.223 32.933 90.043  1.00 18.12 ? 66  ALA A O   1 
ATOM   494  C CB  . ALA A 1 68  ? 31.757 30.040 89.432  1.00 16.79 ? 66  ALA A CB  1 
ATOM   495  N N   . ASP A 1 69  ? 31.706 33.135 87.857  1.00 17.54 ? 67  ASP A N   1 
ATOM   496  C CA  . ASP A 1 69  ? 32.057 34.541 87.941  1.00 19.04 ? 67  ASP A CA  1 
ATOM   497  C C   . ASP A 1 69  ? 30.803 35.304 87.576  1.00 18.47 ? 67  ASP A C   1 
ATOM   498  O O   . ASP A 1 69  ? 30.390 35.340 86.391  1.00 16.29 ? 67  ASP A O   1 
ATOM   499  C CB  . ASP A 1 69  ? 33.243 34.869 87.017  1.00 18.62 ? 67  ASP A CB  1 
ATOM   500  C CG  . ASP A 1 69  ? 33.614 36.348 87.029  1.00 22.51 ? 67  ASP A CG  1 
ATOM   501  O OD1 . ASP A 1 69  ? 32.723 37.214 87.193  1.00 23.02 ? 67  ASP A OD1 1 
ATOM   502  O OD2 . ASP A 1 69  ? 34.820 36.630 86.828  1.00 28.31 ? 67  ASP A OD2 1 
ATOM   503  N N   . GLN A 1 70  ? 30.161 35.892 88.590  1.00 19.16 ? 68  GLN A N   1 
ATOM   504  C CA  . GLN A 1 70  ? 28.844 36.502 88.330  1.00 20.34 ? 68  GLN A CA  1 
ATOM   505  C C   . GLN A 1 70  ? 28.810 37.639 87.304  1.00 19.34 ? 68  GLN A C   1 
ATOM   506  O O   . GLN A 1 70  ? 27.893 37.684 86.484  1.00 17.67 ? 68  GLN A O   1 
ATOM   507  C CB  . GLN A 1 70  ? 28.098 36.891 89.624  1.00 21.45 ? 68  GLN A CB  1 
ATOM   508  C CG  . GLN A 1 70  ? 27.433 35.657 90.266  1.00 23.10 ? 68  GLN A CG  1 
ATOM   509  C CD  . GLN A 1 70  ? 26.224 35.964 91.186  1.00 25.12 ? 68  GLN A CD  1 
ATOM   510  O OE1 . GLN A 1 70  ? 25.228 36.605 90.778  1.00 29.18 ? 68  GLN A OE1 1 
ATOM   511  N NE2 . GLN A 1 70  ? 26.290 35.446 92.417  1.00 25.86 ? 68  GLN A NE2 1 
ATOM   512  N N   . GLN A 1 71  ? 29.825 38.515 87.315  1.00 19.36 ? 69  GLN A N   1 
ATOM   513  C CA  . GLN A 1 71  ? 29.849 39.607 86.318  1.00 20.56 ? 69  GLN A CA  1 
ATOM   514  C C   . GLN A 1 71  ? 30.058 39.025 84.917  1.00 18.75 ? 69  GLN A C   1 
ATOM   515  O O   . GLN A 1 71  ? 29.408 39.506 83.971  1.00 19.01 ? 69  GLN A O   1 
ATOM   516  C CB  . GLN A 1 71  ? 30.862 40.721 86.650  1.00 21.91 ? 69  GLN A CB  1 
ATOM   517  C CG  . GLN A 1 71  ? 30.512 42.119 85.997  1.00 26.25 ? 69  GLN A CG  1 
ATOM   518  C CD  . GLN A 1 71  ? 28.980 42.522 85.901  1.00 29.48 ? 69  GLN A CD  1 
ATOM   519  O OE1 . GLN A 1 71  ? 28.313 42.916 86.899  1.00 27.85 ? 69  GLN A OE1 1 
ATOM   520  N NE2 . GLN A 1 71  ? 28.457 42.488 84.677  1.00 28.70 ? 69  GLN A NE2 1 
ATOM   521  N N   . GLN A 1 72  ? 30.904 37.984 84.818  1.00 17.60 ? 70  GLN A N   1 
ATOM   522  C CA  . GLN A 1 72  ? 31.167 37.299 83.523  1.00 18.51 ? 70  GLN A CA  1 
ATOM   523  C C   . GLN A 1 72  ? 29.844 36.709 83.020  1.00 16.36 ? 70  GLN A C   1 
ATOM   524  O O   . GLN A 1 72  ? 29.484 36.854 81.827  1.00 16.07 ? 70  GLN A O   1 
ATOM   525  C CB  . GLN A 1 72  ? 32.165 36.153 83.632  1.00 19.38 ? 70  GLN A CB  1 
ATOM   526  C CG  . GLN A 1 72  ? 33.637 36.505 83.774  1.00 23.72 ? 70  GLN A CG  1 
ATOM   527  C CD  . GLN A 1 72  ? 34.556 35.272 83.615  1.00 22.52 ? 70  GLN A CD  1 
ATOM   528  O OE1 . GLN A 1 72  ? 34.406 34.489 82.676  1.00 21.14 ? 70  GLN A OE1 1 
ATOM   529  N NE2 . GLN A 1 72  ? 35.539 35.122 84.532  1.00 26.93 ? 70  GLN A NE2 1 
ATOM   530  N N   . LEU A 1 73  ? 29.090 36.080 83.931  1.00 15.70 ? 71  LEU A N   1 
ATOM   531  C CA  . LEU A 1 73  ? 27.853 35.423 83.500  1.00 15.25 ? 71  LEU A CA  1 
ATOM   532  C C   . LEU A 1 73  ? 26.799 36.493 83.058  1.00 15.36 ? 71  LEU A C   1 
ATOM   533  O O   . LEU A 1 73  ? 26.150 36.371 82.028  1.00 15.64 ? 71  LEU A O   1 
ATOM   534  C CB  . LEU A 1 73  ? 27.331 34.494 84.619  1.00 14.90 ? 71  LEU A CB  1 
ATOM   535  C CG  . LEU A 1 73  ? 26.104 33.639 84.243  1.00 13.98 ? 71  LEU A CG  1 
ATOM   536  C CD1 . LEU A 1 73  ? 26.418 32.722 83.095  1.00 15.39 ? 71  LEU A CD1 1 
ATOM   537  C CD2 . LEU A 1 73  ? 25.619 32.830 85.465  1.00 15.37 ? 71  LEU A CD2 1 
ATOM   538  N N   . ARG A 1 74  ? 26.687 37.596 83.802  1.00 15.09 ? 72  ARG A N   1 
ATOM   539  C CA  . ARG A 1 74  ? 25.783 38.672 83.392  1.00 15.90 ? 72  ARG A CA  1 
ATOM   540  C C   . ARG A 1 74  ? 26.114 39.235 81.996  1.00 14.68 ? 72  ARG A C   1 
ATOM   541  O O   . ARG A 1 74  ? 25.220 39.434 81.160  1.00 15.17 ? 72  ARG A O   1 
ATOM   542  C CB  . ARG A 1 74  ? 25.844 39.809 84.390  1.00 17.20 ? 72  ARG A CB  1 
ATOM   543  C CG  . ARG A 1 74  ? 25.233 39.449 85.717  1.00 22.19 ? 72  ARG A CG  1 
ATOM   544  C CD  . ARG A 1 74  ? 25.059 40.727 86.515  1.00 29.33 ? 72  ARG A CD  1 
ATOM   545  N NE  . ARG A 1 74  ? 26.238 41.026 87.305  1.00 33.28 ? 72  ARG A NE  1 
ATOM   546  C CZ  . ARG A 1 74  ? 26.358 40.714 88.590  1.00 35.41 ? 72  ARG A CZ  1 
ATOM   547  N NH1 . ARG A 1 74  ? 25.374 40.069 89.211  1.00 36.34 ? 72  ARG A NH1 1 
ATOM   548  N NH2 . ARG A 1 74  ? 27.465 41.030 89.239  1.00 35.27 ? 72  ARG A NH2 1 
ATOM   549  N N   . ASP A 1 75  ? 27.401 39.485 81.792  1.00 14.96 ? 73  ASP A N   1 
ATOM   550  C CA  . ASP A 1 75  ? 27.906 40.010 80.499  1.00 16.00 ? 73  ASP A CA  1 
ATOM   551  C C   . ASP A 1 75  ? 27.558 39.033 79.370  1.00 15.24 ? 73  ASP A C   1 
ATOM   552  O O   . ASP A 1 75  ? 27.138 39.433 78.276  1.00 15.26 ? 73  ASP A O   1 
ATOM   553  C CB  . ASP A 1 75  ? 29.413 40.182 80.574  1.00 16.42 ? 73  ASP A CB  1 
ATOM   554  C CG  . ASP A 1 75  ? 29.837 41.425 81.403  1.00 18.77 ? 73  ASP A CG  1 
ATOM   555  O OD1 . ASP A 1 75  ? 28.971 42.211 81.867  1.00 23.37 ? 73  ASP A OD1 1 
ATOM   556  O OD2 . ASP A 1 75  ? 31.068 41.609 81.548  1.00 25.16 ? 73  ASP A OD2 1 
ATOM   557  N N   . THR A 1 76  ? 27.726 37.752 79.674  1.00 13.86 ? 74  THR A N   1 
ATOM   558  C CA  . THR A 1 76  ? 27.406 36.666 78.704  1.00 14.06 ? 74  THR A CA  1 
ATOM   559  C C   . THR A 1 76  ? 25.936 36.656 78.272  1.00 13.42 ? 74  THR A C   1 
ATOM   560  O O   . THR A 1 76  ? 25.637 36.575 77.075  1.00 13.28 ? 74  THR A O   1 
ATOM   561  C CB  . THR A 1 76  ? 27.846 35.318 79.285  1.00 13.37 ? 74  THR A CB  1 
ATOM   562  O OG1 . THR A 1 76  ? 29.261 35.320 79.527  1.00 14.00 ? 74  THR A OG1 1 
ATOM   563  C CG2 . THR A 1 76  ? 27.468 34.147 78.337  1.00 14.04 ? 74  THR A CG2 1 
ATOM   564  N N   . PHE A 1 77  ? 24.991 36.772 79.226  1.00 12.18 ? 75  PHE A N   1 
ATOM   565  C CA  . PHE A 1 77  ? 23.571 36.850 78.860  1.00 13.68 ? 75  PHE A CA  1 
ATOM   566  C C   . PHE A 1 77  ? 23.314 38.065 77.959  1.00 13.52 ? 75  PHE A C   1 
ATOM   567  O O   . PHE A 1 77  ? 22.617 37.976 76.982  1.00 13.96 ? 75  PHE A O   1 
ATOM   568  C CB  . PHE A 1 77  ? 22.665 36.906 80.094  1.00 14.22 ? 75  PHE A CB  1 
ATOM   569  C CG  . PHE A 1 77  ? 22.362 35.556 80.676  1.00 13.28 ? 75  PHE A CG  1 
ATOM   570  C CD1 . PHE A 1 77  ? 23.377 34.811 81.306  1.00 14.23 ? 75  PHE A CD1 1 
ATOM   571  C CD2 . PHE A 1 77  ? 21.085 35.032 80.550  1.00 13.10 ? 75  PHE A CD2 1 
ATOM   572  C CE1 . PHE A 1 77  ? 23.064 33.510 81.842  1.00 15.99 ? 75  PHE A CE1 1 
ATOM   573  C CE2 . PHE A 1 77  ? 20.761 33.740 81.081  1.00 14.94 ? 75  PHE A CE2 1 
ATOM   574  C CZ  . PHE A 1 77  ? 21.748 33.030 81.745  1.00 13.24 ? 75  PHE A CZ  1 
ATOM   575  N N   . ARG A 1 78  ? 23.881 39.211 78.347  1.00 14.86 ? 76  ARG A N   1 
ATOM   576  C CA  . ARG A 1 78  ? 23.698 40.433 77.587  1.00 16.13 ? 76  ARG A CA  1 
ATOM   577  C C   . ARG A 1 78  ? 24.201 40.261 76.145  1.00 14.87 ? 76  ARG A C   1 
ATOM   578  O O   . ARG A 1 78  ? 23.526 40.671 75.203  1.00 16.41 ? 76  ARG A O   1 
ATOM   579  C CB  . ARG A 1 78  ? 24.406 41.591 78.290  1.00 16.65 ? 76  ARG A CB  1 
ATOM   580  C CG  A ARG A 1 78  ? 24.607 42.833 77.425  0.50 17.02 ? 76  ARG A CG  1 
ATOM   581  C CG  B ARG A 1 78  ? 24.085 42.948 77.658  0.50 18.21 ? 76  ARG A CG  1 
ATOM   582  C CD  A ARG A 1 78  ? 25.529 43.847 78.131  0.50 17.49 ? 76  ARG A CD  1 
ATOM   583  C CD  B ARG A 1 78  ? 24.467 44.100 78.583  0.50 21.25 ? 76  ARG A CD  1 
ATOM   584  N NE  A ARG A 1 78  ? 26.952 43.514 78.036  0.50 19.61 ? 76  ARG A NE  1 
ATOM   585  N NE  B ARG A 1 78  ? 25.867 44.033 79.007  0.50 24.72 ? 76  ARG A NE  1 
ATOM   586  C CZ  A ARG A 1 78  ? 27.677 43.655 76.931  0.50 22.01 ? 76  ARG A CZ  1 
ATOM   587  C CZ  B ARG A 1 78  ? 26.277 43.663 80.217  0.50 24.31 ? 76  ARG A CZ  1 
ATOM   588  N NH1 A ARG A 1 78  ? 27.119 44.124 75.813  0.50 21.25 ? 76  ARG A NH1 1 
ATOM   589  N NH1 B ARG A 1 78  ? 25.403 43.333 81.164  0.50 24.83 ? 76  ARG A NH1 1 
ATOM   590  N NH2 A ARG A 1 78  ? 28.956 43.311 76.934  0.50 24.79 ? 76  ARG A NH2 1 
ATOM   591  N NH2 B ARG A 1 78  ? 27.574 43.647 80.479  0.50 25.90 ? 76  ARG A NH2 1 
ATOM   592  N N   . LYS A 1 79  ? 25.365 39.639 75.984  1.00 14.72 ? 77  LYS A N   1 
ATOM   593  C CA  . LYS A 1 79  ? 25.951 39.454 74.638  1.00 15.07 ? 77  LYS A CA  1 
ATOM   594  C C   . LYS A 1 79  ? 25.092 38.511 73.800  1.00 15.20 ? 77  LYS A C   1 
ATOM   595  O O   . LYS A 1 79  ? 24.925 38.683 72.572  1.00 15.71 ? 77  LYS A O   1 
ATOM   596  C CB  . LYS A 1 79  ? 27.379 38.940 74.735  1.00 14.72 ? 77  LYS A CB  1 
ATOM   597  C CG  . LYS A 1 79  ? 28.352 39.910 75.411  1.00 15.37 ? 77  LYS A CG  1 
ATOM   598  C CD  . LYS A 1 79  ? 29.653 39.219 75.780  1.00 17.97 ? 77  LYS A CD  1 
ATOM   599  C CE  . LYS A 1 79  ? 30.514 40.108 76.665  1.00 19.19 ? 77  LYS A CE  1 
ATOM   600  N NZ  . LYS A 1 79  ? 31.784 39.515 77.114  1.00 18.50 ? 77  LYS A NZ  1 
ATOM   601  N N   . VAL A 1 80  ? 24.513 37.515 74.468  1.00 14.35 ? 78  VAL A N   1 
ATOM   602  C CA  . VAL A 1 80  ? 23.646 36.562 73.764  1.00 14.08 ? 78  VAL A CA  1 
ATOM   603  C C   . VAL A 1 80  ? 22.378 37.231 73.218  1.00 14.54 ? 78  VAL A C   1 
ATOM   604  O O   . VAL A 1 80  ? 22.021 37.084 72.057  1.00 14.74 ? 78  VAL A O   1 
ATOM   605  C CB  . VAL A 1 80  ? 23.337 35.304 74.650  1.00 14.23 ? 78  VAL A CB  1 
ATOM   606  C CG1 . VAL A 1 80  ? 22.249 34.421 73.998  1.00 12.37 ? 78  VAL A CG1 1 
ATOM   607  C CG2 . VAL A 1 80  ? 24.589 34.500 74.904  1.00 14.86 ? 78  VAL A CG2 1 
ATOM   608  N N   . VAL A 1 81  ? 21.702 37.977 74.088  1.00 14.93 ? 79  VAL A N   1 
ATOM   609  C CA  . VAL A 1 81  ? 20.494 38.686 73.710  1.00 15.94 ? 79  VAL A CA  1 
ATOM   610  C C   . VAL A 1 81  ? 20.780 39.771 72.672  1.00 15.88 ? 79  VAL A C   1 
ATOM   611  O O   . VAL A 1 81  ? 19.993 39.940 71.746  1.00 15.86 ? 79  VAL A O   1 
ATOM   612  C CB  . VAL A 1 81  ? 19.744 39.207 74.937  1.00 15.95 ? 79  VAL A CB  1 
ATOM   613  C CG1 . VAL A 1 81  ? 18.541 40.044 74.513  1.00 16.78 ? 79  VAL A CG1 1 
ATOM   614  C CG2 . VAL A 1 81  ? 19.344 38.016 75.810  1.00 14.20 ? 79  VAL A CG2 1 
ATOM   615  N N   . ASP A 1 82  ? 21.916 40.443 72.820  1.00 17.71 ? 80  ASP A N   1 
ATOM   616  C CA  . ASP A 1 82  ? 22.330 41.468 71.837  1.00 17.95 ? 80  ASP A CA  1 
ATOM   617  C C   . ASP A 1 82  ? 22.538 40.812 70.480  1.00 18.35 ? 80  ASP A C   1 
ATOM   618  O O   . ASP A 1 82  ? 22.181 41.368 69.451  1.00 18.95 ? 80  ASP A O   1 
ATOM   619  C CB  . ASP A 1 82  ? 23.630 42.157 72.258  1.00 18.80 ? 80  ASP A CB  1 
ATOM   620  C CG  . ASP A 1 82  ? 23.418 43.247 73.319  1.00 21.66 ? 80  ASP A CG  1 
ATOM   621  O OD1 . ASP A 1 82  ? 22.253 43.579 73.657  1.00 25.24 ? 80  ASP A OD1 1 
ATOM   622  O OD2 . ASP A 1 82  ? 24.447 43.779 73.774  1.00 26.89 ? 80  ASP A OD2 1 
ATOM   623  N N   . HIS A 1 83  ? 23.123 39.622 70.478  1.00 16.81 ? 81  HIS A N   1 
ATOM   624  C CA  . HIS A 1 83  ? 23.434 38.969 69.214  1.00 16.84 ? 81  HIS A CA  1 
ATOM   625  C C   . HIS A 1 83  ? 22.220 38.387 68.497  1.00 17.91 ? 81  HIS A C   1 
ATOM   626  O O   . HIS A 1 83  ? 22.031 38.605 67.284  1.00 19.21 ? 81  HIS A O   1 
ATOM   627  C CB  . HIS A 1 83  ? 24.512 37.899 69.418  1.00 16.25 ? 81  HIS A CB  1 
ATOM   628  C CG  . HIS A 1 83  ? 24.805 37.139 68.177  1.00 16.64 ? 81  HIS A CG  1 
ATOM   629  N ND1 . HIS A 1 83  ? 25.551 37.663 67.140  1.00 16.04 ? 81  HIS A ND1 1 
ATOM   630  C CD2 . HIS A 1 83  ? 24.361 35.931 67.752  1.00 19.07 ? 81  HIS A CD2 1 
ATOM   631  C CE1 . HIS A 1 83  ? 25.618 36.771 66.165  1.00 18.65 ? 81  HIS A CE1 1 
ATOM   632  N NE2 . HIS A 1 83  ? 24.896 35.717 66.502  1.00 20.21 ? 81  HIS A NE2 1 
ATOM   633  N N   . PHE A 1 84  ? 21.425 37.589 69.233  1.00 16.98 ? 82  PHE A N   1 
ATOM   634  C CA  . PHE A 1 84  ? 20.306 36.857 68.645  1.00 17.49 ? 82  PHE A CA  1 
ATOM   635  C C   . PHE A 1 84  ? 18.982 37.610 68.724  1.00 17.61 ? 82  PHE A C   1 
ATOM   636  O O   . PHE A 1 84  ? 17.992 37.213 68.082  1.00 18.34 ? 82  PHE A O   1 
ATOM   637  C CB  . PHE A 1 84  ? 20.167 35.488 69.319  1.00 16.56 ? 82  PHE A CB  1 
ATOM   638  C CG  . PHE A 1 84  ? 21.207 34.492 68.909  1.00 18.07 ? 82  PHE A CG  1 
ATOM   639  C CD1 . PHE A 1 84  ? 21.379 34.138 67.560  1.00 18.17 ? 82  PHE A CD1 1 
ATOM   640  C CD2 . PHE A 1 84  ? 22.000 33.865 69.874  1.00 18.58 ? 82  PHE A CD2 1 
ATOM   641  C CE1 . PHE A 1 84  ? 22.327 33.181 67.171  1.00 18.38 ? 82  PHE A CE1 1 
ATOM   642  C CE2 . PHE A 1 84  ? 22.947 32.906 69.514  1.00 19.28 ? 82  PHE A CE2 1 
ATOM   643  C CZ  . PHE A 1 84  ? 23.130 32.557 68.173  1.00 19.16 ? 82  PHE A CZ  1 
ATOM   644  N N   . GLY A 1 85  ? 18.950 38.668 69.546  1.00 18.02 ? 83  GLY A N   1 
ATOM   645  C CA  . GLY A 1 85  ? 17.762 39.517 69.699  1.00 18.16 ? 83  GLY A CA  1 
ATOM   646  C C   . GLY A 1 85  ? 16.729 39.013 70.705  1.00 18.36 ? 83  GLY A C   1 
ATOM   647  O O   . GLY A 1 85  ? 15.740 39.706 70.974  1.00 19.04 ? 83  GLY A O   1 
ATOM   648  N N   . ARG A 1 86  ? 16.926 37.797 71.238  1.00 16.25 ? 84  ARG A N   1 
ATOM   649  C CA  . ARG A 1 86  ? 15.958 37.206 72.157  1.00 16.09 ? 84  ARG A CA  1 
ATOM   650  C C   . ARG A 1 86  ? 16.641 36.020 72.876  1.00 15.86 ? 84  ARG A C   1 
ATOM   651  O O   . ARG A 1 86  ? 17.732 35.612 72.518  1.00 14.97 ? 84  ARG A O   1 
ATOM   652  C CB  . ARG A 1 86  ? 14.740 36.695 71.393  1.00 15.73 ? 84  ARG A CB  1 
ATOM   653  C CG  . ARG A 1 86  ? 15.090 35.569 70.374  1.00 16.93 ? 84  ARG A CG  1 
ATOM   654  C CD  . ARG A 1 86  ? 13.938 35.220 69.442  1.00 18.88 ? 84  ARG A CD  1 
ATOM   655  N NE  . ARG A 1 86  ? 12.840 34.665 70.223  1.00 20.50 ? 84  ARG A NE  1 
ATOM   656  C CZ  . ARG A 1 86  ? 11.654 35.253 70.400  1.00 24.40 ? 84  ARG A CZ  1 
ATOM   657  N NH1 . ARG A 1 86  ? 11.364 36.397 69.746  1.00 24.81 ? 84  ARG A NH1 1 
ATOM   658  N NH2 . ARG A 1 86  ? 10.738 34.665 71.185  1.00 21.93 ? 84  ARG A NH2 1 
ATOM   659  N N   . LEU A 1 87  ? 15.935 35.493 73.870  1.00 15.50 ? 85  LEU A N   1 
ATOM   660  C CA  . LEU A 1 87  ? 16.340 34.318 74.618  1.00 14.45 ? 85  LEU A CA  1 
ATOM   661  C C   . LEU A 1 87  ? 15.053 33.554 74.947  1.00 14.45 ? 85  LEU A C   1 
ATOM   662  O O   . LEU A 1 87  ? 14.088 34.148 75.489  1.00 15.30 ? 85  LEU A O   1 
ATOM   663  C CB  . LEU A 1 87  ? 17.108 34.731 75.885  1.00 14.23 ? 85  LEU A CB  1 
ATOM   664  C CG  . LEU A 1 87  ? 17.583 33.554 76.765  1.00 14.83 ? 85  LEU A CG  1 
ATOM   665  C CD1 . LEU A 1 87  ? 18.569 32.627 75.990  1.00 13.75 ? 85  LEU A CD1 1 
ATOM   666  C CD2 . LEU A 1 87  ? 18.147 33.966 78.128  1.00 16.94 ? 85  LEU A CD2 1 
ATOM   667  N N   . ASP A 1 88  ? 15.019 32.269 74.593  1.00 12.97 ? 86  ASP A N   1 
ATOM   668  C CA  . ASP A 1 88  ? 13.841 31.418 74.786  1.00 13.44 ? 86  ASP A CA  1 
ATOM   669  C C   . ASP A 1 88  ? 14.080 30.198 75.683  1.00 12.54 ? 86  ASP A C   1 
ATOM   670  O O   . ASP A 1 88  ? 13.153 29.717 76.334  1.00 13.32 ? 86  ASP A O   1 
ATOM   671  C CB  . ASP A 1 88  ? 13.285 30.928 73.447  1.00 13.91 ? 86  ASP A CB  1 
ATOM   672  C CG  . ASP A 1 88  ? 12.940 32.082 72.510  1.00 16.25 ? 86  ASP A CG  1 
ATOM   673  O OD1 . ASP A 1 88  ? 12.018 32.863 72.867  1.00 17.13 ? 86  ASP A OD1 1 
ATOM   674  O OD2 . ASP A 1 88  ? 13.617 32.209 71.454  1.00 15.38 ? 86  ASP A OD2 1 
ATOM   675  N N   . ILE A 1 89  ? 15.313 29.704 75.659  1.00 12.00 ? 87  ILE A N   1 
ATOM   676  C CA  . ILE A 1 89  ? 15.655 28.441 76.312  1.00 11.89 ? 87  ILE A CA  1 
ATOM   677  C C   . ILE A 1 89  ? 17.001 28.670 77.013  1.00 12.39 ? 87  ILE A C   1 
ATOM   678  O O   . ILE A 1 89  ? 17.984 29.095 76.379  1.00 12.43 ? 87  ILE A O   1 
ATOM   679  C CB  . ILE A 1 89  ? 15.820 27.310 75.274  1.00 12.92 ? 87  ILE A CB  1 
ATOM   680  C CG1 . ILE A 1 89  ? 14.515 27.069 74.485  1.00 11.28 ? 87  ILE A CG1 1 
ATOM   681  C CG2 . ILE A 1 89  ? 16.445 26.047 75.899  1.00 13.46 ? 87  ILE A CG2 1 
ATOM   682  C CD1 . ILE A 1 89  ? 14.793 26.380 73.086  1.00 12.61 ? 87  ILE A CD1 1 
ATOM   683  N N   . LEU A 1 90  ? 17.045 28.435 78.325  1.00 10.21 ? 88  LEU A N   1 
ATOM   684  C CA  . LEU A 1 90  ? 18.315 28.476 79.050  1.00 9.98  ? 88  LEU A CA  1 
ATOM   685  C C   . LEU A 1 90  ? 18.595 27.071 79.582  1.00 10.37 ? 88  LEU A C   1 
ATOM   686  O O   . LEU A 1 90  ? 17.703 26.456 80.206  1.00 12.15 ? 88  LEU A O   1 
ATOM   687  C CB  . LEU A 1 90  ? 18.249 29.445 80.240  1.00 11.01 ? 88  LEU A CB  1 
ATOM   688  C CG  . LEU A 1 90  ? 19.419 29.384 81.245  1.00 11.69 ? 88  LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 90  ? 20.787 29.700 80.641  1.00 11.95 ? 88  LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 90  ? 19.191 30.413 82.380  1.00 12.37 ? 88  LEU A CD2 1 
ATOM   691  N N   . VAL A 1 91  ? 19.798 26.569 79.332  1.00 8.69  ? 89  VAL A N   1 
ATOM   692  C CA  . VAL A 1 91  ? 20.161 25.247 79.882  1.00 9.10  ? 89  VAL A CA  1 
ATOM   693  C C   . VAL A 1 91  ? 21.390 25.433 80.773  1.00 9.48  ? 89  VAL A C   1 
ATOM   694  O O   . VAL A 1 91  ? 22.512 25.743 80.293  1.00 9.25  ? 89  VAL A O   1 
ATOM   695  C CB  . VAL A 1 91  ? 20.416 24.184 78.829  1.00 8.99  ? 89  VAL A CB  1 
ATOM   696  C CG1 . VAL A 1 91  ? 20.599 22.823 79.561  1.00 10.92 ? 89  VAL A CG1 1 
ATOM   697  C CG2 . VAL A 1 91  ? 19.250 24.157 77.777  1.00 9.17  ? 89  VAL A CG2 1 
ATOM   698  N N   . ASN A 1 92  ? 21.158 25.356 82.103  1.00 9.42  ? 90  ASN A N   1 
ATOM   699  C CA  . ASN A 1 92  ? 22.254 25.447 83.061  1.00 10.13 ? 90  ASN A CA  1 
ATOM   700  C C   . ASN A 1 92  ? 22.827 24.046 83.257  1.00 10.76 ? 90  ASN A C   1 
ATOM   701  O O   . ASN A 1 92  ? 22.352 23.237 84.100  1.00 9.76  ? 90  ASN A O   1 
ATOM   702  C CB  . ASN A 1 92  ? 21.758 26.011 84.400  1.00 10.44 ? 90  ASN A CB  1 
ATOM   703  C CG  . ASN A 1 92  ? 21.269 27.463 84.272  1.00 10.12 ? 90  ASN A CG  1 
ATOM   704  O OD1 . ASN A 1 92  ? 22.018 28.335 83.811  1.00 12.50 ? 90  ASN A OD1 1 
ATOM   705  N ND2 . ASN A 1 92  ? 20.015 27.712 84.638  1.00 9.42  ? 90  ASN A ND2 1 
ATOM   706  N N   . ASN A 1 93  ? 23.820 23.743 82.430  1.00 9.98  ? 91  ASN A N   1 
ATOM   707  C CA  . ASN A 1 93  ? 24.376 22.378 82.310  1.00 10.14 ? 91  ASN A CA  1 
ATOM   708  C C   . ASN A 1 93  ? 25.822 22.258 82.829  1.00 10.67 ? 91  ASN A C   1 
ATOM   709  O O   . ASN A 1 93  ? 26.257 21.185 83.285  1.00 10.83 ? 91  ASN A O   1 
ATOM   710  C CB  . ASN A 1 93  ? 24.301 21.913 80.833  1.00 10.17 ? 91  ASN A CB  1 
ATOM   711  C CG  . ASN A 1 93  ? 25.206 20.718 80.527  1.00 10.30 ? 91  ASN A CG  1 
ATOM   712  O OD1 . ASN A 1 93  ? 24.858 19.558 80.813  1.00 10.73 ? 91  ASN A OD1 1 
ATOM   713  N ND2 . ASN A 1 93  ? 26.393 21.000 79.980  1.00 9.14  ? 91  ASN A ND2 1 
ATOM   714  N N   . ALA A 1 94  ? 26.598 23.323 82.788  1.00 10.93 ? 92  ALA A N   1 
ATOM   715  C CA  . ALA A 1 94  ? 27.983 23.202 83.280  1.00 10.78 ? 92  ALA A CA  1 
ATOM   716  C C   . ALA A 1 94  ? 27.976 22.586 84.701  1.00 10.92 ? 92  ALA A C   1 
ATOM   717  O O   . ALA A 1 94  ? 27.138 22.896 85.576  1.00 9.95  ? 92  ALA A O   1 
ATOM   718  C CB  . ALA A 1 94  ? 28.654 24.541 83.370  1.00 12.34 ? 92  ALA A CB  1 
ATOM   719  N N   . GLY A 1 95  ? 28.922 21.682 84.903  1.00 11.01 ? 93  GLY A N   1 
ATOM   720  C CA  . GLY A 1 95  ? 29.123 21.112 86.221  1.00 11.07 ? 93  GLY A CA  1 
ATOM   721  C C   . GLY A 1 95  ? 30.447 20.369 86.258  1.00 12.34 ? 93  GLY A C   1 
ATOM   722  O O   . GLY A 1 95  ? 31.041 20.060 85.202  1.00 11.33 ? 93  GLY A O   1 
ATOM   723  N N   . VAL A 1 96  ? 30.892 20.087 87.481  1.00 11.02 ? 94  VAL A N   1 
ATOM   724  C CA  . VAL A 1 96  ? 32.146 19.390 87.709  1.00 11.84 ? 94  VAL A CA  1 
ATOM   725  C C   . VAL A 1 96  ? 31.948 18.375 88.842  1.00 12.07 ? 94  VAL A C   1 
ATOM   726  O O   . VAL A 1 96  ? 30.962 18.450 89.599  1.00 11.29 ? 94  VAL A O   1 
ATOM   727  C CB  . VAL A 1 96  ? 33.305 20.367 88.081  1.00 11.68 ? 94  VAL A CB  1 
ATOM   728  C CG1 . VAL A 1 96  ? 33.580 21.445 86.945  1.00 13.22 ? 94  VAL A CG1 1 
ATOM   729  C CG2 . VAL A 1 96  ? 33.019 21.097 89.435  1.00 9.78  ? 94  VAL A CG2 1 
ATOM   730  N N   . ASN A 1 97  ? 32.901 17.446 88.925  1.00 11.56 ? 95  ASN A N   1 
ATOM   731  C CA  . ASN A 1 97  ? 33.030 16.534 90.057  1.00 11.79 ? 95  ASN A CA  1 
ATOM   732  C C   . ASN A 1 97  ? 34.367 16.770 90.717  1.00 11.72 ? 95  ASN A C   1 
ATOM   733  O O   . ASN A 1 97  ? 35.432 16.558 90.090  1.00 12.11 ? 95  ASN A O   1 
ATOM   734  C CB  . ASN A 1 97  ? 32.967 15.063 89.613  1.00 11.32 ? 95  ASN A CB  1 
ATOM   735  C CG  . ASN A 1 97  ? 33.261 14.119 90.770  1.00 14.17 ? 95  ASN A CG  1 
ATOM   736  O OD1 . ASN A 1 97  ? 32.661 14.253 91.839  1.00 15.88 ? 95  ASN A OD1 1 
ATOM   737  N ND2 . ASN A 1 97  ? 34.163 13.149 90.564  1.00 17.83 ? 95  ASN A ND2 1 
ATOM   738  N N   . ASN A 1 98  ? 34.330 17.258 91.954  1.00 11.54 ? 96  ASN A N   1 
ATOM   739  C CA  . ASN A 1 98  ? 35.547 17.464 92.696  1.00 11.86 ? 96  ASN A CA  1 
ATOM   740  C C   . ASN A 1 98  ? 35.197 17.580 94.176  1.00 12.48 ? 96  ASN A C   1 
ATOM   741  O O   . ASN A 1 98  ? 34.689 18.610 94.617  1.00 12.87 ? 96  ASN A O   1 
ATOM   742  C CB  . ASN A 1 98  ? 36.303 18.714 92.196  1.00 12.68 ? 96  ASN A CB  1 
ATOM   743  C CG  . ASN A 1 98  ? 37.696 18.821 92.842  1.00 13.61 ? 96  ASN A CG  1 
ATOM   744  O OD1 . ASN A 1 98  ? 37.891 18.335 93.946  1.00 13.93 ? 96  ASN A OD1 1 
ATOM   745  N ND2 . ASN A 1 98  ? 38.644 19.438 92.140  1.00 16.34 ? 96  ASN A ND2 1 
ATOM   746  N N   . GLU A 1 99  ? 35.469 16.493 94.891  1.00 11.15 ? 97  GLU A N   1 
ATOM   747  C CA  . GLU A 1 99  ? 35.210 16.365 96.343  1.00 12.05 ? 97  GLU A CA  1 
ATOM   748  C C   . GLU A 1 99  ? 36.389 16.904 97.182  1.00 12.79 ? 97  GLU A C   1 
ATOM   749  O O   . GLU A 1 99  ? 36.238 17.080 98.412  1.00 11.94 ? 97  GLU A O   1 
ATOM   750  C CB  . GLU A 1 99  ? 34.922 14.919 96.693  1.00 12.77 ? 97  GLU A CB  1 
ATOM   751  C CG  . GLU A 1 99  ? 33.637 14.359 96.057  1.00 13.28 ? 97  GLU A CG  1 
ATOM   752  C CD  . GLU A 1 99  ? 32.333 15.050 96.539  1.00 13.50 ? 97  GLU A CD  1 
ATOM   753  O OE1 . GLU A 1 99  ? 32.229 15.395 97.750  1.00 10.78 ? 97  GLU A OE1 1 
ATOM   754  O OE2 . GLU A 1 99  ? 31.426 15.231 95.682  1.00 13.33 ? 97  GLU A OE2 1 
ATOM   755  N N   . LYS A 1 100 ? 37.529 17.174 96.527  1.00 13.23 ? 98  LYS A N   1 
ATOM   756  C CA  . LYS A 1 100 ? 38.685 17.789 97.213  1.00 14.40 ? 98  LYS A CA  1 
ATOM   757  C C   . LYS A 1 100 ? 38.540 19.315 97.343  1.00 14.20 ? 98  LYS A C   1 
ATOM   758  O O   . LYS A 1 100 ? 38.449 19.837 98.464  1.00 16.24 ? 98  LYS A O   1 
ATOM   759  C CB  . LYS A 1 100 ? 39.994 17.368 96.558  1.00 15.66 ? 98  LYS A CB  1 
ATOM   760  C CG  . LYS A 1 100 ? 41.172 18.008 97.255  1.00 18.89 ? 98  LYS A CG  1 
ATOM   761  C CD  . LYS A 1 100 ? 42.475 17.789 96.459  1.00 23.80 ? 98  LYS A CD  1 
ATOM   762  C CE  . LYS A 1 100 ? 43.164 16.551 96.932  1.00 26.61 ? 98  LYS A CE  1 
