data_2GH0
# 
_entry.id   2GH0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GH0         
RCSB  RCSB037106   
WWPDB D_1000037106 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GH0 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Wang, X.Q.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Structure of Artemin Complexed with Its Receptor GFRalpha3: Convergent Recognition of Glial Cell Line-Derived Neurotrophic Factors.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            14 
_citation.page_first                1083 
_citation.page_last                 1092 
_citation.year                      2006 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16765900 
_citation.pdbx_database_id_DOI      10.1016/j.str.2006.05.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, X.'      1 
primary 'Baloh, R.H.'   2 
primary 'Milbrandt, J.' 3 
primary 'Garcia, K.C.'  4 
# 
_cell.entry_id           2GH0 
_cell.length_a           73.678 
_cell.length_b           41.460 
_cell.length_c           119.863 
_cell.angle_alpha        90.00 
_cell.angle_beta         103.56 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2GH0 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man artemin                        10957.620 2   ? ? ? ? 
2 polymer     man 'GDNF family receptor alpha-3' 23778.625 2   ? ? ? ? 
3 non-polymer man N-ACETYL-D-GLUCOSAMINE         221.208   3   ? ? ? ? 
4 non-polymer man BETA-D-MANNOSE                 180.156   1   ? ? ? ? 
5 non-polymer man ALPHA-D-MANNOSE                180.156   2   ? ? ? ? 
6 water       nat water                          18.015    236 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        GFR-alpha-3 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DPGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFM
DVNSTWRTVDRLSATACGCLG
;
;DPGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFM
DVNSTWRTVDRLSATACGCLG
;
C,D ? 
2 'polypeptide(L)' no no 
;KLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGER
RRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNT
SVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHP
;
;KLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGER
RRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNT
SVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHP
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   PRO n 
1 3   GLY n 
1 4   CYS n 
1 5   ARG n 
1 6   LEU n 
1 7   ARG n 
1 8   SER n 
1 9   GLN n 
1 10  LEU n 
1 11  VAL n 
1 12  PRO n 
1 13  VAL n 
1 14  ARG n 
1 15  ALA n 
1 16  LEU n 
1 17  GLY n 
1 18  LEU n 
1 19  GLY n 
1 20  HIS n 
1 21  ARG n 
1 22  SER n 
1 23  ASP n 
1 24  GLU n 
1 25  LEU n 
1 26  VAL n 
1 27  ARG n 
1 28  PHE n 
1 29  ARG n 
1 30  PHE n 
1 31  CYS n 
1 32  SER n 
1 33  GLY n 
1 34  SER n 
1 35  CYS n 
1 36  ARG n 
1 37  ARG n 
1 38  ALA n 
1 39  ARG n 
1 40  SER n 
1 41  PRO n 
1 42  HIS n 
1 43  ASP n 
1 44  LEU n 
1 45  SER n 
1 46  LEU n 
1 47  ALA n 
1 48  SER n 
1 49  LEU n 
1 50  LEU n 
1 51  GLY n 
1 52  ALA n 
1 53  GLY n 
1 54  ALA n 
1 55  LEU n 
1 56  ARG n 
1 57  PRO n 
1 58  PRO n 
1 59  PRO n 
1 60  GLY n 
1 61  SER n 
1 62  ARG n 
1 63  PRO n 
1 64  VAL n 
1 65  SER n 
1 66  GLN n 
1 67  PRO n 
1 68  CYS n 
1 69  CYS n 
1 70  ARG n 
1 71  PRO n 
1 72  THR n 
1 73  ARG n 
1 74  TYR n 
1 75  GLU n 
1 76  ALA n 
1 77  VAL n 
1 78  SER n 
1 79  PHE n 
1 80  MET n 
1 81  ASP n 
1 82  VAL n 
1 83  ASN n 
1 84  SER n 
1 85  THR n 
1 86  TRP n 
1 87  ARG n 
1 88  THR n 
1 89  VAL n 
1 90  ASP n 
1 91  ARG n 
1 92  LEU n 
1 93  SER n 
1 94  ALA n 
1 95  THR n 
1 96  ALA n 
1 97  CYS n 
1 98  GLY n 
1 99  CYS n 
1 100 LEU n 
1 101 GLY n 
2 1   LYS n 
2 2   LEU n 
2 3   ASN n 
2 4   MET n 
2 5   LEU n 
2 6   LYS n 
2 7   PRO n 
2 8   ASP n 
2 9   SER n 
2 10  ASP n 
2 11  LEU n 
2 12  CYS n 
2 13  LEU n 
2 14  LYS n 
2 15  PHE n 
2 16  ALA n 
2 17  MET n 
2 18  LEU n 
2 19  CYS n 
2 20  THR n 
2 21  LEU n 
2 22  ASN n 
2 23  ASP n 
2 24  LYS n 
2 25  CYS n 
2 26  ASP n 
2 27  ARG n 
2 28  LEU n 
2 29  ARG n 
2 30  LYS n 
2 31  ALA n 
2 32  TYR n 
2 33  GLY n 
2 34  GLU n 
2 35  ALA n 
2 36  CYS n 
2 37  SER n 
2 38  GLY n 
2 39  PRO n 
2 40  HIS n 
2 41  CYS n 
2 42  GLN n 
2 43  ARG n 
2 44  HIS n 
2 45  VAL n 
2 46  CYS n 
2 47  LEU n 
2 48  ARG n 
2 49  GLN n 
2 50  LEU n 
2 51  LEU n 
2 52  THR n 
2 53  PHE n 
2 54  PHE n 
2 55  GLU n 
2 56  LYS n 
2 57  ALA n 
2 58  ALA n 
2 59  GLU n 
2 60  PRO n 
2 61  HIS n 
2 62  ALA n 
2 63  GLN n 
2 64  GLY n 
2 65  LEU n 
2 66  LEU n 
2 67  LEU n 
2 68  CYS n 
2 69  PRO n 
2 70  CYS n 
2 71  ALA n 
2 72  PRO n 
2 73  ASN n 
2 74  ASP n 
2 75  ARG n 
2 76  GLY n 
2 77  CYS n 
2 78  GLY n 
2 79  GLU n 
2 80  ARG n 
2 81  ARG n 
2 82  ARG n 
2 83  ASN n 
2 84  THR n 
2 85  ILE n 
2 86  ALA n 
2 87  PRO n 
2 88  ASN n 
2 89  CYS n 
2 90  ALA n 
2 91  LEU n 
2 92  PRO n 
2 93  PRO n 
2 94  VAL n 
2 95  ALA n 
2 96  PRO n 
2 97  ASN n 
2 98  CYS n 
2 99  LEU n 
2 100 GLU n 
2 101 LEU n 
2 102 ARG n 
2 103 ARG n 
2 104 LEU n 
2 105 CYS n 
2 106 PHE n 
2 107 SER n 
2 108 ASP n 
2 109 PRO n 
2 110 LEU n 
2 111 CYS n 
2 112 ARG n 
2 113 SER n 
2 114 ARG n 
2 115 LEU n 
2 116 VAL n 
2 117 ASP n 
2 118 PHE n 
2 119 GLN n 
2 120 THR n 
2 121 HIS n 
2 122 CYS n 
2 123 HIS n 
2 124 PRO n 
2 125 MET n 
2 126 ASP n 
2 127 ILE n 
2 128 LEU n 
2 129 GLY n 
2 130 THR n 
2 131 CYS n 
2 132 ALA n 
2 133 THR n 
2 134 GLU n 
2 135 GLN n 
2 136 SER n 
2 137 ARG n 
2 138 CYS n 
2 139 LEU n 
2 140 ARG n 
2 141 ALA n 
2 142 TYR n 
2 143 LEU n 
2 144 GLY n 
2 145 LEU n 
2 146 ILE n 
2 147 GLY n 
2 148 THR n 
2 149 ALA n 
2 150 MET n 
2 151 THR n 
2 152 PRO n 
2 153 ASN n 
2 154 PHE n 
2 155 VAL n 
2 156 SER n 
2 157 ASN n 
2 158 VAL n 
2 159 ASN n 
2 160 THR n 
2 161 SER n 
2 162 VAL n 
2 163 ALA n 
2 164 LEU n 
2 165 SER n 
2 166 CYS n 
2 167 THR n 
2 168 CYS n 
2 169 ARG n 
2 170 GLY n 
2 171 SER n 
2 172 GLY n 
2 173 ASN n 
2 174 LEU n 
2 175 GLN n 
2 176 GLU n 
2 177 GLU n 
2 178 CYS n 
2 179 GLU n 
2 180 MET n 
2 181 LEU n 
2 182 GLU n 
2 183 GLY n 
2 184 PHE n 
2 185 PHE n 
2 186 SER n 
2 187 HIS n 
2 188 ASN n 
2 189 PRO n 
2 190 CYS n 
2 191 LEU n 
2 192 THR n 
2 193 GLU n 
2 194 ALA n 
2 195 ILE n 
2 196 ALA n 
2 197 ALA n 
2 198 LYS n 
2 199 MET n 
2 200 ARG n 
2 201 PHE n 
2 202 HIS n 
2 203 SER n 
2 204 GLN n 
2 205 LEU n 
2 206 PHE n 
2 207 SER n 
2 208 GLN n 
2 209 ASP n 
2 210 TRP n 
2 211 PRO n 
2 212 HIS n 
2 213 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ?     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'cabbage looper' 'Trichoplusia ni' 7111 
Trichoplusia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo GFRA3 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'cabbage looper' 'Trichoplusia ni' 7111 
Trichoplusia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP ARTN_HUMAN  Q5T4W7 1 122 ? ? 
2 UNP GFRA3_HUMAN O60609 2 151 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GH0 C 3 ? 101 ? Q5T4W7 122 ? 220 ? 122 220 
2 1 2GH0 D 3 ? 101 ? Q5T4W7 122 ? 220 ? 122 220 
3 2 2GH0 A 1 ? 213 ? O60609 151 ? 363 ? 151 363 
4 2 2GH0 B 1 ? 213 ? O60609 151 ? 363 ? 151 363 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GH0 ASP C 1 ? UNP Q5T4W7 ? ? 'CLONING ARTIFACT' 120 1 
1 2GH0 PRO C 2 ? UNP Q5T4W7 ? ? 'CLONING ARTIFACT' 121 2 
2 2GH0 ASP D 1 ? UNP Q5T4W7 ? ? 'CLONING ARTIFACT' 120 3 
2 2GH0 PRO D 2 ? UNP Q5T4W7 ? ? 'CLONING ARTIFACT' 121 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ? 'C4 H7 N O4'     133.103 
BMA D-saccharide        . BETA-D-MANNOSE         ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking' y CYSTEINE               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ? 'C6 H15 N2 O2 1' 147.195 
MAN D-saccharide        . ALPHA-D-MANNOSE        ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking' y METHIONINE             ? 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2GH0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   51.95 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'0.1 M Imidazole buffer, 0.1 M MgCl2, and 20% (v/v) ethanol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-11-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystals' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2GH0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   54357 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   98.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2GH0 
_refine.ls_number_reflns_obs                     51067 
_refine.ls_number_reflns_all                     51723 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            1.92 
_refine.ls_percent_reflns_obs                    98.73 
_refine.ls_R_factor_obs                          0.22164 
_refine.ls_R_factor_all                          0.2412 
_refine.ls_R_factor_R_work                       0.21946 
_refine.ls_R_factor_R_free                       0.26294 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2740 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.944 
_refine.correlation_coeff_Fo_to_Fc_free          0.916 
_refine.B_iso_mean                               37.509 
_refine.aniso_B[1][1]                            -0.24 
_refine.aniso_B[2][2]                            0.47 
_refine.aniso_B[3][3]                            0.35 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            1.25 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.169 
_refine.pdbx_overall_ESU_R_Free                  0.160 
_refine.overall_SU_ML                            0.110 
_refine.overall_SU_B                             7.281 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4570 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         75 
_refine_hist.number_atoms_solvent             236 
_refine_hist.number_atoms_total               4881 
_refine_hist.d_res_high                       1.92 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.021  0.021  ? 4772 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.824  1.995  ? 6480 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.834  5.000  ? 594  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   33.050 21.373 ? 204  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   15.573 15.000 ? 773  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   18.174 15.000 ? 62   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.128  0.200  ? 727  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.008  0.020  ? 3596 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.218  0.200  ? 2007 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.306  0.200  ? 3311 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.160  0.200  ? 220  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.270  0.200  ? 51   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.167  0.200  ? 10   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.280  1.500  ? 3103 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.889  2.000  ? 4802 'X-RAY DIFFRACTION' ? 
r_scbond_it              3.510  3.000  ? 1849 'X-RAY DIFFRACTION' ? 
r_scangle_it             5.082  4.500  ? 1678 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.920 
_refine_ls_shell.d_res_low                        1.970 
_refine_ls_shell.number_reflns_R_work             3720 
_refine_ls_shell.R_factor_R_work                  0.266 
_refine_ls_shell.percent_reflns_obs               97.61 
_refine_ls_shell.R_factor_R_free                  0.355 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             199 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2GH0 
_struct.title                     'Growth factor/receptor complex' 
_struct.pdbx_descriptor           'artemin, GDNF family receptor alpha-3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GH0 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR' 
_struct_keywords.text            'cystine-knot, helix bundle, HORMONE-GROWTH FACTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 3 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 14  ? LEU A 16  ? ARG C 133 LEU C 135 5 ? 3  
HELX_P HELX_P2  2  CYS A 35  ? ARG A 39  ? CYS C 154 ARG C 158 5 ? 5  
HELX_P HELX_P3  3  SER A 40  ? ALA A 52  ? SER C 159 ALA C 171 1 ? 13 
HELX_P HELX_P4  4  ARG B 14  ? LEU B 16  ? ARG D 133 LEU D 135 5 ? 3  
HELX_P HELX_P5  5  SER B 40  ? GLY B 53  ? SER D 159 GLY D 172 1 ? 14 
HELX_P HELX_P6  6  ASP C 10  ? LEU C 21  ? ASP A 160 LEU A 171 1 ? 12 
HELX_P HELX_P7  7  ASN C 22  ? CYS C 36  ? ASN A 172 CYS A 186 1 ? 15 
HELX_P HELX_P8  8  GLN C 42  ? ALA C 57  ? GLN A 192 ALA A 207 1 ? 16 
HELX_P HELX_P9  9  ALA C 58  ? LEU C 67  ? ALA A 208 LEU A 217 1 ? 10 
HELX_P HELX_P10 10 ASP C 74  ? THR C 84  ? ASP A 224 THR A 234 1 ? 11 
HELX_P HELX_P11 11 ALA C 86  ? LEU C 91  ? ALA A 236 LEU A 241 1 ? 6  
HELX_P HELX_P12 12 ASN C 97  ? SER C 107 ? ASN A 247 SER A 257 1 ? 11 
HELX_P HELX_P13 13 ASP C 108 ? CYS C 122 ? ASP A 258 CYS A 272 1 ? 15 
HELX_P HELX_P14 14 GLU C 134 ? GLY C 144 ? GLU A 284 GLY A 294 1 ? 11 
HELX_P HELX_P15 15 SER C 171 ? ASN C 173 ? SER A 321 ASN A 323 5 ? 3  
HELX_P HELX_P16 16 LEU C 174 ? HIS C 187 ? LEU A 324 HIS A 337 1 ? 14 
HELX_P HELX_P17 17 ASN C 188 ? PHE C 206 ? ASN A 338 PHE A 356 1 ? 19 
HELX_P HELX_P18 18 ASP D 10  ? ASN D 22  ? ASP B 160 ASN B 172 1 ? 13 
HELX_P HELX_P19 19 ASN D 22  ? CYS D 36  ? ASN B 172 CYS B 186 1 ? 15 
HELX_P HELX_P20 20 GLN D 42  ? ALA D 57  ? GLN B 192 ALA B 207 1 ? 16 
HELX_P HELX_P21 21 ALA D 58  ? LEU D 67  ? ALA B 208 LEU B 217 1 ? 10 
HELX_P HELX_P22 22 ASP D 74  ? THR D 84  ? ASP B 224 THR B 234 1 ? 11 
HELX_P HELX_P23 23 ALA D 86  ? LEU D 91  ? ALA B 236 LEU B 241 1 ? 6  
HELX_P HELX_P24 24 ASN D 97  ? SER D 107 ? ASN B 247 SER B 257 1 ? 11 
HELX_P HELX_P25 25 ASP D 108 ? CYS D 122 ? ASP B 258 CYS B 272 1 ? 15 
HELX_P HELX_P26 26 GLU D 134 ? GLY D 144 ? GLU B 284 GLY B 294 1 ? 11 
HELX_P HELX_P27 27 SER D 171 ? ASN D 173 ? SER B 321 ASN B 323 5 ? 3  
HELX_P HELX_P28 28 LEU D 174 ? HIS D 187 ? LEU B 324 HIS B 337 1 ? 14 
HELX_P HELX_P29 29 ASN D 188 ? SER D 207 ? ASN B 338 SER B 357 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 4   SG  ? ? ? 1_555 A CYS 69  SG ? ? C CYS 123 C CYS 188  1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf2  disulf ? ? A CYS 31  SG  ? ? ? 1_555 A CYS 97  SG ? ? C CYS 150 C CYS 216  1_555 ? ? ? ? ? ? ? 2.006 ? 
disulf3  disulf ? ? A CYS 35  SG  ? ? ? 1_555 A CYS 99  SG ? ? C CYS 154 C CYS 218  1_555 ? ? ? ? ? ? ? 2.135 ? 
disulf4  disulf ? ? A CYS 68  SG  ? ? ? 1_555 B CYS 68  SG ? ? C CYS 187 D CYS 187  1_555 ? ? ? ? ? ? ? 2.083 ? 
disulf5  disulf ? ? B CYS 4   SG  ? ? ? 1_555 B CYS 69  SG ? ? D CYS 123 D CYS 188  1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf6  disulf ? ? B CYS 31  SG  ? ? ? 1_555 B CYS 97  SG ? ? D CYS 150 D CYS 216  1_555 ? ? ? ? ? ? ? 2.007 ? 
disulf7  disulf ? ? B CYS 35  SG  ? ? ? 1_555 B CYS 99  SG ? ? D CYS 154 D CYS 218  1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf8  disulf ? ? C CYS 12  SG  ? ? ? 1_555 C CYS 68  SG ? ? A CYS 162 A CYS 218  1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf9  disulf ? ? C CYS 19  SG  ? ? ? 1_555 C CYS 25  SG ? ? A CYS 169 A CYS 175  1_555 ? ? ? ? ? ? ? 2.097 ? 
disulf10 disulf ? ? C CYS 36  SG  ? ? ? 1_555 C CYS 46  SG ? ? A CYS 186 A CYS 196  1_555 ? ? ? ? ? ? ? 2.058 ? 
disulf11 disulf ? ? C CYS 41  SG  ? ? ? 1_555 C CYS 89  SG ? ? A CYS 191 A CYS 239  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf12 disulf ? ? C CYS 70  SG  ? ? ? 1_555 C CYS 77  SG ? ? A CYS 220 A CYS 227  1_555 ? ? ? ? ? ? ? 2.121 ? 
disulf13 disulf ? ? C CYS 98  SG  ? ? ? 1_555 C CYS 166 SG ? ? A CYS 248 A CYS 316  1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf14 disulf ? ? C CYS 105 SG  ? ? ? 1_555 C CYS 111 SG ? ? A CYS 255 A CYS 261  1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf15 disulf ? ? C CYS 122 SG  ? ? ? 1_555 C CYS 138 SG ? ? A CYS 272 A CYS 288  1_555 ? ? ? ? ? ? ? 2.157 ? 
disulf16 disulf ? ? C CYS 131 SG  ? ? ? 1_555 C CYS 190 SG ? ? A CYS 281 A CYS 340  1_555 ? ? ? ? ? ? ? 2.080 ? 
disulf17 disulf ? ? C CYS 168 SG  ? ? ? 1_555 C CYS 178 SG ? ? A CYS 318 A CYS 328  1_555 ? ? ? ? ? ? ? 2.105 ? 
disulf18 disulf ? ? D CYS 12  SG  ? ? ? 1_555 D CYS 68  SG ? ? B CYS 162 B CYS 218  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf19 disulf ? ? D CYS 19  SG  ? ? ? 1_555 D CYS 25  SG ? ? B CYS 169 B CYS 175  1_555 ? ? ? ? ? ? ? 2.083 ? 
disulf20 disulf ? ? D CYS 36  SG  ? ? ? 1_555 D CYS 46  SG ? ? B CYS 186 B CYS 196  1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf21 disulf ? ? D CYS 41  SG  ? ? ? 1_555 D CYS 89  SG ? ? B CYS 191 B CYS 239  1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf22 disulf ? ? D CYS 70  SG  ? ? ? 1_555 D CYS 77  SG ? ? B CYS 220 B CYS 227  1_555 ? ? ? ? ? ? ? 2.093 ? 
disulf23 disulf ? ? D CYS 98  SG  ? ? ? 1_555 D CYS 166 SG ? ? B CYS 248 B CYS 316  1_555 ? ? ? ? ? ? ? 1.984 ? 
disulf24 disulf ? ? D CYS 105 SG  ? ? ? 1_555 D CYS 111 SG ? ? B CYS 255 B CYS 261  1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf25 disulf ? ? D CYS 122 SG  ? ? ? 1_555 D CYS 138 SG ? ? B CYS 272 B CYS 288  1_555 ? ? ? ? ? ? ? 2.121 ? 
disulf26 disulf ? ? D CYS 131 SG  ? ? ? 1_555 D CYS 190 SG ? ? B CYS 281 B CYS 340  1_555 ? ? ? ? ? ? ? 2.082 ? 
disulf27 disulf ? ? D CYS 168 SG  ? ? ? 1_555 D CYS 178 SG ? ? B CYS 318 B CYS 328  1_555 ? ? ? ? ? ? ? 2.064 ? 
covale1  covale ? ? C ASN 159 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 309 A NAG 100  1_555 ? ? ? ? ? ? ? 1.442 ? 
covale2  covale ? ? D ASN 159 ND2 ? ? ? 1_555 J NAG .   C1 ? ? B ASN 309 B NAG 1100 1_555 ? ? ? ? ? ? ? 1.450 ? 
covale3  covale ? ? E NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? A NAG 100 A NAG 101  1_555 ? ? ? ? ? ? ? 1.366 ? 
covale4  covale ? ? F NAG .   O4  ? ? ? 1_555 G BMA .   C1 ? ? A NAG 101 A BMA 102  1_555 ? ? ? ? ? ? ? 1.469 ? 
covale5  covale ? ? G BMA .   O6  ? ? ? 1_555 H MAN .   C1 ? ? A BMA 102 A MAN 103  1_555 ? ? ? ? ? ? ? 1.422 ? 
covale6  covale ? ? G BMA .   O3  ? ? ? 1_555 I MAN .   C1 ? ? A BMA 102 A MAN 104  1_555 ? ? ? ? ? ? ? 1.456 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 5   ? PRO A 12  ? ARG C 124 PRO C 131 
A 2 LEU A 25  ? SER A 32  ? LEU C 144 SER C 151 
B 1 CYS A 68  ? MET A 80  ? CYS C 187 MET C 199 
B 2 TRP A 86  ? LEU A 100 ? TRP C 205 LEU C 219 
C 1 ARG B 5   ? PRO B 12  ? ARG D 124 PRO D 131 
C 2 LEU B 25  ? SER B 32  ? LEU D 144 SER D 151 
D 1 CYS B 68  ? MET B 80  ? CYS D 187 MET D 199 
D 2 TRP B 86  ? LEU B 100 ? TRP D 205 LEU D 219 
E 1 PRO C 152 ? PHE C 154 ? PRO A 302 PHE A 304 
E 2 VAL C 162 ? LEU C 164 ? VAL A 312 LEU A 314 
F 1 PRO D 152 ? PHE D 154 ? PRO B 302 PHE B 304 
F 2 VAL D 162 ? LEU D 164 ? VAL B 312 LEU B 314 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 9   ? N GLN C 128 O PHE A 28  ? O PHE C 147 
B 1 2 N CYS A 68  ? N CYS C 187 O LEU A 100 ? O LEU C 219 
C 1 2 N ARG B 7   ? N ARG D 126 O PHE B 30  ? O PHE D 149 
D 1 2 N GLU B 75  ? N GLU D 194 O SER B 93  ? O SER D 212 
E 1 2 N ASN C 153 ? N ASN A 303 O ALA C 163 ? O ALA A 313 
F 1 2 N ASN D 153 ? N ASN B 303 O ALA D 163 ? O ALA B 313 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NAG A 100'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NAG A 101'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BMA A 102'  
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MAN A 103'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MAN A 104'  
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NAG B 1100' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 NAG F .   ? NAG A 101 . ? 1_555 ? 
2  AC1 6 SER C 156 ? SER A 306 . ? 1_555 ? 
3  AC1 6 ASN C 159 ? ASN A 309 . ? 1_555 ? 
4  AC1 6 SER C 161 ? SER A 311 . ? 1_555 ? 
5  AC1 6 HOH M .   ? HOH A 435 . ? 1_555 ? 
6  AC1 6 HOH M .   ? HOH A 472 . ? 1_555 ? 
7  AC2 6 NAG E .   ? NAG A 100 . ? 1_555 ? 
8  AC2 6 BMA G .   ? BMA A 102 . ? 1_555 ? 
9  AC2 6 HOH M .   ? HOH A 435 . ? 1_555 ? 
10 AC2 6 HOH M .   ? HOH A 436 . ? 1_555 ? 
11 AC2 6 HOH M .   ? HOH A 451 . ? 1_555 ? 
12 AC2 6 HOH M .   ? HOH A 472 . ? 1_555 ? 
13 AC3 4 NAG F .   ? NAG A 101 . ? 1_555 ? 
14 AC3 4 MAN H .   ? MAN A 103 . ? 1_555 ? 
15 AC3 4 MAN I .   ? MAN A 104 . ? 1_555 ? 
16 AC3 4 PRO C 60  ? PRO A 210 . ? 1_565 ? 
17 AC4 5 BMA G .   ? BMA A 102 . ? 1_555 ? 
18 AC4 5 ASN C 22  ? ASN A 172 . ? 1_565 ? 
19 AC4 5 LYS C 24  ? LYS A 174 . ? 1_565 ? 
20 AC4 5 HIS C 61  ? HIS A 211 . ? 1_565 ? 
21 AC4 5 HOH M .   ? HOH A 436 . ? 1_555 ? 
22 AC5 4 BMA G .   ? BMA A 102 . ? 1_555 ? 
23 AC5 4 GLU C 59  ? GLU A 209 . ? 1_565 ? 
24 AC5 4 ARG C 140 ? ARG A 290 . ? 1_565 ? 
25 AC5 4 HOH M .   ? HOH A 445 . ? 1_565 ? 
26 AC6 4 VAL D 155 ? VAL B 305 . ? 1_555 ? 
27 AC6 4 SER D 156 ? SER B 306 . ? 1_555 ? 
28 AC6 4 ASN D 159 ? ASN B 309 . ? 1_555 ? 
29 AC6 4 SER D 161 ? SER B 311 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2GH0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GH0 
_atom_sites.fract_transf_matrix[1][1]   0.013573 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003274 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024120 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008582 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 17.446  -17.750 -40.965 1.00 45.94 ? 120  ASP C N   1 
ATOM   2    C CA  . ASP A 1 1   ? 17.110  -17.928 -39.512 1.00 45.71 ? 120  ASP C CA  1 
ATOM   3    C C   . ASP A 1 1   ? 15.965  -17.003 -39.118 1.00 44.71 ? 120  ASP C C   1 
ATOM   4    O O   . ASP A 1 1   ? 16.166  -15.798 -38.930 1.00 44.35 ? 120  ASP C O   1 
ATOM   5    C CB  . ASP A 1 1   ? 18.330  -17.641 -38.621 1.00 46.35 ? 120  ASP C CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 18.099  -18.038 -37.152 1.00 48.52 ? 120  ASP C CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 16.962  -18.419 -36.794 1.00 48.84 ? 120  ASP C OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 19.070  -17.971 -36.356 1.00 51.12 ? 120  ASP C OD2 1 
ATOM   9    N N   . PRO A 1 2   ? 14.755  -17.560 -39.009 1.00 44.03 ? 121  PRO C N   1 
ATOM   10   C CA  . PRO A 1 2   ? 13.552  -16.838 -38.601 1.00 42.63 ? 121  PRO C CA  1 
ATOM   11   C C   . PRO A 1 2   ? 13.450  -16.539 -37.086 1.00 41.56 ? 121  PRO C C   1 
ATOM   12   O O   . PRO A 1 2   ? 12.493  -15.892 -36.662 1.00 40.95 ? 121  PRO C O   1 
ATOM   13   C CB  . PRO A 1 2   ? 12.445  -17.799 -39.014 1.00 42.72 ? 121  PRO C CB  1 
ATOM   14   C CG  . PRO A 1 2   ? 13.049  -19.105 -38.817 1.00 43.57 ? 121  PRO C CG  1 
ATOM   15   C CD  . PRO A 1 2   ? 14.447  -18.960 -39.325 1.00 43.86 ? 121  PRO C CD  1 
ATOM   16   N N   . GLY A 1 3   ? 14.391  -17.053 -36.290 1.00 40.06 ? 122  GLY C N   1 
ATOM   17   C CA  . GLY A 1 3   ? 14.434  -16.767 -34.859 1.00 38.07 ? 122  GLY C CA  1 
ATOM   18   C C   . GLY A 1 3   ? 14.932  -15.358 -34.608 1.00 37.07 ? 122  GLY C C   1 
ATOM   19   O O   . GLY A 1 3   ? 15.732  -14.818 -35.390 1.00 35.84 ? 122  GLY C O   1 
ATOM   20   N N   . CYS A 1 4   ? 14.482  -14.765 -33.508 1.00 35.97 ? 123  CYS C N   1 
ATOM   21   C CA  . CYS A 1 4   ? 14.850  -13.384 -33.179 1.00 34.72 ? 123  CYS C CA  1 
ATOM   22   C C   . CYS A 1 4   ? 16.342  -13.167 -33.296 1.00 34.11 ? 123  CYS C C   1 
ATOM   23   O O   . CYS A 1 4   ? 17.130  -13.893 -32.698 1.00 32.97 ? 123  CYS C O   1 
ATOM   24   C CB  . CYS A 1 4   ? 14.398  -13.069 -31.743 1.00 36.05 ? 123  CYS C CB  1 
ATOM   25   S SG  . CYS A 1 4   ? 14.884  -11.475 -31.172 1.00 37.30 ? 123  CYS C SG  1 
ATOM   26   N N   . ARG A 1 5   ? 16.743  -12.210 -34.131 1.00 34.12 ? 124  ARG C N   1 
ATOM   27   C CA  . ARG A 1 5   ? 18.159  -11.845 -34.260 1.00 34.78 ? 124  ARG C CA  1 
ATOM   28   C C   . ARG A 1 5   ? 18.326  -10.463 -34.893 1.00 33.55 ? 124  ARG C C   1 
ATOM   29   O O   . ARG A 1 5   ? 17.364  -9.849  -35.404 1.00 31.62 ? 124  ARG C O   1 
ATOM   30   C CB  . ARG A 1 5   ? 18.937  -12.901 -35.059 1.00 35.38 ? 124  ARG C CB  1 
ATOM   31   C CG  . ARG A 1 5   ? 18.448  -13.095 -36.484 1.00 36.87 ? 124  ARG C CG  1 
ATOM   32   C CD  . ARG A 1 5   ? 19.354  -14.049 -37.256 1.00 38.88 ? 124  ARG C CD  1 
ATOM   33   N NE  . ARG A 1 5   ? 20.668  -13.462 -37.536 1.00 48.36 ? 124  ARG C NE  1 
ATOM   34   C CZ  . ARG A 1 5   ? 21.431  -13.758 -38.594 1.00 51.68 ? 124  ARG C CZ  1 
ATOM   35   N NH1 . ARG A 1 5   ? 21.018  -14.628 -39.515 1.00 53.42 ? 124  ARG C NH1 1 
ATOM   36   N NH2 . ARG A 1 5   ? 22.612  -13.166 -38.741 1.00 53.16 ? 124  ARG C NH2 1 
ATOM   37   N N   . LEU A 1 6   ? 19.559  -9.977  -34.799 1.00 32.74 ? 125  LEU C N   1 
ATOM   38   C CA  . LEU A 1 6   ? 19.985  -8.733  -35.398 1.00 32.64 ? 125  LEU C CA  1 
ATOM   39   C C   . LEU A 1 6   ? 20.128  -8.880  -36.901 1.00 33.02 ? 125  LEU C C   1 
ATOM   40   O O   . LEU A 1 6   ? 20.835  -9.803  -37.399 1.00 33.04 ? 125  LEU C O   1 
ATOM   41   C CB  . LEU A 1 6   ? 21.329  -8.299  -34.787 1.00 31.68 ? 125  LEU C CB  1 
ATOM   42   C CG  . LEU A 1 6   ? 21.935  -6.944  -35.167 1.00 34.15 ? 125  LEU C CG  1 
ATOM   43   C CD1 . LEU A 1 6   ? 21.154  -5.826  -34.501 1.00 32.74 ? 125  LEU C CD1 1 
ATOM   44   C CD2 . LEU A 1 6   ? 23.411  -6.882  -34.762 1.00 33.03 ? 125  LEU C CD2 1 
ATOM   45   N N   . ARG A 1 7   ? 19.484  -7.954  -37.622 1.00 32.07 ? 126  ARG C N   1 
ATOM   46   C CA  . ARG A 1 7   ? 19.485  -7.943  -39.073 1.00 30.96 ? 126  ARG C CA  1 
ATOM   47   C C   . ARG A 1 7   ? 20.074  -6.611  -39.496 1.00 32.03 ? 126  ARG C C   1 
ATOM   48   O O   . ARG A 1 7   ? 20.010  -5.629  -38.725 1.00 31.05 ? 126  ARG C O   1 
ATOM   49   C CB  . ARG A 1 7   ? 18.052  -7.997  -39.631 1.00 32.32 ? 126  ARG C CB  1 
ATOM   50   C CG  . ARG A 1 7   ? 17.003  -8.848  -38.862 1.00 34.42 ? 126  ARG C CG  1 
ATOM   51   C CD  . ARG A 1 7   ? 17.029  -10.224 -39.350 1.00 31.61 ? 126  ARG C CD  1 
ATOM   52   N NE  . ARG A 1 7   ? 16.043  -11.091 -38.672 1.00 28.76 ? 126  ARG C NE  1 
ATOM   53   C CZ  . ARG A 1 7   ? 15.996  -12.398 -38.876 1.00 31.51 ? 126  ARG C CZ  1 
ATOM   54   N NH1 . ARG A 1 7   ? 16.866  -12.933 -39.737 1.00 33.29 ? 126  ARG C NH1 1 
ATOM   55   N NH2 . ARG A 1 7   ? 15.103  -13.154 -38.228 1.00 30.76 ? 126  ARG C NH2 1 
ATOM   56   N N   . SER A 1 8   ? 20.634  -6.583  -40.712 1.00 32.69 ? 127  SER C N   1 
ATOM   57   C CA  . SER A 1 8   ? 21.338  -5.412  -41.223 1.00 34.52 ? 127  SER C CA  1 
ATOM   58   C C   . SER A 1 8   ? 20.907  -5.167  -42.654 1.00 34.16 ? 127  SER C C   1 
ATOM   59   O O   . SER A 1 8   ? 20.762  -6.104  -43.423 1.00 34.62 ? 127  SER C O   1 
ATOM   60   C CB  . SER A 1 8   ? 22.856  -5.588  -41.143 1.00 34.93 ? 127  SER C CB  1 
ATOM   61   O OG  . SER A 1 8   ? 23.518  -4.385  -41.519 1.00 39.33 ? 127  SER C OG  1 
ATOM   62   N N   . GLN A 1 9   ? 20.640  -3.909  -42.980 1.00 33.71 ? 128  GLN C N   1 
ATOM   63   C CA  . GLN A 1 9   ? 20.347  -3.504  -44.348 1.00 34.62 ? 128  GLN C CA  1 
ATOM   64   C C   . GLN A 1 9   ? 20.898  -2.116  -44.655 1.00 33.67 ? 128  GLN C C   1 
ATOM   65   O O   . GLN A 1 9   ? 20.872  -1.248  -43.836 1.00 33.92 ? 128  GLN C O   1 
ATOM   66   C CB  . GLN A 1 9   ? 18.869  -3.491  -44.688 1.00 33.75 ? 128  GLN C CB  1 
ATOM   67   C CG  . GLN A 1 9   ? 18.760  -3.414  -46.206 1.00 39.70 ? 128  GLN C CG  1 
ATOM   68   C CD  . GLN A 1 9   ? 17.396  -3.644  -46.782 1.00 45.57 ? 128  GLN C CD  1 
ATOM   69   O OE1 . GLN A 1 9   ? 16.502  -4.226  -46.144 1.00 46.53 ? 128  GLN C OE1 1 
ATOM   70   N NE2 . GLN A 1 9   ? 17.221  -3.187  -48.031 1.00 47.36 ? 128  GLN C NE2 1 
ATOM   71   N N   . LEU A 1 10  ? 21.388  -1.951  -45.866 1.00 33.91 ? 129  LEU C N   1 
ATOM   72   C CA  . LEU A 1 10  ? 21.877  -0.662  -46.377 1.00 33.94 ? 129  LEU C CA  1 
ATOM   73   C C   . LEU A 1 10  ? 20.639  0.088   -46.883 1.00 34.25 ? 129  LEU C C   1 
ATOM   74   O O   . LEU A 1 10  ? 19.904  -0.423  -47.757 1.00 33.25 ? 129  LEU C O   1 
ATOM   75   C CB  . LEU A 1 10  ? 22.810  -0.924  -47.571 1.00 33.90 ? 129  LEU C CB  1 
ATOM   76   C CG  . LEU A 1 10  ? 23.684  0.286   -47.843 1.00 36.24 ? 129  LEU C CG  1 
ATOM   77   C CD1 . LEU A 1 10  ? 24.702  0.402   -46.734 1.00 36.05 ? 129  LEU C CD1 1 
ATOM   78   C CD2 . LEU A 1 10  ? 24.331  0.163   -49.207 1.00 39.08 ? 129  LEU C CD2 1 
ATOM   79   N N   . VAL A 1 11  ? 20.393  1.263   -46.326 1.00 32.92 ? 130  VAL C N   1 
ATOM   80   C CA  . VAL A 1 11  ? 19.198  2.044   -46.673 1.00 33.63 ? 130  VAL C CA  1 
ATOM   81   C C   . VAL A 1 11  ? 19.566  3.518   -46.971 1.00 33.90 ? 130  VAL C C   1 
ATOM   82   O O   . VAL A 1 11  ? 20.568  4.020   -46.436 1.00 34.12 ? 130  VAL C O   1 
ATOM   83   C CB  . VAL A 1 11  ? 18.147  1.989   -45.509 1.00 33.71 ? 130  VAL C CB  1 
ATOM   84   C CG1 . VAL A 1 11  ? 17.740  0.546   -45.213 1.00 32.80 ? 130  VAL C CG1 1 
ATOM   85   C CG2 . VAL A 1 11  ? 18.674  2.666   -44.210 1.00 34.47 ? 130  VAL C CG2 1 
ATOM   86   N N   . PRO A 1 12  ? 18.759  4.203   -47.795 1.00 33.90 ? 131  PRO C N   1 
ATOM   87   C CA  . PRO A 1 12  ? 18.965  5.620   -48.048 1.00 33.86 ? 131  PRO C CA  1 
ATOM   88   C C   . PRO A 1 12  ? 18.726  6.381   -46.748 1.00 33.85 ? 131  PRO C C   1 
ATOM   89   O O   . PRO A 1 12  ? 17.730  6.112   -46.071 1.00 32.72 ? 131  PRO C O   1 
ATOM   90   C CB  . PRO A 1 12  ? 17.844  5.962   -49.024 1.00 34.25 ? 131  PRO C CB  1 
ATOM   91   C CG  . PRO A 1 12  ? 17.361  4.690   -49.583 1.00 34.48 ? 131  PRO C CG  1 
ATOM   92   C CD  . PRO A 1 12  ? 17.606  3.663   -48.548 1.00 34.40 ? 131  PRO C CD  1 
ATOM   93   N N   . VAL A 1 13  ? 19.625  7.298   -46.374 1.00 33.03 ? 132  VAL C N   1 
ATOM   94   C CA  . VAL A 1 13  ? 19.383  8.184   -45.204 1.00 32.17 ? 132  VAL C CA  1 
ATOM   95   C C   . VAL A 1 13  ? 18.016  8.884   -45.361 1.00 32.57 ? 132  VAL C C   1 
ATOM   96   O O   . VAL A 1 13  ? 17.303  9.127   -44.371 1.00 31.43 ? 132  VAL C O   1 
ATOM   97   C CB  . VAL A 1 13  ? 20.518  9.229   -44.997 1.00 32.18 ? 132  VAL C CB  1 
ATOM   98   C CG1 . VAL A 1 13  ? 20.128  10.256  -43.930 1.00 33.33 ? 132  VAL C CG1 1 
ATOM   99   C CG2 . VAL A 1 13  ? 21.818  8.551   -44.587 1.00 33.13 ? 132  VAL C CG2 1 
ATOM   100  N N   . ARG A 1 14  ? 17.644  9.172   -46.610 1.00 33.66 ? 133  ARG C N   1 
ATOM   101  C CA  . ARG A 1 14  ? 16.366  9.802   -46.947 1.00 35.73 ? 133  ARG C CA  1 
ATOM   102  C C   . ARG A 1 14  ? 15.116  9.015   -46.519 1.00 35.40 ? 133  ARG C C   1 
ATOM   103  O O   . ARG A 1 14  ? 14.030  9.584   -46.477 1.00 36.11 ? 133  ARG C O   1 
ATOM   104  C CB  . ARG A 1 14  ? 16.276  10.149  -48.446 1.00 34.91 ? 133  ARG C CB  1 
ATOM   105  C CG  . ARG A 1 14  ? 16.935  11.476  -48.743 1.00 40.27 ? 133  ARG C CG  1 
ATOM   106  C CD  . ARG A 1 14  ? 17.116  11.763  -50.228 1.00 40.16 ? 133  ARG C CD  1 
ATOM   107  N NE  . ARG A 1 14  ? 17.674  13.105  -50.438 1.00 48.19 ? 133  ARG C NE  1 
ATOM   108  C CZ  . ARG A 1 14  ? 18.436  13.446  -51.478 1.00 52.86 ? 133  ARG C CZ  1 
ATOM   109  N NH1 . ARG A 1 14  ? 18.758  12.527  -52.396 1.00 55.24 ? 133  ARG C NH1 1 
ATOM   110  N NH2 . ARG A 1 14  ? 18.899  14.699  -51.601 1.00 53.55 ? 133  ARG C NH2 1 
ATOM   111  N N   . ALA A 1 15  ? 15.254  7.730   -46.202 1.00 34.84 ? 134  ALA C N   1 
ATOM   112  C CA  . ALA A 1 15  ? 14.077  6.928   -45.893 1.00 34.12 ? 134  ALA C CA  1 
ATOM   113  C C   . ALA A 1 15  ? 13.940  6.806   -44.385 1.00 34.44 ? 134  ALA C C   1 
ATOM   114  O O   . ALA A 1 15  ? 12.996  6.209   -43.895 1.00 34.44 ? 134  ALA C O   1 
ATOM   115  C CB  . ALA A 1 15  ? 14.178  5.558   -46.557 1.00 33.06 ? 134  ALA C CB  1 
ATOM   116  N N   . LEU A 1 16  ? 14.908  7.360   -43.646 1.00 34.89 ? 135  LEU C N   1 
ATOM   117  C CA  . LEU A 1 16  ? 14.930  7.235   -42.168 1.00 35.08 ? 135  LEU C CA  1 
ATOM   118  C C   . LEU A 1 16  ? 14.018  8.220   -41.429 1.00 36.32 ? 135  LEU C C   1 
ATOM   119  O O   . LEU A 1 16  ? 13.883  8.131   -40.214 1.00 36.29 ? 135  LEU C O   1 
ATOM   120  C CB  . LEU A 1 16  ? 16.362  7.392   -41.629 1.00 34.64 ? 135  LEU C CB  1 
ATOM   121  C CG  . LEU A 1 16  ? 17.398  6.324   -41.954 1.00 32.90 ? 135  LEU C CG  1 
ATOM   122  C CD1 . LEU A 1 16  ? 18.759  6.830   -41.498 1.00 33.18 ? 135  LEU C CD1 1 
ATOM   123  C CD2 . LEU A 1 16  ? 17.025  5.049   -41.204 1.00 33.41 ? 135  LEU C CD2 1 
ATOM   124  N N   . GLY A 1 17  ? 13.418  9.157   -42.166 1.00 37.10 ? 136  GLY C N   1 
ATOM   125  C CA  . GLY A 1 17  ? 12.526  10.176  -41.607 1.00 39.01 ? 136  GLY C CA  1 
ATOM   126  C C   . GLY A 1 17  ? 13.158  11.154  -40.635 1.00 39.90 ? 136  GLY C C   1 
ATOM   127  O O   . GLY A 1 17  ? 12.536  11.554  -39.647 1.00 40.11 ? 136  GLY C O   1 
ATOM   128  N N   . LEU A 1 18  ? 14.384  11.566  -40.936 1.00 41.24 ? 137  LEU C N   1 
ATOM   129  C CA  . LEU A 1 18  ? 15.186  12.382  -40.021 1.00 42.37 ? 137  LEU C CA  1 
ATOM   130  C C   . LEU A 1 18  ? 15.102  13.889  -40.198 1.00 42.71 ? 137  LEU C C   1 
ATOM   131  O O   . LEU A 1 18  ? 15.595  14.634  -39.344 1.00 44.52 ? 137  LEU C O   1 
ATOM   132  C CB  . LEU A 1 18  ? 16.668  11.997  -40.122 1.00 42.47 ? 137  LEU C CB  1 
ATOM   133  C CG  . LEU A 1 18  ? 17.099  10.596  -39.727 1.00 42.78 ? 137  LEU C CG  1 
ATOM   134  C CD1 . LEU A 1 18  ? 18.595  10.447  -40.050 1.00 41.01 ? 137  LEU C CD1 1 
ATOM   135  C CD2 . LEU A 1 18  ? 16.803  10.312  -38.263 1.00 45.19 ? 137  LEU C CD2 1 
ATOM   136  N N   . GLY A 1 19  ? 14.559  14.383  -41.295 1.00 42.17 ? 138  GLY C N   1 
ATOM   137  C CA  . GLY A 1 19  ? 14.671  15.854  -41.485 1.00 42.70 ? 138  GLY C CA  1 
ATOM   138  C C   . GLY A 1 19  ? 16.038  16.440  -41.869 1.00 41.76 ? 138  GLY C C   1 
ATOM   139  O O   . GLY A 1 19  ? 16.067  17.485  -42.542 1.00 42.75 ? 138  GLY C O   1 
ATOM   140  N N   . HIS A 1 20  ? 17.165  15.835  -41.443 1.00 40.77 ? 139  HIS C N   1 
ATOM   141  C CA  . HIS A 1 20  ? 18.463  16.091  -42.141 1.00 39.89 ? 139  HIS C CA  1 
ATOM   142  C C   . HIS A 1 20  ? 18.333  15.432  -43.497 1.00 38.28 ? 139  HIS C C   1 
ATOM   143  O O   . HIS A 1 20  ? 17.854  14.297  -43.605 1.00 39.18 ? 139  HIS C O   1 
ATOM   144  C CB  . HIS A 1 20  ? 19.698  15.447  -41.473 1.00 40.53 ? 139  HIS C CB  1 
ATOM   145  C CG  . HIS A 1 20  ? 20.110  16.082  -40.179 1.00 41.97 ? 139  HIS C CG  1 
ATOM   146  N ND1 . HIS A 1 20  ? 20.394  17.424  -40.064 1.00 44.52 ? 139  HIS C ND1 1 
ATOM   147  C CD2 . HIS A 1 20  ? 20.301  15.549  -38.948 1.00 43.84 ? 139  HIS C CD2 1 
ATOM   148  C CE1 . HIS A 1 20  ? 20.716  17.701  -38.812 1.00 45.67 ? 139  HIS C CE1 1 
ATOM   149  N NE2 . HIS A 1 20  ? 20.681  16.578  -38.117 1.00 44.85 ? 139  HIS C NE2 1 
ATOM   150  N N   . ARG A 1 21  ? 18.755  16.150  -44.519 1.00 35.78 ? 140  ARG C N   1 
ATOM   151  C CA  . ARG A 1 21  ? 18.748  15.666  -45.880 1.00 33.63 ? 140  ARG C CA  1 
ATOM   152  C C   . ARG A 1 21  ? 20.168  15.192  -46.190 1.00 31.53 ? 140  ARG C C   1 
ATOM   153  O O   . ARG A 1 21  ? 21.128  15.901  -45.903 1.00 29.28 ? 140  ARG C O   1 
ATOM   154  C CB  . ARG A 1 21  ? 18.357  16.815  -46.805 1.00 33.95 ? 140  ARG C CB  1 
ATOM   155  C CG  . ARG A 1 21  ? 16.864  17.166  -46.669 1.00 33.72 ? 140  ARG C CG  1 
ATOM   156  C CD  . ARG A 1 21  ? 16.455  18.333  -47.566 1.00 35.81 ? 140  ARG C CD  1 
ATOM   157  N NE  . ARG A 1 21  ? 14.995  18.479  -47.551 1.00 39.12 ? 140  ARG C NE  1 
ATOM   158  C CZ  . ARG A 1 21  ? 14.325  19.493  -48.102 1.00 41.08 ? 140  ARG C CZ  1 
ATOM   159  N NH1 . ARG A 1 21  ? 14.981  20.469  -48.730 1.00 42.76 ? 140  ARG C NH1 1 
ATOM   160  N NH2 . ARG A 1 21  ? 12.993  19.534  -48.030 1.00 39.35 ? 140  ARG C NH2 1 
ATOM   161  N N   . SER A 1 22  ? 20.267  13.999  -46.775 1.00 29.97 ? 141  SER C N   1 
ATOM   162  C CA  . SER A 1 22  ? 21.546  13.407  -47.161 1.00 29.98 ? 141  SER C CA  1 
ATOM   163  C C   . SER A 1 22  ? 21.390  12.583  -48.433 1.00 29.63 ? 141  SER C C   1 
ATOM   164  O O   . SER A 1 22  ? 20.301  12.079  -48.708 1.00 30.09 ? 141  SER C O   1 
ATOM   165  C CB  . SER A 1 22  ? 22.097  12.510  -46.050 1.00 29.89 ? 141  SER C CB  1 
ATOM   166  O OG  . SER A 1 22  ? 23.313  11.932  -46.504 1.00 29.80 ? 141  SER C OG  1 
ATOM   167  N N   . ASP A 1 23  ? 22.457  12.465  -49.214 1.00 29.22 ? 142  ASP C N   1 
ATOM   168  C CA  . ASP A 1 23  ? 22.443  11.598  -50.393 1.00 30.08 ? 142  ASP C CA  1 
ATOM   169  C C   . ASP A 1 23  ? 23.075  10.242  -50.086 1.00 30.59 ? 142  ASP C C   1 
ATOM   170  O O   . ASP A 1 23  ? 23.079  9.339   -50.948 1.00 30.03 ? 142  ASP C O   1 
ATOM   171  C CB  . ASP A 1 23  ? 23.143  12.254  -51.571 1.00 30.68 ? 142  ASP C CB  1 
ATOM   172  C CG  . ASP A 1 23  ? 22.390  13.472  -52.110 1.00 33.41 ? 142  ASP C CG  1 
ATOM   173  O OD1 . ASP A 1 23  ? 23.035  14.429  -52.577 1.00 37.44 ? 142  ASP C OD1 1 
ATOM   174  O OD2 . ASP A 1 23  ? 21.157  13.481  -52.024 1.00 39.32 ? 142  ASP C OD2 1 
ATOM   175  N N   . GLU A 1 24  ? 23.543  10.076  -48.847 1.00 29.03 ? 143  GLU C N   1 
ATOM   176  C CA  . GLU A 1 24  ? 24.209  8.845   -48.442 1.00 29.26 ? 143  GLU C CA  1 
ATOM   177  C C   . GLU A 1 24  ? 23.286  7.649   -48.152 1.00 29.47 ? 143  GLU C C   1 
ATOM   178  O O   . GLU A 1 24  ? 22.058  7.801   -47.932 1.00 29.05 ? 143  GLU C O   1 
ATOM   179  C CB  . GLU A 1 24  ? 25.132  9.093   -47.248 1.00 29.28 ? 143  GLU C CB  1 
ATOM   180  C CG  . GLU A 1 24  ? 26.228  10.140  -47.585 1.00 29.83 ? 143  GLU C CG  1 
ATOM   181  C CD  . GLU A 1 24  ? 27.309  10.269  -46.497 1.00 28.90 ? 143  GLU C CD  1 
ATOM   182  O OE1 . GLU A 1 24  ? 27.216  9.565   -45.503 1.00 28.67 ? 143  GLU C OE1 1 
ATOM   183  O OE2 . GLU A 1 24  ? 28.245  11.077  -46.670 1.00 28.34 ? 143  GLU C OE2 1 
ATOM   184  N N   . LEU A 1 25  ? 23.897  6.461   -48.161 1.00 28.85 ? 144  LEU C N   1 
ATOM   185  C CA  . LEU A 1 25  ? 23.267  5.243   -47.660 1.00 29.23 ? 144  LEU C CA  1 
ATOM   186  C C   . LEU A 1 25  ? 23.957  4.900   -46.394 1.00 29.72 ? 144  LEU C C   1 
ATOM   187  O O   . LEU A 1 25  ? 25.158  5.235   -46.242 1.00 29.11 ? 144  LEU C O   1 
ATOM   188  C CB  . LEU A 1 25  ? 23.435  4.082   -48.664 1.00 29.86 ? 144  LEU C CB  1 
ATOM   189  C CG  . LEU A 1 25  ? 23.105  4.432   -50.127 1.00 31.10 ? 144  LEU C CG  1 
ATOM   190  C CD1 . LEU A 1 25  ? 23.831  3.486   -51.072 1.00 34.56 ? 144  LEU C CD1 1 
ATOM   191  C CD2 . LEU A 1 25  ? 21.622  4.344   -50.331 1.00 36.27 ? 144  LEU C CD2 1 
ATOM   192  N N   . VAL A 1 26  ? 23.209  4.318   -45.448 1.00 28.46 ? 145  VAL C N   1 
ATOM   193  C CA  . VAL A 1 26  ? 23.799  3.886   -44.178 1.00 30.66 ? 145  VAL C CA  1 
ATOM   194  C C   . VAL A 1 26  ? 23.401  2.461   -43.916 1.00 31.31 ? 145  VAL C C   1 
ATOM   195  O O   . VAL A 1 26  ? 22.341  2.056   -44.364 1.00 32.89 ? 145  VAL C O   1 
ATOM   196  C CB  . VAL A 1 26  ? 23.412  4.742   -42.952 1.00 29.27 ? 145  VAL C CB  1 
ATOM   197  C CG1 . VAL A 1 26  ? 24.145  6.088   -43.032 1.00 25.63 ? 145  VAL C CG1 1 
ATOM   198  C CG2 . VAL A 1 26  ? 21.913  4.938   -42.845 1.00 30.94 ? 145  VAL C CG2 1 
ATOM   199  N N   . ARG A 1 27  ? 24.216  1.731   -43.160 1.00 32.58 ? 146  ARG C N   1 
ATOM   200  C CA  . ARG A 1 27  ? 23.781  0.427   -42.672 1.00 34.08 ? 146  ARG C CA  1 
ATOM   201  C C   . ARG A 1 27  ? 22.839  0.699   -41.505 1.00 34.00 ? 146  ARG C C   1 
ATOM   202  O O   . ARG A 1 27  ? 23.198  1.417   -40.579 1.00 34.53 ? 146  ARG C O   1 
ATOM   203  C CB  . ARG A 1 27  ? 24.970  -0.379  -42.193 1.00 35.26 ? 146  ARG C CB  1 
ATOM   204  C CG  . ARG A 1 27  ? 25.763  -0.904  -43.324 1.00 40.17 ? 146  ARG C CG  1 
ATOM   205  C CD  . ARG A 1 27  ? 26.577  -2.140  -42.995 1.00 43.94 ? 146  ARG C CD  1 
ATOM   206  N NE  . ARG A 1 27  ? 27.714  -2.173  -43.925 1.00 44.49 ? 146  ARG C NE  1 
ATOM   207  C CZ  . ARG A 1 27  ? 28.672  -3.077  -43.875 1.00 43.92 ? 146  ARG C CZ  1 
ATOM   208  N NH1 . ARG A 1 27  ? 28.666  -4.027  -42.925 1.00 45.35 ? 146  ARG C NH1 1 
ATOM   209  N NH2 . ARG A 1 27  ? 29.622  -3.054  -44.776 1.00 43.88 ? 146  ARG C NH2 1 
ATOM   210  N N   . PHE A 1 28  ? 21.628  0.174   -41.576 1.00 33.10 ? 147  PHE C N   1 
ATOM   211  C CA  . PHE A 1 28  ? 20.702  0.290   -40.462 1.00 33.21 ? 147  PHE C CA  1 
ATOM   212  C C   . PHE A 1 28  ? 20.436  -1.172  -39.978 1.00 33.21 ? 147  PHE C C   1 
ATOM   213  O O   . PHE A 1 28  ? 20.188  -2.022  -40.794 1.00 32.38 ? 147  PHE C O   1 
ATOM   214  C CB  . PHE A 1 28  ? 19.413  0.921   -40.970 1.00 33.62 ? 147  PHE C CB  1 
ATOM   215  C CG  . PHE A 1 28  ? 18.394  1.140   -39.911 1.00 33.71 ? 147  PHE C CG  1 
ATOM   216  C CD1 . PHE A 1 28  ? 18.467  2.272   -39.087 1.00 32.54 ? 147  PHE C CD1 1 
ATOM   217  C CD2 . PHE A 1 28  ? 17.317  0.265   -39.773 1.00 38.83 ? 147  PHE C CD2 1 
ATOM   218  C CE1 . PHE A 1 28  ? 17.501  2.496   -38.142 1.00 34.54 ? 147  PHE C CE1 1 
ATOM   219  C CE2 . PHE A 1 28  ? 16.353  0.494   -38.770 1.00 34.49 ? 147  PHE C CE2 1 
ATOM   220  C CZ  . PHE A 1 28  ? 16.485  1.608   -37.960 1.00 33.67 ? 147  PHE C CZ  1 
ATOM   221  N N   . ARG A 1 29  ? 20.509  -1.402  -38.664 1.00 32.69 ? 148  ARG C N   1 
ATOM   222  C CA  . ARG A 1 29  ? 20.365  -2.703  -38.049 1.00 33.59 ? 148  ARG C CA  1 
ATOM   223  C C   . ARG A 1 29  ? 19.133  -2.651  -37.119 1.00 33.53 ? 148  ARG C C   1 
ATOM   224  O O   . ARG A 1 29  ? 18.857  -1.632  -36.499 1.00 35.11 ? 148  ARG C O   1 
ATOM   225  C CB  . ARG A 1 29  ? 21.600  -3.112  -37.241 1.00 33.23 ? 148  ARG C CB  1 
ATOM   226  C CG  . ARG A 1 29  ? 22.869  -3.285  -38.085 1.00 34.87 ? 148  ARG C CG  1 
ATOM   227  C CD  . ARG A 1 29  ? 24.013  -3.913  -37.309 1.00 35.40 ? 148  ARG C CD  1 
ATOM   228  N NE  . ARG A 1 29  ? 25.161  -4.045  -38.218 1.00 41.24 ? 148  ARG C NE  1 
ATOM   229  C CZ  . ARG A 1 29  ? 25.968  -3.045  -38.587 1.00 42.69 ? 148  ARG C CZ  1 