ATOM   763  N NZ  . LYS A 1 100 ? 44.539 16.420 96.315  1.00 24.72 ? 98  LYS A NZ  1 
ATOM   764  N N   . ASN A 1 101 ? 38.457 20.015 96.204  1.00 14.27 ? 99  ASN A N   1 
ATOM   765  C CA  A ASN A 1 101 ? 38.080 21.401 96.123  0.50 14.44 ? 99  ASN A CA  1 
ATOM   766  C CA  B ASN A 1 101 ? 38.051 21.444 96.225  0.50 14.22 ? 99  ASN A CA  1 
ATOM   767  C C   . ASN A 1 101 ? 36.541 21.517 96.053  1.00 14.49 ? 99  ASN A C   1 
ATOM   768  O O   . ASN A 1 101 ? 35.990 21.965 95.021  1.00 14.40 ? 99  ASN A O   1 
ATOM   769  C CB  A ASN A 1 101 ? 38.733 21.995 94.873  0.50 15.14 ? 99  ASN A CB  1 
ATOM   770  C CB  B ASN A 1 101 ? 38.754 22.361 95.204  0.50 14.89 ? 99  ASN A CB  1 
ATOM   771  C CG  A ASN A 1 101 ? 40.217 21.714 94.821  0.50 17.17 ? 99  ASN A CG  1 
ATOM   772  C CG  B ASN A 1 101 ? 38.364 23.876 95.359  0.50 14.87 ? 99  ASN A CG  1 
ATOM   773  O OD1 A ASN A 1 101 ? 40.717 21.127 93.851  0.50 21.08 ? 99  ASN A OD1 1 
ATOM   774  O OD1 B ASN A 1 101 ? 37.602 24.323 96.279  0.50 11.67 ? 99  ASN A OD1 1 
ATOM   775  N ND2 A ASN A 1 101 ? 40.926 22.090 95.885  0.50 16.38 ? 99  ASN A ND2 1 
ATOM   776  N ND2 B ASN A 1 101 ? 38.879 24.677 94.405  0.50 15.61 ? 99  ASN A ND2 1 
ATOM   777  N N   . TRP A 1 102 ? 35.883 21.103 97.122  1.00 13.60 ? 100 TRP A N   1 
ATOM   778  C CA  . TRP A 1 102 ? 34.423 20.941 97.116  1.00 12.20 ? 100 TRP A CA  1 
ATOM   779  C C   . TRP A 1 102 ? 33.680 22.267 97.136  1.00 12.25 ? 100 TRP A C   1 
ATOM   780  O O   . TRP A 1 102 ? 32.545 22.336 96.691  1.00 12.46 ? 100 TRP A O   1 
ATOM   781  C CB  . TRP A 1 102 ? 34.002 19.964 98.249  1.00 12.76 ? 100 TRP A CB  1 
ATOM   782  C CG  . TRP A 1 102 ? 34.360 20.445 99.597  1.00 13.80 ? 100 TRP A CG  1 
ATOM   783  C CD1 . TRP A 1 102 ? 35.459 20.099 100.332 1.00 14.07 ? 100 TRP A CD1 1 
ATOM   784  C CD2 . TRP A 1 102 ? 33.614 21.405 100.386 1.00 13.79 ? 100 TRP A CD2 1 
ATOM   785  N NE1 . TRP A 1 102 ? 35.437 20.789 101.556 1.00 12.87 ? 100 TRP A NE1 1 
ATOM   786  C CE2 . TRP A 1 102 ? 34.336 21.615 101.590 1.00 12.38 ? 100 TRP A CE2 1 
ATOM   787  C CE3 . TRP A 1 102 ? 32.420 22.116 100.174 1.00 12.20 ? 100 TRP A CE3 1 
ATOM   788  C CZ2 . TRP A 1 102 ? 33.877 22.475 102.600 1.00 13.31 ? 100 TRP A CZ2 1 
ATOM   789  C CZ3 . TRP A 1 102 ? 31.958 22.988 101.185 1.00 12.37 ? 100 TRP A CZ3 1 
ATOM   790  C CH2 . TRP A 1 102 ? 32.701 23.166 102.385 1.00 13.26 ? 100 TRP A CH2 1 
ATOM   791  N N   . GLU A 1 103 ? 34.298 23.301 97.711  1.00 11.76 ? 101 GLU A N   1 
ATOM   792  C CA  . GLU A 1 103 ? 33.678 24.622 97.737  1.00 12.85 ? 101 GLU A CA  1 
ATOM   793  C C   . GLU A 1 103 ? 33.478 25.116 96.301  1.00 12.39 ? 101 GLU A C   1 
ATOM   794  O O   . GLU A 1 103 ? 32.389 25.588 95.956  1.00 11.78 ? 101 GLU A O   1 
ATOM   795  C CB  . GLU A 1 103 ? 34.534 25.619 98.551  1.00 14.15 ? 101 GLU A CB  1 
ATOM   796  C CG  . GLU A 1 103 ? 34.744 25.152 99.968  1.00 16.12 ? 101 GLU A CG  1 
ATOM   797  C CD  . GLU A 1 103 ? 36.134 24.490 100.221 1.00 22.93 ? 101 GLU A CD  1 
ATOM   798  O OE1 . GLU A 1 103 ? 36.733 23.782 99.303  1.00 17.29 ? 101 GLU A OE1 1 
ATOM   799  O OE2 . GLU A 1 103 ? 36.617 24.705 101.387 1.00 21.91 ? 101 GLU A OE2 1 
ATOM   800  N N   . LYS A 1 104 ? 34.501 24.931 95.453  1.00 12.54 ? 102 LYS A N   1 
ATOM   801  C CA  . LYS A 1 104 ? 34.407 25.313 94.018  1.00 13.98 ? 102 LYS A CA  1 
ATOM   802  C C   . LYS A 1 104 ? 33.309 24.502 93.294  1.00 12.77 ? 102 LYS A C   1 
ATOM   803  O O   . LYS A 1 104 ? 32.569 25.034 92.484  1.00 12.79 ? 102 LYS A O   1 
ATOM   804  C CB  . LYS A 1 104 ? 35.742 25.057 93.306  1.00 14.21 ? 102 LYS A CB  1 
ATOM   805  C CG  . LYS A 1 104 ? 35.792 25.603 91.879  1.00 18.74 ? 102 LYS A CG  1 
ATOM   806  C CD  . LYS A 1 104 ? 37.263 25.742 91.443  1.00 24.56 ? 102 LYS A CD  1 
ATOM   807  C CE  . LYS A 1 104 ? 37.426 26.114 89.953  1.00 31.41 ? 102 LYS A CE  1 
ATOM   808  N NZ  . LYS A 1 104 ? 38.577 25.345 89.324  1.00 32.53 ? 102 LYS A NZ  1 
ATOM   809  N N   . THR A 1 105 ? 33.216 23.220 93.618  1.00 12.24 ? 103 THR A N   1 
ATOM   810  C CA  . THR A 1 105 ? 32.161 22.351 93.098  1.00 12.67 ? 103 THR A CA  1 
ATOM   811  C C   . THR A 1 105 ? 30.776 22.926 93.435  1.00 11.00 ? 103 THR A C   1 
ATOM   812  O O   . THR A 1 105 ? 29.882 22.979 92.592  1.00 12.04 ? 103 THR A O   1 
ATOM   813  C CB  . THR A 1 105 ? 32.363 20.911 93.599  1.00 13.30 ? 103 THR A CB  1 
ATOM   814  O OG1 . THR A 1 105 ? 33.652 20.451 93.106  1.00 11.88 ? 103 THR A OG1 1 
ATOM   815  C CG2 . THR A 1 105 ? 31.208 19.988 93.139  1.00 12.71 ? 103 THR A CG2 1 
ATOM   816  N N   . LEU A 1 106 ? 30.567 23.342 94.679  1.00 9.71  ? 104 LEU A N   1 
ATOM   817  C CA  . LEU A 1 106 ? 29.295 23.973 95.003  1.00 11.53 ? 104 LEU A CA  1 
ATOM   818  C C   . LEU A 1 106 ? 29.065 25.270 94.221  1.00 11.55 ? 104 LEU A C   1 
ATOM   819  O O   . LEU A 1 106 ? 27.937 25.591 93.800  1.00 12.03 ? 104 LEU A O   1 
ATOM   820  C CB  . LEU A 1 106 ? 29.223 24.248 96.494  1.00 12.43 ? 104 LEU A CB  1 
ATOM   821  C CG  . LEU A 1 106 ? 28.908 23.000 97.327  1.00 13.79 ? 104 LEU A CG  1 
ATOM   822  C CD1 . LEU A 1 106 ? 29.016 23.391 98.849  1.00 15.54 ? 104 LEU A CD1 1 
ATOM   823  C CD2 . LEU A 1 106 ? 27.498 22.412 97.010  1.00 14.96 ? 104 LEU A CD2 1 
ATOM   824  N N   . GLN A 1 107 ? 30.140 26.042 94.040  1.00 11.18 ? 105 GLN A N   1 
ATOM   825  C CA  . GLN A 1 107 ? 30.028 27.336 93.360  1.00 11.78 ? 105 GLN A CA  1 
ATOM   826  C C   . GLN A 1 107 ? 29.592 27.073 91.908  1.00 10.74 ? 105 GLN A C   1 
ATOM   827  O O   . GLN A 1 107 ? 28.654 27.721 91.392  1.00 11.11 ? 105 GLN A O   1 
ATOM   828  C CB  . GLN A 1 107 ? 31.384 28.045 93.372  1.00 12.66 ? 105 GLN A CB  1 
ATOM   829  C CG  . GLN A 1 107 ? 31.694 28.771 94.712  1.00 16.55 ? 105 GLN A CG  1 
ATOM   830  C CD  A GLN A 1 107 ? 30.873 30.044 94.878  0.50 14.40 ? 105 GLN A CD  1 
ATOM   831  C CD  B GLN A 1 107 ? 30.506 29.540 95.344  0.50 17.43 ? 105 GLN A CD  1 
ATOM   832  O OE1 A GLN A 1 107 ? 30.527 30.722 93.902  0.50 19.60 ? 105 GLN A OE1 1 
ATOM   833  O OE1 B GLN A 1 107 ? 30.091 29.249 96.478  0.50 22.05 ? 105 GLN A OE1 1 
ATOM   834  N NE2 A GLN A 1 107 ? 30.548 30.359 96.110  0.50 15.84 ? 105 GLN A NE2 1 
ATOM   835  N NE2 B GLN A 1 107 ? 29.960 30.510 94.615  0.50 18.12 ? 105 GLN A NE2 1 
ATOM   836  N N   . ILE A 1 108 ? 30.222 26.087 91.270  1.00 10.88 ? 106 ILE A N   1 
ATOM   837  C CA  . ILE A 1 108 ? 29.892 25.836 89.860  1.00 10.91 ? 106 ILE A CA  1 
ATOM   838  C C   . ILE A 1 108 ? 28.527 25.117 89.741  1.00 10.96 ? 106 ILE A C   1 
ATOM   839  O O   . ILE A 1 108 ? 27.623 25.564 88.997  1.00 11.66 ? 106 ILE A O   1 
ATOM   840  C CB  . ILE A 1 108 ? 30.989 25.014 89.158  1.00 11.39 ? 106 ILE A CB  1 
ATOM   841  C CG1 . ILE A 1 108 ? 32.292 25.841 89.144  1.00 12.01 ? 106 ILE A CG1 1 
ATOM   842  C CG2 . ILE A 1 108 ? 30.548 24.678 87.705  1.00 11.86 ? 106 ILE A CG2 1 
ATOM   843  C CD1 . ILE A 1 108 ? 33.555 25.073 88.765  1.00 14.68 ? 106 ILE A CD1 1 
ATOM   844  N N   . ASN A 1 109 ? 28.382 24.021 90.483  1.00 10.20 ? 107 ASN A N   1 
ATOM   845  C CA  . ASN A 1 109 ? 27.232 23.124 90.287  1.00 10.65 ? 107 ASN A CA  1 
ATOM   846  C C   . ASN A 1 109 ? 25.887 23.697 90.781  1.00 10.96 ? 107 ASN A C   1 
ATOM   847  O O   . ASN A 1 109 ? 24.846 23.405 90.210  1.00 13.10 ? 107 ASN A O   1 
ATOM   848  C CB  . ASN A 1 109 ? 27.468 21.795 90.986  1.00 9.65  ? 107 ASN A CB  1 
ATOM   849  C CG  . ASN A 1 109 ? 28.459 20.890 90.259  1.00 11.16 ? 107 ASN A CG  1 
ATOM   850  O OD1 . ASN A 1 109 ? 29.178 21.345 89.355  1.00 11.43 ? 107 ASN A OD1 1 
ATOM   851  N ND2 . ASN A 1 109 ? 28.530 19.611 90.704  1.00 10.73 ? 107 ASN A ND2 1 
ATOM   852  N N   . LEU A 1 110 ? 25.909 24.475 91.872  1.00 9.89  ? 108 LEU A N   1 
ATOM   853  C CA  . LEU A 1 110 ? 24.690 24.962 92.532  1.00 9.65  ? 108 LEU A CA  1 
ATOM   854  C C   . LEU A 1 110 ? 24.558 26.476 92.410  1.00 10.01 ? 108 LEU A C   1 
ATOM   855  O O   . LEU A 1 110 ? 23.541 26.980 91.915  1.00 10.41 ? 108 LEU A O   1 
ATOM   856  C CB  . LEU A 1 110 ? 24.684 24.533 94.005  1.00 10.02 ? 108 LEU A CB  1 
ATOM   857  C CG  . LEU A 1 110 ? 23.397 24.922 94.771  1.00 10.75 ? 108 LEU A CG  1 
ATOM   858  C CD1 . LEU A 1 110 ? 22.102 24.464 94.027  1.00 12.09 ? 108 LEU A CD1 1 
ATOM   859  C CD2 . LEU A 1 110 ? 23.412 24.394 96.230  1.00 10.07 ? 108 LEU A CD2 1 
ATOM   860  N N   . VAL A 1 111 ? 25.550 27.206 92.942  1.00 9.56  ? 109 VAL A N   1 
ATOM   861  C CA  . VAL A 1 111 ? 25.453 28.668 92.960  1.00 10.88 ? 109 VAL A CA  1 
ATOM   862  C C   . VAL A 1 111 ? 25.242 29.186 91.545  1.00 9.91  ? 109 VAL A C   1 
ATOM   863  O O   . VAL A 1 111 ? 24.365 30.035 91.297  1.00 11.41 ? 109 VAL A O   1 
ATOM   864  C CB  . VAL A 1 111 ? 26.710 29.346 93.608  1.00 10.68 ? 109 VAL A CB  1 
ATOM   865  C CG1 . VAL A 1 111 ? 26.555 30.867 93.515  1.00 13.68 ? 109 VAL A CG1 1 
ATOM   866  C CG2 . VAL A 1 111 ? 26.853 28.836 95.092  1.00 13.73 ? 109 VAL A CG2 1 
ATOM   867  N N   . SER A 1 112 ? 26.022 28.656 90.596  1.00 11.08 ? 110 SER A N   1 
ATOM   868  C CA  . SER A 1 112 ? 25.916 29.163 89.206  1.00 12.32 ? 110 SER A CA  1 
ATOM   869  C C   . SER A 1 112 ? 24.603 28.765 88.499  1.00 12.38 ? 110 SER A C   1 
ATOM   870  O O   . SER A 1 112 ? 24.120 29.444 87.563  1.00 12.50 ? 110 SER A O   1 
ATOM   871  C CB  . SER A 1 112 ? 27.125 28.686 88.418  1.00 13.43 ? 110 SER A CB  1 
ATOM   872  O OG  . SER A 1 112 ? 28.323 29.270 88.952  1.00 14.54 ? 110 SER A OG  1 
ATOM   873  N N   . VAL A 1 113 ? 24.010 27.650 88.936  1.00 10.30 ? 111 VAL A N   1 
ATOM   874  C CA  . VAL A 1 113 ? 22.705 27.256 88.406  1.00 9.50  ? 111 VAL A CA  1 
ATOM   875  C C   . VAL A 1 113 ? 21.652 28.267 88.882  1.00 9.98  ? 111 VAL A C   1 
ATOM   876  O O   . VAL A 1 113 ? 20.822 28.716 88.110  1.00 9.40  ? 111 VAL A O   1 
ATOM   877  C CB  . VAL A 1 113 ? 22.307 25.809 88.778  1.00 9.69  ? 111 VAL A CB  1 
ATOM   878  C CG1 . VAL A 1 113 ? 20.807 25.637 88.555  1.00 11.93 ? 111 VAL A CG1 1 
ATOM   879  C CG2 . VAL A 1 113 ? 23.207 24.822 87.943  1.00 12.33 ? 111 VAL A CG2 1 
ATOM   880  N N   . ILE A 1 114 ? 21.750 28.698 90.134  1.00 8.82  ? 112 ILE A N   1 
ATOM   881  C CA  . ILE A 1 114 ? 20.825 29.677 90.663  1.00 8.77  ? 112 ILE A CA  1 
ATOM   882  C C   . ILE A 1 114 ? 21.022 31.056 89.982  1.00 8.55  ? 112 ILE A C   1 
ATOM   883  O O   . ILE A 1 114 ? 20.044 31.680 89.540  1.00 9.68  ? 112 ILE A O   1 
ATOM   884  C CB  . ILE A 1 114 ? 20.964 29.785 92.202  1.00 9.20  ? 112 ILE A CB  1 
ATOM   885  C CG1 . ILE A 1 114 ? 20.522 28.443 92.840  1.00 10.63 ? 112 ILE A CG1 1 
ATOM   886  C CG2 . ILE A 1 114 ? 20.183 30.982 92.741  1.00 10.26 ? 112 ILE A CG2 1 
ATOM   887  C CD1 . ILE A 1 114 ? 20.894 28.304 94.297  1.00 12.72 ? 112 ILE A CD1 1 
ATOM   888  N N   . SER A 1 115 ? 22.282 31.500 89.906  1.00 10.32 ? 113 SER A N   1 
ATOM   889  C CA  . SER A 1 115 ? 22.624 32.808 89.306  1.00 10.83 ? 113 SER A CA  1 
ATOM   890  C C   . SER A 1 115 ? 22.148 32.803 87.840  1.00 10.73 ? 113 SER A C   1 
ATOM   891  O O   . SER A 1 115 ? 21.474 33.766 87.392  1.00 11.20 ? 113 SER A O   1 
ATOM   892  C CB  A SER A 1 115 ? 24.151 33.057 89.352  0.33 11.27 ? 113 SER A CB  1 
ATOM   893  C CB  B SER A 1 115 ? 24.115 33.152 89.433  0.33 11.17 ? 113 SER A CB  1 
ATOM   894  C CB  C SER A 1 115 ? 24.155 32.993 89.369  0.34 11.58 ? 113 SER A CB  1 
ATOM   895  O OG  A SER A 1 115 ? 24.630 33.146 90.684  0.33 9.10  ? 113 SER A OG  1 
ATOM   896  O OG  B SER A 1 115 ? 24.875 32.223 88.715  0.33 7.42  ? 113 SER A OG  1 
ATOM   897  O OG  C SER A 1 115 ? 24.580 34.106 88.620  0.34 11.58 ? 113 SER A OG  1 
ATOM   898  N N   . GLY A 1 116 ? 22.434 31.725 87.104  1.00 11.06 ? 114 GLY A N   1 
ATOM   899  C CA  . GLY A 1 116 ? 22.029 31.666 85.673  1.00 11.81 ? 114 GLY A CA  1 
ATOM   900  C C   . GLY A 1 116 ? 20.492 31.646 85.576  1.00 11.49 ? 114 GLY A C   1 
ATOM   901  O O   . GLY A 1 116 ? 19.878 32.329 84.729  1.00 10.69 ? 114 GLY A O   1 
ATOM   902  N N   . THR A 1 117 ? 19.837 30.841 86.439  1.00 10.14 ? 115 THR A N   1 
ATOM   903  C CA  . THR A 1 117 ? 18.376 30.816 86.447  1.00 10.87 ? 115 THR A CA  1 
ATOM   904  C C   . THR A 1 117 ? 17.797 32.236 86.625  1.00 10.96 ? 115 THR A C   1 
ATOM   905  O O   . THR A 1 117 ? 16.901 32.649 85.885  1.00 11.41 ? 115 THR A O   1 
ATOM   906  C CB  . THR A 1 117 ? 17.791 29.813 87.505  1.00 10.64 ? 115 THR A CB  1 
ATOM   907  O OG1 . THR A 1 117 ? 18.138 28.478 87.099  1.00 9.12  ? 115 THR A OG1 1 
ATOM   908  C CG2 . THR A 1 117 ? 16.246 29.915 87.595  1.00 9.26  ? 115 THR A CG2 1 
ATOM   909  N N   . TYR A 1 118 ? 18.336 32.958 87.596  1.00 10.88 ? 116 TYR A N   1 
ATOM   910  C CA  . TYR A 1 118 ? 17.843 34.295 87.896  1.00 12.24 ? 116 TYR A CA  1 
ATOM   911  C C   . TYR A 1 118 ? 18.074 35.264 86.724  1.00 11.81 ? 116 TYR A C   1 
ATOM   912  O O   . TYR A 1 118 ? 17.196 36.104 86.417  1.00 12.16 ? 116 TYR A O   1 
ATOM   913  C CB  . TYR A 1 118 ? 18.438 34.804 89.201  1.00 13.04 ? 116 TYR A CB  1 
ATOM   914  C CG  . TYR A 1 118 ? 17.765 34.234 90.440  1.00 12.79 ? 116 TYR A CG  1 
ATOM   915  C CD1 . TYR A 1 118 ? 16.565 33.523 90.355  1.00 13.66 ? 116 TYR A CD1 1 
ATOM   916  C CD2 . TYR A 1 118 ? 18.300 34.471 91.699  1.00 14.47 ? 116 TYR A CD2 1 
ATOM   917  C CE1 . TYR A 1 118 ? 15.917 33.020 91.502  1.00 15.00 ? 116 TYR A CE1 1 
ATOM   918  C CE2 . TYR A 1 118 ? 17.661 33.978 92.872  1.00 13.93 ? 116 TYR A CE2 1 
ATOM   919  C CZ  . TYR A 1 118 ? 16.464 33.275 92.761  1.00 14.88 ? 116 TYR A CZ  1 
ATOM   920  O OH  . TYR A 1 118 ? 15.822 32.798 93.895  1.00 13.79 ? 116 TYR A OH  1 
ATOM   921  N N   . LEU A 1 119 ? 19.202 35.108 86.044  1.00 12.18 ? 117 LEU A N   1 
ATOM   922  C CA  . LEU A 1 119 ? 19.478 35.936 84.824  1.00 13.09 ? 117 LEU A CA  1 
ATOM   923  C C   . LEU A 1 119 ? 18.485 35.523 83.722  1.00 13.59 ? 117 LEU A C   1 
ATOM   924  O O   . LEU A 1 119 ? 17.873 36.373 83.048  1.00 13.47 ? 117 LEU A O   1 
ATOM   925  C CB  . LEU A 1 119 ? 20.916 35.763 84.355  1.00 13.26 ? 117 LEU A CB  1 
ATOM   926  C CG  . LEU A 1 119 ? 21.948 36.542 85.185  1.00 13.21 ? 117 LEU A CG  1 
ATOM   927  C CD1 . LEU A 1 119 ? 23.345 36.020 85.074  1.00 15.02 ? 117 LEU A CD1 1 
ATOM   928  C CD2 . LEU A 1 119 ? 21.843 38.090 84.770  1.00 14.85 ? 117 LEU A CD2 1 
ATOM   929  N N   . GLY A 1 120 ? 18.236 34.218 83.573  1.00 12.22 ? 118 GLY A N   1 
ATOM   930  C CA  . GLY A 1 120 ? 17.178 33.760 82.613  1.00 12.02 ? 118 GLY A CA  1 
ATOM   931  C C   . GLY A 1 120 ? 15.827 34.409 82.875  1.00 12.44 ? 118 GLY A C   1 
ATOM   932  O O   . GLY A 1 120 ? 15.157 34.882 81.959  1.00 13.65 ? 118 GLY A O   1 
ATOM   933  N N   . LEU A 1 121 ? 15.441 34.497 84.150  1.00 11.72 ? 119 LEU A N   1 
ATOM   934  C CA  . LEU A 1 121 ? 14.189 35.105 84.534  1.00 13.18 ? 119 LEU A CA  1 
ATOM   935  C C   . LEU A 1 121 ? 14.245 36.616 84.252  1.00 13.72 ? 119 LEU A C   1 
ATOM   936  O O   . LEU A 1 121 ? 13.257 37.168 83.780  1.00 13.90 ? 119 LEU A O   1 
ATOM   937  C CB  . LEU A 1 121 ? 13.895 34.830 86.009  1.00 13.22 ? 119 LEU A CB  1 
ATOM   938  C CG  . LEU A 1 121 ? 13.581 33.318 86.239  1.00 14.19 ? 119 LEU A CG  1 
ATOM   939  C CD1 . LEU A 1 121 ? 13.417 33.098 87.736  1.00 15.72 ? 119 LEU A CD1 1 
ATOM   940  C CD2 . LEU A 1 121 ? 12.333 32.828 85.464  1.00 14.21 ? 119 LEU A CD2 1 
ATOM   941  N N   . ASP A 1 122 ? 15.406 37.233 84.476  1.00 14.07 ? 120 ASP A N   1 
ATOM   942  C CA  . ASP A 1 122 ? 15.589 38.686 84.235  1.00 14.37 ? 120 ASP A CA  1 
ATOM   943  C C   . ASP A 1 122 ? 15.231 39.034 82.787  1.00 15.77 ? 120 ASP A C   1 
ATOM   944  O O   . ASP A 1 122 ? 14.543 40.031 82.531  1.00 16.80 ? 120 ASP A O   1 
ATOM   945  C CB  . ASP A 1 122 ? 17.048 39.118 84.477  1.00 15.72 ? 120 ASP A CB  1 
ATOM   946  C CG  . ASP A 1 122 ? 17.397 39.256 85.960  1.00 16.68 ? 120 ASP A CG  1 
ATOM   947  O OD1 . ASP A 1 122 ? 16.464 39.357 86.804  1.00 18.50 ? 120 ASP A OD1 1 
ATOM   948  O OD2 . ASP A 1 122 ? 18.628 39.247 86.259  1.00 18.47 ? 120 ASP A OD2 1 
ATOM   949  N N   . TYR A 1 123 ? 15.670 38.187 81.860  1.00 14.18 ? 121 TYR A N   1 
ATOM   950  C CA  . TYR A 1 123 ? 15.389 38.393 80.419  1.00 15.30 ? 121 TYR A CA  1 
ATOM   951  C C   . TYR A 1 123 ? 14.036 37.856 79.953  1.00 15.94 ? 121 TYR A C   1 
ATOM   952  O O   . TYR A 1 123 ? 13.298 38.542 79.206  1.00 16.54 ? 121 TYR A O   1 
ATOM   953  C CB  . TYR A 1 123 ? 16.507 37.777 79.582  1.00 15.35 ? 121 TYR A CB  1 
ATOM   954  C CG  . TYR A 1 123 ? 17.761 38.581 79.626  1.00 15.72 ? 121 TYR A CG  1 
ATOM   955  C CD1 . TYR A 1 123 ? 17.949 39.650 78.731  1.00 16.95 ? 121 TYR A CD1 1 
ATOM   956  C CD2 . TYR A 1 123 ? 18.744 38.327 80.575  1.00 15.37 ? 121 TYR A CD2 1 
ATOM   957  C CE1 . TYR A 1 123 ? 19.107 40.382 78.750  1.00 16.03 ? 121 TYR A CE1 1 
ATOM   958  C CE2 . TYR A 1 123 ? 19.907 39.082 80.630  1.00 16.13 ? 121 TYR A CE2 1 
ATOM   959  C CZ  . TYR A 1 123 ? 20.070 40.122 79.717  1.00 17.64 ? 121 TYR A CZ  1 
ATOM   960  O OH  . TYR A 1 123 ? 21.187 40.881 79.745  1.00 18.04 ? 121 TYR A OH  1 
ATOM   961  N N   . MET A 1 124 ? 13.695 36.641 80.387  1.00 13.36 ? 122 MET A N   1 
ATOM   962  C CA  . MET A 1 124 ? 12.543 35.952 79.821  1.00 13.90 ? 122 MET A CA  1 
ATOM   963  C C   . MET A 1 124 ? 11.210 36.186 80.497  1.00 13.84 ? 122 MET A C   1 
ATOM   964  O O   . MET A 1 124 ? 10.171 35.925 79.887  1.00 14.43 ? 122 MET A O   1 
ATOM   965  C CB  . MET A 1 124 ? 12.828 34.430 79.742  1.00 12.56 ? 122 MET A CB  1 
ATOM   966  C CG  . MET A 1 124 ? 14.047 34.096 78.875  1.00 14.54 ? 122 MET A CG  1 
ATOM   967  S SD  . MET A 1 124 ? 14.108 32.338 78.432  1.00 18.04 ? 122 MET A SD  1 
ATOM   968  C CE  . MET A 1 124 ? 14.650 31.815 80.060  1.00 14.96 ? 122 MET A CE  1 
ATOM   969  N N   . SER A 1 125 ? 11.184 36.585 81.772  1.00 13.62 ? 123 SER A N   1 
ATOM   970  C CA  A SER A 1 125 ? 9.894  36.741 82.441  0.50 13.50 ? 123 SER A CA  1 
ATOM   971  C CA  B SER A 1 125 ? 9.903  36.740 82.463  0.50 13.53 ? 123 SER A CA  1 
ATOM   972  C C   . SER A 1 125 ? 9.021  37.770 81.747  1.00 13.21 ? 123 SER A C   1 
ATOM   973  O O   . SER A 1 125 ? 9.486  38.869 81.453  1.00 13.61 ? 123 SER A O   1 
ATOM   974  C CB  A SER A 1 125 ? 10.037 37.186 83.886  0.50 13.17 ? 123 SER A CB  1 
ATOM   975  C CB  B SER A 1 125 ? 10.106 37.149 83.932  0.50 13.33 ? 123 SER A CB  1 
ATOM   976  O OG  A SER A 1 125 ? 8.752  37.492 84.376  0.50 12.35 ? 123 SER A OG  1 
ATOM   977  O OG  B SER A 1 125 ? 10.893 36.186 84.641  0.50 12.32 ? 123 SER A OG  1 
ATOM   978  N N   . LYS A 1 126 ? 7.747  37.424 81.571  1.00 14.05 ? 124 LYS A N   1 
ATOM   979  C CA  . LYS A 1 126 ? 6.771  38.331 80.971  1.00 15.65 ? 124 LYS A CA  1 
ATOM   980  C C   . LYS A 1 126 ? 6.747  39.637 81.770  1.00 17.18 ? 124 LYS A C   1 
ATOM   981  O O   . LYS A 1 126 ? 6.605  40.734 81.183  1.00 18.62 ? 124 LYS A O   1 
ATOM   982  C CB  . LYS A 1 126 ? 5.400  37.698 80.965  1.00 15.99 ? 124 LYS A CB  1 
ATOM   983  C CG  . LYS A 1 126 ? 5.292  36.575 79.935  1.00 15.18 ? 124 LYS A CG  1 
ATOM   984  C CD  . LYS A 1 126 ? 3.959  35.910 80.095  1.00 18.61 ? 124 LYS A CD  1 
ATOM   985  C CE  . LYS A 1 126 ? 3.727  34.919 79.005  1.00 18.28 ? 124 LYS A CE  1 
ATOM   986  N NZ  . LYS A 1 126 ? 2.435  34.240 79.270  1.00 21.74 ? 124 LYS A NZ  1 
ATOM   987  N N   . GLN A 1 127 ? 6.943  39.549 83.098  1.00 16.99 ? 125 GLN A N   1 
ATOM   988  C CA  . GLN A 1 127 ? 6.879  40.779 83.900  1.00 18.01 ? 125 GLN A CA  1 
ATOM   989  C C   . GLN A 1 127 ? 8.109  41.694 83.762  1.00 17.68 ? 125 GLN A C   1 
ATOM   990  O O   . GLN A 1 127 ? 8.057  42.866 84.182  1.00 19.39 ? 125 GLN A O   1 
ATOM   991  C CB  . GLN A 1 127 ? 6.461  40.489 85.351  0.50 17.17 ? 125 GLN A CB  1 
ATOM   992  C CG  . GLN A 1 127 ? 5.123  39.674 85.450  0.50 19.78 ? 125 GLN A CG  1 
ATOM   993  C CD  . GLN A 1 127 ? 4.020  40.131 84.443  0.50 23.87 ? 125 GLN A CD  1 
ATOM   994  O OE1 . GLN A 1 127 ? 3.862  41.338 84.137  0.50 25.63 ? 125 GLN A OE1 1 
ATOM   995  N NE2 . GLN A 1 127 ? 3.265  39.151 83.917  0.50 21.25 ? 125 GLN A NE2 1 
ATOM   996  N N   . ASN A 1 128 ? 9.182  41.176 83.160  1.00 16.90 ? 126 ASN A N   1 
ATOM   997  C CA  . ASN A 1 128 ? 10.395 41.938 82.909  1.00 17.39 ? 126 ASN A CA  1 
ATOM   998  C C   . ASN A 1 128 ? 10.522 42.377 81.440  1.00 18.13 ? 126 ASN A C   1 
ATOM   999  O O   . ASN A 1 128 ? 11.586 42.856 81.041  1.00 19.22 ? 126 ASN A O   1 
ATOM   1000 C CB  . ASN A 1 128 ? 11.638 41.104 83.272  1.00 17.35 ? 126 ASN A CB  1 
ATOM   1001 C CG  . ASN A 1 128 ? 11.726 40.838 84.762  1.00 19.27 ? 126 ASN A CG  1 
ATOM   1002 O OD1 . ASN A 1 128 ? 11.179 41.605 85.578  1.00 19.02 ? 126 ASN A OD1 1 
ATOM   1003 N ND2 . ASN A 1 128 ? 12.334 39.719 85.126  1.00 18.30 ? 126 ASN A ND2 1 
ATOM   1004 N N   . GLY A 1 129 ? 9.447  42.227 80.666  1.00 17.81 ? 127 GLY A N   1 
ATOM   1005 C CA  . GLY A 1 129 ? 9.483  42.582 79.245  1.00 17.14 ? 127 GLY A CA  1 
ATOM   1006 C C   . GLY A 1 129 ? 9.908  41.444 78.317  1.00 17.43 ? 127 GLY A C   1 
ATOM   1007 O O   . GLY A 1 129 ? 10.145 41.665 77.115  1.00 17.24 ? 127 GLY A O   1 
ATOM   1008 N N   . GLY A 1 130 ? 10.028 40.213 78.846  1.00 16.54 ? 128 GLY A N   1 
ATOM   1009 C CA  . GLY A 1 130 ? 10.219 39.056 77.982  1.00 16.31 ? 128 GLY A CA  1 
ATOM   1010 C C   . GLY A 1 130 ? 8.889  38.474 77.527  1.00 16.15 ? 128 GLY A C   1 
ATOM   1011 O O   . GLY A 1 130 ? 7.818  39.038 77.792  1.00 15.62 ? 128 GLY A O   1 
ATOM   1012 N N   . GLU A 1 131 ? 8.916  37.316 76.877  1.00 15.77 ? 129 GLU A N   1 
ATOM   1013 C CA  . GLU A 1 131 ? 7.649  36.701 76.540  1.00 16.10 ? 129 GLU A CA  1 
ATOM   1014 C C   . GLU A 1 131 ? 7.492  35.302 77.133  1.00 16.24 ? 129 GLU A C   1 
ATOM   1015 O O   . GLU A 1 131 ? 6.609  34.560 76.734  1.00 15.67 ? 129 GLU A O   1 
ATOM   1016 C CB  . GLU A 1 131 ? 7.425  36.675 75.032  1.00 18.81 ? 129 GLU A CB  1 
ATOM   1017 C CG  . GLU A 1 131 ? 8.453  35.890 74.298  1.00 17.63 ? 129 GLU A CG  1 
ATOM   1018 C CD  . GLU A 1 131 ? 8.354  36.107 72.761  1.00 20.77 ? 129 GLU A CD  1 
ATOM   1019 O OE1 . GLU A 1 131 ? 8.357  37.252 72.294  1.00 24.02 ? 129 GLU A OE1 1 
ATOM   1020 O OE2 . GLU A 1 131 ? 8.280  35.110 72.038  1.00 19.28 ? 129 GLU A OE2 1 
ATOM   1021 N N   . GLY A 1 132 ? 8.324  34.996 78.119  1.00 14.70 ? 130 GLY A N   1 
ATOM   1022 C CA  . GLY A 1 132 ? 8.292  33.658 78.740  1.00 14.05 ? 130 GLY A CA  1 
ATOM   1023 C C   . GLY A 1 132 ? 9.329  32.767 78.072  1.00 13.79 ? 130 GLY A C   1 
ATOM   1024 O O   . GLY A 1 132 ? 10.060 33.190 77.171  1.00 14.66 ? 130 GLY A O   1 
ATOM   1025 N N   . GLY A 1 133 ? 9.442  31.524 78.522  1.00 12.43 ? 131 GLY A N   1 
ATOM   1026 C CA  . GLY A 1 133 ? 10.475 30.648 77.981  1.00 11.08 ? 131 GLY A CA  1 
ATOM   1027 C C   . GLY A 1 133 ? 10.615 29.426 78.866  1.00 11.46 ? 131 GLY A C   1 
ATOM   1028 O O   . GLY A 1 133 ? 9.713  29.128 79.606  1.00 12.05 ? 131 GLY A O   1 
ATOM   1029 N N   . ILE A 1 134 ? 11.774 28.793 78.825  1.00 10.42 ? 132 ILE A N   1 
ATOM   1030 C CA  . ILE A 1 134 ? 12.009 27.571 79.640  1.00 10.84 ? 132 ILE A CA  1 
ATOM   1031 C C   . ILE A 1 134 ? 13.454 27.576 80.117  1.00 11.23 ? 132 ILE A C   1 
ATOM   1032 O O   . ILE A 1 134 ? 14.353 27.959 79.393  1.00 11.57 ? 132 ILE A O   1 
ATOM   1033 C CB  . ILE A 1 134 ? 11.629 26.251 78.897  1.00 12.27 ? 132 ILE A CB  1 
ATOM   1034 C CG1 . ILE A 1 134 ? 11.904 25.003 79.786  1.00 12.81 ? 132 ILE A CG1 1 
ATOM   1035 C CG2 . ILE A 1 134 ? 12.342 26.140 77.556  1.00 13.69 ? 132 ILE A CG2 1 
ATOM   1036 C CD1 . ILE A 1 134 ? 11.459 23.657 79.176  1.00 13.82 ? 132 ILE A CD1 1 
ATOM   1037 N N   . ILE A 1 135 ? 13.642 27.156 81.359  1.00 8.74  ? 133 ILE A N   1 
ATOM   1038 C CA  . ILE A 1 135 ? 14.953 27.051 81.980  1.00 9.77  ? 133 ILE A CA  1 
ATOM   1039 C C   . ILE A 1 135 ? 15.064 25.609 82.417  1.00 9.96  ? 133 ILE A C   1 
ATOM   1040 O O   . ILE A 1 135 ? 14.174 25.096 83.123  1.00 10.44 ? 133 ILE A O   1 
ATOM   1041 C CB  . ILE A 1 135 ? 15.103 27.993 83.212  1.00 8.92  ? 133 ILE A CB  1 
ATOM   1042 C CG1 . ILE A 1 135 ? 14.948 29.450 82.716  1.00 7.88  ? 133 ILE A CG1 1 
ATOM   1043 C CG2 . ILE A 1 135 ? 16.473 27.725 83.947  1.00 10.60 ? 133 ILE A CG2 1 
ATOM   1044 C CD1 . ILE A 1 135 ? 14.998 30.503 83.874  1.00 11.21 ? 133 ILE A CD1 1 
ATOM   1045 N N   . ILE A 1 136 ? 16.153 24.965 81.984  1.00 9.02  ? 134 ILE A N   1 
ATOM   1046 C CA  . ILE A 1 136 ? 16.368 23.520 82.313  1.00 9.41  ? 134 ILE A CA  1 
ATOM   1047 C C   . ILE A 1 136 ? 17.677 23.435 83.094  1.00 9.65  ? 134 ILE A C   1 
ATOM   1048 O O   . ILE A 1 136 ? 18.704 23.873 82.576  1.00 9.67  ? 134 ILE A O   1 
ATOM   1049 C CB  . ILE A 1 136 ? 16.414 22.602 81.073  1.00 11.94 ? 134 ILE A CB  1 
ATOM   1050 C CG1 . ILE A 1 136 ? 15.098 22.729 80.279  1.00 12.20 ? 134 ILE A CG1 1 
ATOM   1051 C CG2 . ILE A 1 136 ? 16.618 21.162 81.523  1.00 11.88 ? 134 ILE A CG2 1 
ATOM   1052 C CD1 . ILE A 1 136 ? 15.294 23.711 79.114  1.00 18.70 ? 134 ILE A CD1 1 
ATOM   1053 N N   . ASN A 1 137 ? 17.627 22.843 84.292  1.00 8.91  ? 135 ASN A N   1 
ATOM   1054 C CA  . ASN A 1 137 ? 18.784 22.704 85.156  1.00 8.29  ? 135 ASN A CA  1 
ATOM   1055 C C   . ASN A 1 137 ? 19.215 21.247 85.213  1.00 9.27  ? 135 ASN A C   1 
ATOM   1056 O O   . ASN A 1 137 ? 18.357 20.372 85.372  1.00 8.38  ? 135 ASN A O   1 
ATOM   1057 C CB  . ASN A 1 137 ? 18.477 23.244 86.572  1.00 8.84  ? 135 ASN A CB  1 
ATOM   1058 C CG  . ASN A 1 137 ? 18.199 24.759 86.549  1.00 10.04 ? 135 ASN A CG  1 
ATOM   1059 O OD1 . ASN A 1 137 ? 18.758 25.470 85.701  1.00 7.74  ? 135 ASN A OD1 1 
ATOM   1060 N ND2 . ASN A 1 137 ? 17.341 25.244 87.429  1.00 11.29 ? 135 ASN A ND2 1 
ATOM   1061 N N   . MET A 1 138 ? 20.519 21.019 85.046  1.00 9.16  ? 136 MET A N   1 
ATOM   1062 C CA  . MET A 1 138 ? 21.065 19.659 85.056  1.00 10.79 ? 136 MET A CA  1 
ATOM   1063 C C   . MET A 1 138 ? 21.309 19.247 86.496  1.00 10.96 ? 136 MET A C   1 
ATOM   1064 O O   . MET A 1 138 ? 22.253 19.752 87.164  1.00 11.95 ? 136 MET A O   1 
ATOM   1065 C CB  . MET A 1 138 ? 22.374 19.620 84.250  1.00 11.81 ? 136 MET A CB  1 
ATOM   1066 C CG  . MET A 1 138 ? 22.111 19.666 82.735  1.00 12.90 ? 136 MET A CG  1 
ATOM   1067 S SD  . MET A 1 138 ? 21.055 18.226 82.230  1.00 16.10 ? 136 MET A SD  1 
ATOM   1068 C CE  . MET A 1 138 ? 21.972 16.838 82.847  1.00 18.61 ? 136 MET A CE  1 
ATOM   1069 N N   . SER A 1 139 ? 20.448 18.362 86.984  1.00 10.06 ? 137 SER A N   1 
ATOM   1070 C CA  . SER A 1 139 ? 20.718 17.689 88.252  1.00 10.79 ? 137 SER A CA  1 
ATOM   1071 C C   . SER A 1 139 ? 21.406 16.346 87.905  1.00 10.81 ? 137 SER A C   1 
ATOM   1072 O O   . SER A 1 139 ? 22.295 16.323 87.025  1.00 12.19 ? 137 SER A O   1 
ATOM   1073 C CB  . SER A 1 139 ? 19.440 17.551 89.059  1.00 10.56 ? 137 SER A CB  1 
ATOM   1074 O OG  . SER A 1 139 ? 19.689 17.061 90.396  1.00 11.53 ? 137 SER A OG  1 
ATOM   1075 N N   . SER A 1 140 ? 21.019 15.258 88.599  1.00 10.60 ? 138 SER A N   1 
ATOM   1076 C CA  . SER A 1 140 ? 21.568 13.901 88.408  1.00 11.07 ? 138 SER A CA  1 
ATOM   1077 C C   . SER A 1 140 ? 20.649 12.984 89.218  1.00 10.51 ? 138 SER A C   1 
ATOM   1078 O O   . SER A 1 140 ? 19.865 13.497 90.058  1.00 11.45 ? 138 SER A O   1 
ATOM   1079 C CB  . SER A 1 140 ? 23.003 13.799 88.971  1.00 11.00 ? 138 SER A CB  1 
ATOM   1080 O OG  . SER A 1 140 ? 23.442 12.438 89.117  1.00 12.83 ? 138 SER A OG  1 
ATOM   1081 N N   . LEU A 1 141 ? 20.747 11.663 89.037  1.00 10.25 ? 139 LEU A N   1 
ATOM   1082 C CA  . LEU A 1 141 ? 20.162 10.762 90.059  1.00 9.90  ? 139 LEU A CA  1 
ATOM   1083 C C   . LEU A 1 141 ? 20.754 11.067 91.456  1.00 9.56  ? 139 LEU A C   1 
ATOM   1084 O O   . LEU A 1 141 ? 20.067 10.885 92.456  1.00 11.15 ? 139 LEU A O   1 
ATOM   1085 C CB  . LEU A 1 141 ? 20.334 9.270  89.730  1.00 9.49  ? 139 LEU A CB  1 
ATOM   1086 C CG  . LEU A 1 141 ? 19.479 8.796  88.548  1.00 12.21 ? 139 LEU A CG  1 
ATOM   1087 C CD1 . LEU A 1 141 ? 19.604 7.284  88.430  1.00 14.61 ? 139 LEU A CD1 1 
ATOM   1088 C CD2 . LEU A 1 141 ? 17.989 9.153  88.766  1.00 12.20 ? 139 LEU A CD2 1 
ATOM   1089 N N   . ALA A 1 142 ? 21.986 11.596 91.471  1.00 9.60  ? 140 ALA A N   1 
ATOM   1090 C CA  . ALA A 1 142 ? 22.633 12.086 92.725  1.00 10.49 ? 140 ALA A CA  1 
ATOM   1091 C C   . ALA A 1 142 ? 21.864 13.274 93.398  1.00 11.25 ? 140 ALA A C   1 
ATOM   1092 O O   . ALA A 1 142 ? 22.202 13.663 94.547  1.00 10.48 ? 140 ALA A O   1 
ATOM   1093 C CB  . ALA A 1 142 ? 24.061 12.497 92.411  1.00 11.20 ? 140 ALA A CB  1 
ATOM   1094 N N   . GLY A 1 143 ? 20.853 13.832 92.709  1.00 9.99  ? 141 GLY A N   1 
ATOM   1095 C CA  . GLY A 1 143 ? 19.979 14.872 93.271  1.00 11.56 ? 141 GLY A CA  1 
ATOM   1096 C C   . GLY A 1 143 ? 18.816 14.269 94.051  1.00 11.34 ? 141 GLY A C   1 
ATOM   1097 O O   . GLY A 1 143 ? 18.085 14.977 94.739  1.00 11.41 ? 141 GLY A O   1 
ATOM   1098 N N   . LEU A 1 144 ? 18.654 12.956 93.921  1.00 10.89 ? 142 LEU A N   1 
ATOM   1099 C CA  . LEU A 1 144 ? 17.508 12.248 94.497  1.00 10.11 ? 142 LEU A CA  1 
ATOM   1100 C C   . LEU A 1 144 ? 17.893 11.120 95.486  1.00 11.22 ? 142 LEU A C   1 
ATOM   1101 O O   . LEU A 1 144 ? 17.035 10.659 96.246  1.00 12.07 ? 142 LEU A O   1 
ATOM   1102 C CB  . LEU A 1 144 ? 16.615 11.661 93.380  1.00 10.61 ? 142 LEU A CB  1 
ATOM   1103 C CG  . LEU A 1 144 ? 16.041 12.692 92.408  1.00 9.18  ? 142 LEU A CG  1 
ATOM   1104 C CD1 . LEU A 1 144 ? 15.423 11.922 91.214  1.00 13.11 ? 142 LEU A CD1 1 
ATOM   1105 C CD2 . LEU A 1 144 ? 15.047 13.646 93.079  1.00 14.50 ? 142 LEU A CD2 1 
ATOM   1106 N N   . MET A 1 145 ? 19.131 10.639 95.402  1.00 11.51 ? 143 MET A N   1 
ATOM   1107 C CA  . MET A 1 145 ? 19.592 9.553  96.238  1.00 12.93 ? 143 MET A CA  1 
ATOM   1108 C C   . MET A 1 145 ? 21.047 9.848  96.613  1.00 11.55 ? 143 MET A C   1 
ATOM   1109 O O   . MET A 1 145 ? 21.698 10.701 96.005  1.00 12.53 ? 143 MET A O   1 
ATOM   1110 C CB  . MET A 1 145 ? 19.499 8.245  95.442  1.00 13.48 ? 143 MET A CB  1 
ATOM   1111 C CG  . MET A 1 145 ? 20.386 8.268  94.265  1.00 13.52 ? 143 MET A CG  1 
ATOM   1112 S SD  . MET A 1 145 ? 20.324 6.719  93.276  1.00 20.65 ? 143 MET A SD  1 
ATOM   1113 C CE  . MET A 1 145 ? 21.201 5.593  94.398  1.00 20.15 ? 143 MET A CE  1 
ATOM   1114 N N   . PRO A 1 146 ? 21.532 9.181  97.656  1.00 12.32 ? 144 PRO A N   1 
ATOM   1115 C CA  . PRO A 1 146 ? 22.892 9.494  98.145  1.00 11.93 ? 144 PRO A CA  1 
ATOM   1116 C C   . PRO A 1 146 ? 23.973 8.939  97.244  1.00 11.63 ? 144 PRO A C   1 
ATOM   1117 O O   . PRO A 1 146 ? 23.735 7.949  96.497  1.00 12.38 ? 144 PRO A O   1 
ATOM   1118 C CB  . PRO A 1 146 ? 22.962 8.770  99.525  1.00 12.25 ? 144 PRO A CB  1 
ATOM   1119 C CG  . PRO A 1 146 ? 21.553 8.195  99.804  1.00 13.25 ? 144 PRO A CG  1 
ATOM   1120 C CD  . PRO A 1 146 ? 20.867 8.119  98.436  1.00 13.98 ? 144 PRO A CD  1 
ATOM   1121 N N   . VAL A 1 147 ? 25.159 9.568  97.293  1.00 11.74 ? 145 VAL A N   1 
ATOM   1122 C CA  . VAL A 1 147 ? 26.346 9.028  96.675  1.00 11.28 ? 145 VAL A CA  1 
ATOM   1123 C C   . VAL A 1 147 ? 27.476 9.037  97.725  1.00 10.72 ? 145 VAL A C   1 
ATOM   1124 O O   . VAL A 1 147 ? 28.015 10.094 98.038  1.00 10.50 ? 145 VAL A O   1 
ATOM   1125 C CB  . VAL A 1 147 ? 26.747 9.791  95.419  1.00 11.06 ? 145 VAL A CB  1 
ATOM   1126 C CG1 . VAL A 1 147 ? 27.924 9.042  94.715  1.00 13.73 ? 145 VAL A CG1 1 
ATOM   1127 C CG2 . VAL A 1 147 ? 25.528 9.936  94.429  1.00 12.27 ? 145 VAL A CG2 1 
ATOM   1128 N N   . ALA A 1 148 ? 27.760 7.856  98.289  1.00 11.23 ? 146 ALA A N   1 
ATOM   1129 C CA  . ALA A 1 148 ? 28.734 7.787  99.429  1.00 12.52 ? 146 ALA A CA  1 
ATOM   1130 C C   . ALA A 1 148 ? 30.084 8.423  99.055  1.00 12.50 ? 146 ALA A C   1 
ATOM   1131 O O   . ALA A 1 148 ? 30.709 9.059  99.883  1.00 15.12 ? 146 ALA A O   1 
ATOM   1132 C CB  . ALA A 1 148 ? 28.946 6.352  99.893  1.00 12.75 ? 146 ALA A CB  1 
ATOM   1133 N N   . GLN A 1 149 ? 30.502 8.260  97.804  1.00 12.83 ? 147 GLN A N   1 
ATOM   1134 C CA  . GLN A 1 149 ? 31.817 8.717  97.368  1.00 13.20 ? 147 GLN A CA  1 
ATOM   1135 C C   . GLN A 1 149 ? 31.831 10.159 96.825  1.00 13.08 ? 147 GLN A C   1 
ATOM   1136 O O   . GLN A 1 149 ? 32.905 10.658 96.480  1.00 13.50 ? 147 GLN A O   1 
ATOM   1137 C CB  . GLN A 1 149 ? 32.389 7.750  96.302  1.00 13.32 ? 147 GLN A CB  1 
ATOM   1138 C CG  . GLN A 1 149 ? 32.586 6.300  96.783  1.00 16.63 ? 147 GLN A CG  1 
ATOM   1139 C CD  . GLN A 1 149 ? 31.282 5.486  96.890  1.00 20.18 ? 147 GLN A CD  1 
ATOM   1140 O OE1 . GLN A 1 149 ? 30.210 5.832  96.318  1.00 20.76 ? 147 GLN A OE1 1 
ATOM   1141 N NE2 . GLN A 1 149 ? 31.344 4.421  97.697  1.00 25.01 ? 147 GLN A NE2 1 
ATOM   1142 N N   . GLN A 1 150 ? 30.650 10.806 96.786  1.00 11.68 ? 148 GLN A N   1 
ATOM   1143 C CA  . GLN A 1 150 ? 30.506 12.139 96.229  1.00 12.20 ? 148 GLN A CA  1 
ATOM   1144 C C   . GLN A 1 150 ? 29.487 12.969 97.033  1.00 11.09 ? 148 GLN A C   1 
ATOM   1145 O O   . GLN A 1 150 ? 28.500 13.495 96.479  1.00 10.63 ? 148 GLN A O   1 
ATOM   1146 C CB  . GLN A 1 150 ? 30.102 12.078 94.753  1.00 11.86 ? 148 GLN A CB  1 
ATOM   1147 C CG  . GLN A 1 150 ? 31.110 11.345 93.826  1.00 15.16 ? 148 GLN A CG  1 
ATOM   1148 C CD  . GLN A 1 150 ? 30.498 11.262 92.444  1.00 20.88 ? 148 GLN A CD  1 
ATOM   1149 O OE1 . GLN A 1 150 ? 29.678 10.389 92.182  1.00 26.05 ? 148 GLN A OE1 1 
ATOM   1150 N NE2 . GLN A 1 150 ? 30.772 12.244 91.611  1.00 21.74 ? 148 GLN A NE2 1 
ATOM   1151 N N   . PRO A 1 151 ? 29.730 13.122 98.350  1.00 11.69 ? 149 PRO A N   1 
ATOM   1152 C CA  . PRO A 1 151 ? 28.667 13.769 99.151  1.00 11.02 ? 149 PRO A CA  1 
ATOM   1153 C C   . PRO A 1 151 ? 28.426 15.238 98.757  1.00 9.88  ? 149 PRO A C   1 
ATOM   1154 O O   . PRO A 1 151 ? 27.281 15.701 98.827  1.00 10.17 ? 149 PRO A O   1 
ATOM   1155 C CB  . PRO A 1 151 ? 29.181 13.662 100.601 1.00 10.74 ? 149 PRO A CB  1 
ATOM   1156 C CG  . PRO A 1 151 ? 30.230 12.546 100.545 1.00 14.93 ? 149 PRO A CG  1 
ATOM   1157 C CD  . PRO A 1 151 ? 30.887 12.696 99.168  1.00 12.58 ? 149 PRO A CD  1 
ATOM   1158 N N   . VAL A 1 152 ? 29.462 15.971 98.319  1.00 9.36  ? 150 VAL A N   1 
ATOM   1159 C CA  . VAL A 1 152 ? 29.233 17.382 97.996  1.00 10.11 ? 150 VAL A CA  1 
ATOM   1160 C C   . VAL A 1 152 ? 28.559 17.494 96.596  1.00 9.65  ? 150 VAL A C   1 
ATOM   1161 O O   . VAL A 1 152 ? 27.636 18.290 96.404  1.00 9.80  ? 150 VAL A O   1 
ATOM   1162 C CB  . VAL A 1 152 ? 30.501 18.233 98.116  1.00 8.49  ? 150 VAL A CB  1 
ATOM   1163 C CG1 . VAL A 1 152 ? 30.224 19.688 97.637  1.00 9.94  ? 150 VAL A CG1 1 
ATOM   1164 C CG2 . VAL A 1 152 ? 30.943 18.211 99.601  1.00 11.06 ? 150 VAL A CG2 1 
ATOM   1165 N N   . TYR A 1 153 ? 29.024 16.687 95.651  1.00 9.90  ? 151 TYR A N   1 
ATOM   1166 C CA  . TYR A 1 153 ? 28.338 16.587 94.379  1.00 9.94  ? 151 TYR A CA  1 
ATOM   1167 C C   . TYR A 1 153 ? 26.833 16.254 94.631  1.00 9.43  ? 151 TYR A C   1 
ATOM   1168 O O   . TYR A 1 153 ? 25.941 16.978 94.138  1.00 9.02  ? 151 TYR A O   1 
ATOM   1169 C CB  . TYR A 1 153 ? 29.023 15.528 93.537  1.00 9.97  ? 151 TYR A CB  1 
ATOM   1170 C CG  . TYR A 1 153 ? 28.407 15.372 92.144  1.00 9.84  ? 151 TYR A CG  1 
ATOM   1171 C CD1 . TYR A 1 153 ? 28.879 16.173 91.076  1.00 10.68 ? 151 TYR A CD1 1 
ATOM   1172 C CD2 . TYR A 1 153 ? 27.428 14.430 91.893  1.00 12.17 ? 151 TYR A CD2 1 
ATOM   1173 C CE1 . TYR A 1 153 ? 28.393 16.017 89.779  1.00 10.06 ? 151 TYR A CE1 1 
ATOM   1174 C CE2 . TYR A 1 153 ? 26.913 14.231 90.556  1.00 10.78 ? 151 TYR A CE2 1 
ATOM   1175 C CZ  . TYR A 1 153 ? 27.405 15.054 89.522  1.00 11.70 ? 151 TYR A CZ  1 
ATOM   1176 O OH  . TYR A 1 153 ? 26.924 14.905 88.243  1.00 13.22 ? 151 TYR A OH  1 
ATOM   1177 N N   . CYS A 1 154 ? 26.574 15.256 95.474  1.00 10.48 ? 152 CYS A N   1 
ATOM   1178 C CA  . CYS A 1 154 ? 25.213 14.868 95.830  1.00 9.83  ? 152 CYS A CA  1 
ATOM   1179 C C   . CYS A 1 154 ? 24.454 16.109 96.427  1.00 8.60  ? 152 CYS A C   1 
ATOM   1180 O O   . CYS A 1 154 ? 23.312 16.406 96.045  1.00 8.79  ? 152 CYS A O   1 
ATOM   1181 C CB  . CYS A 1 154 ? 25.271 13.719 96.854  1.00 10.80 ? 152 CYS A CB  1 
ATOM   1182 S SG  . CYS A 1 154 ? 23.646 13.216 97.434  1.00 11.63 ? 152 CYS A SG  1 
ATOM   1183 N N   . ALA A 1 155 ? 25.097 16.838 97.363  1.00 8.90  ? 153 ALA A N   1 
ATOM   1184 C CA  . ALA A 1 155 ? 24.492 18.060 97.955  1.00 9.78  ? 153 ALA A CA  1 
ATOM   1185 C C   . ALA A 1 155 ? 24.093 19.075 96.857  1.00 8.86  ? 153 ALA A C   1 
ATOM   1186 O O   . ALA A 1 155 ? 22.953 19.559 96.821  1.00 9.25  ? 153 ALA A O   1 
ATOM   1187 C CB  . ALA A 1 155 ? 25.499 18.719 98.880  1.00 9.33  ? 153 ALA A CB  1 
ATOM   1188 N N   . SER A 1 156 ? 25.036 19.324 95.942  1.00 7.95  ? 154 SER A N   1 
ATOM   1189 C CA  . SER A 1 156 ? 24.832 20.307 94.838  1.00 8.83  ? 154 SER A CA  1 
ATOM   1190 C C   . SER A 1 156 ? 23.627 19.884 93.980  1.00 9.14  ? 154 SER A C   1 
ATOM   1191 O O   . SER A 1 156 ? 22.761 20.690 93.641  1.00 10.13 ? 154 SER A O   1 
ATOM   1192 C CB  . SER A 1 156 ? 26.090 20.442 93.979  1.00 7.93  ? 154 SER A CB  1 
ATOM   1193 O OG  . SER A 1 156 ? 26.302 19.398 93.037  1.00 9.62  ? 154 SER A OG  1 
ATOM   1194 N N   . LYS A 1 157 ? 23.524 18.578 93.725  1.00 8.28  ? 155 LYS A N   1 
ATOM   1195 C CA  . LYS A 1 157 ? 22.449 18.085 92.838  1.00 9.37  ? 155 LYS A CA  1 
ATOM   1196 C C   . LYS A 1 157 ? 21.075 18.084 93.543  1.00 8.43  ? 155 LYS A C   1 
ATOM   1197 O O   . LYS A 1 157 ? 20.034 18.323 92.906  1.00 8.67  ? 155 LYS A O   1 
ATOM   1198 C CB  . LYS A 1 157 ? 22.818 16.729 92.240  1.00 9.03  ? 155 LYS A CB  1 
ATOM   1199 C CG  . LYS A 1 157 ? 24.164 16.793 91.433  1.00 9.87  ? 155 LYS A CG  1 
ATOM   1200 C CD  . LYS A 1 157 ? 24.039 17.844 90.278  1.00 11.19 ? 155 LYS A CD  1 
ATOM   1201 C CE  . LYS A 1 157 ? 25.112 17.749 89.209  1.00 12.51 ? 155 LYS A CE  1 
ATOM   1202 N NZ  . LYS A 1 157 ? 24.917 18.766 88.095  1.00 10.25 ? 155 LYS A NZ  1 
ATOM   1203 N N   . HIS A 1 158 ? 21.074 17.784 94.851  1.00 9.23  ? 156 HIS A N   1 
ATOM   1204 C CA  . HIS A 1 158 ? 19.865 17.849 95.657  1.00 9.28  ? 156 HIS A CA  1 
ATOM   1205 C C   . HIS A 1 158 ? 19.423 19.345 95.665  1.00 8.97  ? 156 HIS A C   1 
ATOM   1206 O O   . HIS A 1 158 ? 18.221 19.666 95.520  1.00 8.57  ? 156 HIS A O   1 
ATOM   1207 C CB  . HIS A 1 158 ? 20.195 17.412 97.092  1.00 8.60  ? 156 HIS A CB  1 
ATOM   1208 C CG  . HIS A 1 158 ? 19.995 15.955 97.333  1.00 10.06 ? 156 HIS A CG  1 
ATOM   1209 N ND1 . HIS A 1 158 ? 20.735 14.971 96.696  1.00 9.12  ? 156 HIS A ND1 1 
ATOM   1210 C CD2 . HIS A 1 158 ? 19.074 15.316 98.089  1.00 10.17 ? 156 HIS A CD2 1 
ATOM   1211 C CE1 . HIS A 1 158 ? 20.315 13.780 97.115  1.00 11.37 ? 156 HIS A CE1 1 
ATOM   1212 N NE2 . HIS A 1 158 ? 19.298 13.966 97.948  1.00 9.36  ? 156 HIS A NE2 1 
ATOM   1213 N N   . GLY A 1 159 ? 20.409 20.234 95.862  1.00 8.65  ? 157 GLY A N   1 
ATOM   1214 C CA  . GLY A 1 159 ? 20.168 21.687 95.827  1.00 8.75  ? 157 GLY A CA  1 
ATOM   1215 C C   . GLY A 1 159 ? 19.423 22.094 94.562  1.00 8.42  ? 157 GLY A C   1 
ATOM   1216 O O   . GLY A 1 159 ? 18.417 22.842 94.602  1.00 8.82  ? 157 GLY A O   1 
ATOM   1217 N N   . ILE A 1 160 ? 19.886 21.582 93.434  1.00 8.25  ? 158 ILE A N   1 
ATOM   1218 C CA  . ILE A 1 160 ? 19.209 21.924 92.174  1.00 9.94  ? 158 ILE A CA  1 
ATOM   1219 C C   . ILE A 1 160 ? 17.756 21.445 92.138  1.00 9.47  ? 158 ILE A C   1 
ATOM   1220 O O   . ILE A 1 160 ? 16.882 22.177 91.641  1.00 8.74  ? 158 ILE A O   1 
ATOM   1221 C CB  . ILE A 1 160 ? 20.014 21.337 90.977  1.00 10.17 ? 158 ILE A CB  1 
ATOM   1222 C CG1 . ILE A 1 160 ? 21.335 22.068 90.880  1.00 10.71 ? 158 ILE A CG1 1 
ATOM   1223 C CG2 . ILE A 1 160 ? 19.199 21.500 89.657  1.00 9.78  ? 158 ILE A CG2 1 
ATOM   1224 C CD1 . ILE A 1 160 ? 22.393 21.389 90.005  1.00 12.28 ? 158 ILE A CD1 1 
ATOM   1225 N N   . VAL A 1 161 ? 17.491 20.225 92.611  1.00 8.95  ? 159 VAL A N   1 
ATOM   1226 C CA  . VAL A 1 161 ? 16.109 19.740 92.648  1.00 9.74  ? 159 VAL A CA  1 
ATOM   1227 C C   . VAL A 1 161 ? 15.226 20.658 93.510  1.00 9.31  ? 159 VAL A C   1 
ATOM   1228 O O   . VAL A 1 161 ? 14.208 21.142 93.027  1.00 9.41  ? 159 VAL A O   1 
ATOM   1229 C CB  . VAL A 1 161 ? 16.051 18.273 93.133  1.00 9.25  ? 159 VAL A CB  1 
ATOM   1230 C CG1 . VAL A 1 161 ? 14.608 17.814 93.396  1.00 11.05 ? 159 VAL A CG1 1 
ATOM   1231 C CG2 . VAL A 1 161 ? 16.768 17.357 92.110  1.00 11.10 ? 159 VAL A CG2 1 
ATOM   1232 N N   . GLY A 1 162 ? 15.590 20.900 94.773  1.00 9.20  ? 160 GLY A N   1 
ATOM   1233 C CA  . GLY A 1 162 ? 14.752 21.813 95.615  1.00 10.11 ? 160 GLY A CA  1 
ATOM   1234 C C   . GLY A 1 162 ? 14.583 23.209 94.996  1.00 9.40  ? 160 GLY A C   1 
ATOM   1235 O O   . GLY A 1 162 ? 13.495 23.753 94.973  1.00 10.67 ? 160 GLY A O   1 
ATOM   1236 N N   . PHE A 1 163 ? 15.655 23.750 94.441  1.00 9.33  ? 161 PHE A N   1 
ATOM   1237 C CA  . PHE A 1 163 ? 15.612 25.092 93.897  1.00 9.45  ? 161 PHE A CA  1 
ATOM   1238 C C   . PHE A 1 163 ? 14.638 25.138 92.704  1.00 8.72  ? 161 PHE A C   1 
ATOM   1239 O O   . PHE A 1 163 ? 13.781 26.034 92.588  1.00 8.80  ? 161 PHE A O   1 
ATOM   1240 C CB  . PHE A 1 163 ? 17.002 25.498 93.417  1.00 10.05 ? 161 PHE A CB  1 
ATOM   1241 C CG  . PHE A 1 163 ? 16.986 26.808 92.663  1.00 8.11  ? 161 PHE A CG  1 
ATOM   1242 C CD1 . PHE A 1 163 ? 16.662 28.009 93.316  1.00 10.14 ? 161 PHE A CD1 1 
ATOM   1243 C CD2 . PHE A 1 163 ? 17.249 26.840 91.305  1.00 10.19 ? 161 PHE A CD2 1 
ATOM   1244 C CE1 . PHE A 1 163 ? 16.627 29.259 92.640  1.00 13.21 ? 161 PHE A CE1 1 
ATOM   1245 C CE2 . PHE A 1 163 ? 17.190 28.074 90.596  1.00 10.05 ? 161 PHE A CE2 1 
ATOM   1246 C CZ  . PHE A 1 163 ? 16.903 29.275 91.259  1.00 11.55 ? 161 PHE A CZ  1 
ATOM   1247 N N   . THR A 1 164 ? 14.847 24.185 91.806  1.00 8.53  ? 162 THR A N   1 
ATOM   1248 C CA  . THR A 1 164 ? 14.026 24.073 90.581  1.00 9.39  ? 162 THR A CA  1 
ATOM   1249 C C   . THR A 1 164 ? 12.535 23.888 90.841  1.00 9.14  ? 162 THR A C   1 
ATOM   1250 O O   . THR A 1 164 ? 11.718 24.660 90.312  1.00 9.79  ? 162 THR A O   1 
ATOM   1251 C CB  . THR A 1 164 ? 14.587 23.045 89.561  1.00 9.55  ? 162 THR A CB  1 
ATOM   1252 O OG1 . THR A 1 164 ? 15.980 23.295 89.301  1.00 10.00 ? 162 THR A OG1 1 
ATOM   1253 C CG2 . THR A 1 164 ? 13.737 23.114 88.272  1.00 12.70 ? 162 THR A CG2 1 
ATOM   1254 N N   . ARG A 1 165 ? 12.161 22.922 91.707  1.00 9.34  ? 163 ARG A N   1 
ATOM   1255 C CA  . ARG A 1 165 ? 10.740 22.722 92.038  1.00 10.86 ? 163 ARG A CA  1 
ATOM   1256 C C   . ARG A 1 165 ? 10.148 24.003 92.639  1.00 10.16 ? 163 ARG A C   1 
ATOM   1257 O O   . ARG A 1 165 ? 9.000  24.413 92.325  1.00 11.08 ? 163 ARG A O   1 
ATOM   1258 C CB  . ARG A 1 165 ? 10.606 21.574 93.025  1.00 8.73  ? 163 ARG A CB  1 
ATOM   1259 C CG  . ARG A 1 165 ? 11.107 20.239 92.465  1.00 8.70  ? 163 ARG A CG  1 
ATOM   1260 C CD  . ARG A 1 165 ? 10.740 19.121 93.457  1.00 12.66 ? 163 ARG A CD  1 
ATOM   1261 N NE  . ARG A 1 165 ? 9.274  18.994 93.604  1.00 12.01 ? 163 ARG A NE  1 
ATOM   1262 C CZ  . ARG A 1 165 ? 8.646  18.431 94.653  1.00 14.20 ? 163 ARG A CZ  1 
ATOM   1263 N NH1 . ARG A 1 165 ? 9.329  17.984 95.715  1.00 11.94 ? 163 ARG A NH1 1 
ATOM   1264 N NH2 . ARG A 1 165 ? 7.302  18.362 94.647  1.00 12.18 ? 163 ARG A NH2 1 
ATOM   1265 N N   . SER A 1 166 ? 10.930 24.661 93.518  1.00 9.38  ? 164 SER A N   1 
ATOM   1266 C CA  . SER A 1 166 ? 10.490 25.908 94.148  1.00 9.84  ? 164 SER A CA  1 
ATOM   1267 C C   . SER A 1 166 ? 10.292 27.084 93.164  1.00 9.06  ? 164 SER A C   1 
ATOM   1268 O O   . SER A 1 166 ? 9.252  27.784 93.155  1.00 10.31 ? 164 SER A O   1 
ATOM   1269 C CB  . SER A 1 166 ? 11.464 26.303 95.264  1.00 9.53  ? 164 SER A CB  1 
ATOM   1270 O OG  . SER A 1 166 ? 11.545 25.305 96.302  1.00 10.81 ? 164 SER A OG  1 
ATOM   1271 N N   . ALA A 1 167 ? 11.314 27.285 92.338  1.00 9.81  ? 165 ALA A N   1 
ATOM   1272 C CA  . ALA A 1 167 ? 11.320 28.395 91.355  1.00 9.78  ? 165 ALA A CA  1 
ATOM   1273 C C   . ALA A 1 167 ? 10.148 28.151 90.370  1.00 10.98 ? 165 ALA A C   1 
ATOM   1274 O O   . ALA A 1 167 ? 9.509  29.127 89.938  1.00 10.88 ? 165 ALA A O   1 
ATOM   1275 C CB  . ALA A 1 167 ? 12.634 28.444 90.625  1.00 8.47  ? 165 ALA A CB  1 
ATOM   1276 N N   . ALA A 1 168 ? 9.858  26.862 90.020  1.00 11.72 ? 166 ALA A N   1 
ATOM   1277 C CA  . ALA A 1 168 ? 8.739  26.531 89.136  1.00 11.46 ? 166 ALA A CA  1 
ATOM   1278 C C   . ALA A 1 168 ? 7.410  27.020 89.775  1.00 11.25 ? 166 ALA A C   1 
ATOM   1279 O O   . ALA A 1 168 ? 6.590  27.654 89.086  1.00 12.76 ? 166 ALA A O   1 
ATOM   1280 C CB  . ALA A 1 168 ? 8.669  25.066 88.848  1.00 11.04 ? 166 ALA A CB  1 
ATOM   1281 N N   . LEU A 1 169 ? 7.231  26.772 91.086  1.00 10.05 ? 167 LEU A N   1 
ATOM   1282 C CA  . LEU A 1 169 ? 6.007  27.271 91.748  1.00 11.55 ? 167 LEU A CA  1 
ATOM   1283 C C   . LEU A 1 169 ? 5.924  28.812 91.767  1.00 11.57 ? 167 LEU A C   1 
ATOM   1284 O O   . LEU A 1 169 ? 4.862  29.385 91.495  1.00 13.66 ? 167 LEU A O   1 
ATOM   1285 C CB  . LEU A 1 169 ? 5.891  26.697 93.155  1.00 9.55  ? 167 LEU A CB  1 
ATOM   1286 C CG  . LEU A 1 169 ? 5.704  25.179 93.250  1.00 11.51 ? 167 LEU A CG  1 
ATOM   1287 C CD1 . LEU A 1 169 ? 5.821  24.727 94.725  1.00 14.73 ? 167 LEU A CD1 1 
ATOM   1288 C CD2 . LEU A 1 169 ? 4.313  24.725 92.674  1.00 15.97 ? 167 LEU A CD2 1 
ATOM   1289 N N   . ALA A 1 170 ? 7.058  29.458 92.066  1.00 11.55 ? 168 ALA A N   1 
ATOM   1290 C CA  . ALA A 1 170 ? 7.184  30.909 92.073  1.00 11.60 ? 168 ALA A CA  1 
ATOM   1291 C C   . ALA A 1 170 ? 6.815  31.474 90.702  1.00 13.09 ? 168 ALA A C   1 
ATOM   1292 O O   . ALA A 1 170 ? 6.107  32.494 90.625  1.00 13.96 ? 168 ALA A O   1 
ATOM   1293 C CB  . ALA A 1 170 ? 8.591  31.301 92.429  1.00 12.46 ? 168 ALA A CB  1 
ATOM   1294 N N   . ALA A 1 171 ? 7.323  30.835 89.630  1.00 13.76 ? 169 ALA A N   1 
ATOM   1295 C CA  . ALA A 1 171 ? 6.960  31.281 88.257  1.00 13.66 ? 169 ALA A CA  1 
ATOM   1296 C C   . ALA A 1 171 ? 5.426  31.290 88.035  1.00 15.79 ? 169 ALA A C   1 
ATOM   1297 O O   . ALA A 1 171 ? 4.907  32.205 87.390  1.00 15.93 ? 169 ALA A O   1 
ATOM   1298 C CB  . ALA A 1 171 ? 7.602  30.391 87.176  1.00 14.19 ? 169 ALA A CB  1 
ATOM   1299 N N   . ASN A 1 172 ? 4.717  30.273 88.531  1.00 15.76 ? 170 ASN A N   1 
ATOM   1300 C CA  . ASN A 1 172 ? 3.243  30.246 88.425  1.00 17.86 ? 170 ASN A CA  1 
ATOM   1301 C C   . ASN A 1 172 ? 2.616  31.458 89.138  1.00 18.36 ? 170 ASN A C   1 
ATOM   1302 O O   . ASN A 1 172 ? 1.739  32.148 88.585  1.00 17.99 ? 170 ASN A O   1 