ATOM   230  N NH1 . ARG A 1 29  ? 25.829  -1.807  -38.086 1.00 41.46 ? 148  ARG C NH1 1 
ATOM   231  N NH2 . ARG A 1 29  ? 26.950  -3.292  -39.450 1.00 41.43 ? 148  ARG C NH2 1 
ATOM   232  N N   . PHE A 1 30  ? 18.403  -3.754  -37.076 1.00 33.49 ? 149  PHE C N   1 
ATOM   233  C CA  . PHE A 1 30  ? 17.117  -3.831  -36.371 1.00 33.06 ? 149  PHE C CA  1 
ATOM   234  C C   . PHE A 1 30  ? 16.938  -5.286  -35.920 1.00 32.02 ? 149  PHE C C   1 
ATOM   235  O O   . PHE A 1 30  ? 17.697  -6.143  -36.334 1.00 32.77 ? 149  PHE C O   1 
ATOM   236  C CB  . PHE A 1 30  ? 15.947  -3.331  -37.268 1.00 32.20 ? 149  PHE C CB  1 
ATOM   237  C CG  . PHE A 1 30  ? 15.790  -4.092  -38.538 1.00 35.00 ? 149  PHE C CG  1 
ATOM   238  C CD1 . PHE A 1 30  ? 14.855  -5.159  -38.642 1.00 35.79 ? 149  PHE C CD1 1 
ATOM   239  C CD2 . PHE A 1 30  ? 16.586  -3.781  -39.649 1.00 37.01 ? 149  PHE C CD2 1 
ATOM   240  C CE1 . PHE A 1 30  ? 14.735  -5.879  -39.824 1.00 34.65 ? 149  PHE C CE1 1 
ATOM   241  C CE2 . PHE A 1 30  ? 16.477  -4.489  -40.821 1.00 34.43 ? 149  PHE C CE2 1 
ATOM   242  C CZ  . PHE A 1 30  ? 15.551  -5.535  -40.930 1.00 36.59 ? 149  PHE C CZ  1 
ATOM   243  N N   . CYS A 1 31  ? 15.940  -5.553  -35.077 1.00 31.61 ? 150  CYS C N   1 
ATOM   244  C CA  . CYS A 1 31  ? 15.726  -6.868  -34.530 1.00 31.89 ? 150  CYS C CA  1 
ATOM   245  C C   . CYS A 1 31  ? 14.440  -7.413  -35.118 1.00 30.97 ? 150  CYS C C   1 
ATOM   246  O O   . CYS A 1 31  ? 13.442  -6.672  -35.196 1.00 30.86 ? 150  CYS C O   1 
ATOM   247  C CB  . CYS A 1 31  ? 15.565  -6.746  -33.025 1.00 32.00 ? 150  CYS C CB  1 
ATOM   248  S SG  . CYS A 1 31  ? 17.073  -6.107  -32.371 1.00 36.30 ? 150  CYS C SG  1 
ATOM   249  N N   . SER A 1 32  ? 14.442  -8.691  -35.497 1.00 31.27 ? 151  SER C N   1 
ATOM   250  C CA  . SER A 1 32  ? 13.196  -9.348  -35.904 1.00 31.46 ? 151  SER C CA  1 
ATOM   251  C C   . SER A 1 32  ? 13.263  -10.886 -35.878 1.00 32.13 ? 151  SER C C   1 
ATOM   252  O O   . SER A 1 32  ? 14.339  -11.494 -36.041 1.00 31.83 ? 151  SER C O   1 
ATOM   253  C CB  . SER A 1 32  ? 12.776  -8.891  -37.326 1.00 31.65 ? 151  SER C CB  1 
ATOM   254  O OG  . SER A 1 32  ? 13.517  -9.561  -38.344 1.00 32.83 ? 151  SER C OG  1 
ATOM   255  N N   . GLY A 1 33  ? 12.117  -11.505 -35.658 1.00 31.87 ? 152  GLY C N   1 
ATOM   256  C CA  . GLY A 1 33  ? 12.085  -12.927 -35.688 1.00 30.50 ? 152  GLY C CA  1 
ATOM   257  C C   . GLY A 1 33  ? 11.315  -13.473 -34.517 1.00 30.98 ? 152  GLY C C   1 
ATOM   258  O O   . GLY A 1 33  ? 10.890  -12.735 -33.623 1.00 31.18 ? 152  GLY C O   1 
ATOM   259  N N   . SER A 1 34  ? 11.145  -14.803 -34.549 1.00 30.09 ? 153  SER C N   1 
ATOM   260  C CA  . SER A 1 34  ? 10.356  -15.573 -33.591 1.00 31.36 ? 153  SER C CA  1 
ATOM   261  C C   . SER A 1 34  ? 11.001  -15.685 -32.197 1.00 30.84 ? 153  SER C C   1 
ATOM   262  O O   . SER A 1 34  ? 12.235  -15.777 -32.098 1.00 29.85 ? 153  SER C O   1 
ATOM   263  C CB  . SER A 1 34  ? 10.123  -16.965 -34.208 1.00 30.81 ? 153  SER C CB  1 
ATOM   264  O OG  . SER A 1 34  ? 9.395   -17.752 -33.318 1.00 38.27 ? 153  SER C OG  1 
ATOM   265  N N   . CYS A 1 35  ? 10.157  -15.630 -31.153 1.00 30.22 ? 154  CYS C N   1 
ATOM   266  C CA  . CYS A 1 35  ? 10.517  -15.810 -29.745 1.00 32.27 ? 154  CYS C CA  1 
ATOM   267  C C   . CYS A 1 35  ? 9.734   -16.946 -29.082 1.00 32.65 ? 154  CYS C C   1 
ATOM   268  O O   . CYS A 1 35  ? 9.380   -16.893 -27.890 1.00 31.23 ? 154  CYS C O   1 
ATOM   269  C CB  . CYS A 1 35  ? 10.242  -14.505 -28.958 1.00 31.96 ? 154  CYS C CB  1 
ATOM   270  S SG  . CYS A 1 35  ? 11.463  -13.221 -29.426 1.00 34.73 ? 154  CYS C SG  1 
ATOM   271  N N   . ARG A 1 36  ? 9.434   -17.984 -29.851 1.00 34.67 ? 155  ARG C N   1 
ATOM   272  C CA  . ARG A 1 36  ? 8.490   -18.990 -29.370 1.00 37.26 ? 155  ARG C CA  1 
ATOM   273  C C   . ARG A 1 36  ? 9.179   -19.841 -28.303 1.00 36.67 ? 155  ARG C C   1 
ATOM   274  O O   . ARG A 1 36  ? 8.531   -20.431 -27.471 1.00 37.49 ? 155  ARG C O   1 
ATOM   275  C CB  . ARG A 1 36  ? 7.932   -19.815 -30.554 1.00 37.49 ? 155  ARG C CB  1 
ATOM   276  C CG  . ARG A 1 36  ? 7.133   -18.962 -31.562 1.00 40.62 ? 155  ARG C CG  1 
ATOM   277  C CD  . ARG A 1 36  ? 6.128   -19.734 -32.427 1.00 42.76 ? 155  ARG C CD  1 
ATOM   278  N NE  . ARG A 1 36  ? 6.710   -20.810 -33.230 1.00 52.01 ? 155  ARG C NE  1 
ATOM   279  C CZ  . ARG A 1 36  ? 6.099   -21.961 -33.512 1.00 54.33 ? 155  ARG C CZ  1 
ATOM   280  N NH1 . ARG A 1 36  ? 4.883   -22.228 -33.041 1.00 54.22 ? 155  ARG C NH1 1 
ATOM   281  N NH2 . ARG A 1 36  ? 6.725   -22.865 -34.269 1.00 57.75 ? 155  ARG C NH2 1 
ATOM   282  N N   . ARG A 1 37  ? 10.513  -19.864 -28.315 1.00 37.50 ? 156  ARG C N   1 
ATOM   283  C CA  . ARG A 1 37  ? 11.289  -20.544 -27.268 1.00 38.29 ? 156  ARG C CA  1 
ATOM   284  C C   . ARG A 1 37  ? 11.018  -19.962 -25.879 1.00 37.04 ? 156  ARG C C   1 
ATOM   285  O O   . ARG A 1 37  ? 10.951  -20.683 -24.891 1.00 37.49 ? 156  ARG C O   1 
ATOM   286  C CB  . ARG A 1 37  ? 12.803  -20.452 -27.563 1.00 38.86 ? 156  ARG C CB  1 
ATOM   287  C CG  . ARG A 1 37  ? 13.208  -20.483 -29.067 1.00 43.89 ? 156  ARG C CG  1 
ATOM   288  C CD  . ARG A 1 37  ? 13.346  -21.933 -29.591 1.00 50.47 ? 156  ARG C CD  1 
ATOM   289  N NE  . ARG A 1 37  ? 12.232  -22.764 -29.121 1.00 52.42 ? 156  ARG C NE  1 
ATOM   290  C CZ  . ARG A 1 37  ? 12.191  -24.092 -29.168 1.00 54.83 ? 156  ARG C CZ  1 
ATOM   291  N NH1 . ARG A 1 37  ? 13.208  -24.784 -29.679 1.00 54.93 ? 156  ARG C NH1 1 
ATOM   292  N NH2 . ARG A 1 37  ? 11.117  -24.724 -28.696 1.00 56.02 ? 156  ARG C NH2 1 
ATOM   293  N N   . ALA A 1 38  ? 10.811  -18.654 -25.821 1.00 36.49 ? 157  ALA C N   1 
ATOM   294  C CA  . ALA A 1 38  ? 10.700  -17.942 -24.544 1.00 35.51 ? 157  ALA C CA  1 
ATOM   295  C C   . ALA A 1 38  ? 9.249   -17.791 -24.121 1.00 34.18 ? 157  ALA C C   1 
ATOM   296  O O   . ALA A 1 38  ? 8.951   -17.008 -23.225 1.00 33.20 ? 157  ALA C O   1 
ATOM   297  C CB  . ALA A 1 38  ? 11.346  -16.598 -24.646 1.00 36.17 ? 157  ALA C CB  1 
ATOM   298  N N   . ARG A 1 39  ? 8.340   -18.537 -24.742 1.00 32.63 ? 158  ARG C N   1 
ATOM   299  C CA  . ARG A 1 39  ? 6.924   -18.506 -24.283 1.00 33.14 ? 158  ARG C CA  1 
ATOM   300  C C   . ARG A 1 39  ? 6.680   -19.047 -22.897 1.00 32.50 ? 158  ARG C C   1 
ATOM   301  O O   . ARG A 1 39  ? 7.178   -20.114 -22.545 1.00 32.77 ? 158  ARG C O   1 
ATOM   302  C CB  . ARG A 1 39  ? 5.973   -19.212 -25.260 1.00 31.99 ? 158  ARG C CB  1 
ATOM   303  C CG  . ARG A 1 39  ? 5.902   -18.407 -26.525 1.00 36.00 ? 158  ARG C CG  1 
ATOM   304  C CD  . ARG A 1 39  ? 4.982   -19.021 -27.524 1.00 41.13 ? 158  ARG C CD  1 
ATOM   305  N NE  . ARG A 1 39  ? 5.359   -20.398 -27.784 1.00 41.26 ? 158  ARG C NE  1 
ATOM   306  C CZ  . ARG A 1 39  ? 4.744   -21.141 -28.691 1.00 43.33 ? 158  ARG C CZ  1 
ATOM   307  N NH1 . ARG A 1 39  ? 3.781   -20.584 -29.433 1.00 40.00 ? 158  ARG C NH1 1 
ATOM   308  N NH2 . ARG A 1 39  ? 5.117   -22.408 -28.870 1.00 41.75 ? 158  ARG C NH2 1 
ATOM   309  N N   . SER A 1 40  ? 5.880   -18.298 -22.135 1.00 32.49 ? 159  SER C N   1 
ATOM   310  C CA  . SER A 1 40  ? 5.388   -18.727 -20.823 1.00 33.14 ? 159  SER C CA  1 
ATOM   311  C C   . SER A 1 40  ? 4.151   -19.646 -20.911 1.00 32.43 ? 159  SER C C   1 
ATOM   312  O O   . SER A 1 40  ? 3.508   -19.780 -21.989 1.00 31.92 ? 159  SER C O   1 
ATOM   313  C CB  . SER A 1 40  ? 5.058   -17.499 -19.981 1.00 33.47 ? 159  SER C CB  1 
ATOM   314  O OG  . SER A 1 40  ? 4.003   -16.772 -20.595 1.00 33.08 ? 159  SER C OG  1 
ATOM   315  N N   . PRO A 1 41  ? 3.783   -20.305 -19.779 1.00 32.80 ? 160  PRO C N   1 
ATOM   316  C CA  . PRO A 1 41  ? 2.452   -20.946 -19.709 1.00 32.27 ? 160  PRO C CA  1 
ATOM   317  C C   . PRO A 1 41  ? 1.303   -20.005 -20.130 1.00 31.45 ? 160  PRO C C   1 
ATOM   318  O O   . PRO A 1 41  ? 0.451   -20.418 -20.903 1.00 32.36 ? 160  PRO C O   1 
ATOM   319  C CB  . PRO A 1 41  ? 2.325   -21.374 -18.237 1.00 32.27 ? 160  PRO C CB  1 
ATOM   320  C CG  . PRO A 1 41  ? 3.784   -21.428 -17.733 1.00 32.80 ? 160  PRO C CG  1 
ATOM   321  C CD  . PRO A 1 41  ? 4.624   -20.550 -18.581 1.00 32.39 ? 160  PRO C CD  1 
ATOM   322  N N   . HIS A 1 42  ? 1.340   -18.726 -19.751 1.00 31.16 ? 161  HIS C N   1 
ATOM   323  C CA  . HIS A 1 42  ? 0.305   -17.769 -20.235 1.00 30.40 ? 161  HIS C CA  1 
ATOM   324  C C   . HIS A 1 42  ? 0.300   -17.652 -21.764 1.00 30.51 ? 161  HIS C C   1 
ATOM   325  O O   . HIS A 1 42  ? -0.750  -17.675 -22.438 1.00 28.77 ? 161  HIS C O   1 
ATOM   326  C CB  . HIS A 1 42  ? 0.523   -16.355 -19.623 1.00 31.90 ? 161  HIS C CB  1 
ATOM   327  C CG  . HIS A 1 42  ? -0.442  -15.346 -20.170 1.00 31.23 ? 161  HIS C CG  1 
ATOM   328  N ND1 . HIS A 1 42  ? -0.113  -14.444 -21.162 1.00 31.24 ? 161  HIS C ND1 1 
ATOM   329  C CD2 . HIS A 1 42  ? -1.755  -15.158 -19.912 1.00 26.81 ? 161  HIS C CD2 1 
ATOM   330  C CE1 . HIS A 1 42  ? -1.175  -13.718 -21.467 1.00 24.40 ? 161  HIS C CE1 1 
ATOM   331  N NE2 . HIS A 1 42  ? -2.190  -14.154 -20.734 1.00 30.99 ? 161  HIS C NE2 1 
ATOM   332  N N   . ASP A 1 43  ? 1.496   -17.479 -22.316 1.00 30.06 ? 162  ASP C N   1 
ATOM   333  C CA  . ASP A 1 43  ? 1.716   -17.356 -23.756 1.00 29.54 ? 162  ASP C CA  1 
ATOM   334  C C   . ASP A 1 43  ? 1.204   -18.566 -24.511 1.00 30.06 ? 162  ASP C C   1 
ATOM   335  O O   . ASP A 1 43  ? 0.544   -18.441 -25.572 1.00 28.49 ? 162  ASP C O   1 
ATOM   336  C CB  . ASP A 1 43  ? 3.219   -17.196 -24.019 1.00 31.27 ? 162  ASP C CB  1 
ATOM   337  C CG  . ASP A 1 43  ? 3.721   -15.805 -23.680 1.00 33.62 ? 162  ASP C CG  1 
ATOM   338  O OD1 . ASP A 1 43  ? 2.862   -14.942 -23.404 1.00 37.04 ? 162  ASP C OD1 1 
ATOM   339  O OD2 . ASP A 1 43  ? 4.963   -15.538 -23.712 1.00 38.79 ? 162  ASP C OD2 1 
ATOM   340  N N   . LEU A 1 44  ? 1.553   -19.740 -24.007 1.00 28.85 ? 163  LEU C N   1 
ATOM   341  C CA  . LEU A 1 44  ? 1.117   -20.987 -24.633 1.00 28.89 ? 163  LEU C CA  1 
ATOM   342  C C   . LEU A 1 44  ? -0.414  -21.114 -24.646 1.00 29.58 ? 163  LEU C C   1 
ATOM   343  O O   . LEU A 1 44  ? -0.995  -21.571 -25.637 1.00 28.78 ? 163  LEU C O   1 
ATOM   344  C CB  . LEU A 1 44  ? 1.761   -22.171 -23.916 1.00 29.24 ? 163  LEU C CB  1 
ATOM   345  C CG  . LEU A 1 44  ? 3.272   -22.314 -24.117 1.00 30.78 ? 163  LEU C CG  1 
ATOM   346  C CD1 . LEU A 1 44  ? 3.809   -23.533 -23.335 1.00 34.34 ? 163  LEU C CD1 1 
ATOM   347  C CD2 . LEU A 1 44  ? 3.545   -22.528 -25.578 1.00 35.44 ? 163  LEU C CD2 1 
ATOM   348  N N   . SER A 1 45  ? -1.076  -20.723 -23.561 1.00 29.01 ? 164  SER C N   1 
ATOM   349  C CA  . SER A 1 45  ? -2.545  -20.813 -23.501 1.00 30.40 ? 164  SER C CA  1 
ATOM   350  C C   . SER A 1 45  ? -3.146  -19.733 -24.385 1.00 30.32 ? 164  SER C C   1 
ATOM   351  O O   . SER A 1 45  ? -4.157  -19.932 -24.999 1.00 29.66 ? 164  SER C O   1 
ATOM   352  C CB  . SER A 1 45  ? -3.043  -20.627 -22.051 1.00 31.32 ? 164  SER C CB  1 
ATOM   353  O OG  . SER A 1 45  ? -3.003  -21.867 -21.357 1.00 32.07 ? 164  SER C OG  1 
ATOM   354  N N   . LEU A 1 46  ? -2.511  -18.557 -24.430 1.00 29.35 ? 165  LEU C N   1 
ATOM   355  C CA  . LEU A 1 46  ? -2.992  -17.500 -25.308 1.00 29.98 ? 165  LEU C CA  1 
ATOM   356  C C   . LEU A 1 46  ? -2.831  -17.908 -26.786 1.00 29.71 ? 165  LEU C C   1 
ATOM   357  O O   . LEU A 1 46  ? -3.792  -17.791 -27.562 1.00 30.09 ? 165  LEU C O   1 
ATOM   358  C CB  . LEU A 1 46  ? -2.289  -16.161 -24.971 1.00 30.11 ? 165  LEU C CB  1 
ATOM   359  C CG  . LEU A 1 46  ? -2.626  -14.962 -25.864 1.00 32.04 ? 165  LEU C CG  1 
ATOM   360  C CD1 . LEU A 1 46  ? -4.126  -14.652 -25.869 1.00 32.61 ? 165  LEU C CD1 1 
ATOM   361  C CD2 . LEU A 1 46  ? -1.832  -13.759 -25.408 1.00 29.83 ? 165  LEU C CD2 1 
ATOM   362  N N   . ALA A 1 47  ? -1.676  -18.464 -27.177 1.00 28.91 ? 166  ALA C N   1 
ATOM   363  C CA  . ALA A 1 47  ? -1.528  -19.070 -28.527 1.00 28.33 ? 166  ALA C CA  1 
ATOM   364  C C   . ALA A 1 47  ? -2.601  -20.140 -28.828 1.00 28.88 ? 166  ALA C C   1 
ATOM   365  O O   . ALA A 1 47  ? -3.166  -20.209 -29.957 1.00 27.31 ? 166  ALA C O   1 
ATOM   366  C CB  . ALA A 1 47  ? -0.167  -19.696 -28.698 1.00 27.89 ? 166  ALA C CB  1 
ATOM   367  N N   . SER A 1 48  ? -2.876  -20.994 -27.855 1.00 27.76 ? 167  SER C N   1 
ATOM   368  C CA  . SER A 1 48  ? -3.965  -22.014 -28.049 1.00 28.00 ? 167  SER C CA  1 
ATOM   369  C C   . SER A 1 48  ? -5.338  -21.382 -28.298 1.00 27.14 ? 167  SER C C   1 
ATOM   370  O O   . SER A 1 48  ? -6.122  -21.818 -29.220 1.00 27.28 ? 167  SER C O   1 
ATOM   371  C CB  . SER A 1 48  ? -4.016  -22.975 -26.869 1.00 27.29 ? 167  SER C CB  1 
ATOM   372  O OG  . SER A 1 48  ? -4.949  -24.023 -27.118 1.00 33.26 ? 167  SER C OG  1 
ATOM   373  N N   . LEU A 1 49  ? -5.680  -20.376 -27.501 1.00 25.78 ? 168  LEU C N   1 
ATOM   374  C CA  . LEU A 1 49  ? -6.975  -19.695 -27.641 1.00 27.29 ? 168  LEU C CA  1 
ATOM   375  C C   . LEU A 1 49  ? -7.152  -19.032 -29.006 1.00 26.68 ? 168  LEU C C   1 
ATOM   376  O O   . LEU A 1 49  ? -8.218  -19.137 -29.625 1.00 28.16 ? 168  LEU C O   1 
ATOM   377  C CB  . LEU A 1 49  ? -7.168  -18.660 -26.559 1.00 27.93 ? 168  LEU C CB  1 
ATOM   378  C CG  . LEU A 1 49  ? -7.292  -19.195 -25.129 1.00 26.81 ? 168  LEU C CG  1 
ATOM   379  C CD1 . LEU A 1 49  ? -7.245  -18.025 -24.211 1.00 28.76 ? 168  LEU C CD1 1 
ATOM   380  C CD2 . LEU A 1 49  ? -8.621  -19.963 -24.955 1.00 28.90 ? 168  LEU C CD2 1 
ATOM   381  N N   . LEU A 1 50  ? -6.110  -18.373 -29.457 1.00 27.87 ? 169  LEU C N   1 
ATOM   382  C CA  . LEU A 1 50  ? -6.058  -17.766 -30.801 1.00 28.69 ? 169  LEU C CA  1 
ATOM   383  C C   . LEU A 1 50  ? -6.126  -18.782 -31.894 1.00 28.84 ? 169  LEU C C   1 
ATOM   384  O O   . LEU A 1 50  ? -6.931  -18.662 -32.856 1.00 29.99 ? 169  LEU C O   1 
ATOM   385  C CB  . LEU A 1 50  ? -4.769  -16.906 -30.920 1.00 27.70 ? 169  LEU C CB  1 
ATOM   386  C CG  . LEU A 1 50  ? -4.753  -15.702 -29.996 1.00 29.77 ? 169  LEU C CG  1 
ATOM   387  C CD1 . LEU A 1 50  ? -3.351  -15.057 -29.910 1.00 26.82 ? 169  LEU C CD1 1 
ATOM   388  C CD2 . LEU A 1 50  ? -5.809  -14.661 -30.390 1.00 30.24 ? 169  LEU C CD2 1 
ATOM   389  N N   . GLY A 1 51  ? -5.352  -19.855 -31.747 1.00 29.69 ? 170  GLY C N   1 
ATOM   390  C CA  . GLY A 1 51  ? -5.407  -20.947 -32.753 1.00 28.60 ? 170  GLY C CA  1 
ATOM   391  C C   . GLY A 1 51  ? -6.775  -21.586 -32.816 1.00 29.67 ? 170  GLY C C   1 
ATOM   392  O O   . GLY A 1 51  ? -7.254  -22.060 -33.901 1.00 26.65 ? 170  GLY C O   1 
ATOM   393  N N   . ALA A 1 52  ? -7.409  -21.641 -31.648 1.00 28.89 ? 171  ALA C N   1 
ATOM   394  C CA  . ALA A 1 52  ? -8.750  -22.211 -31.512 1.00 30.23 ? 171  ALA C CA  1 
ATOM   395  C C   . ALA A 1 52  ? -9.968  -21.303 -31.928 1.00 28.94 ? 171  ALA C C   1 
ATOM   396  O O   . ALA A 1 52  ? -11.128 -21.763 -31.756 1.00 30.59 ? 171  ALA C O   1 
ATOM   397  C CB  . ALA A 1 52  ? -8.908  -22.708 -30.046 1.00 30.40 ? 171  ALA C CB  1 
ATOM   398  N N   . GLY A 1 53  ? -9.748  -20.028 -32.331 1.00 30.24 ? 172  GLY C N   1 
ATOM   399  C CA  . GLY A 1 53  ? -10.868 -19.136 -32.666 1.00 27.61 ? 172  GLY C CA  1 
ATOM   400  C C   . GLY A 1 53  ? -11.622 -18.647 -31.419 1.00 28.71 ? 172  GLY C C   1 
ATOM   401  O O   . GLY A 1 53  ? -12.735 -18.143 -31.566 1.00 25.45 ? 172  GLY C O   1 
ATOM   402  N N   . ALA A 1 54  ? -11.019 -18.782 -30.189 1.00 26.82 ? 173  ALA C N   1 
ATOM   403  C CA  . ALA A 1 54  ? -11.798 -18.659 -28.939 1.00 28.99 ? 173  ALA C CA  1 
ATOM   404  C C   . ALA A 1 54  ? -12.042 -17.226 -28.463 1.00 29.26 ? 173  ALA C C   1 
ATOM   405  O O   . ALA A 1 54  ? -12.900 -16.966 -27.607 1.00 29.61 ? 173  ALA C O   1 
ATOM   406  C CB  . ALA A 1 54  ? -11.156 -19.491 -27.767 1.00 29.56 ? 173  ALA C CB  1 
ATOM   407  N N   . LEU A 1 55  ? -11.247 -16.296 -28.963 1.00 29.65 ? 174  LEU C N   1 
ATOM   408  C CA  . LEU A 1 55  ? -11.287 -14.913 -28.470 1.00 30.35 ? 174  LEU C CA  1 
ATOM   409  C C   . LEU A 1 55  ? -11.931 -13.964 -29.478 1.00 30.89 ? 174  LEU C C   1 
ATOM   410  O O   . LEU A 1 55  ? -11.589 -13.984 -30.660 1.00 30.41 ? 174  LEU C O   1 
ATOM   411  C CB  . LEU A 1 55  ? -9.864  -14.423 -28.142 1.00 30.08 ? 174  LEU C CB  1 
ATOM   412  C CG  . LEU A 1 55  ? -9.168  -15.079 -26.954 1.00 31.02 ? 174  LEU C CG  1 
ATOM   413  C CD1 . LEU A 1 55  ? -7.663  -14.845 -26.998 1.00 34.10 ? 174  LEU C CD1 1 
ATOM   414  C CD2 . LEU A 1 55  ? -9.789  -14.613 -25.605 1.00 29.72 ? 174  LEU C CD2 1 
ATOM   415  N N   . ARG A 1 56  ? -12.864 -13.150 -28.997 1.00 31.18 ? 175  ARG C N   1 
ATOM   416  C CA  . ARG A 1 56  ? -13.356 -11.991 -29.730 1.00 33.69 ? 175  ARG C CA  1 
ATOM   417  C C   . ARG A 1 56  ? -12.182 -11.011 -29.894 1.00 33.27 ? 175  ARG C C   1 
ATOM   418  O O   . ARG A 1 56  ? -11.409 -10.820 -28.955 1.00 32.89 ? 175  ARG C O   1 
ATOM   419  C CB  . ARG A 1 56  ? -14.502 -11.353 -28.934 1.00 33.62 ? 175  ARG C CB  1 
ATOM   420  C CG  . ARG A 1 56  ? -15.342 -10.359 -29.710 1.00 36.99 ? 175  ARG C CG  1 
ATOM   421  C CD  . ARG A 1 56  ? -16.691 -10.018 -29.032 1.00 37.69 ? 175  ARG C CD  1 
ATOM   422  N NE  . ARG A 1 56  ? -17.318 -8.948  -29.823 1.00 45.35 ? 175  ARG C NE  1 
ATOM   423  C CZ  . ARG A 1 56  ? -18.618 -8.651  -29.843 1.00 46.73 ? 175  ARG C CZ  1 
ATOM   424  N NH1 . ARG A 1 56  ? -19.499 -9.325  -29.097 1.00 48.12 ? 175  ARG C NH1 1 
ATOM   425  N NH2 . ARG A 1 56  ? -19.040 -7.664  -30.632 1.00 47.32 ? 175  ARG C NH2 1 
ATOM   426  N N   . PRO A 1 57  ? -12.042 -10.392 -31.073 1.00 33.48 ? 176  PRO C N   1 
ATOM   427  C CA  . PRO A 1 57  ? -10.960 -9.445  -31.243 1.00 34.43 ? 176  PRO C CA  1 
ATOM   428  C C   . PRO A 1 57  ? -11.120 -8.211  -30.349 1.00 34.67 ? 176  PRO C C   1 
ATOM   429  O O   . PRO A 1 57  ? -12.175 -7.584  -30.369 1.00 33.21 ? 176  PRO C O   1 
ATOM   430  C CB  . PRO A 1 57  ? -11.089 -9.069  -32.725 1.00 33.96 ? 176  PRO C CB  1 
ATOM   431  C CG  . PRO A 1 57  ? -12.461 -9.242  -33.035 1.00 33.45 ? 176  PRO C CG  1 
ATOM   432  C CD  . PRO A 1 57  ? -12.846 -10.494 -32.306 1.00 33.85 ? 176  PRO C CD  1 
ATOM   433  N N   . PRO A 1 58  ? -10.073 -7.852  -29.573 1.00 35.25 ? 177  PRO C N   1 
ATOM   434  C CA  . PRO A 1 58  ? -10.246 -6.637  -28.779 1.00 35.97 ? 177  PRO C CA  1 
ATOM   435  C C   . PRO A 1 58  ? -9.991  -5.420  -29.686 1.00 36.89 ? 177  PRO C C   1 
ATOM   436  O O   . PRO A 1 58  ? -9.418  -5.585  -30.768 1.00 36.77 ? 177  PRO C O   1 
ATOM   437  C CB  . PRO A 1 58  ? -9.153  -6.762  -27.676 1.00 36.03 ? 177  PRO C CB  1 
ATOM   438  C CG  . PRO A 1 58  ? -8.134  -7.727  -28.211 1.00 36.03 ? 177  PRO C CG  1 
ATOM   439  C CD  . PRO A 1 58  ? -8.724  -8.452  -29.405 1.00 35.69 ? 177  PRO C CD  1 
ATOM   440  N N   . PRO A 1 59  ? -10.397 -4.199  -29.260 1.00 37.43 ? 178  PRO C N   1 
ATOM   441  C CA  . PRO A 1 59  ? -10.126 -3.068  -30.154 1.00 37.47 ? 178  PRO C CA  1 
ATOM   442  C C   . PRO A 1 59  ? -8.640  -2.816  -30.196 1.00 37.47 ? 178  PRO C C   1 
ATOM   443  O O   . PRO A 1 59  ? -7.924  -3.166  -29.237 1.00 37.15 ? 178  PRO C O   1 
ATOM   444  C CB  . PRO A 1 59  ? -10.869 -1.891  -29.503 1.00 37.52 ? 178  PRO C CB  1 
ATOM   445  C CG  . PRO A 1 59  ? -11.040 -2.260  -28.110 1.00 38.29 ? 178  PRO C CG  1 
ATOM   446  C CD  . PRO A 1 59  ? -11.043 -3.774  -28.004 1.00 37.97 ? 178  PRO C CD  1 
ATOM   447  N N   . GLY A 1 60  ? -8.173  -2.248  -31.301 1.00 37.88 ? 179  GLY C N   1 
ATOM   448  C CA  . GLY A 1 60  ? -6.752  -2.052  -31.502 1.00 38.83 ? 179  GLY C CA  1 
ATOM   449  C C   . GLY A 1 60  ? -6.099  -3.324  -32.002 1.00 39.85 ? 179  GLY C C   1 
ATOM   450  O O   . GLY A 1 60  ? -6.750  -4.206  -32.585 1.00 39.71 ? 179  GLY C O   1 
ATOM   451  N N   . SER A 1 61  ? -4.799  -3.412  -31.757 1.00 41.28 ? 180  SER C N   1 
ATOM   452  C CA  . SER A 1 61  ? -3.951  -4.466  -32.310 1.00 41.48 ? 180  SER C CA  1 
ATOM   453  C C   . SER A 1 61  ? -4.303  -5.833  -31.753 1.00 41.64 ? 180  SER C C   1 
ATOM   454  O O   . SER A 1 61  ? -4.864  -5.924  -30.653 1.00 41.24 ? 180  SER C O   1 
ATOM   455  C CB  . SER A 1 61  ? -2.494  -4.145  -32.030 1.00 42.00 ? 180  SER C CB  1 
ATOM   456  O OG  . SER A 1 61  ? -2.296  -3.837  -30.662 1.00 42.46 ? 180  SER C OG  1 
ATOM   457  N N   . ARG A 1 62  ? -3.956  -6.885  -32.506 1.00 40.65 ? 181  ARG C N   1 
ATOM   458  C CA  . ARG A 1 62  ? -4.096  -8.293  -32.049 1.00 40.31 ? 181  ARG C CA  1 
ATOM   459  C C   . ARG A 1 62  ? -3.212  -8.528  -30.800 1.00 36.58 ? 181  ARG C C   1 
ATOM   460  O O   . ARG A 1 62  ? -2.141  -8.000  -30.735 1.00 35.21 ? 181  ARG C O   1 
ATOM   461  C CB  . ARG A 1 62  ? -3.682  -9.250  -33.207 1.00 40.64 ? 181  ARG C CB  1 
ATOM   462  C CG  . ARG A 1 62  ? -3.789  -10.770 -32.928 1.00 43.13 ? 181  ARG C CG  1 
ATOM   463  C CD  . ARG A 1 62  ? -3.619  -11.616 -34.237 1.00 45.03 ? 181  ARG C CD  1 
ATOM   464  N NE  . ARG A 1 62  ? -3.721  -13.079 -34.037 1.00 48.95 ? 181  ARG C NE  1 
ATOM   465  C CZ  . ARG A 1 62  ? -4.805  -13.819 -34.296 1.00 55.04 ? 181  ARG C CZ  1 
ATOM   466  N NH1 . ARG A 1 62  ? -5.927  -13.254 -34.737 1.00 57.36 ? 181  ARG C NH1 1 
ATOM   467  N NH2 . ARG A 1 62  ? -4.782  -15.139 -34.101 1.00 56.76 ? 181  ARG C NH2 1 
ATOM   468  N N   . PRO A 1 63  ? -3.654  -9.358  -29.821 1.00 34.80 ? 182  PRO C N   1 
ATOM   469  C CA  . PRO A 1 63  ? -2.671  -9.702  -28.741 1.00 34.96 ? 182  PRO C CA  1 
ATOM   470  C C   . PRO A 1 63  ? -1.494  -10.497 -29.294 1.00 34.17 ? 182  PRO C C   1 
ATOM   471  O O   . PRO A 1 63  ? -1.681  -11.289 -30.237 1.00 34.61 ? 182  PRO C O   1 
ATOM   472  C CB  . PRO A 1 63  ? -3.488  -10.594 -27.774 1.00 34.45 ? 182  PRO C CB  1 
ATOM   473  C CG  . PRO A 1 63  ? -4.698  -11.061 -28.556 1.00 33.50 ? 182  PRO C CG  1 
ATOM   474  C CD  . PRO A 1 63  ? -4.980  -9.964  -29.589 1.00 35.50 ? 182  PRO C CD  1 
ATOM   475  N N   . VAL A 1 64  ? -0.304  -10.302 -28.760 1.00 34.39 ? 183  VAL C N   1 
ATOM   476  C CA  . VAL A 1 64  ? 0.838   -11.111 -29.195 1.00 34.94 ? 183  VAL C CA  1 
ATOM   477  C C   . VAL A 1 64  ? 0.943   -12.265 -28.225 1.00 34.18 ? 183  VAL C C   1 
ATOM   478  O O   . VAL A 1 64  ? 0.650   -12.067 -27.048 1.00 36.59 ? 183  VAL C O   1 
ATOM   479  C CB  . VAL A 1 64  ? 2.166   -10.270 -29.285 1.00 35.05 ? 183  VAL C CB  1 
ATOM   480  C CG1 . VAL A 1 64  ? 1.988   -9.150  -30.314 1.00 37.92 ? 183  VAL C CG1 1 
ATOM   481  C CG2 . VAL A 1 64  ? 2.549   -9.642  -27.970 1.00 35.97 ? 183  VAL C CG2 1 
ATOM   482  N N   . SER A 1 65  ? 1.346   -13.448 -28.670 1.00 32.99 ? 184  SER C N   1 
ATOM   483  C CA  . SER A 1 65  ? 1.374   -14.627 -27.761 1.00 32.76 ? 184  SER C CA  1 
ATOM   484  C C   . SER A 1 65  ? 2.792   -15.085 -27.505 1.00 33.12 ? 184  SER C C   1 
ATOM   485  O O   . SER A 1 65  ? 3.017   -16.254 -27.246 1.00 31.21 ? 184  SER C O   1 
ATOM   486  C CB  . SER A 1 65  ? 0.549   -15.823 -28.311 1.00 33.56 ? 184  SER C CB  1 
ATOM   487  O OG  . SER A 1 65  ? 1.043   -16.228 -29.577 1.00 34.16 ? 184  SER C OG  1 
ATOM   488  N N   . GLN A 1 66  ? 3.769   -14.169 -27.589 1.00 31.81 ? 185  GLN C N   1 
ATOM   489  C CA  . GLN A 1 66  ? 5.149   -14.540 -27.347 1.00 32.02 ? 185  GLN C CA  1 
ATOM   490  C C   . GLN A 1 66  ? 5.921   -13.228 -27.123 1.00 31.67 ? 185  GLN C C   1 
ATOM   491  O O   . GLN A 1 66  ? 5.393   -12.163 -27.423 1.00 29.97 ? 185  GLN C O   1 
ATOM   492  C CB  . GLN A 1 66  ? 5.726   -15.295 -28.544 1.00 32.91 ? 185  GLN C CB  1 
ATOM   493  C CG  . GLN A 1 66  ? 5.832   -14.439 -29.794 1.00 36.36 ? 185  GLN C CG  1 
ATOM   494  C CD  . GLN A 1 66  ? 6.177   -15.246 -30.977 1.00 40.55 ? 185  GLN C CD  1 
ATOM   495  O OE1 . GLN A 1 66  ? 5.298   -15.644 -31.734 1.00 48.67 ? 185  GLN C OE1 1 
ATOM   496  N NE2 . GLN A 1 66  ? 7.440   -15.555 -31.131 1.00 34.98 ? 185  GLN C NE2 1 
ATOM   497  N N   . PRO A 1 67  ? 7.116   -13.298 -26.486 1.00 31.62 ? 186  PRO C N   1 
ATOM   498  C CA  . PRO A 1 67  ? 7.965   -12.120 -26.382 1.00 31.21 ? 186  PRO C CA  1 
ATOM   499  C C   . PRO A 1 67  ? 8.205   -11.458 -27.733 1.00 33.13 ? 186  PRO C C   1 
ATOM   500  O O   . PRO A 1 67  ? 8.123   -12.120 -28.778 1.00 32.32 ? 186  PRO C O   1 
ATOM   501  C CB  . PRO A 1 67  ? 9.288   -12.696 -25.830 1.00 31.76 ? 186  PRO C CB  1 
ATOM   502  C CG  . PRO A 1 67  ? 8.875   -13.868 -25.037 1.00 29.81 ? 186  PRO C CG  1 
ATOM   503  C CD  . PRO A 1 67  ? 7.726   -14.464 -25.825 1.00 32.15 ? 186  PRO C CD  1 
ATOM   504  N N   . CYS A 1 68  ? 8.508   -10.165 -27.718 1.00 34.42 ? 187  CYS C N   1 
ATOM   505  C CA  . CYS A 1 68  ? 8.844   -9.451  -28.963 1.00 37.31 ? 187  CYS C CA  1 
ATOM   506  C C   . CYS A 1 68  ? 10.309  -9.391  -29.166 1.00 34.70 ? 187  CYS C C   1 
ATOM   507  O O   . CYS A 1 68  ? 11.061  -9.238  -28.221 1.00 32.49 ? 187  CYS C O   1 
ATOM   508  C CB  . CYS A 1 68  ? 8.226   -8.039  -29.066 1.00 39.13 ? 187  CYS C CB  1 
ATOM   509  S SG  . CYS A 1 68  ? 8.245   -6.939  -27.622 1.00 52.06 ? 187  CYS C SG  1 
ATOM   510  N N   . CYS A 1 69  ? 10.724  -9.562  -30.404 1.00 33.73 ? 188  CYS C N   1 
ATOM   511  C CA  . CYS A 1 69  ? 12.142  -9.360  -30.745 1.00 33.49 ? 188  CYS C CA  1 
ATOM   512  C C   . CYS A 1 69  ? 12.436  -7.857  -30.813 1.00 32.30 ? 188  CYS C C   1 
ATOM   513  O O   . CYS A 1 69  ? 11.920  -7.152  -31.694 1.00 29.15 ? 188  CYS C O   1 
ATOM   514  C CB  . CYS A 1 69  ? 12.417  -10.025 -32.099 1.00 34.89 ? 188  CYS C CB  1 
ATOM   515  S SG  . CYS A 1 69  ? 14.130  -10.182 -32.560 1.00 35.56 ? 188  CYS C SG  1 
ATOM   516  N N   . ARG A 1 70  ? 13.310  -7.357  -29.921 1.00 31.44 ? 189  ARG C N   1 
ATOM   517  C CA  . ARG A 1 70  ? 13.477  -5.913  -29.791 1.00 31.34 ? 189  ARG C CA  1 
ATOM   518  C C   . ARG A 1 70  ? 14.948  -5.664  -29.468 1.00 31.69 ? 189  ARG C C   1 
ATOM   519  O O   . ARG A 1 70  ? 15.597  -6.546  -28.934 1.00 31.41 ? 189  ARG C O   1 
ATOM   520  C CB  . ARG A 1 70  ? 12.558  -5.319  -28.648 1.00 31.57 ? 189  ARG C CB  1 
ATOM   521  C CG  . ARG A 1 70  ? 11.007  -5.305  -28.969 1.00 35.14 ? 189  ARG C CG  1 
ATOM   522  C CD  . ARG A 1 70  ? 10.715  -4.216  -29.986 1.00 38.26 ? 189  ARG C CD  1 
ATOM   523  N NE  . ARG A 1 70  ? 10.892  -2.884  -29.364 1.00 37.01 ? 189  ARG C NE  1 
ATOM   524  C CZ  . ARG A 1 70  ? 10.817  -1.750  -30.039 1.00 40.84 ? 189  ARG C CZ  1 
ATOM   525  N NH1 . ARG A 1 70  ? 10.651  -1.781  -31.361 1.00 39.27 ? 189  ARG C NH1 1 
ATOM   526  N NH2 . ARG A 1 70  ? 10.957  -0.579  -29.394 1.00 45.69 ? 189  ARG C NH2 1 
ATOM   527  N N   . PRO A 1 71  ? 15.469  -4.472  -29.805 1.00 31.80 ? 190  PRO C N   1 
ATOM   528  C CA  . PRO A 1 71  ? 16.846  -4.122  -29.513 1.00 31.27 ? 190  PRO C CA  1 
ATOM   529  C C   . PRO A 1 71  ? 17.074  -4.109  -28.016 1.00 30.87 ? 190  PRO C C   1 
ATOM   530  O O   . PRO A 1 71  ? 16.190  -3.692  -27.248 1.00 32.36 ? 190  PRO C O   1 
ATOM   531  C CB  . PRO A 1 71  ? 16.976  -2.683  -30.094 1.00 31.08 ? 190  PRO C CB  1 
ATOM   532  C CG  . PRO A 1 71  ? 15.966  -2.626  -31.159 1.00 32.38 ? 190  PRO C CG  1 
ATOM   533  C CD  . PRO A 1 71  ? 14.788  -3.418  -30.583 1.00 33.22 ? 190  PRO C CD  1 
ATOM   534  N N   . THR A 1 72  ? 18.242  -4.562  -27.587 1.00 31.41 ? 191  THR C N   1 
ATOM   535  C CA  . THR A 1 72  ? 18.683  -4.401  -26.188 1.00 30.54 ? 191  THR C CA  1 
ATOM   536  C C   . THR A 1 72  ? 19.790  -3.349  -26.065 1.00 30.81 ? 191  THR C C   1 
ATOM   537  O O   . THR A 1 72  ? 20.198  -2.993  -24.938 1.00 30.69 ? 191  THR C O   1 
ATOM   538  C CB  . THR A 1 72  ? 19.212  -5.736  -25.592 1.00 29.07 ? 191  THR C CB  1 
ATOM   539  O OG1 . THR A 1 72  ? 20.157  -6.295  -26.505 1.00 29.82 ? 191  THR C OG1 1 
ATOM   540  C CG2 . THR A 1 72  ? 18.063  -6.721  -25.345 1.00 31.36 ? 191  THR C CG2 1 
ATOM   541  N N   . ARG A 1 73  ? 20.326  -2.908  -27.202 1.00 31.66 ? 192  ARG C N   1 
ATOM   542  C CA  . ARG A 1 73  ? 21.387  -1.912  -27.214 1.00 32.58 ? 192  ARG C CA  1 
ATOM   543  C C   . ARG A 1 73  ? 21.275  -1.153  -28.511 1.00 32.79 ? 192  ARG C C   1 
ATOM   544  O O   . ARG A 1 73  ? 20.884  -1.713  -29.518 1.00 31.88 ? 192  ARG C O   1 
ATOM   545  C CB  . ARG A 1 73  ? 22.768  -2.566  -27.247 1.00 33.59 ? 192  ARG C CB  1 
ATOM   546  C CG  . ARG A 1 73  ? 23.050  -3.677  -26.320 1.00 36.68 ? 192  ARG C CG  1 
ATOM   547  C CD  . ARG A 1 73  ? 24.543  -3.765  -26.015 1.00 45.06 ? 192  ARG C CD  1 
ATOM   548  N NE  . ARG A 1 73  ? 25.355  -4.039  -27.208 1.00 48.49 ? 192  ARG C NE  1 
ATOM   549  C CZ  . ARG A 1 73  ? 25.801  -5.249  -27.551 1.00 48.27 ? 192  ARG C CZ  1 
ATOM   550  N NH1 . ARG A 1 73  ? 25.526  -6.314  -26.786 1.00 48.75 ? 192  ARG C NH1 1 
ATOM   551  N NH2 . ARG A 1 73  ? 26.532  -5.395  -28.655 1.00 47.15 ? 192  ARG C NH2 1 
ATOM   552  N N   . TYR A 1 74  ? 21.709  0.096   -28.518 1.00 33.21 ? 193  TYR C N   1 
ATOM   553  C CA  . TYR A 1 74  ? 21.687  0.923   -29.729 1.00 33.76 ? 193  TYR C CA  1 
ATOM   554  C C   . TYR A 1 74  ? 23.046  1.645   -29.956 1.00 34.46 ? 193  TYR C C   1 
ATOM   555  O O   . TYR A 1 74  ? 23.870  1.789   -29.031 1.00 31.98 ? 193  TYR C O   1 
ATOM   556  C CB  . TYR A 1 74  ? 20.587  1.999   -29.598 1.00 35.93 ? 193  TYR C CB  1 
ATOM   557  C CG  . TYR A 1 74  ? 19.149  1.511   -29.389 1.00 37.71 ? 193  TYR C CG  1 
ATOM   558  C CD1 . TYR A 1 74  ? 18.289  1.350   -30.470 1.00 38.18 ? 193  TYR C CD1 1 
ATOM   559  C CD2 . TYR A 1 74  ? 18.656  1.240   -28.099 1.00 38.91 ? 193  TYR C CD2 1 
ATOM   560  C CE1 . TYR A 1 74  ? 16.937  0.900   -30.274 1.00 37.68 ? 193  TYR C CE1 1 
ATOM   561  C CE2 . TYR A 1 74  ? 17.332  0.789   -27.890 1.00 39.22 ? 193  TYR C CE2 1 
ATOM   562  C CZ  . TYR A 1 74  ? 16.461  0.649   -28.984 1.00 40.34 ? 193  TYR C CZ  1 
ATOM   563  O OH  . TYR A 1 74  ? 15.116  0.190   -28.832 1.00 42.52 ? 193  TYR C OH  1 
ATOM   564  N N   . GLU A 1 75  ? 23.260  2.104   -31.175 1.00 33.89 ? 194  GLU C N   1 
ATOM   565  C CA  . GLU A 1 75  ? 24.401  3.007   -31.473 1.00 35.19 ? 194  GLU C CA  1 
ATOM   566  C C   . GLU A 1 75  ? 23.930  4.103   -32.424 1.00 34.91 ? 194  GLU C C   1 
ATOM   567  O O   . GLU A 1 75  ? 22.844  3.983   -33.046 1.00 33.57 ? 194  GLU C O   1 
ATOM   568  C CB  . GLU A 1 75  ? 25.577  2.239   -32.090 1.00 34.45 ? 194  GLU C CB  1 
ATOM   569  C CG  . GLU A 1 75  ? 25.226  1.554   -33.464 1.00 35.98 ? 194  GLU C CG  1 
ATOM   570  C CD  . GLU A 1 75  ? 26.429  0.875   -34.111 1.00 37.53 ? 194  GLU C CD  1 
ATOM   571  O OE1 . GLU A 1 75  ? 27.594  1.111   -33.658 1.00 40.75 ? 194  GLU C OE1 1 
ATOM   572  O OE2 . GLU A 1 75  ? 26.222  0.107   -35.089 1.00 36.62 ? 194  GLU C OE2 1 
ATOM   573  N N   . ALA A 1 76  ? 24.775  5.131   -32.602 1.00 34.23 ? 195  ALA C N   1 
ATOM   574  C CA  . ALA A 1 76  ? 24.398  6.238   -33.457 1.00 34.24 ? 195  ALA C CA  1 
ATOM   575  C C   . ALA A 1 76  ? 24.576  5.857   -34.923 1.00 33.94 ? 195  ALA C C   1 
ATOM   576  O O   . ALA A 1 76  ? 25.296  4.919   -35.250 1.00 34.70 ? 195  ALA C O   1 
ATOM   577  C CB  . ALA A 1 76  ? 25.238  7.472   -33.137 1.00 34.77 ? 195  ALA C CB  1 
ATOM   578  N N   . VAL A 1 77  ? 23.941  6.626   -35.793 1.00 33.25 ? 196  VAL C N   1 
ATOM   579  C CA  . VAL A 1 77  ? 24.213  6.602   -37.230 1.00 31.77 ? 196  VAL C CA  1 
ATOM   580  C C   . VAL A 1 77  ? 24.791  7.983   -37.648 1.00 31.94 ? 196  VAL C C   1 
ATOM   581  O O   . VAL A 1 77  ? 24.286  9.034   -37.223 1.00 31.25 ? 196  VAL C O   1 
ATOM   582  C CB  . VAL A 1 77  ? 22.918  6.333   -37.956 1.00 31.82 ? 196  VAL C CB  1 
ATOM   583  C CG1 . VAL A 1 77  ? 23.021  6.667   -39.400 1.00 28.87 ? 196  VAL C CG1 1 
ATOM   584  C CG2 . VAL A 1 77  ? 22.484  4.837   -37.714 1.00 32.44 ? 196  VAL C CG2 1 
ATOM   585  N N   . SER A 1 78  ? 25.812  7.981   -38.506 1.00 31.32 ? 197  SER C N   1 
ATOM   586  C CA  . SER A 1 78  ? 26.526  9.234   -38.900 1.00 30.88 ? 197  SER C CA  1 
ATOM   587  C C   . SER A 1 78  ? 26.650  9.237   -40.393 1.00 29.92 ? 197  SER C C   1 
ATOM   588  O O   . SER A 1 78  ? 26.844  8.172   -40.997 1.00 29.59 ? 197  SER C O   1 
ATOM   589  C CB  . SER A 1 78  ? 27.934  9.272   -38.349 1.00 31.92 ? 197  SER C CB  1 
ATOM   590  O OG  . SER A 1 78  ? 27.912  9.150   -36.921 1.00 35.51 ? 197  SER C OG  1 
ATOM   591  N N   . PHE A 1 79  ? 26.568  10.424  -40.978 1.00 28.69 ? 198  PHE C N   1 
ATOM   592  C CA  . PHE A 1 79  ? 26.554  10.600  -42.405 1.00 28.37 ? 198  PHE C CA  1 
ATOM   593  C C   . PHE A 1 79  ? 26.884  12.061  -42.665 1.00 27.88 ? 198  PHE C C   1 
ATOM   594  O O   . PHE A 1 79  ? 26.826  12.879  -41.769 1.00 29.79 ? 198  PHE C O   1 
ATOM   595  C CB  . PHE A 1 79  ? 25.170  10.243  -43.004 1.00 28.06 ? 198  PHE C CB  1 
ATOM   596  C CG  . PHE A 1 79  ? 24.026  10.991  -42.360 1.00 28.83 ? 198  PHE C CG  1 
ATOM   597  C CD1 . PHE A 1 79  ? 23.669  12.268  -42.793 1.00 27.02 ? 198  PHE C CD1 1 
ATOM   598  C CD2 . PHE A 1 79  ? 23.326  10.422  -41.302 1.00 32.56 ? 198  PHE C CD2 1 
ATOM   599  C CE1 . PHE A 1 79  ? 22.616  12.970  -42.170 1.00 27.13 ? 198  PHE C CE1 1 
ATOM   600  C CE2 . PHE A 1 79  ? 22.279  11.123  -40.667 1.00 30.93 ? 198  PHE C CE2 1 
ATOM   601  C CZ  . PHE A 1 79  ? 21.934  12.400  -41.120 1.00 28.67 ? 198  PHE C CZ  1 
ATOM   602  N N   . MET A 1 80  ? 27.237  12.373  -43.897 1.00 26.93 ? 199  MET C N   1 
ATOM   603  C CA  . MET A 1 80  ? 27.373  13.749  -44.325 1.00 27.35 ? 199  MET C CA  1 
ATOM   604  C C   . MET A 1 80  ? 26.070  14.180  -45.005 1.00 27.84 ? 199  MET C C   1 
ATOM   605  O O   . MET A 1 80  ? 25.532  13.438  -45.826 1.00 28.47 ? 199  MET C O   1 
ATOM   606  C CB  . MET A 1 80  ? 28.560  13.938  -45.283 1.00 27.48 ? 199  MET C CB  1 
ATOM   607  C CG  . MET A 1 80  ? 29.943  13.785  -44.645 1.00 27.31 ? 199  MET C CG  1 
ATOM   608  S SD  . MET A 1 80  ? 31.342  13.947  -45.819 1.00 29.24 ? 199  MET C SD  1 
ATOM   609  C CE  . MET A 1 80  ? 31.501  15.675  -45.952 1.00 28.06 ? 199  MET C CE  1 
ATOM   610  N N   . ASP A 1 81  ? 25.537  15.346  -44.617 1.00 28.25 ? 200  ASP C N   1 
ATOM   611  C CA  . ASP A 1 81  ? 24.270  15.852  -45.219 1.00 28.77 ? 200  ASP C CA  1 
ATOM   612  C C   . ASP A 1 81  ? 24.504  16.462  -46.605 1.00 28.25 ? 200  ASP C C   1 
ATOM   613  O O   . ASP A 1 81  ? 25.651  16.460  -47.104 1.00 28.07 ? 200  ASP C O   1 
ATOM   614  C CB  . ASP A 1 81  ? 23.488  16.787  -44.257 1.00 28.71 ? 200  ASP C CB  1 
ATOM   615  C CG  . ASP A 1 81  ? 24.155  18.118  -44.021 1.00 31.07 ? 200  ASP C CG  1 
ATOM   616  O OD1 . ASP A 1 81  ? 24.998  18.559  -44.822 1.00 30.62 ? 200  ASP C OD1 1 
ATOM   617  O OD2 . ASP A 1 81  ? 23.769  18.790  -43.034 1.00 31.63 ? 200  ASP C OD2 1 
ATOM   618  N N   . VAL A 1 82  ? 23.449  16.989  -47.244 1.00 27.79 ? 201  VAL C N   1 
ATOM   619  C CA  . VAL A 1 82  ? 23.607  17.544  -48.593 1.00 27.24 ? 201  VAL C CA  1 
ATOM   620  C C   . VAL A 1 82  ? 24.507  18.783  -48.674 1.00 27.93 ? 201  VAL C C   1 
ATOM   621  O O   . VAL A 1 82  ? 24.944  19.160  -49.766 1.00 28.69 ? 201  VAL C O   1 
ATOM   622  C CB  . VAL A 1 82  ? 22.269  17.832  -49.315 1.00 27.44 ? 201  VAL C CB  1 
ATOM   623  C CG1 . VAL A 1 82  ? 21.423  16.541  -49.491 1.00 25.88 ? 201  VAL C CG1 1 
ATOM   624  C CG2 . VAL A 1 82  ? 21.504  18.904  -48.602 1.00 28.00 ? 201  VAL C CG2 1 
ATOM   625  N N   . ASN A 1 83  ? 24.748  19.439  -47.537 1.00 28.13 ? 202  ASN C N   1 
ATOM   626  C CA  . ASN A 1 83  ? 25.633  20.600  -47.479 1.00 29.54 ? 202  ASN C CA  1 
ATOM   627  C C   . ASN A 1 83  ? 27.091  20.226  -47.128 1.00 29.49 ? 202  ASN C C   1 
ATOM   628  O O   . ASN A 1 83  ? 27.924  21.106  -46.890 1.00 30.98 ? 202  ASN C O   1 
ATOM   629  C CB  . ASN A 1 83  ? 25.082  21.664  -46.518 1.00 30.70 ? 202  ASN C CB  1 
ATOM   630  C CG  . ASN A 1 83  ? 23.670  22.132  -46.902 1.00 32.96 ? 202  ASN C CG  1 
ATOM   631  O OD1 . ASN A 1 83  ? 23.465  22.840  -47.903 1.00 37.93 ? 202  ASN C OD1 1 
ATOM   632  N ND2 . ASN A 1 83  ? 22.694  21.729  -46.103 1.00 38.27 ? 202  ASN C ND2 1 
ATOM   633  N N   . SER A 1 84  ? 27.398  18.940  -47.098 1.00 20.00 ? 203  SER C N   1 
ATOM   634  C CA  . SER A 1 84  ? 28.715  18.417  -46.755 1.00 20.00 ? 203  SER C CA  1 
ATOM   635  C C   . SER A 1 84  ? 28.991  18.553  -45.261 1.00 20.00 ? 203  SER C C   1 
ATOM   636  O O   . SER A 1 84  ? 30.199  18.615  -44.915 1.00 30.58 ? 203  SER C O   1 
ATOM   637  C CB  . SER A 1 84  ? 29.804  19.133  -47.558 1.00 20.00 ? 203  SER C CB  1 
ATOM   638  O OG  . SER A 1 84  ? 29.578  18.999  -48.951 1.00 20.00 ? 203  SER C OG  1 
ATOM   639  N N   . THR A 1 85  ? 28.021  18.590  -44.436 1.00 29.20 ? 204  THR C N   1 
ATOM   640  C CA  . THR A 1 85  ? 28.248  18.691  -42.992 1.00 28.63 ? 204  THR C CA  1 
ATOM   641  C C   . THR A 1 85  ? 28.014  17.345  -42.334 1.00 28.40 ? 204  THR C C   1 
ATOM   642  O O   . THR A 1 85  ? 26.966  16.707  -42.525 1.00 29.76 ? 204  THR C O   1 
ATOM   643  C CB  . THR A 1 85  ? 27.344  19.792  -42.332 1.00 28.76 ? 204  THR C CB  1 
ATOM   644  O OG1 . THR A 1 85  ? 27.495  21.026  -43.053 1.00 30.48 ? 204  THR C OG1 1 
ATOM   645  C CG2 . THR A 1 85  ? 27.740  20.023  -40.891 1.00 27.21 ? 204  THR C CG2 1 
ATOM   646  N N   . TRP A 1 86  ? 28.956  16.913  -41.514 1.00 28.11 ? 205  TRP C N   1 
ATOM   647  C CA  . TRP A 1 86  ? 28.733  15.678  -40.737 1.00 25.63 ? 205  TRP C CA  1 
ATOM   648  C C   . TRP A 1 86  ? 27.638  15.838  -39.681 1.00 26.65 ? 205  TRP C C   1 
ATOM   649  O O   . TRP A 1 86  ? 27.668  16.767  -38.865 1.00 23.34 ? 205  TRP C O   1 
ATOM   650  C CB  . TRP A 1 86  ? 30.013  15.269  -40.017 1.00 27.59 ? 205  TRP C CB  1 
ATOM   651  C CG  . TRP A 1 86  ? 30.986  14.545  -40.885 1.00 28.72 ? 205  TRP C CG  1 
ATOM   652  C CD1 . TRP A 1 86  ? 32.074  15.053  -41.534 1.00 29.60 ? 205  TRP C CD1 1 
ATOM   653  C CD2 . TRP A 1 86  ? 30.950  13.143  -41.174 1.00 31.23 ? 205  TRP C CD2 1 
ATOM   654  N NE1 . TRP A 1 86  ? 32.722  14.024  -42.222 1.00 33.04 ? 205  TRP C NE1 1 
ATOM   655  C CE2 . TRP A 1 86  ? 32.044  12.850  -42.021 1.00 32.63 ? 205  TRP C CE2 1 
ATOM   656  C CE3 . TRP A 1 86  ? 30.087  12.114  -40.813 1.00 29.07 ? 205  TRP C CE3 1 
ATOM   657  C CZ2 . TRP A 1 86  ? 32.306  11.537  -42.481 1.00 31.43 ? 205  TRP C CZ2 1 
ATOM   658  C CZ3 . TRP A 1 86  ? 30.319  10.812  -41.308 1.00 31.62 ? 205  TRP C CZ3 1 
ATOM   659  C CH2 . TRP A 1 86  ? 31.435  10.557  -42.130 1.00 30.62 ? 205  TRP C CH2 1 
ATOM   660  N N   . ARG A 1 87  ? 26.725  14.856  -39.665 1.00 25.81 ? 206  ARG C N   1 
ATOM   661  C CA  . ARG A 1 87  ? 25.620  14.796  -38.738 1.00 27.91 ? 206  ARG C CA  1 
ATOM   662  C C   . ARG A 1 87  ? 25.638  13.420  -38.063 1.00 28.43 ? 206  ARG C C   1 
ATOM   663  O O   . ARG A 1 87  ? 26.053  12.414  -38.662 1.00 29.31 ? 206  ARG C O   1 
ATOM   664  C CB  . ARG A 1 87  ? 24.285  14.982  -39.468 1.00 26.60 ? 206  ARG C CB  1 
ATOM   665  C CG  . ARG A 1 87  ? 24.164  16.262  -40.299 1.00 29.95 ? 206  ARG C CG  1 
ATOM   666  C CD  . ARG A 1 87  ? 24.204  17.548  -39.444 1.00 28.97 ? 206  ARG C CD  1 
ATOM   667  N NE  . ARG A 1 87  ? 24.058  18.780  -40.231 1.00 30.61 ? 206  ARG C NE  1 
ATOM   668  C CZ  . ARG A 1 87  ? 24.133  19.998  -39.711 1.00 32.05 ? 206  ARG C CZ  1 
ATOM   669  N NH1 . ARG A 1 87  ? 24.362  20.142  -38.414 1.00 32.33 ? 206  ARG C NH1 1 
ATOM   670  N NH2 . ARG A 1 87  ? 23.989  21.084  -40.480 1.00 36.88 ? 206  ARG C NH2 1 
ATOM   671  N N   . THR A 1 88  ? 25.181  13.377  -36.816 1.00 29.55 ? 207  THR C N   1 
ATOM   672  C CA  . THR A 1 88  ? 25.043  12.120  -36.074 1.00 30.75 ? 207  THR C CA  1 
ATOM   673  C C   . THR A 1 88  ? 23.723  12.158  -35.322 1.00 30.94 ? 207  THR C C   1 
ATOM   674  O O   . THR A 1 88  ? 23.390  13.159  -34.684 1.00 31.81 ? 207  THR C O   1 
ATOM   675  C CB  . THR A 1 88  ? 26.185  11.911  -35.068 1.00 30.70 ? 207  THR C CB  1 
ATOM   676  O OG1 . THR A 1 88  ? 27.420  11.966  -35.771 1.00 33.48 ? 207  THR C OG1 1 
ATOM   677  C CG2 . THR A 1 88  ? 26.122  10.526  -34.459 1.00 31.37 ? 207  THR C CG2 1 
ATOM   678  N N   . VAL A 1 89  ? 22.997  11.066  -35.434 1.00 32.20 ? 208  VAL C N   1 
ATOM   679  C CA  . VAL A 1 89  ? 21.743  10.850  -34.713 1.00 33.02 ? 208  VAL C CA  1 
ATOM   680  C C   . VAL A 1 89  ? 21.936  9.657   -33.784 1.00 33.86 ? 208  VAL C C   1 
ATOM   681  O O   . VAL A 1 89  ? 22.150  8.520   -34.250 1.00 33.40 ? 208  VAL C O   1 
ATOM   682  C CB  . VAL A 1 89  ? 20.582  10.563  -35.685 1.00 33.47 ? 208  VAL C CB  1 
ATOM   683  C CG1 . VAL A 1 89  ? 19.243  10.347  -34.879 1.00 33.12 ? 208  VAL C CG1 1 
ATOM   684  C CG2 . VAL A 1 89  ? 20.462  11.661  -36.737 1.00 32.79 ? 208  VAL C CG2 1 
ATOM   685  N N   . ASP A 1 90  ? 21.801  9.911   -32.482 1.00 34.01 ? 209  ASP C N   1 
ATOM   686  C CA  . ASP A 1 90  ? 22.087  8.925   -31.449 1.00 35.83 ? 209  ASP C CA  1 
ATOM   687  C C   . ASP A 1 90  ? 20.992  7.829   -31.386 1.00 36.06 ? 209  ASP C C   1 
ATOM   688  O O   . ASP A 1 90  ? 19.838  8.081   -31.754 1.00 36.49 ? 209  ASP C O   1 
ATOM   689  C CB  . ASP A 1 90  ? 22.159  9.598   -30.083 1.00 36.24 ? 209  ASP C CB  1 
ATOM   690  C CG  . ASP A 1 90  ? 23.232  10.672  -30.000 1.00 39.41 ? 209  ASP C CG  1 
ATOM   691  O OD1 . ASP A 1 90  ? 24.228  10.614  -30.769 1.00 43.16 ? 209  ASP C OD1 1 
ATOM   692  O OD2 . ASP A 1 90  ? 23.071  11.564  -29.129 1.00 42.90 ? 209  ASP C OD2 1 
ATOM   693  N N   . ARG A 1 91  ? 21.368  6.645   -30.909 1.00 36.16 ? 210  ARG C N   1 
ATOM   694  C CA  . ARG A 1 91  ? 20.436  5.549   -30.612 1.00 38.29 ? 210  ARG C CA  1 
ATOM   695  C C   . ARG A 1 91  ? 19.494  5.179   -31.775 1.00 37.46 ? 210  ARG C C   1 
ATOM   696  O O   . ARG A 1 91  ? 18.349  4.759   -31.553 1.00 36.94 ? 210  ARG C O   1 