ATOM   1303 C CB  . ASN A 1 172 ? 2.676  28.929 88.974  1.00 17.99 ? 170 ASN A CB  1 
ATOM   1304 C CG  . ASN A 1 172 ? 2.993  27.742 88.081  1.00 21.65 ? 170 ASN A CG  1 
ATOM   1305 O OD1 . ASN A 1 172 ? 3.281  27.905 86.895  1.00 25.88 ? 170 ASN A OD1 1 
ATOM   1306 N ND2 . ASN A 1 172 ? 2.921  26.533 88.650  1.00 27.41 ? 170 ASN A ND2 1 
ATOM   1307 N N   . LEU A 1 173 ? 3.074  31.707 90.368  1.00 17.68 ? 171 LEU A N   1 
ATOM   1308 C CA  . LEU A 1 173 ? 2.574  32.797 91.197  1.00 18.76 ? 171 LEU A CA  1 
ATOM   1309 C C   . LEU A 1 173 ? 2.796  34.129 90.525  1.00 19.70 ? 171 LEU A C   1 
ATOM   1310 O O   . LEU A 1 173 ? 1.921  34.990 90.591  1.00 19.89 ? 171 LEU A O   1 
ATOM   1311 C CB  . LEU A 1 173 ? 3.262  32.789 92.559  1.00 18.79 ? 171 LEU A CB  1 
ATOM   1312 C CG  . LEU A 1 173 ? 2.827  31.638 93.451  1.00 20.22 ? 171 LEU A CG  1 
ATOM   1313 C CD1 . LEU A 1 173 ? 3.575  31.704 94.790  1.00 19.30 ? 171 LEU A CD1 1 
ATOM   1314 C CD2 . LEU A 1 173 ? 1.302  31.679 93.649  1.00 24.61 ? 171 LEU A CD2 1 
ATOM   1315 N N   . MET A 1 174 ? 3.956  34.274 89.881  1.00 18.58 ? 172 MET A N   1 
ATOM   1316 C CA  . MET A 1 174 ? 4.395  35.526 89.242  1.00 20.88 ? 172 MET A CA  1 
ATOM   1317 C C   . MET A 1 174 ? 3.840  35.732 87.808  1.00 20.17 ? 172 MET A C   1 
ATOM   1318 O O   . MET A 1 174 ? 3.957  36.834 87.251  1.00 20.55 ? 172 MET A O   1 
ATOM   1319 C CB  . MET A 1 174 ? 5.924  35.540 89.189  1.00 19.76 ? 172 MET A CB  1 
ATOM   1320 C CG  . MET A 1 174 ? 6.588  35.751 90.523  1.00 21.91 ? 172 MET A CG  1 
ATOM   1321 S SD  . MET A 1 174 ? 8.366  35.456 90.329  1.00 28.66 ? 172 MET A SD  1 
ATOM   1322 C CE  . MET A 1 174 ? 8.952  35.797 92.009  1.00 25.88 ? 172 MET A CE  1 
ATOM   1323 N N   . ASN A 1 175 ? 3.240  34.672 87.260  1.00 19.00 ? 173 ASN A N   1 
ATOM   1324 C CA  . ASN A 1 175 ? 2.827  34.592 85.850  1.00 19.98 ? 173 ASN A CA  1 
ATOM   1325 C C   . ASN A 1 175 ? 3.963  35.081 84.951  1.00 19.29 ? 173 ASN A C   1 
ATOM   1326 O O   . ASN A 1 175 ? 3.785  35.960 84.101  1.00 18.27 ? 173 ASN A O   1 
ATOM   1327 C CB  . ASN A 1 175 ? 1.533  35.419 85.588  1.00 20.27 ? 173 ASN A CB  1 
ATOM   1328 C CG  . ASN A 1 175 ? 0.872  35.060 84.230  1.00 22.66 ? 173 ASN A CG  1 
ATOM   1329 O OD1 . ASN A 1 175 ? 1.126  33.985 83.684  1.00 28.25 ? 173 ASN A OD1 1 
ATOM   1330 N ND2 . ASN A 1 175 ? 0.006  35.916 83.734  1.00 26.58 ? 173 ASN A ND2 1 
ATOM   1331 N N   . SER A 1 176 ? 5.157  34.516 85.146  1.00 17.90 ? 174 SER A N   1 
ATOM   1332 C CA  . SER A 1 176 ? 6.349  34.953 84.394  1.00 15.94 ? 174 SER A CA  1 
ATOM   1333 C C   . SER A 1 176 ? 6.333  34.315 82.988  1.00 14.71 ? 174 SER A C   1 
ATOM   1334 O O   . SER A 1 176 ? 7.073  34.731 82.089  1.00 15.02 ? 174 SER A O   1 
ATOM   1335 C CB  . SER A 1 176 ? 7.633  34.499 85.099  1.00 16.60 ? 174 SER A CB  1 
ATOM   1336 O OG  . SER A 1 176 ? 7.574  33.096 85.280  1.00 16.28 ? 174 SER A OG  1 
ATOM   1337 N N   . GLY A 1 177 ? 5.506  33.287 82.822  1.00 13.60 ? 175 GLY A N   1 
ATOM   1338 C CA  . GLY A 1 177 ? 5.522  32.499 81.573  1.00 13.66 ? 175 GLY A CA  1 
ATOM   1339 C C   . GLY A 1 177 ? 6.785  31.671 81.348  1.00 13.49 ? 175 GLY A C   1 
ATOM   1340 O O   . GLY A 1 177 ? 7.025  31.194 80.236  1.00 13.91 ? 175 GLY A O   1 
ATOM   1341 N N   . VAL A 1 178 ? 7.600  31.497 82.405  1.00 12.62 ? 176 VAL A N   1 
ATOM   1342 C CA  . VAL A 1 178 ? 8.849  30.698 82.306  1.00 12.18 ? 176 VAL A CA  1 
ATOM   1343 C C   . VAL A 1 178 ? 8.604  29.379 83.038  1.00 12.26 ? 176 VAL A C   1 
ATOM   1344 O O   . VAL A 1 178 ? 8.151  29.415 84.181  1.00 12.46 ? 176 VAL A O   1 
ATOM   1345 C CB  . VAL A 1 178 ? 10.063 31.449 82.933  1.00 12.14 ? 176 VAL A CB  1 
ATOM   1346 C CG1 . VAL A 1 178 ? 11.336 30.629 82.859  1.00 12.44 ? 176 VAL A CG1 1 
ATOM   1347 C CG2 . VAL A 1 178 ? 10.323 32.805 82.206  1.00 13.28 ? 176 VAL A CG2 1 
ATOM   1348 N N   . ARG A 1 179 ? 8.884  28.277 82.349  1.00 11.29 ? 177 ARG A N   1 
ATOM   1349 C CA  . ARG A 1 179 ? 8.760  26.932 82.943  1.00 10.94 ? 177 ARG A CA  1 
ATOM   1350 C C   . ARG A 1 179 ? 10.168 26.544 83.387  1.00 11.13 ? 177 ARG A C   1 
ATOM   1351 O O   . ARG A 1 179 ? 11.149 26.789 82.654  1.00 10.77 ? 177 ARG A O   1 
ATOM   1352 C CB  . ARG A 1 179 ? 8.271  25.937 81.900  1.00 12.69 ? 177 ARG A CB  1 
ATOM   1353 C CG  . ARG A 1 179 ? 6.825  26.260 81.454  1.00 13.42 ? 177 ARG A CG  1 
ATOM   1354 C CD  . ARG A 1 179 ? 6.289  25.207 80.494  1.00 16.89 ? 177 ARG A CD  1 
ATOM   1355 N NE  . ARG A 1 179 ? 6.913  25.286 79.187  1.00 17.12 ? 177 ARG A NE  1 
ATOM   1356 C CZ  . ARG A 1 179 ? 7.687  24.326 78.678  1.00 19.72 ? 177 ARG A CZ  1 
ATOM   1357 N NH1 . ARG A 1 179 ? 7.917  23.197 79.383  1.00 19.30 ? 177 ARG A NH1 1 
ATOM   1358 N NH2 . ARG A 1 179 ? 8.208  24.479 77.465  1.00 20.87 ? 177 ARG A NH2 1 
ATOM   1359 N N   . LEU A 1 180 ? 10.286 25.953 84.576  1.00 9.60  ? 178 LEU A N   1 
ATOM   1360 C CA  . LEU A 1 180 ? 11.603 25.546 85.071  1.00 10.63 ? 178 LEU A CA  1 
ATOM   1361 C C   . LEU A 1 180 ? 11.536 24.041 85.397  1.00 11.22 ? 178 LEU A C   1 
ATOM   1362 O O   . LEU A 1 180 ? 10.654 23.609 86.130  1.00 11.30 ? 178 LEU A O   1 
ATOM   1363 C CB  . LEU A 1 180 ? 12.033 26.347 86.313  1.00 10.44 ? 178 LEU A CB  1 
ATOM   1364 C CG  . LEU A 1 180 ? 12.107 27.876 86.083  1.00 10.20 ? 178 LEU A CG  1 
ATOM   1365 C CD1 . LEU A 1 180 ? 10.788 28.594 86.486  1.00 15.02 ? 178 LEU A CD1 1 
ATOM   1366 C CD2 . LEU A 1 180 ? 13.287 28.437 86.829  1.00 11.45 ? 178 LEU A CD2 1 
ATOM   1367 N N   . ASN A 1 181 ? 12.452 23.285 84.796  1.00 10.07 ? 179 ASN A N   1 
ATOM   1368 C CA  . ASN A 1 181 ? 12.483 21.819 84.978  1.00 10.25 ? 179 ASN A CA  1 
ATOM   1369 C C   . ASN A 1 181 ? 13.915 21.384 85.216  1.00 9.00  ? 179 ASN A C   1 
ATOM   1370 O O   . ASN A 1 181 ? 14.828 22.126 84.914  1.00 10.26 ? 179 ASN A O   1 
ATOM   1371 C CB  . ASN A 1 181 ? 11.918 21.153 83.711  1.00 10.32 ? 179 ASN A CB  1 
ATOM   1372 C CG  . ASN A 1 181 ? 10.458 21.518 83.450  1.00 12.28 ? 179 ASN A CG  1 
ATOM   1373 O OD1 . ASN A 1 181 ? 9.544  21.198 84.249  1.00 11.33 ? 179 ASN A OD1 1 
ATOM   1374 N ND2 . ASN A 1 181 ? 10.220 22.224 82.328  1.00 14.43 ? 179 ASN A ND2 1 
ATOM   1375 N N   . ALA A 1 182 ? 14.111 20.167 85.727  1.00 8.44  ? 180 ALA A N   1 
ATOM   1376 C CA  . ALA A 1 182 ? 15.476 19.609 85.895  1.00 8.87  ? 180 ALA A CA  1 
ATOM   1377 C C   . ALA A 1 182 ? 15.530 18.211 85.273  1.00 9.53  ? 180 ALA A C   1 
ATOM   1378 O O   . ALA A 1 182 ? 14.493 17.502 85.209  1.00 11.37 ? 180 ALA A O   1 
ATOM   1379 C CB  . ALA A 1 182 ? 15.891 19.514 87.427  1.00 9.29  ? 180 ALA A CB  1 
ATOM   1380 N N   . ILE A 1 183 ? 16.746 17.821 84.887  1.00 7.90  ? 181 ILE A N   1 
ATOM   1381 C CA  . ILE A 1 183 ? 17.000 16.487 84.344  1.00 9.40  ? 181 ILE A CA  1 
ATOM   1382 C C   . ILE A 1 183 ? 17.964 15.785 85.307  1.00 9.17  ? 181 ILE A C   1 
ATOM   1383 O O   . ILE A 1 183 ? 18.986 16.377 85.733  1.00 9.55  ? 181 ILE A O   1 
ATOM   1384 C CB  . ILE A 1 183 ? 17.560 16.507 82.915  1.00 8.81  ? 181 ILE A CB  1 
ATOM   1385 C CG1 . ILE A 1 183 ? 16.614 17.260 81.956  1.00 10.31 ? 181 ILE A CG1 1 
ATOM   1386 C CG2 . ILE A 1 183 ? 17.915 15.050 82.469  1.00 10.97 ? 181 ILE A CG2 1 
ATOM   1387 C CD1 . ILE A 1 183 ? 17.247 17.522 80.607  1.00 10.18 ? 181 ILE A CD1 1 
ATOM   1388 N N   . CYS A 1 184 ? 17.619 14.526 85.647  1.00 9.42  ? 182 CYS A N   1 
ATOM   1389 C CA  . CYS A 1 184 ? 18.373 13.696 86.582  1.00 9.86  ? 182 CYS A CA  1 
ATOM   1390 C C   . CYS A 1 184 ? 18.829 12.393 85.899  1.00 10.76 ? 182 CYS A C   1 
ATOM   1391 O O   . CYS A 1 184 ? 18.130 11.371 85.990  1.00 10.93 ? 182 CYS A O   1 
ATOM   1392 C CB  . CYS A 1 184 ? 17.493 13.349 87.778  1.00 11.93 ? 182 CYS A CB  1 
ATOM   1393 S SG  . CYS A 1 184 ? 17.016 14.826 88.745  1.00 12.26 ? 182 CYS A SG  1 
ATOM   1394 N N   . PRO A 1 185 ? 19.943 12.453 85.144  1.00 9.95  ? 183 PRO A N   1 
ATOM   1395 C CA  . PRO A 1 185 ? 20.409 11.195 84.481  1.00 10.73 ? 183 PRO A CA  1 
ATOM   1396 C C   . PRO A 1 185 ? 21.114 10.221 85.425  1.00 10.62 ? 183 PRO A C   1 
ATOM   1397 O O   . PRO A 1 185 ? 21.674 10.638 86.464  1.00 11.60 ? 183 PRO A O   1 
ATOM   1398 C CB  . PRO A 1 185 ? 21.392 11.678 83.409  1.00 11.98 ? 183 PRO A CB  1 
ATOM   1399 C CG  . PRO A 1 185 ? 21.150 13.218 83.263  1.00 11.70 ? 183 PRO A CG  1 
ATOM   1400 C CD  . PRO A 1 185 ? 20.674 13.651 84.700  1.00 11.06 ? 183 PRO A CD  1 
ATOM   1401 N N   . GLY A 1 186 ? 21.080 8.932  85.039  1.00 10.80 ? 184 GLY A N   1 
ATOM   1402 C CA  . GLY A 1 186 ? 22.050 7.958  85.517  1.00 11.90 ? 184 GLY A CA  1 
ATOM   1403 C C   . GLY A 1 186 ? 23.389 8.233  84.853  1.00 11.72 ? 184 GLY A C   1 
ATOM   1404 O O   . GLY A 1 186 ? 23.629 9.334  84.303  1.00 11.25 ? 184 GLY A O   1 
ATOM   1405 N N   . PHE A 1 187 ? 24.263 7.234  84.832  1.00 11.36 ? 185 PHE A N   1 
ATOM   1406 C CA  . PHE A 1 187 ? 25.635 7.464  84.321  1.00 12.59 ? 185 PHE A CA  1 
ATOM   1407 C C   . PHE A 1 187 ? 25.618 7.732  82.821  1.00 13.31 ? 185 PHE A C   1 
ATOM   1408 O O   . PHE A 1 187 ? 24.910 7.045  82.059  1.00 13.05 ? 185 PHE A O   1 
ATOM   1409 C CB  . PHE A 1 187 ? 26.549 6.252  84.566  1.00 12.19 ? 185 PHE A CB  1 
ATOM   1410 C CG  . PHE A 1 187 ? 26.555 5.787  86.012  1.00 13.23 ? 185 PHE A CG  1 
ATOM   1411 C CD1 . PHE A 1 187 ? 27.099 6.610  87.024  1.00 16.46 ? 185 PHE A CD1 1 
ATOM   1412 C CD2 . PHE A 1 187 ? 25.992 4.573  86.351  1.00 17.59 ? 185 PHE A CD2 1 
ATOM   1413 C CE1 . PHE A 1 187 ? 27.099 6.191  88.373  1.00 18.64 ? 185 PHE A CE1 1 
ATOM   1414 C CE2 . PHE A 1 187 ? 25.984 4.131  87.709  1.00 17.22 ? 185 PHE A CE2 1 
ATOM   1415 C CZ  . PHE A 1 187 ? 26.546 4.959  88.713  1.00 17.80 ? 185 PHE A CZ  1 
ATOM   1416 N N   . VAL A 1 188 ? 26.436 8.701  82.420  1.00 14.87 ? 186 VAL A N   1 
ATOM   1417 C CA  . VAL A 1 188 ? 26.560 9.112  81.014  1.00 16.12 ? 186 VAL A CA  1 
ATOM   1418 C C   . VAL A 1 188 ? 28.030 9.184  80.640  1.00 16.63 ? 186 VAL A C   1 
ATOM   1419 O O   . VAL A 1 188 ? 28.918 9.623  81.403  1.00 15.00 ? 186 VAL A O   1 
ATOM   1420 C CB  . VAL A 1 188 ? 25.864 10.500 80.708  1.00 16.05 ? 186 VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 188 ? 25.846 10.778 79.180  1.00 18.12 ? 186 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 188 ? 24.419 10.554 81.337  1.00 17.37 ? 186 VAL A CG2 1 
ATOM   1423 N N   . ASN A 1 189 ? 28.254 8.759  79.414  1.00 18.23 ? 187 ASN A N   1 
ATOM   1424 C CA  . ASN A 1 189 ? 29.570 8.638  78.916  1.00 20.94 ? 187 ASN A CA  1 
ATOM   1425 C C   . ASN A 1 189 ? 30.242 9.973  78.610  1.00 21.33 ? 187 ASN A C   1 
ATOM   1426 O O   . ASN A 1 189 ? 30.106 10.450 77.491  1.00 22.70 ? 187 ASN A O   1 
ATOM   1427 C CB  . ASN A 1 189 ? 29.490 7.818  77.627  1.00 22.04 ? 187 ASN A CB  1 
ATOM   1428 C CG  . ASN A 1 189 ? 30.826 7.339  77.223  1.00 25.61 ? 187 ASN A CG  1 
ATOM   1429 O OD1 . ASN A 1 189 ? 31.689 7.098  78.082  1.00 31.48 ? 187 ASN A OD1 1 
ATOM   1430 N ND2 . ASN A 1 189 ? 31.042 7.230  75.925  1.00 28.91 ? 187 ASN A ND2 1 
ATOM   1431 N N   . THR A 1 190 ? 30.948 10.543 79.593  1.00 20.43 ? 188 THR A N   1 
ATOM   1432 C CA  . THR A 1 190 ? 31.670 11.829 79.464  1.00 20.78 ? 188 THR A CA  1 
ATOM   1433 C C   . THR A 1 190 ? 32.909 11.886 80.354  1.00 21.24 ? 188 THR A C   1 
ATOM   1434 O O   . THR A 1 190 ? 33.164 10.974 81.172  1.00 20.41 ? 188 THR A O   1 
ATOM   1435 C CB  . THR A 1 190 ? 30.775 13.057 79.900  1.00 20.74 ? 188 THR A CB  1 
ATOM   1436 O OG1 . THR A 1 190 ? 30.658 13.085 81.333  1.00 16.93 ? 188 THR A OG1 1 
ATOM   1437 C CG2 . THR A 1 190 ? 29.395 13.046 79.257  1.00 19.62 ? 188 THR A CG2 1 
ATOM   1438 N N   . ALA A 1 191 ? 33.625 13.013 80.275  1.00 21.97 ? 189 ALA A N   1 
ATOM   1439 C CA  . ALA A 1 191 ? 34.765 13.341 81.170  1.00 23.21 ? 189 ALA A CA  1 
ATOM   1440 C C   . ALA A 1 191 ? 34.458 13.362 82.673  1.00 23.27 ? 189 ALA A C   1 
ATOM   1441 O O   . ALA A 1 191 ? 35.335 13.075 83.498  1.00 24.84 ? 189 ALA A O   1 
ATOM   1442 C CB  . ALA A 1 191 ? 35.421 14.702 80.749  1.00 23.36 ? 189 ALA A CB  1 
ATOM   1443 N N   . ILE A 1 192 ? 33.219 13.666 83.057  1.00 22.98 ? 190 ILE A N   1 
ATOM   1444 C CA  . ILE A 1 192 ? 32.875 13.608 84.476  1.00 22.56 ? 190 ILE A CA  1 
ATOM   1445 C C   . ILE A 1 192 ? 33.007 12.178 85.013  1.00 22.33 ? 190 ILE A C   1 
ATOM   1446 O O   . ILE A 1 192 ? 33.507 11.957 86.117  1.00 22.44 ? 190 ILE A O   1 
ATOM   1447 C CB  . ILE A 1 192 ? 31.517 14.304 84.838  1.00 22.27 ? 190 ILE A CB  1 
ATOM   1448 C CG1 . ILE A 1 192 ? 31.792 15.742 85.283  1.00 23.63 ? 190 ILE A CG1 1 
ATOM   1449 C CG2 . ILE A 1 192 ? 30.759 13.592 86.009  1.00 24.34 ? 190 ILE A CG2 1 
ATOM   1450 C CD1 . ILE A 1 192 ? 30.548 16.644 85.436  1.00 24.09 ? 190 ILE A CD1 1 
ATOM   1451 N N   . LEU A 1 193 ? 32.591 11.200 84.216  1.00 22.05 ? 191 LEU A N   1 
ATOM   1452 C CA  . LEU A 1 193 ? 32.690 9.810  84.631  1.00 23.54 ? 191 LEU A CA  1 
ATOM   1453 C C   . LEU A 1 193 ? 34.152 9.375  84.888  1.00 24.03 ? 191 LEU A C   1 
ATOM   1454 O O   . LEU A 1 193 ? 34.453 8.629  85.836  1.00 24.32 ? 191 LEU A O   1 
ATOM   1455 C CB  . LEU A 1 193 ? 31.963 8.909  83.597  1.00 23.16 ? 191 LEU A CB  1 
ATOM   1456 C CG  . LEU A 1 193 ? 31.093 7.754  84.083  1.00 25.21 ? 191 LEU A CG  1 
ATOM   1457 C CD1 . LEU A 1 193 ? 30.100 8.102  85.244  1.00 24.00 ? 191 LEU A CD1 1 
ATOM   1458 C CD2 . LEU A 1 193 ? 30.354 7.083  82.919  1.00 23.16 ? 191 LEU A CD2 1 
ATOM   1459 N N   . GLU A 1 194 ? 35.073 9.883  84.076  1.00 24.10 ? 192 GLU A N   1 
ATOM   1460 C CA  . GLU A 1 194 ? 36.508 9.565  84.220  1.00 25.54 ? 192 GLU A CA  1 
ATOM   1461 C C   . GLU A 1 194 ? 37.160 10.141 85.500  1.00 25.20 ? 192 GLU A C   1 
ATOM   1462 O O   . GLU A 1 194 ? 38.151 9.599  86.017  1.00 25.62 ? 192 GLU A O   1 
ATOM   1463 C CB  . GLU A 1 194 ? 37.269 10.013 82.947  1.00 25.86 ? 192 GLU A CB  1 
ATOM   1464 C CG  . GLU A 1 194 ? 36.619 9.526  81.618  1.00 28.02 ? 192 GLU A CG  1 
ATOM   1465 C CD  . GLU A 1 194 ? 37.171 10.203 80.335  1.00 27.82 ? 192 GLU A CD  1 
ATOM   1466 O OE1 . GLU A 1 194 ? 37.850 11.253 80.440  1.00 32.08 ? 192 GLU A OE1 1 
ATOM   1467 O OE2 . GLU A 1 194 ? 36.893 9.679  79.220  1.00 30.48 ? 192 GLU A OE2 1 
ATOM   1468 N N   . SER A 1 195 ? 36.592 11.230 86.019  1.00 23.87 ? 193 SER A N   1 
ATOM   1469 C CA  . SER A 1 195 ? 37.140 11.937 87.175  1.00 22.86 ? 193 SER A CA  1 
ATOM   1470 C C   . SER A 1 195 ? 37.090 11.095 88.483  1.00 22.66 ? 193 SER A C   1 
ATOM   1471 O O   . SER A 1 195 ? 37.788 11.418 89.451  1.00 22.95 ? 193 SER A O   1 
ATOM   1472 C CB  . SER A 1 195 ? 36.403 13.277 87.364  1.00 22.52 ? 193 SER A CB  1 
ATOM   1473 O OG  . SER A 1 195 ? 35.089 13.034 87.853  1.00 21.79 ? 193 SER A OG  1 
ATOM   1474 N N   . ILE A 1 196 ? 36.290 10.025 88.500  1.00 23.28 ? 194 ILE A N   1 
ATOM   1475 C CA  . ILE A 1 196 ? 36.216 9.169  89.703  1.00 24.34 ? 194 ILE A CA  1 
ATOM   1476 C C   . ILE A 1 196 ? 37.539 8.395  89.963  1.00 24.80 ? 194 ILE A C   1 
ATOM   1477 O O   . ILE A 1 196 ? 37.761 7.872  91.063  1.00 24.49 ? 194 ILE A O   1 
ATOM   1478 C CB  . ILE A 1 196 ? 34.980 8.233  89.720  1.00 25.01 ? 194 ILE A CB  1 
ATOM   1479 C CG1 . ILE A 1 196 ? 35.156 7.066  88.748  1.00 26.71 ? 194 ILE A CG1 1 
ATOM   1480 C CG2 . ILE A 1 196 ? 33.673 9.028  89.483  1.00 25.40 ? 194 ILE A CG2 1 
ATOM   1481 C CD1 . ILE A 1 196 ? 34.454 5.799  89.186  1.00 28.00 ? 194 ILE A CD1 1 
ATOM   1482 N N   . GLU A 1 197 ? 38.406 8.356  88.950  1.00 25.51 ? 195 GLU A N   1 
ATOM   1483 C CA  . GLU A 1 197 ? 39.692 7.636  89.008  1.00 26.87 ? 195 GLU A CA  1 
ATOM   1484 C C   . GLU A 1 197 ? 40.828 8.430  89.655  1.00 26.77 ? 195 GLU A C   1 
ATOM   1485 O O   . GLU A 1 197 ? 41.916 7.881  89.881  1.00 26.77 ? 195 GLU A O   1 
ATOM   1486 C CB  . GLU A 1 197 ? 40.158 7.275  87.582  1.00 27.79 ? 195 GLU A CB  1 
ATOM   1487 C CG  . GLU A 1 197 ? 39.192 6.448  86.781  1.00 31.12 ? 195 GLU A CG  1 
ATOM   1488 C CD  . GLU A 1 197 ? 38.990 5.052  87.341  1.00 36.77 ? 195 GLU A CD  1 
ATOM   1489 O OE1 . GLU A 1 197 ? 39.934 4.456  87.932  1.00 37.40 ? 195 GLU A OE1 1 
ATOM   1490 O OE2 . GLU A 1 197 ? 37.859 4.553  87.188  1.00 41.03 ? 195 GLU A OE2 1 
ATOM   1491 N N   . LYS A 1 198 ? 40.592 9.715  89.939  1.00 26.05 ? 196 LYS A N   1 
ATOM   1492 C CA  . LYS A 1 198 ? 41.670 10.619 90.316  1.00 25.88 ? 196 LYS A CA  1 
ATOM   1493 C C   . LYS A 1 198 ? 41.515 11.151 91.740  1.00 25.37 ? 196 LYS A C   1 
ATOM   1494 O O   . LYS A 1 198 ? 40.458 11.697 92.076  1.00 23.72 ? 196 LYS A O   1 
ATOM   1495 C CB  . LYS A 1 198 ? 41.723 11.791 89.319  1.00 27.18 ? 196 LYS A CB  1 
ATOM   1496 C CG  . LYS A 1 198 ? 41.963 11.379 87.865  1.00 29.72 ? 196 LYS A CG  1 
ATOM   1497 C CD  . LYS A 1 198 ? 41.203 12.276 86.867  1.00 33.75 ? 196 LYS A CD  1 
ATOM   1498 C CE  . LYS A 1 198 ? 41.548 11.961 85.381  1.00 35.29 ? 196 LYS A CE  1 
ATOM   1499 N NZ  . LYS A 1 198 ? 41.263 10.540 84.927  1.00 39.41 ? 196 LYS A NZ  1 
ATOM   1500 N N   . GLU A 1 199 ? 42.567 11.010 92.564  1.00 24.47 ? 197 GLU A N   1 
ATOM   1501 C CA  . GLU A 1 199 ? 42.547 11.576 93.922  1.00 23.94 ? 197 GLU A CA  1 
ATOM   1502 C C   . GLU A 1 199 ? 42.333 13.086 93.873  1.00 22.84 ? 197 GLU A C   1 
ATOM   1503 O O   . GLU A 1 199 ? 41.728 13.659 94.796  1.00 23.29 ? 197 GLU A O   1 
ATOM   1504 C CB  . GLU A 1 199 ? 43.823 11.256 94.722  1.00 23.85 ? 197 GLU A CB  1 
ATOM   1505 C CG  . GLU A 1 199 ? 43.709 11.569 96.216  1.00 26.37 ? 197 GLU A CG  1 
ATOM   1506 C CD  . GLU A 1 199 ? 44.018 13.044 96.612  1.00 28.93 ? 197 GLU A CD  1 
ATOM   1507 O OE1 . GLU A 1 199 ? 44.631 13.809 95.835  1.00 27.31 ? 197 GLU A OE1 1 
ATOM   1508 O OE2 . GLU A 1 199 ? 43.630 13.436 97.732  1.00 31.26 ? 197 GLU A OE2 1 
ATOM   1509 N N   . GLU A 1 200 ? 42.839 13.721 92.805  1.00 21.83 ? 198 GLU A N   1 
ATOM   1510 C CA  . GLU A 1 200 ? 42.639 15.167 92.562  1.00 22.32 ? 198 GLU A CA  1 
ATOM   1511 C C   . GLU A 1 200 ? 41.159 15.540 92.632  1.00 21.32 ? 198 GLU A C   1 
ATOM   1512 O O   . GLU A 1 200 ? 40.803 16.644 93.080  1.00 21.89 ? 198 GLU A O   1 
ATOM   1513 C CB  . GLU A 1 200 ? 43.159 15.556 91.177  1.00 22.64 ? 198 GLU A CB  1 
ATOM   1514 C CG  . GLU A 1 200 ? 44.680 15.559 91.066  1.00 28.42 ? 198 GLU A CG  1 
ATOM   1515 C CD  . GLU A 1 200 ? 45.277 14.197 90.632  1.00 33.76 ? 198 GLU A CD  1 
ATOM   1516 O OE1 . GLU A 1 200 ? 44.660 13.104 90.829  1.00 34.17 ? 198 GLU A OE1 1 
ATOM   1517 O OE2 . GLU A 1 200 ? 46.411 14.235 90.098  1.00 34.90 ? 198 GLU A OE2 1 
ATOM   1518 N N   . ASN A 1 201 ? 40.311 14.638 92.138  1.00 20.85 ? 199 ASN A N   1 
ATOM   1519 C CA  . ASN A 1 201 ? 38.870 14.887 92.110  1.00 19.96 ? 199 ASN A CA  1 
ATOM   1520 C C   . ASN A 1 201 ? 38.077 14.207 93.222  1.00 19.91 ? 199 ASN A C   1 
ATOM   1521 O O   . ASN A 1 201 ? 36.952 14.599 93.520  1.00 21.70 ? 199 ASN A O   1 
ATOM   1522 C CB  . ASN A 1 201 ? 38.264 14.490 90.761  1.00 19.39 ? 199 ASN A CB  1 
ATOM   1523 C CG  . ASN A 1 201 ? 38.858 15.279 89.603  1.00 20.98 ? 199 ASN A CG  1 
ATOM   1524 O OD1 . ASN A 1 201 ? 39.970 14.983 89.143  1.00 24.58 ? 199 ASN A OD1 1 
ATOM   1525 N ND2 . ASN A 1 201 ? 38.113 16.275 89.105  1.00 21.40 ? 199 ASN A ND2 1 
ATOM   1526 N N   . MET A 1 202 ? 38.632 13.147 93.783  1.00 19.73 ? 200 MET A N   1 
ATOM   1527 C CA  . MET A 1 202 ? 37.928 12.336 94.764  1.00 19.23 ? 200 MET A CA  1 
ATOM   1528 C C   . MET A 1 202 ? 38.410 12.548 96.212  1.00 19.90 ? 200 MET A C   1 
ATOM   1529 O O   . MET A 1 202 ? 37.642 12.297 97.152  1.00 17.99 ? 200 MET A O   1 
ATOM   1530 C CB  . MET A 1 202 ? 37.996 10.859 94.372  1.00 19.33 ? 200 MET A CB  1 
ATOM   1531 C CG  . MET A 1 202 ? 37.321 10.521 93.036  1.00 18.56 ? 200 MET A CG  1 
ATOM   1532 S SD  . MET A 1 202 ? 35.510 10.913 93.029  1.00 20.50 ? 200 MET A SD  1 
ATOM   1533 C CE  . MET A 1 202 ? 34.931 9.501  94.001  1.00 22.43 ? 200 MET A CE  1 
ATOM   1534 N N   . GLY A 1 203 ? 39.662 13.006 96.390  1.00 20.24 ? 201 GLY A N   1 
ATOM   1535 C CA  . GLY A 1 203 ? 40.161 13.334 97.733  1.00 19.98 ? 201 GLY A CA  1 
ATOM   1536 C C   . GLY A 1 203 ? 40.024 12.123 98.648  1.00 20.84 ? 201 GLY A C   1 
ATOM   1537 O O   . GLY A 1 203 ? 40.340 10.977 98.238  1.00 20.45 ? 201 GLY A O   1 
ATOM   1538 N N   . GLN A 1 204 ? 39.528 12.378 99.859  1.00 21.39 ? 202 GLN A N   1 
ATOM   1539 C CA  . GLN A 1 204 ? 39.300 11.357 100.908 1.00 23.20 ? 202 GLN A CA  1 
ATOM   1540 C C   . GLN A 1 204 ? 38.454 10.140 100.463 1.00 22.52 ? 202 GLN A C   1 
ATOM   1541 O O   . GLN A 1 204 ? 38.425 9.111  101.161 1.00 23.94 ? 202 GLN A O   1 
ATOM   1542 C CB  . GLN A 1 204 ? 38.647 11.996 102.143 1.00 23.67 ? 202 GLN A CB  1 
ATOM   1543 C CG  . GLN A 1 204 ? 37.220 12.561 101.899 1.00 25.70 ? 202 GLN A CG  1 
ATOM   1544 C CD  . GLN A 1 204 ? 36.580 13.191 103.125 1.00 25.65 ? 202 GLN A CD  1 
ATOM   1545 O OE1 . GLN A 1 204 ? 36.352 12.507 104.127 1.00 30.00 ? 202 GLN A OE1 1 
ATOM   1546 N NE2 . GLN A 1 204 ? 36.224 14.473 103.031 1.00 25.28 ? 202 GLN A NE2 1 
ATOM   1547 N N   . TYR A 1 205 ? 37.728 10.295 99.349  1.00 19.56 ? 203 TYR A N   1 
ATOM   1548 C CA  . TYR A 1 205 ? 36.845 9.244  98.815  1.00 18.40 ? 203 TYR A CA  1 
ATOM   1549 C C   . TYR A 1 205 ? 37.486 8.340  97.751  1.00 18.40 ? 203 TYR A C   1 
ATOM   1550 O O   . TYR A 1 205 ? 36.868 7.371  97.306  1.00 17.40 ? 203 TYR A O   1 
ATOM   1551 C CB  . TYR A 1 205 ? 35.569 9.887  98.252  1.00 17.42 ? 203 TYR A CB  1 
ATOM   1552 C CG  . TYR A 1 205 ? 34.906 10.745 99.302  1.00 15.90 ? 203 TYR A CG  1 
ATOM   1553 C CD1 . TYR A 1 205 ? 34.300 10.155 100.431 1.00 17.88 ? 203 TYR A CD1 1 
ATOM   1554 C CD2 . TYR A 1 205 ? 34.928 12.130 99.201  1.00 12.32 ? 203 TYR A CD2 1 
ATOM   1555 C CE1 . TYR A 1 205 ? 33.701 10.930 101.417 1.00 17.86 ? 203 TYR A CE1 1 
ATOM   1556 C CE2 . TYR A 1 205 ? 34.329 12.941 100.181 1.00 13.89 ? 203 TYR A CE2 1 
ATOM   1557 C CZ  . TYR A 1 205 ? 33.725 12.340 101.292 1.00 16.35 ? 203 TYR A CZ  1 
ATOM   1558 O OH  . TYR A 1 205 ? 33.138 13.126 102.257 1.00 15.44 ? 203 TYR A OH  1 
ATOM   1559 N N   . ILE A 1 206 ? 38.713 8.666  97.340  1.00 18.51 ? 204 ILE A N   1 
ATOM   1560 C CA  . ILE A 1 206 ? 39.373 7.916  96.272  1.00 18.73 ? 204 ILE A CA  1 
ATOM   1561 C C   . ILE A 1 206 ? 39.470 6.412  96.589  1.00 18.72 ? 204 ILE A C   1 
ATOM   1562 O O   . ILE A 1 206 ? 39.391 5.587  95.677  1.00 19.05 ? 204 ILE A O   1 
ATOM   1563 C CB  . ILE A 1 206 ? 40.772 8.492  95.925  1.00 19.05 ? 204 ILE A CB  1 
ATOM   1564 C CG1 . ILE A 1 206 ? 41.296 7.884  94.618  1.00 18.83 ? 204 ILE A CG1 1 
ATOM   1565 C CG2 . ILE A 1 206 ? 41.762 8.246  97.101  1.00 19.71 ? 204 ILE A CG2 1 
ATOM   1566 C CD1 . ILE A 1 206 ? 40.547 8.238  93.321  1.00 24.26 ? 204 ILE A CD1 1 
ATOM   1567 N N   . GLU A 1 207 ? 39.612 6.049  97.864  1.00 18.99 ? 205 GLU A N   1 
ATOM   1568 C CA  . GLU A 1 207 ? 39.782 4.626  98.194  1.00 20.86 ? 205 GLU A CA  1 
ATOM   1569 C C   . GLU A 1 207 ? 38.532 3.790  97.962  1.00 20.93 ? 205 GLU A C   1 
ATOM   1570 O O   . GLU A 1 207 ? 38.612 2.558  97.899  1.00 21.80 ? 205 GLU A O   1 
ATOM   1571 C CB  . GLU A 1 207 ? 40.330 4.430  99.613  1.00 21.88 ? 205 GLU A CB  1 