ATOM   697  C CB  . ARG A 1 91  ? 19.624  5.813   -29.321 1.00 38.73 ? 210  ARG C CB  1 
ATOM   698  C CG  . ARG A 1 91  ? 20.467  6.228   -28.046 1.00 42.84 ? 210  ARG C CG  1 
ATOM   699  C CD  . ARG A 1 91  ? 19.526  6.391   -26.818 1.00 41.69 ? 210  ARG C CD  1 
ATOM   700  N NE  . ARG A 1 91  ? 20.154  6.930   -25.602 1.00 49.32 ? 210  ARG C NE  1 
ATOM   701  C CZ  . ARG A 1 91  ? 19.521  7.032   -24.423 1.00 52.85 ? 210  ARG C CZ  1 
ATOM   702  N NH1 . ARG A 1 91  ? 18.255  6.608   -24.303 1.00 55.68 ? 210  ARG C NH1 1 
ATOM   703  N NH2 . ARG A 1 91  ? 20.141  7.530   -23.354 1.00 54.23 ? 210  ARG C NH2 1 
ATOM   704  N N   . LEU A 1 92  ? 19.973  5.340   -33.011 1.00 36.48 ? 211  LEU C N   1 
ATOM   705  C CA  . LEU A 1 92  ? 19.151  5.104   -34.215 1.00 36.31 ? 211  LEU C CA  1 
ATOM   706  C C   . LEU A 1 92  ? 19.142  3.653   -34.646 1.00 35.42 ? 211  LEU C C   1 
ATOM   707  O O   . LEU A 1 92  ? 18.118  3.181   -35.183 1.00 34.40 ? 211  LEU C O   1 
ATOM   708  C CB  . LEU A 1 92  ? 19.615  5.979   -35.400 1.00 37.63 ? 211  LEU C CB  1 
ATOM   709  C CG  . LEU A 1 92  ? 18.557  6.499   -36.397 1.00 40.09 ? 211  LEU C CG  1 
ATOM   710  C CD1 . LEU A 1 92  ? 19.180  7.123   -37.584 1.00 37.63 ? 211  LEU C CD1 1 
ATOM   711  C CD2 . LEU A 1 92  ? 17.640  5.450   -36.900 1.00 45.29 ? 211  LEU C CD2 1 
ATOM   712  N N   . SER A 1 93  ? 20.253  2.944   -34.427 1.00 34.52 ? 212  SER C N   1 
ATOM   713  C CA  . SER A 1 93  ? 20.463  1.584   -35.022 1.00 33.74 ? 212  SER C CA  1 
ATOM   714  C C   . SER A 1 93  ? 20.720  0.581   -33.900 1.00 33.49 ? 212  SER C C   1 
ATOM   715  O O   . SER A 1 93  ? 21.395  0.916   -32.923 1.00 33.68 ? 212  SER C O   1 
ATOM   716  C CB  . SER A 1 93  ? 21.667  1.602   -36.022 1.00 34.71 ? 212  SER C CB  1 
ATOM   717  O OG  . SER A 1 93  ? 21.840  0.358   -36.701 1.00 32.10 ? 212  SER C OG  1 
ATOM   718  N N   . ALA A 1 94  ? 20.103  -0.603  -33.982 1.00 32.60 ? 213  ALA C N   1 
ATOM   719  C CA  . ALA A 1 94  ? 20.297  -1.649  -32.991 1.00 32.06 ? 213  ALA C CA  1 
ATOM   720  C C   . ALA A 1 94  ? 21.699  -2.249  -33.133 1.00 31.64 ? 213  ALA C C   1 
ATOM   721  O O   . ALA A 1 94  ? 22.249  -2.297  -34.228 1.00 30.76 ? 213  ALA C O   1 
ATOM   722  C CB  . ALA A 1 94  ? 19.215  -2.752  -33.156 1.00 32.58 ? 213  ALA C CB  1 
ATOM   723  N N   . THR A 1 95  ? 22.252  -2.713  -32.005 1.00 31.86 ? 214  THR C N   1 
ATOM   724  C CA  . THR A 1 95  ? 23.493  -3.499  -31.950 1.00 31.34 ? 214  THR C CA  1 
ATOM   725  C C   . THR A 1 95  ? 23.357  -4.899  -31.292 1.00 31.28 ? 214  THR C C   1 
ATOM   726  O O   . THR A 1 95  ? 24.277  -5.717  -31.349 1.00 29.65 ? 214  THR C O   1 
ATOM   727  C CB  . THR A 1 95  ? 24.654  -2.669  -31.288 1.00 32.68 ? 214  THR C CB  1 
ATOM   728  O OG1 . THR A 1 95  ? 24.316  -2.283  -29.950 1.00 32.45 ? 214  THR C OG1 1 
ATOM   729  C CG2 . THR A 1 95  ? 24.876  -1.445  -32.071 1.00 32.40 ? 214  THR C CG2 1 
ATOM   730  N N   . ALA A 1 96  ? 22.194  -5.180  -30.688 1.00 30.66 ? 215  ALA C N   1 
ATOM   731  C CA  . ALA A 1 96  ? 21.958  -6.448  -29.998 1.00 30.20 ? 215  ALA C CA  1 
ATOM   732  C C   . ALA A 1 96  ? 20.461  -6.595  -29.905 1.00 30.88 ? 215  ALA C C   1 
ATOM   733  O O   . ALA A 1 96  ? 19.746  -5.587  -29.900 1.00 31.67 ? 215  ALA C O   1 
ATOM   734  C CB  . ALA A 1 96  ? 22.566  -6.426  -28.629 1.00 30.82 ? 215  ALA C CB  1 
ATOM   735  N N   . CYS A 1 97  ? 19.968  -7.838  -29.797 1.00 31.92 ? 216  CYS C N   1 
ATOM   736  C CA  . CYS A 1 97  ? 18.524  -8.112  -29.801 1.00 31.18 ? 216  CYS C CA  1 
ATOM   737  C C   . CYS A 1 97  ? 18.160  -9.034  -28.672 1.00 30.99 ? 216  CYS C C   1 
ATOM   738  O O   . CYS A 1 97  ? 19.001  -9.803  -28.220 1.00 30.94 ? 216  CYS C O   1 
ATOM   739  C CB  . CYS A 1 97  ? 18.061  -8.761  -31.133 1.00 31.66 ? 216  CYS C CB  1 
ATOM   740  S SG  . CYS A 1 97  ? 18.310  -7.677  -32.543 1.00 39.07 ? 216  CYS C SG  1 
ATOM   741  N N   . GLY A 1 98  ? 16.915  -8.932  -28.213 1.00 29.94 ? 217  GLY C N   1 
ATOM   742  C CA  . GLY A 1 98  ? 16.419  -9.781  -27.130 1.00 30.01 ? 217  GLY C CA  1 
ATOM   743  C C   . GLY A 1 98  ? 14.998  -10.217 -27.433 1.00 30.50 ? 217  GLY C C   1 
ATOM   744  O O   . GLY A 1 98  ? 14.272  -9.549  -28.184 1.00 29.43 ? 217  GLY C O   1 
ATOM   745  N N   . CYS A 1 99  ? 14.614  -11.352 -26.869 1.00 31.07 ? 218  CYS C N   1 
ATOM   746  C CA  . CYS A 1 99  ? 13.205  -11.711 -26.785 1.00 32.52 ? 218  CYS C CA  1 
ATOM   747  C C   . CYS A 1 99  ? 12.586  -11.076 -25.562 1.00 32.40 ? 218  CYS C C   1 
ATOM   748  O O   . CYS A 1 99  ? 12.644  -11.643 -24.497 1.00 32.80 ? 218  CYS C O   1 
ATOM   749  C CB  . CYS A 1 99  ? 13.056  -13.227 -26.765 1.00 33.38 ? 218  CYS C CB  1 
ATOM   750  S SG  . CYS A 1 99  ? 13.243  -13.911 -28.469 1.00 38.05 ? 218  CYS C SG  1 
ATOM   751  N N   . LEU A 1 100 ? 12.002  -9.894  -25.710 1.00 32.31 ? 219  LEU C N   1 
ATOM   752  C CA  . LEU A 1 100 ? 11.639  -9.070  -24.531 1.00 35.50 ? 219  LEU C CA  1 
ATOM   753  C C   . LEU A 1 100 ? 10.159  -9.117  -24.136 1.00 36.51 ? 219  LEU C C   1 
ATOM   754  O O   . LEU A 1 100 ? 9.233   -9.007  -24.968 1.00 38.22 ? 219  LEU C O   1 
ATOM   755  C CB  . LEU A 1 100 ? 12.139  -7.611  -24.681 1.00 33.65 ? 219  LEU C CB  1 
ATOM   756  C CG  . LEU A 1 100 ? 13.617  -7.330  -25.053 1.00 34.89 ? 219  LEU C CG  1 
ATOM   757  C CD1 . LEU A 1 100 ? 13.914  -5.830  -24.938 1.00 35.25 ? 219  LEU C CD1 1 
ATOM   758  C CD2 . LEU A 1 100 ? 14.680  -8.067  -24.209 1.00 31.46 ? 219  LEU C CD2 1 
ATOM   759  N N   . PRO B 1 2   ? -8.136  0.081   -27.005 1.00 41.00 ? 121  PRO D N   1 
ATOM   760  C CA  . PRO B 1 2   ? -7.356  0.536   -28.190 1.00 40.82 ? 121  PRO D CA  1 
ATOM   761  C C   . PRO B 1 2   ? -5.843  0.650   -27.926 1.00 40.49 ? 121  PRO D C   1 
ATOM   762  O O   . PRO B 1 2   ? -5.021  0.092   -28.687 1.00 40.34 ? 121  PRO D O   1 
ATOM   763  C CB  . PRO B 1 2   ? -7.946  1.911   -28.503 1.00 41.19 ? 121  PRO D CB  1 
ATOM   764  C CG  . PRO B 1 2   ? -8.658  2.328   -27.232 1.00 41.36 ? 121  PRO D CG  1 
ATOM   765  C CD  . PRO B 1 2   ? -9.103  1.084   -26.528 1.00 41.06 ? 121  PRO D CD  1 
ATOM   766  N N   . GLY B 1 3   ? -5.500  1.379   -26.858 1.00 39.60 ? 122  GLY D N   1 
ATOM   767  C CA  . GLY B 1 3   ? -4.149  1.433   -26.310 1.00 37.55 ? 122  GLY D CA  1 
ATOM   768  C C   . GLY B 1 3   ? -3.897  0.244   -25.400 1.00 36.94 ? 122  GLY D C   1 
ATOM   769  O O   . GLY B 1 3   ? -4.829  -0.497  -25.064 1.00 36.93 ? 122  GLY D O   1 
ATOM   770  N N   . CYS B 1 4   ? -2.640  0.055   -24.993 1.00 36.72 ? 123  CYS D N   1 
ATOM   771  C CA  . CYS B 1 4   ? -2.251  -1.176  -24.282 1.00 35.41 ? 123  CYS D CA  1 
ATOM   772  C C   . CYS B 1 4   ? -2.972  -1.316  -22.933 1.00 34.79 ? 123  CYS D C   1 
ATOM   773  O O   . CYS B 1 4   ? -2.857  -0.447  -22.086 1.00 33.19 ? 123  CYS D O   1 
ATOM   774  C CB  . CYS B 1 4   ? -0.723  -1.264  -24.159 1.00 35.86 ? 123  CYS D CB  1 
ATOM   775  S SG  . CYS B 1 4   ? -0.097  -2.529  -23.063 1.00 38.53 ? 123  CYS D SG  1 
ATOM   776  N N   . ARG B 1 5   ? -3.740  -2.404  -22.743 1.00 32.62 ? 124  ARG D N   1 
ATOM   777  C CA  . ARG B 1 5   ? -4.609  -2.573  -21.566 1.00 33.78 ? 124  ARG D CA  1 
ATOM   778  C C   . ARG B 1 5   ? -4.858  -4.070  -21.276 1.00 32.69 ? 124  ARG D C   1 
ATOM   779  O O   . ARG B 1 5   ? -4.764  -4.902  -22.178 1.00 30.66 ? 124  ARG D O   1 
ATOM   780  C CB  . ARG B 1 5   ? -5.982  -1.938  -21.857 1.00 34.48 ? 124  ARG D CB  1 
ATOM   781  C CG  . ARG B 1 5   ? -6.481  -1.000  -20.779 1.00 39.89 ? 124  ARG D CG  1 
ATOM   782  C CD  . ARG B 1 5   ? -7.281  0.175   -21.373 1.00 45.94 ? 124  ARG D CD  1 
ATOM   783  N NE  . ARG B 1 5   ? -6.439  1.151   -22.085 1.00 49.66 ? 124  ARG D NE  1 
ATOM   784  C CZ  . ARG B 1 5   ? -6.913  2.199   -22.760 1.00 51.03 ? 124  ARG D CZ  1 
ATOM   785  N NH1 . ARG B 1 5   ? -8.223  2.414   -22.815 1.00 51.64 ? 124  ARG D NH1 1 
ATOM   786  N NH2 . ARG B 1 5   ? -6.080  3.033   -23.379 1.00 53.27 ? 124  ARG D NH2 1 
ATOM   787  N N   . LEU B 1 6   ? -5.216  -4.379  -20.027 1.00 32.73 ? 125  LEU D N   1 
ATOM   788  C CA  . LEU B 1 6   ? -5.676  -5.704  -19.620 1.00 32.56 ? 125  LEU D CA  1 
ATOM   789  C C   . LEU B 1 6   ? -7.069  -5.960  -20.184 1.00 32.35 ? 125  LEU D C   1 
ATOM   790  O O   . LEU B 1 6   ? -7.971  -5.119  -20.082 1.00 32.19 ? 125  LEU D O   1 
ATOM   791  C CB  . LEU B 1 6   ? -5.683  -5.852  -18.077 1.00 32.53 ? 125  LEU D CB  1 
ATOM   792  C CG  . LEU B 1 6   ? -5.852  -7.271  -17.532 1.00 32.14 ? 125  LEU D CG  1 
ATOM   793  C CD1 . LEU B 1 6   ? -4.610  -8.120  -17.668 1.00 34.43 ? 125  LEU D CD1 1 
ATOM   794  C CD2 . LEU B 1 6   ? -6.277  -7.221  -16.060 1.00 33.53 ? 125  LEU D CD2 1 
ATOM   795  N N   . ARG B 1 7   ? -7.236  -7.120  -20.807 1.00 31.64 ? 126  ARG D N   1 
ATOM   796  C CA  . ARG B 1 7   ? -8.488  -7.483  -21.449 1.00 31.12 ? 126  ARG D CA  1 
ATOM   797  C C   . ARG B 1 7   ? -9.013  -8.779  -20.785 1.00 31.42 ? 126  ARG D C   1 
ATOM   798  O O   . ARG B 1 7   ? -8.241  -9.555  -20.201 1.00 30.96 ? 126  ARG D O   1 
ATOM   799  C CB  . ARG B 1 7   ? -8.293  -7.744  -22.954 1.00 30.71 ? 126  ARG D CB  1 
ATOM   800  C CG  . ARG B 1 7   ? -7.436  -6.794  -23.809 1.00 32.08 ? 126  ARG D CG  1 
ATOM   801  C CD  . ARG B 1 7   ? -8.176  -5.493  -24.144 1.00 27.52 ? 126  ARG D CD  1 
ATOM   802  N NE  . ARG B 1 7   ? -7.317  -4.572  -24.865 1.00 25.94 ? 126  ARG D NE  1 
ATOM   803  C CZ  . ARG B 1 7   ? -7.716  -3.383  -25.288 1.00 27.00 ? 126  ARG D CZ  1 
ATOM   804  N NH1 . ARG B 1 7   ? -8.975  -2.989  -25.037 1.00 25.91 ? 126  ARG D NH1 1 
ATOM   805  N NH2 . ARG B 1 7   ? -6.849  -2.597  -25.935 1.00 28.77 ? 126  ARG D NH2 1 
ATOM   806  N N   . SER B 1 8   ? -10.313 -9.031  -20.882 1.00 30.56 ? 127  SER D N   1 
ATOM   807  C CA  . SER B 1 8   ? -10.895 -10.154 -20.159 1.00 30.40 ? 127  SER D CA  1 
ATOM   808  C C   . SER B 1 8   ? -12.028 -10.787 -20.959 1.00 30.40 ? 127  SER D C   1 
ATOM   809  O O   . SER B 1 8   ? -12.844 -10.059 -21.497 1.00 29.64 ? 127  SER D O   1 
ATOM   810  C CB  . SER B 1 8   ? -11.443 -9.646  -18.829 1.00 30.87 ? 127  SER D CB  1 
ATOM   811  O OG  . SER B 1 8   ? -12.042 -10.718 -18.155 1.00 32.54 ? 127  SER D OG  1 
ATOM   812  N N   . GLN B 1 9   ? -12.071 -12.114 -21.019 1.00 29.58 ? 128  GLN D N   1 
ATOM   813  C CA  . GLN B 1 9   ? -13.088 -12.842 -21.781 1.00 30.97 ? 128  GLN D CA  1 
ATOM   814  C C   . GLN B 1 9   ? -13.326 -14.199 -21.128 1.00 30.95 ? 128  GLN D C   1 
ATOM   815  O O   . GLN B 1 9   ? -12.401 -14.810 -20.622 1.00 32.08 ? 128  GLN D O   1 
ATOM   816  C CB  . GLN B 1 9   ? -12.631 -13.066 -23.236 1.00 30.74 ? 128  GLN D CB  1 
ATOM   817  C CG  . GLN B 1 9   ? -12.672 -11.811 -24.064 1.00 33.05 ? 128  GLN D CG  1 
ATOM   818  C CD  . GLN B 1 9   ? -12.440 -11.989 -25.573 1.00 31.86 ? 128  GLN D CD  1 
ATOM   819  O OE1 . GLN B 1 9   ? -13.042 -12.883 -26.236 1.00 31.07 ? 128  GLN D OE1 1 
ATOM   820  N NE2 . GLN B 1 9   ? -11.654 -11.054 -26.148 1.00 30.88 ? 128  GLN D NE2 1 
ATOM   821  N N   . LEU B 1 10  ? -14.552 -14.694 -21.185 1.00 30.05 ? 129  LEU D N   1 
ATOM   822  C CA  . LEU B 1 10  ? -14.838 -16.075 -20.825 1.00 31.11 ? 129  LEU D CA  1 
ATOM   823  C C   . LEU B 1 10  ? -14.488 -16.952 -22.008 1.00 31.54 ? 129  LEU D C   1 
ATOM   824  O O   . LEU B 1 10  ? -14.925 -16.692 -23.155 1.00 30.93 ? 129  LEU D O   1 
ATOM   825  C CB  . LEU B 1 10  ? -16.349 -16.296 -20.529 1.00 31.42 ? 129  LEU D CB  1 
ATOM   826  C CG  . LEU B 1 10  ? -16.875 -15.704 -19.231 1.00 34.22 ? 129  LEU D CG  1 
ATOM   827  C CD1 . LEU B 1 10  ? -18.361 -15.952 -19.099 1.00 37.16 ? 129  LEU D CD1 1 
ATOM   828  C CD2 . LEU B 1 10  ? -16.163 -16.226 -18.000 1.00 32.72 ? 129  LEU D CD2 1 
ATOM   829  N N   . VAL B 1 11  ? -13.711 -17.983 -21.733 1.00 30.72 ? 130  VAL D N   1 
ATOM   830  C CA  . VAL B 1 11  ? -13.285 -18.903 -22.793 1.00 32.22 ? 130  VAL D CA  1 
ATOM   831  C C   . VAL B 1 11  ? -13.509 -20.371 -22.346 1.00 32.22 ? 130  VAL D C   1 
ATOM   832  O O   . VAL B 1 11  ? -13.390 -20.673 -21.126 1.00 32.78 ? 130  VAL D O   1 
ATOM   833  C CB  . VAL B 1 11  ? -11.759 -18.723 -23.092 1.00 32.11 ? 130  VAL D CB  1 
ATOM   834  C CG1 . VAL B 1 11  ? -11.449 -17.357 -23.731 1.00 32.37 ? 130  VAL D CG1 1 
ATOM   835  C CG2 . VAL B 1 11  ? -10.968 -18.857 -21.821 1.00 30.71 ? 130  VAL D CG2 1 
ATOM   836  N N   . PRO B 1 12  ? -13.724 -21.280 -23.320 1.00 32.21 ? 131  PRO D N   1 
ATOM   837  C CA  . PRO B 1 12  ? -13.762 -22.697 -22.990 1.00 31.90 ? 131  PRO D CA  1 
ATOM   838  C C   . PRO B 1 12  ? -12.408 -23.169 -22.415 1.00 33.08 ? 131  PRO D C   1 
ATOM   839  O O   . PRO B 1 12  ? -11.354 -22.921 -23.015 1.00 31.05 ? 131  PRO D O   1 
ATOM   840  C CB  . PRO B 1 12  ? -14.086 -23.366 -24.335 1.00 33.47 ? 131  PRO D CB  1 
ATOM   841  C CG  . PRO B 1 12  ? -14.720 -22.243 -25.219 1.00 32.25 ? 131  PRO D CG  1 
ATOM   842  C CD  . PRO B 1 12  ? -13.878 -21.043 -24.769 1.00 31.88 ? 131  PRO D CD  1 
ATOM   843  N N   . VAL B 1 13  ? -12.424 -23.831 -21.253 1.00 32.70 ? 132  VAL D N   1 
ATOM   844  C CA  . VAL B 1 13  ? -11.199 -24.423 -20.707 1.00 33.27 ? 132  VAL D CA  1 
ATOM   845  C C   . VAL B 1 13  ? -10.550 -25.318 -21.784 1.00 33.72 ? 132  VAL D C   1 
ATOM   846  O O   . VAL B 1 13  ? -9.328  -25.375 -21.919 1.00 31.69 ? 132  VAL D O   1 
ATOM   847  C CB  . VAL B 1 13  ? -11.491 -25.260 -19.438 1.00 34.12 ? 132  VAL D CB  1 
ATOM   848  C CG1 . VAL B 1 13  ? -10.252 -26.072 -19.042 1.00 36.57 ? 132  VAL D CG1 1 
ATOM   849  C CG2 . VAL B 1 13  ? -11.862 -24.322 -18.288 1.00 34.47 ? 132  VAL D CG2 1 
ATOM   850  N N   . ARG B 1 14  ? -11.379 -25.970 -22.598 1.00 32.02 ? 133  ARG D N   1 
ATOM   851  C CA  . ARG B 1 14  ? -10.837 -26.841 -23.612 1.00 33.24 ? 133  ARG D CA  1 
ATOM   852  C C   . ARG B 1 14  ? -9.989  -26.143 -24.679 1.00 31.86 ? 133  ARG D C   1 
ATOM   853  O O   . ARG B 1 14  ? -9.250  -26.800 -25.416 1.00 32.61 ? 133  ARG D O   1 
ATOM   854  C CB  . ARG B 1 14  ? -11.971 -27.611 -24.285 1.00 34.51 ? 133  ARG D CB  1 
ATOM   855  C CG  . ARG B 1 14  ? -11.729 -29.103 -24.203 1.00 40.78 ? 133  ARG D CG  1 
ATOM   856  C CD  . ARG B 1 14  ? -12.924 -29.917 -24.696 1.00 46.81 ? 133  ARG D CD  1 
ATOM   857  N NE  . ARG B 1 14  ? -13.674 -30.577 -23.622 1.00 49.77 ? 133  ARG D NE  1 
ATOM   858  C CZ  . ARG B 1 14  ? -14.829 -31.204 -23.822 1.00 56.33 ? 133  ARG D CZ  1 
ATOM   859  N NH1 . ARG B 1 14  ? -15.350 -31.243 -25.054 1.00 56.99 ? 133  ARG D NH1 1 
ATOM   860  N NH2 . ARG B 1 14  ? -15.474 -31.790 -22.811 1.00 57.11 ? 133  ARG D NH2 1 
ATOM   861  N N   . ALA B 1 15  ? -10.094 -24.829 -24.773 1.00 31.59 ? 134  ALA D N   1 
ATOM   862  C CA  . ALA B 1 15  ? -9.313  -24.051 -25.764 1.00 30.01 ? 134  ALA D CA  1 
ATOM   863  C C   . ALA B 1 15  ? -7.968  -23.612 -25.218 1.00 30.38 ? 134  ALA D C   1 
ATOM   864  O O   . ALA B 1 15  ? -7.161  -23.063 -25.917 1.00 26.97 ? 134  ALA D O   1 
ATOM   865  C CB  . ALA B 1 15  ? -10.103 -22.838 -26.214 1.00 29.86 ? 134  ALA D CB  1 
ATOM   866  N N   . LEU B 1 16  ? -7.759  -23.824 -23.935 1.00 29.70 ? 135  LEU D N   1 
ATOM   867  C CA  . LEU B 1 16  ? -6.564  -23.315 -23.302 1.00 31.00 ? 135  LEU D CA  1 
ATOM   868  C C   . LEU B 1 16  ? -5.322  -24.132 -23.612 1.00 31.47 ? 135  LEU D C   1 
ATOM   869  O O   . LEU B 1 16  ? -4.221  -23.699 -23.281 1.00 32.36 ? 135  LEU D O   1 
ATOM   870  C CB  . LEU B 1 16  ? -6.763  -23.215 -21.782 1.00 30.32 ? 135  LEU D CB  1 
ATOM   871  C CG  . LEU B 1 16  ? -7.648  -22.074 -21.283 1.00 34.14 ? 135  LEU D CG  1 
ATOM   872  C CD1 . LEU B 1 16  ? -7.901  -22.244 -19.768 1.00 34.22 ? 135  LEU D CD1 1 
ATOM   873  C CD2 . LEU B 1 16  ? -7.060  -20.714 -21.558 1.00 33.59 ? 135  LEU D CD2 1 
ATOM   874  N N   . GLY B 1 17  ? -5.493  -25.312 -24.204 1.00 33.10 ? 136  GLY D N   1 
ATOM   875  C CA  . GLY B 1 17  ? -4.353  -26.175 -24.580 1.00 35.23 ? 136  GLY D CA  1 
ATOM   876  C C   . GLY B 1 17  ? -3.685  -26.831 -23.366 1.00 35.76 ? 136  GLY D C   1 
ATOM   877  O O   . GLY B 1 17  ? -2.463  -26.945 -23.298 1.00 36.03 ? 136  GLY D O   1 
ATOM   878  N N   . LEU B 1 18  ? -4.492  -27.251 -22.410 1.00 35.71 ? 137  LEU D N   1 
ATOM   879  C CA  . LEU B 1 18  ? -3.993  -27.761 -21.125 1.00 36.99 ? 137  LEU D CA  1 
ATOM   880  C C   . LEU B 1 18  ? -3.971  -29.276 -20.940 1.00 38.70 ? 137  LEU D C   1 
ATOM   881  O O   . LEU B 1 18  ? -3.482  -29.769 -19.912 1.00 39.33 ? 137  LEU D O   1 
ATOM   882  C CB  . LEU B 1 18  ? -4.827  -27.190 -19.986 1.00 36.65 ? 137  LEU D CB  1 
ATOM   883  C CG  . LEU B 1 18  ? -4.838  -25.690 -19.812 1.00 35.58 ? 137  LEU D CG  1 
ATOM   884  C CD1 . LEU B 1 18  ? -5.848  -25.315 -18.663 1.00 34.05 ? 137  LEU D CD1 1 
ATOM   885  C CD2 . LEU B 1 18  ? -3.434  -25.215 -19.570 1.00 34.11 ? 137  LEU D CD2 1 
ATOM   886  N N   . GLY B 1 19  ? -4.498  -30.043 -21.876 1.00 39.06 ? 138  GLY D N   1 
ATOM   887  C CA  . GLY B 1 19  ? -4.478  -31.478 -21.638 1.00 42.33 ? 138  GLY D CA  1 
ATOM   888  C C   . GLY B 1 19  ? -5.691  -31.954 -20.838 1.00 43.66 ? 138  GLY D C   1 
ATOM   889  O O   . GLY B 1 19  ? -6.526  -32.672 -21.388 1.00 45.11 ? 138  GLY D O   1 
ATOM   890  N N   . HIS B 1 20  ? -5.808  -31.567 -19.558 1.00 44.24 ? 139  HIS D N   1 
ATOM   891  C CA  . HIS B 1 20  ? -7.065  -31.811 -18.805 1.00 44.50 ? 139  HIS D CA  1 
ATOM   892  C C   . HIS B 1 20  ? -8.247  -31.327 -19.621 1.00 44.39 ? 139  HIS D C   1 
ATOM   893  O O   . HIS B 1 20  ? -8.184  -30.261 -20.238 1.00 45.58 ? 139  HIS D O   1 
ATOM   894  C CB  . HIS B 1 20  ? -7.075  -31.110 -17.442 1.00 45.40 ? 139  HIS D CB  1 
ATOM   895  C CG  . HIS B 1 20  ? -6.053  -31.622 -16.472 1.00 44.67 ? 139  HIS D CG  1 
ATOM   896  N ND1 . HIS B 1 20  ? -5.076  -30.812 -15.932 1.00 47.75 ? 139  HIS D ND1 1 
ATOM   897  C CD2 . HIS B 1 20  ? -5.870  -32.849 -15.929 1.00 46.41 ? 139  HIS D CD2 1 
ATOM   898  C CE1 . HIS B 1 20  ? -4.324  -31.521 -15.109 1.00 48.36 ? 139  HIS D CE1 1 
ATOM   899  N NE2 . HIS B 1 20  ? -4.786  -32.760 -15.087 1.00 49.03 ? 139  HIS D NE2 1 
ATOM   900  N N   . ARG B 1 21  ? -9.302  -32.138 -19.648 1.00 44.30 ? 140  ARG D N   1 
ATOM   901  C CA  . ARG B 1 21  ? -10.519 -31.870 -20.414 1.00 43.84 ? 140  ARG D CA  1 
ATOM   902  C C   . ARG B 1 21  ? -11.538 -31.305 -19.440 1.00 42.31 ? 140  ARG D C   1 
ATOM   903  O O   . ARG B 1 21  ? -11.557 -31.710 -18.288 1.00 41.58 ? 140  ARG D O   1 
ATOM   904  C CB  . ARG B 1 21  ? -11.072 -33.173 -21.013 1.00 44.45 ? 140  ARG D CB  1 
ATOM   905  C CG  . ARG B 1 21  ? -10.217 -33.735 -22.142 1.00 45.50 ? 140  ARG D CG  1 
ATOM   906  C CD  . ARG B 1 21  ? -10.596 -35.158 -22.522 1.00 46.36 ? 140  ARG D CD  1 
ATOM   907  N NE  . ARG B 1 21  ? -9.627  -35.638 -23.513 1.00 52.83 ? 140  ARG D NE  1 
ATOM   908  C CZ  . ARG B 1 21  ? -9.718  -36.773 -24.198 1.00 56.16 ? 140  ARG D CZ  1 
ATOM   909  N NH1 . ARG B 1 21  ? -10.750 -37.615 -24.027 1.00 57.21 ? 140  ARG D NH1 1 
ATOM   910  N NH2 . ARG B 1 21  ? -8.754  -37.070 -25.062 1.00 59.19 ? 140  ARG D NH2 1 
ATOM   911  N N   . SER B 1 22  ? -12.362 -30.372 -19.905 1.00 40.95 ? 141  SER D N   1 
ATOM   912  C CA  . SER B 1 22  ? -13.336 -29.698 -19.047 1.00 41.67 ? 141  SER D CA  1 
ATOM   913  C C   . SER B 1 22  ? -14.486 -29.217 -19.931 1.00 41.31 ? 141  SER D C   1 
ATOM   914  O O   . SER B 1 22  ? -14.343 -29.116 -21.146 1.00 41.07 ? 141  SER D O   1 
ATOM   915  C CB  . SER B 1 22  ? -12.688 -28.545 -18.240 1.00 42.13 ? 141  SER D CB  1 
ATOM   916  O OG  . SER B 1 22  ? -13.553 -28.032 -17.212 1.00 44.07 ? 141  SER D OG  1 
ATOM   917  N N   . ASP B 1 23  ? -15.638 -28.988 -19.314 1.00 40.51 ? 142  ASP D N   1 
ATOM   918  C CA  . ASP B 1 23  ? -16.806 -28.429 -19.973 1.00 40.57 ? 142  ASP D CA  1 
ATOM   919  C C   . ASP B 1 23  ? -17.026 -27.017 -19.438 1.00 39.23 ? 142  ASP D C   1 
ATOM   920  O O   . ASP B 1 23  ? -17.982 -26.332 -19.798 1.00 38.63 ? 142  ASP D O   1 
ATOM   921  C CB  . ASP B 1 23  ? -18.025 -29.286 -19.664 1.00 41.03 ? 142  ASP D CB  1 
ATOM   922  C CG  . ASP B 1 23  ? -18.009 -30.623 -20.393 1.00 45.26 ? 142  ASP D CG  1 
ATOM   923  O OD1 . ASP B 1 23  ? -17.609 -30.661 -21.589 1.00 48.94 ? 142  ASP D OD1 1 
ATOM   924  O OD2 . ASP B 1 23  ? -18.419 -31.636 -19.773 1.00 49.36 ? 142  ASP D OD2 1 
ATOM   925  N N   . GLU B 1 24  ? -16.153 -26.611 -18.543 1.00 38.45 ? 143  GLU D N   1 
ATOM   926  C CA  . GLU B 1 24  ? -16.254 -25.299 -17.962 1.00 38.84 ? 143  GLU D CA  1 
ATOM   927  C C   . GLU B 1 24  ? -15.757 -24.165 -18.880 1.00 38.77 ? 143  GLU D C   1 
ATOM   928  O O   . GLU B 1 24  ? -14.944 -24.380 -19.780 1.00 38.37 ? 143  GLU D O   1 
ATOM   929  C CB  . GLU B 1 24  ? -15.554 -25.274 -16.614 1.00 38.50 ? 143  GLU D CB  1 
ATOM   930  C CG  . GLU B 1 24  ? -16.297 -26.135 -15.586 1.00 39.58 ? 143  GLU D CG  1 
ATOM   931  C CD  . GLU B 1 24  ? -15.888 -25.877 -14.157 1.00 42.23 ? 143  GLU D CD  1 
ATOM   932  O OE1 . GLU B 1 24  ? -16.349 -26.651 -13.296 1.00 42.60 ? 143  GLU D OE1 1 
ATOM   933  O OE2 . GLU B 1 24  ? -15.150 -24.928 -13.877 1.00 45.14 ? 143  GLU D OE2 1 
ATOM   934  N N   . LEU B 1 25  ? -16.294 -22.971 -18.638 1.00 38.12 ? 144  LEU D N   1 
ATOM   935  C CA  . LEU B 1 25  ? -15.752 -21.713 -19.143 1.00 37.32 ? 144  LEU D CA  1 
ATOM   936  C C   . LEU B 1 25  ? -14.964 -21.146 -18.001 1.00 36.76 ? 144  LEU D C   1 
ATOM   937  O O   . LEU B 1 25  ? -15.271 -21.439 -16.823 1.00 35.53 ? 144  LEU D O   1 
ATOM   938  C CB  . LEU B 1 25  ? -16.885 -20.744 -19.525 1.00 37.06 ? 144  LEU D CB  1 
ATOM   939  C CG  . LEU B 1 25  ? -17.891 -21.239 -20.537 1.00 37.12 ? 144  LEU D CG  1 
ATOM   940  C CD1 . LEU B 1 25  ? -19.159 -20.398 -20.459 1.00 37.02 ? 144  LEU D CD1 1 
ATOM   941  C CD2 . LEU B 1 25  ? -17.317 -21.233 -21.932 1.00 38.31 ? 144  LEU D CD2 1 
ATOM   942  N N   . VAL B 1 26  ? -13.891 -20.404 -18.305 1.00 35.60 ? 145  VAL D N   1 
ATOM   943  C CA  . VAL B 1 26  ? -13.178 -19.656 -17.271 1.00 35.50 ? 145  VAL D CA  1 
ATOM   944  C C   . VAL B 1 26  ? -12.913 -18.245 -17.736 1.00 34.39 ? 145  VAL D C   1 
ATOM   945  O O   . VAL B 1 26  ? -12.811 -17.978 -18.940 1.00 34.32 ? 145  VAL D O   1 
ATOM   946  C CB  . VAL B 1 26  ? -11.777 -20.230 -16.859 1.00 36.89 ? 145  VAL D CB  1 
ATOM   947  C CG1 . VAL B 1 26  ? -11.923 -21.473 -15.986 1.00 38.67 ? 145  VAL D CG1 1 
ATOM   948  C CG2 . VAL B 1 26  ? -10.885 -20.487 -18.120 1.00 35.66 ? 145  VAL D CG2 1 
ATOM   949  N N   . ARG B 1 27  ? -12.796 -17.338 -16.788 1.00 33.32 ? 146  ARG D N   1 
ATOM   950  C CA  . ARG B 1 27  ? -12.363 -16.002 -17.129 1.00 35.10 ? 146  ARG D CA  1 
ATOM   951  C C   . ARG B 1 27  ? -10.864 -16.054 -17.465 1.00 33.52 ? 146  ARG D C   1 
ATOM   952  O O   . ARG B 1 27  ? -10.063 -16.525 -16.631 1.00 34.93 ? 146  ARG D O   1 
ATOM   953  C CB  . ARG B 1 27  ? -12.561 -15.029 -15.972 1.00 34.03 ? 146  ARG D CB  1 
ATOM   954  C CG  . ARG B 1 27  ? -13.948 -14.781 -15.614 1.00 41.33 ? 146  ARG D CG  1 
ATOM   955  C CD  . ARG B 1 27  ? -14.470 -13.437 -16.132 1.00 47.83 ? 146  ARG D CD  1 
ATOM   956  N NE  . ARG B 1 27  ? -15.804 -13.234 -15.550 1.00 50.02 ? 146  ARG D NE  1 
ATOM   957  C CZ  . ARG B 1 27  ? -15.997 -12.797 -14.313 1.00 50.10 ? 146  ARG D CZ  1 
ATOM   958  N NH1 . ARG B 1 27  ? -14.953 -12.487 -13.543 1.00 51.95 ? 146  ARG D NH1 1 
ATOM   959  N NH2 . ARG B 1 27  ? -17.228 -12.628 -13.861 1.00 50.90 ? 146  ARG D NH2 1 
ATOM   960  N N   . PHE B 1 28  ? -10.492 -15.584 -18.655 1.00 32.08 ? 147  PHE D N   1 
ATOM   961  C CA  . PHE B 1 28  ? -9.063  -15.488 -18.986 1.00 32.41 ? 147  PHE D CA  1 
ATOM   962  C C   . PHE B 1 28  ? -8.707  -14.047 -19.305 1.00 31.61 ? 147  PHE D C   1 
ATOM   963  O O   . PHE B 1 28  ? -9.428  -13.393 -20.083 1.00 33.12 ? 147  PHE D O   1 
ATOM   964  C CB  . PHE B 1 28  ? -8.776  -16.420 -20.164 1.00 32.00 ? 147  PHE D CB  1 
ATOM   965  C CG  . PHE B 1 28  ? -7.344  -16.490 -20.554 1.00 32.32 ? 147  PHE D CG  1 
ATOM   966  C CD1 . PHE B 1 28  ? -6.464  -17.348 -19.879 1.00 33.29 ? 147  PHE D CD1 1 
ATOM   967  C CD2 . PHE B 1 28  ? -6.866  -15.714 -21.624 1.00 32.27 ? 147  PHE D CD2 1 
ATOM   968  C CE1 . PHE B 1 28  ? -5.135  -17.454 -20.270 1.00 32.78 ? 147  PHE D CE1 1 
ATOM   969  C CE2 . PHE B 1 28  ? -5.514  -15.784 -22.014 1.00 31.64 ? 147  PHE D CE2 1 
ATOM   970  C CZ  . PHE B 1 28  ? -4.643  -16.648 -21.322 1.00 32.60 ? 147  PHE D CZ  1 
ATOM   971  N N   . ARG B 1 29  ? -7.625  -13.551 -18.708 1.00 30.08 ? 148  ARG D N   1 
ATOM   972  C CA  . ARG B 1 29  ? -7.167  -12.205 -18.944 1.00 29.98 ? 148  ARG D CA  1 
ATOM   973  C C   . ARG B 1 29  ? -5.827  -12.171 -19.651 1.00 29.16 ? 148  ARG D C   1 
ATOM   974  O O   . ARG B 1 29  ? -4.977  -13.009 -19.416 1.00 27.77 ? 148  ARG D O   1 
ATOM   975  C CB  . ARG B 1 29  ? -7.149  -11.411 -17.635 1.00 30.68 ? 148  ARG D CB  1 
ATOM   976  C CG  . ARG B 1 29  ? -8.532  -11.346 -16.964 1.00 31.43 ? 148  ARG D CG  1 
ATOM   977  C CD  . ARG B 1 29  ? -8.471  -10.432 -15.715 1.00 33.05 ? 148  ARG D CD  1 
ATOM   978  N NE  . ARG B 1 29  ? -9.801  -10.384 -15.106 1.00 37.49 ? 148  ARG D NE  1 
ATOM   979  C CZ  . ARG B 1 29  ? -10.255 -11.250 -14.202 1.00 40.15 ? 148  ARG D CZ  1 
ATOM   980  N NH1 . ARG B 1 29  ? -9.487  -12.264 -13.793 1.00 39.18 ? 148  ARG D NH1 1 
ATOM   981  N NH2 . ARG B 1 29  ? -11.492 -11.116 -13.730 1.00 38.15 ? 148  ARG D NH2 1 
ATOM   982  N N   . PHE B 1 30  ? -5.694  -11.211 -20.571 1.00 29.45 ? 149  PHE D N   1 
ATOM   983  C CA  . PHE B 1 30  ? -4.533  -11.072 -21.416 1.00 29.94 ? 149  PHE D CA  1 
ATOM   984  C C   . PHE B 1 30  ? -4.340  -9.602  -21.738 1.00 29.87 ? 149  PHE D C   1 
ATOM   985  O O   . PHE B 1 30  ? -5.191  -8.768  -21.393 1.00 30.40 ? 149  PHE D O   1 
ATOM   986  C CB  . PHE B 1 30  ? -4.741  -11.889 -22.711 1.00 27.79 ? 149  PHE D CB  1 
ATOM   987  C CG  . PHE B 1 30  ? -5.915  -11.434 -23.539 1.00 28.71 ? 149  PHE D CG  1 
ATOM   988  C CD1 . PHE B 1 30  ? -5.752  -10.523 -24.535 1.00 28.10 ? 149  PHE D CD1 1 
ATOM   989  C CD2 . PHE B 1 30  ? -7.210  -11.972 -23.310 1.00 27.43 ? 149  PHE D CD2 1 
ATOM   990  C CE1 . PHE B 1 30  ? -6.822  -10.123 -25.362 1.00 29.78 ? 149  PHE D CE1 1 
ATOM   991  C CE2 . PHE B 1 30  ? -8.311  -11.540 -24.109 1.00 31.81 ? 149  PHE D CE2 1 
ATOM   992  C CZ  . PHE B 1 30  ? -8.103  -10.630 -25.149 1.00 29.74 ? 149  PHE D CZ  1 
ATOM   993  N N   . CYS B 1 31  ? -3.236  -9.282  -22.414 1.00 31.58 ? 150  CYS D N   1 
ATOM   994  C CA  . CYS B 1 31  ? -2.830  -7.893  -22.639 1.00 32.25 ? 150  CYS D CA  1 
ATOM   995  C C   . CYS B 1 31  ? -2.847  -7.659  -24.134 1.00 31.65 ? 150  CYS D C   1 
ATOM   996  O O   . CYS B 1 31  ? -2.383  -8.540  -24.873 1.00 30.93 ? 150  CYS D O   1 
ATOM   997  C CB  . CYS B 1 31  ? -1.394  -7.665  -22.115 1.00 32.04 ? 150  CYS D CB  1 
ATOM   998  S SG  . CYS B 1 31  ? -1.332  -7.845  -20.289 1.00 36.90 ? 150  CYS D SG  1 
ATOM   999  N N   . SER B 1 32  ? -3.345  -6.498  -24.574 1.00 31.53 ? 151  SER D N   1 
ATOM   1000 C CA  . SER B 1 32  ? -3.247  -6.109  -26.001 1.00 32.05 ? 151  SER D CA  1 
ATOM   1001 C C   . SER B 1 32  ? -3.445  -4.598  -26.187 1.00 31.54 ? 151  SER D C   1 
ATOM   1002 O O   . SER B 1 32  ? -4.192  -3.968  -25.448 1.00 31.95 ? 151  SER D O   1 
ATOM   1003 C CB  . SER B 1 32  ? -4.288  -6.868  -26.839 1.00 31.71 ? 151  SER D CB  1 
ATOM   1004 O OG  . SER B 1 32  ? -5.568  -6.287  -26.695 1.00 34.31 ? 151  SER D OG  1 
ATOM   1005 N N   . GLY B 1 33  ? -2.803  -4.028  -27.195 1.00 31.66 ? 152  GLY D N   1 
ATOM   1006 C CA  . GLY B 1 33  ? -3.097  -2.655  -27.594 1.00 32.05 ? 152  GLY D CA  1 
ATOM   1007 C C   . GLY B 1 33  ? -1.827  -1.933  -27.994 1.00 32.97 ? 152  GLY D C   1 
ATOM   1008 O O   . GLY B 1 33  ? -0.717  -2.458  -27.826 1.00 32.78 ? 152  GLY D O   1 
ATOM   1009 N N   . SER B 1 34  ? -1.986  -0.714  -28.505 1.00 33.64 ? 153  SER D N   1 
ATOM   1010 C CA  . SER B 1 34  ? -0.836  0.037   -29.037 1.00 34.63 ? 153  SER D CA  1 
ATOM   1011 C C   . SER B 1 34  ? 0.016   0.633   -27.918 1.00 35.66 ? 153  SER D C   1 
ATOM   1012 O O   . SER B 1 34  ? -0.496  1.000   -26.864 1.00 35.19 ? 153  SER D O   1 
ATOM   1013 C CB  . SER B 1 34  ? -1.308  1.139   -29.986 1.00 35.29 ? 153  SER D CB  1 
ATOM   1014 O OG  . SER B 1 34  ? -2.087  2.067   -29.263 1.00 35.03 ? 153  SER D OG  1 
ATOM   1015 N N   . CYS B 1 35  ? 1.319   0.717   -28.181 1.00 37.84 ? 154  CYS D N   1 
ATOM   1016 C CA  . CYS B 1 35  ? 2.326   1.333   -27.311 1.00 39.68 ? 154  CYS D CA  1 
ATOM   1017 C C   . CYS B 1 35  ? 2.963   2.493   -28.082 1.00 41.99 ? 154  CYS D C   1 
ATOM   1018 O O   . CYS B 1 35  ? 4.160   2.514   -28.357 1.00 41.72 ? 154  CYS D O   1 
ATOM   1019 C CB  . CYS B 1 35  ? 3.372   0.286   -26.915 1.00 38.85 ? 154  CYS D CB  1 
ATOM   1020 S SG  . CYS B 1 35  ? 2.674   -1.010  -25.864 1.00 37.76 ? 154  CYS D SG  1 
ATOM   1021 N N   . ARG B 1 36  ? 2.123   3.441   -28.467 1.00 45.41 ? 155  ARG D N   1 
ATOM   1022 C CA  . ARG B 1 36  ? 2.564   4.558   -29.267 1.00 49.30 ? 155  ARG D CA  1 
ATOM   1023 C C   . ARG B 1 36  ? 2.472   5.742   -28.343 1.00 50.77 ? 155  ARG D C   1 
ATOM   1024 O O   . ARG B 1 36  ? 1.416   6.361   -28.204 1.00 51.70 ? 155  ARG D O   1 
ATOM   1025 C CB  . ARG B 1 36  ? 1.677   4.718   -30.495 1.00 49.76 ? 155  ARG D CB  1 
ATOM   1026 C CG  . ARG B 1 36  ? 2.258   4.043   -31.708 1.00 53.63 ? 155  ARG D CG  1 
ATOM   1027 C CD  . ARG B 1 36  ? 1.222   3.786   -32.776 1.00 58.63 ? 155  ARG D CD  1 
ATOM   1028 N NE  . ARG B 1 36  ? 1.850   3.634   -34.093 1.00 61.49 ? 155  ARG D NE  1 
ATOM   1029 C CZ  . ARG B 1 36  ? 1.175   3.389   -35.215 1.00 64.57 ? 155  ARG D CZ  1 
ATOM   1030 N NH1 . ARG B 1 36  ? -0.154  3.244   -35.177 1.00 65.80 ? 155  ARG D NH1 1 
ATOM   1031 N NH2 . ARG B 1 36  ? 1.821   3.280   -36.372 1.00 64.67 ? 155  ARG D NH2 1 
ATOM   1032 N N   . ARG B 1 37  ? 3.569   6.003   -27.649 1.00 52.78 ? 156  ARG D N   1 
ATOM   1033 C CA  . ARG B 1 37  ? 3.608   7.107   -26.708 1.00 54.26 ? 156  ARG D CA  1 
ATOM   1034 C C   . ARG B 1 37  ? 5.030   7.616   -26.598 1.00 54.46 ? 156  ARG D C   1 
ATOM   1035 O O   . ARG B 1 37  ? 5.348   8.722   -27.070 1.00 54.66 ? 156  ARG D O   1 
ATOM   1036 C CB  . ARG B 1 37  ? 3.055   6.676   -25.340 1.00 54.70 ? 156  ARG D CB  1 
ATOM   1037 C CG  . ARG B 1 37  ? 2.808   7.823   -24.365 1.00 57.65 ? 156  ARG D CG  1 
ATOM   1038 C CD  . ARG B 1 37  ? 1.402   8.424   -24.492 1.00 61.67 ? 156  ARG D CD  1 
ATOM   1039 N NE  . ARG B 1 37  ? 1.436   9.900   -24.502 1.00 62.57 ? 156  ARG D NE  1 
ATOM   1040 C CZ  . ARG B 1 37  ? 0.376   10.693  -24.323 1.00 63.31 ? 156  ARG D CZ  1 
ATOM   1041 N NH1 . ARG B 1 37  ? -0.837  10.172  -24.092 1.00 62.96 ? 156  ARG D NH1 1 
ATOM   1042 N NH2 . ARG B 1 37  ? 0.534   12.018  -24.363 1.00 63.33 ? 156  ARG D NH2 1 
ATOM   1043 N N   . ALA B 1 38  ? 5.903   6.812   -25.998 1.00 54.25 ? 157  ALA D N   1 
ATOM   1044 C CA  . ALA B 1 38  ? 7.250   7.298   -25.715 1.00 53.93 ? 157  ALA D CA  1 
ATOM   1045 C C   . ALA B 1 38  ? 8.166   7.202   -26.957 1.00 53.25 ? 157  ALA D C   1 
ATOM   1046 O O   . ALA B 1 38  ? 9.363   6.914   -26.819 1.00 53.96 ? 157  ALA D O   1 
ATOM   1047 C CB  . ALA B 1 38  ? 7.840   6.534   -24.511 1.00 54.03 ? 157  ALA D CB  1 
ATOM   1048 N N   . ARG B 1 39  ? 7.619   7.498   -28.148 1.00 52.01 ? 158  ARG D N   1 
ATOM   1049 C CA  . ARG B 1 39  ? 8.228   7.058   -29.435 1.00 50.70 ? 158  ARG D CA  1 
ATOM   1050 C C   . ARG B 1 39  ? 9.725   7.275   -29.657 1.00 49.03 ? 158  ARG D C   1 
ATOM   1051 O O   . ARG B 1 39  ? 10.198  8.426   -29.728 1.00 48.59 ? 158  ARG D O   1 
ATOM   1052 C CB  . ARG B 1 39  ? 7.434   7.501   -30.671 1.00 51.21 ? 158  ARG D CB  1 
ATOM   1053 C CG  . ARG B 1 39  ? 7.462   6.407   -31.785 1.00 52.83 ? 158  ARG D CG  1 
ATOM   1054 C CD  . ARG B 1 39  ? 6.505   5.229   -31.454 1.00 53.91 ? 158  ARG D CD  1 
ATOM   1055 N NE  . ARG B 1 39  ? 6.466   4.135   -32.442 1.00 51.64 ? 158  ARG D NE  1 
ATOM   1056 C CZ  . ARG B 1 39  ? 6.026   4.264   -33.695 1.00 53.17 ? 158  ARG D CZ  1 
ATOM   1057 N NH1 . ARG B 1 39  ? 5.607   5.444   -34.147 1.00 52.22 ? 158  ARG D NH1 1 
ATOM   1058 N NH2 . ARG B 1 39  ? 5.988   3.209   -34.503 1.00 53.86 ? 158  ARG D NH2 1 
ATOM   1059 N N   . SER B 1 40  ? 10.456  6.160   -29.804 1.00 46.36 ? 159  SER D N   1 
ATOM   1060 C CA  . SER B 1 40  ? 11.927  6.194   -29.812 1.00 44.13 ? 159  SER D CA  1 
ATOM   1061 C C   . SER B 1 40  ? 12.471  6.537   -31.202 1.00 42.45 ? 159  SER D C   1 
ATOM   1062 O O   . SER B 1 40  ? 11.800  6.259   -32.210 1.00 41.88 ? 159  SER D O   1 
ATOM   1063 C CB  . SER B 1 40  ? 12.512  4.850   -29.331 1.00 44.59 ? 159  SER D CB  1 
ATOM   1064 O OG  . SER B 1 40  ? 12.621  3.923   -30.404 1.00 42.74 ? 159  SER D OG  1 
ATOM   1065 N N   . PRO B 1 41  ? 13.684  7.142   -31.260 1.00 40.56 ? 160  PRO D N   1 
ATOM   1066 C CA  . PRO B 1 41  ? 14.326  7.403   -32.547 1.00 39.10 ? 160  PRO D CA  1 
ATOM   1067 C C   . PRO B 1 41  ? 14.406  6.156   -33.435 1.00 36.80 ? 160  PRO D C   1 
ATOM   1068 O O   . PRO B 1 41  ? 14.077  6.216   -34.619 1.00 36.48 ? 160  PRO D O   1 
ATOM   1069 C CB  . PRO B 1 41  ? 15.737  7.893   -32.151 1.00 38.58 ? 160  PRO D CB  1 
ATOM   1070 C CG  . PRO B 1 41  ? 15.574  8.463   -30.793 1.00 40.99 ? 160  PRO D CG  1 
ATOM   1071 C CD  . PRO B 1 41  ? 14.512  7.615   -30.130 1.00 40.55 ? 160  PRO D CD  1 
ATOM   1072 N N   . HIS B 1 42  ? 14.854  5.044   -32.876 1.00 35.69 ? 161  HIS D N   1 
ATOM   1073 C CA  . HIS B 1 42  ? 14.955  3.795   -33.656 1.00 35.40 ? 161  HIS D CA  1 
ATOM   1074 C C   . HIS B 1 42  ? 13.601  3.411   -34.259 1.00 34.84 ? 161  HIS D C   1 
ATOM   1075 O O   . HIS B 1 42  ? 13.513  3.151   -35.453 1.00 33.69 ? 161  HIS D O   1 
ATOM   1076 C CB  . HIS B 1 42  ? 15.551  2.662   -32.807 1.00 34.95 ? 161  HIS D CB  1 
ATOM   1077 C CG  . HIS B 1 42  ? 15.685  1.353   -33.540 1.00 34.58 ? 161  HIS D CG  1 
ATOM   1078 N ND1 . HIS B 1 42  ? 14.835  0.277   -33.339 1.00 37.05 ? 161  HIS D ND1 1 
ATOM   1079 C CD2 . HIS B 1 42  ? 16.601  0.938   -34.439 1.00 31.46 ? 161  HIS D CD2 1 
ATOM   1080 C CE1 . HIS B 1 42  ? 15.201  -0.731  -34.118 1.00 31.91 ? 161  HIS D CE1 1 
ATOM   1081 N NE2 . HIS B 1 42  ? 16.269  -0.358  -34.796 1.00 39.63 ? 161  HIS D NE2 1 
ATOM   1082 N N   . ASP B 1 43  ? 12.540  3.457   -33.440 1.00 35.43 ? 162  ASP D N   1 
ATOM   1083 C CA  . ASP B 1 43  ? 11.187  3.001   -33.834 1.00 35.65 ? 162  ASP D CA  1 
ATOM   1084 C C   . ASP B 1 43  ? 10.580  3.947   -34.836 1.00 34.45 ? 162  ASP D C   1 
ATOM   1085 O O   . ASP B 1 43  ? 9.871   3.537   -35.727 1.00 33.37 ? 162  ASP D O   1 
ATOM   1086 C CB  . ASP B 1 43  ? 10.256  2.979   -32.599 1.00 36.52 ? 162  ASP D CB  1 
ATOM   1087 C CG  . ASP B 1 43  ? 10.457  1.749   -31.732 1.00 40.47 ? 162  ASP D CG  1 
ATOM   1088 O OD1 . ASP B 1 43  ? 10.982  0.737   -32.247 1.00 45.03 ? 162  ASP D OD1 1 
ATOM   1089 O OD2 . ASP B 1 43  ? 10.072  1.784   -30.543 1.00 44.06 ? 162  ASP D OD2 1 
ATOM   1090 N N   . LEU B 1 44  ? 10.826  5.234   -34.647 1.00 35.45 ? 163  LEU D N   1 
ATOM   1091 C CA  . LEU B 1 44  ? 10.417  6.240   -35.627 1.00 36.79 ? 163  LEU D CA  1 
ATOM   1092 C C   . LEU B 1 44  ? 11.037  5.962   -36.983 1.00 36.46 ? 163  LEU D C   1 
ATOM   1093 O O   . LEU B 1 44  ? 10.339  6.015   -38.005 1.00 36.34 ? 163  LEU D O   1 
ATOM   1094 C CB  . LEU B 1 44  ? 10.785  7.650   -35.164 1.00 37.47 ? 163  LEU D CB  1 
ATOM   1095 C CG  . LEU B 1 44  ? 9.906   8.223   -34.043 1.00 39.67 ? 163  LEU D CG  1 
ATOM   1096 C CD1 . LEU B 1 44  ? 10.536  9.480   -33.479 1.00 41.44 ? 163  LEU D CD1 1 
ATOM   1097 C CD2 . LEU B 1 44  ? 8.478   8.481   -34.535 1.00 42.13 ? 163  LEU D CD2 1 
ATOM   1098 N N   . SER B 1 45  ? 12.327  5.627   -37.001 1.00 36.51 ? 164  SER D N   1 
ATOM   1099 C CA  . SER B 1 45  ? 13.000  5.374   -38.288 1.00 36.10 ? 164  SER D CA  1 
ATOM   1100 C C   . SER B 1 45  ? 12.629  4.037   -38.878 1.00 36.36 ? 164  SER D C   1 
ATOM   1101 O O   . SER B 1 45  ? 12.382  3.956   -40.089 1.00 35.08 ? 164  SER D O   1 
ATOM   1102 C CB  . SER B 1 45  ? 14.533  5.538   -38.186 1.00 37.08 ? 164  SER D CB  1 
ATOM   1103 O OG  . SER B 1 45  ? 14.847  6.921   -38.217 1.00 35.57 ? 164  SER D OG  1 
ATOM   1104 N N   . LEU B 1 46  ? 12.560  2.997   -38.032 1.00 36.93 ? 165  LEU D N   1 
ATOM   1105 C CA  . LEU B 1 46  ? 12.031  1.686   -38.449 1.00 37.78 ? 165  LEU D CA  1 
ATOM   1106 C C   . LEU B 1 46  ? 10.658  1.843   -39.084 1.00 37.81 ? 165  LEU D C   1 
ATOM   1107 O O   . LEU B 1 46  ? 10.405  1.319   -40.162 1.00 38.30 ? 165  LEU D O   1 
ATOM   1108 C CB  . LEU B 1 46  ? 12.032  0.676   -37.278 1.00 36.90 ? 165  LEU D CB  1 
ATOM   1109 C CG  . LEU B 1 46  ? 11.812  -0.829  -37.518 1.00 38.29 ? 165  LEU D CG  1 
ATOM   1110 C CD1 . LEU B 1 46  ? 12.705  -1.409  -38.635 1.00 38.93 ? 165  LEU D CD1 1 
ATOM   1111 C CD2 . LEU B 1 46  ? 12.005  -1.625  -36.203 1.00 38.80 ? 165  LEU D CD2 1 
ATOM   1112 N N   . ALA B 1 47  ? 9.780   2.613   -38.443 1.00 38.57 ? 166  ALA D N   1 
ATOM   1113 C CA  . ALA B 1 47  ? 8.439   2.823   -38.964 1.00 39.11 ? 166  ALA D CA  1 
ATOM   1114 C C   . ALA B 1 47  ? 8.477   3.609   -40.289 1.00 39.92 ? 166  ALA D C   1 
ATOM   1115 O O   . ALA B 1 47  ? 7.667   3.367   -41.200 1.00 39.68 ? 166  ALA D O   1 
ATOM   1116 C CB  . ALA B 1 47  ? 7.581   3.538   -37.939 1.00 39.87 ? 166  ALA D CB  1 
ATOM   1117 N N   . SER B 1 48  ? 9.415   4.552   -40.385 1.00 39.68 ? 167  SER D N   1 
ATOM   1118 C CA  . SER B 1 48  ? 9.596   5.339   -41.595 1.00 40.93 ? 167  SER D CA  1 
ATOM   1119 C C   . SER B 1 48  ? 10.036  4.410   -42.739 1.00 40.60 ? 167  SER D C   1 
ATOM   1120 O O   . SER B 1 48  ? 9.472   4.450   -43.835 1.00 41.07 ? 167  SER D O   1 
ATOM   1121 C CB  . SER B 1 48  ? 10.639  6.439   -41.341 1.00 40.39 ? 167  SER D CB  1 
ATOM   1122 O OG  . SER B 1 48  ? 10.601  7.457   -42.339 1.00 43.88 ? 167  SER D OG  1 
ATOM   1123 N N   . LEU B 1 49  ? 11.015  3.553   -42.457 1.00 40.91 ? 168  LEU D N   1 
ATOM   1124 C CA  . LEU B 1 49  ? 11.619  2.671   -43.464 1.00 41.80 ? 168  LEU D CA  1 
ATOM   1125 C C   . LEU B 1 49  ? 10.656  1.623   -43.942 1.00 42.43 ? 168  LEU D C   1 
ATOM   1126 O O   . LEU B 1 49  ? 10.628  1.314   -45.129 1.00 42.61 ? 168  LEU D O   1 
ATOM   1127 C CB  . LEU B 1 49  ? 12.833  1.958   -42.880 1.00 41.48 ? 168  LEU D CB  1 
ATOM   1128 C CG  . LEU B 1 49  ? 14.065  2.793   -42.582 1.00 40.53 ? 168  LEU D CG  1 
ATOM   1129 C CD1 . LEU B 1 49  ? 14.880  1.967   -41.675 1.00 37.94 ? 168  LEU D CD1 1 
ATOM   1130 C CD2 . LEU B 1 49  ? 14.849  3.146   -43.858 1.00 40.52 ? 168  LEU D CD2 1 
ATOM   1131 N N   . LEU B 1 50  ? 9.887   1.064   -43.000 1.00 43.73 ? 169  LEU D N   1 
ATOM   1132 C CA  . LEU B 1 50  ? 8.791   0.141   -43.320 1.00 45.28 ? 169  LEU D CA  1 
ATOM   1133 C C   . LEU B 1 50  ? 7.719   0.840   -44.157 1.00 46.12 ? 169  LEU D C   1 
ATOM   1134 O O   . LEU B 1 50  ? 7.201   0.270   -45.120 1.00 46.96 ? 169  LEU D O   1 
ATOM   1135 C CB  . LEU B 1 50  ? 8.200   -0.493  -42.046 1.00 45.26 ? 169  LEU D CB  1 
ATOM   1136 C CG  . LEU B 1 50  ? 9.162   -1.403  -41.262 1.00 44.62 ? 169  LEU D CG  1 
ATOM   1137 C CD1 . LEU B 1 50  ? 8.647   -1.735  -39.850 1.00 42.98 ? 169  LEU D CD1 1 
ATOM   1138 C CD2 . LEU B 1 50  ? 9.515   -2.676  -42.050 1.00 45.46 ? 169  LEU D CD2 1 
ATOM   1139 N N   . GLY B 1 51  ? 7.433   2.093   -43.820 1.00 47.25 ? 170  GLY D N   1 
ATOM   1140 C CA  . GLY B 1 51  ? 6.484   2.913   -44.594 1.00 47.40 ? 170  GLY D CA  1 
ATOM   1141 C C   . GLY B 1 51  ? 6.956   3.318   -45.973 1.00 47.32 ? 170  GLY D C   1 
ATOM   1142 O O   . GLY B 1 51  ? 6.147   3.446   -46.894 1.00 47.45 ? 170  GLY D O   1 
ATOM   1143 N N   . ALA B 1 52  ? 8.259   3.566   -46.111 1.00 47.51 ? 171  ALA D N   1 
ATOM   1144 C CA  . ALA B 1 52  ? 8.880   3.888   -47.399 1.00 47.00 ? 171  ALA D CA  1 
ATOM   1145 C C   . ALA B 1 52  ? 9.244   2.628   -48.216 1.00 47.03 ? 171  ALA D C   1 
ATOM   1146 O O   . ALA B 1 52  ? 9.625   2.725   -49.388 1.00 47.14 ? 171  ALA D O   1 
ATOM   1147 C CB  . ALA B 1 52  ? 10.106  4.772   -47.188 1.00 47.44 ? 171  ALA D CB  1 
ATOM   1148 N N   . GLY B 1 53  ? 9.122   1.461   -47.577 1.00 47.21 ? 172  GLY D N   1 
ATOM   1149 C CA  . GLY B 1 53  ? 9.379   0.159   -48.181 1.00 47.23 ? 172  GLY D CA  1 
ATOM   1150 C C   . GLY B 1 53  ? 10.847  -0.029  -48.474 1.00 47.68 ? 172  GLY D C   1 
ATOM   1151 O O   . GLY B 1 53  ? 11.210  -0.682  -49.455 1.00 47.31 ? 172  GLY D O   1 
ATOM   1152 N N   . ALA B 1 54  ? 11.694  0.554   -47.622 1.00 47.53 ? 173  ALA D N   1 
ATOM   1153 C CA  . ALA B 1 54  ? 13.147  0.533   -47.808 1.00 47.50 ? 173  ALA D CA  1 
ATOM   1154 C C   . ALA B 1 54  ? 13.782  -0.717  -47.211 1.00 47.94 ? 173  ALA D C   1 
ATOM   1155 O O   . ALA B 1 54  ? 14.972  -0.968  -47.415 1.00 47.96 ? 173  ALA D O   1 
ATOM   1156 C CB  . ALA B 1 54  ? 13.788  1.792   -47.203 1.00 47.41 ? 173  ALA D CB  1 
ATOM   1157 N N   . LEU B 1 55  ? 12.990  -1.482  -46.453 1.00 48.18 ? 174  LEU D N   1 
ATOM   1158 C CA  . LEU B 1 55  ? 13.453  -2.721  -45.854 1.00 48.42 ? 174  LEU D CA  1 
ATOM   1159 C C   . LEU B 1 55  ? 12.863  -3.942  -46.546 1.00 49.29 ? 174  LEU D C   1 
ATOM   1160 O O   . LEU B 1 55  ? 11.640  -4.117  -46.616 1.00 49.55 ? 174  LEU D O   1 
ATOM   1161 C CB  . LEU B 1 55  ? 13.170  -2.761  -44.339 1.00 48.18 ? 174  LEU D CB  1 
ATOM   1162 C CG  . LEU B 1 55  ? 13.993  -1.851  -43.409 1.00 46.52 ? 174  LEU D CG  1 
ATOM   1163 C CD1 . LEU B 1 55  ? 13.585  -2.069  -41.956 1.00 43.33 ? 174  LEU D CD1 1 
ATOM   1164 C CD2 . LEU B 1 55  ? 15.493  -2.075  -43.559 1.00 43.62 ? 174  LEU D CD2 1 
ATOM   1165 N N   . ARG B 1 56  ? 13.758  -4.767  -47.085 1.00 50.31 ? 175  ARG D N   1 
ATOM   1166 C CA  . ARG B 1 56  ? 13.407  -6.078  -47.599 1.00 51.45 ? 175  ARG D CA  1 
ATOM   1167 C C   . ARG B 1 56  ? 12.930  -6.868  -46.400 1.00 51.60 ? 175  ARG D C   1 
ATOM   1168 O O   . ARG B 1 56  ? 13.571  -6.802  -45.339 1.00 51.80 ? 175  ARG D O   1 
ATOM   1169 C CB  . ARG B 1 56  ? 14.625  -6.786  -48.188 1.00 51.46 ? 175  ARG D CB  1 
ATOM   1170 C CG  . ARG B 1 56  ? 15.411  -6.009  -49.247 1.00 52.73 ? 175  ARG D CG  1 
ATOM   1171 C CD  . ARG B 1 56  ? 16.458  -6.977  -49.826 1.00 57.35 ? 175  ARG D CD  1 
ATOM   1172 N NE  . ARG B 1 56  ? 17.120  -6.482  -51.038 1.00 60.12 ? 175  ARG D NE  1 
ATOM   1173 C CZ  . ARG B 1 56  ? 17.493  -7.248  -52.067 1.00 62.83 ? 175  ARG D CZ  1 
ATOM   1174 N NH1 . ARG B 1 56  ? 17.253  -8.558  -52.051 1.00 64.17 ? 175  ARG D NH1 1 
ATOM   1175 N NH2 . ARG B 1 56  ? 18.096  -6.705  -53.128 1.00 63.52 ? 175  ARG D NH2 1 
ATOM   1176 N N   . PRO B 1 57  ? 11.816  -7.619  -46.546 1.00 51.77 ? 176  PRO D N   1 
ATOM   1177 C CA  . PRO B 1 57  ? 11.335  -8.325  -45.354 1.00 52.17 ? 176  PRO D CA  1 
ATOM   1178 C C   . PRO B 1 57  ? 12.253  -9.498  -44.991 1.00 52.67 ? 176  PRO D C   1 
ATOM   1179 O O   . PRO B 1 57  ? 12.594  -10.307 -45.855 1.00 52.96 ? 176  PRO D O   1 
ATOM   1180 C CB  . PRO B 1 57  ? 9.936   -8.818  -45.759 1.00 51.98 ? 176  PRO D CB  1 
ATOM   1181 C CG  . PRO B 1 57  ? 9.979   -8.901  -47.260 1.00 51.71 ? 176  PRO D CG  1 
ATOM   1182 C CD  . PRO B 1 57  ? 10.991  -7.892  -47.745 1.00 51.73 ? 176  PRO D CD  1 
ATOM   1183 N N   . PRO B 1 58  ? 12.692  -9.563  -43.723 1.00 52.79 ? 177  PRO D N   1 
ATOM   1184 C CA  . PRO B 1 58  ? 13.524  -10.662 -43.245 1.00 52.67 ? 177  PRO D CA  1 
ATOM   1185 C C   . PRO B 1 58  ? 12.776  -11.992 -43.272 1.00 53.20 ? 177  PRO D C   1 
ATOM   1186 O O   . PRO B 1 58  ? 11.541  -11.994 -43.419 1.00 53.26 ? 177  PRO D O   1 
ATOM   1187 C CB  . PRO B 1 58  ? 13.835  -10.250 -41.798 1.00 52.85 ? 177  PRO D CB  1 
ATOM   1188 C CG  . PRO B 1 58  ? 13.667  -8.764  -41.785 1.00 52.37 ? 177  PRO D CG  1 
ATOM   1189 C CD  . PRO B 1 58  ? 12.481  -8.550  -42.677 1.00 53.09 ? 177  PRO D CD  1 
ATOM   1190 N N   . PRO B 1 59  ? 13.507  -13.124 -43.159 1.00 53.58 ? 178  PRO D N   1 
ATOM   1191 C CA  . PRO B 1 59  ? 12.808  -14.404 -42.938 1.00 53.72 ? 178  PRO D CA  1 
ATOM   1192 C C   . PRO B 1 59  ? 12.046  -14.348 -41.621 1.00 53.74 ? 178  PRO D C   1 
ATOM   1193 O O   . PRO B 1 59  ? 12.531  -13.742 -40.663 1.00 53.92 ? 178  PRO D O   1 
ATOM   1194 C CB  . PRO B 1 59  ? 13.949  -15.429 -42.843 1.00 53.78 ? 178  PRO D CB  1 
ATOM   1195 C CG  . PRO B 1 59  ? 15.193  -14.613 -42.551 1.00 53.72 ? 178  PRO D CG  1 
ATOM   1196 C CD  . PRO B 1 59  ? 14.971  -13.305 -43.251 1.00 53.51 ? 178  PRO D CD  1 
ATOM   1197 N N   . GLY B 1 60  ? 10.857  -14.947 -41.584 1.00 53.56 ? 179  GLY D N   1 
ATOM   1198 C CA  . GLY B 1 60  ? 10.048  -14.955 -40.366 1.00 53.07 ? 179  GLY D CA  1 
ATOM   1199 C C   . GLY B 1 60  ? 9.151   -13.744 -40.176 1.00 52.79 ? 179  GLY D C   1 
ATOM   1200 O O   . GLY B 1 60  ? 8.699   -13.121 -41.156 1.00 53.09 ? 179  GLY D O   1 
ATOM   1201 N N   . SER B 1 61  ? 8.881   -13.454 -38.902 1.00 51.61 ? 180  SER D N   1 
ATOM   1202 C CA  . SER B 1 61  ? 8.069   -12.337 -38.435 1.00 51.66 ? 180  SER D CA  1 
ATOM   1203 C C   . SER B 1 61  ? 8.658   -11.036 -38.943 1.00 50.56 ? 180  SER D C   1 
ATOM   1204 O O   . SER B 1 61  ? 9.898   -10.912 -39.019 1.00 50.20 ? 180  SER D O   1 
ATOM   1205 C CB  . SER B 1 61  ? 8.133   -12.262 -36.896 1.00 51.85 ? 180  SER D CB  1 
ATOM   1206 O OG  . SER B 1 61  ? 7.975   -13.532 -36.271 1.00 55.99 ? 180  SER D OG  1 
ATOM   1207 N N   . ARG B 1 62  ? 7.809   -10.057 -39.280 1.00 48.85 ? 181  ARG D N   1 
ATOM   1208 C CA  . ARG B 1 62  ? 8.361   -8.725  -39.566 1.00 47.72 ? 181  ARG D CA  1 
ATOM   1209 C C   . ARG B 1 62  ? 8.732   -7.982  -38.284 1.00 44.17 ? 181  ARG D C   1 
ATOM   1210 O O   . ARG B 1 62  ? 8.226   -8.310  -37.211 1.00 42.65 ? 181  ARG D O   1 
ATOM   1211 C CB  . ARG B 1 62  ? 7.465   -7.889  -40.471 1.00 48.12 ? 181  ARG D CB  1 
ATOM   1212 C CG  . ARG B 1 62  ? 7.374   -8.482  -41.902 1.00 51.55 ? 181  ARG D CG  1 
ATOM   1213 C CD  . ARG B 1 62  ? 6.405   -7.694  -42.771 1.00 51.84 ? 181  ARG D CD  1 
ATOM   1214 N NE  . ARG B 1 62  ? 5.896   -8.449  -43.907 1.00 59.19 ? 181  ARG D NE  1 
ATOM   1215 C CZ  . ARG B 1 62  ? 4.613   -8.432  -44.275 1.00 63.62 ? 181  ARG D CZ  1 
ATOM   1216 N NH1 . ARG B 1 62  ? 3.735   -7.720  -43.568 1.00 66.26 ? 181  ARG D NH1 1 
ATOM   1217 N NH2 . ARG B 1 62  ? 4.189   -9.138  -45.323 1.00 64.91 ? 181  ARG D NH2 1 
ATOM   1218 N N   . PRO B 1 63  ? 9.650   -7.002  -38.388 1.00 41.64 ? 182  PRO D N   1 
ATOM   1219 C CA  . PRO B 1 63  ? 10.024  -6.285  -37.183 1.00 40.75 ? 182  PRO D CA  1 
ATOM   1220 C C   . PRO B 1 63  ? 8.892   -5.418  -36.670 1.00 39.16 ? 182  PRO D C   1 
ATOM   1221 O O   . PRO B 1 63  ? 8.091   -4.933  -37.434 1.00 37.85 ? 182  PRO D O   1 
ATOM   1222 C CB  . PRO B 1 63  ? 11.196  -5.390  -37.638 1.00 39.56 ? 182  PRO D CB  1 
ATOM   1223 C CG  . PRO B 1 63  ? 11.040  -5.258  -39.080 1.00 40.16 ? 182  PRO D CG  1 
ATOM   1224 C CD  . PRO B 1 63  ? 10.378  -6.513  -39.575 1.00 41.88 ? 182  PRO D CD  1 
ATOM   1225 N N   . VAL B 1 64  ? 8.822   -5.254  -35.372 1.00 39.92 ? 183  VAL D N   1 
ATOM   1226 C CA  . VAL B 1 64  ? 7.838   -4.341  -34.800 1.00 40.91 ? 183  VAL D CA  1 
ATOM   1227 C C   . VAL B 1 64  ? 8.498   -2.994  -34.522 1.00 40.94 ? 183  VAL D C   1 
ATOM   1228 O O   . VAL B 1 64  ? 9.643   -2.955  -34.106 1.00 41.65 ? 183  VAL D O   1 
ATOM   1229 C CB  . VAL B 1 64  ? 7.177   -4.919  -33.530 1.00 40.44 ? 183  VAL D CB  1 
ATOM   1230 C CG1 . VAL B 1 64  ? 6.402   -6.238  -33.887 1.00 42.81 ? 183  VAL D CG1 1 
ATOM   1231 C CG2 . VAL B 1 64  ? 8.212   -5.145  -32.447 1.00 41.41 ? 183  VAL D CG2 1 
ATOM   1232 N N   . SER B 1 65  ? 7.779   -1.905  -34.805 1.00 41.50 ? 184  SER D N   1 
ATOM   1233 C CA  . SER B 1 65  ? 8.286   -0.533  -34.598 1.00 40.78 ? 184  SER D CA  1 
ATOM   1234 C C   . SER B 1 65  ? 7.683   0.157   -33.361 1.00 41.42 ? 184  SER D C   1 
ATOM   1235 O O   . SER B 1 65  ? 7.459   1.371   -33.375 1.00 40.99 ? 184  SER D O   1 
ATOM   1236 C CB  . SER B 1 65  ? 7.975   0.303   -35.826 1.00 41.12 ? 184  SER D CB  1 
ATOM   1237 O OG  . SER B 1 65  ? 6.573   0.273   -36.084 1.00 40.33 ? 184  SER D OG  1 
ATOM   1238 N N   . GLN B 1 66  ? 7.444   -0.628  -32.303 1.00 41.39 ? 185  GLN D N   1 
ATOM   1239 C CA  . GLN B 1 66  ? 6.757   -0.209  -31.064 1.00 41.05 ? 185  GLN D CA  1 
ATOM   1240 C C   . GLN B 1 66  ? 7.060   -1.218  -29.969 1.00 39.59 ? 185  GLN D C   1 
ATOM   1241 O O   . GLN B 1 66  ? 7.250   -2.392  -30.250 1.00 40.07 ? 185  GLN D O   1 
ATOM   1242 C CB  . GLN B 1 66  ? 5.250   -0.323  -31.244 1.00 42.86 ? 185  GLN D CB  1 
ATOM   1243 C CG  . GLN B 1 66  ? 4.505   0.881   -31.682 1.00 44.98 ? 185  GLN D CG  1 
ATOM   1244 C CD  . GLN B 1 66  ? 3.026   0.528   -31.827 1.00 46.20 ? 185  GLN D CD  1 
ATOM   1245 O OE1 . GLN B 1 66  ? 2.395   0.023   -30.895 1.00 48.17 ? 185  GLN D OE1 1 
ATOM   1246 N NE2 . GLN B 1 66  ? 2.484   0.755   -33.012 1.00 49.24 ? 185  GLN D NE2 1 
ATOM   1247 N N   . PRO B 1 67  ? 7.034   -0.790  -28.701 1.00 38.43 ? 186  PRO D N   1 
ATOM   1248 C CA  . PRO B 1 67  ? 7.049   -1.804  -27.682 1.00 37.47 ? 186  PRO D CA  1 
ATOM   1249 C C   . PRO B 1 67  ? 5.782   -2.687  -27.815 1.00 37.50 ? 186  PRO D C   1 
ATOM   1250 O O   . PRO B 1 67  ? 4.775   -2.257  -28.417 1.00 36.42 ? 186  PRO D O   1 
ATOM   1251 C CB  . PRO B 1 67  ? 7.057   -0.995  -26.375 1.00 38.09 ? 186  PRO D CB  1 
ATOM   1252 C CG  . PRO B 1 67  ? 7.595   0.345   -26.762 1.00 37.21 ? 186  PRO D CG  1 
ATOM   1253 C CD  . PRO B 1 67  ? 7.044   0.572   -28.133 1.00 39.14 ? 186  PRO D CD  1 
ATOM   1254 N N   . CYS B 1 68  ? 5.855   -3.906  -27.291 1.00 38.00 ? 187  CYS D N   1 
ATOM   1255 C CA  . CYS B 1 68  ? 4.699   -4.851  -27.277 1.00 39.50 ? 187  CYS D CA  1 
ATOM   1256 C C   . CYS B 1 68  ? 3.925   -4.804  -25.970 1.00 37.61 ? 187  CYS D C   1 
ATOM   1257 O O   . CYS B 1 68  ? 4.516   -4.690  -24.888 1.00 36.40 ? 187  CYS D O   1 
ATOM   1258 C CB  . CYS B 1 68  ? 5.122   -6.298  -27.595 1.00 41.20 ? 187  CYS D CB  1 
ATOM   1259 S SG  . CYS B 1 68  ? 6.450   -7.063  -26.573 1.00 51.39 ? 187  CYS D SG  1 
ATOM   1260 N N   . CYS B 1 69  ? 2.592   -4.863  -26.082 1.00 36.03 ? 188  CYS D N   1 
ATOM   1261 C CA  . CYS B 1 69  ? 1.725   -4.931  -24.907 1.00 35.33 ? 188  CYS D CA  1 
ATOM   1262 C C   . CYS B 1 69  ? 1.822   -6.326  -24.297 1.00 34.25 ? 188  CYS D C   1 
ATOM   1263 O O   . CYS B 1 69  ? 1.397   -7.314  -24.904 1.00 32.23 ? 188  CYS D O   1 
ATOM   1264 C CB  . CYS B 1 69  ? 0.264   -4.604  -25.275 1.00 35.94 ? 188  CYS D CB  1 
ATOM   1265 S SG  . CYS B 1 69  ? -0.788  -4.303  -23.837 1.00 35.99 ? 188  CYS D SG  1 
ATOM   1266 N N   . ARG B 1 70  ? 2.416   -6.428  -23.115 1.00 31.80 ? 189  ARG D N   1 
ATOM   1267 C CA  . ARG B 1 70  ? 2.653   -7.732  -22.504 1.00 31.99 ? 189  ARG D CA  1 
ATOM   1268 C C   . ARG B 1 70  ? 2.259   -7.825  -21.035 1.00 31.44 ? 189  ARG D C   1 
ATOM   1269 O O   . ARG B 1 70  ? 2.279   -6.796  -20.310 1.00 31.72 ? 189  ARG D O   1 
ATOM   1270 C CB  . ARG B 1 70  ? 4.141   -8.103  -22.620 1.00 33.17 ? 189  ARG D CB  1 
ATOM   1271 C CG  . ARG B 1 70  ? 4.657   -8.290  -24.069 1.00 34.38 ? 189  ARG D CG  1 
ATOM   1272 C CD  . ARG B 1 70  ? 4.149   -9.578  -24.703 1.00 37.47 ? 189  ARG D CD  1 
ATOM   1273 N NE  . ARG B 1 70  ? 4.889   -10.660 -24.056 1.00 36.38 ? 189  ARG D NE  1 
ATOM   1274 C CZ  . ARG B 1 70  ? 4.479   -11.896 -23.966 1.00 36.23 ? 189  ARG D CZ  1 
ATOM   1275 N NH1 . ARG B 1 70  ? 3.290   -12.259 -24.487 1.00 36.13 ? 189  ARG D NH1 1 
ATOM   1276 N NH2 . ARG B 1 70  ? 5.266   -12.770 -23.374 1.00 38.92 ? 189  ARG D NH2 1 
ATOM   1277 N N   . PRO B 1 71  ? 1.971   -9.052  -20.539 1.00 30.85 ? 190  PRO D N   1 
ATOM   1278 C CA  . PRO B 1 71  ? 1.676   -9.106  -19.093 1.00 30.77 ? 190  PRO D CA  1 
ATOM   1279 C C   . PRO B 1 71  ? 2.890   -8.934  -18.225 1.00 32.13 ? 190  PRO D C   1 
ATOM   1280 O O   . PRO B 1 71  ? 4.009   -9.251  -18.639 1.00 33.52 ? 190  PRO D O   1 
ATOM   1281 C CB  . PRO B 1 71  ? 1.097   -10.523 -18.885 1.00 31.47 ? 190  PRO D CB  1 
ATOM   1282 C CG  . PRO B 1 71  ? 0.859   -11.089 -20.269 1.00 29.61 ? 190  PRO D CG  1 
ATOM   1283 C CD  . PRO B 1 71  ? 1.886   -10.389 -21.147 1.00 30.65 ? 190  PRO D CD  1 
ATOM   1284 N N   . THR B 1 72  ? 2.683   -8.392  -17.041 1.00 32.10 ? 191  THR D N   1 
ATOM   1285 C CA  . THR B 1 72  ? 3.779   -8.096  -16.135 1.00 32.24 ? 191  THR D CA  1 
ATOM   1286 C C   . THR B 1 72  ? 3.633   -8.920  -14.838 1.00 33.01 ? 191  THR D C   1 
ATOM   1287 O O   . THR B 1 72  ? 4.582   -9.040  -14.020 1.00 33.84 ? 191  THR D O   1 
ATOM   1288 C CB  . THR B 1 72  ? 3.825   -6.576  -15.807 1.00 32.98 ? 191  THR D CB  1 
ATOM   1289 O OG1 . THR B 1 72  ? 2.522   -6.121  -15.458 1.00 32.88 ? 191  THR D OG1 1 
ATOM   1290 C CG2 . THR B 1 72  ? 4.331   -5.785  -16.999 1.00 31.29 ? 191  THR D CG2 1 
ATOM   1291 N N   . ARG B 1 73  ? 2.421   -9.425  -14.626 1.00 33.31 ? 192  ARG D N   1 
ATOM   1292 C CA  . ARG B 1 73  ? 2.044   -10.209 -13.433 1.00 34.57 ? 192  ARG D CA  1 
ATOM   1293 C C   . ARG B 1 73  ? 0.958   -11.198 -13.838 1.00 32.81 ? 192  ARG D C   1 
ATOM   1294 O O   . ARG B 1 73  ? 0.264   -10.940 -14.812 1.00 32.37 ? 192  ARG D O   1 
ATOM   1295 C CB  . ARG B 1 73  ? 1.455   -9.314  -12.374 1.00 33.62 ? 192  ARG D CB  1 
ATOM   1296 C CG  . ARG B 1 73  ? 2.454   -8.433  -11.756 1.00 37.23 ? 192  ARG D CG  1 
ATOM   1297 C CD  . ARG B 1 73  ? 1.989   -7.987  -10.397 1.00 40.28 ? 192  ARG D CD  1 
ATOM   1298 N NE  . ARG B 1 73  ? 1.169   -6.790  -10.556 1.00 50.66 ? 192  ARG D NE  1 
ATOM   1299 C CZ  . ARG B 1 73  ? 1.697   -5.588  -10.805 1.00 52.90 ? 192  ARG D CZ  1 
ATOM   1300 N NH1 . ARG B 1 73  ? 3.002   -5.462  -10.942 1.00 57.15 ? 192  ARG D NH1 1 
ATOM   1301 N NH2 . ARG B 1 73  ? 0.907   -4.526  -10.948 1.00 58.39 ? 192  ARG D NH2 1 
ATOM   1302 N N   . TYR B 1 74  ? 0.764   -12.279 -13.072 1.00 33.45 ? 193  TYR D N   1 
ATOM   1303 C CA  . TYR B 1 74  ? -0.205  -13.375 -13.458 1.00 34.39 ? 193  TYR D CA  1 
ATOM   1304 C C   . TYR B 1 74  ? -0.941  -13.932 -12.259 1.00 35.34 ? 193  TYR D C   1 
ATOM   1305 O O   . TYR B 1 74  ? -0.486  -13.779 -11.145 1.00 34.32 ? 193  TYR D O   1 
ATOM   1306 C CB  . TYR B 1 74  ? 0.519   -14.562 -14.074 1.00 34.99 ? 193  TYR D CB  1 
ATOM   1307 C CG  . TYR B 1 74  ? 1.431   -14.193 -15.192 1.00 36.93 ? 193  TYR D CG  1 
ATOM   1308 C CD1 . TYR B 1 74  ? 0.993   -14.205 -16.521 1.00 37.16 ? 193  TYR D CD1 1 
ATOM   1309 C CD2 . TYR B 1 74  ? 2.746   -13.837 -14.930 1.00 39.48 ? 193  TYR D CD2 1 
ATOM   1310 C CE1 . TYR B 1 74  ? 1.872   -13.836 -17.552 1.00 38.07 ? 193  TYR D CE1 1 
ATOM   1311 C CE2 . TYR B 1 74  ? 3.617   -13.474 -15.949 1.00 40.31 ? 193  TYR D CE2 1 
ATOM   1312 C CZ  . TYR B 1 74  ? 3.174   -13.473 -17.234 1.00 41.27 ? 193  TYR D CZ  1 
ATOM   1313 O OH  . TYR B 1 74  ? 4.054   -13.116 -18.219 1.00 39.79 ? 193  TYR D OH  1 
ATOM   1314 N N   . GLU B 1 75  ? -2.058  -14.610 -12.493 1.00 35.65 ? 194  GLU D N   1 
ATOM   1315 C CA  . GLU B 1 75  ? -2.689  -15.389 -11.427 1.00 38.00 ? 194  GLU D CA  1 
ATOM   1316 C C   . GLU B 1 75  ? -3.068  -16.767 -11.960 1.00 36.97 ? 194  GLU D C   1 
ATOM   1317 O O   . GLU B 1 75  ? -3.137  -16.955 -13.192 1.00 36.92 ? 194  GLU D O   1 
ATOM   1318 C CB  . GLU B 1 75  ? -3.894  -14.639 -10.869 1.00 37.68 ? 194  GLU D CB  1 
ATOM   1319 C CG  . GLU B 1 75  ? -5.060  -14.419 -11.876 1.00 42.07 ? 194  GLU D CG  1 
ATOM   1320 C CD  . GLU B 1 75  ? -6.207  -13.656 -11.231 1.00 44.27 ? 194  GLU D CD  1 
ATOM   1321 O OE1 . GLU B 1 75  ? -6.512  -13.954 -10.026 1.00 54.11 ? 194  GLU D OE1 1 
ATOM   1322 O OE2 . GLU B 1 75  ? -6.748  -12.709 -11.864 1.00 49.76 ? 194  GLU D OE2 1 
ATOM   1323 N N   . ALA B 1 76  ? -3.325  -17.722 -11.059 1.00 35.64 ? 195  ALA D N   1 
ATOM   1324 C CA  . ALA B 1 76  ? -3.755  -19.066 -11.453 1.00 36.48 ? 195  ALA D CA  1 
ATOM   1325 C C   . ALA B 1 76  ? -5.160  -19.129 -12.091 1.00 35.16 ? 195  ALA D C   1 
ATOM   1326 O O   . ALA B 1 76  ? -5.963  -18.213 -11.947 1.00 35.75 ? 195  ALA D O   1 
ATOM   1327 C CB  . ALA B 1 76  ? -3.655  -20.030 -10.301 1.00 37.59 ? 195  ALA D CB  1 
ATOM   1328 N N   . VAL B 1 77  ? -5.438  -20.227 -12.790 1.00 34.38 ? 196  VAL D N   1 
ATOM   1329 C CA  . VAL B 1 77  ? -6.744  -20.515 -13.369 1.00 33.48 ? 196  VAL D CA  1 
ATOM   1330 C C   . VAL B 1 77  ? -7.106  -21.887 -12.756 1.00 34.14 ? 196  VAL D C   1 
ATOM   1331 O O   . VAL B 1 77  ? -6.224  -22.774 -12.657 1.00 33.45 ? 196  VAL D O   1 
ATOM   1332 C CB  . VAL B 1 77  ? -6.695  -20.597 -14.906 1.00 34.17 ? 196  VAL D CB  1 
ATOM   1333 C CG1 . VAL B 1 77  ? -7.942  -21.257 -15.441 1.00 32.19 ? 196  VAL D CG1 1 
ATOM   1334 C CG2 . VAL B 1 77  ? -6.581  -19.206 -15.531 1.00 33.26 ? 196  VAL D CG2 1 
ATOM   1335 N N   . SER B 1 78  ? -8.336  -22.000 -12.241 1.00 33.20 ? 197  SER D N   1 
ATOM   1336 C CA  . SER B 1 78  ? -8.830  -23.219 -11.583 1.00 33.65 ? 197  SER D CA  1 
ATOM   1337 C C   . SER B 1 78  ? -10.184 -23.613 -12.148 1.00 33.52 ? 197  SER D C   1 
ATOM   1338 O O   . SER B 1 78  ? -10.955 -22.741 -12.583 1.00 34.71 ? 197  SER D O   1 
ATOM   1339 C CB  . SER B 1 78  ? -8.963  -23.050 -10.059 1.00 33.25 ? 197  SER D CB  1 
ATOM   1340 O OG  . SER B 1 78  ? -7.773  -22.575 -9.463  1.00 34.83 ? 197  SER D OG  1 
ATOM   1341 N N   . PHE B 1 79  ? -10.469 -24.911 -12.176 1.00 32.50 ? 198  PHE D N   1 
ATOM   1342 C CA  . PHE B 1 79  ? -11.698 -25.434 -12.825 1.00 33.59 ? 198  PHE D CA  1 
ATOM   1343 C C   . PHE B 1 79  ? -11.900 -26.897 -12.426 1.00 33.30 ? 198  PHE D C   1 
ATOM   1344 O O   . PHE B 1 79  ? -10.970 -27.557 -11.946 1.00 34.20 ? 198  PHE D O   1 
ATOM   1345 C CB  . PHE B 1 79  ? -11.621 -25.281 -14.373 1.00 32.98 ? 198  PHE D CB  1 
ATOM   1346 C CG  . PHE B 1 79  ? -10.416 -25.960 -14.986 1.00 33.59 ? 198  PHE D CG  1 
ATOM   1347 C CD1 . PHE B 1 79  ? -10.472 -27.294 -15.401 1.00 35.12 ? 198  PHE D CD1 1 
ATOM   1348 C CD2 . PHE B 1 79  ? -9.223  -25.270 -15.137 1.00 35.51 ? 198  PHE D CD2 1 
ATOM   1349 C CE1 . PHE B 1 79  ? -9.331  -27.938 -15.952 1.00 32.92 ? 198  PHE D CE1 1 
ATOM   1350 C CE2 . PHE B 1 79  ? -8.088  -25.886 -15.670 1.00 34.40 ? 198  PHE D CE2 1 
ATOM   1351 C CZ  . PHE B 1 79  ? -8.153  -27.233 -16.087 1.00 34.35 ? 198  PHE D CZ  1 
ATOM   1352 N N   . MET B 1 80  ? -13.101 -27.412 -12.597 1.00 34.61 ? 199  MET D N   1 
ATOM   1353 C CA  . MET B 1 80  ? -13.307 -28.823 -12.355 1.00 35.22 ? 199  MET D CA  1 
ATOM   1354 C C   . MET B 1 80  ? -13.236 -29.491 -13.711 1.00 35.09 ? 199  MET D C   1 
ATOM   1355 O O   . MET B 1 80  ? -13.870 -29.039 -14.669 1.00 35.42 ? 199  MET D O   1 
ATOM   1356 C CB  . MET B 1 80  ? -14.641 -29.105 -11.645 1.00 34.22 ? 199  MET D CB  1 
ATOM   1357 C CG  . MET B 1 80  ? -14.776 -28.481 -10.232 1.00 35.72 ? 199  MET D CG  1 
ATOM   1358 S SD  . MET B 1 80  ? -16.437 -28.814 -9.575  1.00 38.04 ? 199  MET D SD  1 
ATOM   1359 C CE  . MET B 1 80  ? -16.237 -30.500 -9.086  1.00 38.71 ? 199  MET D CE  1 
ATOM   1360 N N   . ASP B 1 81  ? -12.474 -30.570 -13.804 1.00 35.12 ? 200  ASP D N   1 
ATOM   1361 C CA  . ASP B 1 81  ? -12.373 -31.294 -15.085 1.00 36.05 ? 200  ASP D CA  1 
ATOM   1362 C C   . ASP B 1 81  ? -13.558 -32.260 -15.301 1.00 36.03 ? 200  ASP D C   1 
ATOM   1363 O O   . ASP B 1 81  ? -14.413 -32.414 -14.433 1.00 37.05 ? 200  ASP D O   1 
ATOM   1364 C CB  . ASP B 1 81  ? -11.002 -31.994 -15.223 1.00 36.07 ? 200  ASP D CB  1 
ATOM   1365 C CG  . ASP B 1 81  ? -10.799 -33.142 -14.220 1.00 37.71 ? 200  ASP D CG  1 
ATOM   1366 O OD1 . ASP B 1 81  ? -9.630  -33.479 -13.945 1.00 40.34 ? 200  ASP D OD1 1 
ATOM   1367 O OD2 . ASP B 1 81  ? -11.782 -33.717 -13.695 1.00 38.46 ? 200  ASP D OD2 1 
ATOM   1368 N N   . VAL B 1 82  ? -13.614 -32.906 -16.455 1.00 36.52 ? 201  VAL D N   1 
ATOM   1369 C CA  . VAL B 1 82  ? -14.747 -33.799 -16.818 1.00 36.46 ? 201  VAL D CA  1 
ATOM   1370 C C   . VAL B 1 82  ? -15.012 -34.937 -15.841 1.00 35.71 ? 201  VAL D C   1 
ATOM   1371 O O   . VAL B 1 82  ? -16.087 -35.528 -15.871 1.00 35.49 ? 201  VAL D O   1 
ATOM   1372 C CB  . VAL B 1 82  ? -14.576 -34.437 -18.220 1.00 37.23 ? 201  VAL D CB  1 
ATOM   1373 C CG1 . VAL B 1 82  ? -14.732 -33.396 -19.318 1.00 38.18 ? 201  VAL D CG1 1 
ATOM   1374 C CG2 . VAL B 1 82  ? -13.228 -35.197 -18.354 1.00 37.88 ? 201  VAL D CG2 1 
ATOM   1375 N N   . ASN B 1 83  ? -14.020 -35.264 -15.016 1.00 36.23 ? 202  ASN D N   1 
ATOM   1376 C CA  . ASN B 1 83  ? -14.167 -36.252 -13.938 1.00 37.29 ? 202  ASN D CA  1 
ATOM   1377 C C   . ASN B 1 83  ? -14.494 -35.577 -12.589 1.00 37.55 ? 202  ASN D C   1 
ATOM   1378 O O   . ASN B 1 83  ? -14.464 -36.217 -11.535 1.00 36.87 ? 202  ASN D O   1 
ATOM   1379 C CB  . ASN B 1 83  ? -12.914 -37.126 -13.799 1.00 37.59 ? 202  ASN D CB  1 
ATOM   1380 C CG  . ASN B 1 83  ? -12.625 -37.964 -15.052 1.00 38.76 ? 202  ASN D CG  1 
ATOM   1381 O OD1 . ASN B 1 83  ? -13.404 -38.840 -15.432 1.00 41.14 ? 202  ASN D OD1 1 
ATOM   1382 N ND2 . ASN B 1 83  ? -11.495 -37.694 -15.688 1.00 40.26 ? 202  ASN D ND2 1 
ATOM   1383 N N   . SER B 1 84  ? -14.788 -34.277 -12.636 1.00 38.27 ? 203  SER D N   1 
ATOM   1384 C CA  . SER B 1 84  ? -15.196 -33.542 -11.437 1.00 38.16 ? 203  SER D CA  1 
ATOM   1385 C C   . SER B 1 84  ? -14.066 -33.427 -10.427 1.00 37.54 ? 203  SER D C   1 
ATOM   1386 O O   . SER B 1 84  ? -14.297 -33.380 -9.227  1.00 37.36 ? 203  SER D O   1 
ATOM   1387 C CB  . SER B 1 84  ? -16.380 -34.265 -10.799 1.00 39.04 ? 203  SER D CB  1 
ATOM   1388 O OG  . SER B 1 84  ? -17.532 -34.121 -11.604 1.00 40.20 ? 203  SER D OG  1 
ATOM   1389 N N   . THR B 1 85  ? -12.833 -33.438 -10.914 1.00 36.74 ? 204  THR D N   1 
ATOM   1390 C CA  . THR B 1 85  ? -11.676 -33.178 -10.075 1.00 36.37 ? 204  THR D CA  1 
ATOM   1391 C C   . THR B 1 85  ? -11.263 -31.720 -10.283 1.00 35.41 ? 204  THR D C   1 
ATOM   1392 O O   . THR B 1 85  ? -11.197 -31.248 -11.411 1.00 34.45 ? 204  THR D O   1 
ATOM   1393 C CB  . THR B 1 85  ? -10.468 -34.149 -10.389 1.00 36.72 ? 204  THR D CB  1 
ATOM   1394 O OG1 . THR B 1 85  ? -10.858 -35.508 -10.139 1.00 38.92 ? 204  THR D OG1 1 
ATOM   1395 C CG2 . THR B 1 85  ? -9.302  -33.842 -9.502  1.00 37.27 ? 204  THR D CG2 1 
ATOM   1396 N N   . TRP B 1 86  ? -11.007 -31.010 -9.186  1.00 34.62 ? 205  TRP D N   1 
ATOM   1397 C CA  . TRP B 1 86  ? -10.506 -29.643 -9.282  1.00 34.40 ? 205  TRP D CA  1 
ATOM   1398 C C   . TRP B 1 86  ? -9.067  -29.640 -9.757  1.00 34.29 ? 205  TRP D C   1 
ATOM   1399 O O   . TRP B 1 86  ? -8.253  -30.405 -9.243  1.00 32.34 ? 205  TRP D O   1 
ATOM   1400 C CB  . TRP B 1 86  ? -10.592 -28.952 -7.927  1.00 35.00 ? 205  TRP D CB  1 
ATOM   1401 C CG  . TRP B 1 86  ? -11.952 -28.338 -7.617  1.00 35.91 ? 205  TRP D CG  1 
ATOM   1402 C CD1 . TRP B 1 86  ? -12.931 -28.869 -6.855  1.00 36.14 ? 205  TRP D CD1 1 
ATOM   1403 C CD2 . TRP B 1 86  ? -12.426 -27.057 -8.052  1.00 34.84 ? 205  TRP D CD2 1 
ATOM   1404 N NE1 . TRP B 1 86  ? -14.001 -28.009 -6.786  1.00 36.43 ? 205  TRP D NE1 1 
ATOM   1405 C CE2 . TRP B 1 86  ? -13.704 -26.875 -7.489  1.00 35.49 ? 205  TRP D CE2 1 
ATOM   1406 C CE3 . TRP B 1 86  ? -11.873 -26.027 -8.826  1.00 36.20 ? 205  TRP D CE3 1 
ATOM   1407 C CZ2 . TRP B 1 86  ? -14.460 -25.722 -7.707  1.00 35.73 ? 205  TRP D CZ2 1 
ATOM   1408 C CZ3 . TRP B 1 86  ? -12.628 -24.877 -9.046  1.00 37.16 ? 205  TRP D CZ3 1 
ATOM   1409 C CH2 . TRP B 1 86  ? -13.901 -24.737 -8.494  1.00 36.78 ? 205  TRP D CH2 1 
ATOM   1410 N N   . ARG B 1 87  ? -8.782  -28.770 -10.741 1.00 34.16 ? 206  ARG D N   1 
ATOM   1411 C CA  . ARG B 1 87  ? -7.460  -28.574 -11.313 1.00 34.78 ? 206  ARG D CA  1 
ATOM   1412 C C   . ARG B 1 87  ? -7.124  -27.105 -11.200 1.00 34.85 ? 206  ARG D C   1 
ATOM   1413 O O   . ARG B 1 87  ? -8.012  -26.276 -11.210 1.00 34.78 ? 206  ARG D O   1 
ATOM   1414 C CB  . ARG B 1 87  ? -7.461  -28.981 -12.792 1.00 35.23 ? 206  ARG D CB  1 
ATOM   1415 C CG  . ARG B 1 87  ? -7.924  -30.446 -13.034 1.00 35.39 ? 206  ARG D CG  1 
ATOM   1416 C CD  . ARG B 1 87  ? -6.948  -31.473 -12.386 1.00 37.94 ? 206  ARG D CD  1 
ATOM   1417 N NE  . ARG B 1 87  ? -7.371  -32.854 -12.600 1.00 38.98 ? 206  ARG D NE  1 
ATOM   1418 C CZ  . ARG B 1 87  ? -6.820  -33.937 -12.058 1.00 41.88 ? 206  ARG D CZ  1 
ATOM   1419 N NH1 . ARG B 1 87  ? -5.774  -33.869 -11.238 1.00 40.83 ? 206  ARG D NH1 1 
ATOM   1420 N NH2 . ARG B 1 87  ? -7.342  -35.117 -12.335 1.00 44.07 ? 206  ARG D NH2 1 
ATOM   1421 N N   . THR B 1 88  ? -5.848  -26.799 -11.041 1.00 33.65 ? 207  THR D N   1 
ATOM   1422 C CA  . THR B 1 88  ? -5.377  -25.423 -10.997 1.00 34.54 ? 207  THR D CA  1 
ATOM   1423 C C   . THR B 1 88  ? -4.082  -25.349 -11.789 1.00 33.21 ? 207  THR D C   1 
ATOM   1424 O O   . THR B 1 88  ? -3.238  -26.230 -11.691 1.00 33.17 ? 207  THR D O   1 
ATOM   1425 C CB  . THR B 1 88  ? -5.225  -24.927 -9.538  1.00 35.82 ? 207  THR D CB  1 
ATOM   1426 O OG1 . THR B 1 88  ? -4.485  -23.696 -9.494  1.00 38.03 ? 207  THR D OG1 1 
ATOM   1427 C CG2 . THR B 1 88  ? -4.473  -25.942 -8.705  1.00 39.06 ? 207  THR D CG2 1 
ATOM   1428 N N   . VAL B 1 89  ? -3.950  -24.311 -12.591 1.00 32.45 ? 208  VAL D N   1 
ATOM   1429 C CA  . VAL B 1 89  ? -2.708  -24.009 -13.296 1.00 32.64 ? 208  VAL D CA  1 
ATOM   1430 C C   . VAL B 1 89  ? -2.203  -22.640 -12.902 1.00 31.91 ? 208  VAL D C   1 
ATOM   1431 O O   . VAL B 1 89  ? -2.853  -21.648 -13.157 1.00 30.52 ? 208  VAL D O   1 
ATOM   1432 C CB  . VAL B 1 89  ? -2.941  -24.126 -14.785 1.00 32.72 ? 208  VAL D CB  1 
ATOM   1433 C CG1 . VAL B 1 89  ? -1.640  -23.872 -15.603 1.00 31.98 ? 208  VAL D CG1 1 
ATOM   1434 C CG2 . VAL B 1 89  ? -3.488  -25.504 -15.056 1.00 35.81 ? 208  VAL D CG2 1 
ATOM   1435 N N   . ASP B 1 90  ? -1.009  -22.579 -12.307 1.00 33.99 ? 209  ASP D N   1 
ATOM   1436 C CA  . ASP B 1 90  ? -0.404  -21.294 -11.912 1.00 35.03 ? 209  ASP D CA  1 
ATOM   1437 C C   . ASP B 1 90  ? -0.012  -20.373 -13.057 1.00 34.60 ? 209  ASP D C   1 
ATOM   1438 O O   . ASP B 1 90  ? 0.317   -20.802 -14.174 1.00 35.99 ? 209  ASP D O   1 
ATOM   1439 C CB  . ASP B 1 90  ? 0.826   -21.484 -10.999 1.00 35.65 ? 209  ASP D CB  1 
ATOM   1440 C CG  . ASP B 1 90  ? 0.529   -22.300 -9.762  1.00 39.61 ? 209  ASP D CG  1 
ATOM   1441 O OD1 . ASP B 1 90  ? 1.417   -23.088 -9.386  1.00 47.81 ? 209  ASP D OD1 1 
ATOM   1442 O OD2 . ASP B 1 90  ? -0.553  -22.194 -9.144  1.00 44.09 ? 209  ASP D OD2 1 
ATOM   1443 N N   . ARG B 1 91  ? -0.035  -19.084 -12.756 1.00 33.91 ? 210  ARG D N   1 
ATOM   1444 C CA  . ARG B 1 91  ? 0.448   -18.044 -13.642 1.00 34.82 ? 210  ARG D CA  1 
ATOM   1445 C C   . ARG B 1 91  ? -0.103  -18.136 -15.073 1.00 33.12 ? 210  ARG D C   1 
ATOM   1446 O O   . ARG B 1 91  ? 0.589   -17.789 -16.030 1.00 34.51 ? 210  ARG D O   1 
ATOM   1447 C CB  . ARG B 1 91  ? 1.992   -18.003 -13.665 1.00 35.40 ? 210  ARG D CB  1 
ATOM   1448 C CG  . ARG B 1 91  ? 2.720   -17.892 -12.284 1.00 37.19 ? 210  ARG D CG  1 
ATOM   1449 C CD  . ARG B 1 91  ? 4.211   -18.146 -12.548 1.00 38.98 ? 210  ARG D CD  1 
ATOM   1450 N NE  . ARG B 1 91  ? 4.439   -17.937 -13.983 1.00 51.59 ? 210  ARG D NE  1 
ATOM   1451 C CZ  . ARG B 1 91  ? 5.608   -17.979 -14.628 1.00 54.09 ? 210  ARG D CZ  1 
ATOM   1452 N NH1 . ARG B 1 91  ? 6.756   -18.225 -13.982 1.00 55.97 ? 210  ARG D NH1 1 
ATOM   1453 N NH2 . ARG B 1 91  ? 5.615   -17.748 -15.949 1.00 55.92 ? 210  ARG D NH2 1 
ATOM   1454 N N   . LEU B 1 92  ? -1.319  -18.609 -15.241 1.00 31.80 ? 211  LEU D N   1 
ATOM   1455 C CA  . LEU B 1 92  ? -1.885  -18.673 -16.611 1.00 32.18 ? 211  LEU D CA  1 
ATOM   1456 C C   . LEU B 1 92  ? -2.549  -17.396 -17.087 1.00 31.63 ? 211  LEU D C   1 
ATOM   1457 O O   . LEU B 1 92  ? -2.690  -17.204 -18.289 1.00 31.80 ? 211  LEU D O   1 
ATOM   1458 C CB  . LEU B 1 92  ? -2.989  -19.712 -16.683 1.00 32.08 ? 211  LEU D CB  1 
ATOM   1459 C CG  . LEU B 1 92  ? -2.868  -21.020 -17.425 1.00 36.37 ? 211  LEU D CG  1 
ATOM   1460 C CD1 . LEU B 1 92  ? -4.255  -21.459 -17.898 1.00 35.21 ? 211  LEU D CD1 1 
ATOM   1461 C CD2 . LEU B 1 92  ? -1.835  -21.026 -18.512 1.00 33.79 ? 211  LEU D CD2 1 
ATOM   1462 N N   . SER B 1 93  ? -3.078  -16.602 -16.159 1.00 30.70 ? 212  SER D N   1 
ATOM   1463 C CA  . SER B 1 93  ? -3.947  -15.481 -16.543 1.00 30.93 ? 212  SER D CA  1 
ATOM   1464 C C   . SER B 1 93  ? -3.234  -14.209 -16.106 1.00 32.55 ? 212  SER D C   1 
ATOM   1465 O O   . SER B 1 93  ? -2.660  -14.170 -15.004 1.00 30.68 ? 212  SER D O   1 
ATOM   1466 C CB  . SER B 1 93  ? -5.353  -15.648 -15.919 1.00 31.62 ? 212  SER D CB  1 
ATOM   1467 O OG  . SER B 1 93  ? -6.287  -14.701 -16.430 1.00 33.62 ? 212  SER D OG  1 
ATOM   1468 N N   . ALA B 1 94  ? -3.197  -13.206 -17.004 1.00 31.75 ? 213  ALA D N   1 
ATOM   1469 C CA  . ALA B 1 94  ? -2.628  -11.892 -16.698 1.00 31.10 ? 213  ALA D CA  1 
ATOM   1470 C C   . ALA B 1 94  ? -3.408  -11.091 -15.661 1.00 31.58 ? 213  ALA D C   1 
ATOM   1471 O O   . ALA B 1 94  ? -4.653  -11.185 -15.562 1.00 30.67 ? 213  ALA D O   1 
ATOM   1472 C CB  . ALA B 1 94  ? -2.483  -11.086 -17.995 1.00 31.87 ? 213  ALA D CB  1 
ATOM   1473 N N   . THR B 1 95  ? -2.692  -10.333 -14.825 1.00 32.04 ? 214  THR D N   1 
ATOM   1474 C CA  . THR B 1 95  ? -3.377  -9.451  -13.884 1.00 32.35 ? 214  THR D CA  1 
ATOM   1475 C C   . THR B 1 95  ? -2.893  -8.001  -14.037 1.00 32.76 ? 214  THR D C   1 
ATOM   1476 O O   . THR B 1 95  ? -3.424  -7.096  -13.397 1.00 32.55 ? 214  THR D O   1 
ATOM   1477 C CB  . THR B 1 95  ? -3.122  -9.854  -12.428 1.00 32.74 ? 214  THR D CB  1 
ATOM   1478 O OG1 . THR B 1 95  ? -1.720  -9.886  -12.211 1.00 33.70 ? 214  THR D OG1 1 
ATOM   1479 C CG2 . THR B 1 95  ? -3.687  -11.198 -12.122 1.00 33.67 ? 214  THR D CG2 1 
ATOM   1480 N N   . ALA B 1 96  ? -1.848  -7.789  -14.829 1.00 32.90 ? 215  ALA D N   1 
ATOM   1481 C CA  . ALA B 1 96  ? -1.377  -6.441  -15.163 1.00 31.90 ? 215  ALA D CA  1 
ATOM   1482 C C   . ALA B 1 96  ? -0.636  -6.455  -16.487 1.00 32.39 ? 215  ALA D C   1 
ATOM   1483 O O   . ALA B 1 96  ? -0.027  -7.466  -16.843 1.00 32.29 ? 215  ALA D O   1 
ATOM   1484 C CB  . ALA B 1 96  ? -0.468  -5.851  -14.037 1.00 33.37 ? 215  ALA D CB  1 
ATOM   1485 N N   . CYS B 1 97  ? -0.646  -5.315  -17.191 1.00 32.23 ? 216  CYS D N   1 
ATOM   1486 C CA  . CYS B 1 97  ? 0.024   -5.187  -18.500 1.00 33.57 ? 216  CYS D CA  1 
ATOM   1487 C C   . CYS B 1 97  ? 1.019   -4.031  -18.545 1.00 32.55 ? 216  CYS D C   1 
ATOM   1488 O O   . CYS B 1 97  ? 0.958   -3.124  -17.724 1.00 33.50 ? 216  CYS D O   1 
ATOM   1489 C CB  . CYS B 1 97  ? -1.007  -4.933  -19.597 1.00 33.48 ? 216  CYS D CB  1 
ATOM   1490 S SG  . CYS B 1 97  ? -2.234  -6.174  -19.640 1.00 41.86 ? 216  CYS D SG  1 
ATOM   1491 N N   . GLY B 1 98  ? 1.886   -4.020  -19.542 1.00 32.70 ? 217  GLY D N   1 
ATOM   1492 C CA  . GLY B 1 98  ? 2.863   -2.925  -19.702 1.00 33.19 ? 217  GLY D CA  1 
ATOM   1493 C C   . GLY B 1 98  ? 3.311   -2.814  -21.133 1.00 34.25 ? 217  GLY D C   1 
ATOM   1494 O O   . GLY B 1 98  ? 3.077   -3.734  -21.896 1.00 32.11 ? 217  GLY D O   1 
ATOM   1495 N N   . CYS B 1 99  ? 3.968   -1.714  -21.510 1.00 35.77 ? 218  CYS D N   1 
ATOM   1496 C CA  . CYS B 1 99  ? 4.526   -1.629  -22.848 1.00 37.83 ? 218  CYS D CA  1 
ATOM   1497 C C   . CYS B 1 99  ? 5.990   -1.988  -22.672 1.00 39.12 ? 218  CYS D C   1 
ATOM   1498 O O   . CYS B 1 99  ? 6.747   -1.232  -22.044 1.00 38.00 ? 218  CYS D O   1 
ATOM   1499 C CB  . CYS B 1 99  ? 4.341   -0.220  -23.448 1.00 39.08 ? 218  CYS D CB  1 
ATOM   1500 S SG  . CYS B 1 99  ? 2.647   0.033   -24.091 1.00 43.18 ? 218  CYS D SG  1 
ATOM   1501 N N   . LEU B 1 100 ? 6.366   -3.153  -23.177 1.00 40.03 ? 219  LEU D N   1 
ATOM   1502 C CA  . LEU B 1 100 ? 7.674   -3.757  -22.870 1.00 42.66 ? 219  LEU D CA  1 
ATOM   1503 C C   . LEU B 1 100 ? 8.534   -3.764  -24.108 1.00 43.21 ? 219  LEU D C   1 
ATOM   1504 O O   . LEU B 1 100 ? 8.012   -3.870  -25.235 1.00 44.19 ? 219  LEU D O   1 
ATOM   1505 C CB  . LEU B 1 100 ? 7.496   -5.193  -22.346 1.00 41.64 ? 219  LEU D CB  1 
ATOM   1506 C CG  . LEU B 1 100 ? 7.015   -5.434  -20.903 1.00 44.17 ? 219  LEU D CG  1 
ATOM   1507 C CD1 . LEU B 1 100 ? 5.595   -4.961  -20.596 1.00 44.23 ? 219  LEU D CD1 1 
ATOM   1508 C CD2 . LEU B 1 100 ? 7.121   -6.897  -20.504 1.00 44.07 ? 219  LEU D CD2 1 
ATOM   1509 N N   . ASP C 2 8   ? 23.121  10.223  -61.075 1.00 49.15 ? 158  ASP A N   1 
ATOM   1510 C CA  . ASP C 2 8   ? 24.210  11.233  -61.326 1.00 50.18 ? 158  ASP A CA  1 
ATOM   1511 C C   . ASP C 2 8   ? 24.987  11.651  -60.078 1.00 48.18 ? 158  ASP A C   1 
ATOM   1512 O O   . ASP C 2 8   ? 25.401  12.814  -59.927 1.00 48.37 ? 158  ASP A O   1 
ATOM   1513 C CB  . ASP C 2 8   ? 23.665  12.479  -62.041 1.00 51.17 ? 158  ASP A CB  1 
ATOM   1514 C CG  . ASP C 2 8   ? 23.778  12.385  -63.568 1.00 55.16 ? 158  ASP A CG  1 
ATOM   1515 O OD1 . ASP C 2 8   ? 23.039  11.576  -64.183 1.00 57.67 ? 158  ASP A OD1 1 
ATOM   1516 O OD2 . ASP C 2 8   ? 24.592  13.145  -64.157 1.00 59.84 ? 158  ASP A OD2 1 
ATOM   1517 N N   . SER C 2 9   ? 25.201  10.698  -59.184 1.00 46.73 ? 159  SER A N   1 
ATOM   1518 C CA  . SER C 2 9   ? 26.016  10.948  -57.991 1.00 45.17 ? 159  SER A CA  1 
ATOM   1519 C C   . SER C 2 9   ? 27.451  11.261  -58.396 1.00 43.77 ? 159  SER A C   1 
ATOM   1520 O O   . SER C 2 9   ? 27.968  10.668  -59.346 1.00 44.36 ? 159  SER A O   1 
ATOM   1521 C CB  . SER C 2 9   ? 26.007  9.708   -57.109 1.00 44.39 ? 159  SER A CB  1 
ATOM   1522 O OG  . SER C 2 9   ? 24.739  9.609   -56.494 1.00 45.95 ? 159  SER A OG  1 
ATOM   1523 N N   . ASP C 2 10  ? 28.116  12.148  -57.666 1.00 41.68 ? 160  ASP A N   1 
ATOM   1524 C CA  . ASP C 2 10  ? 29.507  12.426  -57.964 1.00 40.22 ? 160  ASP A CA  1 
ATOM   1525 C C   . ASP C 2 10  ? 30.388  11.316  -57.397 1.00 38.37 ? 160  ASP A C   1 
ATOM   1526 O O   . ASP C 2 10  ? 29.918  10.449  -56.643 1.00 36.20 ? 160  ASP A O   1 
ATOM   1527 C CB  . ASP C 2 10  ? 29.916  13.787  -57.419 1.00 40.86 ? 160  ASP A CB  1 
ATOM   1528 C CG  . ASP C 2 10  ? 29.823  13.874  -55.882 1.00 42.73 ? 160  ASP A CG  1 
ATOM   1529 O OD1 . ASP C 2 10  ? 29.020  14.680  -55.343 1.00 48.63 ? 160  ASP A OD1 1 
ATOM   1530 O OD2 . ASP C 2 10  ? 30.573  13.176  -55.201 1.00 46.24 ? 160  ASP A OD2 1 
ATOM   1531 N N   . LEU C 2 11  ? 31.655  11.310  -57.788 1.00 36.33 ? 161  LEU A N   1 
ATOM   1532 C CA  . LEU C 2 11  ? 32.503  10.174  -57.430 1.00 35.39 ? 161  LEU A CA  1 
ATOM   1533 C C   . LEU C 2 11  ? 32.948  10.261  -55.977 1.00 34.42 ? 161  LEU A C   1 
ATOM   1534 O O   . LEU C 2 11  ? 33.239  9.254   -55.366 1.00 33.72 ? 161  LEU A O   1 
ATOM   1535 C CB  . LEU C 2 11  ? 33.746  10.076  -58.342 1.00 36.59 ? 161  LEU A CB  1 
ATOM   1536 C CG  . LEU C 2 11  ? 33.359  9.756   -59.795 1.00 36.94 ? 161  LEU A CG  1 
ATOM   1537 C CD1 . LEU C 2 11  ? 34.580  9.454   -60.629 1.00 39.74 ? 161  LEU A CD1 1 
ATOM   1538 C CD2 . LEU C 2 11  ? 32.426  8.578   -59.846 1.00 43.46 ? 161  LEU A CD2 1 
ATOM   1539 N N   . CYS C 2 12  ? 32.995  11.458  -55.410 1.00 33.73 ? 162  CYS A N   1 
ATOM   1540 C CA  . CYS C 2 12  ? 33.299  11.525  -53.966 1.00 33.77 ? 162  CYS A CA  1 
ATOM   1541 C C   . CYS C 2 12  ? 32.214  10.797  -53.137 1.00 32.31 ? 162  CYS A C   1 
ATOM   1542 O O   . CYS C 2 12  ? 32.535  10.044  -52.239 1.00 32.65 ? 162  CYS A O   1 
ATOM   1543 C CB  . CYS C 2 12  ? 33.465  12.962  -53.512 1.00 33.89 ? 162  CYS A CB  1 
ATOM   1544 S SG  . CYS C 2 12  ? 35.117  13.563  -54.082 1.00 39.61 ? 162  CYS A SG  1 
ATOM   1545 N N   . LEU C 2 13  ? 30.949  10.989  -53.493 1.00 32.82 ? 163  LEU A N   1 
ATOM   1546 C CA  . LEU C 2 13  ? 29.840  10.277  -52.859 1.00 32.29 ? 163  LEU A CA  1 
ATOM   1547 C C   . LEU C 2 13  ? 29.988  8.781   -53.128 1.00 32.77 ? 163  LEU A C   1 
ATOM   1548 O O   . LEU C 2 13  ? 29.869  7.981   -52.212 1.00 31.74 ? 163  LEU A O   1 
ATOM   1549 C CB  . LEU C 2 13  ? 28.463  10.776  -53.367 1.00 32.25 ? 163  LEU A CB  1 
ATOM   1550 C CG  . LEU C 2 13  ? 27.227  10.048  -52.797 1.00 32.68 ? 163  LEU A CG  1 
ATOM   1551 C CD1 . LEU C 2 13  ? 27.252  9.920   -51.255 1.00 34.36 ? 163  LEU A CD1 1 
ATOM   1552 C CD2 . LEU C 2 13  ? 25.930  10.712  -53.238 1.00 33.54 ? 163  LEU A CD2 1 
ATOM   1553 N N   . LYS C 2 14  ? 30.189  8.400   -54.389 1.00 31.51 ? 164  LYS A N   1 
ATOM   1554 C CA  . LYS C 2 14  ? 30.380  6.968   -54.701 1.00 32.83 ? 164  LYS A CA  1 
ATOM   1555 C C   . LYS C 2 14  ? 31.515  6.310   -53.901 1.00 33.26 ? 164  LYS A C   1 
ATOM   1556 O O   . LYS C 2 14  ? 31.356  5.169   -53.379 1.00 32.26 ? 164  LYS A O   1 
ATOM   1557 C CB  . LYS C 2 14  ? 30.550  6.749   -56.211 1.00 33.52 ? 164  LYS A CB  1 
ATOM   1558 C CG  . LYS C 2 14  ? 29.285  7.002   -56.999 1.00 33.82 ? 164  LYS A CG  1 
ATOM   1559 C CD  . LYS C 2 14  ? 29.602  6.782   -58.499 1.00 41.47 ? 164  LYS A CD  1 
ATOM   1560 C CE  . LYS C 2 14  ? 28.412  7.016   -59.427 1.00 44.28 ? 164  LYS A CE  1 
ATOM   1561 N NZ  . LYS C 2 14  ? 28.550  6.174   -60.710 1.00 48.64 ? 164  LYS A NZ  1 
ATOM   1562 N N   . PHE C 2 15  ? 32.668  6.970   -53.805 1.00 31.98 ? 165  PHE A N   1 
ATOM   1563 C CA  . PHE C 2 15  ? 33.750  6.400   -52.982 1.00 33.43 ? 165  PHE A CA  1 
ATOM   1564 C C   . PHE C 2 15  ? 33.497  6.319   -51.478 1.00 32.44 ? 165  PHE A C   1 
ATOM   1565 O O   . PHE C 2 15  ? 33.982  5.396   -50.819 1.00 32.52 ? 165  PHE A O   1 
ATOM   1566 C CB  . PHE C 2 15  ? 35.090  7.071   -53.262 1.00 35.10 ? 165  PHE A CB  1 
ATOM   1567 C CG  . PHE C 2 15  ? 35.705  6.608   -54.560 1.00 36.02 ? 165  PHE A CG  1 
ATOM   1568 C CD1 . PHE C 2 15  ? 35.570  7.378   -55.718 1.00 37.23 ? 165  PHE A CD1 1 
ATOM   1569 C CD2 . PHE C 2 15  ? 36.403  5.413   -54.600 1.00 33.53 ? 165  PHE A CD2 1 
ATOM   1570 C CE1 . PHE C 2 15  ? 36.107  6.967   -56.946 1.00 39.71 ? 165  PHE A CE1 1 
ATOM   1571 C CE2 . PHE C 2 15  ? 36.940  4.958   -55.821 1.00 36.71 ? 165  PHE A CE2 1 
ATOM   1572 C CZ  . PHE C 2 15  ? 36.795  5.737   -57.001 1.00 38.60 ? 165  PHE A CZ  1 
ATOM   1573 N N   . ALA C 2 16  ? 32.761  7.287   -50.946 1.00 32.86 ? 166  ALA A N   1 
ATOM   1574 C CA  . ALA C 2 16  ? 32.269  7.208   -49.548 1.00 31.50 ? 166  ALA A CA  1 
ATOM   1575 C C   . ALA C 2 16  ? 31.457  5.948   -49.419 1.00 31.90 ? 166  ALA A C   1 
ATOM   1576 O O   . ALA C 2 16  ? 31.594  5.193   -48.481 1.00 32.77 ? 166  ALA A O   1 
ATOM   1577 C CB  . ALA C 2 16  ? 31.418  8.449   -49.176 1.00 32.11 ? 166  ALA A CB  1 
ATOM   1578 N N   . MET C 2 17  ? 30.583  5.720   -50.368 1.00 29.53 ? 167  MET A N   1 
ATOM   1579 C CA  . MET C 2 17  ? 29.717  4.540   -50.282 1.00 30.25 ? 167  MET A CA  1 
ATOM   1580 C C   . MET C 2 17  ? 30.443  3.187   -50.486 1.00 31.12 ? 167  MET A C   1 
ATOM   1581 O O   . MET C 2 17  ? 30.018  2.159   -49.904 1.00 31.03 ? 167  MET A O   1 
ATOM   1582 C CB  . MET C 2 17  ? 28.531  4.725   -51.229 1.00 30.28 ? 167  MET A CB  1 
ATOM   1583 C CG  . MET C 2 17  ? 27.615  5.899   -50.773 1.00 32.97 ? 167  MET A CG  1 
ATOM   1584 S SD  . MET C 2 17  ? 26.981  5.758   -49.075 1.00 35.75 ? 167  MET A SD  1 
ATOM   1585 C CE  . MET C 2 17  ? 28.123  6.718   -48.115 1.00 30.96 ? 167  MET A CE  1 
ATOM   1586 N N   . LEU C 2 18  ? 31.515  3.154   -51.306 1.00 32.76 ? 168  LEU A N   1 
ATOM   1587 C CA  . LEU C 2 18  ? 32.374  1.949   -51.362 1.00 32.63 ? 168  LEU A CA  1 
ATOM   1588 C C   . LEU C 2 18  ? 32.940  1.600   -50.013 1.00 33.58 ? 168  LEU A C   1 
ATOM   1589 O O   . LEU C 2 18  ? 33.089  0.444   -49.643 1.00 31.24 ? 168  LEU A O   1 
ATOM   1590 C CB  . LEU C 2 18  ? 33.547  2.156   -52.290 1.00 32.51 ? 168  LEU A CB  1 
ATOM   1591 C CG  . LEU C 2 18  ? 33.662  1.698   -53.704 1.00 37.75 ? 168  LEU A CG  1 
ATOM   1592 C CD1 . LEU C 2 18  ? 35.158  1.932   -54.106 1.00 41.99 ? 168  LEU A CD1 1 
ATOM   1593 C CD2 . LEU C 2 18  ? 33.218  0.215   -53.889 1.00 37.56 ? 168  LEU A CD2 1 
ATOM   1594 N N   . CYS C 2 19  ? 33.292  2.610   -49.235 1.00 35.36 ? 169  CYS A N   1 
ATOM   1595 C CA  . CYS C 2 19  ? 33.750  2.392   -47.852 1.00 35.14 ? 169  CYS A CA  1 
ATOM   1596 C C   . CYS C 2 19  ? 32.613  1.804   -46.997 1.00 35.27 ? 169  CYS A C   1 
ATOM   1597 O O   . CYS C 2 19  ? 32.804  0.835   -46.225 1.00 34.25 ? 169  CYS A O   1 
ATOM   1598 C CB  . CYS C 2 19  ? 34.243  3.764   -47.272 1.00 38.30 ? 169  CYS A CB  1 
ATOM   1599 S SG  . CYS C 2 19  ? 34.827  3.745   -45.495 1.00 44.96 ? 169  CYS A SG  1 
ATOM   1600 N N   . THR C 2 20  ? 31.419  2.392   -47.111 1.00 33.45 ? 170  THR A N   1 
ATOM   1601 C CA  . THR C 2 20  ? 30.256  1.936   -46.333 1.00 33.73 ? 170  THR A CA  1 
ATOM   1602 C C   . THR C 2 20  ? 29.964  0.481   -46.665 1.00 34.00 ? 170  THR A C   1 
ATOM   1603 O O   . THR C 2 20  ? 29.490  -0.316  -45.803 1.00 33.35 ? 170  THR A O   1 
ATOM   1604 C CB  . THR C 2 20  ? 29.033  2.818   -46.672 1.00 34.84 ? 170  THR A CB  1 
ATOM   1605 O OG1 . THR C 2 20  ? 29.319  4.194   -46.318 1.00 35.97 ? 170  THR A OG1 1 
ATOM   1606 C CG2 . THR C 2 20  ? 27.788  2.329   -45.983 1.00 38.52 ? 170  THR A CG2 1 
ATOM   1607 N N   . LEU C 2 21  ? 30.219  0.108   -47.920 1.00 32.05 ? 171  LEU A N   1 
ATOM   1608 C CA  . LEU C 2 21  ? 30.001  -1.280  -48.365 1.00 33.70 ? 171  LEU A CA  1 
ATOM   1609 C C   . LEU C 2 21  ? 31.007  -2.303  -47.777 1.00 34.79 ? 171  LEU A C   1 
ATOM   1610 O O   . LEU C 2 21  ? 30.790  -3.512  -47.832 1.00 34.55 ? 171  LEU A O   1 
ATOM   1611 C CB  . LEU C 2 21  ? 30.023  -1.343  -49.899 1.00 33.24 ? 171  LEU A CB  1 
ATOM   1612 C CG  . LEU C 2 21  ? 28.764  -0.811  -50.587 1.00 36.01 ? 171  LEU A CG  1 
ATOM   1613 C CD1 . LEU C 2 21  ? 29.100  -0.800  -52.079 1.00 41.87 ? 171  LEU A CD1 1 
ATOM   1614 C CD2 . LEU C 2 21  ? 27.589  -1.685  -50.341 1.00 37.08 ? 171  LEU A CD2 1 
ATOM   1615 N N   . ASN C 2 22  ? 32.100  -1.813  -47.212 1.00 34.96 ? 172  ASN A N   1 
ATOM   1616 C CA  . ASN C 2 22  ? 33.141  -2.692  -46.669 1.00 35.77 ? 172  ASN A CA  1 
ATOM   1617 C C   . ASN C 2 22  ? 32.981  -2.612  -45.169 1.00 35.73 ? 172  ASN A C   1 
ATOM   1618 O O   . ASN C 2 22  ? 33.035  -1.520  -44.632 1.00 35.04 ? 172  ASN A O   1 
ATOM   1619 C CB  . ASN C 2 22  ? 34.555  -2.200  -47.099 1.00 33.45 ? 172  ASN A CB  1 
ATOM   1620 C CG  . ASN C 2 22  ? 35.673  -3.010  -46.454 1.00 39.27 ? 172  ASN A CG  1 
ATOM   1621 O OD1 . ASN C 2 22  ? 36.201  -2.604  -45.417 1.00 42.91 ? 172  ASN A OD1 1 
ATOM   1622 N ND2 . ASN C 2 22  ? 35.980  -4.226  -47.013 1.00 38.49 ? 172  ASN A ND2 1 
ATOM   1623 N N   . ASP C 2 23  ? 32.755  -3.745  -44.523 1.00 35.29 ? 173  ASP A N   1 
ATOM   1624 C CA  . ASP C 2 23  ? 32.416  -3.803  -43.100 1.00 36.42 ? 173  ASP A CA  1 
ATOM   1625 C C   . ASP C 2 23  ? 33.406  -3.019  -42.278 1.00 35.52 ? 173  ASP A C   1 
ATOM   1626 O O   . ASP C 2 23  ? 32.984  -2.191  -41.480 1.00 34.13 ? 173  ASP A O   1 
ATOM   1627 C CB  . ASP C 2 23  ? 32.351  -5.241  -42.569 1.00 37.46 ? 173  ASP A CB  1 
ATOM   1628 C CG  . ASP C 2 23  ? 31.354  -6.100  -43.307 1.00 42.40 ? 173  ASP A CG  1 
ATOM   1629 O OD1 . ASP C 2 23  ? 30.643  -5.554  -44.180 1.00 51.41 ? 173  ASP A OD1 1 