ATOM   1572 C CG  . GLU A 1 207 ? 41.827 4.790  99.715  1.00 24.24 ? 205 GLU A CG  1 
ATOM   1573 N N   . TYR A 1 208 ? 37.384 4.467  97.828  1.00 21.31 ? 206 TYR A N   1 
ATOM   1574 C CA  . TYR A 1 208 ? 36.085 3.796  97.716  1.00 21.37 ? 206 TYR A CA  1 
ATOM   1575 C C   . TYR A 1 208 ? 35.510 3.856  96.303  1.00 21.25 ? 206 TYR A C   1 
ATOM   1576 O O   . TYR A 1 208 ? 34.356 3.464  96.081  1.00 21.32 ? 206 TYR A O   1 
ATOM   1577 C CB  . TYR A 1 208 ? 35.106 4.349  98.769  1.00 21.91 ? 206 TYR A CB  1 
ATOM   1578 C CG  . TYR A 1 208 ? 35.754 4.301  100.121 1.00 22.05 ? 206 TYR A CG  1 
ATOM   1579 C CD1 . TYR A 1 208 ? 35.872 3.096  100.814 1.00 22.93 ? 206 TYR A CD1 1 
ATOM   1580 C CD2 . TYR A 1 208 ? 36.331 5.449  100.669 1.00 23.05 ? 206 TYR A CD2 1 
ATOM   1581 C CE1 . TYR A 1 208 ? 36.526 3.056  102.053 1.00 22.57 ? 206 TYR A CE1 1 
ATOM   1582 C CE2 . TYR A 1 208 ? 37.003 5.416  101.883 1.00 23.65 ? 206 TYR A CE2 1 
ATOM   1583 C CZ  . TYR A 1 208 ? 37.085 4.221  102.567 1.00 24.04 ? 206 TYR A CZ  1 
ATOM   1584 O OH  . TYR A 1 208 ? 37.750 4.226  103.776 1.00 26.03 ? 206 TYR A OH  1 
ATOM   1585 N N   . LYS A 1 209 ? 36.332 4.297  95.361  1.00 20.80 ? 207 LYS A N   1 
ATOM   1586 C CA  . LYS A 1 209 ? 35.874 4.519  93.973  1.00 22.11 ? 207 LYS A CA  1 
ATOM   1587 C C   . LYS A 1 209 ? 35.331 3.261  93.289  1.00 22.21 ? 207 LYS A C   1 
ATOM   1588 O O   . LYS A 1 209 ? 34.480 3.348  92.377  1.00 22.09 ? 207 LYS A O   1 
ATOM   1589 C CB  . LYS A 1 209 ? 36.980 5.146  93.122  1.00 22.05 ? 207 LYS A CB  1 
ATOM   1590 C CG  . LYS A 1 209 ? 38.106 4.171  92.813  1.00 25.19 ? 207 LYS A CG  1 
ATOM   1591 C CD  . LYS A 1 209 ? 38.913 4.597  91.597  1.00 29.62 ? 207 LYS A CD  1 
ATOM   1592 C CE  . LYS A 1 209 ? 40.177 3.727  91.487  1.00 32.29 ? 207 LYS A CE  1 
ATOM   1593 N NZ  . LYS A 1 209 ? 39.870 2.260  91.375  1.00 34.93 ? 207 LYS A NZ  1 
ATOM   1594 N N   . ASP A 1 210 ? 35.791 2.085  93.720  1.00 21.69 ? 208 ASP A N   1 
ATOM   1595 C CA  . ASP A 1 210 ? 35.321 0.856  93.059  1.00 23.43 ? 208 ASP A CA  1 
ATOM   1596 C C   . ASP A 1 210 ? 33.818 0.598  93.197  1.00 23.18 ? 208 ASP A C   1 
ATOM   1597 O O   . ASP A 1 210 ? 33.225 -0.056 92.339  1.00 23.31 ? 208 ASP A O   1 
ATOM   1598 C CB  . ASP A 1 210 ? 36.130 -0.374 93.478  1.00 24.50 ? 208 ASP A CB  1 
ATOM   1599 C CG  . ASP A 1 210 ? 37.549 -0.373 92.894  1.00 28.45 ? 208 ASP A CG  1 
ATOM   1600 O OD1 . ASP A 1 210 ? 37.898 0.531  92.092  1.00 32.11 ? 208 ASP A OD1 1 
ATOM   1601 O OD2 . ASP A 1 210 ? 38.335 -1.274 93.266  1.00 34.41 ? 208 ASP A OD2 1 
ATOM   1602 N N   . HIS A 1 211 ? 33.209 1.110  94.270  1.00 22.84 ? 209 HIS A N   1 
ATOM   1603 C CA  . HIS A 1 211 ? 31.775 0.953  94.484  1.00 23.59 ? 209 HIS A CA  1 
ATOM   1604 C C   . HIS A 1 211 ? 31.025 1.647  93.311  1.00 22.69 ? 209 HIS A C   1 
ATOM   1605 O O   . HIS A 1 211 ? 30.069 1.081  92.765  1.00 21.07 ? 209 HIS A O   1 
ATOM   1606 C CB  . HIS A 1 211 ? 31.360 1.547  95.837  1.00 24.43 ? 209 HIS A CB  1 
ATOM   1607 C CG  . HIS A 1 211 ? 31.878 0.783  97.027  1.00 28.95 ? 209 HIS A CG  1 
ATOM   1608 N ND1 . HIS A 1 211 ? 31.048 0.069  97.873  1.00 32.24 ? 209 HIS A ND1 1 
ATOM   1609 C CD2 . HIS A 1 211 ? 33.136 0.638  97.522  1.00 31.57 ? 209 HIS A CD2 1 
ATOM   1610 C CE1 . HIS A 1 211 ? 31.775 -0.488 98.832  1.00 31.99 ? 209 HIS A CE1 1 
ATOM   1611 N NE2 . HIS A 1 211 ? 33.044 -0.160 98.641  1.00 31.22 ? 209 HIS A NE2 1 
ATOM   1612 N N   . ILE A 1 212 ? 31.493 2.840  92.909  1.00 21.45 ? 210 ILE A N   1 
ATOM   1613 C CA  . ILE A 1 212 ? 30.903 3.532  91.737  1.00 21.61 ? 210 ILE A CA  1 
ATOM   1614 C C   . ILE A 1 212 ? 31.156 2.727  90.458  1.00 21.09 ? 210 ILE A C   1 
ATOM   1615 O O   . ILE A 1 212 ? 30.240 2.506  89.637  1.00 19.18 ? 210 ILE A O   1 
ATOM   1616 C CB  . ILE A 1 212 ? 31.452 4.977  91.563  1.00 21.61 ? 210 ILE A CB  1 
ATOM   1617 C CG1 . ILE A 1 212 ? 31.249 5.803  92.849  1.00 22.46 ? 210 ILE A CG1 1 
ATOM   1618 C CG2 . ILE A 1 212 ? 30.820 5.668  90.344  1.00 21.00 ? 210 ILE A CG2 1 
ATOM   1619 C CD1 . ILE A 1 212 ? 31.665 7.316  92.725  1.00 24.02 ? 210 ILE A CD1 1 
ATOM   1620 N N   . LYS A 1 213 ? 32.407 2.302  90.263  1.00 20.95 ? 211 LYS A N   1 
ATOM   1621 C CA  . LYS A 1 213 ? 32.739 1.536  89.055  1.00 22.31 ? 211 LYS A CA  1 
ATOM   1622 C C   . LYS A 1 213 ? 31.861 0.285  88.924  1.00 20.94 ? 211 LYS A C   1 
ATOM   1623 O O   . LYS A 1 213 ? 31.412 -0.075 87.833  1.00 21.89 ? 211 LYS A O   1 
ATOM   1624 C CB  . LYS A 1 213 ? 34.223 1.185  89.018  1.00 21.91 ? 211 LYS A CB  1 
ATOM   1625 C CG  . LYS A 1 213 ? 35.105 2.443  89.037  1.00 24.98 ? 211 LYS A CG  1 
ATOM   1626 C CD  . LYS A 1 213 ? 36.609 2.095  88.994  1.00 25.58 ? 211 LYS A CD  1 
ATOM   1627 C CE  . LYS A 1 213 ? 37.004 1.515  87.649  1.00 30.59 ? 211 LYS A CE  1 
ATOM   1628 N NZ  . LYS A 1 213 ? 38.406 0.977  87.687  1.00 32.98 ? 211 LYS A NZ  1 
ATOM   1629 N N   . ASP A 1 214 ? 31.621 -0.375 90.044  1.00 20.27 ? 212 ASP A N   1 
ATOM   1630 C CA  . ASP A 1 214 ? 30.762 -1.555 90.042  1.00 19.86 ? 212 ASP A CA  1 
ATOM   1631 C C   . ASP A 1 214 ? 29.353 -1.196 89.600  1.00 19.25 ? 212 ASP A C   1 
ATOM   1632 O O   . ASP A 1 214 ? 28.737 -1.923 88.821  1.00 18.56 ? 212 ASP A O   1 
ATOM   1633 C CB  . ASP A 1 214 ? 30.732 -2.184 91.414  1.00 20.96 ? 212 ASP A CB  1 
ATOM   1634 C CG  . ASP A 1 214 ? 32.005 -2.958 91.712  1.00 21.83 ? 212 ASP A CG  1 
ATOM   1635 O OD1 . ASP A 1 214 ? 32.872 -3.089 90.812  1.00 24.71 ? 212 ASP A OD1 1 
ATOM   1636 O OD2 . ASP A 1 214 ? 32.130 -3.409 92.869  1.00 27.69 ? 212 ASP A OD2 1 
ATOM   1637 N N   . MET A 1 215 ? 28.851 -0.064 90.079  1.00 18.67 ? 213 MET A N   1 
ATOM   1638 C CA  . MET A 1 215 ? 27.511 0.411  89.654  1.00 18.43 ? 213 MET A CA  1 
ATOM   1639 C C   . MET A 1 215 ? 27.417 0.665  88.151  1.00 17.19 ? 213 MET A C   1 
ATOM   1640 O O   . MET A 1 215 ? 26.444 0.287  87.484  1.00 16.24 ? 213 MET A O   1 
ATOM   1641 C CB  A MET A 1 215 ? 27.178 1.728  90.360  0.65 18.74 ? 213 MET A CB  1 
ATOM   1642 C CB  B MET A 1 215 ? 27.069 1.621  90.448  0.35 18.09 ? 213 MET A CB  1 
ATOM   1643 C CG  A MET A 1 215 ? 27.017 1.635  91.862  0.65 21.52 ? 213 MET A CG  1 
ATOM   1644 C CG  B MET A 1 215 ? 26.469 1.224  91.763  0.35 18.53 ? 213 MET A CG  1 
ATOM   1645 S SD  A MET A 1 215 ? 25.378 1.021  92.272  0.65 26.57 ? 213 MET A SD  1 
ATOM   1646 S SD  B MET A 1 215 ? 25.887 2.649  92.656  0.35 18.65 ? 213 MET A SD  1 
ATOM   1647 C CE  A MET A 1 215 ? 24.338 2.380  91.657  0.65 27.28 ? 213 MET A CE  1 
ATOM   1648 C CE  B MET A 1 215 ? 24.471 3.172  91.700  0.35 17.59 ? 213 MET A CE  1 
ATOM   1649 N N   . ILE A 1 216 ? 28.442 1.328  87.640  1.00 17.28 ? 214 ILE A N   1 
ATOM   1650 C CA  . ILE A 1 216 ? 28.518 1.648  86.217  1.00 17.60 ? 214 ILE A CA  1 
ATOM   1651 C C   . ILE A 1 216 ? 28.522 0.351  85.394  1.00 17.70 ? 214 ILE A C   1 
ATOM   1652 O O   . ILE A 1 216 ? 27.806 0.224  84.414  1.00 17.80 ? 214 ILE A O   1 
ATOM   1653 C CB  . ILE A 1 216 ? 29.792 2.483  85.906  1.00 17.15 ? 214 ILE A CB  1 
ATOM   1654 C CG1 . ILE A 1 216 ? 29.739 3.861  86.610  1.00 17.71 ? 214 ILE A CG1 1 
ATOM   1655 C CG2 . ILE A 1 216 ? 29.958 2.611  84.395  1.00 17.49 ? 214 ILE A CG2 1 
ATOM   1656 C CD1 . ILE A 1 216 ? 31.073 4.665  86.623  1.00 18.54 ? 214 ILE A CD1 1 
ATOM   1657 N N   . LYS A 1 217 ? 29.321 -0.630 85.811  1.00 17.49 ? 215 LYS A N   1 
ATOM   1658 C CA  . LYS A 1 217 ? 29.336 -1.935 85.145  1.00 18.73 ? 215 LYS A CA  1 
ATOM   1659 C C   . LYS A 1 217 ? 27.953 -2.627 85.194  1.00 17.51 ? 215 LYS A C   1 
ATOM   1660 O O   . LYS A 1 217 ? 27.533 -3.241 84.227  1.00 18.59 ? 215 LYS A O   1 
ATOM   1661 C CB  . LYS A 1 217 ? 30.395 -2.831 85.770  1.00 19.21 ? 215 LYS A CB  1 
ATOM   1662 C CG  . LYS A 1 217 ? 30.623 -4.125 85.013  1.00 22.98 ? 215 LYS A CG  1 
ATOM   1663 N N   . TYR A 1 218 ? 27.270 -2.529 86.333  1.00 17.78 ? 216 TYR A N   1 
ATOM   1664 C CA  . TYR A 1 218 ? 25.958 -3.172 86.494  1.00 18.43 ? 216 TYR A CA  1 
ATOM   1665 C C   . TYR A 1 218 ? 24.845 -2.515 85.650  1.00 18.54 ? 216 TYR A C   1 
ATOM   1666 O O   . TYR A 1 218 ? 24.113 -3.215 84.939  1.00 18.70 ? 216 TYR A O   1 
ATOM   1667 C CB  . TYR A 1 218 ? 25.549 -3.228 87.966  1.00 19.89 ? 216 TYR A CB  1 
ATOM   1668 C CG  . TYR A 1 218 ? 24.365 -4.119 88.201  1.00 22.63 ? 216 TYR A CG  1 
ATOM   1669 C CD1 . TYR A 1 218 ? 24.547 -5.480 88.477  1.00 25.71 ? 216 TYR A CD1 1 
ATOM   1670 C CD2 . TYR A 1 218 ? 23.061 -3.628 88.129  1.00 24.70 ? 216 TYR A CD2 1 
ATOM   1671 C CE1 . TYR A 1 218 ? 23.466 -6.328 88.681  1.00 27.96 ? 216 TYR A CE1 1 
ATOM   1672 C CE2 . TYR A 1 218 ? 21.957 -4.476 88.320  1.00 27.58 ? 216 TYR A CE2 1 
ATOM   1673 C CZ  . TYR A 1 218 ? 22.177 -5.834 88.603  1.00 27.81 ? 216 TYR A CZ  1 
ATOM   1674 O OH  . TYR A 1 218 ? 21.110 -6.707 88.804  1.00 27.47 ? 216 TYR A OH  1 
ATOM   1675 N N   . TYR A 1 219 ? 24.694 -1.193 85.778  1.00 17.57 ? 217 TYR A N   1 
ATOM   1676 C CA  . TYR A 1 219 ? 23.582 -0.469 85.132  1.00 17.84 ? 217 TYR A CA  1 
ATOM   1677 C C   . TYR A 1 219 ? 23.872 -0.015 83.705  1.00 17.82 ? 217 TYR A C   1 
ATOM   1678 O O   . TYR A 1 219 ? 22.954 0.264  82.927  1.00 18.37 ? 217 TYR A O   1 
ATOM   1679 C CB  . TYR A 1 219 ? 23.172 0.704  86.030  1.00 18.70 ? 217 TYR A CB  1 
ATOM   1680 C CG  . TYR A 1 219 ? 22.511 0.151  87.251  1.00 19.49 ? 217 TYR A CG  1 
ATOM   1681 C CD1 . TYR A 1 219 ? 21.278 -0.507 87.159  1.00 20.26 ? 217 TYR A CD1 1 
ATOM   1682 C CD2 . TYR A 1 219 ? 23.147 0.216  88.490  1.00 21.90 ? 217 TYR A CD2 1 
ATOM   1683 C CE1 . TYR A 1 219 ? 20.671 -1.050 88.286  1.00 21.63 ? 217 TYR A CE1 1 
ATOM   1684 C CE2 . TYR A 1 219 ? 22.559 -0.320 89.625  1.00 21.93 ? 217 TYR A CE2 1 
ATOM   1685 C CZ  . TYR A 1 219 ? 21.325 -0.948 89.523  1.00 22.48 ? 217 TYR A CZ  1 
ATOM   1686 O OH  . TYR A 1 219 ? 20.753 -1.473 90.673  1.00 25.85 ? 217 TYR A OH  1 
ATOM   1687 N N   . GLY A 1 220 ? 25.147 0.041  83.339  1.00 17.42 ? 218 GLY A N   1 
ATOM   1688 C CA  . GLY A 1 220 ? 25.462 0.546  82.008  1.00 17.02 ? 218 GLY A CA  1 
ATOM   1689 C C   . GLY A 1 220 ? 25.493 2.070  81.967  1.00 17.21 ? 218 GLY A C   1 
ATOM   1690 O O   . GLY A 1 220 ? 25.279 2.768  82.986  1.00 16.31 ? 218 GLY A O   1 
ATOM   1691 N N   . ILE A 1 221 ? 25.766 2.561  80.758  1.00 17.76 ? 219 ILE A N   1 
ATOM   1692 C CA  . ILE A 1 221 ? 26.109 3.958  80.545  1.00 18.67 ? 219 ILE A CA  1 
ATOM   1693 C C   . ILE A 1 221 ? 25.213 4.481  79.409  1.00 18.17 ? 219 ILE A C   1 
ATOM   1694 O O   . ILE A 1 221 ? 25.042 3.823  78.377  1.00 19.51 ? 219 ILE A O   1 
ATOM   1695 C CB  . ILE A 1 221 ? 27.623 4.123  80.171  1.00 18.46 ? 219 ILE A CB  1 
ATOM   1696 C CG1 . ILE A 1 221 ? 28.564 3.604  81.286  1.00 20.53 ? 219 ILE A CG1 1 
ATOM   1697 C CG2 . ILE A 1 221 ? 27.934 5.569  79.828  1.00 21.60 ? 219 ILE A CG2 1 
ATOM   1698 C CD1 . ILE A 1 221 ? 30.113 3.616  80.867  1.00 21.85 ? 219 ILE A CD1 1 
ATOM   1699 N N   . LEU A 1 222 ? 24.629 5.654  79.615  1.00 16.60 ? 220 LEU A N   1 
ATOM   1700 C CA  . LEU A 1 222 ? 23.780 6.291  78.608  1.00 14.95 ? 220 LEU A CA  1 
ATOM   1701 C C   . LEU A 1 222 ? 24.644 7.106  77.637  1.00 15.75 ? 220 LEU A C   1 
ATOM   1702 O O   . LEU A 1 222 ? 25.667 7.676  78.019  1.00 16.31 ? 220 LEU A O   1 
ATOM   1703 C CB  . LEU A 1 222 ? 22.836 7.259  79.313  1.00 13.99 ? 220 LEU A CB  1 
ATOM   1704 C CG  . LEU A 1 222 ? 21.853 6.579  80.269  1.00 15.80 ? 220 LEU A CG  1 
ATOM   1705 C CD1 . LEU A 1 222 ? 21.450 7.577  81.313  1.00 15.07 ? 220 LEU A CD1 1 
ATOM   1706 C CD2 . LEU A 1 222 ? 20.627 6.014  79.563  1.00 19.05 ? 220 LEU A CD2 1 
ATOM   1707 N N   . ASP A 1 223 ? 24.207 7.156  76.384  1.00 18.18 ? 221 ASP A N   1 
ATOM   1708 C CA  . ASP A 1 223 ? 24.855 7.990  75.370  1.00 20.21 ? 221 ASP A CA  1 
ATOM   1709 C C   . ASP A 1 223 ? 24.315 9.425  75.524  1.00 19.24 ? 221 ASP A C   1 
ATOM   1710 O O   . ASP A 1 223 ? 23.115 9.581  75.713  1.00 19.45 ? 221 ASP A O   1 
ATOM   1711 C CB  . ASP A 1 223 ? 24.482 7.462  73.980  1.00 21.02 ? 221 ASP A CB  1 
ATOM   1712 C CG  . ASP A 1 223 ? 24.810 5.958  73.815  1.00 24.71 ? 221 ASP A CG  1 
ATOM   1713 O OD1 . ASP A 1 223 ? 25.976 5.629  74.071  1.00 26.83 ? 221 ASP A OD1 1 
ATOM   1714 O OD2 . ASP A 1 223 ? 23.920 5.148  73.442  1.00 29.79 ? 221 ASP A OD2 1 
ATOM   1715 N N   . PRO A 1 224 ? 25.184 10.458 75.435  1.00 20.08 ? 222 PRO A N   1 
ATOM   1716 C CA  . PRO A 1 224 ? 24.678 11.840 75.604  1.00 20.13 ? 222 PRO A CA  1 
ATOM   1717 C C   . PRO A 1 224 ? 23.441 12.251 74.770  1.00 19.77 ? 222 PRO A C   1 
ATOM   1718 O O   . PRO A 1 224 ? 22.595 13.004 75.282  1.00 17.97 ? 222 PRO A O   1 
ATOM   1719 C CB  . PRO A 1 224 ? 25.901 12.709 75.285  1.00 19.92 ? 222 PRO A CB  1 
ATOM   1720 C CG  . PRO A 1 224 ? 27.080 11.800 75.720  1.00 20.98 ? 222 PRO A CG  1 
ATOM   1721 C CD  . PRO A 1 224 ? 26.638 10.452 75.193  1.00 19.71 ? 222 PRO A CD  1 
ATOM   1722 N N   . PRO A 1 225 ? 23.327 11.807 73.498  1.00 19.50 ? 223 PRO A N   1 
ATOM   1723 C CA  . PRO A 1 225 ? 22.091 12.116 72.733  1.00 20.27 ? 223 PRO A CA  1 
ATOM   1724 C C   . PRO A 1 225 ? 20.771 11.734 73.402  1.00 19.14 ? 223 PRO A C   1 
ATOM   1725 O O   . PRO A 1 225 ? 19.751 12.401 73.205  1.00 18.90 ? 223 PRO A O   1 
ATOM   1726 C CB  . PRO A 1 225 ? 22.274 11.287 71.444  1.00 20.69 ? 223 PRO A CB  1 
ATOM   1727 C CG  . PRO A 1 225 ? 23.705 11.310 71.235  1.00 20.19 ? 223 PRO A CG  1 
ATOM   1728 C CD  . PRO A 1 225 ? 24.298 11.102 72.641  1.00 20.78 ? 223 PRO A CD  1 
ATOM   1729 N N   . LEU A 1 226 ? 20.790 10.644 74.180  1.00 19.04 ? 224 LEU A N   1 
ATOM   1730 C CA  . LEU A 1 226 ? 19.621 10.203 74.915  1.00 18.59 ? 224 LEU A CA  1 
ATOM   1731 C C   . LEU A 1 226 ? 19.167 11.274 75.939  1.00 16.44 ? 224 LEU A C   1 
ATOM   1732 O O   . LEU A 1 226 ? 17.953 11.534 76.146  1.00 17.68 ? 224 LEU A O   1 
ATOM   1733 C CB  . LEU A 1 226 ? 19.940 8.905  75.644  1.00 18.02 ? 224 LEU A CB  1 
ATOM   1734 C CG  . LEU A 1 226 ? 20.478 7.744  74.775  1.00 21.71 ? 224 LEU A CG  1 
ATOM   1735 C CD1 . LEU A 1 226 ? 20.808 6.411  75.611  1.00 21.82 ? 224 LEU A CD1 1 
ATOM   1736 C CD2 . LEU A 1 226 ? 19.485 7.495  73.616  1.00 24.93 ? 224 LEU A CD2 1 
ATOM   1737 N N   . ILE A 1 227 ? 20.158 11.926 76.526  1.00 15.06 ? 225 ILE A N   1 
ATOM   1738 C CA  . ILE A 1 227 ? 19.852 12.996 77.474  1.00 13.28 ? 225 ILE A CA  1 
ATOM   1739 C C   . ILE A 1 227 ? 19.264 14.215 76.712  1.00 13.20 ? 225 ILE A C   1 
ATOM   1740 O O   . ILE A 1 227 ? 18.301 14.837 77.171  1.00 12.24 ? 225 ILE A O   1 
ATOM   1741 C CB  . ILE A 1 227 ? 21.101 13.422 78.286  1.00 13.84 ? 225 ILE A CB  1 
ATOM   1742 C CG1 . ILE A 1 227 ? 21.932 12.209 78.773  1.00 14.95 ? 225 ILE A CG1 1 
ATOM   1743 C CG2 . ILE A 1 227 ? 20.681 14.352 79.435  1.00 13.20 ? 225 ILE A CG2 1 
ATOM   1744 C CD1 . ILE A 1 227 ? 21.130 11.162 79.550  1.00 17.30 ? 225 ILE A CD1 1 
ATOM   1745 N N   . ALA A 1 228 ? 19.838 14.511 75.537  1.00 13.23 ? 226 ALA A N   1 
ATOM   1746 C CA  . ALA A 1 228 ? 19.317 15.571 74.666  1.00 14.21 ? 226 ALA A CA  1 
ATOM   1747 C C   . ALA A 1 228 ? 17.851 15.282 74.275  1.00 13.79 ? 226 ALA A C   1 
ATOM   1748 O O   . ALA A 1 228 ? 17.054 16.206 74.257  1.00 13.85 ? 226 ALA A O   1 
ATOM   1749 C CB  . ALA A 1 228 ? 20.210 15.768 73.424  1.00 14.84 ? 226 ALA A CB  1 
ATOM   1750 N N   . ASN A 1 229 ? 17.469 14.019 74.016  1.00 14.39 ? 227 ASN A N   1 
ATOM   1751 C CA  . ASN A 1 229 ? 16.068 13.701 73.745  1.00 15.79 ? 227 ASN A CA  1 
ATOM   1752 C C   . ASN A 1 229 ? 15.167 14.175 74.894  1.00 15.44 ? 227 ASN A C   1 
ATOM   1753 O O   . ASN A 1 229 ? 14.087 14.732 74.689  1.00 14.50 ? 227 ASN A O   1 
ATOM   1754 C CB  . ASN A 1 229 ? 15.866 12.206 73.545  1.00 16.68 ? 227 ASN A CB  1 
ATOM   1755 C CG  . ASN A 1 229 ? 16.693 11.665 72.377  1.00 21.80 ? 227 ASN A CG  1 
ATOM   1756 O OD1 . ASN A 1 229 ? 17.034 12.413 71.456  1.00 25.58 ? 227 ASN A OD1 1 
ATOM   1757 N ND2 . ASN A 1 229 ? 17.018 10.370 72.420  1.00 26.87 ? 227 ASN A ND2 1 
ATOM   1758 N N   . GLY A 1 230 ? 15.631 13.963 76.122  1.00 13.78 ? 228 GLY A N   1 
ATOM   1759 C CA  . GLY A 1 230 ? 14.909 14.442 77.314  1.00 14.24 ? 228 GLY A CA  1 
ATOM   1760 C C   . GLY A 1 230 ? 14.756 15.968 77.331  1.00 12.68 ? 228 GLY A C   1 
ATOM   1761 O O   . GLY A 1 230 ? 13.669 16.497 77.628  1.00 12.56 ? 228 GLY A O   1 
ATOM   1762 N N   . LEU A 1 231 ? 15.818 16.672 76.984  1.00 12.46 ? 229 LEU A N   1 
ATOM   1763 C CA  . LEU A 1 231 ? 15.789 18.128 76.924  1.00 13.67 ? 229 LEU A CA  1 
ATOM   1764 C C   . LEU A 1 231 ? 14.700 18.581 75.942  1.00 13.41 ? 229 LEU A C   1 
ATOM   1765 O O   . LEU A 1 231 ? 13.879 19.450 76.241  1.00 13.86 ? 229 LEU A O   1 
ATOM   1766 C CB  . LEU A 1 231 ? 17.154 18.672 76.489  1.00 13.27 ? 229 LEU A CB  1 
ATOM   1767 C CG  . LEU A 1 231 ? 17.215 20.200 76.262  1.00 14.95 ? 229 LEU A CG  1 
ATOM   1768 C CD1 . LEU A 1 231 ? 17.119 20.950 77.564  1.00 21.88 ? 229 LEU A CD1 1 
ATOM   1769 C CD2 . LEU A 1 231 ? 18.500 20.612 75.527  1.00 15.61 ? 229 LEU A CD2 1 
ATOM   1770 N N   . ILE A 1 232 ? 14.723 18.007 74.741  1.00 13.89 ? 230 ILE A N   1 
ATOM   1771 C CA  . ILE A 1 232 ? 13.757 18.397 73.693  1.00 15.12 ? 230 ILE A CA  1 
ATOM   1772 C C   . ILE A 1 232 ? 12.325 18.143 74.184  1.00 15.09 ? 230 ILE A C   1 
ATOM   1773 O O   . ILE A 1 232 ? 11.428 18.975 74.000  1.00 15.79 ? 230 ILE A O   1 
ATOM   1774 C CB  . ILE A 1 232 ? 14.087 17.694 72.343  1.00 15.87 ? 230 ILE A CB  1 
ATOM   1775 C CG1 . ILE A 1 232 ? 15.507 18.111 71.862  1.00 15.45 ? 230 ILE A CG1 1 
ATOM   1776 C CG2 . ILE A 1 232 ? 12.973 17.954 71.299  1.00 17.01 ? 230 ILE A CG2 1 
ATOM   1777 C CD1 . ILE A 1 232 ? 15.664 19.615 71.607  1.00 20.47 ? 230 ILE A CD1 1 
ATOM   1778 N N   . THR A 1 233 ? 12.125 17.006 74.846  1.00 15.11 ? 231 THR A N   1 
ATOM   1779 C CA  . THR A 1 233 ? 10.833 16.665 75.424  1.00 15.54 ? 231 THR A CA  1 
ATOM   1780 C C   . THR A 1 233 ? 10.357 17.789 76.364  1.00 15.04 ? 231 THR A C   1 
ATOM   1781 O O   . THR A 1 233 ? 9.240  18.269 76.262  1.00 14.81 ? 231 THR A O   1 
ATOM   1782 C CB  . THR A 1 233 ? 10.934 15.313 76.165  1.00 15.77 ? 231 THR A CB  1 
ATOM   1783 O OG1 . THR A 1 233 ? 11.234 14.252 75.225  1.00 18.35 ? 231 THR A OG1 1 
ATOM   1784 C CG2 . THR A 1 233 ? 9.632  15.009 76.912  1.00 17.97 ? 231 THR A CG2 1 
ATOM   1785 N N   . LEU A 1 234 ? 11.227 18.222 77.280  1.00 13.84 ? 232 LEU A N   1 
ATOM   1786 C CA  . LEU A 1 234 ? 10.845 19.310 78.193  1.00 14.31 ? 232 LEU A CA  1 
ATOM   1787 C C   . LEU A 1 234 ? 10.470 20.617 77.464  1.00 14.21 ? 232 LEU A C   1 
ATOM   1788 O O   . LEU A 1 234 ? 9.527  21.296 77.825  1.00 13.96 ? 232 LEU A O   1 
ATOM   1789 C CB  . LEU A 1 234 ? 11.988 19.593 79.163  1.00 13.92 ? 232 LEU A CB  1 
ATOM   1790 C CG  . LEU A 1 234 ? 12.257 18.452 80.157  1.00 13.28 ? 232 LEU A CG  1 
ATOM   1791 C CD1 . LEU A 1 234 ? 13.543 18.859 80.931  1.00 13.44 ? 232 LEU A CD1 1 
ATOM   1792 C CD2 . LEU A 1 234 ? 11.089 18.257 81.097  1.00 13.15 ? 232 LEU A CD2 1 
ATOM   1793 N N   . ILE A 1 235 ? 11.269 20.974 76.468  1.00 15.04 ? 233 ILE A N   1 
ATOM   1794 C CA  . ILE A 1 235 ? 11.042 22.194 75.714  1.00 15.71 ? 233 ILE A CA  1 
ATOM   1795 C C   . ILE A 1 235 ? 9.693  22.152 74.982  1.00 17.10 ? 233 ILE A C   1 
ATOM   1796 O O   . ILE A 1 235 ? 8.946  23.119 75.017  1.00 17.51 ? 233 ILE A O   1 
ATOM   1797 C CB  . ILE A 1 235 ? 12.228 22.459 74.744  1.00 15.83 ? 233 ILE A CB  1 
ATOM   1798 C CG1 . ILE A 1 235 ? 13.525 22.731 75.567  1.00 14.09 ? 233 ILE A CG1 1 
ATOM   1799 C CG2 . ILE A 1 235 ? 11.913 23.648 73.793  1.00 16.03 ? 233 ILE A CG2 1 
ATOM   1800 C CD1 . ILE A 1 235 ? 14.863 22.577 74.781  1.00 15.93 ? 233 ILE A CD1 1 
ATOM   1801 N N   . GLU A 1 236 ? 9.379  21.017 74.363  1.00 17.46 ? 234 GLU A N   1 
ATOM   1802 C CA  . GLU A 1 236 ? 8.179  20.907 73.488  1.00 19.64 ? 234 GLU A CA  1 
ATOM   1803 C C   . GLU A 1 236 ? 6.862  20.737 74.257  1.00 20.48 ? 234 GLU A C   1 
ATOM   1804 O O   . GLU A 1 236 ? 5.782  21.064 73.735  1.00 21.12 ? 234 GLU A O   1 
ATOM   1805 C CB  . GLU A 1 236 ? 8.346  19.742 72.496  1.00 19.24 ? 234 GLU A CB  1 
ATOM   1806 C CG  . GLU A 1 236 ? 9.434  20.014 71.496  1.00 19.73 ? 234 GLU A CG  1 
ATOM   1807 C CD  . GLU A 1 236 ? 9.651  18.892 70.490  1.00 20.66 ? 234 GLU A CD  1 
ATOM   1808 O OE1 . GLU A 1 236 ? 9.242  17.726 70.730  1.00 22.00 ? 234 GLU A OE1 1 
ATOM   1809 O OE2 . GLU A 1 236 ? 10.325 19.211 69.501  1.00 22.28 ? 234 GLU A OE2 1 
ATOM   1810 N N   . ASP A 1 237 ? 6.938  20.186 75.470  1.00 19.89 ? 235 ASP A N   1 
ATOM   1811 C CA  . ASP A 1 237 ? 5.728  19.927 76.245  1.00 20.41 ? 235 ASP A CA  1 
ATOM   1812 C C   . ASP A 1 237 ? 5.443  21.082 77.169  1.00 21.26 ? 235 ASP A C   1 
ATOM   1813 O O   . ASP A 1 237 ? 6.017  21.169 78.264  1.00 21.34 ? 235 ASP A O   1 
ATOM   1814 C CB  . ASP A 1 237 ? 5.819  18.615 77.044  1.00 20.64 ? 235 ASP A CB  1 
ATOM   1815 C CG  . ASP A 1 237 ? 4.487  18.239 77.710  1.00 21.57 ? 235 ASP A CG  1 
ATOM   1816 O OD1 . ASP A 1 237 ? 3.597  19.104 77.892  1.00 22.28 ? 235 ASP A OD1 1 
ATOM   1817 O OD2 . ASP A 1 237 ? 4.334  17.051 78.068  1.00 23.27 ? 235 ASP A OD2 1 
ATOM   1818 N N   . ASP A 1 238 ? 4.527  21.939 76.723  1.00 21.29 ? 236 ASP A N   1 
ATOM   1819 C CA  . ASP A 1 238 ? 4.014  23.094 77.482  1.00 22.28 ? 236 ASP A CA  1 
ATOM   1820 C C   . ASP A 1 238 ? 3.478  22.833 78.915  1.00 22.19 ? 236 ASP A C   1 
ATOM   1821 O O   . ASP A 1 238 ? 3.429  23.754 79.717  1.00 24.48 ? 236 ASP A O   1 
ATOM   1822 C CB  . ASP A 1 238 ? 2.919  23.766 76.634  1.00 22.99 ? 236 ASP A CB  1 
ATOM   1823 N N   . ALA A 1 239 ? 3.088  21.594 79.224  1.00 21.83 ? 237 ALA A N   1 
ATOM   1824 C CA  . ALA A 1 239 ? 2.491  21.216 80.528  1.00 21.72 ? 237 ALA A CA  1 
ATOM   1825 C C   . ALA A 1 239 ? 3.542  20.904 81.604  1.00 21.21 ? 237 ALA A C   1 
ATOM   1826 O O   . ALA A 1 239 ? 3.186  20.677 82.781  1.00 21.96 ? 237 ALA A O   1 
ATOM   1827 C CB  . ALA A 1 239 ? 1.558  20.011 80.361  1.00 22.94 ? 237 ALA A CB  1 
ATOM   1828 N N   . LEU A 1 240 ? 4.816  20.863 81.206  1.00 18.44 ? 238 LEU A N   1 
ATOM   1829 C CA  . LEU A 1 240 ? 5.873  20.475 82.145  1.00 16.60 ? 238 LEU A CA  1 
ATOM   1830 C C   . LEU A 1 240 ? 6.507  21.699 82.811  1.00 16.03 ? 238 LEU A C   1 
ATOM   1831 O O   . LEU A 1 240 ? 7.256  22.509 82.207  1.00 15.98 ? 238 LEU A O   1 
ATOM   1832 C CB  . LEU A 1 240 ? 6.914  19.603 81.449  1.00 15.57 ? 238 LEU A CB  1 
ATOM   1833 C CG  . LEU A 1 240 ? 6.386  18.282 80.869  1.00 16.18 ? 238 LEU A CG  1 
ATOM   1834 C CD1 . LEU A 1 240 ? 7.520  17.587 80.159  1.00 16.78 ? 238 LEU A CD1 1 
ATOM   1835 C CD2 . LEU A 1 240 ? 5.776  17.429 81.966  1.00 17.14 ? 238 LEU A CD2 1 
ATOM   1836 N N   . ASN A 1 241 ? 6.163  21.841 84.069  1.00 14.21 ? 239 ASN A N   1 
ATOM   1837 C CA  . ASN A 1 241 ? 6.754  22.878 84.883  1.00 14.28 ? 239 ASN A CA  1 
ATOM   1838 C C   . ASN A 1 241 ? 7.013  22.312 86.282  1.00 13.93 ? 239 ASN A C   1 
ATOM   1839 O O   . ASN A 1 241 ? 6.110  21.728 86.894  1.00 14.38 ? 239 ASN A O   1 
ATOM   1840 C CB  . ASN A 1 241 ? 5.850  24.095 84.962  1.00 13.33 ? 239 ASN A CB  1 
ATOM   1841 C CG  . ASN A 1 241 ? 6.462  25.228 85.774  1.00 13.93 ? 239 ASN A CG  1 