ATOM   1630 O OD2 . ASP C 2 23  ? 31.293  -7.326  -43.041 1.00 47.70 ? 173  ASP A OD2 1 
ATOM   1631 N N   . LYS C 2 24  ? 34.694  -3.294  -42.493 1.00 35.40 ? 174  LYS A N   1 
ATOM   1632 C CA  . LYS C 2 24  ? 35.793  -2.716  -41.704 1.00 38.50 ? 174  LYS A CA  1 
ATOM   1633 C C   . LYS C 2 24  ? 35.870  -1.214  -41.895 1.00 36.28 ? 174  LYS A C   1 
ATOM   1634 O O   . LYS C 2 24  ? 35.965  -0.461  -40.924 1.00 36.49 ? 174  LYS A O   1 
ATOM   1635 C CB  . LYS C 2 24  ? 37.155  -3.362  -42.055 1.00 38.81 ? 174  LYS A CB  1 
ATOM   1636 C CG  . LYS C 2 24  ? 38.363  -2.543  -41.615 1.00 41.22 ? 174  LYS A CG  1 
ATOM   1637 C CD  . LYS C 2 24  ? 39.665  -3.287  -41.901 1.00 43.78 ? 174  LYS A CD  1 
ATOM   1638 C CE  . LYS C 2 24  ? 39.987  -3.374  -43.403 1.00 46.72 ? 174  LYS A CE  1 
ATOM   1639 N NZ  . LYS C 2 24  ? 40.969  -4.493  -43.659 1.00 49.28 ? 174  LYS A NZ  1 
ATOM   1640 N N   . CYS C 2 25  ? 35.832  -0.764  -43.143 1.00 35.47 ? 175  CYS A N   1 
ATOM   1641 C CA  . CYS C 2 25  ? 35.931  0.660   -43.428 1.00 34.25 ? 175  CYS A CA  1 
ATOM   1642 C C   . CYS C 2 25  ? 34.685  1.434   -42.945 1.00 34.43 ? 175  CYS A C   1 
ATOM   1643 O O   . CYS C 2 25  ? 34.800  2.581   -42.467 1.00 34.59 ? 175  CYS A O   1 
ATOM   1644 C CB  . CYS C 2 25  ? 36.096  0.880   -44.942 1.00 34.88 ? 175  CYS A CB  1 
ATOM   1645 S SG  . CYS C 2 25  ? 36.526  2.519   -45.419 1.00 43.00 ? 175  CYS A SG  1 
ATOM   1646 N N   . ASP C 2 26  ? 33.501  0.857   -43.148 1.00 30.89 ? 176  ASP A N   1 
ATOM   1647 C CA  . ASP C 2 26  ? 32.277  1.469   -42.646 1.00 32.40 ? 176  ASP A CA  1 
ATOM   1648 C C   . ASP C 2 26  ? 32.399  1.768   -41.146 1.00 32.08 ? 176  ASP A C   1 
ATOM   1649 O O   . ASP C 2 26  ? 32.038  2.856   -40.674 1.00 32.56 ? 176  ASP A O   1 
ATOM   1650 C CB  . ASP C 2 26  ? 31.085  0.507   -42.878 1.00 33.84 ? 176  ASP A CB  1 
ATOM   1651 C CG  . ASP C 2 26  ? 29.749  1.086   -42.371 1.00 35.76 ? 176  ASP A CG  1 
ATOM   1652 O OD1 . ASP C 2 26  ? 29.466  2.257   -42.695 1.00 38.55 ? 176  ASP A OD1 1 
ATOM   1653 O OD2 . ASP C 2 26  ? 29.053  0.403   -41.614 1.00 39.11 ? 176  ASP A OD2 1 
ATOM   1654 N N   . ARG C 2 27  ? 32.885  0.801   -40.370 1.00 31.54 ? 177  ARG A N   1 
ATOM   1655 C CA  . ARG C 2 27  ? 32.878  0.986   -38.906 1.00 31.23 ? 177  ARG A CA  1 
ATOM   1656 C C   . ARG C 2 27  ? 33.848  2.120   -38.545 1.00 31.75 ? 177  ARG A C   1 
ATOM   1657 O O   . ARG C 2 27  ? 33.558  2.923   -37.649 1.00 30.87 ? 177  ARG A O   1 
ATOM   1658 C CB  . ARG C 2 27  ? 33.212  -0.290  -38.167 1.00 30.48 ? 177  ARG A CB  1 
ATOM   1659 C CG  . ARG C 2 27  ? 32.017  -1.320  -38.192 1.00 35.02 ? 177  ARG A CG  1 
ATOM   1660 C CD  . ARG C 2 27  ? 31.653  -1.875  -36.854 1.00 45.88 ? 177  ARG A CD  1 
ATOM   1661 N NE  . ARG C 2 27  ? 30.796  -3.058  -37.023 1.00 53.43 ? 177  ARG A NE  1 
ATOM   1662 C CZ  . ARG C 2 27  ? 30.297  -3.770  -36.030 1.00 57.05 ? 177  ARG A CZ  1 
ATOM   1663 N NH1 . ARG C 2 27  ? 30.562  -3.434  -34.770 1.00 60.91 ? 177  ARG A NH1 1 
ATOM   1664 N NH2 . ARG C 2 27  ? 29.531  -4.820  -36.296 1.00 58.73 ? 177  ARG A NH2 1 
ATOM   1665 N N   . LEU C 2 28  ? 34.992  2.154   -39.234 1.00 30.07 ? 178  LEU A N   1 
ATOM   1666 C CA  . LEU C 2 28  ? 36.052  3.175   -38.931 1.00 30.67 ? 178  LEU A CA  1 
ATOM   1667 C C   . LEU C 2 28  ? 35.618  4.587   -39.359 1.00 31.40 ? 178  LEU A C   1 
ATOM   1668 O O   . LEU C 2 28  ? 35.961  5.591   -38.702 1.00 32.00 ? 178  LEU A O   1 
ATOM   1669 C CB  . LEU C 2 28  ? 37.368  2.798   -39.609 1.00 29.59 ? 178  LEU A CB  1 
ATOM   1670 C CG  . LEU C 2 28  ? 37.964  1.493   -39.054 1.00 29.45 ? 178  LEU A CG  1 
ATOM   1671 C CD1 . LEU C 2 28  ? 39.041  1.098   -40.072 1.00 30.22 ? 178  LEU A CD1 1 
ATOM   1672 C CD2 . LEU C 2 28  ? 38.619  1.710   -37.723 1.00 33.21 ? 178  LEU A CD2 1 
ATOM   1673 N N   . ARG C 2 29  ? 34.924  4.668   -40.486 1.00 30.48 ? 179  ARG A N   1 
ATOM   1674 C CA  . ARG C 2 29  ? 34.424  5.971   -40.997 1.00 32.25 ? 179  ARG A CA  1 
ATOM   1675 C C   . ARG C 2 29  ? 33.318  6.452   -40.070 1.00 32.23 ? 179  ARG A C   1 
ATOM   1676 O O   . ARG C 2 29  ? 33.278  7.621   -39.704 1.00 32.46 ? 179  ARG A O   1 
ATOM   1677 C CB  . ARG C 2 29  ? 33.859  5.815   -42.421 1.00 31.03 ? 179  ARG A CB  1 
ATOM   1678 C CG  . ARG C 2 29  ? 33.285  7.134   -42.973 1.00 35.84 ? 179  ARG A CG  1 
ATOM   1679 C CD  . ARG C 2 29  ? 32.956  6.995   -44.499 1.00 33.80 ? 179  ARG A CD  1 
ATOM   1680 N NE  . ARG C 2 29  ? 32.163  8.132   -44.975 1.00 36.29 ? 179  ARG A NE  1 
ATOM   1681 C CZ  . ARG C 2 29  ? 30.832  8.199   -44.949 1.00 38.07 ? 179  ARG A CZ  1 
ATOM   1682 N NH1 . ARG C 2 29  ? 30.086  7.196   -44.503 1.00 38.83 ? 179  ARG A NH1 1 
ATOM   1683 N NH2 . ARG C 2 29  ? 30.233  9.279   -45.419 1.00 44.97 ? 179  ARG A NH2 1 
ATOM   1684 N N   . LYS C 2 30  ? 32.425  5.546   -39.676 1.00 34.05 ? 180  LYS A N   1 
ATOM   1685 C CA  . LYS C 2 30  ? 31.341  5.889   -38.752 1.00 34.07 ? 180  LYS A CA  1 
ATOM   1686 C C   . LYS C 2 30  ? 31.905  6.402   -37.417 1.00 33.66 ? 180  LYS A C   1 
ATOM   1687 O O   . LYS C 2 30  ? 31.329  7.310   -36.798 1.00 32.89 ? 180  LYS A O   1 
ATOM   1688 C CB  . LYS C 2 30  ? 30.419  4.671   -38.494 1.00 35.31 ? 180  LYS A CB  1 
ATOM   1689 C CG  . LYS C 2 30  ? 29.248  4.591   -39.522 1.00 39.24 ? 180  LYS A CG  1 
ATOM   1690 C CD  . LYS C 2 30  ? 27.980  3.919   -38.925 1.00 42.23 ? 180  LYS A CD  1 
ATOM   1691 C CE  . LYS C 2 30  ? 26.643  4.299   -39.634 1.00 38.00 ? 180  LYS A CE  1 
ATOM   1692 N NZ  . LYS C 2 30  ? 25.611  2.970   -39.550 1.00 36.75 ? 180  LYS A NZ  1 
ATOM   1693 N N   . ALA C 2 31  ? 32.965  5.747   -36.943 1.00 33.06 ? 181  ALA A N   1 
ATOM   1694 C CA  . ALA C 2 31  ? 33.628  6.125   -35.710 1.00 33.72 ? 181  ALA A CA  1 
ATOM   1695 C C   . ALA C 2 31  ? 34.162  7.567   -35.722 1.00 33.12 ? 181  ALA A C   1 
ATOM   1696 O O   . ALA C 2 31  ? 33.916  8.309   -34.770 1.00 31.76 ? 181  ALA A O   1 
ATOM   1697 C CB  . ALA C 2 31  ? 34.765  5.143   -35.386 1.00 34.38 ? 181  ALA A CB  1 
ATOM   1698 N N   . TYR C 2 32  ? 34.882  7.988   -36.779 1.00 31.80 ? 182  TYR A N   1 
ATOM   1699 C CA  . TYR C 2 32  ? 35.359  9.365   -36.766 1.00 31.92 ? 182  TYR A CA  1 
ATOM   1700 C C   . TYR C 2 32  ? 34.252  10.347  -37.108 1.00 33.29 ? 182  TYR A C   1 
ATOM   1701 O O   . TYR C 2 32  ? 34.268  11.483  -36.637 1.00 33.46 ? 182  TYR A O   1 
ATOM   1702 C CB  . TYR C 2 32  ? 36.617  9.587   -37.649 1.00 30.59 ? 182  TYR A CB  1 
ATOM   1703 C CG  . TYR C 2 32  ? 36.396  9.860   -39.152 1.00 30.33 ? 182  TYR A CG  1 
ATOM   1704 C CD1 . TYR C 2 32  ? 36.722  8.907   -40.116 1.00 29.82 ? 182  TYR A CD1 1 
ATOM   1705 C CD2 . TYR C 2 32  ? 35.889  11.097  -39.596 1.00 30.26 ? 182  TYR A CD2 1 
ATOM   1706 C CE1 . TYR C 2 32  ? 36.542  9.180   -41.487 1.00 28.48 ? 182  TYR A CE1 1 
ATOM   1707 C CE2 . TYR C 2 32  ? 35.716  11.386  -40.923 1.00 31.20 ? 182  TYR A CE2 1 
ATOM   1708 C CZ  . TYR C 2 32  ? 36.047  10.425  -41.877 1.00 31.34 ? 182  TYR A CZ  1 
ATOM   1709 O OH  . TYR C 2 32  ? 35.855  10.702  -43.232 1.00 31.68 ? 182  TYR A OH  1 
ATOM   1710 N N   . GLY C 2 33  ? 33.305  9.923   -37.952 1.00 32.59 ? 183  GLY A N   1 
ATOM   1711 C CA  . GLY C 2 33  ? 32.194  10.792  -38.291 1.00 32.93 ? 183  GLY A CA  1 
ATOM   1712 C C   . GLY C 2 33  ? 31.435  11.167  -37.032 1.00 33.29 ? 183  GLY A C   1 
ATOM   1713 O O   . GLY C 2 33  ? 30.992  12.310  -36.884 1.00 34.16 ? 183  GLY A O   1 
ATOM   1714 N N   . GLU C 2 34  ? 31.249  10.186  -36.142 1.00 32.50 ? 184  GLU A N   1 
ATOM   1715 C CA  . GLU C 2 34  ? 30.600  10.427  -34.843 1.00 34.03 ? 184  GLU A CA  1 
ATOM   1716 C C   . GLU C 2 34  ? 31.429  11.351  -33.942 1.00 34.09 ? 184  GLU A C   1 
ATOM   1717 O O   . GLU C 2 34  ? 30.866  12.260  -33.302 1.00 34.54 ? 184  GLU A O   1 
ATOM   1718 C CB  . GLU C 2 34  ? 30.344  9.113   -34.092 1.00 33.14 ? 184  GLU A CB  1 
ATOM   1719 C CG  . GLU C 2 34  ? 29.657  9.297   -32.741 1.00 34.53 ? 184  GLU A CG  1 
ATOM   1720 C CD  . GLU C 2 34  ? 29.197  7.993   -32.111 1.00 37.93 ? 184  GLU A CD  1 
ATOM   1721 O OE1 . GLU C 2 34  ? 29.636  6.902   -32.547 1.00 43.68 ? 184  GLU A OE1 1 
ATOM   1722 O OE2 . GLU C 2 34  ? 28.402  8.068   -31.141 1.00 43.30 ? 184  GLU A OE2 1 
ATOM   1723 N N   . ALA C 2 35  ? 32.715  11.051  -33.834 1.00 33.61 ? 185  ALA A N   1 
ATOM   1724 C CA  . ALA C 2 35  ? 33.674  11.840  -33.012 1.00 34.38 ? 185  ALA A CA  1 
ATOM   1725 C C   . ALA C 2 35  ? 33.867  13.295  -33.492 1.00 34.76 ? 185  ALA A C   1 
ATOM   1726 O O   . ALA C 2 35  ? 34.159  14.173  -32.705 1.00 32.16 ? 185  ALA A O   1 
ATOM   1727 C CB  . ALA C 2 35  ? 34.993  11.130  -32.921 1.00 33.78 ? 185  ALA A CB  1 
ATOM   1728 N N   . CYS C 2 36  ? 33.599  13.537  -34.766 1.00 34.79 ? 186  CYS A N   1 
ATOM   1729 C CA  . CYS C 2 36  ? 33.901  14.786  -35.405 1.00 36.16 ? 186  CYS A CA  1 
ATOM   1730 C C   . CYS C 2 36  ? 32.665  15.623  -35.737 1.00 37.54 ? 186  CYS A C   1 
ATOM   1731 O O   . CYS C 2 36  ? 32.801  16.710  -36.303 1.00 37.15 ? 186  CYS A O   1 
ATOM   1732 C CB  . CYS C 2 36  ? 34.701  14.525  -36.669 1.00 34.92 ? 186  CYS A CB  1 
ATOM   1733 S SG  . CYS C 2 36  ? 36.283  13.684  -36.446 1.00 35.52 ? 186  CYS A SG  1 
ATOM   1734 N N   . SER C 2 37  ? 31.478  15.131  -35.383 1.00 37.12 ? 187  SER A N   1 
ATOM   1735 C CA  . SER C 2 37  ? 30.212  15.826  -35.617 1.00 39.51 ? 187  SER A CA  1 
ATOM   1736 C C   . SER C 2 37  ? 29.879  16.924  -34.597 1.00 41.72 ? 187  SER A C   1 
ATOM   1737 O O   . SER C 2 37  ? 30.180  16.821  -33.396 1.00 40.47 ? 187  SER A O   1 
ATOM   1738 C CB  . SER C 2 37  ? 29.021  14.823  -35.555 1.00 38.76 ? 187  SER A CB  1 
ATOM   1739 O OG  . SER C 2 37  ? 29.125  13.891  -36.609 1.00 41.98 ? 187  SER A OG  1 
ATOM   1740 N N   . GLY C 2 38  ? 29.189  17.942  -35.110 1.00 44.76 ? 188  GLY A N   1 
ATOM   1741 C CA  . GLY C 2 38  ? 28.214  18.725  -34.298 1.00 46.70 ? 188  GLY A CA  1 
ATOM   1742 C C   . GLY C 2 38  ? 28.908  19.997  -33.940 1.00 48.95 ? 188  GLY A C   1 
ATOM   1743 O O   . GLY C 2 38  ? 30.135  20.076  -34.119 1.00 50.12 ? 188  GLY A O   1 
ATOM   1744 N N   . PRO C 2 39  ? 28.157  21.004  -33.441 1.00 49.89 ? 189  PRO A N   1 
ATOM   1745 C CA  . PRO C 2 39  ? 28.875  22.194  -33.026 1.00 50.85 ? 189  PRO A CA  1 
ATOM   1746 C C   . PRO C 2 39  ? 29.742  21.846  -31.815 1.00 51.55 ? 189  PRO A C   1 
ATOM   1747 O O   . PRO C 2 39  ? 30.714  22.553  -31.525 1.00 52.28 ? 189  PRO A O   1 
ATOM   1748 C CB  . PRO C 2 39  ? 27.747  23.168  -32.625 1.00 50.64 ? 189  PRO A CB  1 
ATOM   1749 C CG  . PRO C 2 39  ? 26.577  22.305  -32.312 1.00 50.03 ? 189  PRO A CG  1 
ATOM   1750 C CD  . PRO C 2 39  ? 26.700  21.115  -33.211 1.00 49.90 ? 189  PRO A CD  1 
ATOM   1751 N N   . HIS C 2 40  ? 29.351  20.773  -31.121 1.00 51.67 ? 190  HIS A N   1 
ATOM   1752 C CA  . HIS C 2 40  ? 30.103  20.170  -30.032 1.00 52.25 ? 190  HIS A CA  1 
ATOM   1753 C C   . HIS C 2 40  ? 31.533  19.819  -30.489 1.00 51.89 ? 190  HIS A C   1 
ATOM   1754 O O   . HIS C 2 40  ? 32.366  20.691  -30.706 1.00 53.14 ? 190  HIS A O   1 
ATOM   1755 C CB  . HIS C 2 40  ? 29.396  18.870  -29.575 1.00 53.44 ? 190  HIS A CB  1 
ATOM   1756 C CG  . HIS C 2 40  ? 27.954  19.032  -29.149 1.00 55.66 ? 190  HIS A CG  1 
ATOM   1757 N ND1 . HIS C 2 40  ? 26.913  19.154  -30.050 1.00 57.64 ? 190  HIS A ND1 1 
ATOM   1758 C CD2 . HIS C 2 40  ? 27.379  19.015  -27.919 1.00 57.68 ? 190  HIS A CD2 1 
ATOM   1759 C CE1 . HIS C 2 40  ? 25.768  19.246  -29.393 1.00 58.58 ? 190  HIS A CE1 1 
ATOM   1760 N NE2 . HIS C 2 40  ? 26.022  19.164  -28.097 1.00 58.64 ? 190  HIS A NE2 1 
ATOM   1761 N N   . CYS C 2 41  ? 31.763  18.521  -30.685 1.00 50.06 ? 191  CYS A N   1 
ATOM   1762 C CA  . CYS C 2 41  ? 33.041  17.884  -30.962 1.00 47.48 ? 191  CYS A CA  1 
ATOM   1763 C C   . CYS C 2 41  ? 34.166  18.165  -29.968 1.00 45.95 ? 191  CYS A C   1 
ATOM   1764 O O   . CYS C 2 41  ? 34.601  19.303  -29.769 1.00 46.16 ? 191  CYS A O   1 
ATOM   1765 C CB  . CYS C 2 41  ? 33.471  18.026  -32.443 1.00 47.12 ? 191  CYS A CB  1 
ATOM   1766 S SG  . CYS C 2 41  ? 34.981  18.999  -32.716 1.00 49.03 ? 191  CYS A SG  1 
ATOM   1767 N N   . GLN C 2 42  ? 34.614  17.102  -29.319 1.00 44.33 ? 192  GLN A N   1 
ATOM   1768 C CA  . GLN C 2 42  ? 35.851  17.132  -28.560 1.00 43.98 ? 192  GLN A CA  1 
ATOM   1769 C C   . GLN C 2 42  ? 36.939  16.959  -29.598 1.00 42.41 ? 192  GLN A C   1 
ATOM   1770 O O   . GLN C 2 42  ? 37.022  15.900  -30.207 1.00 41.12 ? 192  GLN A O   1 
ATOM   1771 C CB  . GLN C 2 42  ? 35.909  15.980  -27.556 1.00 44.49 ? 192  GLN A CB  1 
ATOM   1772 C CG  . GLN C 2 42  ? 35.049  16.195  -26.282 1.00 48.49 ? 192  GLN A CG  1 
ATOM   1773 C CD  . GLN C 2 42  ? 33.574  15.993  -26.558 1.00 53.39 ? 192  GLN A CD  1 
ATOM   1774 O OE1 . GLN C 2 42  ? 33.206  15.188  -27.429 1.00 57.94 ? 192  GLN A OE1 1 
ATOM   1775 N NE2 . GLN C 2 42  ? 32.712  16.721  -25.831 1.00 55.56 ? 192  GLN A NE2 1 
ATOM   1776 N N   . ARG C 2 43  ? 37.780  17.976  -29.794 1.00 40.94 ? 193  ARG A N   1 
ATOM   1777 C CA  . ARG C 2 43  ? 38.670  17.944  -30.951 1.00 40.70 ? 193  ARG A CA  1 
ATOM   1778 C C   . ARG C 2 43  ? 39.683  16.797  -30.876 1.00 39.17 ? 193  ARG A C   1 
ATOM   1779 O O   . ARG C 2 43  ? 40.037  16.210  -31.894 1.00 37.19 ? 193  ARG A O   1 
ATOM   1780 C CB  . ARG C 2 43  ? 39.356  19.304  -31.150 1.00 41.16 ? 193  ARG A CB  1 
ATOM   1781 C CG  . ARG C 2 43  ? 40.233  19.386  -32.373 1.00 42.00 ? 193  ARG A CG  1 
ATOM   1782 C CD  . ARG C 2 43  ? 40.878  20.788  -32.479 1.00 42.95 ? 193  ARG A CD  1 
ATOM   1783 N NE  . ARG C 2 43  ? 42.114  20.703  -33.231 1.00 50.75 ? 193  ARG A NE  1 
ATOM   1784 C CZ  . ARG C 2 43  ? 43.329  20.681  -32.680 1.00 57.29 ? 193  ARG A CZ  1 
ATOM   1785 N NH1 . ARG C 2 43  ? 43.463  20.753  -31.347 1.00 56.95 ? 193  ARG A NH1 1 
ATOM   1786 N NH2 . ARG C 2 43  ? 44.417  20.593  -33.472 1.00 59.51 ? 193  ARG A NH2 1 
ATOM   1787 N N   . HIS C 2 44  ? 40.168  16.505  -29.666 1.00 38.56 ? 194  HIS A N   1 
ATOM   1788 C CA  . HIS C 2 44  ? 41.160  15.439  -29.473 1.00 37.94 ? 194  HIS A CA  1 
ATOM   1789 C C   . HIS C 2 44  ? 40.609  14.021  -29.745 1.00 36.29 ? 194  HIS A C   1 
ATOM   1790 O O   . HIS C 2 44  ? 41.350  13.123  -30.173 1.00 34.70 ? 194  HIS A O   1 
ATOM   1791 C CB  . HIS C 2 44  ? 41.784  15.522  -28.085 1.00 39.12 ? 194  HIS A CB  1 
ATOM   1792 C CG  . HIS C 2 44  ? 40.818  15.305  -26.967 1.00 41.95 ? 194  HIS A CG  1 
ATOM   1793 N ND1 . HIS C 2 44  ? 40.021  16.312  -26.455 1.00 44.71 ? 194  HIS A ND1 1 
ATOM   1794 C CD2 . HIS C 2 44  ? 40.547  14.199  -26.229 1.00 46.32 ? 194  HIS A CD2 1 
ATOM   1795 C CE1 . HIS C 2 44  ? 39.295  15.829  -25.460 1.00 45.91 ? 194  HIS A CE1 1 
ATOM   1796 N NE2 . HIS C 2 44  ? 39.597  14.551  -25.299 1.00 44.83 ? 194  HIS A NE2 1 
ATOM   1797 N N   . VAL C 2 45  ? 39.319  13.834  -29.507 1.00 34.31 ? 195  VAL A N   1 
ATOM   1798 C CA  . VAL C 2 45  ? 38.707  12.542  -29.777 1.00 34.50 ? 195  VAL A CA  1 
ATOM   1799 C C   . VAL C 2 45  ? 38.540  12.425  -31.287 1.00 33.42 ? 195  VAL A C   1 
ATOM   1800 O O   . VAL C 2 45  ? 38.824  11.407  -31.855 1.00 33.16 ? 195  VAL A O   1 
ATOM   1801 C CB  . VAL C 2 45  ? 37.357  12.379  -29.081 1.00 35.14 ? 195  VAL A CB  1 
ATOM   1802 C CG1 . VAL C 2 45  ? 36.767  10.987  -29.373 1.00 34.29 ? 195  VAL A CG1 1 
ATOM   1803 C CG2 . VAL C 2 45  ? 37.537  12.555  -27.602 1.00 32.73 ? 195  VAL A CG2 1 
ATOM   1804 N N   . CYS C 2 46  ? 38.101  13.495  -31.932 1.00 33.76 ? 196  CYS A N   1 
ATOM   1805 C CA  . CYS C 2 46  ? 37.992  13.481  -33.425 1.00 33.55 ? 196  CYS A CA  1 
ATOM   1806 C C   . CYS C 2 46  ? 39.333  13.169  -34.068 1.00 34.01 ? 196  CYS A C   1 
ATOM   1807 O O   . CYS C 2 46  ? 39.459  12.324  -34.966 1.00 33.53 ? 196  CYS A O   1 
ATOM   1808 C CB  . CYS C 2 46  ? 37.426  14.825  -33.880 1.00 33.93 ? 196  CYS A CB  1 
ATOM   1809 S SG  . CYS C 2 46  ? 37.517  15.135  -35.667 1.00 35.89 ? 196  CYS A SG  1 
ATOM   1810 N N   . LEU C 2 47  ? 40.382  13.826  -33.577 1.00 33.38 ? 197  LEU A N   1 
ATOM   1811 C CA  . LEU C 2 47  ? 41.721  13.648  -34.154 1.00 34.04 ? 197  LEU A CA  1 
ATOM   1812 C C   . LEU C 2 47  ? 42.152  12.179  -33.977 1.00 32.14 ? 197  LEU A C   1 
ATOM   1813 O O   . LEU C 2 47  ? 42.703  11.585  -34.877 1.00 33.98 ? 197  LEU A O   1 
ATOM   1814 C CB  . LEU C 2 47  ? 42.697  14.592  -33.401 1.00 33.93 ? 197  LEU A CB  1 
ATOM   1815 C CG  . LEU C 2 47  ? 43.219  15.874  -33.996 1.00 36.58 ? 197  LEU A CG  1 
ATOM   1816 C CD1 . LEU C 2 47  ? 42.542  16.404  -35.296 1.00 38.31 ? 197  LEU A CD1 1 
ATOM   1817 C CD2 . LEU C 2 47  ? 43.569  16.928  -32.846 1.00 35.03 ? 197  LEU A CD2 1 
ATOM   1818 N N   . ARG C 2 48  ? 41.907  11.607  -32.816 1.00 32.89 ? 198  ARG A N   1 
ATOM   1819 C CA  . ARG C 2 48  ? 42.300  10.236  -32.512 1.00 33.56 ? 198  ARG A CA  1 
ATOM   1820 C C   . ARG C 2 48  ? 41.526  9.234   -33.413 1.00 34.57 ? 198  ARG A C   1 
ATOM   1821 O O   . ARG C 2 48  ? 42.094  8.256   -33.906 1.00 35.28 ? 198  ARG A O   1 
ATOM   1822 C CB  . ARG C 2 48  ? 41.982  9.920   -31.040 1.00 35.22 ? 198  ARG A CB  1 
ATOM   1823 C CG  . ARG C 2 48  ? 42.312  8.494   -30.618 1.00 39.49 ? 198  ARG A CG  1 
ATOM   1824 C CD  . ARG C 2 48  ? 43.825  8.227   -30.805 1.00 46.79 ? 198  ARG A CD  1 
ATOM   1825 N NE  . ARG C 2 48  ? 44.066  7.429   -32.023 1.00 49.00 ? 198  ARG A NE  1 
ATOM   1826 C CZ  . ARG C 2 48  ? 45.260  6.998   -32.430 1.00 49.27 ? 198  ARG A CZ  1 
ATOM   1827 N NH1 . ARG C 2 48  ? 46.371  7.279   -31.737 1.00 52.24 ? 198  ARG A NH1 1 
ATOM   1828 N NH2 . ARG C 2 48  ? 45.339  6.246   -33.505 1.00 49.65 ? 198  ARG A NH2 1 
ATOM   1829 N N   . GLN C 2 49  ? 40.255  9.511   -33.653 1.00 33.33 ? 199  GLN A N   1 
ATOM   1830 C CA  . GLN C 2 49  ? 39.451  8.623   -34.572 1.00 32.71 ? 199  GLN A CA  1 
ATOM   1831 C C   . GLN C 2 49  ? 39.892  8.752   -36.027 1.00 32.31 ? 199  GLN A C   1 
ATOM   1832 O O   . GLN C 2 49  ? 39.826  7.777   -36.802 1.00 31.71 ? 199  GLN A O   1 
ATOM   1833 C CB  . GLN C 2 49  ? 37.943  8.885   -34.403 1.00 32.17 ? 199  GLN A CB  1 
ATOM   1834 C CG  . GLN C 2 49  ? 37.421  8.493   -33.002 1.00 34.68 ? 199  GLN A CG  1 
ATOM   1835 C CD  . GLN C 2 49  ? 37.731  7.011   -32.730 1.00 41.00 ? 199  GLN A CD  1 
ATOM   1836 O OE1 . GLN C 2 49  ? 37.324  6.136   -33.484 1.00 48.91 ? 199  GLN A OE1 1 
ATOM   1837 N NE2 . GLN C 2 49  ? 38.519  6.750   -31.714 1.00 46.94 ? 199  GLN A NE2 1 
ATOM   1838 N N   . LEU C 2 50  ? 40.318  9.944   -36.436 1.00 31.54 ? 200  LEU A N   1 
ATOM   1839 C CA  . LEU C 2 50  ? 40.949  10.136  -37.766 1.00 31.68 ? 200  LEU A CA  1 
ATOM   1840 C C   . LEU C 2 50  ? 42.244  9.324   -37.910 1.00 31.22 ? 200  LEU A C   1 
ATOM   1841 O O   . LEU C 2 50  ? 42.462  8.637   -38.942 1.00 32.10 ? 200  LEU A O   1 
ATOM   1842 C CB  . LEU C 2 50  ? 41.182  11.649  -38.072 1.00 31.81 ? 200  LEU A CB  1 
ATOM   1843 C CG  . LEU C 2 50  ? 39.902  12.430  -38.431 1.00 32.11 ? 200  LEU A CG  1 
ATOM   1844 C CD1 . LEU C 2 50  ? 40.228  13.884  -38.387 1.00 34.63 ? 200  LEU A CD1 1 
ATOM   1845 C CD2 . LEU C 2 50  ? 39.381  12.080  -39.850 1.00 31.01 ? 200  LEU A CD2 1 
ATOM   1846 N N   . LEU C 2 51  ? 43.094  9.384   -36.897 1.00 31.86 ? 201  LEU A N   1 
ATOM   1847 C CA  . LEU C 2 51  ? 44.353  8.654   -36.930 1.00 32.24 ? 201  LEU A CA  1 
ATOM   1848 C C   . LEU C 2 51  ? 44.099  7.162   -37.062 1.00 30.32 ? 201  LEU A C   1 
ATOM   1849 O O   . LEU C 2 51  ? 44.749  6.473   -37.874 1.00 30.73 ? 201  LEU A O   1 
ATOM   1850 C CB  . LEU C 2 51  ? 45.170  8.934   -35.671 1.00 33.79 ? 201  LEU A CB  1 
ATOM   1851 C CG  . LEU C 2 51  ? 45.933  10.284  -35.670 1.00 34.40 ? 201  LEU A CG  1 
ATOM   1852 C CD1 . LEU C 2 51  ? 46.390  10.530  -34.257 1.00 39.29 ? 201  LEU A CD1 1 
ATOM   1853 C CD2 . LEU C 2 51  ? 47.112  10.282  -36.625 1.00 36.27 ? 201  LEU A CD2 1 
ATOM   1854 N N   . THR C 2 52  ? 43.151  6.670   -36.290 1.00 31.20 ? 202  THR A N   1 
ATOM   1855 C CA  . THR C 2 52  ? 42.783  5.227   -36.343 1.00 30.90 ? 202  THR A CA  1 
ATOM   1856 C C   . THR C 2 52  ? 42.249  4.871   -37.703 1.00 30.91 ? 202  THR A C   1 
ATOM   1857 O O   . THR C 2 52  ? 42.578  3.804   -38.247 1.00 31.40 ? 202  THR A O   1 
ATOM   1858 C CB  . THR C 2 52  ? 41.729  4.933   -35.314 1.00 30.79 ? 202  THR A CB  1 
ATOM   1859 O OG1 . THR C 2 52  ? 42.316  5.214   -34.036 1.00 32.00 ? 202  THR A OG1 1 
ATOM   1860 C CG2 . THR C 2 52  ? 41.284  3.482   -35.370 1.00 33.54 ? 202  THR A CG2 1 
ATOM   1861 N N   . PHE C 2 53  ? 41.442  5.760   -38.275 1.00 29.94 ? 203  PHE A N   1 
ATOM   1862 C CA  . PHE C 2 53  ? 40.832  5.446   -39.569 1.00 31.27 ? 203  PHE A CA  1 
ATOM   1863 C C   . PHE C 2 53  ? 41.923  5.200   -40.609 1.00 32.03 ? 203  PHE A C   1 
ATOM   1864 O O   . PHE C 2 53  ? 41.861  4.248   -41.334 1.00 33.86 ? 203  PHE A O   1 
ATOM   1865 C CB  . PHE C 2 53  ? 39.899  6.585   -40.093 1.00 30.66 ? 203  PHE A CB  1 
ATOM   1866 C CG  . PHE C 2 53  ? 39.371  6.300   -41.489 1.00 32.07 ? 203  PHE A CG  1 
ATOM   1867 C CD1 . PHE C 2 53  ? 38.295  5.452   -41.648 1.00 33.62 ? 203  PHE A CD1 1 
ATOM   1868 C CD2 . PHE C 2 53  ? 40.012  6.830   -42.628 1.00 36.41 ? 203  PHE A CD2 1 
ATOM   1869 C CE1 . PHE C 2 53  ? 37.790  5.125   -42.915 1.00 32.06 ? 203  PHE A CE1 1 
ATOM   1870 C CE2 . PHE C 2 53  ? 39.553  6.527   -43.928 1.00 33.91 ? 203  PHE A CE2 1 
ATOM   1871 C CZ  . PHE C 2 53  ? 38.426  5.647   -44.061 1.00 34.33 ? 203  PHE A CZ  1 
ATOM   1872 N N   . PHE C 2 54  ? 42.892  6.106   -40.753 1.00 32.37 ? 204  PHE A N   1 
ATOM   1873 C CA  . PHE C 2 54  ? 43.903  5.914   -41.783 1.00 32.32 ? 204  PHE A CA  1 
ATOM   1874 C C   . PHE C 2 54  ? 44.884  4.775   -41.420 1.00 33.25 ? 204  PHE A C   1 
ATOM   1875 O O   . PHE C 2 54  ? 45.487  4.157   -42.294 1.00 33.74 ? 204  PHE A O   1 
ATOM   1876 C CB  . PHE C 2 54  ? 44.618  7.261   -42.078 1.00 31.56 ? 204  PHE A CB  1 
ATOM   1877 C CG  . PHE C 2 54  ? 43.728  8.209   -42.744 1.00 32.06 ? 204  PHE A CG  1 
ATOM   1878 C CD1 . PHE C 2 54  ? 43.077  9.207   -42.039 1.00 33.45 ? 204  PHE A CD1 1 
ATOM   1879 C CD2 . PHE C 2 54  ? 43.438  8.008   -44.093 1.00 30.87 ? 204  PHE A CD2 1 
ATOM   1880 C CE1 . PHE C 2 54  ? 42.177  10.041  -42.696 1.00 35.80 ? 204  PHE A CE1 1 
ATOM   1881 C CE2 . PHE C 2 54  ? 42.551  8.815   -44.765 1.00 32.60 ? 204  PHE A CE2 1 
ATOM   1882 C CZ  . PHE C 2 54  ? 41.889  9.812   -44.084 1.00 35.50 ? 204  PHE A CZ  1 
ATOM   1883 N N   . GLU C 2 55  ? 45.066  4.544   -40.144 1.00 32.77 ? 205  GLU A N   1 
ATOM   1884 C CA  . GLU C 2 55  ? 45.855  3.442   -39.702 1.00 36.22 ? 205  GLU A CA  1 
ATOM   1885 C C   . GLU C 2 55  ? 45.255  2.053   -40.027 1.00 36.82 ? 205  GLU A C   1 
ATOM   1886 O O   . GLU C 2 55  ? 46.003  1.125   -40.395 1.00 38.00 ? 205  GLU A O   1 
ATOM   1887 C CB  . GLU C 2 55  ? 46.048  3.562   -38.209 1.00 36.99 ? 205  GLU A CB  1 
ATOM   1888 C CG  . GLU C 2 55  ? 46.887  2.552   -37.674 1.00 43.09 ? 205  GLU A CG  1 
ATOM   1889 C CD  . GLU C 2 55  ? 47.283  2.876   -36.247 1.00 52.48 ? 205  GLU A CD  1 
ATOM   1890 O OE1 . GLU C 2 55  ? 46.746  3.879   -35.666 1.00 49.58 ? 205  GLU A OE1 1 
ATOM   1891 O OE2 . GLU C 2 55  ? 48.145  2.121   -35.715 1.00 55.12 ? 205  GLU A OE2 1 
ATOM   1892 N N   . LYS C 2 56  ? 43.933  1.929   -39.862 1.00 33.99 ? 206  LYS A N   1 
ATOM   1893 C CA  . LYS C 2 56  ? 43.260  0.635   -39.890 1.00 34.19 ? 206  LYS A CA  1 
ATOM   1894 C C   . LYS C 2 56  ? 42.540  0.317   -41.212 1.00 33.59 ? 206  LYS A C   1 
ATOM   1895 O O   . LYS C 2 56  ? 42.447  -0.848  -41.590 1.00 30.88 ? 206  LYS A O   1 
ATOM   1896 C CB  . LYS C 2 56  ? 42.317  0.477   -38.681 1.00 34.13 ? 206  LYS A CB  1 
ATOM   1897 C CG  . LYS C 2 56  ? 43.051  0.514   -37.309 1.00 38.51 ? 206  LYS A CG  1 
ATOM   1898 C CD  . LYS C 2 56  ? 44.131  -0.523  -37.205 1.00 41.12 ? 206  LYS A CD  1 
ATOM   1899 C CE  . LYS C 2 56  ? 45.014  -0.350  -35.921 1.00 42.24 ? 206  LYS A CE  1 
ATOM   1900 N NZ  . LYS C 2 56  ? 45.664  -1.672  -35.636 1.00 47.76 ? 206  LYS A NZ  1 
ATOM   1901 N N   . ALA C 2 57  ? 42.059  1.327   -41.916 1.00 33.10 ? 207  ALA A N   1 
ATOM   1902 C CA  . ALA C 2 57  ? 41.280  1.107   -43.141 1.00 34.80 ? 207  ALA A CA  1 
ATOM   1903 C C   . ALA C 2 57  ? 42.225  0.620   -44.240 1.00 36.26 ? 207  ALA A C   1 
ATOM   1904 O O   . ALA C 2 57  ? 43.371  1.053   -44.277 1.00 36.30 ? 207  ALA A O   1 
ATOM   1905 C CB  . ALA C 2 57  ? 40.635  2.404   -43.593 1.00 35.85 ? 207  ALA A CB  1 
ATOM   1906 N N   . ALA C 2 58  ? 41.738  -0.205  -45.186 1.00 35.18 ? 208  ALA A N   1 
ATOM   1907 C CA  . ALA C 2 58  ? 42.606  -0.607  -46.313 1.00 35.37 ? 208  ALA A CA  1 
ATOM   1908 C C   . ALA C 2 58  ? 43.062  0.643   -47.047 1.00 34.74 ? 208  ALA A C   1 
ATOM   1909 O O   . ALA C 2 58  ? 42.215  1.564   -47.242 1.00 35.75 ? 208  ALA A O   1 
ATOM   1910 C CB  . ALA C 2 58  ? 41.839  -1.589  -47.245 1.00 36.00 ? 208  ALA A CB  1 
ATOM   1911 N N   . GLU C 2 59  ? 44.348  0.731   -47.454 1.00 33.26 ? 209  GLU A N   1 
ATOM   1912 C CA  . GLU C 2 59  ? 44.834  1.936   -48.088 1.00 34.73 ? 209  GLU A CA  1 
ATOM   1913 C C   . GLU C 2 59  ? 43.976  2.315   -49.294 1.00 34.07 ? 209  GLU A C   1 
ATOM   1914 O O   . GLU C 2 59  ? 43.678  3.499   -49.485 1.00 33.10 ? 209  GLU A O   1 
ATOM   1915 C CB  . GLU C 2 59  ? 46.312  1.877   -48.503 1.00 35.08 ? 209  GLU A CB  1 
ATOM   1916 C CG  . GLU C 2 59  ? 47.294  1.929   -47.372 1.00 42.25 ? 209  GLU A CG  1 
ATOM   1917 C CD  . GLU C 2 59  ? 48.604  1.257   -47.735 1.00 53.82 ? 209  GLU A CD  1 
ATOM   1918 O OE1 . GLU C 2 59  ? 49.304  1.845   -48.601 1.00 59.37 ? 209  GLU A OE1 1 
ATOM   1919 O OE2 . GLU C 2 59  ? 48.928  0.161   -47.178 1.00 50.93 ? 209  GLU A OE2 1 
ATOM   1920 N N   . PRO C 2 60  ? 43.623  1.324   -50.122 1.00 32.15 ? 210  PRO A N   1 
ATOM   1921 C CA  . PRO C 2 60  ? 42.830  1.767   -51.268 1.00 33.70 ? 210  PRO A CA  1 
ATOM   1922 C C   . PRO C 2 60  ? 41.443  2.380   -50.899 1.00 33.48 ? 210  PRO A C   1 
ATOM   1923 O O   . PRO C 2 60  ? 40.957  3.223   -51.621 1.00 32.82 ? 210  PRO A O   1 
ATOM   1924 C CB  . PRO C 2 60  ? 42.699  0.493   -52.099 1.00 31.03 ? 210  PRO A CB  1 
ATOM   1925 C CG  . PRO C 2 60  ? 43.836  -0.438  -51.623 1.00 35.00 ? 210  PRO A CG  1 
ATOM   1926 C CD  . PRO C 2 60  ? 43.946  -0.151  -50.166 1.00 33.57 ? 210  PRO A CD  1 
ATOM   1927 N N   . HIS C 2 61  ? 40.788  1.864   -49.846 1.00 32.05 ? 211  HIS A N   1 
ATOM   1928 C CA  . HIS C 2 61  ? 39.533  2.463   -49.364 1.00 32.73 ? 211  HIS A CA  1 
ATOM   1929 C C   . HIS C 2 61  ? 39.738  3.852   -48.789 1.00 33.18 ? 211  HIS A C   1 
ATOM   1930 O O   . HIS C 2 61  ? 38.998  4.791   -49.077 1.00 34.39 ? 211  HIS A O   1 
ATOM   1931 C CB  . HIS C 2 61  ? 38.838  1.548   -48.316 1.00 32.87 ? 211  HIS A CB  1 
ATOM   1932 C CG  . HIS C 2 61  ? 38.330  0.272   -48.902 1.00 34.98 ? 211  HIS A CG  1 
ATOM   1933 N ND1 . HIS C 2 61  ? 38.529  -0.948  -48.313 1.00 37.17 ? 211  HIS A ND1 1 
ATOM   1934 C CD2 . HIS C 2 61  ? 37.642  0.032   -50.044 1.00 37.24 ? 211  HIS A CD2 1 
ATOM   1935 C CE1 . HIS C 2 61  ? 38.000  -1.903  -49.070 1.00 39.23 ? 211  HIS A CE1 1 
ATOM   1936 N NE2 . HIS C 2 61  ? 37.465  -1.329  -50.135 1.00 39.92 ? 211  HIS A NE2 1 
ATOM   1937 N N   . ALA C 2 62  ? 40.759  3.992   -47.991 1.00 32.86 ? 212  ALA A N   1 
ATOM   1938 C CA  . ALA C 2 62  ? 41.049  5.311   -47.407 1.00 34.55 ? 212  ALA A CA  1 
ATOM   1939 C C   . ALA C 2 62  ? 41.414  6.381   -48.470 1.00 33.89 ? 212  ALA A C   1 
ATOM   1940 O O   . ALA C 2 62  ? 40.963  7.562   -48.415 1.00 32.62 ? 212  ALA A O   1 
ATOM   1941 C CB  . ALA C 2 62  ? 42.168  5.105   -46.287 1.00 34.37 ? 212  ALA A CB  1 
ATOM   1942 N N   . GLN C 2 63  ? 42.193  5.991   -49.491 1.00 33.59 ? 213  GLN A N   1 
ATOM   1943 C CA  . GLN C 2 63  ? 42.553  6.934   -50.592 1.00 32.97 ? 213  GLN A CA  1 
ATOM   1944 C C   . GLN C 2 63  ? 41.403  7.208   -51.522 1.00 33.10 ? 213  GLN A C   1 
ATOM   1945 O O   . GLN C 2 63  ? 41.285  8.305   -52.040 1.00 35.17 ? 213  GLN A O   1 
ATOM   1946 C CB  . GLN C 2 63  ? 43.741  6.306   -51.369 1.00 34.07 ? 213  GLN A CB  1 
ATOM   1947 C CG  . GLN C 2 63  ? 44.974  6.376   -50.362 1.00 34.47 ? 213  GLN A CG  1 
ATOM   1948 C CD  . GLN C 2 63  ? 46.231  5.761   -50.873 1.00 41.04 ? 213  GLN A CD  1 
ATOM   1949 O OE1 . GLN C 2 63  ? 46.336  5.458   -52.054 1.00 43.36 ? 213  GLN A OE1 1 
ATOM   1950 N NE2 . GLN C 2 63  ? 47.207  5.586   -49.982 1.00 40.71 ? 213  GLN A NE2 1 
ATOM   1951 N N   . GLY C 2 64  ? 40.512  6.246   -51.693 1.00 32.51 ? 214  GLY A N   1 
ATOM   1952 C CA  . GLY C 2 64  ? 39.293  6.475   -52.487 1.00 32.41 ? 214  GLY A CA  1 
ATOM   1953 C C   . GLY C 2 64  ? 38.402  7.512   -51.791 1.00 32.77 ? 214  GLY A C   1 
ATOM   1954 O O   . GLY C 2 64  ? 37.819  8.403   -52.451 1.00 33.36 ? 214  GLY A O   1 
ATOM   1955 N N   . LEU C 2 65  ? 38.291  7.366   -50.489 1.00 32.51 ? 215  LEU A N   1 
ATOM   1956 C CA  . LEU C 2 65  ? 37.413  8.222   -49.694 1.00 33.49 ? 215  LEU A CA  1 
ATOM   1957 C C   . LEU C 2 65  ? 37.876  9.709   -49.824 1.00 33.53 ? 215  LEU A C   1 
ATOM   1958 O O   . LEU C 2 65  ? 37.095  10.672  -50.020 1.00 34.47 ? 215  LEU A O   1 
ATOM   1959 C CB  . LEU C 2 65  ? 37.514  7.773   -48.224 1.00 33.25 ? 215  LEU A CB  1 
ATOM   1960 C CG  . LEU C 2 65  ? 36.626  8.614   -47.289 1.00 36.54 ? 215  LEU A CG  1 
ATOM   1961 C CD1 . LEU C 2 65  ? 35.137  8.436   -47.623 1.00 37.00 ? 215  LEU A CD1 1 
ATOM   1962 C CD2 . LEU C 2 65  ? 36.892  8.393   -45.779 1.00 36.53 ? 215  LEU A CD2 1 
ATOM   1963 N N   . LEU C 2 66  ? 39.164  9.903   -49.646 1.00 33.48 ? 216  LEU A N   1 
ATOM   1964 C CA  . LEU C 2 66  ? 39.681  11.286  -49.576 1.00 35.15 ? 216  LEU A CA  1 
ATOM   1965 C C   . LEU C 2 66  ? 40.185  11.848  -50.881 1.00 33.62 ? 216  LEU A C   1 
ATOM   1966 O O   . LEU C 2 66  ? 39.931  13.056  -51.178 1.00 35.88 ? 216  LEU A O   1 
ATOM   1967 C CB  . LEU C 2 66  ? 40.778  11.290  -48.512 1.00 35.84 ? 216  LEU A CB  1 
ATOM   1968 C CG  . LEU C 2 66  ? 41.310  12.699  -48.136 1.00 39.65 ? 216  LEU A CG  1 
ATOM   1969 C CD1 . LEU C 2 66  ? 40.210  13.591  -47.703 1.00 41.47 ? 216  LEU A CD1 1 
ATOM   1970 C CD2 . LEU C 2 66  ? 42.365  12.542  -46.978 1.00 40.64 ? 216  LEU A CD2 1 
ATOM   1971 N N   . LEU C 2 67  ? 40.838  11.023  -51.709 1.00 32.37 ? 217  LEU A N   1 
ATOM   1972 C CA  . LEU C 2 67  ? 41.502  11.483  -52.964 1.00 33.83 ? 217  LEU A CA  1 
ATOM   1973 C C   . LEU C 2 67  ? 40.596  11.222  -54.102 1.00 35.98 ? 217  LEU A C   1 
ATOM   1974 O O   . LEU C 2 67  ? 40.970  10.641  -55.094 1.00 37.06 ? 217  LEU A O   1 
ATOM   1975 C CB  . LEU C 2 67  ? 42.886  10.855  -53.190 1.00 33.02 ? 217  LEU A CB  1 
ATOM   1976 C CG  . LEU C 2 67  ? 43.834  10.990  -51.979 1.00 34.99 ? 217  LEU A CG  1 
ATOM   1977 C CD1 . LEU C 2 67  ? 45.220  10.336  -52.157 1.00 33.64 ? 217  LEU A CD1 1 
ATOM   1978 C CD2 . LEU C 2 67  ? 43.992  12.445  -51.535 1.00 33.76 ? 217  LEU A CD2 1 
ATOM   1979 N N   . CYS C 2 68  ? 39.379  11.741  -53.973 1.00 37.96 ? 218  CYS A N   1 
ATOM   1980 C CA  . CYS C 2 68  ? 38.320  11.403  -54.948 1.00 36.06 ? 218  CYS A CA  1 
ATOM   1981 C C   . CYS C 2 68  ? 38.226  12.529  -55.962 1.00 36.58 ? 218  CYS A C   1 
ATOM   1982 O O   . CYS C 2 68  ? 38.455  13.766  -55.625 1.00 33.37 ? 218  CYS A O   1 
ATOM   1983 C CB  . CYS C 2 68  ? 36.982  11.126  -54.226 1.00 37.37 ? 218  CYS A CB  1 
ATOM   1984 S SG  . CYS C 2 68  ? 36.483  12.456  -53.085 1.00 40.03 ? 218  CYS A SG  1 
ATOM   1985 N N   . PRO C 2 69  ? 37.986  12.168  -57.224 1.00 36.99 ? 219  PRO A N   1 
ATOM   1986 C CA  . PRO C 2 69  ? 38.020  13.170  -58.284 1.00 36.15 ? 219  PRO A CA  1 
ATOM   1987 C C   . PRO C 2 69  ? 36.695  13.951  -58.430 1.00 37.82 ? 219  PRO A C   1 
ATOM   1988 O O   . PRO C 2 69  ? 35.649  13.349  -58.249 1.00 35.79 ? 219  PRO A O   1 
ATOM   1989 C CB  . PRO C 2 69  ? 38.255  12.311  -59.536 1.00 37.73 ? 219  PRO A CB  1 
ATOM   1990 C CG  . PRO C 2 69  ? 37.611  11.026  -59.242 1.00 36.23 ? 219  PRO A CG  1 
ATOM   1991 C CD  . PRO C 2 69  ? 37.692  10.800  -57.738 1.00 37.50 ? 219  PRO A CD  1 
ATOM   1992 N N   . CYS C 2 70  ? 36.759  15.253  -58.800 1.00 36.62 ? 220  CYS A N   1 
ATOM   1993 C CA  . CYS C 2 70  ? 35.598  16.129  -58.972 1.00 38.04 ? 220  CYS A CA  1 
ATOM   1994 C C   . CYS C 2 70  ? 35.727  16.867  -60.288 1.00 39.66 ? 220  CYS A C   1 
ATOM   1995 O O   . CYS C 2 70  ? 36.797  17.400  -60.593 1.00 39.72 ? 220  CYS A O   1 
ATOM   1996 C CB  . CYS C 2 70  ? 35.486  17.170  -57.849 1.00 38.27 ? 220  CYS A CB  1 
ATOM   1997 S SG  . CYS C 2 70  ? 35.145  16.419  -56.203 1.00 40.70 ? 220  CYS A SG  1 
ATOM   1998 N N   . ALA C 2 71  ? 34.643  16.968  -61.036 1.00 40.96 ? 221  ALA A N   1 
ATOM   1999 C CA  . ALA C 2 71  ? 34.638  17.835  -62.219 1.00 43.13 ? 221  ALA A CA  1 
ATOM   2000 C C   . ALA C 2 71  ? 34.925  19.285  -61.778 1.00 45.25 ? 221  ALA A C   1 
ATOM   2001 O O   . ALA C 2 71  ? 34.629  19.667  -60.632 1.00 44.52 ? 221  ALA A O   1 
ATOM   2002 C CB  . ALA C 2 71  ? 33.304  17.733  -62.970 1.00 42.60 ? 221  ALA A CB  1 
ATOM   2003 N N   . PRO C 2 72  ? 35.515  20.113  -62.684 1.00 47.11 ? 222  PRO A N   1 
ATOM   2004 C CA  . PRO C 2 72  ? 35.935  21.479  -62.348 1.00 47.25 ? 222  PRO A CA  1 
ATOM   2005 C C   . PRO C 2 72  ? 34.763  22.315  -61.771 1.00 47.32 ? 222  PRO A C   1 
ATOM   2006 O O   . PRO C 2 72  ? 34.914  22.996  -60.741 1.00 47.69 ? 222  PRO A O   1 
ATOM   2007 C CB  . PRO C 2 72  ? 36.310  22.063  -63.737 1.00 48.51 ? 222  PRO A CB  1 
ATOM   2008 C CG  . PRO C 2 72  ? 35.481  21.215  -64.752 1.00 47.28 ? 222  PRO A CG  1 
ATOM   2009 C CD  . PRO C 2 72  ? 35.676  19.837  -64.131 1.00 47.96 ? 222  PRO A CD  1 
ATOM   2010 N N   . ASN C 2 73  ? 33.599  22.239  -62.406 1.00 46.02 ? 223  ASN A N   1 
ATOM   2011 C CA  . ASN C 2 73  ? 32.472  23.087  -61.979 1.00 45.96 ? 223  ASN A CA  1 
ATOM   2012 C C   . ASN C 2 73  ? 31.524  22.388  -60.981 1.00 44.18 ? 223  ASN A C   1 
ATOM   2013 O O   . ASN C 2 73  ? 30.408  22.864  -60.749 1.00 43.83 ? 223  ASN A O   1 
ATOM   2014 C CB  . ASN C 2 73  ? 31.681  23.632  -63.186 1.00 47.74 ? 223  ASN A CB  1 
ATOM   2015 C CG  . ASN C 2 73  ? 32.530  24.553  -64.118 1.00 50.87 ? 223  ASN A CG  1 
ATOM   2016 O OD1 . ASN C 2 73  ? 33.524  25.186  -63.706 1.00 53.53 ? 223  ASN A OD1 1 
ATOM   2017 N ND2 . ASN C 2 73  ? 32.121  24.616  -65.389 1.00 51.91 ? 223  ASN A ND2 1 
ATOM   2018 N N   . ASP C 2 74  ? 31.973  21.281  -60.375 1.00 40.51 ? 224  ASP A N   1 
ATOM   2019 C CA  . ASP C 2 74  ? 31.113  20.498  -59.481 1.00 39.95 ? 224  ASP A CA  1 
ATOM   2020 C C   . ASP C 2 74  ? 31.445  20.873  -58.028 1.00 38.52 ? 224  ASP A C   1 
ATOM   2021 O O   . ASP C 2 74  ? 32.199  20.167  -57.347 1.00 37.31 ? 224  ASP A O   1 
ATOM   2022 C CB  . ASP C 2 74  ? 31.312  18.997  -59.726 1.00 39.72 ? 224  ASP A CB  1 
ATOM   2023 C CG  . ASP C 2 74  ? 30.302  18.132  -58.972 1.00 40.88 ? 224  ASP A CG  1 
ATOM   2024 O OD1 . ASP C 2 74  ? 29.592  18.667  -58.078 1.00 40.78 ? 224  ASP A OD1 1 
ATOM   2025 O OD2 . ASP C 2 74  ? 30.211  16.912  -59.304 1.00 38.56 ? 224  ASP A OD2 1 
ATOM   2026 N N   . ARG C 2 75  ? 30.890  21.994  -57.570 1.00 37.52 ? 225  ARG A N   1 
ATOM   2027 C CA  . ARG C 2 75  ? 31.261  22.537  -56.276 1.00 38.60 ? 225  ARG A CA  1 
ATOM   2028 C C   . ARG C 2 75  ? 30.752  21.673  -55.134 1.00 36.96 ? 225  ARG A C   1 
ATOM   2029 O O   . ARG C 2 75  ? 31.382  21.625  -54.081 1.00 36.75 ? 225  ARG A O   1 
ATOM   2030 C CB  . ARG C 2 75  ? 30.802  24.009  -56.105 1.00 38.02 ? 225  ARG A CB  1 
ATOM   2031 C CG  . ARG C 2 75  ? 31.442  25.014  -57.103 1.00 42.91 ? 225  ARG A CG  1 
ATOM   2032 C CD  . ARG C 2 75  ? 31.352  26.462  -56.606 1.00 42.52 ? 225  ARG A CD  1 
ATOM   2033 N NE  . ARG C 2 75  ? 32.218  27.405  -57.354 1.00 52.64 ? 225  ARG A NE  1 
ATOM   2034 C CZ  . ARG C 2 75  ? 32.911  28.411  -56.793 1.00 56.67 ? 225  ARG A CZ  1 
ATOM   2035 N NH1 . ARG C 2 75  ? 32.853  28.610  -55.467 1.00 60.82 ? 225  ARG A NH1 1 
ATOM   2036 N NH2 . ARG C 2 75  ? 33.689  29.217  -57.537 1.00 54.44 ? 225  ARG A NH2 1 
ATOM   2037 N N   . GLY C 2 76  ? 29.635  20.991  -55.350 1.00 35.78 ? 226  GLY A N   1 
ATOM   2038 C CA  . GLY C 2 76  ? 29.102  20.010  -54.369 1.00 36.23 ? 226  GLY A CA  1 
ATOM   2039 C C   . GLY C 2 76  ? 30.100  18.888  -54.087 1.00 35.78 ? 226  GLY A C   1 
ATOM   2040 O O   . GLY C 2 76  ? 30.407  18.556  -52.910 1.00 35.81 ? 226  GLY A O   1 
ATOM   2041 N N   . CYS C 2 77  ? 30.663  18.317  -55.150 1.00 35.40 ? 227  CYS A N   1 
ATOM   2042 C CA  . CYS C 2 77  ? 31.717  17.294  -54.982 1.00 34.19 ? 227  CYS A CA  1 
ATOM   2043 C C   . CYS C 2 77  ? 32.934  17.844  -54.258 1.00 35.30 ? 227  CYS A C   1 
ATOM   2044 O O   . CYS C 2 77  ? 33.473  17.234  -53.309 1.00 34.35 ? 227  CYS A O   1 
ATOM   2045 C CB  . CYS C 2 77  ? 32.088  16.725  -56.367 1.00 35.25 ? 227  CYS A CB  1 
ATOM   2046 S SG  . CYS C 2 77  ? 33.286  15.424  -56.431 1.00 38.36 ? 227  CYS A SG  1 
ATOM   2047 N N   . GLY C 2 78  ? 33.393  19.016  -54.692 1.00 33.84 ? 228  GLY A N   1 
ATOM   2048 C CA  . GLY C 2 78  ? 34.579  19.574  -54.060 1.00 33.81 ? 228  GLY A CA  1 
ATOM   2049 C C   . GLY C 2 78  ? 34.370  19.869  -52.604 1.00 32.71 ? 228  GLY A C   1 
ATOM   2050 O O   . GLY C 2 78  ? 35.300  19.728  -51.823 1.00 34.52 ? 228  GLY A O   1 
ATOM   2051 N N   . GLU C 2 79  ? 33.171  20.335  -52.253 1.00 34.18 ? 229  GLU A N   1 
ATOM   2052 C CA  . GLU C 2 79  ? 32.824  20.650  -50.870 1.00 35.85 ? 229  GLU A CA  1 
ATOM   2053 C C   . GLU C 2 79  ? 32.764  19.357  -50.058 1.00 33.90 ? 229  GLU A C   1 
ATOM   2054 O O   . GLU C 2 79  ? 33.238  19.309  -48.940 1.00 33.50 ? 229  GLU A O   1 
ATOM   2055 C CB  . GLU C 2 79  ? 31.476  21.380  -50.752 1.00 36.46 ? 229  GLU A CB  1 
ATOM   2056 C CG  . GLU C 2 79  ? 31.095  21.788  -49.352 1.00 46.79 ? 229  GLU A CG  1 
ATOM   2057 C CD  . GLU C 2 79  ? 29.759  22.565  -49.270 1.00 53.57 ? 229  GLU A CD  1 
ATOM   2058 O OE1 . GLU C 2 79  ? 29.122  22.792  -50.329 1.00 60.50 ? 229  GLU A OE1 1 
ATOM   2059 O OE2 . GLU C 2 79  ? 29.351  22.936  -48.142 1.00 57.97 ? 229  GLU A OE2 1 
ATOM   2060 N N   . ARG C 2 80  ? 32.161  18.318  -50.611 1.00 33.11 ? 230  ARG A N   1 
ATOM   2061 C CA  . ARG C 2 80  ? 32.199  17.002  -49.924 1.00 33.57 ? 230  ARG A CA  1 
ATOM   2062 C C   . ARG C 2 80  ? 33.642  16.583  -49.660 1.00 32.39 ? 230  ARG A C   1 
ATOM   2063 O O   . ARG C 2 80  ? 34.008  16.279  -48.525 1.00 34.09 ? 230  ARG A O   1 
ATOM   2064 C CB  . ARG C 2 80  ? 31.498  15.936  -50.758 1.00 33.03 ? 230  ARG A CB  1 
ATOM   2065 C CG  . ARG C 2 80  ? 31.781  14.552  -50.232 1.00 34.40 ? 230  ARG A CG  1 
ATOM   2066 C CD  . ARG C 2 80  ? 30.951  13.519  -50.924 1.00 35.12 ? 230  ARG A CD  1 
ATOM   2067 N NE  . ARG C 2 80  ? 30.900  12.525  -49.894 1.00 50.34 ? 230  ARG A NE  1 
ATOM   2068 C CZ  . ARG C 2 80  ? 29.877  12.287  -49.097 1.00 41.74 ? 230  ARG A CZ  1 
ATOM   2069 N NH1 . ARG C 2 80  ? 28.667  12.843  -49.263 1.00 43.08 ? 230  ARG A NH1 1 
ATOM   2070 N NH2 . ARG C 2 80  ? 30.075  11.385  -48.189 1.00 44.26 ? 230  ARG A NH2 1 
ATOM   2071 N N   . ARG C 2 81  ? 34.471  16.634  -50.696 1.00 32.52 ? 231  ARG A N   1 
ATOM   2072 C CA  . ARG C 2 81  ? 35.886  16.224  -50.538 1.00 32.14 ? 231  ARG A CA  1 
ATOM   2073 C C   . ARG C 2 81  ? 36.599  17.036  -49.496 1.00 33.31 ? 231  ARG A C   1 
ATOM   2074 O O   . ARG C 2 81  ? 37.325  16.478  -48.650 1.00 33.16 ? 231  ARG A O   1 
ATOM   2075 C CB  . ARG C 2 81  ? 36.676  16.414  -51.835 1.00 31.68 ? 231  ARG A CB  1 
ATOM   2076 C CG  . ARG C 2 81  ? 38.065  15.854  -51.796 1.00 32.32 ? 231  ARG A CG  1 
ATOM   2077 C CD  . ARG C 2 81  ? 38.630  15.850  -53.228 1.00 32.12 ? 231  ARG A CD  1 
ATOM   2078 N NE  . ARG C 2 81  ? 38.696  17.231  -53.730 1.00 34.44 ? 231  ARG A NE  1 
ATOM   2079 C CZ  . ARG C 2 81  ? 38.843  17.524  -55.010 1.00 37.77 ? 231  ARG A CZ  1 
ATOM   2080 N NH1 . ARG C 2 81  ? 38.921  16.533  -55.941 1.00 36.01 ? 231  ARG A NH1 1 
ATOM   2081 N NH2 . ARG C 2 81  ? 38.918  18.791  -55.382 1.00 36.08 ? 231  ARG A NH2 1 
ATOM   2082 N N   . ARG C 2 82  ? 36.393  18.361  -49.513 1.00 33.16 ? 232  ARG A N   1 
ATOM   2083 C CA  . ARG C 2 82  ? 37.052  19.267  -48.529 1.00 33.20 ? 232  ARG A CA  1 
ATOM   2084 C C   . ARG C 2 82  ? 36.582  19.052  -47.072 1.00 32.74 ? 232  ARG A C   1 
ATOM   2085 O O   . ARG C 2 82  ? 37.290  19.379  -46.085 1.00 33.50 ? 232  ARG A O   1 
ATOM   2086 C CB  . ARG C 2 82  ? 36.772  20.739  -48.978 1.00 34.66 ? 232  ARG A CB  1 
ATOM   2087 C CG  . ARG C 2 82  ? 37.642  21.770  -48.341 1.00 37.07 ? 232  ARG A CG  1 
ATOM   2088 C CD  . ARG C 2 82  ? 37.249  23.173  -48.865 1.00 33.85 ? 232  ARG A CD  1 
ATOM   2089 N NE  . ARG C 2 82  ? 35.900  23.593  -48.556 1.00 40.13 ? 232  ARG A NE  1 
ATOM   2090 C CZ  . ARG C 2 82  ? 35.532  24.007  -47.344 1.00 46.46 ? 232  ARG A CZ  1 
ATOM   2091 N NH1 . ARG C 2 82  ? 36.433  24.044  -46.358 1.00 48.33 ? 232  ARG A NH1 1 
ATOM   2092 N NH2 . ARG C 2 82  ? 34.277  24.375  -47.097 1.00 49.15 ? 232  ARG A NH2 1 
ATOM   2093 N N   . ASN C 2 83  ? 35.360  18.552  -46.911 1.00 32.85 ? 233  ASN A N   1 
ATOM   2094 C CA  . ASN C 2 83  ? 34.836  18.297  -45.547 1.00 33.32 ? 233  ASN A CA  1 
ATOM   2095 C C   . ASN C 2 83  ? 34.831  16.878  -45.055 1.00 33.27 ? 233  ASN A C   1 
ATOM   2096 O O   . ASN C 2 83  ? 34.353  16.612  -43.931 1.00 31.03 ? 233  ASN A O   1 
ATOM   2097 C CB  . ASN C 2 83  ? 33.442  18.891  -45.428 1.00 31.99 ? 233  ASN A CB  1 
ATOM   2098 C CG  . ASN C 2 83  ? 33.499  20.426  -45.443 1.00 38.64 ? 233  ASN A CG  1 
ATOM   2099 O OD1 . ASN C 2 83  ? 33.837  21.025  -44.431 1.00 40.83 ? 233  ASN A OD1 1 
ATOM   2100 N ND2 . ASN C 2 83  ? 33.289  21.046  -46.612 1.00 39.66 ? 233  ASN A ND2 1 
ATOM   2101 N N   . THR C 2 84  ? 35.377  15.997  -45.886 1.00 32.84 ? 234  THR A N   1 
ATOM   2102 C CA  . THR C 2 84  ? 35.458  14.586  -45.574 1.00 32.67 ? 234  THR A CA  1 
ATOM   2103 C C   . THR C 2 84  ? 36.137  14.276  -44.247 1.00 33.85 ? 234  THR A C   1 
ATOM   2104 O O   . THR C 2 84  ? 35.649  13.388  -43.529 1.00 33.93 ? 234  THR A O   1 
ATOM   2105 C CB  . THR C 2 84  ? 35.998  13.770  -46.771 1.00 33.48 ? 234  THR A CB  1 
ATOM   2106 O OG1 . THR C 2 84  ? 35.013  13.802  -47.797 1.00 33.29 ? 234  THR A OG1 1 
ATOM   2107 C CG2 . THR C 2 84  ? 36.292  12.321  -46.389 1.00 33.14 ? 234  THR A CG2 1 
ATOM   2108 N N   . ILE C 2 85  ? 37.233  14.985  -43.895 1.00 32.61 ? 235  ILE A N   1 
ATOM   2109 C CA  . ILE C 2 85  ? 37.890  14.777  -42.599 1.00 35.13 ? 235  ILE A CA  1 
ATOM   2110 C C   . ILE C 2 85  ? 37.331  15.658  -41.479 1.00 34.85 ? 235  ILE A C   1 
ATOM   2111 O O   . ILE C 2 85  ? 37.942  15.780  -40.410 1.00 35.84 ? 235  ILE A O   1 
ATOM   2112 C CB  . ILE C 2 85  ? 39.487  14.939  -42.659 1.00 35.82 ? 235  ILE A CB  1 
ATOM   2113 C CG1 . ILE C 2 85  ? 39.988  16.349  -43.102 1.00 43.17 ? 235  ILE A CG1 1 
ATOM   2114 C CG2 . ILE C 2 85  ? 40.138  13.830  -43.519 1.00 40.97 ? 235  ILE A CG2 1 
ATOM   2115 C CD1 . ILE C 2 85  ? 41.428  16.532  -42.948 1.00 46.92 ? 235  ILE A CD1 1 
ATOM   2116 N N   . ALA C 2 86  ? 36.184  16.294  -41.726 1.00 35.05 ? 236  ALA A N   1 
ATOM   2117 C CA  . ALA C 2 86  ? 35.545  17.187  -40.719 1.00 34.35 ? 236  ALA A CA  1 
ATOM   2118 C C   . ALA C 2 86  ? 36.524  18.299  -40.215 1.00 35.17 ? 236  ALA A C   1 
ATOM   2119 O O   . ALA C 2 86  ? 36.797  18.375  -39.011 1.00 34.36 ? 236  ALA A O   1 
ATOM   2120 C CB  . ALA C 2 86  ? 35.015  16.350  -39.527 1.00 33.74 ? 236  ALA A CB  1 
ATOM   2121 N N   . PRO C 2 87  ? 37.023  19.176  -41.119 1.00 35.09 ? 237  PRO A N   1 
ATOM   2122 C CA  . PRO C 2 87  ? 38.062  20.181  -40.723 1.00 35.82 ? 237  PRO A CA  1 
ATOM   2123 C C   . PRO C 2 87  ? 37.543  21.213  -39.677 1.00 36.49 ? 237  PRO A C   1 
ATOM   2124 O O   . PRO C 2 87  ? 38.315  21.725  -38.804 1.00 36.66 ? 237  PRO A O   1 
ATOM   2125 C CB  . PRO C 2 87  ? 38.460  20.852  -42.075 1.00 35.02 ? 237  PRO A CB  1 
ATOM   2126 C CG  . PRO C 2 87  ? 37.220  20.636  -43.001 1.00 34.72 ? 237  PRO A CG  1 
ATOM   2127 C CD  . PRO C 2 87  ? 36.645  19.285  -42.547 1.00 35.07 ? 237  PRO A CD  1 
ATOM   2128 N N   . ASN C 2 88  ? 36.238  21.502  -39.723 1.00 37.25 ? 238  ASN A N   1 
ATOM   2129 C CA  . ASN C 2 88  ? 35.634  22.426  -38.726 1.00 39.38 ? 238  ASN A CA  1 
ATOM   2130 C C   . ASN C 2 88  ? 35.743  21.881  -37.309 1.00 39.09 ? 238  ASN A C   1 
ATOM   2131 O O   . ASN C 2 88  ? 35.637  22.620  -36.353 1.00 39.37 ? 238  ASN A O   1 
ATOM   2132 C CB  . ASN C 2 88  ? 34.175  22.726  -39.083 1.00 40.16 ? 238  ASN A CB  1 
ATOM   2133 C CG  . ASN C 2 88  ? 34.058  23.587  -40.354 1.00 44.41 ? 238  ASN A CG  1 
ATOM   2134 O OD1 . ASN C 2 88  ? 34.890  24.460  -40.593 1.00 51.84 ? 238  ASN A OD1 1 
ATOM   2135 N ND2 . ASN C 2 88  ? 33.030  23.346  -41.156 1.00 46.65 ? 238  ASN A ND2 1 
ATOM   2136 N N   . CYS C 2 89  ? 35.928  20.567  -37.190 1.00 39.31 ? 239  CYS A N   1 
ATOM   2137 C CA  . CYS C 2 89  ? 36.220  19.979  -35.919 1.00 38.59 ? 239  CYS A CA  1 
ATOM   2138 C C   . CYS C 2 89  ? 37.696  19.718  -35.702 1.00 38.48 ? 239  CYS A C   1 
ATOM   2139 O O   . CYS C 2 89  ? 38.193  19.979  -34.601 1.00 37.76 ? 239  CYS A O   1 
ATOM   2140 C CB  . CYS C 2 89  ? 35.476  18.657  -35.714 1.00 40.07 ? 239  CYS A CB  1 
ATOM   2141 S SG  . CYS C 2 89  ? 35.973  17.916  -34.123 1.00 42.24 ? 239  CYS A SG  1 
ATOM   2142 N N   . ALA C 2 90  ? 38.358  19.135  -36.704 1.00 36.38 ? 240  ALA A N   1 
ATOM   2143 C CA  . ALA C 2 90  ? 39.725  18.617  -36.588 1.00 37.32 ? 240  ALA A CA  1 
ATOM   2144 C C   . ALA C 2 90  ? 40.753  19.750  -36.475 1.00 38.43 ? 240  ALA A C   1 
ATOM   2145 O O   . ALA C 2 90  ? 41.797  19.573  -35.874 1.00 39.33 ? 240  ALA A O   1 
ATOM   2146 C CB  . ALA C 2 90  ? 40.073  17.754  -37.799 1.00 37.28 ? 240  ALA A CB  1 
ATOM   2147 N N   . LEU C 2 91  ? 40.455  20.886  -37.077 1.00 38.30 ? 241  LEU A N   1 
ATOM   2148 C CA  . LEU C 2 91  ? 41.444  21.995  -37.144 1.00 40.24 ? 241  LEU A CA  1 
ATOM   2149 C C   . LEU C 2 91  ? 41.084  23.119  -36.187 1.00 41.48 ? 241  LEU A C   1 
ATOM   2150 O O   . LEU C 2 91  ? 39.909  23.457  -36.065 1.00 41.09 ? 241  LEU A O   1 
ATOM   2151 C CB  . LEU C 2 91  ? 41.535  22.498  -38.581 1.00 39.65 ? 241  LEU A CB  1 
ATOM   2152 C CG  . LEU C 2 91  ? 41.772  21.444  -39.680 1.00 40.99 ? 241  LEU A CG  1 
ATOM   2153 C CD1 . LEU C 2 91  ? 41.760  22.113  -41.072 1.00 41.18 ? 241  LEU A CD1 1 
ATOM   2154 C CD2 . LEU C 2 91  ? 43.080  20.814  -39.436 1.00 41.85 ? 241  LEU A CD2 1 
ATOM   2155 N N   . PRO C 2 92  ? 42.108  23.720  -35.512 1.00 43.65 ? 242  PRO A N   1 
ATOM   2156 C CA  . PRO C 2 92  ? 41.928  24.905  -34.678 1.00 45.04 ? 242  PRO A CA  1 
ATOM   2157 C C   . PRO C 2 92  ? 41.203  25.985  -35.451 1.00 45.39 ? 242  PRO A C   1 
ATOM   2158 O O   . PRO C 2 92  ? 41.404  26.103  -36.629 1.00 45.90 ? 242  PRO A O   1 
ATOM   2159 C CB  . PRO C 2 92  ? 43.366  25.336  -34.371 1.00 45.29 ? 242  PRO A CB  1 
ATOM   2160 C CG  . PRO C 2 92  ? 44.132  24.050  -34.360 1.00 45.68 ? 242  PRO A CG  1 
ATOM   2161 C CD  . PRO C 2 92  ? 43.513  23.262  -35.517 1.00 43.66 ? 242  PRO A CD  1 
ATOM   2162 N N   . PRO C 2 93  ? 40.332  26.759  -34.793 1.00 46.92 ? 243  PRO A N   1 
ATOM   2163 C CA  . PRO C 2 93  ? 39.641  27.809  -35.575 1.00 47.05 ? 243  PRO A CA  1 
ATOM   2164 C C   . PRO C 2 93  ? 40.549  29.011  -35.887 1.00 47.12 ? 243  PRO A C   1 
ATOM   2165 O O   . PRO C 2 93  ? 40.252  29.796  -36.811 1.00 48.10 ? 243  PRO A O   1 
ATOM   2166 C CB  . PRO C 2 93  ? 38.492  28.225  -34.660 1.00 47.08 ? 243  PRO A CB  1 
ATOM   2167 C CG  . PRO C 2 93  ? 39.017  27.944  -33.269 1.00 48.09 ? 243  PRO A CG  1 
ATOM   2168 C CD  . PRO C 2 93  ? 39.898  26.724  -33.387 1.00 46.28 ? 243  PRO A CD  1 
ATOM   2169 N N   . VAL C 2 94  ? 41.652  29.146  -35.153 1.00 45.43 ? 244  VAL A N   1 
ATOM   2170 C CA  . VAL C 2 94  ? 42.678  30.137  -35.540 1.00 45.21 ? 244  VAL A CA  1 
ATOM   2171 C C   . VAL C 2 94  ? 43.871  29.427  -36.149 1.00 44.13 ? 244  VAL A C   1 
ATOM   2172 O O   . VAL C 2 94  ? 44.462  28.557  -35.489 1.00 44.55 ? 244  VAL A O   1 
ATOM   2173 C CB  . VAL C 2 94  ? 43.154  30.977  -34.347 1.00 45.32 ? 244  VAL A CB  1 
ATOM   2174 C CG1 . VAL C 2 94  ? 44.160  32.087  -34.798 1.00 45.56 ? 244  VAL A CG1 1 
ATOM   2175 C CG2 . VAL C 2 94  ? 41.949  31.564  -33.582 1.00 45.34 ? 244  VAL A CG2 1 
ATOM   2176 N N   . ALA C 2 95  ? 44.216  29.789  -37.395 1.00 42.37 ? 245  ALA A N   1 
ATOM   2177 C CA  . ALA C 2 95  ? 45.414  29.251  -38.057 1.00 40.33 ? 245  ALA A CA  1 
ATOM   2178 C C   . ALA C 2 95  ? 46.672  29.878  -37.458 1.00 39.13 ? 245  ALA A C   1 
ATOM   2179 O O   . ALA C 2 95  ? 46.839  31.113  -37.507 1.00 39.61 ? 245  ALA A O   1 
ATOM   2180 C CB  . ALA C 2 95  ? 45.355  29.494  -39.546 1.00 41.45 ? 245  ALA A CB  1 
ATOM   2181 N N   . PRO C 2 96  ? 47.560  29.053  -36.868 1.00 37.33 ? 246  PRO A N   1 
ATOM   2182 C CA  . PRO C 2 96  ? 48.760  29.609  -36.250 1.00 36.56 ? 246  PRO A CA  1 
ATOM   2183 C C   . PRO C 2 96  ? 49.899  29.776  -37.227 1.00 34.58 ? 246  PRO A C   1 
ATOM   2184 O O   . PRO C 2 96  ? 49.768  29.418  -38.381 1.00 34.39 ? 246  PRO A O   1 
ATOM   2185 C CB  . PRO C 2 96  ? 49.133  28.544  -35.215 1.00 36.93 ? 246  PRO A CB  1 
ATOM   2186 C CG  . PRO C 2 96  ? 48.742  27.306  -35.845 1.00 37.81 ? 246  PRO A CG  1 
ATOM   2187 C CD  . PRO C 2 96  ? 47.528  27.588  -36.734 1.00 37.89 ? 246  PRO A CD  1 
ATOM   2188 N N   . ASN C 2 97  ? 51.022  30.320  -36.761 1.00 33.28 ? 247  ASN A N   1 
ATOM   2189 C CA  . ASN C 2 97  ? 52.206  30.376  -37.612 1.00 33.81 ? 247  ASN A CA  1 
ATOM   2190 C C   . ASN C 2 97  ? 52.669  28.945  -37.928 1.00 33.72 ? 247  ASN A C   1 
ATOM   2191 O O   . ASN C 2 97  ? 52.573  28.020  -37.082 1.00 32.98 ? 247  ASN A O   1 
ATOM   2192 C CB  . ASN C 2 97  ? 53.305  31.195  -36.930 1.00 34.46 ? 247  ASN A CB  1 
ATOM   2193 C CG  . ASN C 2 97  ? 54.534  31.291  -37.765 1.00 34.46 ? 247  ASN A CG  1 
ATOM   2194 O OD1 . ASN C 2 97  ? 55.375  30.413  -37.693 1.00 39.78 ? 247  ASN A OD1 1 
ATOM   2195 N ND2 . ASN C 2 97  ? 54.652  32.367  -38.575 1.00 39.16 ? 247  ASN A ND2 1 
ATOM   2196 N N   . CYS C 2 98  ? 53.099  28.699  -39.151 1.00 34.90 ? 248  CYS A N   1 
ATOM   2197 C CA  . CYS C 2 98  ? 53.430  27.288  -39.489 1.00 34.62 ? 248  CYS A CA  1 
ATOM   2198 C C   . CYS C 2 98  ? 54.548  26.680  -38.630 1.00 33.63 ? 248  CYS A C   1 
ATOM   2199 O O   . CYS C 2 98  ? 54.497  25.462  -38.357 1.00 33.03 ? 248  CYS A O   1 
ATOM   2200 C CB  . CYS C 2 98  ? 53.857  27.167  -40.922 1.00 37.94 ? 248  CYS A CB  1 
ATOM   2201 S SG  . CYS C 2 98  ? 52.494  27.506  -42.091 1.00 43.98 ? 248  CYS A SG  1 
ATOM   2202 N N   . LEU C 2 99  ? 55.549  27.515  -38.298 1.00 30.47 ? 249  LEU A N   1 
ATOM   2203 C CA  . LEU C 2 99  ? 56.720  27.129  -37.477 1.00 31.08 ? 249  LEU A CA  1 
ATOM   2204 C C   . LEU C 2 99  ? 56.358  26.832  -36.025 1.00 32.50 ? 249  LEU A C   1 
ATOM   2205 O O   . LEU C 2 99  ? 56.904  25.889  -35.443 1.00 35.38 ? 249  LEU A O   1 
ATOM   2206 C CB  . LEU C 2 99  ? 57.843  28.192  -37.528 1.00 30.25 ? 249  LEU A CB  1 
ATOM   2207 C CG  . LEU C 2 99  ? 58.410  28.421  -38.931 1.00 29.60 ? 249  LEU A CG  1 
ATOM   2208 C CD1 . LEU C 2 99  ? 59.359  29.592  -38.882 1.00 31.62 ? 249  LEU A CD1 1 
ATOM   2209 C CD2 . LEU C 2 99  ? 59.036  27.128  -39.512 1.00 32.54 ? 249  LEU A CD2 1 
ATOM   2210 N N   . GLU C 2 100 ? 55.460  27.624  -35.438 1.00 32.43 ? 250  GLU A N   1 
ATOM   2211 C CA  . GLU C 2 100 ? 54.767  27.217  -34.169 1.00 32.39 ? 250  GLU A CA  1 
ATOM   2212 C C   . GLU C 2 100 ? 53.995  25.906  -34.188 1.00 33.69 ? 250  GLU A C   1 
ATOM   2213 O O   . GLU C 2 100 ? 54.057  25.108  -33.253 1.00 34.41 ? 250  GLU A O   1 
ATOM   2214 C CB  . GLU C 2 100 ? 53.826  28.341  -33.758 1.00 33.81 ? 250  GLU A CB  1 
ATOM   2215 C CG  . GLU C 2 100 ? 54.677  29.510  -33.346 1.00 39.36 ? 250  GLU A CG  1 
ATOM   2216 C CD  . GLU C 2 100 ? 55.823  29.030  -32.457 1.00 49.94 ? 250  GLU A CD  1 
ATOM   2217 O OE1 . GLU C 2 100 ? 55.437  28.283  -31.464 1.00 51.58 ? 250  GLU A OE1 1 
ATOM   2218 O OE2 . GLU C 2 100 ? 57.059  29.399  -32.729 1.00 50.95 ? 250  GLU A OE2 1 
ATOM   2219 N N   . LEU C 2 101 ? 53.198  25.715  -35.220 1.00 31.87 ? 251  LEU A N   1 
ATOM   2220 C CA  . LEU C 2 101 ? 52.515  24.436  -35.420 1.00 31.60 ? 251  LEU A CA  1 
ATOM   2221 C C   . LEU C 2 101 ? 53.471  23.209  -35.472 1.00 31.93 ? 251  LEU A C   1 
ATOM   2222 O O   . LEU C 2 101 ? 53.220  22.173  -34.823 1.00 32.31 ? 251  LEU A O   1 
ATOM   2223 C CB  . LEU C 2 101 ? 51.712  24.536  -36.724 1.00 32.42 ? 251  LEU A CB  1 
ATOM   2224 C CG  . LEU C 2 101 ? 50.625  23.495  -36.968 1.00 30.38 ? 251  LEU A CG  1 
ATOM   2225 C CD1 . LEU C 2 101 ? 49.592  23.408  -35.769 1.00 35.20 ? 251  LEU A CD1 1 
ATOM   2226 C CD2 . LEU C 2 101 ? 49.923  23.707  -38.359 1.00 34.36 ? 251  LEU A CD2 1 
ATOM   2227 N N   . ARG C 2 102 ? 54.528  23.280  -36.306 1.00 31.85 ? 252  ARG A N   1 
ATOM   2228 C CA  . ARG C 2 102 ? 55.546  22.218  -36.324 1.00 31.97 ? 252  ARG A CA  1 
ATOM   2229 C C   . ARG C 2 102 ? 56.172  21.978  -34.959 1.00 31.42 ? 252  ARG A C   1 
ATOM   2230 O O   . ARG C 2 102 ? 56.492  20.853  -34.610 1.00 32.33 ? 252  ARG A O   1 
ATOM   2231 C CB  . ARG C 2 102 ? 56.684  22.570  -37.284 1.00 32.82 ? 252  ARG A CB  1 
ATOM   2232 C CG  . ARG C 2 102 ? 57.526  21.330  -37.660 1.00 35.65 ? 252  ARG A CG  1 
ATOM   2233 C CD  . ARG C 2 102 ? 58.632  21.630  -38.706 1.00 34.03 ? 252  ARG A CD  1 
ATOM   2234 N NE  . ARG C 2 102 ? 59.468  22.758  -38.252 1.00 34.46 ? 252  ARG A NE  1 
ATOM   2235 C CZ  . ARG C 2 102 ? 60.385  23.358  -39.010 1.00 36.52 ? 252  ARG A CZ  1 
ATOM   2236 N NH1 . ARG C 2 102 ? 60.626  22.888  -40.214 1.00 38.39 ? 252  ARG A NH1 1 
ATOM   2237 N NH2 . ARG C 2 102 ? 61.095  24.389  -38.543 1.00 34.70 ? 252  ARG A NH2 1 
ATOM   2238 N N   . ARG C 2 103 ? 56.348  23.042  -34.192 1.00 28.52 ? 253  ARG A N   1 
ATOM   2239 C CA  . ARG C 2 103 ? 56.917  22.925  -32.840 1.00 30.74 ? 253  ARG A CA  1 
ATOM   2240 C C   . ARG C 2 103 ? 55.984  22.136  -31.908 1.00 33.49 ? 253  ARG A C   1 
ATOM   2241 O O   . ARG C 2 103 ? 56.490  21.418  -30.896 1.00 31.48 ? 253  ARG A O   1 
ATOM   2242 C CB  . ARG C 2 103 ? 57.132  24.286  -32.252 1.00 30.90 ? 253  ARG A CB  1 
ATOM   2243 C CG  . ARG C 2 103 ? 57.960  24.178  -30.885 1.00 29.43 ? 253  ARG A CG  1 
ATOM   2244 C CD  . ARG C 2 103 ? 58.478  25.523  -30.561 1.00 39.19 ? 253  ARG A CD  1 
ATOM   2245 N NE  . ARG C 2 103 ? 57.979  25.980  -29.256 1.00 48.83 ? 253  ARG A NE  1 
ATOM   2246 C CZ  . ARG C 2 103 ? 56.731  26.432  -29.067 1.00 50.44 ? 253  ARG A CZ  1 
ATOM   2247 N NH1 . ARG C 2 103 ? 55.830  26.476  -30.103 1.00 51.50 ? 253  ARG A NH1 1 
ATOM   2248 N NH2 . ARG C 2 103 ? 56.404  26.831  -27.823 1.00 53.32 ? 253  ARG A NH2 1 
ATOM   2249 N N   . LEU C 2 104 ? 54.653  22.308  -32.227 1.00 33.37 ? 254  LEU A N   1 
ATOM   2250 C CA  . LEU C 2 104 ? 53.638  21.605  -31.423 1.00 34.70 ? 254  LEU A CA  1 
ATOM   2251 C C   . LEU C 2 104 ? 53.705  20.163  -31.891 1.00 35.45 ? 254  LEU A C   1 
ATOM   2252 O O   . LEU C 2 104 ? 53.681  19.247  -31.067 1.00 36.44 ? 254  LEU A O   1 
ATOM   2253 C CB  . LEU C 2 104 ? 52.227  22.205  -31.591 1.00 34.58 ? 254  LEU A CB  1 
ATOM   2254 C CG  . LEU C 2 104 ? 51.021  21.438  -30.957 1.00 35.31 ? 254  LEU A CG  1 
ATOM   2255 C CD1 . LEU C 2 104 ? 51.109  21.311  -29.428 1.00 34.57 ? 254  LEU A CD1 1 
ATOM   2256 C CD2 . LEU C 2 104 ? 49.669  22.030  -31.374 1.00 35.73 ? 254  LEU A CD2 1 
ATOM   2257 N N   . CYS C 2 105 ? 53.753  19.951  -33.213 1.00 36.13 ? 255  CYS A N   1 
ATOM   2258 C CA  . CYS C 2 105 ? 54.086  18.642  -33.733 1.00 35.89 ? 255  CYS A CA  1 
ATOM   2259 C C   . CYS C 2 105 ? 55.335  17.978  -33.074 1.00 35.35 ? 255  CYS A C   1 
ATOM   2260 O O   . CYS C 2 105 ? 55.275  16.826  -32.603 1.00 35.64 ? 255  CYS A O   1 
ATOM   2261 C CB  . CYS C 2 105 ? 54.204  18.693  -35.273 1.00 36.05 ? 255  CYS A CB  1 
ATOM   2262 S SG  . CYS C 2 105 ? 54.508  17.098  -35.941 1.00 40.89 ? 255  CYS A SG  1 
ATOM   2263 N N   . PHE C 2 106 ? 56.454  18.693  -33.012 1.00 35.16 ? 256  PHE A N   1 
ATOM   2264 C CA  . PHE C 2 106 ? 57.684  18.107  -32.530 1.00 35.50 ? 256  PHE A CA  1 
ATOM   2265 C C   . PHE C 2 106 ? 57.555  17.620  -31.093 1.00 36.23 ? 256  PHE A C   1 
ATOM   2266 O O   . PHE C 2 106 ? 58.311  16.739  -30.658 1.00 38.05 ? 256  PHE A O   1 
ATOM   2267 C CB  . PHE C 2 106 ? 58.849  19.102  -32.657 1.00 36.51 ? 256  PHE A CB  1 
ATOM   2268 C CG  . PHE C 2 106 ? 59.362  19.292  -34.068 1.00 34.83 ? 256  PHE A CG  1 
ATOM   2269 C CD1 . PHE C 2 106 ? 60.055  20.452  -34.402 1.00 37.71 ? 256  PHE A CD1 1 
ATOM   2270 C CD2 . PHE C 2 106 ? 59.176  18.321  -35.043 1.00 40.49 ? 256  PHE A CD2 1 
ATOM   2271 C CE1 . PHE C 2 106 ? 60.590  20.663  -35.702 1.00 34.29 ? 256  PHE A CE1 1 
ATOM   2272 C CE2 . PHE C 2 106 ? 59.673  18.509  -36.354 1.00 39.35 ? 256  PHE A CE2 1 
ATOM   2273 C CZ  . PHE C 2 106 ? 60.403  19.692  -36.664 1.00 38.93 ? 256  PHE A CZ  1 
ATOM   2274 N N   . SER C 2 107 ? 56.639  18.222  -30.321 1.00 36.99 ? 257  SER A N   1 
ATOM   2275 C CA  . SER C 2 107 ? 56.495  17.915  -28.868 1.00 36.86 ? 257  SER A CA  1 
ATOM   2276 C C   . SER C 2 107 ? 55.896  16.521  -28.573 1.00 37.19 ? 257  SER A C   1 
ATOM   2277 O O   . SER C 2 107 ? 56.017  15.986  -27.434 1.00 34.76 ? 257  SER A O   1 
ATOM   2278 C CB  . SER C 2 107 ? 55.622  18.978  -28.183 1.00 37.88 ? 257  SER A CB  1 
ATOM   2279 O OG  . SER C 2 107 ? 54.251  18.818  -28.547 1.00 38.04 ? 257  SER A OG  1 
ATOM   2280 N N   . ASP C 2 108 ? 55.249  15.944  -29.588 1.00 35.97 ? 258  ASP A N   1 
ATOM   2281 C CA  . ASP C 2 108 ? 54.594  14.609  -29.502 1.00 36.50 ? 258  ASP A CA  1 
ATOM   2282 C C   . ASP C 2 108 ? 55.339  13.619  -30.381 1.00 36.42 ? 258  ASP A C   1 
ATOM   2283 O O   . ASP C 2 108 ? 55.388  13.827  -31.604 1.00 34.31 ? 258  ASP A O   1 
ATOM   2284 C CB  . ASP C 2 108 ? 53.147  14.669  -30.045 1.00 37.17 ? 258  ASP A CB  1 
ATOM   2285 C CG  . ASP C 2 108 ? 52.508  13.266  -30.185 1.00 40.24 ? 258  ASP A CG  1 
ATOM   2286 O OD1 . ASP C 2 108 ? 52.450  12.505  -29.204 1.00 48.08 ? 258  ASP A OD1 1 
ATOM   2287 O OD2 . ASP C 2 108 ? 52.063  12.924  -31.295 1.00 47.71 ? 258  ASP A OD2 1 
ATOM   2288 N N   . PRO C 2 109 ? 55.893  12.549  -29.780 1.00 35.54 ? 259  PRO A N   1 
ATOM   2289 C CA  . PRO C 2 109 ? 56.614  11.565  -30.596 1.00 36.31 ? 259  PRO A CA  1 
ATOM   2290 C C   . PRO C 2 109 ? 55.905  11.008  -31.861 1.00 35.12 ? 259  PRO A C   1 
ATOM   2291 O O   . PRO C 2 109 ? 56.576  10.851  -32.901 1.00 35.82 ? 259  PRO A O   1 
ATOM   2292 C CB  . PRO C 2 109 ? 56.876  10.437  -29.605 1.00 36.58 ? 259  PRO A CB  1 
ATOM   2293 C CG  . PRO C 2 109 ? 57.012  11.178  -28.241 1.00 36.43 ? 259  PRO A CG  1 
ATOM   2294 C CD  . PRO C 2 109 ? 55.926  12.204  -28.337 1.00 37.49 ? 259  PRO A CD  1 
ATOM   2295 N N   . LEU C 2 110 ? 54.599  10.678  -31.781 1.00 34.64 ? 260  LEU A N   1 
ATOM   2296 C CA  . LEU C 2 110 ? 53.836  10.231  -32.977 1.00 35.94 ? 260  LEU A CA  1 
ATOM   2297 C C   . LEU C 2 110 ? 53.833  11.234  -34.116 1.00 34.55 ? 260  LEU A C   1 
ATOM   2298 O O   . LEU C 2 110 ? 54.048  10.869  -35.299 1.00 35.95 ? 260  LEU A O   1 
ATOM   2299 C CB  . LEU C 2 110 ? 52.372  9.885   -32.627 1.00 36.59 ? 260  LEU A CB  1 
ATOM   2300 C CG  . LEU C 2 110 ? 51.455  9.410   -33.782 1.00 37.74 ? 260  LEU A CG  1 
ATOM   2301 C CD1 . LEU C 2 110 ? 52.067  8.210   -34.450 1.00 43.20 ? 260  LEU A CD1 1 
ATOM   2302 C CD2 . LEU C 2 110 ? 50.076  8.974   -33.256 1.00 39.52 ? 260  LEU A CD2 1 
ATOM   2303 N N   . CYS C 2 111 ? 53.462  12.469  -33.817 1.00 34.56 ? 261  CYS A N   1 
ATOM   2304 C CA  . CYS C 2 111 ? 53.444  13.517  -34.873 1.00 33.33 ? 261  CYS A CA  1 
ATOM   2305 C C   . CYS C 2 111 ? 54.821  13.727  -35.475 1.00 32.08 ? 261  CYS A C   1 
ATOM   2306 O O   . CYS C 2 111 ? 54.948  13.775  -36.673 1.00 31.89 ? 261  CYS A O   1 
ATOM   2307 C CB  . CYS C 2 111 ? 52.892  14.827  -34.360 1.00 32.89 ? 261  CYS A CB  1 
ATOM   2308 S SG  . CYS C 2 111 ? 52.731  16.057  -35.701 1.00 39.27 ? 261  CYS A SG  1 
ATOM   2309 N N   . ARG C 2 112 ? 55.875  13.837  -34.639 1.00 31.93 ? 262  ARG A N   1 
ATOM   2310 C CA  . ARG C 2 112 ? 57.227  13.969  -35.218 1.00 32.75 ? 262  ARG A CA  1 
ATOM   2311 C C   . ARG C 2 112 ? 57.542  12.849  -36.256 1.00 32.92 ? 262  ARG A C   1 
ATOM   2312 O O   . ARG C 2 112 ? 58.016  13.110  -37.385 1.00 31.13 ? 262  ARG A O   1 
ATOM   2313 C CB  . ARG C 2 112 ? 58.312  14.001  -34.114 1.00 32.47 ? 262  ARG A CB  1 
ATOM   2314 C CG  . ARG C 2 112 ? 59.703  14.221  -34.782 1.00 32.40 ? 262  ARG A CG  1 
ATOM   2315 C CD  . ARG C 2 112 ? 60.834  14.003  -33.833 1.00 34.34 ? 262  ARG A CD  1 
ATOM   2316 N NE  . ARG C 2 112 ? 60.922  15.054  -32.835 1.00 35.70 ? 262  ARG A NE  1 
ATOM   2317 C CZ  . ARG C 2 112 ? 61.554  16.232  -32.981 1.00 38.18 ? 262  ARG A CZ  1 
ATOM   2318 N NH1 . ARG C 2 112 ? 62.133  16.605  -34.133 1.00 35.08 ? 262  ARG A NH1 1 
ATOM   2319 N NH2 . ARG C 2 112 ? 61.561  17.069  -31.953 1.00 33.39 ? 262  ARG A NH2 1 
ATOM   2320 N N   . SER C 2 113 ? 57.264  11.605  -35.864 1.00 33.32 ? 263  SER A N   1 
ATOM   2321 C CA  . SER C 2 113 ? 57.462  10.440  -36.729 1.00 34.80 ? 263  SER A CA  1 
ATOM   2322 C C   . SER C 2 113 ? 56.648  10.481  -38.052 1.00 33.55 ? 263  SER A C   1 
ATOM   2323 O O   . SER C 2 113 ? 57.161  10.116  -39.122 1.00 33.36 ? 263  SER A O   1 
ATOM   2324 C CB  . SER C 2 113 ? 57.153  9.183   -35.897 1.00 37.13 ? 263  SER A CB  1 
ATOM   2325 O OG  . SER C 2 113 ? 57.185  7.985   -36.657 1.00 42.63 ? 263  SER A OG  1 
ATOM   2326 N N   . ARG C 2 114 ? 55.387  10.918  -37.990 1.00 31.94 ? 264  ARG A N   1 
ATOM   2327 C CA  . ARG C 2 114 ? 54.552  11.051  -39.210 1.00 32.17 ? 264  ARG A CA  1 
ATOM   2328 C C   . ARG C 2 114 ? 55.096  12.110  -40.116 1.00 32.70 ? 264  ARG A C   1 
ATOM   2329 O O   . ARG C 2 114 ? 55.058  11.960  -41.366 1.00 29.98 ? 264  ARG A O   1 
ATOM   2330 C CB  . ARG C 2 114 ? 53.111  11.326  -38.853 1.00 30.25 ? 264  ARG A CB  1 
ATOM   2331 C CG  . ARG C 2 114 ? 52.543  10.154  -37.928 1.00 34.33 ? 264  ARG A CG  1 
ATOM   2332 C CD  . ARG C 2 114 ? 52.359  8.882   -38.844 1.00 32.76 ? 264  ARG A CD  1 
ATOM   2333 N NE  . ARG C 2 114 ? 51.923  7.712   -38.061 1.00 31.98 ? 264  ARG A NE  1 
ATOM   2334 C CZ  . ARG C 2 114 ? 50.641  7.416   -37.852 1.00 36.57 ? 264  ARG A CZ  1 
ATOM   2335 N NH1 . ARG C 2 114 ? 49.729  8.202   -38.370 1.00 34.14 ? 264  ARG A NH1 1 
ATOM   2336 N NH2 . ARG C 2 114 ? 50.251  6.327   -37.163 1.00 36.95 ? 264  ARG A NH2 1 
ATOM   2337 N N   . LEU C 2 115 ? 55.598  13.188  -39.496 1.00 31.84 ? 265  LEU A N   1 
ATOM   2338 C CA  . LEU C 2 115 ? 56.177  14.313  -40.306 1.00 34.33 ? 265  LEU A CA  1 
ATOM   2339 C C   . LEU C 2 115 ? 57.496  13.877  -40.931 1.00 34.24 ? 265  LEU A C   1 
ATOM   2340 O O   . LEU C 2 115 ? 57.744  14.162  -42.091 1.00 36.07 ? 265  LEU A O   1 
ATOM   2341 C CB  . LEU C 2 115 ? 56.357  15.606  -39.506 1.00 32.52 ? 265  LEU A CB  1 
ATOM   2342 C CG  . LEU C 2 115 ? 56.785  16.838  -40.337 1.00 34.51 ? 265  LEU A CG  1 
ATOM   2343 C CD1 . LEU C 2 115 ? 55.763  17.265  -41.418 1.00 31.56 ? 265  LEU A CD1 1 
ATOM   2344 C CD2 . LEU C 2 115 ? 57.110  18.018  -39.439 1.00 34.24 ? 265  LEU A CD2 1 
ATOM   2345 N N   . VAL C 2 116 ? 58.313  13.154  -40.181 1.00 35.04 ? 266  VAL A N   1 
ATOM   2346 C CA  . VAL C 2 116 ? 59.496  12.547  -40.790 1.00 35.52 ? 266  VAL A CA  1 
ATOM   2347 C C   . VAL C 2 116 ? 59.156  11.652  -42.007 1.00 36.14 ? 266  VAL A C   1 
ATOM   2348 O O   . VAL C 2 116 ? 59.807  11.755  -43.052 1.00 34.99 ? 266  VAL A O   1 
ATOM   2349 C CB  . VAL C 2 116 ? 60.303  11.782  -39.801 1.00 35.45 ? 266  VAL A CB  1 
ATOM   2350 C CG1 . VAL C 2 116 ? 61.297  10.903  -40.511 1.00 36.81 ? 266  VAL A CG1 1 
ATOM   2351 C CG2 . VAL C 2 116 ? 60.994  12.753  -38.859 1.00 36.74 ? 266  VAL A CG2 1 
ATOM   2352 N N   . ASP C 2 117 ? 58.153  10.785  -41.901 1.00 35.41 ? 267  ASP A N   1 
ATOM   2353 C CA  . ASP C 2 117 ? 57.939  9.947   -43.065 1.00 36.32 ? 267  ASP A CA  1 
ATOM   2354 C C   . ASP C 2 117 ? 57.398  10.720  -44.254 1.00 34.06 ? 267  ASP A C   1 
ATOM   2355 O O   . ASP C 2 117 ? 57.702  10.354  -45.385 1.00 33.74 ? 267  ASP A O   1 
ATOM   2356 C CB  . ASP C 2 117 ? 57.215  8.618   -42.808 1.00 37.72 ? 267  ASP A CB  1 
ATOM   2357 C CG  . ASP C 2 117 ? 56.055  8.727   -41.895 1.00 45.18 ? 267  ASP A CG  1 
ATOM   2358 O OD1 . ASP C 2 117 ? 55.084  9.404   -42.315 1.00 54.28 ? 267  ASP A OD1 1 
ATOM   2359 O OD2 . ASP C 2 117 ? 56.043  7.990   -40.824 1.00 50.02 ? 267  ASP A OD2 1 
ATOM   2360 N N   . PHE C 2 118 ? 56.622  11.774  -44.029 1.00 32.38 ? 268  PHE A N   1 
ATOM   2361 C CA  . PHE C 2 118 ? 56.105  12.579  -45.149 1.00 33.11 ? 268  PHE A CA  1 
ATOM   2362 C C   . PHE C 2 118 ? 57.291  13.281  -45.876 1.00 35.33 ? 268  PHE A C   1 
ATOM   2363 O O   . PHE C 2 118 ? 57.385  13.349  -47.130 1.00 35.00 ? 268  PHE A O   1 
ATOM   2364 C CB  . PHE C 2 118 ? 55.077  13.584  -44.591 1.00 31.97 ? 268  PHE A CB  1 
ATOM   2365 C CG  . PHE C 2 118 ? 54.623  14.618  -45.603 1.00 35.94 ? 268  PHE A CG  1 
ATOM   2366 C CD1 . PHE C 2 118 ? 53.893  14.230  -46.726 1.00 36.78 ? 268  PHE A CD1 1 
ATOM   2367 C CD2 . PHE C 2 118 ? 54.929  15.916  -45.447 1.00 38.71 ? 268  PHE A CD2 1 
ATOM   2368 C CE1 . PHE C 2 118 ? 53.490  15.143  -47.653 1.00 36.03 ? 268  PHE A CE1 1 
ATOM   2369 C CE2 . PHE C 2 118 ? 54.538  16.864  -46.417 1.00 41.78 ? 268  PHE A CE2 1 
ATOM   2370 C CZ  . PHE C 2 118 ? 53.827  16.468  -47.503 1.00 38.27 ? 268  PHE A CZ  1 
ATOM   2371 N N   . GLN C 2 119 ? 58.224  13.797  -45.088 1.00 35.93 ? 269  GLN A N   1 
ATOM   2372 C CA  . GLN C 2 119 ? 59.455  14.391  -45.660 1.00 38.14 ? 269  GLN A CA  1 
ATOM   2373 C C   . GLN C 2 119 ? 60.343  13.406  -46.416 1.00 38.42 ? 269  GLN A C   1 
ATOM   2374 O O   . GLN C 2 119 ? 61.003  13.807  -47.348 1.00 41.09 ? 269  GLN A O   1 
ATOM   2375 C CB  . GLN C 2 119 ? 60.289  15.001  -44.527 1.00 38.37 ? 269  GLN A CB  1 
ATOM   2376 C CG  . GLN C 2 119 ? 59.573  16.196  -43.984 1.00 43.15 ? 269  GLN A CG  1 
ATOM   2377 C CD  . GLN C 2 119 ? 60.317  16.886  -42.815 1.00 48.82 ? 269  GLN A CD  1 
ATOM   2378 O OE1 . GLN C 2 119 ? 61.204  16.303  -42.134 1.00 51.99 ? 269  GLN A OE1 1 
ATOM   2379 N NE2 . GLN C 2 119 ? 59.930  18.143  -42.573 1.00 50.34 ? 269  GLN A NE2 1 
ATOM   2380 N N   . THR C 2 120 ? 60.375  12.149  -45.978 1.00 39.34 ? 270  THR A N   1 
ATOM   2381 C CA  . THR C 2 120 ? 61.164  11.051  -46.559 1.00 39.60 ? 270  THR A CA  1 
ATOM   2382 C C   . THR C 2 120 ? 60.528  10.590  -47.881 1.00 39.88 ? 270  THR A C   1 
ATOM   2383 O O   . THR C 2 120 ? 61.233  10.435  -48.881 1.00 40.44 ? 270  THR A O   1 
ATOM   2384 C CB  . THR C 2 120 ? 61.260  9.883   -45.590 1.00 40.55 ? 270  THR A CB  1 
ATOM   2385 O OG1 . THR C 2 120 ? 62.005  10.312  -44.436 1.00 40.61 ? 270  THR A OG1 1 
ATOM   2386 C CG2 . THR C 2 120 ? 61.990  8.661   -46.188 1.00 42.70 ? 270  THR A CG2 1 
ATOM   2387 N N   . HIS C 2 121 ? 59.220  10.433  -47.904 1.00 36.19 ? 271  HIS A N   1 
ATOM   2388 C CA  . HIS C 2 121 ? 58.605  9.832   -49.093 1.00 35.77 ? 271  HIS A CA  1 
ATOM   2389 C C   . HIS C 2 121 ? 58.089  10.847  -50.103 1.00 34.39 ? 271  HIS A C   1 
ATOM   2390 O O   . HIS C 2 121 ? 58.068  10.544  -51.309 1.00 35.02 ? 271  HIS A O   1 
ATOM   2391 C CB  . HIS C 2 121 ? 57.518  8.859   -48.688 1.00 34.58 ? 271  HIS A CB  1 
ATOM   2392 C CG  . HIS C 2 121 ? 58.042  7.665   -47.943 1.00 36.08 ? 271  HIS A CG  1 
ATOM   2393 N ND1 . HIS C 2 121 ? 58.041  7.584   -46.558 1.00 40.18 ? 271  HIS A ND1 1 
ATOM   2394 C CD2 . HIS C 2 121 ? 58.663  6.548   -48.381 1.00 30.75 ? 271  HIS A CD2 1 
ATOM   2395 C CE1 . HIS C 2 121 ? 58.588  6.435   -46.181 1.00 36.48 ? 271  HIS A CE1 1 
ATOM   2396 N NE2 . HIS C 2 121 ? 58.955  5.781   -47.267 1.00 39.28 ? 271  HIS A NE2 1 
ATOM   2397 N N   . CYS C 2 122 ? 57.728  12.035  -49.629 1.00 33.28 ? 272  CYS A N   1 
ATOM   2398 C CA  . CYS C 2 122 ? 57.139  13.035  -50.499 1.00 34.36 ? 272  CYS A CA  1 
ATOM   2399 C C   . CYS C 2 122 ? 58.120  14.102  -50.904 1.00 35.34 ? 272  CYS A C   1 
ATOM   2400 O O   . CYS C 2 122 ? 57.689  15.086  -51.486 1.00 34.49 ? 272  CYS A O   1 
ATOM   2401 C CB  . CYS C 2 122 ? 55.902  13.682  -49.873 1.00 35.46 ? 272  CYS A CB  1 
ATOM   2402 S SG  . CYS C 2 122 ? 54.558  12.519  -49.559 1.00 38.23 ? 272  CYS A SG  1 
ATOM   2403 N N   . HIS C 2 123 ? 59.424  13.882  -50.678 1.00 34.52 ? 273  HIS A N   1 
ATOM   2404 C CA  . HIS C 2 123 ? 60.414  14.888  -51.109 1.00 36.55 ? 273  HIS A CA  1 
ATOM   2405 C C   . HIS C 2 123 ? 60.653  14.735  -52.622 1.00 35.84 ? 273  HIS A C   1 
ATOM   2406 O O   . HIS C 2 123 ? 60.963  13.619  -53.055 1.00 35.97 ? 273  HIS A O   1 
ATOM   2407 C CB  . HIS C 2 123 ? 61.731  14.665  -50.364 1.00 36.57 ? 273  HIS A CB  1 
ATOM   2408 C CG  . HIS C 2 123 ? 62.841  15.570  -50.798 1.00 40.50 ? 273  HIS A CG  1 
ATOM   2409 N ND1 . HIS C 2 123 ? 62.828  16.931  -50.574 1.00 44.99 ? 273  HIS A ND1 1 
ATOM   2410 C CD2 . HIS C 2 123 ? 64.009  15.307  -51.428 1.00 40.84 ? 273  HIS A CD2 1 
ATOM   2411 C CE1 . HIS C 2 123 ? 63.919  17.475  -51.089 1.00 42.96 ? 273  HIS A CE1 1 
ATOM   2412 N NE2 . HIS C 2 123 ? 64.662  16.509  -51.599 1.00 42.04 ? 273  HIS A NE2 1 
ATOM   2413 N N   . PRO C 2 124 ? 60.512  15.833  -53.418 1.00 35.97 ? 274  PRO A N   1 
ATOM   2414 C CA  . PRO C 2 124 ? 60.780  15.653  -54.882 1.00 35.83 ? 274  PRO A CA  1 
ATOM   2415 C C   . PRO C 2 124 ? 62.267  15.457  -55.168 1.00 35.55 ? 274  PRO A C   1 
ATOM   2416 O O   . PRO C 2 124 ? 63.090  16.210  -54.650 1.00 36.82 ? 274  PRO A O   1 
ATOM   2417 C CB  . PRO C 2 124 ? 60.197  16.954  -55.510 1.00 37.26 ? 274  PRO A CB  1 
ATOM   2418 C CG  . PRO C 2 124 ? 60.211  17.986  -54.387 1.00 37.34 ? 274  PRO A CG  1 
ATOM   2419 C CD  . PRO C 2 124 ? 60.015  17.190  -53.095 1.00 36.42 ? 274  PRO A CD  1 
ATOM   2420 N N   . MET C 2 125 ? 62.615  14.430  -55.937 1.00 34.50 ? 275  MET A N   1 
ATOM   2421 C CA  . MET C 2 125 ? 63.995  14.136  -56.294 1.00 34.42 ? 275  MET A CA  1 
ATOM   2422 C C   . MET C 2 125 ? 64.444  14.944  -57.498 1.00 33.91 ? 275  MET A C   1 
ATOM   2423 O O   . MET C 2 125 ? 65.596  14.963  -57.818 1.00 31.39 ? 275  MET A O   1 
ATOM   2424 C CB  . MET C 2 125 ? 64.111  12.665  -56.678 1.00 35.77 ? 275  MET A CB  1 
ATOM   2425 C CG  . MET C 2 125 ? 64.068  11.725  -55.487 1.00 41.41 ? 275  MET A CG  1 
ATOM   2426 S SD  . MET C 2 125 ? 65.302  12.079  -54.159 1.00 51.98 ? 275  MET A SD  1 
ATOM   2427 C CE  . MET C 2 125 ? 66.784  11.584  -55.040 1.00 47.98 ? 275  MET A CE  1 
ATOM   2428 N N   . ASP C 2 126 ? 63.486  15.525  -58.211 1.00 33.47 ? 276  ASP A N   1 
ATOM   2429 C CA  . ASP C 2 126 ? 63.805  16.406  -59.332 1.00 33.97 ? 276  ASP A CA  1 
ATOM   2430 C C   . ASP C 2 126 ? 62.649  17.415  -59.505 1.00 32.55 ? 276  ASP A C   1 
ATOM   2431 O O   . ASP C 2 126 ? 61.617  17.285  -58.869 1.00 34.11 ? 276  ASP A O   1 
ATOM   2432 C CB  . ASP C 2 126 ? 64.034  15.596  -60.593 1.00 33.52 ? 276  ASP A CB  1 
ATOM   2433 C CG  . ASP C 2 126 ? 62.810  14.742  -60.994 1.00 37.35 ? 276  ASP A CG  1 
ATOM   2434 O OD1 . ASP C 2 126 ? 61.651  15.144  -60.760 1.00 38.27 ? 276  ASP A OD1 1 
ATOM   2435 O OD2 . ASP C 2 126 ? 63.011  13.631  -61.580 1.00 38.02 ? 276  ASP A OD2 1 
ATOM   2436 N N   . ILE C 2 127 ? 62.866  18.393  -60.357 1.00 31.10 ? 277  ILE A N   1 
ATOM   2437 C CA  . ILE C 2 127 ? 61.907  19.466  -60.700 1.00 32.80 ? 277  ILE A CA  1 
ATOM   2438 C C   . ILE C 2 127 ? 60.596  18.957  -61.285 1.00 33.33 ? 277  ILE A C   1 
ATOM   2439 O O   . ILE C 2 127 ? 59.546  19.639  -61.191 1.00 32.99 ? 277  ILE A O   1 
ATOM   2440 C CB  . ILE C 2 127 ? 62.614  20.470  -61.669 1.00 33.32 ? 277  ILE A CB  1 
ATOM   2441 C CG1 . ILE C 2 127 ? 61.989  21.893  -61.672 1.00 39.29 ? 277  ILE A CG1 1 
ATOM   2442 C CG2 . ILE C 2 127 ? 62.757  19.958  -63.110 1.00 29.70 ? 277  ILE A CG2 1 
ATOM   2443 C CD1 . ILE C 2 127 ? 61.338  22.206  -60.429 1.00 45.49 ? 277  ILE A CD1 1 
ATOM   2444 N N   . LEU C 2 128 ? 60.634  17.722  -61.811 1.00 32.30 ? 278  LEU A N   1 
ATOM   2445 C CA  . LEU C 2 128 ? 59.471  17.114  -62.529 1.00 32.59 ? 278  LEU A CA  1 
ATOM   2446 C C   . LEU C 2 128 ? 58.430  16.581  -61.606 1.00 32.71 ? 278  LEU A C   1 
ATOM   2447 O O   . LEU C 2 128 ? 57.229  16.405  -61.965 1.00 32.34 ? 278  LEU A O   1 
ATOM   2448 C CB  . LEU C 2 128 ? 60.011  15.969  -63.377 1.00 32.36 ? 278  LEU A CB  1 
ATOM   2449 C CG  . LEU C 2 128 ? 60.553  16.332  -64.768 1.00 34.40 ? 278  LEU A CG  1 
ATOM   2450 C CD1 . LEU C 2 128 ? 60.347  17.750  -65.293 1.00 32.16 ? 278  LEU A CD1 1 
ATOM   2451 C CD2 . LEU C 2 128 ? 61.836  15.714  -65.111 1.00 35.05 ? 278  LEU A CD2 1 
ATOM   2452 N N   . GLY C 2 129 ? 58.872  16.288  -60.395 1.00 32.48 ? 279  GLY A N   1 
ATOM   2453 C CA  . GLY C 2 129 ? 58.013  15.711  -59.386 1.00 32.88 ? 279  GLY A CA  1 
ATOM   2454 C C   . GLY C 2 129 ? 58.210  14.242  -59.150 1.00 32.56 ? 279  GLY A C   1 
ATOM   2455 O O   . GLY C 2 129 ? 57.356  13.611  -58.572 1.00 35.26 ? 279  GLY A O   1 
ATOM   2456 N N   . THR C 2 130 ? 59.325  13.681  -59.569 1.00 32.06 ? 280  THR A N   1 
ATOM   2457 C CA  . THR C 2 130 ? 59.622  12.323  -59.152 1.00 33.13 ? 280  THR A CA  1 
ATOM   2458 C C   . THR C 2 130 ? 59.772  12.287  -57.618 1.00 34.21 ? 280  THR A C   1 
ATOM   2459 O O   . THR C 2 130 ? 60.473  13.155  -57.069 1.00 32.36 ? 280  THR A O   1 
ATOM   2460 C CB  . THR C 2 130 ? 60.870  11.828  -59.841 1.00 33.67 ? 280  THR A CB  1 
ATOM   2461 O OG1 . THR C 2 130 ? 60.586  11.821  -61.256 1.00 34.54 ? 280  THR A OG1 1 
ATOM   2462 C CG2 . THR C 2 130 ? 61.187  10.425  -59.396 1.00 33.57 ? 280  THR A CG2 1 
ATOM   2463 N N   . CYS C 2 131 ? 59.122  11.315  -56.958 1.00 32.77 ? 281  CYS A N   1 
ATOM   2464 C CA  . CYS C 2 131 ? 59.156  11.228  -55.496 1.00 34.65 ? 281  CYS A CA  1 
ATOM   2465 C C   . CYS C 2 131 ? 60.455  10.532  -55.049 1.00 34.39 ? 281  CYS A C   1 
ATOM   2466 O O   . CYS C 2 131 ? 60.986  9.660   -55.758 1.00 32.95 ? 281  CYS A O   1 
ATOM   2467 C CB  . CYS C 2 131 ? 57.930  10.429  -54.973 1.00 34.96 ? 281  CYS A CB  1 
ATOM   2468 S SG  . CYS C 2 131 ? 56.337  11.339  -55.289 1.00 38.90 ? 281  CYS A SG  1 
ATOM   2469 N N   . ALA C 2 132 ? 60.891  10.817  -53.822 1.00 33.87 ? 282  ALA A N   1 
ATOM   2470 C CA  . ALA C 2 132 ? 62.135  10.231  -53.368 1.00 35.25 ? 282  ALA A CA  1 
ATOM   2471 C C   . ALA C 2 132 ? 62.073  8.681   -53.274 1.00 34.61 ? 282  ALA A C   1 
ATOM   2472 O O   . ALA C 2 132 ? 63.094  8.015   -53.431 1.00 36.21 ? 282  ALA A O   1 
ATOM   2473 C CB  . ALA C 2 132 ? 62.573  10.861  -52.009 1.00 37.01 ? 282  ALA A CB  1 
ATOM   2474 N N   . THR C 2 133 ? 60.893  8.099   -53.030 1.00 34.94 ? 283  THR A N   1 
ATOM   2475 C CA  . THR C 2 133 ? 60.720  6.625   -53.062 1.00 34.97 ? 283  THR A CA  1 
ATOM   2476 C C   . THR C 2 133 ? 59.797  6.199   -54.216 1.00 35.60 ? 283  THR A C   1 
ATOM   2477 O O   . THR C 2 133 ? 60.288  5.863   -55.301 1.00 36.02 ? 283  THR A O   1 
ATOM   2478 C CB  . THR C 2 133 ? 60.245  6.046   -51.693 1.00 35.11 ? 283  THR A CB  1 
ATOM   2479 O OG1 . THR C 2 133 ? 59.076  6.751   -51.260 1.00 37.14 ? 283  THR A OG1 1 
ATOM   2480 C CG2 . THR C 2 133 ? 61.320  6.302   -50.665 1.00 35.39 ? 283  THR A CG2 1 
ATOM   2481 N N   . GLU C 2 134 ? 58.486  6.265   -53.992 1.00 35.87 ? 284  GLU A N   1 
ATOM   2482 C CA  . GLU C 2 134 ? 57.455  5.899   -55.010 1.00 37.51 ? 284  GLU A CA  1 
ATOM   2483 C C   . GLU C 2 134 ? 56.211  6.677   -54.624 1.00 35.12 ? 284  GLU A C   1 
ATOM   2484 O O   . GLU C 2 134 ? 56.003  6.975   -53.420 1.00 35.57 ? 284  GLU A O   1 
ATOM   2485 C CB  . GLU C 2 134 ? 57.112  4.359   -54.932 1.00 37.84 ? 284  GLU A CB  1 
ATOM   2486 C CG  . GLU C 2 134 ? 57.796  3.472   -55.967 1.00 44.69 ? 284  GLU A CG  1 
ATOM   2487 C CD  . GLU C 2 134 ? 57.640  1.960   -55.642 1.00 43.66 ? 284  GLU A CD  1 
ATOM   2488 O OE1 . GLU C 2 134 ? 56.947  1.673   -54.644 1.00 48.34 ? 284  GLU A OE1 1 
ATOM   2489 O OE2 . GLU C 2 134 ? 58.266  1.069   -56.346 1.00 54.30 ? 284  GLU A OE2 1 
ATOM   2490 N N   . GLN C 2 135 ? 55.328  6.968   -55.588 1.00 32.62 ? 285  GLN A N   1 
ATOM   2491 C CA  . GLN C 2 135 ? 54.102  7.735   -55.240 1.00 33.17 ? 285  GLN A CA  1 
ATOM   2492 C C   . GLN C 2 135 ? 53.261  7.049   -54.146 1.00 32.91 ? 285  GLN A C   1 
ATOM   2493 O O   . GLN C 2 135 ? 52.692  7.745   -53.352 1.00 33.04 ? 285  GLN A O   1 
ATOM   2494 C CB  . GLN C 2 135 ? 53.205  7.957   -56.471 1.00 32.58 ? 285  GLN A CB  1 
ATOM   2495 C CG  . GLN C 2 135 ? 53.890  8.753   -57.595 1.00 31.27 ? 285  GLN A CG  1 
ATOM   2496 C CD  . GLN C 2 135 ? 52.959  8.946   -58.771 1.00 35.63 ? 285  GLN A CD  1 
ATOM   2497 O OE1 . GLN C 2 135 ? 51.975  8.191   -58.957 1.00 32.82 ? 285  GLN A OE1 1 
ATOM   2498 N NE2 . GLN C 2 135 ? 53.249  9.939   -59.573 1.00 36.89 ? 285  GLN A NE2 1 
ATOM   2499 N N   . SER C 2 136 ? 53.132  5.716   -54.136 1.00 32.23 ? 286  SER A N   1 
ATOM   2500 C CA  . SER C 2 136 ? 52.189  5.071   -53.182 1.00 33.82 ? 286  SER A CA  1 
ATOM   2501 C C   . SER C 2 136 ? 52.706  5.285   -51.741 1.00 34.78 ? 286  SER A C   1 
ATOM   2502 O O   . SER C 2 136 ? 51.908  5.385   -50.795 1.00 35.74 ? 286  SER A O   1 
ATOM   2503 C CB  . SER C 2 136 ? 52.045  3.534   -53.413 1.00 33.52 ? 286  SER A CB  1 
ATOM   2504 O OG  . SER C 2 136 ? 53.319  2.915   -53.427 1.00 33.54 ? 286  SER A OG  1 
ATOM   2505 N N   . ARG C 2 137 ? 54.018  5.256   -51.577 1.00 33.92 ? 287  ARG A N   1 
ATOM   2506 C CA  . ARG C 2 137 ? 54.625  5.531   -50.251 1.00 33.98 ? 287  ARG A CA  1 
ATOM   2507 C C   . ARG C 2 137 ? 54.422  6.997   -49.790 1.00 35.34 ? 287  ARG A C   1 
ATOM   2508 O O   . ARG C 2 137 ? 54.205  7.282   -48.576 1.00 33.50 ? 287  ARG A O   1 
ATOM   2509 C CB  . ARG C 2 137 ? 56.109  5.189   -50.285 1.00 34.44 ? 287  ARG A CB  1 
ATOM   2510 C CG  . ARG C 2 137 ? 56.395  3.701   -50.540 1.00 39.07 ? 287  ARG A CG  1 
ATOM   2511 C CD  . ARG C 2 137 ? 57.849  3.439   -50.151 1.00 46.09 ? 287  ARG A CD  1 
ATOM   2512 N NE  . ARG C 2 137 ? 58.324  2.071   -50.344 1.00 48.41 ? 287  ARG A NE  1 
ATOM   2513 C CZ  . ARG C 2 137 ? 58.055  1.046   -49.527 1.00 54.49 ? 287  ARG A CZ  1 
ATOM   2514 N NH1 . ARG C 2 137 ? 57.266  1.200   -48.452 1.00 54.48 ? 287  ARG A NH1 1 
ATOM   2515 N NH2 . ARG C 2 137 ? 58.560  -0.153  -49.792 1.00 50.05 ? 287  ARG A NH2 1 
ATOM   2516 N N   . CYS C 2 138 ? 54.498  7.936   -50.749 1.00 34.60 ? 288  CYS A N   1 
ATOM   2517 C CA  . CYS C 2 138 ? 54.173  9.332   -50.494 1.00 36.47 ? 288  CYS A CA  1 
ATOM   2518 C C   . CYS C 2 138 ? 52.717  9.531   -50.082 1.00 35.32 ? 288  CYS A C   1 
ATOM   2519 O O   . CYS C 2 138 ? 52.464  10.232  -49.110 1.00 34.71 ? 288  CYS A O   1 
ATOM   2520 C CB  . CYS C 2 138 ? 54.527  10.247  -51.694 1.00 35.53 ? 288  CYS A CB  1 
ATOM   2521 S SG  . CYS C 2 138 ? 53.876  11.934  -51.520 1.00 39.07 ? 288  CYS A SG  1 
ATOM   2522 N N   . LEU C 2 139 ? 51.774  8.874   -50.760 1.00 33.38 ? 289  LEU A N   1 
ATOM   2523 C CA  . LEU C 2 139 ? 50.364  9.058   -50.396 1.00 32.51 ? 289  LEU A CA  1 
ATOM   2524 C C   . LEU C 2 139 ? 50.080  8.547   -49.001 1.00 33.60 ? 289  LEU A C   1 
ATOM   2525 O O   . LEU C 2 139 ? 49.357  9.184   -48.225 1.00 33.27 ? 289  LEU A O   1 
ATOM   2526 C CB  . LEU C 2 139 ? 49.445  8.340   -51.402 1.00 33.31 ? 289  LEU A CB  1 
ATOM   2527 C CG  . LEU C 2 139 ? 49.382  9.101   -52.758 1.00 31.14 ? 289  LEU A CG  1 
ATOM   2528 C CD1 . LEU C 2 139 ? 48.301  8.393   -53.642 1.00 36.17 ? 289  LEU A CD1 1 
ATOM   2529 C CD2 . LEU C 2 139 ? 49.179  10.692  -52.801 1.00 33.71 ? 289  LEU A CD2 1 
ATOM   2530 N N   . ARG C 2 140 ? 50.696  7.415   -48.670 1.00 33.61 ? 290  ARG A N   1 
ATOM   2531 C CA  . ARG C 2 140 ? 50.462  6.789   -47.349 1.00 34.43 ? 290  ARG A CA  1 
ATOM   2532 C C   . ARG C 2 140 ? 51.030  7.680   -46.254 1.00 33.42 ? 290  ARG A C   1 
ATOM   2533 O O   . ARG C 2 140 ? 50.435  7.814   -45.180 1.00 32.94 ? 290  ARG A O   1 
ATOM   2534 C CB  . ARG C 2 140 ? 51.059  5.377   -47.348 1.00 34.27 ? 290  ARG A CB  1 
ATOM   2535 C CG  . ARG C 2 140 ? 51.206  4.732   -45.968 1.00 38.16 ? 290  ARG A CG  1 
ATOM   2536 C CD  . ARG C 2 140 ? 52.116  3.532   -46.011 1.00 43.48 ? 290  ARG A CD  1 
ATOM   2537 N NE  . ARG C 2 140 ? 51.609  2.430   -46.818 1.00 49.86 ? 290  ARG A NE  1 
ATOM   2538 C CZ  . ARG C 2 140 ? 52.136  2.022   -47.974 1.00 54.74 ? 290  ARG A CZ  1 
ATOM   2539 N NH1 . ARG C 2 140 ? 53.223  2.595   -48.483 1.00 53.95 ? 290  ARG A NH1 1 
ATOM   2540 N NH2 . ARG C 2 140 ? 51.590  0.990   -48.614 1.00 59.21 ? 290  ARG A NH2 1 
ATOM   2541 N N   . ALA C 2 141 ? 52.167  8.314   -46.516 1.00 32.70 ? 291  ALA A N   1 
ATOM   2542 C CA  . ALA C 2 141 ? 52.799  9.235   -45.538 1.00 33.18 ? 291  ALA A CA  1 
ATOM   2543 C C   . ALA C 2 141 ? 52.038  10.563  -45.393 1.00 34.50 ? 291  ALA A C   1 
ATOM   2544 O O   . ALA C 2 141 ? 51.894  11.116  -44.296 1.00 33.67 ? 291  ALA A O   1 
ATOM   2545 C CB  . ALA C 2 141 ? 54.232  9.522   -45.954 1.00 34.05 ? 291  ALA A CB  1 
ATOM   2546 N N   . TYR C 2 142 ? 51.541  11.071  -46.509 1.00 33.12 ? 292  TYR A N   1 
ATOM   2547 C CA  . TYR C 2 142 ? 50.629  12.235  -46.507 1.00 34.77 ? 292  TYR A CA  1 
ATOM   2548 C C   . TYR C 2 142 ? 49.368  11.954  -45.689 1.00 34.56 ? 292  TYR A C   1 
ATOM   2549 O O   . TYR C 2 142 ? 49.056  12.710  -44.755 1.00 35.30 ? 292  TYR A O   1 
ATOM   2550 C CB  . TYR C 2 142 ? 50.253  12.610  -47.943 1.00 34.57 ? 292  TYR A CB  1 
ATOM   2551 C CG  . TYR C 2 142 ? 49.255  13.772  -48.011 1.00 35.10 ? 292  TYR A CG  1 
ATOM   2552 C CD1 . TYR C 2 142 ? 49.660  15.092  -47.823 1.00 36.47 ? 292  TYR A CD1 1 
ATOM   2553 C CD2 . TYR C 2 142 ? 47.906  13.531  -48.256 1.00 37.03 ? 292  TYR A CD2 1 
ATOM   2554 C CE1 . TYR C 2 142 ? 48.731  16.155  -47.896 1.00 36.03 ? 292  TYR A CE1 1 
ATOM   2555 C CE2 . TYR C 2 142 ? 46.962  14.601  -48.323 1.00 38.32 ? 292  TYR A CE2 1 
ATOM   2556 C CZ  . TYR C 2 142 ? 47.406  15.908  -48.109 1.00 34.10 ? 292  TYR A CZ  1 
ATOM   2557 O OH  . TYR C 2 142 ? 46.399  16.882  -48.122 1.00 36.64 ? 292  TYR A OH  1 
ATOM   2558 N N   . LEU C 2 143 ? 48.669  10.846  -45.976 1.00 33.62 ? 293  LEU A N   1 
ATOM   2559 C CA  . LEU C 2 143 ? 47.464  10.512  -45.215 1.00 32.58 ? 293  LEU A CA  1 
ATOM   2560 C C   . LEU C 2 143 ? 47.737  10.204  -43.758 1.00 33.38 ? 293  LEU A C   1 
ATOM   2561 O O   . LEU C 2 143 ? 46.914  10.501  -42.892 1.00 33.01 ? 293  LEU A O   1 
ATOM   2562 C CB  . LEU C 2 143 ? 46.605  9.402   -45.884 1.00 32.67 ? 293  LEU A CB  1 