ATOM   1842 O OD1 . ASN A 1 241 ? 7.666  25.527 85.646  1.00 12.27 ? 239 ASN A OD1 1 
ATOM   1843 N ND2 . ASN A 1 241 ? 5.651  25.865 86.624  1.00 16.43 ? 239 ASN A ND2 1 
ATOM   1844 N N   . GLY A 1 242 ? 8.243  22.479 86.744  1.00 12.77 ? 240 GLY A N   1 
ATOM   1845 C CA  . GLY A 1 242 ? 8.678  21.856 88.002  1.00 11.70 ? 240 GLY A CA  1 
ATOM   1846 C C   . GLY A 1 242 ? 8.875  20.340 87.871  1.00 11.72 ? 240 GLY A C   1 
ATOM   1847 O O   . GLY A 1 242 ? 9.033  19.623 88.882  1.00 11.84 ? 240 GLY A O   1 
ATOM   1848 N N   . ALA A 1 243 ? 8.886  19.849 86.636  1.00 10.99 ? 241 ALA A N   1 
ATOM   1849 C CA  . ALA A 1 243 ? 9.098  18.399 86.415  1.00 11.97 ? 241 ALA A CA  1 
ATOM   1850 C C   . ALA A 1 243 ? 10.549 18.031 86.682  1.00 11.93 ? 241 ALA A C   1 
ATOM   1851 O O   . ALA A 1 243 ? 11.490 18.741 86.259  1.00 12.46 ? 241 ALA A O   1 
ATOM   1852 C CB  . ALA A 1 243 ? 8.665  17.982 84.980  1.00 12.11 ? 241 ALA A CB  1 
ATOM   1853 N N   . ILE A 1 244 ? 10.722 16.888 87.358  1.00 12.46 ? 242 ILE A N   1 
ATOM   1854 C CA  . ILE A 1 244 ? 12.031 16.308 87.622  1.00 11.43 ? 242 ILE A CA  1 
ATOM   1855 C C   . ILE A 1 244 ? 12.121 15.055 86.775  1.00 12.56 ? 242 ILE A C   1 
ATOM   1856 O O   . ILE A 1 244 ? 11.554 14.014 87.111  1.00 11.47 ? 242 ILE A O   1 
ATOM   1857 C CB  . ILE A 1 244 ? 12.241 15.988 89.135  1.00 12.06 ? 242 ILE A CB  1 
ATOM   1858 C CG1 . ILE A 1 244 ? 12.012 17.268 89.991  1.00 11.75 ? 242 ILE A CG1 1 
ATOM   1859 C CG2 . ILE A 1 244 ? 13.632 15.339 89.343  1.00 11.56 ? 242 ILE A CG2 1 
ATOM   1860 C CD1 . ILE A 1 244 ? 12.933 18.500 89.591  1.00 12.13 ? 242 ILE A CD1 1 
ATOM   1861 N N   . MET A 1 245 ? 12.750 15.234 85.627  1.00 11.02 ? 243 MET A N   1 
ATOM   1862 C CA  . MET A 1 245 ? 12.892 14.190 84.638  1.00 12.74 ? 243 MET A CA  1 
ATOM   1863 C C   . MET A 1 245 ? 14.078 13.286 84.941  1.00 13.63 ? 243 MET A C   1 
ATOM   1864 O O   . MET A 1 245 ? 15.233 13.761 84.988  1.00 16.54 ? 243 MET A O   1 
ATOM   1865 C CB  . MET A 1 245 ? 13.093 14.836 83.252  1.00 11.08 ? 243 MET A CB  1 
ATOM   1866 C CG  . MET A 1 245 ? 13.247 13.773 82.180  1.00 12.80 ? 243 MET A CG  1 
ATOM   1867 S SD  . MET A 1 245 ? 13.521 14.466 80.525  1.00 14.39 ? 243 MET A SD  1 
ATOM   1868 C CE  . MET A 1 245 ? 11.833 14.912 80.057  1.00 15.70 ? 243 MET A CE  1 
ATOM   1869 N N   . LYS A 1 246 ? 13.825 11.986 85.088  1.00 11.50 ? 244 LYS A N   1 
ATOM   1870 C CA  . LYS A 1 246 ? 14.913 11.002 85.274  1.00 11.06 ? 244 LYS A CA  1 
ATOM   1871 C C   . LYS A 1 246 ? 15.182 10.319 83.927  1.00 11.05 ? 244 LYS A C   1 
ATOM   1872 O O   . LYS A 1 246 ? 14.255 10.116 83.142  1.00 10.19 ? 244 LYS A O   1 
ATOM   1873 C CB  . LYS A 1 246 ? 14.568 9.961  86.322  1.00 11.62 ? 244 LYS A CB  1 
ATOM   1874 C CG  . LYS A 1 246 ? 14.524 10.583 87.753  1.00 11.32 ? 244 LYS A CG  1 
ATOM   1875 C CD  . LYS A 1 246 ? 14.104 9.568  88.860  1.00 13.46 ? 244 LYS A CD  1 
ATOM   1876 C CE  . LYS A 1 246 ? 12.653 9.045  88.730  1.00 16.36 ? 244 LYS A CE  1 
ATOM   1877 N NZ  . LYS A 1 246 ? 12.338 8.030  89.861  1.00 16.34 ? 244 LYS A NZ  1 
ATOM   1878 N N   . ILE A 1 247 ? 16.436 9.991  83.681  1.00 11.08 ? 245 ILE A N   1 
ATOM   1879 C CA  . ILE A 1 247 ? 16.776 9.267  82.446  1.00 11.22 ? 245 ILE A CA  1 
ATOM   1880 C C   . ILE A 1 247 ? 17.710 8.136  82.810  1.00 11.08 ? 245 ILE A C   1 
ATOM   1881 O O   . ILE A 1 247 ? 18.807 8.399  83.325  1.00 11.00 ? 245 ILE A O   1 
ATOM   1882 C CB  . ILE A 1 247 ? 17.430 10.164 81.404  1.00 11.22 ? 245 ILE A CB  1 
ATOM   1883 C CG1 . ILE A 1 247 ? 16.497 11.355 81.105  1.00 11.09 ? 245 ILE A CG1 1 
ATOM   1884 C CG2 . ILE A 1 247 ? 17.693 9.311  80.088  1.00 10.82 ? 245 ILE A CG2 1 
ATOM   1885 C CD1 . ILE A 1 247 ? 17.037 12.377 80.045  1.00 13.38 ? 245 ILE A CD1 1 
ATOM   1886 N N   . THR A 1 248 ? 17.253 6.889  82.641  1.00 11.14 ? 246 THR A N   1 
ATOM   1887 C CA  . THR A 1 248 ? 18.094 5.771  83.049  1.00 12.17 ? 246 THR A CA  1 
ATOM   1888 C C   . THR A 1 248 ? 18.131 4.679  81.972  1.00 12.56 ? 246 THR A C   1 
ATOM   1889 O O   . THR A 1 248 ? 17.256 4.638  81.093  1.00 12.02 ? 246 THR A O   1 
ATOM   1890 C CB  . THR A 1 248 ? 17.589 5.106  84.340  1.00 13.67 ? 246 THR A CB  1 
ATOM   1891 O OG1 . THR A 1 248 ? 16.276 4.579  84.102  1.00 11.84 ? 246 THR A OG1 1 
ATOM   1892 C CG2 . THR A 1 248 ? 17.535 6.090  85.533  1.00 12.97 ? 246 THR A CG2 1 
ATOM   1893 N N   . THR A 1 249 ? 19.074 3.751  82.104  1.00 12.29 ? 247 THR A N   1 
ATOM   1894 C CA  . THR A 1 249 ? 19.152 2.644  81.117  1.00 13.33 ? 247 THR A CA  1 
ATOM   1895 C C   . THR A 1 249 ? 17.891 1.743  81.276  1.00 13.29 ? 247 THR A C   1 
ATOM   1896 O O   . THR A 1 249 ? 17.373 1.198  80.277  1.00 15.25 ? 247 THR A O   1 
ATOM   1897 C CB  . THR A 1 249 ? 20.435 1.822  81.294  1.00 14.39 ? 247 THR A CB  1 
ATOM   1898 O OG1 . THR A 1 249 ? 20.525 1.349  82.646  1.00 13.67 ? 247 THR A OG1 1 
ATOM   1899 C CG2 . THR A 1 249 ? 21.664 2.668  80.972  1.00 13.94 ? 247 THR A CG2 1 
ATOM   1900 N N   . SER A 1 250 ? 17.377 1.637  82.508  1.00 13.86 ? 248 SER A N   1 
ATOM   1901 C CA  . SER A 1 250 ? 16.214 0.764  82.826  1.00 14.45 ? 248 SER A CA  1 
ATOM   1902 C C   . SER A 1 250 ? 14.872 1.263  82.271  1.00 15.20 ? 248 SER A C   1 
ATOM   1903 O O   . SER A 1 250 ? 14.055 0.470  81.763  1.00 14.87 ? 248 SER A O   1 
ATOM   1904 C CB  . SER A 1 250 ? 16.078 0.617  84.340  1.00 15.65 ? 248 SER A CB  1 
ATOM   1905 O OG  . SER A 1 250 ? 17.179 -0.136 84.851  1.00 16.05 ? 248 SER A OG  1 
ATOM   1906 N N   . LYS A 1 251 ? 14.637 2.574  82.378  1.00 13.90 ? 249 LYS A N   1 
ATOM   1907 C CA  . LYS A 1 251 ? 13.285 3.136  82.125  1.00 13.69 ? 249 LYS A CA  1 
ATOM   1908 C C   . LYS A 1 251 ? 13.270 4.232  81.050  1.00 12.79 ? 249 LYS A C   1 
ATOM   1909 O O   . LYS A 1 251 ? 12.229 4.793  80.749  1.00 13.43 ? 249 LYS A O   1 
ATOM   1910 C CB  . LYS A 1 251 ? 12.681 3.673  83.424  1.00 14.35 ? 249 LYS A CB  1 
ATOM   1911 C CG  . LYS A 1 251 ? 12.370 2.557  84.398  1.00 17.08 ? 249 LYS A CG  1 
ATOM   1912 C CD  . LYS A 1 251 ? 11.685 3.048  85.654  1.00 18.42 ? 249 LYS A CD  1 
ATOM   1913 C CE  . LYS A 1 251 ? 11.546 1.809  86.506  1.00 23.82 ? 249 LYS A CE  1 
ATOM   1914 N NZ  . LYS A 1 251 ? 11.344 2.035  87.938  1.00 25.70 ? 249 LYS A NZ  1 
ATOM   1915 N N   . GLY A 1 252 ? 14.445 4.535  80.489  1.00 12.85 ? 250 GLY A N   1 
ATOM   1916 C CA  . GLY A 1 252 ? 14.569 5.706  79.593  1.00 11.97 ? 250 GLY A CA  1 
ATOM   1917 C C   . GLY A 1 252 ? 14.055 6.964  80.290  1.00 11.94 ? 250 GLY A C   1 
ATOM   1918 O O   . GLY A 1 252 ? 14.297 7.193  81.495  1.00 12.34 ? 250 GLY A O   1 
ATOM   1919 N N   . ILE A 1 253 ? 13.367 7.805  79.537  1.00 11.60 ? 251 ILE A N   1 
ATOM   1920 C CA  . ILE A 1 253 ? 12.901 9.092  80.067  1.00 12.16 ? 251 ILE A CA  1 
ATOM   1921 C C   . ILE A 1 253 ? 11.655 8.849  80.879  1.00 13.45 ? 251 ILE A C   1 
ATOM   1922 O O   . ILE A 1 253 ? 10.668 8.258  80.376  1.00 13.74 ? 251 ILE A O   1 
ATOM   1923 C CB  . ILE A 1 253 ? 12.612 10.059 78.902  1.00 12.67 ? 251 ILE A CB  1 
ATOM   1924 C CG1 . ILE A 1 253 ? 13.901 10.435 78.192  1.00 12.86 ? 251 ILE A CG1 1 
ATOM   1925 C CG2 . ILE A 1 253 ? 11.808 11.312 79.364  1.00 13.98 ? 251 ILE A CG2 1 
ATOM   1926 C CD1 . ILE A 1 253 ? 13.630 11.155 76.843  1.00 16.86 ? 251 ILE A CD1 1 
ATOM   1927 N N   . HIS A 1 254 ? 11.677 9.337  82.123  1.00 11.62 ? 252 HIS A N   1 
ATOM   1928 C CA  . HIS A 1 254 ? 10.534 9.188  83.036  1.00 12.40 ? 252 HIS A CA  1 
ATOM   1929 C C   . HIS A 1 254 ? 10.629 10.292 84.096  1.00 13.14 ? 252 HIS A C   1 
ATOM   1930 O O   . HIS A 1 254 ? 11.509 11.146 83.996  1.00 14.69 ? 252 HIS A O   1 
ATOM   1931 C CB  . HIS A 1 254 ? 10.440 7.760  83.631  1.00 11.88 ? 252 HIS A CB  1 
ATOM   1932 C CG  . HIS A 1 254 ? 11.634 7.342  84.453  1.00 11.26 ? 252 HIS A CG  1 
ATOM   1933 N ND1 . HIS A 1 254 ? 12.887 7.130  83.909  1.00 12.55 ? 252 HIS A ND1 1 
ATOM   1934 C CD2 . HIS A 1 254 ? 11.745 7.031  85.774  1.00 11.66 ? 252 HIS A CD2 1 
ATOM   1935 C CE1 . HIS A 1 254 ? 13.725 6.738  84.857  1.00 12.84 ? 252 HIS A CE1 1 
ATOM   1936 N NE2 . HIS A 1 254 ? 13.056 6.678  86.001  1.00 12.19 ? 252 HIS A NE2 1 
ATOM   1937 N N   . PHE A 1 255 ? 9.682  10.333 85.022  1.00 14.07 ? 253 PHE A N   1 
ATOM   1938 C CA  . PHE A 1 255 ? 9.588  11.473 85.955  1.00 13.75 ? 253 PHE A CA  1 
ATOM   1939 C C   . PHE A 1 255 ? 9.500  10.997 87.378  1.00 15.08 ? 253 PHE A C   1 
ATOM   1940 O O   . PHE A 1 255 ? 8.889  9.955  87.666  1.00 15.66 ? 253 PHE A O   1 
ATOM   1941 C CB  . PHE A 1 255 ? 8.377  12.354 85.629  1.00 14.69 ? 253 PHE A CB  1 
ATOM   1942 C CG  . PHE A 1 255 ? 8.455  12.986 84.258  1.00 13.31 ? 253 PHE A CG  1 
ATOM   1943 C CD1 . PHE A 1 255 ? 9.026  14.258 84.110  1.00 13.42 ? 253 PHE A CD1 1 
ATOM   1944 C CD2 . PHE A 1 255 ? 7.997  12.307 83.114  1.00 13.95 ? 253 PHE A CD2 1 
ATOM   1945 C CE1 . PHE A 1 255 ? 9.121  14.862 82.860  1.00 11.95 ? 253 PHE A CE1 1 
ATOM   1946 C CE2 . PHE A 1 255 ? 8.078  12.896 81.835  1.00 15.80 ? 253 PHE A CE2 1 
ATOM   1947 C CZ  . PHE A 1 255 ? 8.663  14.195 81.701  1.00 14.07 ? 253 PHE A CZ  1 
ATOM   1948 N N   . GLN A 1 256 ? 10.122 11.766 88.254  1.00 14.37 ? 254 GLN A N   1 
ATOM   1949 C CA  . GLN A 1 256 ? 9.960  11.582 89.703  1.00 14.09 ? 254 GLN A CA  1 
ATOM   1950 C C   . GLN A 1 256 ? 8.507  11.952 90.021  1.00 14.57 ? 254 GLN A C   1 
ATOM   1951 O O   . GLN A 1 256 ? 8.034  13.024 89.620  1.00 13.97 ? 254 GLN A O   1 
ATOM   1952 C CB  . GLN A 1 256 ? 10.947 12.497 90.455  1.00 13.56 ? 254 GLN A CB  1 
ATOM   1953 C CG  . GLN A 1 256 ? 10.947 12.307 91.963  1.00 15.40 ? 254 GLN A CG  1 
ATOM   1954 C CD  . GLN A 1 256 ? 11.592 10.986 92.384  1.00 17.46 ? 254 GLN A CD  1 
ATOM   1955 O OE1 . GLN A 1 256 ? 12.008 10.166 91.554  1.00 14.80 ? 254 GLN A OE1 1 
ATOM   1956 N NE2 . GLN A 1 256 ? 11.693 10.789 93.696  1.00 21.14 ? 254 GLN A NE2 1 
ATOM   1957 N N   . ASP A 1 257 ? 7.826  11.086 90.765  1.00 15.37 ? 255 ASP A N   1 
ATOM   1958 C CA  . ASP A 1 257 ? 6.431  11.325 91.080  1.00 17.39 ? 255 ASP A CA  1 
ATOM   1959 C C   . ASP A 1 257 ? 6.338  11.753 92.547  1.00 16.72 ? 255 ASP A C   1 
ATOM   1960 O O   . ASP A 1 257 ? 6.629  10.954 93.443  1.00 18.09 ? 255 ASP A O   1 
ATOM   1961 C CB  . ASP A 1 257 ? 5.610  10.039 90.846  1.00 18.51 ? 255 ASP A CB  1 
ATOM   1962 C CG  . ASP A 1 257 ? 4.093  10.263 91.010  1.00 23.49 ? 255 ASP A CG  1 
ATOM   1963 O OD1 . ASP A 1 257 ? 3.643  11.385 91.379  1.00 23.32 ? 255 ASP A OD1 1 
ATOM   1964 O OD2 . ASP A 1 257 ? 3.352  9.290  90.732  1.00 27.07 ? 255 ASP A OD2 1 
ATOM   1965 N N   . TYR A 1 258 ? 5.958  13.005 92.781  1.00 15.90 ? 256 TYR A N   1 
ATOM   1966 C CA  . TYR A 1 258 ? 5.875  13.519 94.140  1.00 16.14 ? 256 TYR A CA  1 
ATOM   1967 C C   . TYR A 1 258 ? 4.445  13.430 94.689  1.00 17.84 ? 256 TYR A C   1 
ATOM   1968 O O   . TYR A 1 258 ? 4.167  13.942 95.779  1.00 17.74 ? 256 TYR A O   1 
ATOM   1969 C CB  . TYR A 1 258 ? 6.365  14.956 94.199  1.00 15.88 ? 256 TYR A CB  1 
ATOM   1970 C CG  . TYR A 1 258 ? 7.866  15.085 93.928  1.00 13.91 ? 256 TYR A CG  1 
ATOM   1971 C CD1 . TYR A 1 258 ? 8.815  14.741 94.911  1.00 15.75 ? 256 TYR A CD1 1 
ATOM   1972 C CD2 . TYR A 1 258 ? 8.323  15.549 92.696  1.00 14.79 ? 256 TYR A CD2 1 
ATOM   1973 C CE1 . TYR A 1 258 ? 10.206 14.862 94.651  1.00 15.62 ? 256 TYR A CE1 1 
ATOM   1974 C CE2 . TYR A 1 258 ? 9.720  15.682 92.414  1.00 15.86 ? 256 TYR A CE2 1 
ATOM   1975 C CZ  . TYR A 1 258 ? 10.642 15.325 93.392  1.00 13.03 ? 256 TYR A CZ  1 
ATOM   1976 O OH  . TYR A 1 258 ? 12.007 15.459 93.143  1.00 12.40 ? 256 TYR A OH  1 
ATOM   1977 N N   . GLY A 1 259 ? 3.565  12.795 93.918  1.00 18.06 ? 257 GLY A N   1 
ATOM   1978 C CA  . GLY A 1 259 ? 2.168  12.583 94.364  1.00 19.32 ? 257 GLY A CA  1 
ATOM   1979 C C   . GLY A 1 259 ? 1.274  13.815 94.228  1.00 20.43 ? 257 GLY A C   1 
ATOM   1980 O O   . GLY A 1 259 ? 1.734  14.883 93.799  1.00 20.31 ? 257 GLY A O   1 
ATOM   1981 N N   . SER A 1 260 ? -0.009 13.656 94.584  1.00 21.26 ? 258 SER A N   1 
ATOM   1982 C CA  . SER A 1 260 ? -1.033 14.713 94.341  1.00 22.31 ? 258 SER A CA  1 
ATOM   1983 C C   . SER A 1 260 ? -1.355 15.532 95.599  1.00 22.86 ? 258 SER A C   1 
ATOM   1984 O O   . SER A 1 260 ? -2.265 16.366 95.574  1.00 23.27 ? 258 SER A O   1 
ATOM   1985 C CB  . SER A 1 260 ? -2.341 14.105 93.775  1.00 22.04 ? 258 SER A CB  1 
ATOM   1986 O OG  . SER A 1 260 ? -2.688 12.972 94.573  1.00 24.17 ? 258 SER A OG  1 
ATOM   1987 N N   . LYS A 1 261 ? -0.615 15.291 96.684  1.00 22.76 ? 259 LYS A N   1 
ATOM   1988 C CA  . LYS A 1 261 ? -0.811 15.998 97.955  1.00 23.55 ? 259 LYS A CA  1 
ATOM   1989 C C   . LYS A 1 261 ? 0.390  16.881 98.260  1.00 23.52 ? 259 LYS A C   1 
ATOM   1990 O O   . LYS A 1 261 ? 1.367  16.397 98.832  1.00 23.34 ? 259 LYS A O   1 
ATOM   1991 C CB  . LYS A 1 261 ? -1.028 15.006 99.096  1.00 23.74 ? 259 LYS A CB  1 
ATOM   1992 C CG  . LYS A 1 261 ? -2.218 14.108 98.908  1.00 26.72 ? 259 LYS A CG  1 
ATOM   1993 C CD  . LYS A 1 261 ? -2.215 13.013 99.970  1.00 30.99 ? 259 LYS A CD  1 
ATOM   1994 C CE  . LYS A 1 261 ? -3.321 12.017 99.719  1.00 33.52 ? 259 LYS A CE  1 
ATOM   1995 N NZ  . LYS A 1 261 ? -3.099 10.692 100.405 1.00 34.76 ? 259 LYS A NZ  1 
ATOM   1996 N N   . GLU A 1 262 ? 0.294  18.171 97.898  1.00 24.09 ? 260 GLU A N   1 
ATOM   1997 C CA  . GLU A 1 262 ? 1.419  19.112 97.982  1.00 25.26 ? 260 GLU A CA  1 
ATOM   1998 C C   . GLU A 1 262 ? 1.978  19.250 99.398  1.00 23.96 ? 260 GLU A C   1 
ATOM   1999 O O   . GLU A 1 262 ? 3.195  19.370 99.563  1.00 22.84 ? 260 GLU A O   1 
ATOM   2000 C CB  . GLU A 1 262 ? 1.035  20.499 97.445  1.00 25.57 ? 260 GLU A CB  1 
ATOM   2001 C CG  . GLU A 1 262 ? -0.111 21.170 98.232  1.00 29.11 ? 260 GLU A CG  1 
ATOM   2002 C CD  . GLU A 1 262 ? -0.697 22.386 97.517  1.00 30.41 ? 260 GLU A CD  1 
ATOM   2003 O OE1 . GLU A 1 262 ? -0.206 22.737 96.403  1.00 36.09 ? 260 GLU A OE1 1 
ATOM   2004 O OE2 . GLU A 1 262 ? -1.664 22.968 98.070  1.00 36.01 ? 260 GLU A OE2 1 
ATOM   2005 N N   . ASN A 1 263 ? 1.097  19.236 100.407 1.00 22.33 ? 261 ASN A N   1 
ATOM   2006 C CA  . ASN A 1 263 ? 1.565  19.414 101.785 1.00 22.17 ? 261 ASN A CA  1 
ATOM   2007 C C   . ASN A 1 263 ? 1.634  18.133 102.594 1.00 20.95 ? 261 ASN A C   1 
ATOM   2008 O O   . ASN A 1 263 ? 1.570  18.155 103.834 1.00 19.58 ? 261 ASN A O   1 
ATOM   2009 C CB  . ASN A 1 263 ? 0.761  20.495 102.492 1.00 22.31 ? 261 ASN A CB  1 
ATOM   2010 C CG  . ASN A 1 263 ? 1.062  21.848 101.940 1.00 24.41 ? 261 ASN A CG  1 
ATOM   2011 O OD1 . ASN A 1 263 ? 2.224  22.137 101.574 1.00 26.84 ? 261 ASN A OD1 1 
ATOM   2012 N ND2 . ASN A 1 263 ? 0.035  22.689 101.845 1.00 26.16 ? 261 ASN A ND2 1 
ATOM   2013 N N   . LEU A 1 264 ? 1.778  17.030 101.857 1.00 20.00 ? 262 LEU A N   1 
ATOM   2014 C CA  . LEU A 1 264 ? 1.885  15.690 102.431 1.00 19.31 ? 262 LEU A CA  1 
ATOM   2015 C C   . LEU A 1 264 ? 2.667  15.690 103.735 1.00 18.95 ? 262 LEU A C   1 
ATOM   2016 O O   . LEU A 1 264 ? 2.211  15.110 104.744 1.00 18.78 ? 262 LEU A O   1 
ATOM   2017 C CB  . LEU A 1 264 ? 2.549  14.713 101.456 1.00 20.49 ? 262 LEU A CB  1 
ATOM   2018 C CG  . LEU A 1 264 ? 2.764  13.273 101.955 1.00 19.92 ? 262 LEU A CG  1 
ATOM   2019 C CD1 . LEU A 1 264 ? 1.437  12.540 102.237 1.00 21.86 ? 262 LEU A CD1 1 
ATOM   2020 C CD2 . LEU A 1 264 ? 3.615  12.515 100.943 1.00 20.06 ? 262 LEU A CD2 1 
ATOM   2021 N N   . TYR A 1 265 ? 3.846  16.316 103.717 1.00 17.32 ? 263 TYR A N   1 
ATOM   2022 C CA  . TYR A 1 265 ? 4.785  16.154 104.846 1.00 18.37 ? 263 TYR A CA  1 
ATOM   2023 C C   . TYR A 1 265 ? 4.370  16.879 106.121 1.00 18.15 ? 263 TYR A C   1 
ATOM   2024 O O   . TYR A 1 265 ? 4.904  16.587 107.196 1.00 16.64 ? 263 TYR A O   1 
ATOM   2025 C CB  . TYR A 1 265 ? 6.219  16.531 104.448 1.00 18.14 ? 263 TYR A CB  1 
ATOM   2026 C CG  . TYR A 1 265 ? 6.837  15.551 103.466 1.00 18.92 ? 263 TYR A CG  1 
ATOM   2027 C CD1 . TYR A 1 265 ? 7.705  16.000 102.460 1.00 19.17 ? 263 TYR A CD1 1 
ATOM   2028 C CD2 . TYR A 1 265 ? 6.518  14.185 103.498 1.00 20.58 ? 263 TYR A CD2 1 
ATOM   2029 C CE1 . TYR A 1 265 ? 8.269  15.126 101.544 1.00 19.50 ? 263 TYR A CE1 1 
ATOM   2030 C CE2 . TYR A 1 265 ? 7.067  13.287 102.567 1.00 21.70 ? 263 TYR A CE2 1 
ATOM   2031 C CZ  . TYR A 1 265 ? 7.966  13.778 101.591 1.00 20.60 ? 263 TYR A CZ  1 
ATOM   2032 O OH  . TYR A 1 265 ? 8.522  12.914 100.658 1.00 21.63 ? 263 TYR A OH  1 
ATOM   2033 N N   . PHE A 1 266 ? 3.449  17.838 105.984 1.00 17.79 ? 264 PHE A N   1 
ATOM   2034 C CA  . PHE A 1 266 ? 2.825  18.516 107.132 1.00 18.85 ? 264 PHE A CA  1 
ATOM   2035 C C   . PHE A 1 266 ? 1.619  17.755 107.706 1.00 19.54 ? 264 PHE A C   1 
ATOM   2036 O O   . PHE A 1 266 ? 1.121  18.106 108.782 1.00 18.38 ? 264 PHE A O   1 
ATOM   2037 C CB  . PHE A 1 266 ? 2.354  19.915 106.710 1.00 18.69 ? 264 PHE A CB  1 
ATOM   2038 C CG  . PHE A 1 266 ? 3.465  20.920 106.620 1.00 17.28 ? 264 PHE A CG  1 
ATOM   2039 C CD1 . PHE A 1 266 ? 3.916  21.584 107.766 1.00 16.92 ? 264 PHE A CD1 1 
ATOM   2040 C CD2 . PHE A 1 266 ? 4.083  21.181 105.392 1.00 17.47 ? 264 PHE A CD2 1 
ATOM   2041 C CE1 . PHE A 1 266 ? 4.952  22.534 107.686 1.00 18.10 ? 264 PHE A CE1 1 
ATOM   2042 C CE2 . PHE A 1 266 ? 5.142  22.122 105.294 1.00 19.73 ? 264 PHE A CE2 1 
ATOM   2043 C CZ  . PHE A 1 266 ? 5.568  22.805 106.421 1.00 16.69 ? 264 PHE A CZ  1 
ATOM   2044 N N   . GLN A 1 267 ? 1.138  16.748 106.974 1.00 21.00 ? 265 GLN A N   1 
ATOM   2045 C CA  . GLN A 1 267 ? -0.157 16.125 107.295 1.00 23.22 ? 265 GLN A CA  1 
ATOM   2046 C C   . GLN A 1 267 ? -0.027 14.871 108.139 1.00 24.57 ? 265 GLN A C   1 
ATOM   2047 O O   . GLN A 1 267 ? 1.074  14.439 108.503 1.00 24.82 ? 265 GLN A O   1 
ATOM   2048 C CB  . GLN A 1 267 ? -0.952 15.836 106.011 1.00 23.00 ? 265 GLN A CB  1 
ATOM   2049 C CG  . GLN A 1 267 ? -1.350 17.090 105.277 1.00 25.99 ? 265 GLN A CG  1 
ATOM   2050 C CD  . GLN A 1 267 ? -1.788 16.853 103.840 1.00 29.76 ? 265 GLN A CD  1 
ATOM   2051 O OE1 . GLN A 1 267 ? -1.707 15.735 103.301 1.00 29.48 ? 265 GLN A OE1 1 
ATOM   2052 N NE2 . GLN A 1 267 ? -2.256 17.924 103.207 1.00 32.59 ? 265 GLN A NE2 1 
ATOM   2053 O OXT . GLN A 1 267 ? -1.059 14.265 108.489 1.00 25.68 ? 265 GLN A OXT 1 
HETATM 2054 P PA  . NAD B 2 .   ? 31.800 17.248 80.967  1.00 13.97 ? 300 NAD A PA  1 
HETATM 2055 O O1A . NAD B 2 .   ? 32.982 17.377 81.882  1.00 13.24 ? 300 NAD A O1A 1 
HETATM 2056 O O2A . NAD B 2 .   ? 32.039 16.324 79.834  1.00 15.32 ? 300 NAD A O2A 1 
HETATM 2057 O O5B . NAD B 2 .   ? 31.212 18.625 80.411  1.00 13.72 ? 300 NAD A O5B 1 
HETATM 2058 C C5B . NAD B 2 .   ? 31.055 19.711 81.297  1.00 15.31 ? 300 NAD A C5B 1 
HETATM 2059 C C4B . NAD B 2 .   ? 31.296 21.005 80.506  1.00 16.08 ? 300 NAD A C4B 1 
HETATM 2060 O O4B . NAD B 2 .   ? 31.065 22.080 81.425  1.00 13.88 ? 300 NAD A O4B 1 
HETATM 2061 C C3B . NAD B 2 .   ? 32.738 21.137 79.968  1.00 14.84 ? 300 NAD A C3B 1 
HETATM 2062 O O3B . NAD B 2 .   ? 32.719 21.591 78.625  1.00 15.89 ? 300 NAD A O3B 1 
HETATM 2063 C C2B . NAD B 2 .   ? 33.366 22.162 80.913  1.00 14.57 ? 300 NAD A C2B 1 
HETATM 2064 O O2B . NAD B 2 .   ? 34.422 22.954 80.371  1.00 15.56 ? 300 NAD A O2B 1 
HETATM 2065 C C1B . NAD B 2 .   ? 32.130 22.999 81.340  1.00 14.09 ? 300 NAD A C1B 1 
HETATM 2066 N N9A . NAD B 2 .   ? 32.342 23.708 82.618  1.00 14.50 ? 300 NAD A N9A 1 
HETATM 2067 C C8A . NAD B 2 .   ? 32.710 23.160 83.830  1.00 14.65 ? 300 NAD A C8A 1 
HETATM 2068 N N7A . NAD B 2 .   ? 32.826 24.167 84.727  1.00 13.88 ? 300 NAD A N7A 1 
HETATM 2069 C C5A . NAD B 2 .   ? 32.485 25.324 84.099  1.00 13.58 ? 300 NAD A C5A 1 
HETATM 2070 C C6A . NAD B 2 .   ? 32.427 26.652 84.504  1.00 13.51 ? 300 NAD A C6A 1 
HETATM 2071 N N6A . NAD B 2 .   ? 32.735 26.978 85.762  1.00 14.44 ? 300 NAD A N6A 1 
HETATM 2072 N N1A . NAD B 2 .   ? 32.077 27.620 83.590  1.00 15.00 ? 300 NAD A N1A 1 
HETATM 2073 C C2A . NAD B 2 .   ? 31.774 27.336 82.264  1.00 13.37 ? 300 NAD A C2A 1 
HETATM 2074 N N3A . NAD B 2 .   ? 31.851 26.032 81.851  1.00 14.48 ? 300 NAD A N3A 1 
HETATM 2075 C C4A . NAD B 2 .   ? 32.184 25.040 82.764  1.00 12.35 ? 300 NAD A C4A 1 
HETATM 2076 O O3  . NAD B 2 .   ? 30.658 16.634 81.910  1.00 15.33 ? 300 NAD A O3  1 
HETATM 2077 P PN  . NAD B 2 .   ? 29.146 16.294 81.553  1.00 14.01 ? 300 NAD A PN  1 
HETATM 2078 O O1N . NAD B 2 .   ? 28.770 16.551 80.152  1.00 10.61 ? 300 NAD A O1N 1 
HETATM 2079 O O2N . NAD B 2 .   ? 28.942 14.912 82.016  1.00 14.57 ? 300 NAD A O2N 1 
HETATM 2080 O O5D . NAD B 2 .   ? 28.416 17.333 82.562  1.00 13.24 ? 300 NAD A O5D 1 
HETATM 2081 C C5D . NAD B 2 .   ? 27.335 18.211 82.196  1.00 10.85 ? 300 NAD A C5D 1 
HETATM 2082 C C4D . NAD B 2 .   ? 26.263 18.109 83.326  1.00 10.88 ? 300 NAD A C4D 1 
HETATM 2083 O O4D . NAD B 2 .   ? 25.669 16.766 83.413  1.00 10.69 ? 300 NAD A O4D 1 
HETATM 2084 C C3D . NAD B 2 .   ? 26.886 18.408 84.706  1.00 9.68  ? 300 NAD A C3D 1 
HETATM 2085 O O3D . NAD B 2 .   ? 26.070 19.306 85.439  1.00 11.85 ? 300 NAD A O3D 1 
HETATM 2086 C C2D . NAD B 2 .   ? 26.894 17.025 85.359  1.00 10.92 ? 300 NAD A C2D 1 
HETATM 2087 O O2D . NAD B 2 .   ? 26.915 17.111 86.782  1.00 11.35 ? 300 NAD A O2D 1 
HETATM 2088 C C1D . NAD B 2 .   ? 25.604 16.437 84.788  1.00 12.16 ? 300 NAD A C1D 1 
HETATM 2089 N N1N . NAD B 2 .   ? 25.488 14.958 84.935  1.00 12.22 ? 300 NAD A N1N 1 
HETATM 2090 C C2N . NAD B 2 .   ? 26.422 14.139 84.338  1.00 11.71 ? 300 NAD A C2N 1 
HETATM 2091 C C3N . NAD B 2 .   ? 26.310 12.754 84.470  1.00 12.89 ? 300 NAD A C3N 1 
HETATM 2092 C C7N . NAD B 2 .   ? 27.368 11.879 83.843  1.00 14.02 ? 300 NAD A C7N 1 
HETATM 2093 O O7N . NAD B 2 .   ? 27.377 10.579 84.213  1.00 14.70 ? 300 NAD A O7N 1 
HETATM 2094 N N7N . NAD B 2 .   ? 28.236 12.351 82.938  1.00 14.65 ? 300 NAD A N7N 1 
HETATM 2095 C C4N . NAD B 2 .   ? 25.219 12.184 85.132  1.00 13.23 ? 300 NAD A C4N 1 
HETATM 2096 C C5N . NAD B 2 .   ? 24.261 13.053 85.698  1.00 11.55 ? 300 NAD A C5N 1 
HETATM 2097 C C6N . NAD B 2 .   ? 24.388 14.440 85.565  1.00 12.14 ? 300 NAD A C6N 1 
HETATM 2098 O O   . HOH C 3 .   ? 23.559 4.827  83.386  1.00 13.81 ? 301 HOH A O   1 
HETATM 2099 O O   . HOH C 3 .   ? 33.782 16.641 99.514  1.00 12.48 ? 302 HOH A O   1 
HETATM 2100 O O   . HOH C 3 .   ? 15.517 3.453  86.438  1.00 14.91 ? 303 HOH A O   1 
HETATM 2101 O O   . HOH C 3 .   ? 28.433 19.164 79.245  1.00 11.54 ? 304 HOH A O   1 
HETATM 2102 O O   . HOH C 3 .   ? 25.396 21.484 88.246  1.00 15.07 ? 305 HOH A O   1 
HETATM 2103 O O   . HOH C 3 .   ? 32.116 16.498 93.364  1.00 14.19 ? 306 HOH A O   1 
HETATM 2104 O O   . HOH C 3 .   ? 7.145  22.418 91.579  1.00 14.03 ? 307 HOH A O   1 
HETATM 2105 O O   . HOH C 3 .   ? 22.522 15.162 70.798  1.00 17.20 ? 308 HOH A O   1 
HETATM 2106 O O   . HOH C 3 .   ? 24.492 29.207 84.736  1.00 13.39 ? 309 HOH A O   1 
HETATM 2107 O O   . HOH C 3 .   ? 8.463  15.462 88.313  1.00 13.80 ? 310 HOH A O   1 
HETATM 2108 O O   . HOH C 3 .   ? 6.621  41.447 78.514  1.00 15.33 ? 311 HOH A O   1 
HETATM 2109 O O   . HOH C 3 .   ? 13.326 15.376 95.487  1.00 13.63 ? 312 HOH A O   1 
HETATM 2110 O O   . HOH C 3 .   ? 33.199 18.651 84.321  1.00 16.14 ? 313 HOH A O   1 
HETATM 2111 O O   . HOH C 3 .   ? 26.547 25.430 86.374  1.00 12.27 ? 314 HOH A O   1 
HETATM 2112 O O   . HOH C 3 .   ? 9.406  33.270 87.477  1.00 18.55 ? 315 HOH A O   1 
HETATM 2113 O O   . HOH C 3 .   ? 20.895 4.711  84.133  1.00 14.84 ? 316 HOH A O   1 
HETATM 2114 O O   . HOH C 3 .   ? 25.963 12.324 88.312  1.00 13.51 ? 317 HOH A O   1 
HETATM 2115 O O   . HOH C 3 .   ? 25.367 26.741 84.261  1.00 13.94 ? 318 HOH A O   1 
HETATM 2116 O O   . HOH C 3 .   ? 33.155 12.084 104.929 1.00 17.86 ? 319 HOH A O   1 
HETATM 2117 O O   . HOH C 3 .   ? 7.883  19.705 91.317  1.00 15.23 ? 320 HOH A O   1 
HETATM 2118 O O   . HOH C 3 .   ? 15.879 15.733 96.478  1.00 14.41 ? 321 HOH A O   1 
HETATM 2119 O O   . HOH C 3 .   ? 17.494 12.065 99.059  1.00 14.59 ? 322 HOH A O   1 
HETATM 2120 O O   . HOH C 3 .   ? 34.622 17.398 86.469  1.00 18.47 ? 323 HOH A O   1 
HETATM 2121 O O   . HOH C 3 .   ? 35.027 28.749 66.020  1.00 22.18 ? 324 HOH A O   1 
HETATM 2122 O O   . HOH C 3 .   ? 33.223 14.795 78.145  1.00 22.09 ? 325 HOH A O   1 
HETATM 2123 O O   . HOH C 3 .   ? 19.312 25.349 63.681  1.00 19.18 ? 326 HOH A O   1 
HETATM 2124 O O   . HOH C 3 .   ? 21.575 36.259 88.845  1.00 13.27 ? 327 HOH A O   1 
HETATM 2125 O O   . HOH C 3 .   ? 10.158 32.093 74.595  1.00 17.05 ? 328 HOH A O   1 
HETATM 2126 O O   . HOH C 3 .   ? 35.934 22.018 92.034  1.00 22.69 ? 329 HOH A O   1 
HETATM 2127 O O   . HOH C 3 .   ? 17.464 16.874 67.618  1.00 22.66 ? 330 HOH A O   1 
HETATM 2128 O O   . HOH C 3 .   ? 2.282  19.595 110.656 1.00 18.18 ? 331 HOH A O   1 
HETATM 2129 O O   . HOH C 3 .   ? 26.633 5.314  97.682  1.00 20.24 ? 332 HOH A O   1 
HETATM 2130 O O   . HOH C 3 .   ? 8.291  16.653 97.917  1.00 21.26 ? 333 HOH A O   1 
HETATM 2131 O O   . HOH C 3 .   ? 2.195  14.164 97.524  1.00 19.78 ? 334 HOH A O   1 
HETATM 2132 O O   . HOH C 3 .   ? 9.027  40.266 75.081  1.00 19.63 ? 335 HOH A O   1 
HETATM 2133 O O   . HOH C 3 .   ? 10.716 31.532 89.106  1.00 13.58 ? 336 HOH A O   1 
HETATM 2134 O O   . HOH C 3 .   ? 22.834 40.503 81.755  1.00 21.14 ? 337 HOH A O   1 
HETATM 2135 O O   . HOH C 3 .   ? 31.096 37.265 78.623  1.00 20.29 ? 338 HOH A O   1 
HETATM 2136 O O   . HOH C 3 .   ? 5.392  23.015 89.464  1.00 19.46 ? 339 HOH A O   1 
HETATM 2137 O O   . HOH C 3 .   ? 4.580  19.652 85.297  1.00 25.01 ? 340 HOH A O   1 
HETATM 2138 O O   . HOH C 3 .   ? 4.039  31.483 84.560  1.00 16.89 ? 341 HOH A O   1 
HETATM 2139 O O   . HOH C 3 .   ? 11.323 35.733 76.447  1.00 16.95 ? 342 HOH A O   1 
HETATM 2140 O O   . HOH C 3 .   ? 10.233 5.850  79.217  1.00 20.86 ? 343 HOH A O   1 
HETATM 2141 O O   . HOH C 3 .   ? 26.758 26.411 63.062  1.00 24.73 ? 344 HOH A O   1 
HETATM 2142 O O   . HOH C 3 .   ? 9.644  39.602 72.625  1.00 19.80 ? 345 HOH A O   1 
HETATM 2143 O O   . HOH C 3 .   ? 8.846  8.495  91.511  1.00 21.56 ? 346 HOH A O   1 
HETATM 2144 O O   . HOH C 3 .   ? 7.324  16.849 74.726  1.00 22.37 ? 347 HOH A O   1 
HETATM 2145 O O   . HOH C 3 .   ? 24.059 9.411  87.774  1.00 16.06 ? 348 HOH A O   1 
HETATM 2146 O O   . HOH C 3 .   ? 7.266  8.749  84.613  1.00 23.92 ? 349 HOH A O   1 
HETATM 2147 O O   . HOH C 3 .   ? 28.644 32.593 96.147  1.00 23.08 ? 350 HOH A O   1 
HETATM 2148 O O   . HOH C 3 .   ? 10.375 35.827 87.388  1.00 23.63 ? 351 HOH A O   1 
HETATM 2149 O O   . HOH C 3 .   ? 34.439 17.146 57.989  1.00 21.71 ? 352 HOH A O   1 
HETATM 2150 O O   . HOH C 3 .   ? 5.095  14.841 90.656  1.00 25.35 ? 353 HOH A O   1 
HETATM 2151 O O   . HOH C 3 .   ? 13.948 5.877  88.445  1.00 17.37 ? 354 HOH A O   1 
HETATM 2152 O O   . HOH C 3 .   ? 21.480 25.338 59.319  1.00 24.90 ? 355 HOH A O   1 
HETATM 2153 O O   . HOH C 3 .   ? 12.610 7.130  76.907  1.00 19.49 ? 356 HOH A O   1 
HETATM 2154 O O   . HOH C 3 .   ? 4.777  17.819 101.491 1.00 25.08 ? 357 HOH A O   1 
HETATM 2155 O O   . HOH C 3 .   ? 7.232  28.256 78.579  1.00 24.08 ? 358 HOH A O   1 
HETATM 2156 O O   . HOH C 3 .   ? 5.044  19.823 97.963  1.00 25.55 ? 359 HOH A O   1 
HETATM 2157 O O   . HOH C 3 .   ? 19.561 15.079 67.486  1.00 27.34 ? 360 HOH A O   1 
HETATM 2158 O O   . HOH C 3 .   ? 2.562  28.092 92.306  1.00 25.64 ? 361 HOH A O   1 
HETATM 2159 O O   . HOH C 3 .   ? 6.553  17.086 89.742  1.00 23.60 ? 362 HOH A O   1 
HETATM 2160 O O   . HOH C 3 .   ? 15.427 36.919 88.577  1.00 26.14 ? 363 HOH A O   1 
HETATM 2161 O O   . HOH C 3 .   ? 8.204  32.680 73.023  1.00 22.32 ? 364 HOH A O   1 
HETATM 2162 O O   . HOH C 3 .   ? 29.153 44.719 88.968  1.00 27.97 ? 365 HOH A O   1 
HETATM 2163 O O   . HOH C 3 .   ? 2.048  24.278 67.981  1.00 23.57 ? 366 HOH A O   1 
HETATM 2164 O O   . HOH C 3 .   ? 34.332 28.881 63.506  1.00 29.93 ? 367 HOH A O   1 
HETATM 2165 O O   . HOH C 3 .   ? 26.834 40.210 71.265  1.00 25.04 ? 368 HOH A O   1 
HETATM 2166 O O   . HOH C 3 .   ? 28.811 15.168 73.346  1.00 25.72 ? 369 HOH A O   1 
HETATM 2167 O O   . HOH C 3 .   ? 4.619  34.590 74.808  1.00 23.18 ? 370 HOH A O   1 
HETATM 2168 O O   . HOH C 3 .   ? 2.269  32.730 81.771  1.00 27.16 ? 371 HOH A O   1 
HETATM 2169 O O   . HOH C 3 .   ? 8.631  37.686 69.624  1.00 20.40 ? 372 HOH A O   1 
HETATM 2170 O O   . HOH C 3 .   ? -1.692 18.976 100.465 1.00 37.31 ? 373 HOH A O   1 
HETATM 2171 O O   . HOH C 3 .   ? 28.752 26.105 64.963  1.00 30.62 ? 374 HOH A O   1 
HETATM 2172 O O   . HOH C 3 .   ? 35.550 20.793 71.092  1.00 27.09 ? 375 HOH A O   1 
HETATM 2173 O O   . HOH C 3 .   ? 12.801 12.763 96.062  1.00 23.56 ? 376 HOH A O   1 
HETATM 2174 O O   . HOH C 3 .   ? 1.236  11.416 98.025  1.00 27.94 ? 377 HOH A O   1 
HETATM 2175 O O   . HOH C 3 .   ? 24.711 22.055 85.681  1.00 17.43 ? 378 HOH A O   1 
HETATM 2176 O O   . HOH C 3 .   ? 5.664  17.604 96.850  1.00 27.38 ? 379 HOH A O   1 
HETATM 2177 O O   . HOH C 3 .   ? 5.356  29.134 84.366  1.00 26.25 ? 380 HOH A O   1 
HETATM 2178 O O   . HOH C 3 .   ? 19.825 38.329 88.494  1.00 23.23 ? 381 HOH A O   1 
HETATM 2179 O O   . HOH C 3 .   ? 31.028 27.223 97.826  1.00 28.22 ? 382 HOH A O   1 
HETATM 2180 O O   . HOH C 3 .   ? 26.801 10.011 86.975  1.00 25.75 ? 383 HOH A O   1 
HETATM 2181 O O   . HOH C 3 .   ? 15.605 16.178 65.485  1.00 28.50 ? 384 HOH A O   1 
HETATM 2182 O O   . HOH C 3 .   ? 41.523 27.060 75.943  1.00 29.31 ? 385 HOH A O   1 
HETATM 2183 O O   . HOH C 3 .   ? 37.862 13.704 84.128  1.00 30.60 ? 386 HOH A O   1 
HETATM 2184 O O   . HOH C 3 .   ? 6.201  15.353 86.113  1.00 27.88 ? 387 HOH A O   1 
HETATM 2185 O O   . HOH C 3 .   ? 10.158 21.182 67.682  1.00 29.97 ? 388 HOH A O   1 
HETATM 2186 O O   . HOH C 3 .   ? 37.871 1.324  95.632  1.00 28.75 ? 389 HOH A O   1 
HETATM 2187 O O   . HOH C 3 .   ? 36.712 21.115 104.194 1.00 22.80 ? 390 HOH A O   1 
HETATM 2188 O O   . HOH C 3 .   ? 20.044 14.061 69.943  1.00 27.64 ? 391 HOH A O   1 
HETATM 2189 O O   . HOH C 3 .   ? 13.697 39.124 87.714  1.00 25.46 ? 392 HOH A O   1 
HETATM 2190 O O   . HOH C 3 .   ? 25.565 33.440 64.977  1.00 22.82 ? 393 HOH A O   1 
HETATM 2191 O O   . HOH C 3 .   ? 40.277 28.219 78.316  1.00 28.48 ? 394 HOH A O   1 
HETATM 2192 O O   . HOH C 3 .   ? 41.859 19.003 93.082  1.00 35.20 ? 395 HOH A O   1 
HETATM 2193 O O   . HOH C 3 .   ? 1.333  32.532 77.461  1.00 36.21 ? 396 HOH A O   1 
HETATM 2194 O O   . HOH C 3 .   ? 38.612 22.354 100.140 1.00 32.18 ? 397 HOH A O   1 
HETATM 2195 O O   . HOH C 3 .   ? 8.714  15.657 72.602  1.00 30.20 ? 398 HOH A O   1 
HETATM 2196 O O   . HOH C 3 .   ? 18.264 35.681 65.894  1.00 33.92 ? 399 HOH A O   1 
HETATM 2197 O O   . HOH C 3 .   ? 36.959 31.308 80.014  1.00 28.69 ? 400 HOH A O   1 
HETATM 2198 O O   . HOH C 3 .   ? 4.733  28.600 79.574  1.00 32.14 ? 401 HOH A O   1 
HETATM 2199 O O   . HOH C 3 .   ? 40.300 7.617  100.296 1.00 34.15 ? 402 HOH A O   1 
HETATM 2200 O O   . HOH C 3 .   ? 32.439 15.777 74.086  1.00 23.34 ? 403 HOH A O   1 
HETATM 2201 O O   . HOH C 3 .   ? 44.322 21.307 69.787  1.00 30.47 ? 404 HOH A O   1 
HETATM 2202 O O   . HOH C 3 .   ? 25.361 31.257 58.210  1.00 41.93 ? 405 HOH A O   1 
HETATM 2203 O O   . HOH C 3 .   ? 14.556 -2.532 81.813  1.00 34.94 ? 406 HOH A O   1 
HETATM 2204 O O   . HOH C 3 .   ? 23.429 40.033 65.534  1.00 28.19 ? 407 HOH A O   1 
HETATM 2205 O O   . HOH C 3 .   ? 5.533  18.647 87.510  1.00 31.63 ? 408 HOH A O   1 
HETATM 2206 O O   . HOH C 3 .   ? 37.267 16.430 100.941 1.00 27.35 ? 409 HOH A O   1 
HETATM 2207 O O   . HOH C 3 .   ? 29.259 2.818  98.242  1.00 32.66 ? 410 HOH A O   1 
HETATM 2208 O O   . HOH C 3 .   ? 4.592  31.675 78.439  1.00 31.43 ? 411 HOH A O   1 
HETATM 2209 O O   . HOH C 3 .   ? 22.998 17.642 65.295  1.00 39.58 ? 412 HOH A O   1 
HETATM 2210 O O   . HOH C 3 .   ? 35.031 20.330 83.385  1.00 30.90 ? 413 HOH A O   1 
HETATM 2211 O O   . HOH C 3 .   ? 27.530 32.497 89.370  1.00 29.23 ? 414 HOH A O   1 
HETATM 2212 O O   . HOH C 3 .   ? 45.765 17.550 98.872  1.00 30.61 ? 415 HOH A O   1 
HETATM 2213 O O   . HOH C 3 .   ? 10.105 11.825 96.885  1.00 34.79 ? 416 HOH A O   1 
HETATM 2214 O O   . HOH C 3 .   ? 16.537 9.034  75.860  1.00 36.89 ? 417 HOH A O   1 
HETATM 2215 O O   . HOH C 3 .   ? 29.223 32.185 91.541  1.00 29.34 ? 418 HOH A O   1 
HETATM 2216 O O   . HOH C 3 .   ? 34.575 25.859 60.549  1.00 31.07 ? 419 HOH A O   1 
HETATM 2217 O O   . HOH C 3 .   ? 33.821 18.957 72.092  1.00 26.25 ? 420 HOH A O   1 
HETATM 2218 O O   . HOH C 3 .   ? 24.317 14.428 68.763  1.00 29.95 ? 421 HOH A O   1 
HETATM 2219 O O   . HOH C 3 .   ? 37.944 19.878 71.159  1.00 25.45 ? 422 HOH A O   1 
HETATM 2220 O O   . HOH C 3 .   ? 5.465  21.059 93.521  1.00 26.43 ? 423 HOH A O   1 
HETATM 2221 O O   . HOH C 3 .   ? 44.899 17.837 93.784  1.00 32.09 ? 424 HOH A O   1 
HETATM 2222 O O   . HOH C 3 .   ? 43.137 11.477 99.691  1.00 37.43 ? 425 HOH A O   1 
HETATM 2223 O O   . HOH C 3 .   ? 10.687 28.985 74.889  1.00 30.99 ? 426 HOH A O   1 
HETATM 2224 O O   . HOH C 3 .   ? 35.047 28.370 95.650  1.00 30.40 ? 427 HOH A O   1 
HETATM 2225 O O   . HOH C 3 .   ? 15.045 17.562 63.354  1.00 29.74 ? 428 HOH A O   1 
HETATM 2226 O O   . HOH C 3 .   ? 3.413  24.719 82.514  1.00 38.72 ? 429 HOH A O   1 
HETATM 2227 O O   . HOH C 3 .   ? 2.507  27.972 95.101  1.00 36.17 ? 430 HOH A O   1 
HETATM 2228 O O   . HOH C 3 .   ? 31.615 38.990 89.578  1.00 28.47 ? 431 HOH A O   1 
HETATM 2229 O O   . HOH C 3 .   ? 37.643 18.369 102.650 1.00 36.20 ? 432 HOH A O   1 
HETATM 2230 O O   . HOH C 3 .   ? 1.442  26.080 90.951  1.00 36.92 ? 433 HOH A O   1 
HETATM 2231 O O   . HOH C 3 .   ? 35.586 17.979 81.603  1.00 32.77 ? 434 HOH A O   1 
HETATM 2232 O O   . HOH C 3 .   ? 22.692 41.290 84.553  1.00 38.29 ? 435 HOH A O   1 
HETATM 2233 O O   . HOH C 3 .   ? 4.453  21.798 96.223  1.00 32.54 ? 436 HOH A O   1 
HETATM 2234 O O   . HOH C 3 .   ? 16.257 15.530 69.765  1.00 34.82 ? 437 HOH A O   1 
HETATM 2235 O O   . HOH C 3 .   ? 5.707  15.892 98.882  1.00 36.02 ? 438 HOH A O   1 
HETATM 2236 O O   . HOH C 3 .   ? 34.996 39.101 85.968  1.00 35.93 ? 439 HOH A O   1 
HETATM 2237 O O   . HOH C 3 .   ? 4.118  28.722 82.159  1.00 37.70 ? 440 HOH A O   1 
HETATM 2238 O O   A HOH C 3 .   ? 36.787 21.555 79.793  0.50 13.49 ? 441 HOH A O   1 
HETATM 2239 O O   B HOH C 3 .   ? 35.719 21.426 78.443  0.50 22.24 ? 441 HOH A O   1 
HETATM 2240 O O   . HOH C 3 .   ? 2.751  15.984 79.778  1.00 29.23 ? 442 HOH A O   1 
HETATM 2241 O O   . HOH C 3 .   ? 23.750 5.232  97.599  1.00 33.94 ? 443 HOH A O   1 
HETATM 2242 O O   . HOH C 3 .   ? 5.933  15.289 76.676  1.00 34.11 ? 444 HOH A O   1 
HETATM 2243 O O   . HOH C 3 .   ? 3.223  17.167 95.137  1.00 35.20 ? 445 HOH A O   1 
HETATM 2244 O O   . HOH C 3 .   ? 30.856 35.912 91.300  1.00 28.60 ? 446 HOH A O   1 
HETATM 2245 O O   . HOH C 3 .   ? 2.896  24.562 86.605  1.00 34.75 ? 447 HOH A O   1 
HETATM 2246 O O   . HOH C 3 .   ? 28.683 34.225 92.963  1.00 33.42 ? 448 HOH A O   1 
HETATM 2247 O O   . HOH C 3 .   ? 28.368 -0.537 94.472  1.00 35.59 ? 449 HOH A O   1 
HETATM 2248 O O   . HOH C 3 .   ? 3.381  23.975 100.169 1.00 32.56 ? 450 HOH A O   1 
HETATM 2249 O O   . HOH C 3 .   ? 4.811  13.814 80.793  1.00 28.50 ? 451 HOH A O   1 
HETATM 2250 O O   . HOH C 3 .   ? 37.150 21.140 89.574  1.00 32.67 ? 452 HOH A O   1 
HETATM 2251 O O   . HOH C 3 .   ? 3.506  16.559 92.067  1.00 34.72 ? 453 HOH A O   1 
HETATM 2252 O O   . HOH C 3 .   ? -4.913 8.773  99.599  1.00 33.89 ? 454 HOH A O   1 
HETATM 2253 O O   . HOH C 3 .   ? 33.138 0.457  85.577  1.00 29.64 ? 455 HOH A O   1 
HETATM 2254 O O   . HOH C 3 .   ? 22.145 36.951 64.674  1.00 39.57 ? 456 HOH A O   1 
HETATM 2255 O O   A HOH C 3 .   ? 13.943 37.349 76.155  0.50 26.78 ? 457 HOH A O   1 
HETATM 2256 O O   B HOH C 3 .   ? 13.690 37.537 74.597  0.50 20.43 ? 457 HOH A O   1 
HETATM 2257 O O   . HOH C 3 .   ? 29.333 7.475  73.075  1.00 41.95 ? 458 HOH A O   1 
HETATM 2258 O O   . HOH C 3 .   ? -1.230 12.632 110.074 1.00 34.64 ? 459 HOH A O   1 
HETATM 2259 O O   . HOH C 3 .   ? 1.076  18.653 77.522  1.00 39.35 ? 460 HOH A O   1 
HETATM 2260 O O   . HOH C 3 .   ? 38.257 10.259 76.735  1.00 37.21 ? 461 HOH A O   1 
HETATM 2261 O O   . HOH C 3 .   ? 34.999 -0.376 100.817 1.00 34.62 ? 462 HOH A O   1 
HETATM 2262 O O   . HOH C 3 .   ? 15.439 37.593 67.155  1.00 38.47 ? 463 HOH A O   1 
HETATM 2263 O O   . HOH C 3 .   ? 41.376 30.977 78.090  1.00 37.81 ? 464 HOH A O   1 
HETATM 2264 O O   . HOH C 3 .   ? 32.926 6.745  100.237 1.00 35.19 ? 465 HOH A O   1 
HETATM 2265 O O   . HOH C 3 .   ? 25.839 35.987 87.402  1.00 28.67 ? 466 HOH A O   1 
HETATM 2266 O O   . HOH C 3 .   ? 33.437 8.156  80.313  1.00 30.49 ? 467 HOH A O   1 
HETATM 2267 O O   . HOH C 3 .   ? 41.140 3.722  94.732  1.00 40.30 ? 468 HOH A O   1 
HETATM 2268 O O   . HOH C 3 .   ? 9.565  15.812 68.829  1.00 37.12 ? 469 HOH A O   1 
HETATM 2269 O O   . HOH C 3 .   ? 17.088 -4.374 83.376  1.00 28.16 ? 470 HOH A O   1 
HETATM 2270 O O   . HOH C 3 .   ? 14.893 42.845 84.610  1.00 47.79 ? 471 HOH A O   1 
HETATM 2271 O O   . HOH C 3 .   ? 28.144 4.792  94.988  1.00 30.39 ? 472 HOH A O   1 
HETATM 2272 O O   . HOH C 3 .   ? 14.445 33.208 65.633  1.00 37.67 ? 473 HOH A O   1 
HETATM 2273 O O   . HOH C 3 .   ? 7.907  25.017 63.918  1.00 24.18 ? 474 HOH A O   1 
HETATM 2274 O O   . HOH C 3 .   ? 19.352 -2.148 82.275  1.00 39.12 ? 475 HOH A O   1 
HETATM 2275 O O   . HOH C 3 .   ? 27.497 9.223  71.849  1.00 35.47 ? 476 HOH A O   1 
HETATM 2276 O O   . HOH C 3 .   ? 25.068 8.190  70.296  1.00 35.44 ? 477 HOH A O   1 
HETATM 2277 O O   . HOH C 3 .   ? 40.589 21.373 76.115  1.00 29.13 ? 478 HOH A O   1 
HETATM 2278 O O   . HOH C 3 .   ? 23.362 45.839 75.349  1.00 40.74 ? 479 HOH A O   1 
HETATM 2279 O O   . HOH C 3 .   ? 18.666 42.702 70.339  1.00 41.78 ? 480 HOH A O   1 
HETATM 2280 O O   . HOH C 3 .   ? 12.738 18.817 63.456  1.00 36.05 ? 481 HOH A O   1 
HETATM 2281 O O   . HOH C 3 .   ? 2.835  23.453 89.693  1.00 39.60 ? 482 HOH A O   1 
HETATM 2282 O O   . HOH C 3 .   ? 6.592  28.438 71.668  1.00 37.79 ? 483 HOH A O   1 
HETATM 2283 O O   . HOH C 3 .   ? 36.411 16.299 84.984  1.00 36.43 ? 484 HOH A O   1 
HETATM 2284 O O   . HOH C 3 .   ? 26.979 25.126 57.170  1.00 37.07 ? 485 HOH A O   1 
HETATM 2285 O O   . HOH C 3 .   ? 30.653 -2.437 94.923  1.00 52.59 ? 486 HOH A O   1 
HETATM 2286 O O   . HOH C 3 .   ? 28.197 1.947  95.586  1.00 43.37 ? 487 HOH A O   1 
HETATM 2287 O O   . HOH C 3 .   ? 5.158  18.517 92.660  1.00 38.28 ? 488 HOH A O   1 
HETATM 2288 O O   . HOH C 3 .   ? 41.128 11.046 82.149  1.00 32.60 ? 489 HOH A O   1 
HETATM 2289 O O   . HOH C 3 .   ? -0.323 38.162 84.696  1.00 41.25 ? 490 HOH A O   1 
HETATM 2290 O O   . HOH C 3 .   ? 24.497 9.322  90.582  1.00 32.62 ? 491 HOH A O   1 
HETATM 2291 O O   . HOH C 3 .   ? 14.705 10.632 96.333  1.00 35.06 ? 492 HOH A O   1 
HETATM 2292 O O   . HOH C 3 .   ? 32.454 13.625 76.095  1.00 35.27 ? 493 HOH A O   1 
HETATM 2293 O O   . HOH C 3 .   ? 34.508 11.407 76.945  1.00 42.45 ? 494 HOH A O   1 
HETATM 2294 O O   . HOH C 3 .   ? 6.739  13.704 78.738  1.00 35.58 ? 495 HOH A O   1 
HETATM 2295 O O   . HOH C 3 .   ? 34.183 35.575 80.395  1.00 38.29 ? 496 HOH A O   1 
HETATM 2296 O O   . HOH C 3 .   ? 10.718 8.949  75.734  1.00 27.73 ? 497 HOH A O   1 
HETATM 2297 O O   . HOH C 3 .   ? 26.684 10.864 90.915  1.00 35.98 ? 498 HOH A O   1 
HETATM 2298 O O   . HOH C 3 .   ? 37.836 16.668 105.062 1.00 36.97 ? 499 HOH A O   1 
HETATM 2299 O O   . HOH C 3 .   ? 33.219 4.815  80.846  1.00 43.44 ? 500 HOH A O   1 
HETATM 2300 O O   . HOH C 3 .   ? 1.960  16.931 82.188  1.00 41.83 ? 501 HOH A O   1 
HETATM 2301 O O   . HOH C 3 .   ? 5.621  32.155 73.593  1.00 27.03 ? 502 HOH A O   1 
HETATM 2302 O O   . HOH C 3 .   ? 5.526  10.311 87.153  1.00 44.49 ? 503 HOH A O   1 
HETATM 2303 O O   . HOH C 3 .   ? 30.936 11.336 88.495  1.00 42.74 ? 504 HOH A O   1 
HETATM 2304 O O   . HOH C 3 .   ? 24.116 37.300 88.830  1.00 33.52 ? 505 HOH A O   1 
HETATM 2305 O O   . HOH C 3 .   ? 8.340  11.629 78.097  1.00 32.01 ? 506 HOH A O   1 
HETATM 2306 O O   . HOH C 3 .   ? 28.891 9.566  88.360  1.00 27.25 ? 507 HOH A O   1 
HETATM 2307 O O   . HOH C 3 .   ? 36.078 33.740 79.651  1.00 36.92 ? 508 HOH A O   1 
HETATM 2308 O O   . HOH C 3 .   ? 29.760 17.984 66.046  1.00 38.25 ? 509 HOH A O   1 
HETATM 2309 O O   . HOH C 3 .   ? 5.805  31.511 76.209  1.00 44.09 ? 510 HOH A O   1 
HETATM 2310 O O   . HOH C 3 .   ? 24.603 -6.068 84.590  1.00 50.73 ? 511 HOH A O   1 
HETATM 2311 O O   . HOH C 3 .   ? 34.767 -3.695 94.299  1.00 43.29 ? 512 HOH A O   1 
HETATM 2312 O O   . HOH C 3 .   ? 32.698 18.950 61.799  1.00 31.52 ? 513 HOH A O   1 
HETATM 2313 O O   . HOH C 3 .   ? 6.212  9.341  81.586  1.00 38.17 ? 514 HOH A O   1 
HETATM 2314 O O   . HOH C 3 .   ? 1.177  23.817 92.436  1.00 50.06 ? 515 HOH A O   1 
HETATM 2315 O O   . HOH C 3 .   ? 38.103 23.293 103.048 1.00 36.02 ? 516 HOH A O   1 
HETATM 2316 O O   . HOH C 3 .   ? 32.599 41.519 79.025  1.00 36.62 ? 517 HOH A O   1 
HETATM 2317 O O   . HOH C 3 .   ? 15.748 30.288 62.713  1.00 37.91 ? 518 HOH A O   1 
HETATM 2318 O O   . HOH C 3 .   ? -0.088 35.039 92.365  1.00 32.02 ? 519 HOH A O   1 
HETATM 2319 O O   . HOH C 3 .   ? 23.132 8.139  92.327  1.00 44.66 ? 520 HOH A O   1 
HETATM 2320 O O   . HOH C 3 .   ? 26.727 14.350 71.231  1.00 39.37 ? 521 HOH A O   1 
HETATM 2321 O O   . HOH C 3 .   ? 42.677 12.008 102.615 1.00 36.77 ? 522 HOH A O   1 
HETATM 2322 O O   . HOH C 3 .   ? 4.975  14.111 83.997  1.00 38.21 ? 523 HOH A O   1 
HETATM 2323 O O   . HOH C 3 .   ? 19.841 40.797 66.673  1.00 38.09 ? 524 HOH A O   1 
HETATM 2324 O O   . HOH C 3 .   ? 10.507 18.435 65.039  1.00 38.60 ? 525 HOH A O   1 
HETATM 2325 O O   . HOH C 3 .   ? 18.235 20.315 60.542  1.00 44.08 ? 526 HOH A O   1 
HETATM 2326 O O   . HOH C 3 .   ? 5.289  13.391 87.980  1.00 39.33 ? 527 HOH A O   1 
HETATM 2327 O O   . HOH C 3 .   ? 32.081 -5.235 88.674  1.00 45.74 ? 528 HOH A O   1 
HETATM 2328 O O   . HOH C 3 .   ? 42.474 19.759 68.643  1.00 45.29 ? 529 HOH A O   1 
HETATM 2329 O O   . HOH C 3 .   ? 26.005 22.985 56.339  1.00 50.19 ? 530 HOH A O   1 
HETATM 2330 O O   . HOH C 3 .   ? 33.421 -2.995 86.563  1.00 50.45 ? 531 HOH A O   1 
HETATM 2331 O O   . HOH C 3 .   ? 39.413 19.157 100.868 1.00 33.71 ? 532 HOH A O   1 
HETATM 2332 O O   . HOH C 3 .   ? 28.350 12.147 88.018  1.00 41.64 ? 533 HOH A O   1 
HETATM 2333 O O   . HOH C 3 .   ? 8.449  27.372 76.012  1.00 42.38 ? 534 HOH A O   1 
HETATM 2334 O O   . HOH C 3 .   ? 9.484  28.727 63.684  1.00 41.97 ? 535 HOH A O   1 
HETATM 2335 O O   . HOH C 3 .   ? 34.020 29.789 97.646  1.00 41.37 ? 536 HOH A O   1 
HETATM 2336 O O   . HOH C 3 .   ? 18.870 -0.064 78.021  1.00 33.96 ? 537 HOH A O   1 
HETATM 2337 O O   . HOH C 3 .   ? 23.581 0.807  78.454  1.00 40.43 ? 538 HOH A O   1 
HETATM 2338 O O   . HOH C 3 .   ? 2.743  21.778 86.197  1.00 42.02 ? 539 HOH A O   1 
HETATM 2339 O O   . HOH C 3 .   ? 36.100 19.653 56.240  1.00 39.05 ? 540 HOH A O   1 
HETATM 2340 O O   . HOH C 3 .   ? 20.448 -3.561 84.661  1.00 39.83 ? 541 HOH A O   1 
HETATM 2341 O O   . HOH C 3 .   ? 33.274 38.527 80.731  1.00 51.14 ? 542 HOH A O   1 
HETATM 2342 O O   . HOH C 3 .   ? 21.889 -1.095 79.940  1.00 57.69 ? 543 HOH A O   1 
HETATM 2343 O O   . HOH C 3 .   ? 20.891 33.456 63.424  1.00 50.94 ? 544 HOH A O   1 
HETATM 2344 O O   . HOH C 3 .   ? 32.847 40.116 82.785  1.00 48.21 ? 545 HOH A O   1 
HETATM 2345 O O   . HOH C 3 .   ? 13.001 10.139 73.439  1.00 44.79 ? 546 HOH A O   1 
HETATM 2346 O O   . HOH C 3 .   ? 5.192  10.336 84.450  1.00 41.40 ? 547 HOH A O   1 
HETATM 2347 O O   . HOH C 3 .   ? 39.397 26.437 82.940  1.00 45.86 ? 548 HOH A O   1 
HETATM 2348 O O   . HOH C 3 .   ? 35.866 -1.649 90.143  1.00 53.96 ? 549 HOH A O   1 
HETATM 2349 O O   . HOH C 3 .   ? 28.784 15.912 70.684  1.00 41.68 ? 550 HOH A O   1 
HETATM 2350 O O   . HOH C 3 .   ? 39.201 24.414 81.457  1.00 40.55 ? 551 HOH A O   1 
HETATM 2351 O O   . HOH C 3 .   ? 3.611  17.061 84.510  1.00 44.35 ? 552 HOH A O   1 
HETATM 2352 O O   . HOH C 3 .   ? 33.275 -2.270 95.940  1.00 50.88 ? 553 HOH A O   1 
HETATM 2353 O O   . HOH C 3 .   ? -2.250 19.024 96.495  1.00 46.48 ? 554 HOH A O   1 
HETATM 2354 O O   . HOH C 3 .   ? 10.076 11.633 75.877  1.00 37.53 ? 555 HOH A O   1 
HETATM 2355 O O   . HOH C 3 .   ? 23.821 -3.057 81.566  1.00 49.80 ? 556 HOH A O   1 
HETATM 2356 O O   . HOH C 3 .   ? 32.417 15.546 69.570  1.00 39.98 ? 557 HOH A O   1 
HETATM 2357 O O   . HOH C 3 .   ? 37.926 36.799 83.377  1.00 41.37 ? 558 HOH A O   1 
HETATM 2358 O O   . HOH C 3 .   ? 37.685 2.693  84.596  1.00 38.69 ? 559 HOH A O   1 
HETATM 2359 O O   . HOH C 3 .   ? 16.963 -2.440 81.533  1.00 43.73 ? 560 HOH A O   1 
HETATM 2360 O O   . HOH C 3 .   ? 37.057 35.187 74.233  1.00 41.87 ? 561 HOH A O   1 
HETATM 2361 O O   . HOH C 3 .   ? 22.546 7.935  71.260  1.00 42.79 ? 562 HOH A O   1 
HETATM 2362 O O   . HOH C 3 .   ? 24.674 6.421  94.323  1.00 36.47 ? 563 HOH A O   1 
HETATM 2363 O O   . HOH C 3 .   ? 12.547 1.282  90.155  1.00 36.32 ? 564 HOH A O   1 
HETATM 2364 O O   . HOH C 3 .   ? 36.355 15.605 77.591  1.00 35.81 ? 565 HOH A O   1 
HETATM 2365 O O   . HOH C 3 .   ? 19.023 11.237 69.750  1.00 41.21 ? 566 HOH A O   1 
HETATM 2366 O O   . HOH C 3 .   ? 36.925 35.254 87.802  1.00 39.95 ? 567 HOH A O   1 
HETATM 2367 O O   . HOH C 3 .   ? 26.901 5.983  92.449  1.00 48.37 ? 568 HOH A O   1 
HETATM 2368 O O   . HOH C 3 .   ? 16.248 27.960 62.344  1.00 36.94 ? 569 HOH A O   1 
HETATM 2369 O O   . HOH C 3 .   ? 27.921 8.462  90.985  1.00 37.12 ? 570 HOH A O   1 
HETATM 2370 O O   . HOH C 3 .   ? 4.995  7.640  88.389  1.00 50.36 ? 571 HOH A O   1 
HETATM 2371 O O   . HOH C 3 .   ? 35.749 13.085 106.252 1.00 36.50 ? 572 HOH A O   1 
HETATM 2372 O O   . HOH C 3 .   ? 29.691 15.374 68.684  1.00 38.11 ? 573 HOH A O   1 
HETATM 2373 O O   . HOH C 3 .   ? 35.275 27.993 61.306  1.00 37.31 ? 574 HOH A O   1 
HETATM 2374 O O   A HOH C 3 .   ? 11.651 22.130 65.676  0.50 21.54 ? 575 HOH A O   1 
HETATM 2375 O O   B HOH C 3 .   ? 9.824  22.861 65.172  0.50 22.57 ? 575 HOH A O   1 
HETATM 2376 O O   . HOH C 3 .   ? 11.809 35.664 73.771  1.00 33.20 ? 576 HOH A O   1 
HETATM 2377 O O   . HOH C 3 .   ? 12.789 38.430 68.032  1.00 39.66 ? 577 HOH A O   1 
HETATM 2378 O O   . HOH C 3 .   ? 39.522 15.194 100.538 1.00 38.63 ? 578 HOH A O   1 
HETATM 2379 O O   . HOH C 3 .   ? 40.774 23.108 92.453  1.00 38.22 ? 579 HOH A O   1 
HETATM 2380 O O   . HOH C 3 .   ? 12.873 12.770 72.659  1.00 45.73 ? 580 HOH A O   1 
HETATM 2381 O O   . HOH C 3 .   ? -0.280 11.016 95.922  1.00 29.74 ? 581 HOH A O   1 