ATOM   2563 C CG  . LEU C 2 143 ? 46.191  9.660   -47.368 1.00 39.13 ? 293  LEU A CG  1 
ATOM   2564 C CD1 . LEU C 2 143 ? 45.346  8.488   -47.748 1.00 42.21 ? 293  LEU A CD1 1 
ATOM   2565 C CD2 . LEU C 2 143 ? 45.390  10.881  -47.471 1.00 43.39 ? 293  LEU A CD2 1 
ATOM   2566 N N   . GLY C 2 144 ? 48.918  9.692   -43.482 1.00 33.88 ? 294  GLY A N   1 
ATOM   2567 C CA  . GLY C 2 144 ? 49.437  9.493   -42.107 1.00 34.58 ? 294  GLY A CA  1 
ATOM   2568 C C   . GLY C 2 144 ? 49.601  10.751  -41.249 1.00 33.42 ? 294  GLY A C   1 
ATOM   2569 O O   . GLY C 2 144 ? 49.818  10.654  -40.034 1.00 33.70 ? 294  GLY A O   1 
ATOM   2570 N N   . LEU C 2 145 ? 49.427  11.938  -41.836 1.00 32.91 ? 295  LEU A N   1 
ATOM   2571 C CA  . LEU C 2 145 ? 49.480  13.187  -41.029 1.00 33.82 ? 295  LEU A CA  1 
ATOM   2572 C C   . LEU C 2 145 ? 48.072  13.628  -40.567 1.00 33.41 ? 295  LEU A C   1 
ATOM   2573 O O   . LEU C 2 145 ? 47.957  14.442  -39.654 1.00 31.92 ? 295  LEU A O   1 
ATOM   2574 C CB  . LEU C 2 145 ? 50.222  14.329  -41.800 1.00 33.48 ? 295  LEU A CB  1 
ATOM   2575 C CG  . LEU C 2 145 ? 51.755  14.182  -41.789 1.00 35.26 ? 295  LEU A CG  1 
ATOM   2576 C CD1 . LEU C 2 145 ? 52.321  15.098  -42.856 1.00 33.91 ? 295  LEU A CD1 1 
ATOM   2577 C CD2 . LEU C 2 145 ? 52.315  14.532  -40.446 1.00 38.80 ? 295  LEU A CD2 1 
ATOM   2578 N N   . ILE C 2 146 ? 47.025  12.987  -41.101 1.00 33.27 ? 296  ILE A N   1 
ATOM   2579 C CA  . ILE C 2 146 ? 45.654  13.384  -40.805 1.00 33.63 ? 296  ILE A CA  1 
ATOM   2580 C C   . ILE C 2 146 ? 45.241  12.896  -39.429 1.00 33.87 ? 296  ILE A C   1 
ATOM   2581 O O   . ILE C 2 146 ? 45.377  11.705  -39.117 1.00 34.80 ? 296  ILE A O   1 
ATOM   2582 C CB  . ILE C 2 146 ? 44.702  12.940  -41.918 1.00 34.75 ? 296  ILE A CB  1 
ATOM   2583 C CG1 . ILE C 2 146 ? 45.075  13.648  -43.165 1.00 37.21 ? 296  ILE A CG1 1 
ATOM   2584 C CG2 . ILE C 2 146 ? 43.275  13.440  -41.671 1.00 34.73 ? 296  ILE A CG2 1 
ATOM   2585 C CD1 . ILE C 2 146 ? 44.408  13.160  -44.338 1.00 55.07 ? 296  ILE A CD1 1 
ATOM   2586 N N   . GLY C 2 147 ? 44.858  13.843  -38.558 1.00 33.15 ? 297  GLY A N   1 
ATOM   2587 C CA  . GLY C 2 147 ? 44.675  13.536  -37.129 1.00 33.48 ? 297  GLY A CA  1 
ATOM   2588 C C   . GLY C 2 147 ? 45.858  13.974  -36.238 1.00 35.26 ? 297  GLY A C   1 
ATOM   2589 O O   . GLY C 2 147 ? 45.781  13.857  -34.993 1.00 33.23 ? 297  GLY A O   1 
ATOM   2590 N N   . THR C 2 148 ? 46.955  14.430  -36.834 1.00 35.11 ? 298  THR A N   1 
ATOM   2591 C CA  . THR C 2 148 ? 48.063  14.991  -36.039 1.00 36.93 ? 298  THR A CA  1 
ATOM   2592 C C   . THR C 2 148 ? 47.898  16.511  -35.931 1.00 36.31 ? 298  THR A C   1 
ATOM   2593 O O   . THR C 2 148 ? 46.981  17.090  -36.520 1.00 35.77 ? 298  THR A O   1 
ATOM   2594 C CB  . THR C 2 148 ? 49.435  14.718  -36.674 1.00 38.10 ? 298  THR A CB  1 
ATOM   2595 O OG1 . THR C 2 148 ? 49.553  15.465  -37.914 1.00 36.11 ? 298  THR A OG1 1 
ATOM   2596 C CG2 . THR C 2 148 ? 49.697  13.214  -36.896 1.00 38.60 ? 298  THR A CG2 1 
ATOM   2597 N N   . ALA C 2 149 ? 48.795  17.174  -35.208 1.00 36.63 ? 299  ALA A N   1 
ATOM   2598 C CA  . ALA C 2 149 ? 48.824  18.630  -35.232 1.00 36.89 ? 299  ALA A CA  1 
ATOM   2599 C C   . ALA C 2 149 ? 49.083  19.157  -36.649 1.00 37.17 ? 299  ALA A C   1 
ATOM   2600 O O   . ALA C 2 149 ? 48.669  20.279  -36.976 1.00 39.66 ? 299  ALA A O   1 
ATOM   2601 C CB  . ALA C 2 149 ? 49.889  19.198  -34.243 1.00 38.01 ? 299  ALA A CB  1 
ATOM   2602 N N   . MET C 2 150 ? 49.748  18.373  -37.502 1.00 35.23 ? 300  MET A N   1 
ATOM   2603 C CA  . MET C 2 150 ? 50.040  18.827  -38.848 1.00 34.52 ? 300  MET A CA  1 
ATOM   2604 C C   . MET C 2 150 ? 49.055  18.284  -39.851 1.00 33.29 ? 300  MET A C   1 
ATOM   2605 O O   . MET C 2 150 ? 49.498  17.806  -40.895 1.00 34.90 ? 300  MET A O   1 
ATOM   2606 C CB  . MET C 2 150 ? 51.425  18.349  -39.305 1.00 34.30 ? 300  MET A CB  1 
ATOM   2607 C CG  . MET C 2 150 ? 52.586  18.768  -38.405 1.00 40.31 ? 300  MET A CG  1 
ATOM   2608 S SD  . MET C 2 150 ? 53.015  20.466  -38.555 1.00 44.00 ? 300  MET A SD  1 
ATOM   2609 C CE  . MET C 2 150 ? 54.210  20.541  -39.846 1.00 43.09 ? 300  MET A CE  1 
ATOM   2610 N N   . THR C 2 151 ? 47.744  18.416  -39.611 1.00 33.02 ? 301  THR A N   1 
ATOM   2611 C CA  . THR C 2 151 ? 46.750  17.764  -40.513 1.00 32.99 ? 301  THR A CA  1 
ATOM   2612 C C   . THR C 2 151 ? 46.624  18.584  -41.771 1.00 33.17 ? 301  THR A C   1 
ATOM   2613 O O   . THR C 2 151 ? 46.299  19.794  -41.679 1.00 33.56 ? 301  THR A O   1 
ATOM   2614 C CB  . THR C 2 151 ? 45.339  17.602  -39.802 1.00 32.89 ? 301  THR A CB  1 
ATOM   2615 O OG1 . THR C 2 151 ? 45.470  16.607  -38.795 1.00 33.46 ? 301  THR A OG1 1 
ATOM   2616 C CG2 . THR C 2 151 ? 44.221  17.197  -40.787 1.00 31.04 ? 301  THR A CG2 1 
ATOM   2617 N N   . PRO C 2 152 ? 46.908  17.979  -42.942 1.00 33.69 ? 302  PRO A N   1 
ATOM   2618 C CA  . PRO C 2 152 ? 46.707  18.661  -44.214 1.00 32.86 ? 302  PRO A CA  1 
ATOM   2619 C C   . PRO C 2 152 ? 45.274  18.514  -44.763 1.00 33.97 ? 302  PRO A C   1 
ATOM   2620 O O   . PRO C 2 152 ? 44.523  17.536  -44.389 1.00 33.31 ? 302  PRO A O   1 
ATOM   2621 C CB  . PRO C 2 152 ? 47.687  17.913  -45.136 1.00 34.19 ? 302  PRO A CB  1 
ATOM   2622 C CG  . PRO C 2 152 ? 47.694  16.532  -44.667 1.00 34.03 ? 302  PRO A CG  1 
ATOM   2623 C CD  . PRO C 2 152 ? 47.450  16.611  -43.158 1.00 33.70 ? 302  PRO A CD  1 
ATOM   2624 N N   . ASN C 2 153 ? 44.851  19.417  -45.647 1.00 33.00 ? 303  ASN A N   1 
ATOM   2625 C CA  . ASN C 2 153 ? 43.508  19.195  -46.232 1.00 32.95 ? 303  ASN A CA  1 
ATOM   2626 C C   . ASN C 2 153 ? 43.345  19.997  -47.518 1.00 32.72 ? 303  ASN A C   1 
ATOM   2627 O O   . ASN C 2 153 ? 44.080  20.936  -47.742 1.00 31.72 ? 303  ASN A O   1 
ATOM   2628 C CB  . ASN C 2 153 ? 42.414  19.665  -45.245 1.00 32.87 ? 303  ASN A CB  1 
ATOM   2629 C CG  . ASN C 2 153 ? 40.989  19.198  -45.661 1.00 34.79 ? 303  ASN A CG  1 
ATOM   2630 O OD1 . ASN C 2 153 ? 40.833  18.101  -46.207 1.00 37.42 ? 303  ASN A OD1 1 
ATOM   2631 N ND2 . ASN C 2 153 ? 39.955  20.065  -45.414 1.00 33.84 ? 303  ASN A ND2 1 
ATOM   2632 N N   . PHE C 2 154 ? 42.356  19.648  -48.335 1.00 30.97 ? 304  PHE A N   1 
ATOM   2633 C CA  . PHE C 2 154 ? 42.040  20.440  -49.536 1.00 31.22 ? 304  PHE A CA  1 
ATOM   2634 C C   . PHE C 2 154 ? 41.622  21.854  -49.114 1.00 31.78 ? 304  PHE A C   1 
ATOM   2635 O O   . PHE C 2 154 ? 40.910  22.039  -48.149 1.00 31.99 ? 304  PHE A O   1 
ATOM   2636 C CB  . PHE C 2 154 ? 40.904  19.788  -50.343 1.00 31.92 ? 304  PHE A CB  1 
ATOM   2637 C CG  . PHE C 2 154 ? 41.319  18.442  -50.886 1.00 32.04 ? 304  PHE A CG  1 
ATOM   2638 C CD1 . PHE C 2 154 ? 41.037  17.279  -50.195 1.00 35.54 ? 304  PHE A CD1 1 
ATOM   2639 C CD2 . PHE C 2 154 ? 42.107  18.384  -52.038 1.00 30.46 ? 304  PHE A CD2 1 
ATOM   2640 C CE1 . PHE C 2 154 ? 41.474  16.050  -50.672 1.00 33.03 ? 304  PHE A CE1 1 
ATOM   2641 C CE2 . PHE C 2 154 ? 42.560  17.176  -52.535 1.00 36.94 ? 304  PHE A CE2 1 
ATOM   2642 C CZ  . PHE C 2 154 ? 42.204  15.978  -51.872 1.00 36.38 ? 304  PHE A CZ  1 
ATOM   2643 N N   . VAL C 2 155 ? 41.988  22.844  -49.906 1.00 32.80 ? 305  VAL A N   1 
ATOM   2644 C CA  . VAL C 2 155 ? 41.742  24.219  -49.503 1.00 32.66 ? 305  VAL A CA  1 
ATOM   2645 C C   . VAL C 2 155 ? 40.524  24.767  -50.238 1.00 33.01 ? 305  VAL A C   1 
ATOM   2646 O O   . VAL C 2 155 ? 39.941  25.792  -49.811 1.00 33.00 ? 305  VAL A O   1 
ATOM   2647 C CB  . VAL C 2 155 ? 42.984  25.106  -49.797 1.00 33.43 ? 305  VAL A CB  1 
ATOM   2648 C CG1 . VAL C 2 155 ? 44.231  24.534  -49.100 1.00 38.26 ? 305  VAL A CG1 1 
ATOM   2649 C CG2 . VAL C 2 155 ? 43.219  25.213  -51.249 1.00 33.64 ? 305  VAL A CG2 1 
ATOM   2650 N N   . SER C 2 156 ? 40.144  24.119  -51.329 1.00 30.40 ? 306  SER A N   1 
ATOM   2651 C CA  . SER C 2 156 ? 39.125  24.664  -52.214 1.00 33.20 ? 306  SER A CA  1 
ATOM   2652 C C   . SER C 2 156 ? 38.052  23.674  -52.603 1.00 33.06 ? 306  SER A C   1 
ATOM   2653 O O   . SER C 2 156 ? 38.316  22.462  -52.617 1.00 33.55 ? 306  SER A O   1 
ATOM   2654 C CB  . SER C 2 156 ? 39.797  25.201  -53.525 1.00 32.85 ? 306  SER A CB  1 
ATOM   2655 O OG  . SER C 2 156 ? 38.839  25.639  -54.466 1.00 32.59 ? 306  SER A OG  1 
ATOM   2656 N N   . ASN C 2 157 ? 36.876  24.178  -52.975 1.00 33.46 ? 307  ASN A N   1 
ATOM   2657 C CA  . ASN C 2 157 ? 35.869  23.300  -53.615 1.00 35.76 ? 307  ASN A CA  1 
ATOM   2658 C C   . ASN C 2 157 ? 35.931  23.312  -55.146 1.00 35.90 ? 307  ASN A C   1 
ATOM   2659 O O   . ASN C 2 157 ? 35.123  22.657  -55.802 1.00 35.60 ? 307  ASN A O   1 
ATOM   2660 C CB  . ASN C 2 157 ? 34.440  23.630  -53.155 1.00 37.45 ? 307  ASN A CB  1 
ATOM   2661 C CG  . ASN C 2 157 ? 34.113  25.064  -53.252 1.00 41.62 ? 307  ASN A CG  1 
ATOM   2662 O OD1 . ASN C 2 157 ? 34.721  25.822  -54.059 1.00 44.35 ? 307  ASN A OD1 1 
ATOM   2663 N ND2 . ASN C 2 157 ? 33.158  25.500  -52.408 1.00 40.88 ? 307  ASN A ND2 1 
ATOM   2664 N N   . VAL C 2 158 ? 36.876  24.083  -55.710 1.00 35.82 ? 308  VAL A N   1 
ATOM   2665 C CA  . VAL C 2 158 ? 37.013  24.185  -57.177 1.00 37.09 ? 308  VAL A CA  1 
ATOM   2666 C C   . VAL C 2 158 ? 38.398  23.780  -57.741 1.00 36.14 ? 308  VAL A C   1 
ATOM   2667 O O   . VAL C 2 158 ? 38.627  23.963  -58.937 1.00 36.11 ? 308  VAL A O   1 
ATOM   2668 C CB  . VAL C 2 158 ? 36.728  25.603  -57.723 1.00 38.04 ? 308  VAL A CB  1 
ATOM   2669 C CG1 . VAL C 2 158 ? 35.342  26.021  -57.445 1.00 41.79 ? 308  VAL A CG1 1 
ATOM   2670 C CG2 . VAL C 2 158 ? 37.741  26.622  -57.172 1.00 38.88 ? 308  VAL A CG2 1 
ATOM   2671 N N   . ASN C 2 159 ? 39.321  23.306  -56.898 1.00 32.54 ? 309  ASN A N   1 
ATOM   2672 C CA  . ASN C 2 159 ? 40.578  22.770  -57.384 1.00 32.70 ? 309  ASN A CA  1 
ATOM   2673 C C   . ASN C 2 159 ? 41.101  21.770  -56.383 1.00 32.56 ? 309  ASN A C   1 
ATOM   2674 O O   . ASN C 2 159 ? 40.427  21.549  -55.362 1.00 33.66 ? 309  ASN A O   1 
ATOM   2675 C CB  . ASN C 2 159 ? 41.608  23.885  -57.675 1.00 30.51 ? 309  ASN A CB  1 
ATOM   2676 C CG  . ASN C 2 159 ? 42.086  24.593  -56.426 1.00 32.92 ? 309  ASN A CG  1 
ATOM   2677 O OD1 . ASN C 2 159 ? 42.352  23.968  -55.415 1.00 31.33 ? 309  ASN A OD1 1 
ATOM   2678 N ND2 . ASN C 2 159 ? 42.163  25.937  -56.498 1.00 27.22 ? 309  ASN A ND2 1 
ATOM   2679 N N   . THR C 2 160 ? 42.272  21.156  -56.648 1.00 32.91 ? 310  THR A N   1 
ATOM   2680 C CA  . THR C 2 160 ? 42.731  20.024  -55.807 1.00 34.07 ? 310  THR A CA  1 
ATOM   2681 C C   . THR C 2 160 ? 43.892  20.388  -54.893 1.00 34.56 ? 310  THR A C   1 
ATOM   2682 O O   . THR C 2 160 ? 44.613  19.479  -54.449 1.00 32.80 ? 310  THR A O   1 
ATOM   2683 C CB  . THR C 2 160 ? 43.220  18.808  -56.679 1.00 36.08 ? 310  THR A CB  1 
ATOM   2684 O OG1 . THR C 2 160 ? 44.077  19.275  -57.714 1.00 35.08 ? 310  THR A OG1 1 
ATOM   2685 C CG2 . THR C 2 160 ? 42.055  18.213  -57.403 1.00 37.44 ? 310  THR A CG2 1 
ATOM   2686 N N   . SER C 2 161 ? 44.156  21.694  -54.729 1.00 33.62 ? 311  SER A N   1 
ATOM   2687 C CA  . SER C 2 161 ? 45.255  22.183  -53.886 1.00 33.62 ? 311  SER A CA  1 
ATOM   2688 C C   . SER C 2 161 ? 45.044  21.767  -52.436 1.00 33.05 ? 311  SER A C   1 
ATOM   2689 O O   . SER C 2 161 ? 43.915  21.743  -51.982 1.00 30.87 ? 311  SER A O   1 
ATOM   2690 C CB  . SER C 2 161 ? 45.479  23.726  -53.937 1.00 33.94 ? 311  SER A CB  1 
ATOM   2691 O OG  . SER C 2 161 ? 45.731  24.067  -55.274 1.00 39.81 ? 311  SER A OG  1 
ATOM   2692 N N   . VAL C 2 162 ? 46.143  21.449  -51.740 1.00 31.88 ? 312  VAL A N   1 
ATOM   2693 C CA  . VAL C 2 162 ? 46.082  21.042  -50.318 1.00 32.77 ? 312  VAL A CA  1 
ATOM   2694 C C   . VAL C 2 162 ? 47.054  21.948  -49.524 1.00 33.59 ? 312  VAL A C   1 
ATOM   2695 O O   . VAL C 2 162 ? 47.943  22.578  -50.135 1.00 33.11 ? 312  VAL A O   1 
ATOM   2696 C CB  . VAL C 2 162 ? 46.452  19.541  -50.118 1.00 33.16 ? 312  VAL A CB  1 
ATOM   2697 C CG1 . VAL C 2 162 ? 45.408  18.693  -50.774 1.00 31.10 ? 312  VAL A CG1 1 
ATOM   2698 C CG2 . VAL C 2 162 ? 47.900  19.228  -50.615 1.00 34.23 ? 312  VAL A CG2 1 
ATOM   2699 N N   . ALA C 2 163 ? 46.858  22.027  -48.199 1.00 32.76 ? 313  ALA A N   1 
ATOM   2700 C CA  . ALA C 2 163 ? 47.714  22.885  -47.356 1.00 33.34 ? 313  ALA A CA  1 
ATOM   2701 C C   . ALA C 2 163 ? 47.542  22.484  -45.904 1.00 33.98 ? 313  ALA A C   1 
ATOM   2702 O O   . ALA C 2 163 ? 46.560  21.874  -45.516 1.00 33.28 ? 313  ALA A O   1 
ATOM   2703 C CB  . ALA C 2 163 ? 47.336  24.353  -47.495 1.00 34.06 ? 313  ALA A CB  1 
ATOM   2704 N N   . LEU C 2 164 ? 48.526  22.852  -45.098 1.00 35.26 ? 314  LEU A N   1 
ATOM   2705 C CA  . LEU C 2 164 ? 48.379  22.786  -43.653 1.00 37.30 ? 314  LEU A CA  1 
ATOM   2706 C C   . LEU C 2 164 ? 47.504  23.965  -43.273 1.00 38.13 ? 314  LEU A C   1 
ATOM   2707 O O   . LEU C 2 164 ? 47.399  24.909  -44.045 1.00 38.29 ? 314  LEU A O   1 
ATOM   2708 C CB  . LEU C 2 164 ? 49.751  22.990  -43.009 1.00 37.09 ? 314  LEU A CB  1 
ATOM   2709 C CG  . LEU C 2 164 ? 50.838  21.948  -43.118 1.00 37.81 ? 314  LEU A CG  1 
ATOM   2710 C CD1 . LEU C 2 164 ? 52.065  22.447  -42.309 1.00 40.04 ? 314  LEU A CD1 1 
ATOM   2711 C CD2 . LEU C 2 164 ? 50.255  20.736  -42.462 1.00 41.64 ? 314  LEU A CD2 1 
ATOM   2712 N N   . SER C 2 165 ? 46.919  23.938  -42.070 1.00 39.15 ? 315  SER A N   1 
ATOM   2713 C CA  . SER C 2 165 ? 46.104  25.021  -41.586 1.00 41.00 ? 315  SER A CA  1 
ATOM   2714 C C   . SER C 2 165 ? 46.951  25.951  -40.711 1.00 40.97 ? 315  SER A C   1 
ATOM   2715 O O   . SER C 2 165 ? 46.845  25.962  -39.493 1.00 40.04 ? 315  SER A O   1 
ATOM   2716 C CB  . SER C 2 165 ? 44.947  24.483  -40.744 1.00 43.18 ? 315  SER A CB  1 
ATOM   2717 O OG  . SER C 2 165 ? 45.457  24.101  -39.455 1.00 49.79 ? 315  SER A OG  1 
ATOM   2718 N N   . CYS C 2 166 ? 47.759  26.742  -41.382 1.00 39.08 ? 316  CYS A N   1 
ATOM   2719 C CA  . CYS C 2 166 ? 48.726  27.611  -40.761 1.00 39.49 ? 316  CYS A CA  1 
ATOM   2720 C C   . CYS C 2 166 ? 48.989  28.752  -41.695 1.00 39.03 ? 316  CYS A C   1 
ATOM   2721 O O   . CYS C 2 166 ? 48.551  28.745  -42.847 1.00 39.43 ? 316  CYS A O   1 
ATOM   2722 C CB  . CYS C 2 166 ? 50.011  26.856  -40.402 1.00 38.99 ? 316  CYS A CB  1 
ATOM   2723 S SG  . CYS C 2 166 ? 51.011  26.187  -41.741 1.00 43.78 ? 316  CYS A SG  1 
ATOM   2724 N N   . THR C 2 167 ? 49.691  29.749  -41.209 1.00 39.66 ? 317  THR A N   1 
ATOM   2725 C CA  . THR C 2 167 ? 49.976  30.901  -42.031 1.00 41.03 ? 317  THR A CA  1 
ATOM   2726 C C   . THR C 2 167 ? 51.452  31.191  -41.841 1.00 40.76 ? 317  THR A C   1 
ATOM   2727 O O   . THR C 2 167 ? 52.039  30.758  -40.854 1.00 38.84 ? 317  THR A O   1 
ATOM   2728 C CB  . THR C 2 167 ? 49.106  32.131  -41.625 1.00 40.82 ? 317  THR A CB  1 
ATOM   2729 O OG1 . THR C 2 167 ? 49.485  33.261  -42.425 1.00 43.49 ? 317  THR A OG1 1 
ATOM   2730 C CG2 . THR C 2 167 ? 49.335  32.534  -40.155 1.00 42.75 ? 317  THR A CG2 1 
ATOM   2731 N N   . CYS C 2 168 ? 52.056  31.909  -42.779 1.00 41.93 ? 318  CYS A N   1 
ATOM   2732 C CA  . CYS C 2 168 ? 53.452  32.364  -42.582 1.00 43.17 ? 318  CYS A CA  1 
ATOM   2733 C C   . CYS C 2 168 ? 53.525  33.834  -42.249 1.00 44.32 ? 318  CYS A C   1 
ATOM   2734 O O   . CYS C 2 168 ? 54.616  34.372  -41.984 1.00 43.06 ? 318  CYS A O   1 
ATOM   2735 C CB  . CYS C 2 168 ? 54.291  32.019  -43.813 1.00 42.89 ? 318  CYS A CB  1 
ATOM   2736 S SG  . CYS C 2 168 ? 54.751  30.276  -43.759 1.00 46.49 ? 318  CYS A SG  1 
ATOM   2737 N N   . ARG C 2 169 ? 52.353  34.469  -42.246 1.00 46.88 ? 319  ARG A N   1 
ATOM   2738 C CA  . ARG C 2 169 ? 52.208  35.850  -41.799 1.00 50.72 ? 319  ARG A CA  1 
ATOM   2739 C C   . ARG C 2 169 ? 52.668  35.881  -40.344 1.00 51.65 ? 319  ARG A C   1 
ATOM   2740 O O   . ARG C 2 169 ? 52.341  34.967  -39.576 1.00 53.20 ? 319  ARG A O   1 
ATOM   2741 C CB  . ARG C 2 169 ? 50.768  36.389  -41.988 1.00 49.99 ? 319  ARG A CB  1 
ATOM   2742 C CG  . ARG C 2 169 ? 50.743  37.942  -42.130 1.00 55.07 ? 319  ARG A CG  1 
ATOM   2743 C CD  . ARG C 2 169 ? 49.388  38.574  -41.769 1.00 59.11 ? 319  ARG A CD  1 
ATOM   2744 N NE  . ARG C 2 169 ? 49.544  39.939  -41.251 1.00 61.05 ? 319  ARG A NE  1 
ATOM   2745 C CZ  . ARG C 2 169 ? 48.625  40.582  -40.529 1.00 62.78 ? 319  ARG A CZ  1 
ATOM   2746 N NH1 . ARG C 2 169 ? 47.472  39.978  -40.235 1.00 63.95 ? 319  ARG A NH1 1 
ATOM   2747 N NH2 . ARG C 2 169 ? 48.855  41.827  -40.097 1.00 64.03 ? 319  ARG A NH2 1 
ATOM   2748 N N   . GLY C 2 170 ? 53.479  36.883  -40.012 1.00 53.76 ? 320  GLY A N   1 
ATOM   2749 C CA  . GLY C 2 170 ? 54.080  37.048  -38.665 1.00 54.94 ? 320  GLY A CA  1 
ATOM   2750 C C   . GLY C 2 170 ? 55.211  36.060  -38.351 1.00 55.80 ? 320  GLY A C   1 
ATOM   2751 O O   . GLY C 2 170 ? 55.483  35.795  -37.081 1.00 55.23 ? 320  GLY A O   1 
ATOM   2752 N N   . SER C 2 171 ? 55.839  35.497  -39.523 1.00 55.08 ? 321  SER A N   1 
ATOM   2753 C CA  . SER C 2 171 ? 57.053  34.665  -39.423 1.00 54.00 ? 321  SER A CA  1 
ATOM   2754 C C   . SER C 2 171 ? 58.298  35.484  -39.162 1.00 52.86 ? 321  SER A C   1 
ATOM   2755 O O   . SER C 2 171 ? 59.339  34.913  -38.852 1.00 53.68 ? 321  SER A O   1 
ATOM   2756 C CB  . SER C 2 171 ? 57.296  33.867  -40.695 1.00 52.82 ? 321  SER A CB  1 
ATOM   2757 O OG  . SER C 2 171 ? 56.168  33.109  -41.005 1.00 51.60 ? 321  SER A OG  1 
ATOM   2758 N N   . GLY C 2 172 ? 58.207  36.813  -39.324 1.00 53.60 ? 322  GLY A N   1 
ATOM   2759 C CA  . GLY C 2 172 ? 59.310  37.737  -39.062 1.00 52.45 ? 322  GLY A CA  1 
ATOM   2760 C C   . GLY C 2 172 ? 60.513  37.398  -39.935 1.00 52.63 ? 322  GLY A C   1 
ATOM   2761 O O   . GLY C 2 172 ? 60.221  37.307  -41.224 1.00 53.27 ? 322  GLY A O   1 
ATOM   2762 N N   . ASN C 2 173 ? 61.938  37.451  -39.167 1.00 50.91 ? 323  ASN A N   1 
ATOM   2763 C CA  . ASN C 2 173 ? 63.175  37.067  -39.886 1.00 48.42 ? 323  ASN A CA  1 
ATOM   2764 C C   . ASN C 2 173 ? 63.268  35.598  -40.356 1.00 44.88 ? 323  ASN A C   1 
ATOM   2765 O O   . ASN C 2 173 ? 64.338  35.193  -40.894 1.00 44.30 ? 323  ASN A O   1 
ATOM   2766 C CB  . ASN C 2 173 ? 64.429  37.439  -39.031 1.00 48.55 ? 323  ASN A CB  1 
ATOM   2767 C CG  . ASN C 2 173 ? 64.815  38.958  -39.130 1.00 51.85 ? 323  ASN A CG  1 
ATOM   2768 O OD1 . ASN C 2 173 ? 65.938  39.346  -38.753 1.00 58.15 ? 323  ASN A OD1 1 
ATOM   2769 N ND2 . ASN C 2 173 ? 63.885  39.684  -39.663 1.00 57.49 ? 323  ASN A ND2 1 
ATOM   2770 N N   . LEU C 2 174 ? 62.193  34.854  -40.148 1.00 42.31 ? 324  LEU A N   1 
ATOM   2771 C CA  . LEU C 2 174 ? 62.158  33.452  -40.460 1.00 39.67 ? 324  LEU A CA  1 
ATOM   2772 C C   . LEU C 2 174 ? 61.131  33.163  -41.543 1.00 37.94 ? 324  LEU A C   1 
ATOM   2773 O O   . LEU C 2 174 ? 60.736  32.007  -41.748 1.00 35.75 ? 324  LEU A O   1 
ATOM   2774 C CB  . LEU C 2 174 ? 61.727  32.655  -39.245 1.00 40.68 ? 324  LEU A CB  1 
ATOM   2775 C CG  . LEU C 2 174 ? 62.846  32.336  -38.095 1.00 39.67 ? 324  LEU A CG  1 
ATOM   2776 C CD1 . LEU C 2 174 ? 62.376  31.230  -37.161 1.00 45.48 ? 324  LEU A CD1 1 
ATOM   2777 C CD2 . LEU C 2 174 ? 64.131  31.840  -38.737 1.00 45.83 ? 324  LEU A CD2 1 
ATOM   2778 N N   . GLN C 2 175 ? 60.718  34.221  -42.239 1.00 35.60 ? 325  GLN A N   1 
ATOM   2779 C CA  . GLN C 2 175 ? 59.781  34.084  -43.346 1.00 35.61 ? 325  GLN A CA  1 
ATOM   2780 C C   . GLN C 2 175 ? 60.131  32.934  -44.295 1.00 33.45 ? 325  GLN A C   1 
ATOM   2781 O O   . GLN C 2 175 ? 59.269  32.094  -44.634 1.00 32.18 ? 325  GLN A O   1 
ATOM   2782 C CB  . GLN C 2 175 ? 59.704  35.417  -44.101 1.00 36.42 ? 325  GLN A CB  1 
ATOM   2783 C CG  . GLN C 2 175 ? 58.648  35.345  -45.237 1.00 40.54 ? 325  GLN A CG  1 
ATOM   2784 C CD  . GLN C 2 175 ? 57.216  35.440  -44.706 1.00 41.41 ? 325  GLN A CD  1 
ATOM   2785 O OE1 . GLN C 2 175 ? 56.979  36.049  -43.651 1.00 48.68 ? 325  GLN A OE1 1 
ATOM   2786 N NE2 . GLN C 2 175 ? 56.263  34.912  -45.458 1.00 39.49 ? 325  GLN A NE2 1 
ATOM   2787 N N   . GLU C 2 176 ? 61.389  32.853  -44.720 1.00 32.66 ? 326  GLU A N   1 
ATOM   2788 C CA  . GLU C 2 176 ? 61.712  31.791  -45.700 1.00 34.26 ? 326  GLU A CA  1 
ATOM   2789 C C   . GLU C 2 176 ? 61.598  30.374  -45.114 1.00 32.26 ? 326  GLU A C   1 
ATOM   2790 O O   . GLU C 2 176 ? 61.223  29.458  -45.798 1.00 30.34 ? 326  GLU A O   1 
ATOM   2791 C CB  . GLU C 2 176 ? 63.074  31.988  -46.327 1.00 34.78 ? 326  GLU A CB  1 
ATOM   2792 C CG  . GLU C 2 176 ? 63.136  33.261  -47.165 1.00 37.44 ? 326  GLU A CG  1 
ATOM   2793 C CD  . GLU C 2 176 ? 64.546  33.610  -47.662 1.00 41.22 ? 326  GLU A CD  1 
ATOM   2794 O OE1 . GLU C 2 176 ? 65.463  33.997  -46.862 1.00 46.55 ? 326  GLU A OE1 1 
ATOM   2795 O OE2 . GLU C 2 176 ? 64.714  33.532  -48.899 1.00 50.46 ? 326  GLU A OE2 1 
ATOM   2796 N N   . GLU C 2 177 ? 62.029  30.194  -43.866 1.00 33.34 ? 327  GLU A N   1 
ATOM   2797 C CA  . GLU C 2 177 ? 61.956  28.888  -43.253 1.00 33.39 ? 327  GLU A CA  1 
ATOM   2798 C C   . GLU C 2 177 ? 60.509  28.502  -43.188 1.00 33.49 ? 327  GLU A C   1 
ATOM   2799 O O   . GLU C 2 177 ? 60.160  27.344  -43.401 1.00 34.71 ? 327  GLU A O   1 
ATOM   2800 C CB  . GLU C 2 177 ? 62.542  28.890  -41.848 1.00 33.89 ? 327  GLU A CB  1 
ATOM   2801 C CG  . GLU C 2 177 ? 62.812  27.466  -41.400 1.00 38.00 ? 327  GLU A CG  1 
ATOM   2802 C CD  . GLU C 2 177 ? 63.244  27.313  -39.946 1.00 43.52 ? 327  GLU A CD  1 
ATOM   2803 O OE1 . GLU C 2 177 ? 63.673  28.296  -39.310 1.00 44.18 ? 327  GLU A OE1 1 
ATOM   2804 O OE2 . GLU C 2 177 ? 63.137  26.164  -39.467 1.00 47.02 ? 327  GLU A OE2 1 
ATOM   2805 N N   . CYS C 2 178 ? 59.645  29.481  -42.936 1.00 33.97 ? 328  CYS A N   1 
ATOM   2806 C CA  . CYS C 2 178 ? 58.208  29.188  -42.805 1.00 32.70 ? 328  CYS A CA  1 
ATOM   2807 C C   . CYS C 2 178 ? 57.659  28.766  -44.136 1.00 31.68 ? 328  CYS A C   1 
ATOM   2808 O O   . CYS C 2 178 ? 56.888  27.815  -44.220 1.00 30.60 ? 328  CYS A O   1 
ATOM   2809 C CB  . CYS C 2 178 ? 57.454  30.423  -42.324 1.00 34.76 ? 328  CYS A CB  1 
ATOM   2810 S SG  . CYS C 2 178 ? 55.743  30.152  -41.906 1.00 38.16 ? 328  CYS A SG  1 
ATOM   2811 N N   . GLU C 2 179 ? 58.029  29.490  -45.192 1.00 30.31 ? 329  GLU A N   1 
ATOM   2812 C CA  . GLU C 2 179 ? 57.421  29.241  -46.531 1.00 31.67 ? 329  GLU A CA  1 
ATOM   2813 C C   . GLU C 2 179 ? 57.874  27.874  -47.032 1.00 30.42 ? 329  GLU A C   1 
ATOM   2814 O O   . GLU C 2 179 ? 57.184  27.185  -47.737 1.00 31.40 ? 329  GLU A O   1 
ATOM   2815 C CB  . GLU C 2 179 ? 57.888  30.332  -47.499 1.00 31.95 ? 329  GLU A CB  1 
ATOM   2816 C CG  . GLU C 2 179 ? 57.182  31.697  -47.326 1.00 33.13 ? 329  GLU A CG  1 
ATOM   2817 C CD  . GLU C 2 179 ? 57.758  32.828  -48.194 1.00 34.90 ? 329  GLU A CD  1 
ATOM   2818 O OE1 . GLU C 2 179 ? 58.875  32.656  -48.767 1.00 34.05 ? 329  GLU A OE1 1 
ATOM   2819 O OE2 . GLU C 2 179 ? 57.158  33.948  -48.204 1.00 34.86 ? 329  GLU A OE2 1 
ATOM   2820 N N   . MET C 2 180 ? 59.113  27.540  -46.734 1.00 32.02 ? 330  MET A N   1 
ATOM   2821 C CA  . MET C 2 180 ? 59.653  26.211  -47.066 1.00 32.50 ? 330  MET A CA  1 
ATOM   2822 C C   . MET C 2 180 ? 58.813  25.079  -46.487 1.00 31.53 ? 330  MET A C   1 
ATOM   2823 O O   . MET C 2 180 ? 58.464  24.156  -47.186 1.00 30.96 ? 330  MET A O   1 
ATOM   2824 C CB  . MET C 2 180 ? 61.083  26.150  -46.536 1.00 33.90 ? 330  MET A CB  1 
ATOM   2825 C CG  . MET C 2 180 ? 61.626  24.738  -46.472 1.00 40.96 ? 330  MET A CG  1 
ATOM   2826 S SD  . MET C 2 180 ? 61.962  24.053  -48.082 1.00 53.09 ? 330  MET A SD  1 
ATOM   2827 C CE  . MET C 2 180 ? 63.360  25.018  -48.376 1.00 39.20 ? 330  MET A CE  1 
ATOM   2828 N N   . LEU C 2 181 ? 58.458  25.180  -45.213 1.00 30.37 ? 331  LEU A N   1 
ATOM   2829 C CA  . LEU C 2 181 ? 57.605  24.151  -44.558 1.00 29.97 ? 331  LEU A CA  1 
ATOM   2830 C C   . LEU C 2 181 ? 56.237  24.145  -45.175 1.00 29.66 ? 331  LEU A C   1 
ATOM   2831 O O   . LEU C 2 181 ? 55.731  23.107  -45.590 1.00 33.39 ? 331  LEU A O   1 
ATOM   2832 C CB  . LEU C 2 181 ? 57.534  24.449  -43.038 1.00 30.66 ? 331  LEU A CB  1 
ATOM   2833 C CG  . LEU C 2 181 ? 56.598  23.582  -42.167 1.00 31.01 ? 331  LEU A CG  1 
ATOM   2834 C CD1 . LEU C 2 181 ? 56.940  22.105  -42.297 1.00 34.29 ? 331  LEU A CD1 1 
ATOM   2835 C CD2 . LEU C 2 181 ? 56.736  24.073  -40.755 1.00 30.63 ? 331  LEU A CD2 1 
ATOM   2836 N N   . GLU C 2 182 ? 55.603  25.305  -45.246 1.00 30.33 ? 332  GLU A N   1 
ATOM   2837 C CA  . GLU C 2 182 ? 54.261  25.439  -45.847 1.00 32.42 ? 332  GLU A CA  1 
ATOM   2838 C C   . GLU C 2 182 ? 54.234  24.872  -47.286 1.00 30.87 ? 332  GLU A C   1 
ATOM   2839 O O   . GLU C 2 182 ? 53.294  24.134  -47.693 1.00 33.86 ? 332  GLU A O   1 
ATOM   2840 C CB  . GLU C 2 182 ? 53.888  26.938  -45.877 1.00 33.44 ? 332  GLU A CB  1 
ATOM   2841 C CG  . GLU C 2 182 ? 52.371  27.093  -45.939 1.00 40.06 ? 332  GLU A CG  1 
ATOM   2842 C CD  . GLU C 2 182 ? 51.770  26.999  -47.381 1.00 44.14 ? 332  GLU A CD  1 
ATOM   2843 O OE1 . GLU C 2 182 ? 52.500  27.264  -48.375 1.00 43.08 ? 332  GLU A OE1 1 
ATOM   2844 O OE2 . GLU C 2 182 ? 50.534  26.755  -47.479 1.00 43.65 ? 332  GLU A OE2 1 
ATOM   2845 N N   . GLY C 2 183 ? 55.219  25.319  -48.070 1.00 31.55 ? 333  GLY A N   1 
ATOM   2846 C CA  . GLY C 2 183 ? 55.347  24.935  -49.474 1.00 31.47 ? 333  GLY A CA  1 
ATOM   2847 C C   . GLY C 2 183 ? 55.464  23.441  -49.717 1.00 33.94 ? 333  GLY A C   1 
ATOM   2848 O O   . GLY C 2 183 ? 55.059  22.941  -50.728 1.00 33.09 ? 333  GLY A O   1 
ATOM   2849 N N   . PHE C 2 184 ? 56.092  22.725  -48.796 1.00 35.41 ? 334  PHE A N   1 
ATOM   2850 C CA  . PHE C 2 184 ? 56.238  21.263  -48.876 1.00 37.51 ? 334  PHE A CA  1 
ATOM   2851 C C   . PHE C 2 184 ? 54.882  20.556  -48.974 1.00 38.56 ? 334  PHE A C   1 
ATOM   2852 O O   . PHE C 2 184 ? 54.785  19.472  -49.549 1.00 39.03 ? 334  PHE A O   1 
ATOM   2853 C CB  . PHE C 2 184 ? 57.078  20.741  -47.671 1.00 38.02 ? 334  PHE A CB  1 
ATOM   2854 C CG  . PHE C 2 184 ? 57.733  19.435  -47.933 1.00 39.99 ? 334  PHE A CG  1 
ATOM   2855 C CD1 . PHE C 2 184 ? 58.893  19.356  -48.670 1.00 46.36 ? 334  PHE A CD1 1 
ATOM   2856 C CD2 . PHE C 2 184 ? 57.151  18.254  -47.489 1.00 45.35 ? 334  PHE A CD2 1 
ATOM   2857 C CE1 . PHE C 2 184 ? 59.501  18.117  -48.931 1.00 45.91 ? 334  PHE A CE1 1 
ATOM   2858 C CE2 . PHE C 2 184 ? 57.749  16.965  -47.772 1.00 42.95 ? 334  PHE A CE2 1 
ATOM   2859 C CZ  . PHE C 2 184 ? 58.918  16.928  -48.491 1.00 42.70 ? 334  PHE A CZ  1 
ATOM   2860 N N   . PHE C 2 185 ? 53.815  21.227  -48.532 1.00 38.53 ? 335  PHE A N   1 
ATOM   2861 C CA  . PHE C 2 185 ? 52.455  20.726  -48.674 1.00 39.62 ? 335  PHE A CA  1 
ATOM   2862 C C   . PHE C 2 185 ? 51.734  21.455  -49.781 1.00 39.84 ? 335  PHE A C   1 
ATOM   2863 O O   . PHE C 2 185 ? 51.057  20.830  -50.597 1.00 43.46 ? 335  PHE A O   1 
ATOM   2864 C CB  . PHE C 2 185 ? 51.653  21.002  -47.375 1.00 39.65 ? 335  PHE A CB  1 
ATOM   2865 C CG  . PHE C 2 185 ? 52.081  20.165  -46.216 1.00 41.52 ? 335  PHE A CG  1 
ATOM   2866 C CD1 . PHE C 2 185 ? 53.184  20.532  -45.452 1.00 36.63 ? 335  PHE A CD1 1 
ATOM   2867 C CD2 . PHE C 2 185 ? 51.390  18.984  -45.916 1.00 43.64 ? 335  PHE A CD2 1 
ATOM   2868 C CE1 . PHE C 2 185 ? 53.627  19.778  -44.387 1.00 41.78 ? 335  PHE A CE1 1 
ATOM   2869 C CE2 . PHE C 2 185 ? 51.798  18.220  -44.842 1.00 45.46 ? 335  PHE A CE2 1 
ATOM   2870 C CZ  . PHE C 2 185 ? 52.903  18.607  -44.069 1.00 42.50 ? 335  PHE A CZ  1 
ATOM   2871 N N   . SER C 2 186 ? 51.883  22.771  -49.843 1.00 36.93 ? 336  SER A N   1 
ATOM   2872 C CA  . SER C 2 186 ? 51.065  23.532  -50.758 1.00 35.73 ? 336  SER A CA  1 
ATOM   2873 C C   . SER C 2 186 ? 51.527  23.554  -52.225 1.00 35.85 ? 336  SER A C   1 
ATOM   2874 O O   . SER C 2 186 ? 50.687  23.803  -53.125 1.00 36.37 ? 336  SER A O   1 
ATOM   2875 C CB  . SER C 2 186 ? 50.794  24.910  -50.221 1.00 37.27 ? 336  SER A CB  1 
ATOM   2876 O OG  . SER C 2 186 ? 51.988  25.680  -50.295 1.00 36.73 ? 336  SER A OG  1 
ATOM   2877 N N   . HIS C 2 187 ? 52.825  23.350  -52.484 1.00 31.54 ? 337  HIS A N   1 
ATOM   2878 C CA  . HIS C 2 187 ? 53.360  23.490  -53.871 1.00 34.17 ? 337  HIS A CA  1 
ATOM   2879 C C   . HIS C 2 187 ? 54.532  22.503  -53.951 1.00 33.95 ? 337  HIS A C   1 
ATOM   2880 O O   . HIS C 2 187 ? 55.658  22.903  -53.839 1.00 34.21 ? 337  HIS A O   1 
ATOM   2881 C CB  . HIS C 2 187 ? 53.843  24.901  -54.147 1.00 34.20 ? 337  HIS A CB  1 
ATOM   2882 C CG  . HIS C 2 187 ? 54.106  25.198  -55.601 1.00 37.52 ? 337  HIS A CG  1 
ATOM   2883 N ND1 . HIS C 2 187 ? 53.304  26.055  -56.298 1.00 35.42 ? 337  HIS A ND1 1 
ATOM   2884 C CD2 . HIS C 2 187 ? 54.996  24.693  -56.503 1.00 37.24 ? 337  HIS A CD2 1 
ATOM   2885 C CE1 . HIS C 2 187 ? 53.732  26.149  -57.554 1.00 41.39 ? 337  HIS A CE1 1 
ATOM   2886 N NE2 . HIS C 2 187 ? 54.778  25.349  -57.706 1.00 35.02 ? 337  HIS A NE2 1 
ATOM   2887 N N   . ASN C 2 188 ? 54.221  21.228  -54.092 1.00 33.37 ? 338  ASN A N   1 
ATOM   2888 C CA  . ASN C 2 188 ? 55.206  20.111  -53.996 1.00 32.92 ? 338  ASN A CA  1 
ATOM   2889 C C   . ASN C 2 188 ? 54.845  19.228  -55.182 1.00 32.59 ? 338  ASN A C   1 
ATOM   2890 O O   . ASN C 2 188 ? 53.819  18.582  -55.130 1.00 34.60 ? 338  ASN A O   1 
ATOM   2891 C CB  . ASN C 2 188 ? 55.004  19.374  -52.623 1.00 34.55 ? 338  ASN A CB  1 
ATOM   2892 C CG  . ASN C 2 188 ? 55.895  18.110  -52.456 1.00 35.98 ? 338  ASN A CG  1 
ATOM   2893 O OD1 . ASN C 2 188 ? 56.169  17.638  -51.338 1.00 37.61 ? 338  ASN A OD1 1 
ATOM   2894 N ND2 . ASN C 2 188 ? 56.337  17.575  -53.571 1.00 31.39 ? 338  ASN A ND2 1 
ATOM   2895 N N   . PRO C 2 189 ? 55.657  19.212  -56.274 1.00 32.99 ? 339  PRO A N   1 
ATOM   2896 C CA  . PRO C 2 189 ? 55.262  18.471  -57.463 1.00 32.36 ? 339  PRO A CA  1 
ATOM   2897 C C   . PRO C 2 189 ? 55.150  16.968  -57.268 1.00 33.05 ? 339  PRO A C   1 
ATOM   2898 O O   . PRO C 2 189 ? 54.374  16.324  -57.965 1.00 32.54 ? 339  PRO A O   1 
ATOM   2899 C CB  . PRO C 2 189 ? 56.400  18.815  -58.469 1.00 33.70 ? 339  PRO A CB  1 
ATOM   2900 C CG  . PRO C 2 189 ? 57.597  19.036  -57.598 1.00 35.13 ? 339  PRO A CG  1 
ATOM   2901 C CD  . PRO C 2 189 ? 56.952  19.905  -56.486 1.00 33.58 ? 339  PRO A CD  1 
ATOM   2902 N N   . CYS C 2 190 ? 55.902  16.414  -56.322 1.00 34.04 ? 340  CYS A N   1 
ATOM   2903 C CA  . CYS C 2 190 ? 55.841  14.951  -56.069 1.00 34.36 ? 340  CYS A CA  1 
ATOM   2904 C C   . CYS C 2 190 ? 54.437  14.639  -55.522 1.00 33.98 ? 340  CYS A C   1 
ATOM   2905 O O   . CYS C 2 190 ? 53.727  13.718  -55.992 1.00 35.03 ? 340  CYS A O   1 
ATOM   2906 C CB  . CYS C 2 190 ? 56.966  14.522  -55.063 1.00 33.44 ? 340  CYS A CB  1 
ATOM   2907 S SG  . CYS C 2 190 ? 56.464  13.011  -54.059 1.00 38.56 ? 340  CYS A SG  1 
ATOM   2908 N N   . LEU C 2 191 ? 54.029  15.422  -54.515 1.00 34.44 ? 341  LEU A N   1 
ATOM   2909 C CA  . LEU C 2 191 ? 52.751  15.219  -53.875 1.00 33.69 ? 341  LEU A CA  1 
ATOM   2910 C C   . LEU C 2 191 ? 51.607  15.502  -54.846 1.00 32.82 ? 341  LEU A C   1 
ATOM   2911 O O   . LEU C 2 191 ? 50.628  14.762  -54.941 1.00 31.91 ? 341  LEU A O   1 
ATOM   2912 C CB  . LEU C 2 191 ? 52.651  16.095  -52.610 1.00 35.15 ? 341  LEU A CB  1 
ATOM   2913 C CG  . LEU C 2 191 ? 51.251  16.043  -51.934 1.00 35.14 ? 341  LEU A CG  1 
ATOM   2914 C CD1 . LEU C 2 191 ? 51.094  14.641  -51.403 1.00 33.07 ? 341  LEU A CD1 1 
ATOM   2915 C CD2 . LEU C 2 191 ? 51.250  16.964  -50.727 1.00 33.16 ? 341  LEU A CD2 1 
ATOM   2916 N N   . THR C 2 192 ? 51.740  16.595  -55.604 1.00 32.33 ? 342  THR A N   1 
ATOM   2917 C CA  . THR C 2 192 ? 50.731  16.920  -56.593 1.00 32.88 ? 342  THR A CA  1 
ATOM   2918 C C   . THR C 2 192 ? 50.542  15.858  -57.648 1.00 33.61 ? 342  THR A C   1 
ATOM   2919 O O   . THR C 2 192 ? 49.408  15.527  -57.993 1.00 34.61 ? 342  THR A O   1 
ATOM   2920 C CB  . THR C 2 192 ? 51.104  18.244  -57.269 1.00 34.30 ? 342  THR A CB  1 
ATOM   2921 O OG1 . THR C 2 192 ? 51.106  19.232  -56.232 1.00 34.97 ? 342  THR A OG1 1 
ATOM   2922 C CG2 . THR C 2 192 ? 50.060  18.612  -58.303 1.00 35.82 ? 342  THR A CG2 1 
ATOM   2923 N N   . GLU C 2 193 ? 51.638  15.312  -58.163 1.00 32.28 ? 343  GLU A N   1 
ATOM   2924 C CA  . GLU C 2 193 ? 51.555  14.306  -59.174 1.00 34.70 ? 343  GLU A CA  1 
ATOM   2925 C C   . GLU C 2 193 ? 51.010  12.981  -58.622 1.00 33.09 ? 343  GLU A C   1 
ATOM   2926 O O   . GLU C 2 193 ? 50.240  12.310  -59.302 1.00 34.38 ? 343  GLU A O   1 
ATOM   2927 C CB  . GLU C 2 193 ? 52.901  14.100  -59.852 1.00 35.86 ? 343  GLU A CB  1 
ATOM   2928 C CG  . GLU C 2 193 ? 53.214  15.247  -60.853 1.00 38.71 ? 343  GLU A CG  1 
ATOM   2929 C CD  . GLU C 2 193 ? 51.932  15.674  -61.706 1.00 46.96 ? 343  GLU A CD  1 
ATOM   2930 O OE1 . GLU C 2 193 ? 51.343  14.823  -62.450 1.00 41.37 ? 343  GLU A OE1 1 
ATOM   2931 O OE2 . GLU C 2 193 ? 51.456  16.825  -61.541 1.00 43.40 ? 343  GLU A OE2 1 
ATOM   2932 N N   . ALA C 2 194 ? 51.410  12.609  -57.424 1.00 32.84 ? 344  ALA A N   1 
ATOM   2933 C CA  . ALA C 2 194 ? 50.929  11.398  -56.772 1.00 32.70 ? 344  ALA A CA  1 
ATOM   2934 C C   . ALA C 2 194 ? 49.419  11.470  -56.565 1.00 33.77 ? 344  ALA A C   1 
ATOM   2935 O O   . ALA C 2 194 ? 48.663  10.512  -56.844 1.00 32.11 ? 344  ALA A O   1 
ATOM   2936 C CB  . ALA C 2 194 ? 51.654  11.230  -55.397 1.00 35.38 ? 344  ALA A CB  1 
ATOM   2937 N N   . ILE C 2 195 ? 48.953  12.597  -56.049 1.00 31.53 ? 345  ILE A N   1 
ATOM   2938 C CA  . ILE C 2 195 ? 47.509  12.819  -55.874 1.00 33.05 ? 345  ILE A CA  1 
ATOM   2939 C C   . ILE C 2 195 ? 46.756  12.796  -57.209 1.00 33.24 ? 345  ILE A C   1 
ATOM   2940 O O   . ILE C 2 195 ? 45.713  12.149  -57.347 1.00 33.81 ? 345  ILE A O   1 
ATOM   2941 C CB  . ILE C 2 195 ? 47.181  14.168  -55.023 1.00 34.11 ? 345  ILE A CB  1 
ATOM   2942 C CG1 . ILE C 2 195 ? 47.601  13.943  -53.541 1.00 31.80 ? 345  ILE A CG1 1 
ATOM   2943 C CG2 . ILE C 2 195 ? 45.699  14.482  -55.126 1.00 33.80 ? 345  ILE A CG2 1 
ATOM   2944 C CD1 . ILE C 2 195 ? 47.434  15.254  -52.657 1.00 35.45 ? 345  ILE A CD1 1 
ATOM   2945 N N   . ALA C 2 196 ? 47.250  13.542  -58.168 1.00 33.24 ? 346  ALA A N   1 
ATOM   2946 C CA  . ALA C 2 196 ? 46.618  13.612  -59.508 1.00 33.60 ? 346  ALA A CA  1 
ATOM   2947 C C   . ALA C 2 196 ? 46.467  12.243  -60.165 1.00 33.13 ? 346  ALA A C   1 
ATOM   2948 O O   . ALA C 2 196 ? 45.402  11.899  -60.739 1.00 31.35 ? 346  ALA A O   1 
ATOM   2949 C CB  . ALA C 2 196 ? 47.448  14.498  -60.392 1.00 35.52 ? 346  ALA A CB  1 
ATOM   2950 N N   . ALA C 2 197 ? 47.533  11.441  -60.099 1.00 32.20 ? 347  ALA A N   1 
ATOM   2951 C CA  . ALA C 2 197 ? 47.477  10.085  -60.736 1.00 33.31 ? 347  ALA A CA  1 
ATOM   2952 C C   . ALA C 2 197 ? 46.406  9.202   -60.056 1.00 32.83 ? 347  ALA A C   1 
ATOM   2953 O O   . ALA C 2 197 ? 45.692  8.441   -60.710 1.00 33.67 ? 347  ALA A O   1 
ATOM   2954 C CB  . ALA C 2 197 ? 48.872  9.397   -60.670 1.00 31.78 ? 347  ALA A CB  1 
ATOM   2955 N N   . LYS C 2 198 ? 46.349  9.291   -58.727 1.00 33.12 ? 348  LYS A N   1 
ATOM   2956 C CA  . LYS C 2 198 ? 45.402  8.493   -57.951 1.00 32.07 ? 348  LYS A CA  1 
ATOM   2957 C C   . LYS C 2 198 ? 44.017  8.952   -58.281 1.00 32.99 ? 348  LYS A C   1 
ATOM   2958 O O   . LYS C 2 198 ? 43.113  8.139   -58.442 1.00 31.39 ? 348  LYS A O   1 
ATOM   2959 C CB  . LYS C 2 198 ? 45.655  8.712   -56.439 1.00 32.83 ? 348  LYS A CB  1 
ATOM   2960 C CG  . LYS C 2 198 ? 44.841  7.740   -55.496 1.00 33.26 ? 348  LYS A CG  1 
ATOM   2961 C CD  . LYS C 2 198 ? 44.983  6.255   -55.946 1.00 33.86 ? 348  LYS A CD  1 
ATOM   2962 C CE  . LYS C 2 198 ? 46.356  5.674   -55.703 1.00 34.16 ? 348  LYS A CE  1 
ATOM   2963 N NZ  . LYS C 2 198 ? 46.317  4.151   -56.075 1.00 33.32 ? 348  LYS A NZ  1 
ATOM   2964 N N   . MET C 2 199 ? 43.823  10.270  -58.375 1.00 31.71 ? 349  MET A N   1 
ATOM   2965 C CA  . MET C 2 199 ? 42.496  10.732  -58.830 1.00 32.99 ? 349  MET A CA  1 
ATOM   2966 C C   . MET C 2 199 ? 42.071  10.258  -60.214 1.00 32.51 ? 349  MET A C   1 
ATOM   2967 O O   . MET C 2 199 ? 40.876  9.931   -60.440 1.00 34.07 ? 349  MET A O   1 
ATOM   2968 C CB  . MET C 2 199 ? 42.397  12.285  -58.690 1.00 33.73 ? 349  MET A CB  1 
ATOM   2969 C CG  . MET C 2 199 ? 42.269  12.698  -57.182 1.00 32.40 ? 349  MET A CG  1 
ATOM   2970 S SD  . MET C 2 199 ? 42.013  14.479  -57.216 1.00 35.75 ? 349  MET A SD  1 
ATOM   2971 C CE  . MET C 2 199 ? 42.014  14.814  -55.449 1.00 35.42 ? 349  MET A CE  1 
ATOM   2972 N N   . ARG C 2 200 ? 42.983  10.293  -61.195 1.00 32.00 ? 350  ARG A N   1 
ATOM   2973 C CA  . ARG C 2 200 ? 42.707  9.723   -62.521 1.00 33.11 ? 350  ARG A CA  1 
ATOM   2974 C C   . ARG C 2 200 ? 42.313  8.257   -62.411 1.00 31.16 ? 350  ARG A C   1 
ATOM   2975 O O   . ARG C 2 200 ? 41.341  7.796   -63.017 1.00 30.07 ? 350  ARG A O   1 
ATOM   2976 C CB  . ARG C 2 200 ? 43.906  9.872   -63.486 1.00 32.57 ? 350  ARG A CB  1 
ATOM   2977 C CG  . ARG C 2 200 ? 44.324  11.341  -64.031 1.00 39.22 ? 350  ARG A CG  1 
ATOM   2978 C CD  . ARG C 2 200 ? 45.854  11.216  -64.744 1.00 33.67 ? 350  ARG A CD  1 
ATOM   2979 N NE  . ARG C 2 200 ? 46.722  12.297  -64.162 1.00 46.34 ? 350  ARG A NE  1 
ATOM   2980 C CZ  . ARG C 2 200 ? 47.990  12.137  -63.871 1.00 45.85 ? 350  ARG A CZ  1 
ATOM   2981 N NH1 . ARG C 2 200 ? 48.541  10.980  -64.042 1.00 35.05 ? 350  ARG A NH1 1 
ATOM   2982 N NH2 . ARG C 2 200 ? 48.720  13.128  -63.366 1.00 53.63 ? 350  ARG A NH2 1 
ATOM   2983 N N   . PHE C 2 201 ? 43.051  7.522   -61.582 1.00 32.49 ? 351  PHE A N   1 
ATOM   2984 C CA  . PHE C 2 201 ? 42.730  6.085   -61.423 1.00 32.70 ? 351  PHE A CA  1 
ATOM   2985 C C   . PHE C 2 201 ? 41.316  5.941   -60.897 1.00 32.66 ? 351  PHE A C   1 
ATOM   2986 O O   . PHE C 2 201 ? 40.543  5.140   -61.379 1.00 32.27 ? 351  PHE A O   1 
ATOM   2987 C CB  . PHE C 2 201 ? 43.699  5.405   -60.439 1.00 33.45 ? 351  PHE A CB  1 
ATOM   2988 C CG  . PHE C 2 201 ? 43.209  4.061   -59.966 1.00 32.84 ? 351  PHE A CG  1 
ATOM   2989 C CD1 . PHE C 2 201 ? 43.038  3.008   -60.872 1.00 35.84 ? 351  PHE A CD1 1 
ATOM   2990 C CD2 . PHE C 2 201 ? 42.899  3.870   -58.590 1.00 34.57 ? 351  PHE A CD2 1 
ATOM   2991 C CE1 . PHE C 2 201 ? 42.532  1.750   -60.421 1.00 34.85 ? 351  PHE A CE1 1 
ATOM   2992 C CE2 . PHE C 2 201 ? 42.451  2.660   -58.140 1.00 37.41 ? 351  PHE A CE2 1 
ATOM   2993 C CZ  . PHE C 2 201 ? 42.254  1.608   -59.046 1.00 34.02 ? 351  PHE A CZ  1 
ATOM   2994 N N   . HIS C 2 202 ? 40.986  6.740   -59.883 1.00 32.75 ? 352  HIS A N   1 
ATOM   2995 C CA  . HIS C 2 202 ? 39.600  6.754   -59.373 1.00 32.76 ? 352  HIS A CA  1 
ATOM   2996 C C   . HIS C 2 202 ? 38.495  7.053   -60.409 1.00 31.77 ? 352  HIS A C   1 
ATOM   2997 O O   . HIS C 2 202 ? 37.458  6.354   -60.440 1.00 33.70 ? 352  HIS A O   1 
ATOM   2998 C CB  . HIS C 2 202 ? 39.524  7.714   -58.157 1.00 30.62 ? 352  HIS A CB  1 
ATOM   2999 C CG  . HIS C 2 202 ? 40.251  7.169   -56.977 1.00 31.27 ? 352  HIS A CG  1 
ATOM   3000 N ND1 . HIS C 2 202 ? 40.755  7.958   -55.990 1.00 32.02 ? 352  HIS A ND1 1 
ATOM   3001 C CD2 . HIS C 2 202 ? 40.577  5.889   -56.646 1.00 29.93 ? 352  HIS A CD2 1 
ATOM   3002 C CE1 . HIS C 2 202 ? 41.356  7.211   -55.072 1.00 32.24 ? 352  HIS A CE1 1 
ATOM   3003 N NE2 . HIS C 2 202 ? 41.274  5.950   -55.454 1.00 33.81 ? 352  HIS A NE2 1 
ATOM   3004 N N   . SER C 2 203 ? 38.690  8.042   -61.254 1.00 33.01 ? 353  SER A N   1 
ATOM   3005 C CA  . SER C 2 203 ? 37.769  8.316   -62.377 1.00 34.38 ? 353  SER A CA  1 
ATOM   3006 C C   . SER C 2 203 ? 37.636  7.107   -63.322 1.00 34.99 ? 353  SER A C   1 
ATOM   3007 O O   . SER C 2 203 ? 36.538  6.811   -63.849 1.00 33.78 ? 353  SER A O   1 
ATOM   3008 C CB  . SER C 2 203 ? 38.203  9.527   -63.227 1.00 34.51 ? 353  SER A CB  1 
ATOM   3009 O OG  . SER C 2 203 ? 38.323  10.629  -62.342 1.00 41.64 ? 353  SER A OG  1 
ATOM   3010 N N   . GLN C 2 204 ? 38.752  6.406   -63.510 1.00 32.67 ? 354  GLN A N   1 
ATOM   3011 C CA  . GLN C 2 204 ? 38.779  5.320   -64.474 1.00 34.72 ? 354  GLN A CA  1 
ATOM   3012 C C   . GLN C 2 204 ? 38.115  4.058   -63.961 1.00 35.50 ? 354  GLN A C   1 
ATOM   3013 O O   . GLN C 2 204 ? 37.515  3.286   -64.748 1.00 35.14 ? 354  GLN A O   1 
ATOM   3014 C CB  . GLN C 2 204 ? 40.222  5.057   -64.891 1.00 34.08 ? 354  GLN A CB  1 
ATOM   3015 C CG  . GLN C 2 204 ? 40.818  6.241   -65.679 1.00 33.56 ? 354  GLN A CG  1 
ATOM   3016 C CD  . GLN C 2 204 ? 42.372  6.221   -65.722 1.00 34.43 ? 354  GLN A CD  1 
ATOM   3017 O OE1 . GLN C 2 204 ? 43.024  5.191   -65.429 1.00 34.24 ? 354  GLN A OE1 1 
ATOM   3018 N NE2 . GLN C 2 204 ? 42.949  7.337   -66.126 1.00 31.74 ? 354  GLN A NE2 1 
ATOM   3019 N N   . LEU C 2 205 ? 38.285  3.795   -62.665 1.00 35.52 ? 355  LEU A N   1 
ATOM   3020 C CA  . LEU C 2 205 ? 37.703  2.630   -62.006 1.00 39.58 ? 355  LEU A CA  1 
ATOM   3021 C C   . LEU C 2 205 ? 36.191  2.662   -62.161 1.00 40.71 ? 355  LEU A C   1 
ATOM   3022 O O   . LEU C 2 205 ? 35.529  1.613   -62.401 1.00 39.36 ? 355  LEU A O   1 
ATOM   3023 C CB  . LEU C 2 205 ? 38.119  2.626   -60.513 1.00 39.11 ? 355  LEU A CB  1 
ATOM   3024 C CG  . LEU C 2 205 ? 37.812  1.369   -59.692 1.00 43.42 ? 355  LEU A CG  1 
ATOM   3025 C CD1 . LEU C 2 205 ? 38.427  0.083   -60.266 1.00 46.85 ? 355  LEU A CD1 1 
ATOM   3026 C CD2 . LEU C 2 205 ? 38.206  1.571   -58.216 1.00 42.49 ? 355  LEU A CD2 1 
ATOM   3027 N N   . PHE C 2 206 ? 35.647  3.873   -62.069 1.00 44.21 ? 356  PHE A N   1 
ATOM   3028 C CA  . PHE C 2 206 ? 34.188  4.106   -62.192 1.00 48.09 ? 356  PHE A CA  1 
ATOM   3029 C C   . PHE C 2 206 ? 33.675  4.419   -63.579 1.00 50.26 ? 356  PHE A C   1 