HETATM 2382 O O   . HOH C 3 .   ? 5.918  13.352 97.847  1.00 31.21 ? 582 HOH A O   1 
HETATM 2383 O O   . HOH C 3 .   ? 8.627  13.545 98.178  1.00 31.59 ? 583 HOH A O   1 
HETATM 2384 O O   . HOH C 3 .   ? 0.815  9.847  100.369 1.00 48.67 ? 584 HOH A O   1 
HETATM 2385 O O   . HOH C 3 .   ? 5.623  27.129 69.152  1.00 40.40 ? 585 HOH A O   1 
HETATM 2386 O O   . HOH C 3 .   ? 26.472 -3.160 81.261  1.00 48.09 ? 586 HOH A O   1 
HETATM 2387 O O   . HOH C 3 .   ? 44.092 14.863 99.773  1.00 37.51 ? 587 HOH A O   1 
HETATM 2388 O O   . HOH C 3 .   ? 0.048  20.666 76.560  1.00 38.86 ? 588 HOH A O   1 
HETATM 2389 O O   . HOH C 3 .   ? 2.250  21.074 75.023  1.00 24.31 ? 589 HOH A O   1 
HETATM 2390 O O   A HOH C 3 .   ? 3.557  25.945 78.129  0.50 20.87 ? 590 HOH A O   1 
HETATM 2391 O O   B HOH C 3 .   ? 1.578  25.710 78.116  0.50 25.39 ? 590 HOH A O   1 
HETATM 2392 O O   . HOH C 3 .   ? 21.188 43.405 78.221  1.00 37.07 ? 591 HOH A O   1 
HETATM 2393 O O   . HOH C 3 .   ? 8.749  38.056 86.961  1.00 25.14 ? 592 HOH A O   1 
HETATM 2394 O O   . HOH C 3 .   ? 12.823 45.122 82.552  1.00 38.13 ? 593 HOH A O   1 
HETATM 2395 O O   . HOH C 3 .   ? 35.071 27.627 100.741 1.00 37.57 ? 594 HOH A O   1 
HETATM 2396 O O   . HOH C 3 .   ? 21.137 29.496 57.145  1.00 43.23 ? 595 HOH A O   1 
HETATM 2397 O O   . HOH C 3 .   ? 39.134 12.885 81.977  1.00 40.66 ? 596 HOH A O   1 
HETATM 2398 O O   . HOH C 3 .   ? 1.306  23.694 73.128  1.00 42.50 ? 597 HOH A O   1 
HETATM 2399 O O   . HOH C 3 .   ? 8.621  10.445 95.231  1.00 41.60 ? 598 HOH A O   1 
HETATM 2400 O O   . HOH C 3 .   ? 37.565 33.651 83.884  1.00 41.17 ? 599 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -1  ?   ?   ?   A . n 
A 1 2   ALA 2   0   0   ALA ALA A . n 
A 1 3   HIS 3   1   1   HIS HIS A . n 
A 1 4   MET 4   2   2   MET MET A . n 
A 1 5   VAL 5   3   3   VAL VAL A . n 
A 1 6   ASN 6   4   4   ASN ASN A . n 
A 1 7   GLY 7   5   5   GLY GLY A . n 
A 1 8   LYS 8   6   6   LYS LYS A . n 
A 1 9   VAL 9   7   7   VAL VAL A . n 
A 1 10  ALA 10  8   8   ALA ALA A . n 
A 1 11  LEU 11  9   9   LEU LEU A . n 
A 1 12  VAL 12  10  10  VAL VAL A . n 
A 1 13  THR 13  11  11  THR THR A . n 
A 1 14  GLY 14  12  12  GLY GLY A . n 
A 1 15  ALA 15  13  13  ALA ALA A . n 
A 1 16  ALA 16  14  14  ALA ALA A . n 
A 1 17  GLN 17  15  15  GLN GLN A . n 
A 1 18  GLY 18  16  16  GLY GLY A . n 
A 1 19  ILE 19  17  17  ILE ILE A . n 
A 1 20  GLY 20  18  18  GLY GLY A . n 
A 1 21  ARG 21  19  19  ARG ARG A . n 
A 1 22  ALA 22  20  20  ALA ALA A . n 
A 1 23  PHE 23  21  21  PHE PHE A . n 
A 1 24  ALA 24  22  22  ALA ALA A . n 
A 1 25  GLU 25  23  23  GLU GLU A . n 
A 1 26  ALA 26  24  24  ALA ALA A . n 
A 1 27  LEU 27  25  25  LEU LEU A . n 
A 1 28  LEU 28  26  26  LEU LEU A . n 
A 1 29  LEU 29  27  27  LEU LEU A . n 
A 1 30  LYS 30  28  28  LYS LYS A . n 
A 1 31  GLY 31  29  29  GLY GLY A . n 
A 1 32  ALA 32  30  30  ALA ALA A . n 
A 1 33  LYS 33  31  31  LYS LYS A . n 
A 1 34  VAL 34  32  32  VAL VAL A . n 
A 1 35  ALA 35  33  33  ALA ALA A . n 
A 1 36  LEU 36  34  34  LEU LEU A . n 
A 1 37  VAL 37  35  35  VAL VAL A . n 
A 1 38  ASP 38  36  36  ASP ASP A . n 
A 1 39  TRP 39  37  37  TRP TRP A . n 
A 1 40  ASN 40  38  38  ASN ASN A . n 
A 1 41  LEU 41  39  39  LEU LEU A . n 
A 1 42  GLU 42  40  40  GLU GLU A . n 
A 1 43  ALA 43  41  41  ALA ALA A . n 
A 1 44  GLY 44  42  42  GLY GLY A . n 
A 1 45  VAL 45  43  43  VAL VAL A . n 
A 1 46  GLN 46  44  44  GLN GLN A . n 
A 1 47  CYS 47  45  45  CYS CYS A . n 
A 1 48  LYS 48  46  46  LYS LYS A . n 
A 1 49  ALA 49  47  47  ALA ALA A . n 
A 1 50  ALA 50  48  48  ALA ALA A . n 
A 1 51  LEU 51  49  49  LEU LEU A . n 
A 1 52  HIS 52  50  50  HIS HIS A . n 
A 1 53  GLU 53  51  51  GLU GLU A . n 
A 1 54  GLN 54  52  52  GLN GLN A . n 
A 1 55  PHE 55  53  53  PHE PHE A . n 
A 1 56  GLU 56  54  54  GLU GLU A . n 
A 1 57  PRO 57  55  55  PRO PRO A . n 
A 1 58  GLN 58  56  56  GLN GLN A . n 
A 1 59  LYS 59  57  57  LYS LYS A . n 
A 1 60  THR 60  58  58  THR THR A . n 
A 1 61  LEU 61  59  59  LEU LEU A . n 
A 1 62  PHE 62  60  60  PHE PHE A . n 
A 1 63  ILE 63  61  61  ILE ILE A . n 
A 1 64  GLN 64  62  62  GLN GLN A . n 
A 1 65  CYS 65  63  63  CYS CYS A . n 
A 1 66  ASP 66  64  64  ASP ASP A . n 
A 1 67  VAL 67  65  65  VAL VAL A . n 
A 1 68  ALA 68  66  66  ALA ALA A . n 
A 1 69  ASP 69  67  67  ASP ASP A . n 
A 1 70  GLN 70  68  68  GLN GLN A . n 
A 1 71  GLN 71  69  69  GLN GLN A . n 
A 1 72  GLN 72  70  70  GLN GLN A . n 
A 1 73  LEU 73  71  71  LEU LEU A . n 
A 1 74  ARG 74  72  72  ARG ARG A . n 
A 1 75  ASP 75  73  73  ASP ASP A . n 
A 1 76  THR 76  74  74  THR THR A . n 
A 1 77  PHE 77  75  75  PHE PHE A . n 
A 1 78  ARG 78  76  76  ARG ARG A . n 
A 1 79  LYS 79  77  77  LYS LYS A . n 
A 1 80  VAL 80  78  78  VAL VAL A . n 
A 1 81  VAL 81  79  79  VAL VAL A . n 
A 1 82  ASP 82  80  80  ASP ASP A . n 
A 1 83  HIS 83  81  81  HIS HIS A . n 
A 1 84  PHE 84  82  82  PHE PHE A . n 
A 1 85  GLY 85  83  83  GLY GLY A . n 
A 1 86  ARG 86  84  84  ARG ARG A . n 
A 1 87  LEU 87  85  85  LEU LEU A . n 
A 1 88  ASP 88  86  86  ASP ASP A . n 
A 1 89  ILE 89  87  87  ILE ILE A . n 
A 1 90  LEU 90  88  88  LEU LEU A . n 
A 1 91  VAL 91  89  89  VAL VAL A . n 
A 1 92  ASN 92  90  90  ASN ASN A . n 
A 1 93  ASN 93  91  91  ASN ASN A . n 
A 1 94  ALA 94  92  92  ALA ALA A . n 
A 1 95  GLY 95  93  93  GLY GLY A . n 
A 1 96  VAL 96  94  94  VAL VAL A . n 
A 1 97  ASN 97  95  95  ASN ASN A . n 
A 1 98  ASN 98  96  96  ASN ASN A . n 
A 1 99  GLU 99  97  97  GLU GLU A . n 
A 1 100 LYS 100 98  98  LYS LYS A . n 
A 1 101 ASN 101 99  99  ASN ASN A . n 
A 1 102 TRP 102 100 100 TRP TRP A . n 
A 1 103 GLU 103 101 101 GLU GLU A . n 
A 1 104 LYS 104 102 102 LYS LYS A . n 
A 1 105 THR 105 103 103 THR THR A . n 
A 1 106 LEU 106 104 104 LEU LEU A . n 
A 1 107 GLN 107 105 105 GLN GLN A . n 
A 1 108 ILE 108 106 106 ILE ILE A . n 
A 1 109 ASN 109 107 107 ASN ASN A . n 
A 1 110 LEU 110 108 108 LEU LEU A . n 
A 1 111 VAL 111 109 109 VAL VAL A . n 
A 1 112 SER 112 110 110 SER SER A . n 
A 1 113 VAL 113 111 111 VAL VAL A . n 
A 1 114 ILE 114 112 112 ILE ILE A . n 
A 1 115 SER 115 113 113 SER SER A . n 
A 1 116 GLY 116 114 114 GLY GLY A . n 
A 1 117 THR 117 115 115 THR THR A . n 
A 1 118 TYR 118 116 116 TYR TYR A . n 
A 1 119 LEU 119 117 117 LEU LEU A . n 
A 1 120 GLY 120 118 118 GLY GLY A . n 
A 1 121 LEU 121 119 119 LEU LEU A . n 
A 1 122 ASP 122 120 120 ASP ASP A . n 
A 1 123 TYR 123 121 121 TYR TYR A . n 
A 1 124 MET 124 122 122 MET MET A . n 
A 1 125 SER 125 123 123 SER SER A . n 
A 1 126 LYS 126 124 124 LYS LYS A . n 
A 1 127 GLN 127 125 125 GLN GLN A . n 
A 1 128 ASN 128 126 126 ASN ASN A . n 
A 1 129 GLY 129 127 127 GLY GLY A . n 
A 1 130 GLY 130 128 128 GLY GLY A . n 
A 1 131 GLU 131 129 129 GLU GLU A . n 
A 1 132 GLY 132 130 130 GLY GLY A . n 
A 1 133 GLY 133 131 131 GLY GLY A . n 
A 1 134 ILE 134 132 132 ILE ILE A . n 
A 1 135 ILE 135 133 133 ILE ILE A . n 
A 1 136 ILE 136 134 134 ILE ILE A . n 
A 1 137 ASN 137 135 135 ASN ASN A . n 
A 1 138 MET 138 136 136 MET MET A . n 
A 1 139 SER 139 137 137 SER SER A . n 
A 1 140 SER 140 138 138 SER SER A . n 
A 1 141 LEU 141 139 139 LEU LEU A . n 
A 1 142 ALA 142 140 140 ALA ALA A . n 
A 1 143 GLY 143 141 141 GLY GLY A . n 
A 1 144 LEU 144 142 142 LEU LEU A . n 
A 1 145 MET 145 143 143 MET MET A . n 
A 1 146 PRO 146 144 144 PRO PRO A . n 
A 1 147 VAL 147 145 145 VAL VAL A . n 
A 1 148 ALA 148 146 146 ALA ALA A . n 
A 1 149 GLN 149 147 147 GLN GLN A . n 
A 1 150 GLN 150 148 148 GLN GLN A . n 
A 1 151 PRO 151 149 149 PRO PRO A . n 
A 1 152 VAL 152 150 150 VAL VAL A . n 
A 1 153 TYR 153 151 151 TYR TYR A . n 
A 1 154 CYS 154 152 152 CYS CYS A . n 
A 1 155 ALA 155 153 153 ALA ALA A . n 
A 1 156 SER 156 154 154 SER SER A . n 
A 1 157 LYS 157 155 155 LYS LYS A . n 
A 1 158 HIS 158 156 156 HIS HIS A . n 
A 1 159 GLY 159 157 157 GLY GLY A . n 
A 1 160 ILE 160 158 158 ILE ILE A . n 
A 1 161 VAL 161 159 159 VAL VAL A . n 
A 1 162 GLY 162 160 160 GLY GLY A . n 
A 1 163 PHE 163 161 161 PHE PHE A . n 
A 1 164 THR 164 162 162 THR THR A . n 
A 1 165 ARG 165 163 163 ARG ARG A . n 
A 1 166 SER 166 164 164 SER SER A . n 
A 1 167 ALA 167 165 165 ALA ALA A . n 
A 1 168 ALA 168 166 166 ALA ALA A . n 
A 1 169 LEU 169 167 167 LEU LEU A . n 
A 1 170 ALA 170 168 168 ALA ALA A . n 
A 1 171 ALA 171 169 169 ALA ALA A . n 
A 1 172 ASN 172 170 170 ASN ASN A . n 
A 1 173 LEU 173 171 171 LEU LEU A . n 
A 1 174 MET 174 172 172 MET MET A . n 
A 1 175 ASN 175 173 173 ASN ASN A . n 
A 1 176 SER 176 174 174 SER SER A . n 
A 1 177 GLY 177 175 175 GLY GLY A . n 
A 1 178 VAL 178 176 176 VAL VAL A . n 
A 1 179 ARG 179 177 177 ARG ARG A . n 
A 1 180 LEU 180 178 178 LEU LEU A . n 
A 1 181 ASN 181 179 179 ASN ASN A . n 
A 1 182 ALA 182 180 180 ALA ALA A . n 
A 1 183 ILE 183 181 181 ILE ILE A . n 
A 1 184 CYS 184 182 182 CYS CYS A . n 
A 1 185 PRO 185 183 183 PRO PRO A . n 
A 1 186 GLY 186 184 184 GLY GLY A . n 
A 1 187 PHE 187 185 185 PHE PHE A . n 
A 1 188 VAL 188 186 186 VAL VAL A . n 
A 1 189 ASN 189 187 187 ASN ASN A . n 
A 1 190 THR 190 188 188 THR THR A . n 
A 1 191 ALA 191 189 189 ALA ALA A . n 
A 1 192 ILE 192 190 190 ILE ILE A . n 
A 1 193 LEU 193 191 191 LEU LEU A . n 
A 1 194 GLU 194 192 192 GLU GLU A . n 
A 1 195 SER 195 193 193 SER SER A . n 
A 1 196 ILE 196 194 194 ILE ILE A . n 
A 1 197 GLU 197 195 195 GLU GLU A . n 
A 1 198 LYS 198 196 196 LYS LYS A . n 
A 1 199 GLU 199 197 197 GLU GLU A . n 
A 1 200 GLU 200 198 198 GLU GLU A . n 
A 1 201 ASN 201 199 199 ASN ASN A . n 
A 1 202 MET 202 200 200 MET MET A . n 
A 1 203 GLY 203 201 201 GLY GLY A . n 
A 1 204 GLN 204 202 202 GLN GLN A . n 
A 1 205 TYR 205 203 203 TYR TYR A . n 
A 1 206 ILE 206 204 204 ILE ILE A . n 
A 1 207 GLU 207 205 205 GLU GLU A . n 
A 1 208 TYR 208 206 206 TYR TYR A . n 
A 1 209 LYS 209 207 207 LYS LYS A . n 
A 1 210 ASP 210 208 208 ASP ASP A . n 
A 1 211 HIS 211 209 209 HIS HIS A . n 
A 1 212 ILE 212 210 210 ILE ILE A . n 
A 1 213 LYS 213 211 211 LYS LYS A . n 
A 1 214 ASP 214 212 212 ASP ASP A . n 
A 1 215 MET 215 213 213 MET MET A . n 
A 1 216 ILE 216 214 214 ILE ILE A . n 
A 1 217 LYS 217 215 215 LYS LYS A . n 
A 1 218 TYR 218 216 216 TYR TYR A . n 
A 1 219 TYR 219 217 217 TYR TYR A . n 
A 1 220 GLY 220 218 218 GLY GLY A . n 
A 1 221 ILE 221 219 219 ILE ILE A . n 
A 1 222 LEU 222 220 220 LEU LEU A . n 
A 1 223 ASP 223 221 221 ASP ASP A . n 
A 1 224 PRO 224 222 222 PRO PRO A . n 
A 1 225 PRO 225 223 223 PRO PRO A . n 
A 1 226 LEU 226 224 224 LEU LEU A . n 
A 1 227 ILE 227 225 225 ILE ILE A . n 
A 1 228 ALA 228 226 226 ALA ALA A . n 
A 1 229 ASN 229 227 227 ASN ASN A . n 
A 1 230 GLY 230 228 228 GLY GLY A . n 
A 1 231 LEU 231 229 229 LEU LEU A . n 
A 1 232 ILE 232 230 230 ILE ILE A . n 
A 1 233 THR 233 231 231 THR THR A . n 
A 1 234 LEU 234 232 232 LEU LEU A . n 
A 1 235 ILE 235 233 233 ILE ILE A . n 
A 1 236 GLU 236 234 234 GLU GLU A . n 
A 1 237 ASP 237 235 235 ASP ASP A . n 
A 1 238 ASP 238 236 236 ASP ASP A . n 
A 1 239 ALA 239 237 237 ALA ALA A . n 
A 1 240 LEU 240 238 238 LEU LEU A . n 
A 1 241 ASN 241 239 239 ASN ASN A . n 
A 1 242 GLY 242 240 240 GLY GLY A . n 
A 1 243 ALA 243 241 241 ALA ALA A . n 
A 1 244 ILE 244 242 242 ILE ILE A . n 
A 1 245 MET 245 243 243 MET MET A . n 
A 1 246 LYS 246 244 244 LYS LYS A . n 
A 1 247 ILE 247 245 245 ILE ILE A . n 
A 1 248 THR 248 246 246 THR THR A . n 
A 1 249 THR 249 247 247 THR THR A . n 
A 1 250 SER 250 248 248 SER SER A . n 
A 1 251 LYS 251 249 249 LYS LYS A . n 
A 1 252 GLY 252 250 250 GLY GLY A . n 
A 1 253 ILE 253 251 251 ILE ILE A . n 
A 1 254 HIS 254 252 252 HIS HIS A . n 
A 1 255 PHE 255 253 253 PHE PHE A . n 
A 1 256 GLN 256 254 254 GLN GLN A . n 
A 1 257 ASP 257 255 255 ASP ASP A . n 
A 1 258 TYR 258 256 256 TYR TYR A . n 
A 1 259 GLY 259 257 257 GLY GLY A . n 
A 1 260 SER 260 258 258 SER SER A . n 
A 1 261 LYS 261 259 259 LYS LYS A . n 
A 1 262 GLU 262 260 260 GLU GLU A . n 
A 1 263 ASN 263 261 261 ASN ASN A . n 
A 1 264 LEU 264 262 262 LEU LEU A . n 
A 1 265 TYR 265 263 263 TYR TYR A . n 
A 1 266 PHE 266 264 264 PHE PHE A . n 
A 1 267 GLN 267 265 265 GLN GLN A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAD 1   300 300 NAD NAD A . 
C 3 HOH 1   301 1   HOH HOH A . 
C 3 HOH 2   302 2   HOH HOH A . 
C 3 HOH 3   303 3   HOH HOH A . 
C 3 HOH 4   304 4   HOH HOH A . 
C 3 HOH 5   305 5   HOH HOH A . 
C 3 HOH 6   306 6   HOH HOH A . 
C 3 HOH 7   307 7   HOH HOH A . 
C 3 HOH 8   308 8   HOH HOH A . 
C 3 HOH 9   309 9   HOH HOH A . 
C 3 HOH 10  310 10  HOH HOH A . 
C 3 HOH 11  311 11  HOH HOH A . 
C 3 HOH 12  312 12  HOH HOH A . 
C 3 HOH 13  313 13  HOH HOH A . 
C 3 HOH 14  314 14  HOH HOH A . 
C 3 HOH 15  315 15  HOH HOH A . 
C 3 HOH 16  316 16  HOH HOH A . 
C 3 HOH 17  317 17  HOH HOH A . 
C 3 HOH 18  318 18  HOH HOH A . 
C 3 HOH 19  319 19  HOH HOH A . 
C 3 HOH 20  320 20  HOH HOH A . 
C 3 HOH 21  321 21  HOH HOH A . 
C 3 HOH 22  322 22  HOH HOH A . 
C 3 HOH 23  323 23  HOH HOH A . 
C 3 HOH 24  324 25  HOH HOH A . 
C 3 HOH 25  325 26  HOH HOH A . 
C 3 HOH 26  326 27  HOH HOH A . 
C 3 HOH 27  327 28  HOH HOH A . 
C 3 HOH 28  328 29  HOH HOH A . 
C 3 HOH 29  329 30  HOH HOH A . 
C 3 HOH 30  330 31  HOH HOH A . 
C 3 HOH 31  331 32  HOH HOH A . 
C 3 HOH 32  332 33  HOH HOH A . 
C 3 HOH 33  333 34  HOH HOH A . 
C 3 HOH 34  334 35  HOH HOH A . 
C 3 HOH 35  335 37  HOH HOH A . 
C 3 HOH 36  336 38  HOH HOH A . 
C 3 HOH 37  337 39  HOH HOH A . 
C 3 HOH 38  338 40  HOH HOH A . 
C 3 HOH 39  339 41  HOH HOH A . 
C 3 HOH 40  340 42  HOH HOH A . 
C 3 HOH 41  341 43  HOH HOH A . 
C 3 HOH 42  342 44  HOH HOH A . 
C 3 HOH 43  343 45  HOH HOH A . 
C 3 HOH 44  344 46  HOH HOH A . 
C 3 HOH 45  345 47  HOH HOH A . 
C 3 HOH 46  346 48  HOH HOH A . 
C 3 HOH 47  347 49  HOH HOH A . 
C 3 HOH 48  348 50  HOH HOH A . 
C 3 HOH 49  349 51  HOH HOH A . 
C 3 HOH 50  350 52  HOH HOH A . 
C 3 HOH 51  351 53  HOH HOH A . 
C 3 HOH 52  352 54  HOH HOH A . 
C 3 HOH 53  353 55  HOH HOH A . 
C 3 HOH 54  354 56  HOH HOH A . 
C 3 HOH 55  355 57  HOH HOH A . 
C 3 HOH 56  356 58  HOH HOH A . 
C 3 HOH 57  357 59  HOH HOH A . 
C 3 HOH 58  358 60  HOH HOH A . 
C 3 HOH 59  359 61  HOH HOH A . 
C 3 HOH 60  360 63  HOH HOH A . 
C 3 HOH 61  361 64  HOH HOH A . 
C 3 HOH 62  362 65  HOH HOH A . 
C 3 HOH 63  363 66  HOH HOH A . 
C 3 HOH 64  364 67  HOH HOH A . 
C 3 HOH 65  365 68  HOH HOH A . 
C 3 HOH 66  366 69  HOH HOH A . 
C 3 HOH 67  367 70  HOH HOH A . 
C 3 HOH 68  368 71  HOH HOH A . 
C 3 HOH 69  369 72  HOH HOH A . 
C 3 HOH 70  370 73  HOH HOH A . 
C 3 HOH 71  371 74  HOH HOH A . 
C 3 HOH 72  372 75  HOH HOH A . 
C 3 HOH 73  373 76  HOH HOH A . 
C 3 HOH 74  374 77  HOH HOH A . 
C 3 HOH 75  375 78  HOH HOH A . 
C 3 HOH 76  376 79  HOH HOH A . 
C 3 HOH 77  377 80  HOH HOH A . 
C 3 HOH 78  378 81  HOH HOH A . 
C 3 HOH 79  379 82  HOH HOH A . 
C 3 HOH 80  380 83  HOH HOH A . 
C 3 HOH 81  381 84  HOH HOH A . 
C 3 HOH 82  382 85  HOH HOH A . 
C 3 HOH 83  383 86  HOH HOH A . 
C 3 HOH 84  384 87  HOH HOH A . 
C 3 HOH 85  385 88  HOH HOH A . 
C 3 HOH 86  386 89  HOH HOH A . 
C 3 HOH 87  387 90  HOH HOH A . 
C 3 HOH 88  388 91  HOH HOH A . 
C 3 HOH 89  389 92  HOH HOH A . 
C 3 HOH 90  390 93  HOH HOH A . 
C 3 HOH 91  391 94  HOH HOH A . 
C 3 HOH 92  392 95  HOH HOH A . 
C 3 HOH 93  393 96  HOH HOH A . 
C 3 HOH 94  394 97  HOH HOH A . 
C 3 HOH 95  395 98  HOH HOH A . 
C 3 HOH 96  396 99  HOH HOH A . 
C 3 HOH 97  397 100 HOH HOH A . 
C 3 HOH 98  398 101 HOH HOH A . 
C 3 HOH 99  399 102 HOH HOH A . 
C 3 HOH 100 400 103 HOH HOH A . 
C 3 HOH 101 401 105 HOH HOH A . 
C 3 HOH 102 402 106 HOH HOH A . 
C 3 HOH 103 403 107 HOH HOH A . 
C 3 HOH 104 404 108 HOH HOH A . 
C 3 HOH 105 405 109 HOH HOH A . 
C 3 HOH 106 406 110 HOH HOH A . 
C 3 HOH 107 407 111 HOH HOH A . 
C 3 HOH 108 408 112 HOH HOH A . 
C 3 HOH 109 409 113 HOH HOH A . 
C 3 HOH 110 410 114 HOH HOH A . 
C 3 HOH 111 411 116 HOH HOH A . 
C 3 HOH 112 412 117 HOH HOH A . 
C 3 HOH 113 413 119 HOH HOH A . 
C 3 HOH 114 414 120 HOH HOH A . 
C 3 HOH 115 415 121 HOH HOH A . 
C 3 HOH 116 416 122 HOH HOH A . 
C 3 HOH 117 417 123 HOH HOH A . 
C 3 HOH 118 418 124 HOH HOH A . 
C 3 HOH 119 419 125 HOH HOH A . 
C 3 HOH 120 420 126 HOH HOH A . 
C 3 HOH 121 421 127 HOH HOH A . 
C 3 HOH 122 422 128 HOH HOH A . 
C 3 HOH 123 423 129 HOH HOH A . 
C 3 HOH 124 424 130 HOH HOH A . 
C 3 HOH 125 425 131 HOH HOH A . 
C 3 HOH 126 426 132 HOH HOH A . 
C 3 HOH 127 427 133 HOH HOH A . 
C 3 HOH 128 428 135 HOH HOH A . 
C 3 HOH 129 429 136 HOH HOH A . 
C 3 HOH 130 430 137 HOH HOH A . 
C 3 HOH 131 431 138 HOH HOH A . 
C 3 HOH 132 432 139 HOH HOH A . 
C 3 HOH 133 433 140 HOH HOH A . 
C 3 HOH 134 434 141 HOH HOH A . 
C 3 HOH 135 435 142 HOH HOH A . 
C 3 HOH 136 436 143 HOH HOH A . 
C 3 HOH 137 437 144 HOH HOH A . 
C 3 HOH 138 438 145 HOH HOH A . 
C 3 HOH 139 439 146 HOH HOH A . 
C 3 HOH 140 440 147 HOH HOH A . 
C 3 HOH 141 441 148 HOH HOH A . 
C 3 HOH 142 442 149 HOH HOH A . 
C 3 HOH 143 443 150 HOH HOH A . 
C 3 HOH 144 444 151 HOH HOH A . 
C 3 HOH 145 445 152 HOH HOH A . 
C 3 HOH 146 446 153 HOH HOH A . 
C 3 HOH 147 447 154 HOH HOH A . 
C 3 HOH 148 448 155 HOH HOH A . 
C 3 HOH 149 449 157 HOH HOH A . 
C 3 HOH 150 450 158 HOH HOH A . 
C 3 HOH 151 451 159 HOH HOH A . 
C 3 HOH 152 452 160 HOH HOH A . 
C 3 HOH 153 453 162 HOH HOH A . 
C 3 HOH 154 454 164 HOH HOH A . 
C 3 HOH 155 455 165 HOH HOH A . 
C 3 HOH 156 456 166 HOH HOH A . 
C 3 HOH 157 457 167 HOH HOH A . 
C 3 HOH 158 458 168 HOH HOH A . 
C 3 HOH 159 459 171 HOH HOH A . 
C 3 HOH 160 460 172 HOH HOH A . 
C 3 HOH 161 461 173 HOH HOH A . 
C 3 HOH 162 462 174 HOH HOH A . 
C 3 HOH 163 463 175 HOH HOH A . 
C 3 HOH 164 464 176 HOH HOH A . 
C 3 HOH 165 465 178 HOH HOH A . 
C 3 HOH 166 466 179 HOH HOH A . 
C 3 HOH 167 467 180 HOH HOH A . 
C 3 HOH 168 468 181 HOH HOH A . 
C 3 HOH 169 469 182 HOH HOH A . 
C 3 HOH 170 470 183 HOH HOH A . 
C 3 HOH 171 471 184 HOH HOH A . 
C 3 HOH 172 472 185 HOH HOH A . 
C 3 HOH 173 473 186 HOH HOH A . 
C 3 HOH 174 474 187 HOH HOH A . 
C 3 HOH 175 475 189 HOH HOH A . 
C 3 HOH 176 476 191 HOH HOH A . 
C 3 HOH 177 477 192 HOH HOH A . 
C 3 HOH 178 478 193 HOH HOH A . 
C 3 HOH 179 479 194 HOH HOH A . 
C 3 HOH 180 480 195 HOH HOH A . 
C 3 HOH 181 481 196 HOH HOH A . 
C 3 HOH 182 482 197 HOH HOH A . 
C 3 HOH 183 483 198 HOH HOH A . 
C 3 HOH 184 484 199 HOH HOH A . 
C 3 HOH 185 485 200 HOH HOH A . 
C 3 HOH 186 486 201 HOH HOH A . 
C 3 HOH 187 487 202 HOH HOH A . 
C 3 HOH 188 488 203 HOH HOH A . 
C 3 HOH 189 489 204 HOH HOH A . 
C 3 HOH 190 490 205 HOH HOH A . 
C 3 HOH 191 491 206 HOH HOH A . 
C 3 HOH 192 492 207 HOH HOH A . 
C 3 HOH 193 493 208 HOH HOH A . 
C 3 HOH 194 494 209 HOH HOH A . 
C 3 HOH 195 495 210 HOH HOH A . 
C 3 HOH 196 496 211 HOH HOH A . 
C 3 HOH 197 497 212 HOH HOH A . 
C 3 HOH 198 498 214 HOH HOH A . 
C 3 HOH 199 499 215 HOH HOH A . 
C 3 HOH 200 500 216 HOH HOH A . 
C 3 HOH 201 501 217 HOH HOH A . 
C 3 HOH 202 502 218 HOH HOH A . 
C 3 HOH 203 503 220 HOH HOH A . 
C 3 HOH 204 504 221 HOH HOH A . 
C 3 HOH 205 505 222 HOH HOH A . 
C 3 HOH 206 506 223 HOH HOH A . 
C 3 HOH 207 507 224 HOH HOH A . 
C 3 HOH 208 508 225 HOH HOH A . 
C 3 HOH 209 509 226 HOH HOH A . 
C 3 HOH 210 510 227 HOH HOH A . 
C 3 HOH 211 511 228 HOH HOH A . 
C 3 HOH 212 512 229 HOH HOH A . 
C 3 HOH 213 513 230 HOH HOH A . 
C 3 HOH 214 514 231 HOH HOH A . 
C 3 HOH 215 515 232 HOH HOH A . 
C 3 HOH 216 516 234 HOH HOH A . 
C 3 HOH 217 517 235 HOH HOH A . 
C 3 HOH 218 518 236 HOH HOH A . 
C 3 HOH 219 519 237 HOH HOH A . 
C 3 HOH 220 520 238 HOH HOH A . 
C 3 HOH 221 521 240 HOH HOH A . 
C 3 HOH 222 522 241 HOH HOH A . 
C 3 HOH 223 523 242 HOH HOH A . 
C 3 HOH 224 524 243 HOH HOH A . 
C 3 HOH 225 525 244 HOH HOH A . 
C 3 HOH 226 526 245 HOH HOH A . 
C 3 HOH 227 527 246 HOH HOH A . 
C 3 HOH 228 528 247 HOH HOH A . 
C 3 HOH 229 529 248 HOH HOH A . 
C 3 HOH 230 530 249 HOH HOH A . 
C 3 HOH 231 531 250 HOH HOH A . 
C 3 HOH 232 532 251 HOH HOH A . 
C 3 HOH 233 533 252 HOH HOH A . 
C 3 HOH 234 534 254 HOH HOH A . 
C 3 HOH 235 535 255 HOH HOH A . 
C 3 HOH 236 536 257 HOH HOH A . 
C 3 HOH 237 537 258 HOH HOH A . 
C 3 HOH 238 538 259 HOH HOH A . 
C 3 HOH 239 539 261 HOH HOH A . 
C 3 HOH 240 540 262 HOH HOH A . 
C 3 HOH 241 541 263 HOH HOH A . 
C 3 HOH 242 542 264 HOH HOH A . 
C 3 HOH 243 543 265 HOH HOH A . 
C 3 HOH 244 544 266 HOH HOH A . 
C 3 HOH 245 545 267 HOH HOH A . 
C 3 HOH 246 546 268 HOH HOH A . 
C 3 HOH 247 547 269 HOH HOH A . 
C 3 HOH 248 548 270 HOH HOH A . 
C 3 HOH 249 549 271 HOH HOH A . 
C 3 HOH 250 550 273 HOH HOH A . 
C 3 HOH 251 551 274 HOH HOH A . 
C 3 HOH 252 552 275 HOH HOH A . 
C 3 HOH 253 553 277 HOH HOH A . 
C 3 HOH 254 554 279 HOH HOH A . 
C 3 HOH 255 555 280 HOH HOH A . 
C 3 HOH 256 556 281 HOH HOH A . 
C 3 HOH 257 557 282 HOH HOH A . 
C 3 HOH 258 558 283 HOH HOH A . 
C 3 HOH 259 559 285 HOH HOH A . 
C 3 HOH 260 560 286 HOH HOH A . 
C 3 HOH 261 561 288 HOH HOH A . 
C 3 HOH 262 562 289 HOH HOH A . 
C 3 HOH 263 563 290 HOH HOH A . 
C 3 HOH 264 564 291 HOH HOH A . 
C 3 HOH 265 565 292 HOH HOH A . 
C 3 HOH 266 566 293 HOH HOH A . 
C 3 HOH 267 567 295 HOH HOH A . 
C 3 HOH 268 568 296 HOH HOH A . 
C 3 HOH 269 569 297 HOH HOH A . 
C 3 HOH 270 570 299 HOH HOH A . 
C 3 HOH 271 571 301 HOH HOH A . 
C 3 HOH 272 572 303 HOH HOH A . 
C 3 HOH 273 573 310 HOH HOH A . 
C 3 HOH 274 574 314 HOH HOH A . 
C 3 HOH 275 575 316 HOH HOH A . 
C 3 HOH 276 576 319 HOH HOH A . 
C 3 HOH 277 577 321 HOH HOH A . 
C 3 HOH 278 578 322 HOH HOH A . 
C 3 HOH 279 579 323 HOH HOH A . 
C 3 HOH 280 580 326 HOH HOH A . 
C 3 HOH 281 581 327 HOH HOH A . 
C 3 HOH 282 582 328 HOH HOH A . 
C 3 HOH 283 583 329 HOH HOH A . 
C 3 HOH 284 584 330 HOH HOH A . 
C 3 HOH 285 585 332 HOH HOH A . 
C 3 HOH 286 586 333 HOH HOH A . 
C 3 HOH 287 587 334 HOH HOH A . 
C 3 HOH 288 588 335 HOH HOH A . 
C 3 HOH 289 589 336 HOH HOH A . 
C 3 HOH 290 590 337 HOH HOH A . 
C 3 HOH 291 591 338 HOH HOH A . 
C 3 HOH 292 592 339 HOH HOH A . 
C 3 HOH 293 593 340 HOH HOH A . 
C 3 HOH 294 594 341 HOH HOH A . 
C 3 HOH 295 595 342 HOH HOH A . 
C 3 HOH 296 596 343 HOH HOH A . 
C 3 HOH 297 597 344 HOH HOH A . 
C 3 HOH 298 598 345 HOH HOH A . 
C 3 HOH 299 599 346 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7160  ? 
1 MORE         -53   ? 
1 'SSA (A^2)'  19960 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 195.7710000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-04-04 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019  ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
PHASER phasing          .         ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 96  ? ? -161.69 103.54  
2 1 SER A 137 ? ? -94.32  -138.18 
3 1 GLN A 148 ? ? -143.22 57.18   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 54  ? CD  ? A GLU 56  CD  
2  1 Y 1 A GLU 54  ? OE1 ? A GLU 56  OE1 
3  1 Y 1 A GLU 54  ? OE2 ? A GLU 56  OE2 
4  1 Y 1 A GLU 205 ? CD  ? A GLU 207 CD  
5  1 Y 1 A GLU 205 ? OE1 ? A GLU 207 OE1 
6  1 Y 1 A GLU 205 ? OE2 ? A GLU 207 OE2 
7  1 Y 1 A LYS 215 ? CD  ? A LYS 217 CD  
8  1 Y 1 A LYS 215 ? CE  ? A LYS 217 CE  
9  1 Y 1 A LYS 215 ? NZ  ? A LYS 217 NZ  
10 1 Y 1 A ASP 236 ? CG  ? A ASP 238 CG  
11 1 Y 1 A ASP 236 ? OD1 ? A ASP 238 OD1 
12 1 Y 1 A ASP 236 ? OD2 ? A ASP 238 OD2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      -1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 
3 water                             HOH 
#