ATOM   3030 O O   . PHE C 2 206 ? 32.469  4.618   -63.744 1.00 52.25 ? 356  PHE A O   1 
ATOM   3031 C CB  . PHE C 2 206 ? 33.702  5.224   -61.243 1.00 48.17 ? 356  PHE A CB  1 
ATOM   3032 C CG  . PHE C 2 206 ? 33.271  4.719   -59.901 1.00 49.20 ? 356  PHE A CG  1 
ATOM   3033 C CD1 . PHE C 2 206 ? 34.138  4.756   -58.843 1.00 46.37 ? 356  PHE A CD1 1 
ATOM   3034 C CD2 . PHE C 2 206 ? 32.006  4.166   -59.708 1.00 50.46 ? 356  PHE A CD2 1 
ATOM   3035 C CE1 . PHE C 2 206 ? 33.780  4.259   -57.572 1.00 46.64 ? 356  PHE A CE1 1 
ATOM   3036 C CE2 . PHE C 2 206 ? 31.625  3.679   -58.440 1.00 50.01 ? 356  PHE A CE2 1 
ATOM   3037 C CZ  . PHE C 2 206 ? 32.519  3.721   -57.375 1.00 50.01 ? 356  PHE A CZ  1 
ATOM   3038 N N   . SER C 2 207 ? 34.549  4.465   -64.577 1.00 51.65 ? 357  SER A N   1 
ATOM   3039 C CA  . SER C 2 207 ? 34.100  4.819   -65.904 1.00 53.26 ? 357  SER A CA  1 
ATOM   3040 C C   . SER C 2 207 ? 33.360  3.646   -66.525 1.00 53.52 ? 357  SER A C   1 
ATOM   3041 O O   . SER C 2 207 ? 33.838  2.502   -66.436 1.00 53.44 ? 357  SER A O   1 
ATOM   3042 C CB  . SER C 2 207 ? 35.275  5.229   -66.799 1.00 53.79 ? 357  SER A CB  1 
ATOM   3043 O OG  . SER C 2 207 ? 36.028  4.079   -67.193 1.00 56.15 ? 357  SER A OG  1 
ATOM   3044 N N   . SER D 2 9   ? -26.616 -28.972 -21.345 1.00 44.82 ? 159  SER B N   1 
ATOM   3045 C CA  . SER D 2 9   ? -25.765 -29.285 -20.125 1.00 42.97 ? 159  SER B CA  1 
ATOM   3046 C C   . SER D 2 9   ? -26.553 -29.272 -18.834 1.00 42.18 ? 159  SER B C   1 
ATOM   3047 O O   . SER D 2 9   ? -27.624 -28.650 -18.740 1.00 42.33 ? 159  SER B O   1 
ATOM   3048 C CB  . SER D 2 9   ? -24.512 -28.410 -20.057 1.00 44.19 ? 159  SER B CB  1 
ATOM   3049 O OG  . SER D 2 9   ? -24.795 -27.069 -19.688 1.00 47.52 ? 159  SER B OG  1 
ATOM   3050 N N   . ASP D 2 10  ? -26.026 -29.969 -17.826 1.00 40.59 ? 160  ASP B N   1 
ATOM   3051 C CA  . ASP D 2 10  ? -26.767 -30.207 -16.593 1.00 38.37 ? 160  ASP B CA  1 
ATOM   3052 C C   . ASP D 2 10  ? -26.884 -28.919 -15.773 1.00 37.76 ? 160  ASP B C   1 
ATOM   3053 O O   . ASP D 2 10  ? -26.133 -27.949 -16.017 1.00 37.45 ? 160  ASP B O   1 
ATOM   3054 C CB  . ASP D 2 10  ? -26.144 -31.389 -15.835 1.00 38.20 ? 160  ASP B CB  1 
ATOM   3055 C CG  . ASP D 2 10  ? -24.781 -31.069 -15.188 1.00 37.79 ? 160  ASP B CG  1 
ATOM   3056 O OD1 . ASP D 2 10  ? -23.773 -31.724 -15.496 1.00 37.88 ? 160  ASP B OD1 1 
ATOM   3057 O OD2 . ASP D 2 10  ? -24.727 -30.218 -14.318 1.00 36.86 ? 160  ASP B OD2 1 
ATOM   3058 N N   . LEU D 2 11  ? -27.809 -28.870 -14.822 1.00 35.15 ? 161  LEU B N   1 
ATOM   3059 C CA  . LEU D 2 11  ? -27.987 -27.640 -14.057 1.00 34.74 ? 161  LEU B CA  1 
ATOM   3060 C C   . LEU D 2 11  ? -26.896 -27.388 -13.027 1.00 32.83 ? 161  LEU B C   1 
ATOM   3061 O O   . LEU D 2 11  ? -26.705 -26.264 -12.633 1.00 32.28 ? 161  LEU B O   1 
ATOM   3062 C CB  . LEU D 2 11  ? -29.361 -27.581 -13.365 1.00 35.19 ? 161  LEU B CB  1 
ATOM   3063 C CG  . LEU D 2 11  ? -30.556 -27.596 -14.307 1.00 37.42 ? 161  LEU B CG  1 
ATOM   3064 C CD1 . LEU D 2 11  ? -31.824 -27.200 -13.577 1.00 37.81 ? 161  LEU B CD1 1 
ATOM   3065 C CD2 . LEU D 2 11  ? -30.312 -26.693 -15.482 1.00 40.75 ? 161  LEU B CD2 1 
ATOM   3066 N N   . CYS D 2 12  ? -26.204 -28.419 -12.567 1.00 32.45 ? 162  CYS B N   1 
ATOM   3067 C CA  . CYS D 2 12  ? -25.037 -28.197 -11.721 1.00 34.65 ? 162  CYS B CA  1 
ATOM   3068 C C   . CYS D 2 12  ? -23.942 -27.389 -12.440 1.00 32.80 ? 162  CYS B C   1 
ATOM   3069 O O   . CYS D 2 12  ? -23.373 -26.444 -11.871 1.00 32.81 ? 162  CYS B O   1 
ATOM   3070 C CB  . CYS D 2 12  ? -24.475 -29.507 -11.197 1.00 34.77 ? 162  CYS B CB  1 
ATOM   3071 S SG  . CYS D 2 12  ? -25.632 -30.175 -9.865  1.00 38.95 ? 162  CYS B SG  1 
ATOM   3072 N N   . LEU D 2 13  ? -23.685 -27.748 -13.691 1.00 32.20 ? 163  LEU B N   1 
ATOM   3073 C CA  . LEU D 2 13  ? -22.712 -27.028 -14.496 1.00 31.68 ? 163  LEU B CA  1 
ATOM   3074 C C   . LEU D 2 13  ? -23.233 -25.617 -14.741 1.00 31.67 ? 163  LEU B C   1 
ATOM   3075 O O   . LEU D 2 13  ? -22.459 -24.685 -14.641 1.00 32.64 ? 163  LEU B O   1 
ATOM   3076 C CB  . LEU D 2 13  ? -22.389 -27.768 -15.824 1.00 31.87 ? 163  LEU B CB  1 
ATOM   3077 C CG  . LEU D 2 13  ? -21.449 -27.055 -16.808 1.00 30.83 ? 163  LEU B CG  1 
ATOM   3078 C CD1 . LEU D 2 13  ? -20.053 -26.699 -16.206 1.00 32.90 ? 163  LEU B CD1 1 
ATOM   3079 C CD2 . LEU D 2 13  ? -21.323 -27.822 -18.129 1.00 32.49 ? 163  LEU B CD2 1 
ATOM   3080 N N   . LYS D 2 14  ? -24.529 -25.459 -15.030 1.00 32.15 ? 164  LYS B N   1 
ATOM   3081 C CA  . LYS D 2 14  ? -25.113 -24.134 -15.309 1.00 33.02 ? 164  LYS B CA  1 
ATOM   3082 C C   . LYS D 2 14  ? -24.968 -23.215 -14.110 1.00 33.31 ? 164  LYS B C   1 
ATOM   3083 O O   . LYS D 2 14  ? -24.577 -22.050 -14.256 1.00 31.45 ? 164  LYS B O   1 
ATOM   3084 C CB  . LYS D 2 14  ? -26.567 -24.216 -15.771 1.00 33.11 ? 164  LYS B CB  1 
ATOM   3085 C CG  . LYS D 2 14  ? -26.723 -24.774 -17.168 1.00 35.25 ? 164  LYS B CG  1 
ATOM   3086 C CD  . LYS D 2 14  ? -28.187 -24.728 -17.657 1.00 35.38 ? 164  LYS B CD  1 
ATOM   3087 C CE  . LYS D 2 14  ? -28.276 -24.903 -19.166 1.00 39.73 ? 164  LYS B CE  1 
ATOM   3088 N NZ  . LYS D 2 14  ? -29.720 -24.751 -19.742 1.00 40.24 ? 164  LYS B NZ  1 
ATOM   3089 N N   . PHE D 2 15  ? -25.266 -23.716 -12.916 1.00 33.51 ? 165  PHE B N   1 
ATOM   3090 C CA  . PHE D 2 15  ? -25.146 -22.861 -11.734 1.00 33.30 ? 165  PHE B CA  1 
ATOM   3091 C C   . PHE D 2 15  ? -23.698 -22.549 -11.410 1.00 33.30 ? 165  PHE B C   1 
ATOM   3092 O O   . PHE D 2 15  ? -23.416 -21.474 -10.917 1.00 32.17 ? 165  PHE B O   1 
ATOM   3093 C CB  . PHE D 2 15  ? -25.837 -23.473 -10.489 1.00 35.27 ? 165  PHE B CB  1 
ATOM   3094 C CG  . PHE D 2 15  ? -27.302 -23.264 -10.464 1.00 35.92 ? 165  PHE B CG  1 
ATOM   3095 C CD1 . PHE D 2 15  ? -28.168 -24.294 -10.855 1.00 37.27 ? 165  PHE B CD1 1 
ATOM   3096 C CD2 . PHE D 2 15  ? -27.831 -22.031 -10.056 1.00 34.92 ? 165  PHE B CD2 1 
ATOM   3097 C CE1 . PHE D 2 15  ? -29.584 -24.097 -10.868 1.00 37.78 ? 165  PHE B CE1 1 
ATOM   3098 C CE2 . PHE D 2 15  ? -29.234 -21.827 -10.055 1.00 31.66 ? 165  PHE B CE2 1 
ATOM   3099 C CZ  . PHE D 2 15  ? -30.092 -22.852 -10.465 1.00 37.06 ? 165  PHE B CZ  1 
ATOM   3100 N N   . ALA D 2 16  ? -22.777 -23.478 -11.696 1.00 33.04 ? 166  ALA B N   1 
ATOM   3101 C CA  . ALA D 2 16  ? -21.330 -23.191 -11.548 1.00 32.76 ? 166  ALA B CA  1 
ATOM   3102 C C   . ALA D 2 16  ? -20.942 -22.060 -12.466 1.00 31.88 ? 166  ALA B C   1 
ATOM   3103 O O   . ALA D 2 16  ? -20.153 -21.201 -12.089 1.00 31.79 ? 166  ALA B O   1 
ATOM   3104 C CB  . ALA D 2 16  ? -20.476 -24.406 -11.855 1.00 32.43 ? 166  ALA B CB  1 
ATOM   3105 N N   . MET D 2 17  ? -21.518 -22.057 -13.674 1.00 31.95 ? 167  MET B N   1 
ATOM   3106 C CA  . MET D 2 17  ? -21.209 -21.010 -14.653 1.00 31.70 ? 167  MET B CA  1 
ATOM   3107 C C   . MET D 2 17  ? -21.884 -19.686 -14.348 1.00 32.00 ? 167  MET B C   1 
ATOM   3108 O O   . MET D 2 17  ? -21.349 -18.618 -14.692 1.00 31.75 ? 167  MET B O   1 
ATOM   3109 C CB  . MET D 2 17  ? -21.449 -21.462 -16.092 1.00 32.35 ? 167  MET B CB  1 
ATOM   3110 C CG  . MET D 2 17  ? -20.499 -22.587 -16.495 1.00 31.87 ? 167  MET B CG  1 
ATOM   3111 S SD  . MET D 2 17  ? -18.757 -22.136 -16.357 1.00 34.18 ? 167  MET B SD  1 
ATOM   3112 C CE  . MET D 2 17  ? -18.140 -22.982 -14.897 1.00 32.95 ? 167  MET B CE  1 
ATOM   3113 N N   . LEU D 2 18  ? -23.045 -19.727 -13.692 1.00 32.19 ? 168  LEU B N   1 
ATOM   3114 C CA  . LEU D 2 18  ? -23.639 -18.487 -13.191 1.00 31.25 ? 168  LEU B CA  1 
ATOM   3115 C C   . LEU D 2 18  ? -22.721 -17.832 -12.188 1.00 31.45 ? 168  LEU B C   1 
ATOM   3116 O O   . LEU D 2 18  ? -22.612 -16.629 -12.186 1.00 30.25 ? 168  LEU B O   1 
ATOM   3117 C CB  . LEU D 2 18  ? -25.039 -18.676 -12.611 1.00 30.70 ? 168  LEU B CB  1 
ATOM   3118 C CG  . LEU D 2 18  ? -26.145 -19.023 -13.591 1.00 31.44 ? 168  LEU B CG  1 
ATOM   3119 C CD1 . LEU D 2 18  ? -27.467 -19.268 -12.800 1.00 34.93 ? 168  LEU B CD1 1 
ATOM   3120 C CD2 . LEU D 2 18  ? -26.313 -17.875 -14.589 1.00 30.13 ? 168  LEU B CD2 1 
ATOM   3121 N N   . CYS D 2 19  ? -22.088 -18.618 -11.325 1.00 33.15 ? 169  CYS B N   1 
ATOM   3122 C CA  . CYS D 2 19  ? -21.081 -18.081 -10.403 1.00 33.81 ? 169  CYS B CA  1 
ATOM   3123 C C   . CYS D 2 19  ? -19.892 -17.494 -11.160 1.00 32.76 ? 169  CYS B C   1 
ATOM   3124 O O   . CYS D 2 19  ? -19.377 -16.442 -10.803 1.00 33.63 ? 169  CYS B O   1 
ATOM   3125 C CB  . CYS D 2 19  ? -20.639 -19.165 -9.397  1.00 34.65 ? 169  CYS B CB  1 
ATOM   3126 S SG  . CYS D 2 19  ? -19.375 -18.684 -8.215  1.00 41.29 ? 169  CYS B SG  1 
ATOM   3127 N N   . THR D 2 20  ? -19.419 -18.190 -12.182 1.00 32.46 ? 170  THR B N   1 
ATOM   3128 C CA  . THR D 2 20  ? -18.269 -17.703 -12.971 1.00 31.52 ? 170  THR B CA  1 
ATOM   3129 C C   . THR D 2 20  ? -18.554 -16.357 -13.649 1.00 31.43 ? 170  THR B C   1 
ATOM   3130 O O   . THR D 2 20  ? -17.673 -15.465 -13.713 1.00 30.48 ? 170  THR B O   1 
ATOM   3131 C CB  . THR D 2 20  ? -17.853 -18.737 -14.025 1.00 32.66 ? 170  THR B CB  1 
ATOM   3132 O OG1 . THR D 2 20  ? -17.402 -19.922 -13.357 1.00 34.87 ? 170  THR B OG1 1 
ATOM   3133 C CG2 . THR D 2 20  ? -16.702 -18.168 -14.899 1.00 31.92 ? 170  THR B CG2 1 
ATOM   3134 N N   . LEU D 2 21  ? -19.779 -16.218 -14.161 1.00 29.86 ? 171  LEU B N   1 
ATOM   3135 C CA  . LEU D 2 21  ? -20.248 -14.979 -14.772 1.00 32.07 ? 171  LEU B CA  1 
ATOM   3136 C C   . LEU D 2 21  ? -20.291 -13.794 -13.782 1.00 32.56 ? 171  LEU B C   1 
ATOM   3137 O O   . LEU D 2 21  ? -20.229 -12.661 -14.193 1.00 31.90 ? 171  LEU B O   1 
ATOM   3138 C CB  . LEU D 2 21  ? -21.618 -15.193 -15.426 1.00 32.21 ? 171  LEU B CB  1 
ATOM   3139 C CG  . LEU D 2 21  ? -21.611 -15.629 -16.884 1.00 35.07 ? 171  LEU B CG  1 
ATOM   3140 C CD1 . LEU D 2 21  ? -23.008 -16.119 -17.330 1.00 36.77 ? 171  LEU B CD1 1 
ATOM   3141 C CD2 . LEU D 2 21  ? -21.119 -14.488 -17.790 1.00 35.37 ? 171  LEU B CD2 1 
ATOM   3142 N N   . ASN D 2 22  ? -20.410 -14.070 -12.489 1.00 32.41 ? 172  ASN B N   1 
ATOM   3143 C CA  . ASN D 2 22  ? -20.481 -13.015 -11.480 1.00 33.29 ? 172  ASN B CA  1 
ATOM   3144 C C   . ASN D 2 22  ? -19.073 -12.760 -10.984 1.00 33.97 ? 172  ASN B C   1 
ATOM   3145 O O   . ASN D 2 22  ? -18.443 -13.650 -10.421 1.00 33.53 ? 172  ASN B O   1 
ATOM   3146 C CB  . ASN D 2 22  ? -21.370 -13.465 -10.315 1.00 33.39 ? 172  ASN B CB  1 
ATOM   3147 C CG  . ASN D 2 22  ? -21.616 -12.374 -9.301  1.00 35.12 ? 172  ASN B CG  1 
ATOM   3148 O OD1 . ASN D 2 22  ? -20.926 -12.283 -8.290  1.00 36.98 ? 172  ASN B OD1 1 
ATOM   3149 N ND2 . ASN D 2 22  ? -22.585 -11.527 -9.567  1.00 34.07 ? 172  ASN B ND2 1 
ATOM   3150 N N   . ASP D 2 23  ? -18.565 -11.562 -11.197 1.00 35.55 ? 173  ASP B N   1 
ATOM   3151 C CA  . ASP D 2 23  ? -17.178 -11.313 -10.813 1.00 37.24 ? 173  ASP B CA  1 
ATOM   3152 C C   . ASP D 2 23  ? -16.879 -11.645 -9.369  1.00 36.75 ? 173  ASP B C   1 
ATOM   3153 O O   . ASP D 2 23  ? -15.866 -12.297 -9.085  1.00 37.13 ? 173  ASP B O   1 
ATOM   3154 C CB  . ASP D 2 23  ? -16.748 -9.900  -11.098 1.00 37.92 ? 173  ASP B CB  1 
ATOM   3155 C CG  . ASP D 2 23  ? -15.294 -9.681  -10.744 1.00 43.08 ? 173  ASP B CG  1 
ATOM   3156 O OD1 . ASP D 2 23  ? -14.417 -9.972  -11.600 1.00 46.32 ? 173  ASP B OD1 1 
ATOM   3157 O OD2 . ASP D 2 23  ? -15.027 -9.238  -9.591  1.00 49.84 ? 173  ASP B OD2 1 
ATOM   3158 N N   . LYS D 2 24  ? -17.744 -11.220 -8.442  1.00 36.62 ? 174  LYS B N   1 
ATOM   3159 C CA  . LYS D 2 24  ? -17.496 -11.505 -7.019  1.00 36.28 ? 174  LYS B CA  1 
ATOM   3160 C C   . LYS D 2 24  ? -17.520 -12.996 -6.690  1.00 34.37 ? 174  LYS B C   1 
ATOM   3161 O O   . LYS D 2 24  ? -16.676 -13.486 -5.951  1.00 31.45 ? 174  LYS B O   1 
ATOM   3162 C CB  . LYS D 2 24  ? -18.483 -10.758 -6.119  1.00 36.68 ? 174  LYS B CB  1 
ATOM   3163 C CG  . LYS D 2 24  ? -18.343 -11.162 -4.650  1.00 40.22 ? 174  LYS B CG  1 
ATOM   3164 C CD  . LYS D 2 24  ? -19.398 -10.495 -3.720  1.00 41.94 ? 174  LYS B CD  1 
ATOM   3165 C CE  . LYS D 2 24  ? -19.991 -11.526 -2.717  1.00 41.69 ? 174  LYS B CE  1 
ATOM   3166 N NZ  . LYS D 2 24  ? -21.415 -11.080 -2.354  1.00 51.31 ? 174  LYS B NZ  1 
ATOM   3167 N N   . CYS D 2 25  ? -18.510 -13.732 -7.223  1.00 32.75 ? 175  CYS B N   1 
ATOM   3168 C CA  . CYS D 2 25  ? -18.607 -15.154 -6.968  1.00 32.77 ? 175  CYS B CA  1 
ATOM   3169 C C   . CYS D 2 25  ? -17.470 -15.944 -7.622  1.00 32.04 ? 175  CYS B C   1 
ATOM   3170 O O   . CYS D 2 25  ? -16.942 -16.896 -7.026  1.00 33.05 ? 175  CYS B O   1 
ATOM   3171 C CB  . CYS D 2 25  ? -19.962 -15.716 -7.466  1.00 32.08 ? 175  CYS B CB  1 
ATOM   3172 S SG  . CYS D 2 25  ? -20.295 -17.389 -6.868  1.00 36.82 ? 175  CYS B SG  1 
ATOM   3173 N N   . ASP D 2 26  ? -17.131 -15.573 -8.857  1.00 31.07 ? 176  ASP B N   1 
ATOM   3174 C CA  . ASP D 2 26  ? -16.069 -16.248 -9.581  1.00 31.54 ? 176  ASP B CA  1 
ATOM   3175 C C   . ASP D 2 26  ? -14.741 -16.169 -8.777  1.00 32.07 ? 176  ASP B C   1 
ATOM   3176 O O   . ASP D 2 26  ? -14.032 -17.155 -8.596  1.00 32.62 ? 176  ASP B O   1 
ATOM   3177 C CB  . ASP D 2 26  ? -15.948 -15.607 -10.947 1.00 33.35 ? 176  ASP B CB  1 
ATOM   3178 C CG  . ASP D 2 26  ? -14.735 -16.100 -11.736 1.00 35.02 ? 176  ASP B CG  1 
ATOM   3179 O OD1 . ASP D 2 26  ? -14.552 -17.327 -11.860 1.00 37.69 ? 176  ASP B OD1 1 
ATOM   3180 O OD2 . ASP D 2 26  ? -13.979 -15.242 -12.228 1.00 39.54 ? 176  ASP B OD2 1 
ATOM   3181 N N   . ARG D 2 27  ? -14.461 -15.009 -8.226  1.00 30.59 ? 177  ARG B N   1 
ATOM   3182 C CA  . ARG D 2 27  ? -13.248 -14.837 -7.424  1.00 31.98 ? 177  ARG B CA  1 
ATOM   3183 C C   . ARG D 2 27  ? -13.206 -15.682 -6.147  1.00 31.33 ? 177  ARG B C   1 
ATOM   3184 O O   . ARG D 2 27  ? -12.161 -16.252 -5.788  1.00 31.53 ? 177  ARG B O   1 
ATOM   3185 C CB  . ARG D 2 27  ? -13.007 -13.348 -7.147  1.00 31.14 ? 177  ARG B CB  1 
ATOM   3186 C CG  . ARG D 2 27  ? -12.525 -12.625 -8.413  1.00 34.83 ? 177  ARG B CG  1 
ATOM   3187 C CD  . ARG D 2 27  ? -12.363 -11.096 -8.228  1.00 35.79 ? 177  ARG B CD  1 
ATOM   3188 N NE  . ARG D 2 27  ? -12.399 -10.380 -9.527  1.00 42.63 ? 177  ARG B NE  1 
ATOM   3189 C CZ  . ARG D 2 27  ? -11.982 -9.127  -9.717  1.00 47.66 ? 177  ARG B CZ  1 
ATOM   3190 N NH1 . ARG D 2 27  ? -11.493 -8.416  -8.695  1.00 49.10 ? 177  ARG B NH1 1 
ATOM   3191 N NH2 . ARG D 2 27  ? -12.057 -8.572  -10.929 1.00 48.71 ? 177  ARG B NH2 1 
ATOM   3192 N N   . LEU D 2 28  ? -14.326 -15.764 -5.454  1.00 31.17 ? 178  LEU B N   1 
ATOM   3193 C CA  . LEU D 2 28  ? -14.440 -16.645 -4.266  1.00 32.19 ? 178  LEU B CA  1 
ATOM   3194 C C   . LEU D 2 28  ? -14.398 -18.150 -4.577  1.00 31.83 ? 178  LEU B C   1 
ATOM   3195 O O   . LEU D 2 28  ? -13.794 -18.915 -3.827  1.00 31.92 ? 178  LEU B O   1 
ATOM   3196 C CB  . LEU D 2 28  ? -15.710 -16.319 -3.466  1.00 32.01 ? 178  LEU B CB  1 
ATOM   3197 C CG  . LEU D 2 28  ? -15.821 -14.941 -2.835  1.00 34.01 ? 178  LEU B CG  1 
ATOM   3198 C CD1 . LEU D 2 28  ? -17.320 -14.667 -2.582  1.00 32.51 ? 178  LEU B CD1 1 
ATOM   3199 C CD2 . LEU D 2 28  ? -15.019 -14.902 -1.570  1.00 34.81 ? 178  LEU B CD2 1 
ATOM   3200 N N   . ARG D 2 29  ? -15.003 -18.560 -5.696  1.00 32.30 ? 179  ARG B N   1 
ATOM   3201 C CA  . ARG D 2 29  ? -14.969 -19.960 -6.111  1.00 33.15 ? 179  ARG B CA  1 
ATOM   3202 C C   . ARG D 2 29  ? -13.553 -20.383 -6.577  1.00 33.58 ? 179  ARG B C   1 
ATOM   3203 O O   . ARG D 2 29  ? -13.080 -21.472 -6.225  1.00 33.38 ? 179  ARG B O   1 
ATOM   3204 C CB  . ARG D 2 29  ? -16.019 -20.206 -7.209  1.00 32.45 ? 179  ARG B CB  1 
ATOM   3205 C CG  . ARG D 2 29  ? -16.025 -21.603 -7.773  1.00 35.16 ? 179  ARG B CG  1 
ATOM   3206 C CD  . ARG D 2 29  ? -17.110 -21.810 -8.846  1.00 33.94 ? 179  ARG B CD  1 
ATOM   3207 N NE  . ARG D 2 29  ? -17.048 -23.163 -9.443  1.00 38.14 ? 179  ARG B NE  1 
ATOM   3208 C CZ  . ARG D 2 29  ? -16.433 -23.479 -10.579 1.00 39.46 ? 179  ARG B CZ  1 
ATOM   3209 N NH1 . ARG D 2 29  ? -15.822 -22.565 -11.302 1.00 45.06 ? 179  ARG B NH1 1 
ATOM   3210 N NH2 . ARG D 2 29  ? -16.433 -24.731 -11.012 1.00 44.96 ? 179  ARG B NH2 1 
ATOM   3211 N N   . LYS D 2 30  ? -12.879 -19.514 -7.344  1.00 34.20 ? 180  LYS B N   1 
ATOM   3212 C CA  . LYS D 2 30  ? -11.545 -19.811 -7.845  1.00 35.11 ? 180  LYS B CA  1 
ATOM   3213 C C   . LYS D 2 30  ? -10.637 -19.973 -6.677  1.00 33.72 ? 180  LYS B C   1 
ATOM   3214 O O   . LYS D 2 30  ? -9.702  -20.774 -6.725  1.00 33.10 ? 180  LYS B O   1 
ATOM   3215 C CB  . LYS D 2 30  ? -10.958 -18.627 -8.626  1.00 36.47 ? 180  LYS B CB  1 
ATOM   3216 C CG  . LYS D 2 30  ? -11.178 -18.667 -10.080 1.00 40.72 ? 180  LYS B CG  1 
ATOM   3217 C CD  . LYS D 2 30  ? -10.466 -17.416 -10.692 1.00 45.06 ? 180  LYS B CD  1 
ATOM   3218 C CE  . LYS D 2 30  ? -11.480 -16.262 -10.914 1.00 48.13 ? 180  LYS B CE  1 
ATOM   3219 N NZ  . LYS D 2 30  ? -11.244 -15.476 -12.169 1.00 49.82 ? 180  LYS B NZ  1 
ATOM   3220 N N   . ALA D 2 31  ? -10.861 -19.154 -5.653  1.00 32.39 ? 181  ALA B N   1 
ATOM   3221 C CA  . ALA D 2 31  ? -9.973  -19.162 -4.499  1.00 33.08 ? 181  ALA B CA  1 
ATOM   3222 C C   . ALA D 2 31  ? -10.002 -20.480 -3.755  1.00 32.62 ? 181  ALA B C   1 
ATOM   3223 O O   . ALA D 2 31  ? -8.945  -21.010 -3.444  1.00 32.48 ? 181  ALA B O   1 
ATOM   3224 C CB  . ALA D 2 31  ? -10.257 -18.028 -3.566  1.00 32.60 ? 181  ALA B CB  1 
ATOM   3225 N N   . TYR D 2 32  ? -11.181 -21.027 -3.473  1.00 32.46 ? 182  TYR B N   1 
ATOM   3226 C CA  . TYR D 2 32  ? -11.191 -22.335 -2.825  1.00 32.79 ? 182  TYR B CA  1 
ATOM   3227 C C   . TYR D 2 32  ? -10.773 -23.436 -3.800  1.00 32.81 ? 182  TYR B C   1 
ATOM   3228 O O   . TYR D 2 32  ? -10.050 -24.348 -3.414  1.00 32.93 ? 182  TYR B O   1 
ATOM   3229 C CB  . TYR D 2 32  ? -12.512 -22.639 -2.087  1.00 32.92 ? 182  TYR B CB  1 
ATOM   3230 C CG  . TYR D 2 32  ? -13.658 -23.280 -2.897  1.00 32.88 ? 182  TYR B CG  1 
ATOM   3231 C CD1 . TYR D 2 32  ? -14.786 -22.561 -3.209  1.00 33.20 ? 182  TYR B CD1 1 
ATOM   3232 C CD2 . TYR D 2 32  ? -13.601 -24.614 -3.294  1.00 31.43 ? 182  TYR B CD2 1 
ATOM   3233 C CE1 . TYR D 2 32  ? -15.843 -23.152 -3.920  1.00 30.74 ? 182  TYR B CE1 1 
ATOM   3234 C CE2 . TYR D 2 32  ? -14.628 -25.227 -3.970  1.00 31.44 ? 182  TYR B CE2 1 
ATOM   3235 C CZ  . TYR D 2 32  ? -15.752 -24.486 -4.303  1.00 32.21 ? 182  TYR B CZ  1 
ATOM   3236 O OH  . TYR D 2 32  ? -16.774 -25.099 -4.985  1.00 32.27 ? 182  TYR B OH  1 
ATOM   3237 N N   . GLY D 2 33  ? -11.197 -23.327 -5.060  1.00 32.78 ? 183  GLY B N   1 
ATOM   3238 C CA  . GLY D 2 33  ? -10.781 -24.277 -6.098  1.00 33.27 ? 183  GLY B CA  1 
ATOM   3239 C C   . GLY D 2 33  ? -9.267  -24.440 -6.096  1.00 34.66 ? 183  GLY B C   1 
ATOM   3240 O O   . GLY D 2 33  ? -8.735  -25.557 -6.118  1.00 35.91 ? 183  GLY B O   1 
ATOM   3241 N N   . GLU D 2 34  ? -8.554  -23.313 -6.099  1.00 34.14 ? 184  GLU B N   1 
ATOM   3242 C CA  . GLU D 2 34  ? -7.101  -23.325 -6.037  1.00 35.09 ? 184  GLU B CA  1 
ATOM   3243 C C   . GLU D 2 34  ? -6.578  -23.956 -4.709  1.00 34.28 ? 184  GLU B C   1 
ATOM   3244 O O   . GLU D 2 34  ? -5.663  -24.786 -4.730  1.00 34.88 ? 184  GLU B O   1 
ATOM   3245 C CB  . GLU D 2 34  ? -6.557  -21.895 -6.254  1.00 34.53 ? 184  GLU B CB  1 
ATOM   3246 C CG  . GLU D 2 34  ? -5.095  -21.781 -6.029  1.00 36.59 ? 184  GLU B CG  1 
ATOM   3247 C CD  . GLU D 2 34  ? -4.501  -20.453 -6.476  1.00 37.77 ? 184  GLU B CD  1 
ATOM   3248 O OE1 . GLU D 2 34  ? -5.266  -19.494 -6.712  1.00 43.26 ? 184  GLU B OE1 1 
ATOM   3249 O OE2 . GLU D 2 34  ? -3.265  -20.381 -6.577  1.00 41.91 ? 184  GLU B OE2 1 
ATOM   3250 N N   . ALA D 2 35  ? -7.174  -23.583 -3.579  1.00 33.80 ? 185  ALA B N   1 
ATOM   3251 C CA  . ALA D 2 35  ? -6.724  -24.051 -2.259  1.00 34.12 ? 185  ALA B CA  1 
ATOM   3252 C C   . ALA D 2 35  ? -7.011  -25.537 -2.042  1.00 35.47 ? 185  ALA B C   1 
ATOM   3253 O O   . ALA D 2 35  ? -6.330  -26.211 -1.252  1.00 34.90 ? 185  ALA B O   1 
ATOM   3254 C CB  . ALA D 2 35  ? -7.406  -23.249 -1.177  1.00 34.43 ? 185  ALA B CB  1 
ATOM   3255 N N   . CYS D 2 36  ? -8.018  -26.038 -2.752  1.00 36.00 ? 186  CYS B N   1 
ATOM   3256 C CA  . CYS D 2 36  ? -8.491  -27.426 -2.625  1.00 36.85 ? 186  CYS B CA  1 
ATOM   3257 C C   . CYS D 2 36  ? -8.063  -28.347 -3.764  1.00 37.50 ? 186  CYS B C   1 
ATOM   3258 O O   . CYS D 2 36  ? -8.509  -29.473 -3.808  1.00 37.89 ? 186  CYS B O   1 
ATOM   3259 C CB  . CYS D 2 36  ? -10.016 -27.464 -2.497  1.00 36.08 ? 186  CYS B CB  1 
ATOM   3260 S SG  . CYS D 2 36  ? -10.655 -26.485 -1.185  1.00 35.89 ? 186  CYS B SG  1 
ATOM   3261 N N   . SER D 2 37  ? -7.198  -27.873 -4.664  1.00 38.40 ? 187  SER B N   1 
ATOM   3262 C CA  . SER D 2 37  ? -6.748  -28.664 -5.822  1.00 40.70 ? 187  SER B CA  1 
ATOM   3263 C C   . SER D 2 37  ? -5.526  -29.558 -5.586  1.00 42.17 ? 187  SER B C   1 
ATOM   3264 O O   . SER D 2 37  ? -4.734  -29.366 -4.663  1.00 42.05 ? 187  SER B O   1 
ATOM   3265 C CB  . SER D 2 37  ? -6.400  -27.763 -7.011  1.00 40.01 ? 187  SER B CB  1 
ATOM   3266 O OG  . SER D 2 37  ? -7.565  -27.208 -7.581  1.00 42.21 ? 187  SER B OG  1 
ATOM   3267 N N   . GLY D 2 38  ? -5.371  -30.511 -6.489  1.00 44.70 ? 188  GLY B N   1 
ATOM   3268 C CA  . GLY D 2 38  ? -4.105  -31.226 -6.646  1.00 46.62 ? 188  GLY B CA  1 
ATOM   3269 C C   . GLY D 2 38  ? -4.016  -32.314 -5.604  1.00 48.41 ? 188  GLY B C   1 
ATOM   3270 O O   . GLY D 2 38  ? -4.829  -32.345 -4.663  1.00 48.80 ? 188  GLY B O   1 
ATOM   3271 N N   . PRO D 2 39  ? -3.052  -33.231 -5.775  1.00 49.58 ? 189  PRO B N   1 
ATOM   3272 C CA  . PRO D 2 39  ? -2.807  -34.237 -4.748  1.00 50.61 ? 189  PRO B CA  1 
ATOM   3273 C C   . PRO D 2 39  ? -2.036  -33.625 -3.571  1.00 51.50 ? 189  PRO B C   1 
ATOM   3274 O O   . PRO D 2 39  ? -2.106  -34.137 -2.449  1.00 52.55 ? 189  PRO B O   1 
ATOM   3275 C CB  . PRO D 2 39  ? -1.955  -35.278 -5.479  1.00 50.35 ? 189  PRO B CB  1 
ATOM   3276 C CG  . PRO D 2 39  ? -1.233  -34.489 -6.556  1.00 50.40 ? 189  PRO B CG  1 
ATOM   3277 C CD  . PRO D 2 39  ? -2.152  -33.361 -6.938  1.00 49.75 ? 189  PRO B CD  1 
ATOM   3278 N N   . HIS D 2 40  ? -1.322  -32.529 -3.835  1.00 51.80 ? 190  HIS B N   1 
ATOM   3279 C CA  . HIS D 2 40  ? -0.521  -31.824 -2.833  1.00 52.13 ? 190  HIS B CA  1 
ATOM   3280 C C   . HIS D 2 40  ? -1.364  -31.052 -1.806  1.00 51.38 ? 190  HIS B C   1 
ATOM   3281 O O   . HIS D 2 40  ? -0.828  -30.221 -1.063  1.00 51.35 ? 190  HIS B O   1 
ATOM   3282 C CB  . HIS D 2 40  ? 0.461   -30.863 -3.529  1.00 52.91 ? 190  HIS B CB  1 
ATOM   3283 C CG  . HIS D 2 40  ? 0.033   -30.425 -4.907  1.00 55.79 ? 190  HIS B CG  1 
ATOM   3284 N ND1 . HIS D 2 40  ? 0.724   -30.778 -6.052  1.00 59.06 ? 190  HIS B ND1 1 
ATOM   3285 C CD2 . HIS D 2 40  ? -1.004  -29.653 -5.320  1.00 58.32 ? 190  HIS B CD2 1 
ATOM   3286 C CE1 . HIS D 2 40  ? 0.124   -30.253 -7.109  1.00 59.50 ? 190  HIS B CE1 1 
ATOM   3287 N NE2 . HIS D 2 40  ? -0.926  -29.564 -6.692  1.00 59.06 ? 190  HIS B NE2 1 
ATOM   3288 N N   . CYS D 2 41  ? -2.665  -31.353 -1.738  1.00 50.47 ? 191  CYS B N   1 
ATOM   3289 C CA  . CYS D 2 41  ? -3.614  -30.510 -1.008  1.00 50.22 ? 191  CYS B CA  1 
ATOM   3290 C C   . CYS D 2 41  ? -3.307  -30.210 0.456   1.00 48.53 ? 191  CYS B C   1 
ATOM   3291 O O   . CYS D 2 41  ? -2.900  -31.121 1.200   1.00 49.33 ? 191  CYS B O   1 
ATOM   3292 C CB  . CYS D 2 41  ? -5.044  -31.038 -1.100  1.00 50.04 ? 191  CYS B CB  1 
ATOM   3293 S SG  . CYS D 2 41  ? -6.018  -29.591 -0.971  1.00 58.17 ? 191  CYS B SG  1 
ATOM   3294 N N   . GLN D 2 42  ? -3.537  -28.938 0.862   1.00 46.84 ? 192  GLN B N   1 
ATOM   3295 C CA  . GLN D 2 42  ? -3.359  -28.568 2.264   1.00 45.41 ? 192  GLN B CA  1 
ATOM   3296 C C   . GLN D 2 42  ? -4.685  -28.379 2.865   1.00 44.48 ? 192  GLN B C   1 
ATOM   3297 O O   . GLN D 2 42  ? -5.327  -27.343 2.632   1.00 42.82 ? 192  GLN B O   1 
ATOM   3298 C CB  . GLN D 2 42  ? -2.617  -27.267 2.407   1.00 46.12 ? 192  GLN B CB  1 
ATOM   3299 C CG  . GLN D 2 42  ? -1.143  -27.405 2.251   1.00 47.64 ? 192  GLN B CG  1 
ATOM   3300 C CD  . GLN D 2 42  ? -0.433  -26.406 3.096   1.00 52.58 ? 192  GLN B CD  1 
ATOM   3301 O OE1 . GLN D 2 42  ? -0.115  -25.314 2.638   1.00 57.29 ? 192  GLN B OE1 1 
ATOM   3302 N NE2 . GLN D 2 42  ? -0.197  -26.752 4.360   1.00 54.90 ? 192  GLN B NE2 1 
ATOM   3303 N N   . ARG D 2 43  ? -5.093  -29.371 3.647   1.00 42.98 ? 193  ARG B N   1 
ATOM   3304 C CA  . ARG D 2 43  ? -6.462  -29.470 4.084   1.00 42.73 ? 193  ARG B CA  1 
ATOM   3305 C C   . ARG D 2 43  ? -6.938  -28.208 4.803   1.00 41.43 ? 193  ARG B C   1 
ATOM   3306 O O   . ARG D 2 43  ? -8.007  -27.682 4.473   1.00 40.70 ? 193  ARG B O   1 
ATOM   3307 C CB  . ARG D 2 43  ? -6.640  -30.693 4.967   1.00 43.28 ? 193  ARG B CB  1 
ATOM   3308 C CG  . ARG D 2 43  ? -8.073  -31.126 5.155   1.00 43.90 ? 193  ARG B CG  1 
ATOM   3309 C CD  . ARG D 2 43  ? -8.165  -32.454 5.885   1.00 46.57 ? 193  ARG B CD  1 
ATOM   3310 N NE  . ARG D 2 43  ? -8.511  -32.256 7.290   1.00 54.06 ? 193  ARG B NE  1 
ATOM   3311 C CZ  . ARG D 2 43  ? -7.746  -32.587 8.331   1.00 56.58 ? 193  ARG B CZ  1 
ATOM   3312 N NH1 . ARG D 2 43  ? -6.550  -33.176 8.176   1.00 59.02 ? 193  ARG B NH1 1 
ATOM   3313 N NH2 . ARG D 2 43  ? -8.196  -32.347 9.555   1.00 59.33 ? 193  ARG B NH2 1 
ATOM   3314 N N   . HIS D 2 44  ? -6.155  -27.727 5.761   1.00 39.90 ? 194  HIS B N   1 
ATOM   3315 C CA  . HIS D 2 44  ? -6.591  -26.621 6.595   1.00 39.37 ? 194  HIS B CA  1 
ATOM   3316 C C   . HIS D 2 44  ? -6.766  -25.335 5.795   1.00 38.13 ? 194  HIS B C   1 
ATOM   3317 O O   . HIS D 2 44  ? -7.631  -24.531 6.104   1.00 37.95 ? 194  HIS B O   1 
ATOM   3318 C CB  . HIS D 2 44  ? -5.665  -26.459 7.813   1.00 38.74 ? 194  HIS B CB  1 
ATOM   3319 C CG  . HIS D 2 44  ? -4.255  -26.092 7.463   1.00 39.77 ? 194  HIS B CG  1 
ATOM   3320 N ND1 . HIS D 2 44  ? -3.319  -27.023 7.039   1.00 36.93 ? 194  HIS B ND1 1 
ATOM   3321 C CD2 . HIS D 2 44  ? -3.616  -24.895 7.481   1.00 39.14 ? 194  HIS B CD2 1 
ATOM   3322 C CE1 . HIS D 2 44  ? -2.175  -26.408 6.799   1.00 38.70 ? 194  HIS B CE1 1 
ATOM   3323 N NE2 . HIS D 2 44  ? -2.328  -25.119 7.057   1.00 37.51 ? 194  HIS B NE2 1 
ATOM   3324 N N   . VAL D 2 45  ? -5.976  -25.185 4.730   1.00 36.52 ? 195  VAL B N   1 
ATOM   3325 C CA  . VAL D 2 45  ? -6.073  -24.046 3.824   1.00 35.70 ? 195  VAL B CA  1 
ATOM   3326 C C   . VAL D 2 45  ? -7.329  -24.156 2.931   1.00 35.14 ? 195  VAL B C   1 
ATOM   3327 O O   . VAL D 2 45  ? -8.066  -23.202 2.762   1.00 35.13 ? 195  VAL B O   1 
ATOM   3328 C CB  . VAL D 2 45  ? -4.790  -23.902 2.981   1.00 35.57 ? 195  VAL B CB  1 
ATOM   3329 C CG1 . VAL D 2 45  ? -4.911  -22.769 1.996   1.00 36.44 ? 195  VAL B CG1 1 
ATOM   3330 C CG2 . VAL D 2 45  ? -3.537  -23.692 3.912   1.00 33.83 ? 195  VAL B CG2 1 
ATOM   3331 N N   . CYS D 2 46  ? -7.587  -25.342 2.406   1.00 34.39 ? 196  CYS B N   1 
ATOM   3332 C CA  . CYS D 2 46  ? -8.826  -25.580 1.677   1.00 34.12 ? 196  CYS B CA  1 
ATOM   3333 C C   . CYS D 2 46  ? -10.073 -25.277 2.518   1.00 35.03 ? 196  CYS B C   1 
ATOM   3334 O O   . CYS D 2 46  ? -11.053 -24.630 2.026   1.00 32.97 ? 196  CYS B O   1 
ATOM   3335 C CB  . CYS D 2 46  ? -8.837  -27.016 1.205   1.00 35.03 ? 196  CYS B CB  1 
ATOM   3336 S SG  . CYS D 2 46  ? -10.357 -27.588 0.533   1.00 35.56 ? 196  CYS B SG  1 
ATOM   3337 N N   . LEU D 2 47  ? -10.056 -25.743 3.773   1.00 33.67 ? 197  LEU B N   1 
ATOM   3338 C CA  . LEU D 2 47  ? -11.223 -25.569 4.659   1.00 34.77 ? 197  LEU B CA  1 
ATOM   3339 C C   . LEU D 2 47  ? -11.480 -24.101 4.950   1.00 34.83 ? 197  LEU B C   1 
ATOM   3340 O O   . LEU D 2 47  ? -12.626 -23.655 4.924   1.00 34.64 ? 197  LEU B O   1 
ATOM   3341 C CB  . LEU D 2 47  ? -11.035 -26.330 5.999   1.00 34.00 ? 197  LEU B CB  1 
ATOM   3342 C CG  . LEU D 2 47  ? -11.085 -27.868 5.948   1.00 34.87 ? 197  LEU B CG  1 
ATOM   3343 C CD1 . LEU D 2 47  ? -10.685 -28.496 7.286   1.00 34.98 ? 197  LEU B CD1 1 
ATOM   3344 C CD2 . LEU D 2 47  ? -12.446 -28.373 5.544   1.00 37.34 ? 197  LEU B CD2 1 
ATOM   3345 N N   . ARG D 2 48  ? -10.405 -23.359 5.225   1.00 34.62 ? 198  ARG B N   1 
ATOM   3346 C CA  . ARG D 2 48  ? -10.497 -21.914 5.373   1.00 34.70 ? 198  ARG B CA  1 
ATOM   3347 C C   . ARG D 2 48  ? -11.140 -21.191 4.204   1.00 34.01 ? 198  ARG B C   1 
ATOM   3348 O O   . ARG D 2 48  ? -11.973 -20.293 4.427   1.00 33.01 ? 198  ARG B O   1 
ATOM   3349 C CB  . ARG D 2 48  ? -9.132  -21.307 5.690   1.00 36.10 ? 198  ARG B CB  1 
ATOM   3350 C CG  . ARG D 2 48  ? -9.304  -20.117 6.565   1.00 41.80 ? 198  ARG B CG  1 
ATOM   3351 C CD  . ARG D 2 48  ? -10.280 -20.515 7.696   1.00 49.33 ? 198  ARG B CD  1 
ATOM   3352 N NE  . ARG D 2 48  ? -10.721 -19.388 8.513   1.00 53.68 ? 198  ARG B NE  1 
ATOM   3353 C CZ  . ARG D 2 48  ? -11.632 -18.492 8.121   1.00 53.35 ? 198  ARG B CZ  1 
ATOM   3354 N NH1 . ARG D 2 48  ? -12.144 -18.547 6.918   1.00 47.56 ? 198  ARG B NH1 1 
ATOM   3355 N NH2 . ARG D 2 48  ? -11.967 -17.497 8.927   1.00 54.93 ? 198  ARG B NH2 1 
ATOM   3356 N N   . GLN D 2 49  ? -10.787 -21.608 2.985   1.00 32.08 ? 199  GLN B N   1 
ATOM   3357 C CA  . GLN D 2 49  ? -11.316 -21.016 1.756   1.00 33.22 ? 199  GLN B CA  1 
ATOM   3358 C C   . GLN D 2 49  ? -12.764 -21.394 1.492   1.00 32.30 ? 199  GLN B C   1 
ATOM   3359 O O   . GLN D 2 49  ? -13.531 -20.620 0.883   1.00 33.26 ? 199  GLN B O   1 
ATOM   3360 C CB  . GLN D 2 49  ? -10.447 -21.390 0.539   1.00 32.95 ? 199  GLN B CB  1 
ATOM   3361 C CG  . GLN D 2 49  ? -9.056  -20.696 0.584   1.00 37.29 ? 199  GLN B CG  1 
ATOM   3362 C CD  . GLN D 2 49  ? -9.203  -19.223 0.869   1.00 43.34 ? 199  GLN B CD  1 
ATOM   3363 O OE1 . GLN D 2 49  ? -9.757  -18.476 0.058   1.00 45.53 ? 199  GLN B OE1 1 
ATOM   3364 N NE2 . GLN D 2 49  ? -8.764  -18.808 2.051   1.00 46.20 ? 199  GLN B NE2 1 
ATOM   3365 N N   . LEU D 2 50  ? -13.155 -22.579 1.937   1.00 33.07 ? 200  LEU B N   1 
ATOM   3366 C CA  . LEU D 2 50  ? -14.563 -22.985 1.845   1.00 32.91 ? 200  LEU B CA  1 
ATOM   3367 C C   . LEU D 2 50  ? -15.423 -22.163 2.777   1.00 34.34 ? 200  LEU B C   1 
ATOM   3368 O O   . LEU D 2 50  ? -16.502 -21.740 2.387   1.00 32.47 ? 200  LEU B O   1 
ATOM   3369 C CB  . LEU D 2 50  ? -14.749 -24.474 2.122   1.00 33.38 ? 200  LEU B CB  1 
ATOM   3370 C CG  . LEU D 2 50  ? -14.331 -25.383 0.962   1.00 33.63 ? 200  LEU B CG  1 
ATOM   3371 C CD1 . LEU D 2 50  ? -14.105 -26.807 1.464   1.00 30.65 ? 200  LEU B CD1 1 
ATOM   3372 C CD2 . LEU D 2 50  ? -15.344 -25.370 -0.188  1.00 33.83 ? 200  LEU B CD2 1 
ATOM   3373 N N   . LEU D 2 51  ? -14.950 -21.975 4.009   1.00 33.20 ? 201  LEU B N   1 
ATOM   3374 C CA  . LEU D 2 51  ? -15.657 -21.172 4.998   1.00 34.33 ? 201  LEU B CA  1 
ATOM   3375 C C   . LEU D 2 51  ? -15.855 -19.789 4.435   1.00 34.19 ? 201  LEU B C   1 
ATOM   3376 O O   . LEU D 2 51  ? -16.961 -19.253 4.474   1.00 34.66 ? 201  LEU B O   1 
ATOM   3377 C CB  . LEU D 2 51  ? -14.853 -21.050 6.304   1.00 34.37 ? 201  LEU B CB  1 
ATOM   3378 C CG  . LEU D 2 51  ? -14.906 -22.220 7.287   1.00 37.53 ? 201  LEU B CG  1 
ATOM   3379 C CD1 . LEU D 2 51  ? -13.902 -22.045 8.439   1.00 40.12 ? 201  LEU B CD1 1 
ATOM   3380 C CD2 . LEU D 2 51  ? -16.283 -22.436 7.851   1.00 40.21 ? 201  LEU B CD2 1 
ATOM   3381 N N   . THR D 2 52  ? -14.776 -19.232 3.891   1.00 33.26 ? 202  THR B N   1 
ATOM   3382 C CA  . THR D 2 52  ? -14.836 -17.924 3.241   1.00 32.52 ? 202  THR B CA  1 
ATOM   3383 C C   . THR D 2 52  ? -15.824 -17.882 2.110   1.00 31.90 ? 202  THR B C   1 
ATOM   3384 O O   . THR D 2 52  ? -16.632 -16.953 2.047   1.00 32.05 ? 202  THR B O   1 
ATOM   3385 C CB  . THR D 2 52  ? -13.445 -17.438 2.856   1.00 32.30 ? 202  THR B CB  1 
ATOM   3386 O OG1 . THR D 2 52  ? -12.728 -17.314 4.065   1.00 31.29 ? 202  THR B OG1 1 
ATOM   3387 C CG2 . THR D 2 52  ? -13.493 -16.026 2.201   1.00 33.69 ? 202  THR B CG2 1 
ATOM   3388 N N   . PHE D 2 53  ? -15.846 -18.906 1.266   1.00 31.87 ? 203  PHE B N   1 
ATOM   3389 C CA  . PHE D 2 53  ? -16.799 -18.927 0.181   1.00 32.76 ? 203  PHE B CA  1 
ATOM   3390 C C   . PHE D 2 53  ? -18.249 -18.782 0.670   1.00 34.39 ? 203  PHE B C   1 
ATOM   3391 O O   . PHE D 2 53  ? -18.981 -17.935 0.210   1.00 34.65 ? 203  PHE B O   1 
ATOM   3392 C CB  . PHE D 2 53  ? -16.666 -20.187 -0.685  1.00 31.55 ? 203  PHE B CB  1 
ATOM   3393 C CG  . PHE D 2 53  ? -17.641 -20.200 -1.831  1.00 33.86 ? 203  PHE B CG  1 
ATOM   3394 C CD1 . PHE D 2 53  ? -17.368 -19.507 -3.031  1.00 32.18 ? 203  PHE B CD1 1 
ATOM   3395 C CD2 . PHE D 2 53  ? -18.839 -20.867 -1.719  1.00 33.41 ? 203  PHE B CD2 1 
ATOM   3396 C CE1 . PHE D 2 53  ? -18.260 -19.520 -4.099  1.00 29.72 ? 203  PHE B CE1 1 
ATOM   3397 C CE2 . PHE D 2 53  ? -19.796 -20.844 -2.819  1.00 33.20 ? 203  PHE B CE2 1 
ATOM   3398 C CZ  . PHE D 2 53  ? -19.469 -20.151 -3.984  1.00 30.26 ? 203  PHE B CZ  1 
ATOM   3399 N N   . PHE D 2 54  ? -18.669 -19.629 1.602   1.00 34.13 ? 204  PHE B N   1 
ATOM   3400 C CA  . PHE D 2 54  ? -20.043 -19.642 2.028   1.00 35.00 ? 204  PHE B CA  1 
ATOM   3401 C C   . PHE D 2 54  ? -20.390 -18.421 2.856   1.00 35.92 ? 204  PHE B C   1 
ATOM   3402 O O   . PHE D 2 54  ? -21.544 -17.994 2.883   1.00 35.16 ? 204  PHE B O   1 
ATOM   3403 C CB  . PHE D 2 54  ? -20.382 -20.995 2.715   1.00 35.50 ? 204  PHE B CB  1 
ATOM   3404 C CG  . PHE D 2 54  ? -20.416 -22.136 1.743   1.00 35.17 ? 204  PHE B CG  1 
ATOM   3405 C CD1 . PHE D 2 54  ? -19.343 -23.011 1.617   1.00 36.55 ? 204  PHE B CD1 1 
ATOM   3406 C CD2 . PHE D 2 54  ? -21.469 -22.221 0.809   1.00 37.09 ? 204  PHE B CD2 1 
ATOM   3407 C CE1 . PHE D 2 54  ? -19.385 -24.011 0.603   1.00 35.32 ? 204  PHE B CE1 1 
ATOM   3408 C CE2 . PHE D 2 54  ? -21.492 -23.185 -0.166  1.00 36.35 ? 204  PHE B CE2 1 
ATOM   3409 C CZ  . PHE D 2 54  ? -20.457 -24.077 -0.263  1.00 39.50 ? 204  PHE B CZ  1 
ATOM   3410 N N   . GLU D 2 55  ? -19.392 -17.889 3.559   1.00 35.99 ? 205  GLU B N   1 
ATOM   3411 C CA  . GLU D 2 55  ? -19.519 -16.628 4.256   1.00 36.85 ? 205  GLU B CA  1 
ATOM   3412 C C   . GLU D 2 55  ? -19.751 -15.420 3.319   1.00 36.55 ? 205  GLU B C   1 
ATOM   3413 O O   . GLU D 2 55  ? -20.641 -14.550 3.557   1.00 36.75 ? 205  GLU B O   1 
ATOM   3414 C CB  . GLU D 2 55  ? -18.254 -16.420 5.052   1.00 38.26 ? 205  GLU B CB  1 
ATOM   3415 C CG  . GLU D 2 55  ? -18.456 -15.593 6.219   1.00 43.36 ? 205  GLU B CG  1 
ATOM   3416 C CD  . GLU D 2 55  ? -17.192 -15.494 7.013   1.00 49.65 ? 205  GLU B CD  1 
ATOM   3417 O OE1 . GLU D 2 55  ? -16.476 -16.557 7.146   1.00 47.88 ? 205  GLU B OE1 1 
ATOM   3418 O OE2 . GLU D 2 55  ? -16.924 -14.336 7.482   1.00 53.04 ? 205  GLU B OE2 1 
ATOM   3419 N N   . LYS D 2 56  ? -18.960 -15.346 2.263   1.00 33.52 ? 206  LYS B N   1 
ATOM   3420 C CA  . LYS D 2 56  ? -18.955 -14.154 1.460   1.00 32.81 ? 206  LYS B CA  1 
ATOM   3421 C C   . LYS D 2 56  ? -19.785 -14.200 0.198   1.00 32.65 ? 206  LYS B C   1 
ATOM   3422 O O   . LYS D 2 56  ? -20.225 -13.144 -0.243  1.00 33.15 ? 206  LYS B O   1 
ATOM   3423 C CB  . LYS D 2 56  ? -17.542 -13.719 1.163   1.00 34.87 ? 206  LYS B CB  1 
ATOM   3424 C CG  . LYS D 2 56  ? -16.822 -13.261 2.457   1.00 35.78 ? 206  LYS B CG  1 
ATOM   3425 C CD  . LYS D 2 56  ? -15.686 -12.336 2.166   1.00 42.14 ? 206  LYS B CD  1 
ATOM   3426 C CE  . LYS D 2 56  ? -14.969 -11.865 3.458   1.00 44.11 ? 206  LYS B CE  1 
ATOM   3427 N NZ  . LYS D 2 56  ? -15.718 -10.775 4.176   1.00 49.23 ? 206  LYS B NZ  1 
ATOM   3428 N N   . ALA D 2 57  ? -20.009 -15.375 -0.392  1.00 31.39 ? 207  ALA B N   1 
ATOM   3429 C CA  . ALA D 2 57  ? -20.762 -15.438 -1.673  1.00 32.40 ? 207  ALA B CA  1 
ATOM   3430 C C   . ALA D 2 57  ? -22.226 -15.144 -1.445  1.00 32.21 ? 207  ALA B C   1 
ATOM   3431 O O   . ALA D 2 57  ? -22.781 -15.458 -0.372  1.00 31.74 ? 207  ALA B O   1 
ATOM   3432 C CB  . ALA D 2 57  ? -20.661 -16.818 -2.326  1.00 32.15 ? 207  ALA B CB  1 
ATOM   3433 N N   . ALA D 2 58  ? -22.872 -14.600 -2.475  1.00 32.98 ? 208  ALA B N   1 
ATOM   3434 C CA  . ALA D 2 58  ? -24.302 -14.316 -2.407  1.00 33.16 ? 208  ALA B CA  1 
ATOM   3435 C C   . ALA D 2 58  ? -25.029 -15.618 -2.166  1.00 33.15 ? 208  ALA B C   1 
ATOM   3436 O O   . ALA D 2 58  ? -24.717 -16.608 -2.792  1.00 33.37 ? 208  ALA B O   1 
ATOM   3437 C CB  . ALA D 2 58  ? -24.774 -13.661 -3.746  1.00 31.88 ? 208  ALA B CB  1 
ATOM   3438 N N   . GLU D 2 59  ? -25.981 -15.648 -1.238  1.00 33.76 ? 209  GLU B N   1 
ATOM   3439 C CA  . GLU D 2 59  ? -26.669 -16.861 -0.926  1.00 34.62 ? 209  GLU B CA  1 
ATOM   3440 C C   . GLU D 2 59  ? -27.283 -17.575 -2.139  1.00 32.76 ? 209  GLU B C   1 
ATOM   3441 O O   . GLU D 2 59  ? -27.102 -18.796 -2.217  1.00 32.76 ? 209  GLU B O   1 
ATOM   3442 C CB  . GLU D 2 59  ? -27.735 -16.656 0.165   1.00 36.37 ? 209  GLU B CB  1 
ATOM   3443 C CG  . GLU D 2 59  ? -27.158 -16.424 1.570   1.00 39.73 ? 209  GLU B CG  1 
ATOM   3444 C CD  . GLU D 2 59  ? -28.294 -16.471 2.623   1.00 41.69 ? 209  GLU B CD  1 
ATOM   3445 O OE1 . GLU D 2 59  ? -28.555 -17.586 3.146   1.00 47.80 ? 209  GLU B OE1 1 
ATOM   3446 O OE2 . GLU D 2 59  ? -28.891 -15.395 2.911   1.00 48.02 ? 209  GLU B OE2 1 
ATOM   3447 N N   . PRO D 2 60  ? -27.977 -16.851 -3.070  1.00 30.57 ? 210  PRO B N   1 
ATOM   3448 C CA  . PRO D 2 60  ? -28.486 -17.567 -4.232  1.00 30.93 ? 210  PRO B CA  1 
ATOM   3449 C C   . PRO D 2 60  ? -27.385 -18.258 -5.058  1.00 31.31 ? 210  PRO B C   1 
ATOM   3450 O O   . PRO D 2 60  ? -27.643 -19.320 -5.603  1.00 30.31 ? 210  PRO B O   1 
ATOM   3451 C CB  . PRO D 2 60  ? -29.162 -16.466 -5.058  1.00 30.63 ? 210  PRO B CB  1 
ATOM   3452 C CG  . PRO D 2 60  ? -29.639 -15.488 -4.047  1.00 31.09 ? 210  PRO B CG  1 
ATOM   3453 C CD  . PRO D 2 60  ? -28.426 -15.446 -3.084  1.00 30.68 ? 210  PRO B CD  1 
ATOM   3454 N N   . HIS D 2 61  ? -26.164 -17.676 -5.140  1.00 31.45 ? 211  HIS B N   1 
ATOM   3455 C CA  . HIS D 2 61  ? -25.072 -18.302 -5.893  1.00 32.25 ? 211  HIS B CA  1 
ATOM   3456 C C   . HIS D 2 61  ? -24.476 -19.508 -5.227  1.00 33.96 ? 211  HIS B C   1 
ATOM   3457 O O   . HIS D 2 61  ? -24.287 -20.543 -5.868  1.00 34.06 ? 211  HIS B O   1 
ATOM   3458 C CB  . HIS D 2 61  ? -23.936 -17.284 -6.248  1.00 32.27 ? 211  HIS B CB  1 
ATOM   3459 C CG  . HIS D 2 61  ? -24.290 -16.388 -7.398  1.00 31.25 ? 211  HIS B CG  1 
ATOM   3460 N ND1 . HIS D 2 61  ? -24.039 -15.042 -7.393  1.00 36.24 ? 211  HIS B ND1 1 
ATOM   3461 C CD2 . HIS D 2 61  ? -24.914 -16.649 -8.561  1.00 34.97 ? 211  HIS B CD2 1 
ATOM   3462 C CE1 . HIS D 2 61  ? -24.472 -14.512 -8.520  1.00 35.67 ? 211  HIS B CE1 1 
ATOM   3463 N NE2 . HIS D 2 61  ? -25.030 -15.464 -9.244  1.00 33.31 ? 211  HIS B NE2 1 
ATOM   3464 N N   . ALA D 2 62  ? -24.219 -19.367 -3.937  1.00 32.90 ? 212  ALA B N   1 
ATOM   3465 C CA  . ALA D 2 62  ? -23.726 -20.459 -3.097  1.00 34.96 ? 212  ALA B CA  1 
ATOM   3466 C C   . ALA D 2 62  ? -24.729 -21.640 -3.052  1.00 34.71 ? 212  ALA B C   1 
ATOM   3467 O O   . ALA D 2 62  ? -24.361 -22.824 -3.226  1.00 34.28 ? 212  ALA B O   1 
ATOM   3468 C CB  . ALA D 2 62  ? -23.437 -19.879 -1.666  1.00 32.94 ? 212  ALA B CB  1 
ATOM   3469 N N   . GLN D 2 63  ? -26.030 -21.330 -2.899  1.00 34.13 ? 213  GLN B N   1 
ATOM   3470 C CA  . GLN D 2 63  ? -27.033 -22.397 -2.919  1.00 33.74 ? 213  GLN B CA  1 
ATOM   3471 C C   . GLN D 2 63  ? -27.218 -23.021 -4.251  1.00 34.18 ? 213  GLN B C   1 
ATOM   3472 O O   . GLN D 2 63  ? -27.415 -24.216 -4.343  1.00 33.21 ? 213  GLN B O   1 
ATOM   3473 C CB  . GLN D 2 63  ? -28.366 -21.905 -2.351  1.00 33.89 ? 213  GLN B CB  1 
ATOM   3474 C CG  . GLN D 2 63  ? -28.164 -21.662 -0.853  1.00 34.24 ? 213  GLN B CG  1 
ATOM   3475 C CD  . GLN D 2 63  ? -29.378 -21.146 -0.211  1.00 37.85 ? 213  GLN B CD  1 
ATOM   3476 O OE1 . GLN D 2 63  ? -30.436 -21.022 -0.842  1.00 37.80 ? 213  GLN B OE1 1 
ATOM   3477 N NE2 . GLN D 2 63  ? -29.263 -20.854 1.056   1.00 31.26 ? 213  GLN B NE2 1 
ATOM   3478 N N   . GLY D 2 64  ? -27.201 -22.210 -5.297  1.00 33.30 ? 214  GLY B N   1 
ATOM   3479 C CA  . GLY D 2 64  ? -27.268 -22.788 -6.685  1.00 35.26 ? 214  GLY B CA  1 
ATOM   3480 C C   . GLY D 2 64  ? -26.093 -23.713 -7.006  1.00 34.23 ? 214  GLY B C   1 
ATOM   3481 O O   . GLY D 2 64  ? -26.261 -24.738 -7.674  1.00 33.98 ? 214  GLY B O   1 
ATOM   3482 N N   . LEU D 2 65  ? -24.899 -23.316 -6.571  1.00 34.20 ? 215  LEU B N   1 
ATOM   3483 C CA  . LEU D 2 65  ? -23.666 -24.057 -6.813  1.00 35.22 ? 215  LEU B CA  1 
ATOM   3484 C C   . LEU D 2 65  ? -23.754 -25.449 -6.214  1.00 36.20 ? 215  LEU B C   1 
ATOM   3485 O O   . LEU D 2 65  ? -23.487 -26.456 -6.897  1.00 35.23 ? 215  LEU B O   1 
ATOM   3486 C CB  . LEU D 2 65  ? -22.441 -23.291 -6.227  1.00 36.48 ? 215  LEU B CB  1 
ATOM   3487 C CG  . LEU D 2 65  ? -21.093 -23.984 -6.415  1.00 38.00 ? 215  LEU B CG  1 
ATOM   3488 C CD1 . LEU D 2 65  ? -20.679 -24.006 -7.902  1.00 41.30 ? 215  LEU B CD1 1 
ATOM   3489 C CD2 . LEU D 2 65  ? -20.007 -23.353 -5.604  1.00 36.28 ? 215  LEU B CD2 1 
ATOM   3490 N N   . LEU D 2 66  ? -24.207 -25.520 -4.953  1.00 36.32 ? 216  LEU B N   1 
ATOM   3491 C CA  . LEU D 2 66  ? -24.178 -26.779 -4.230  1.00 37.03 ? 216  LEU B CA  1 
ATOM   3492 C C   . LEU D 2 66  ? -25.476 -27.546 -4.245  1.00 36.91 ? 216  LEU B C   1 
ATOM   3493 O O   . LEU D 2 66  ? -25.466 -28.788 -4.257  1.00 36.93 ? 216  LEU B O   1 
ATOM   3494 C CB  . LEU D 2 66  ? -23.756 -26.557 -2.788  1.00 38.68 ? 216  LEU B CB  1 
ATOM   3495 C CG  . LEU D 2 66  ? -23.278 -27.826 -2.096  1.00 41.77 ? 216  LEU B CG  1 
ATOM   3496 C CD1 . LEU D 2 66  ? -22.236 -28.652 -2.906  1.00 41.59 ? 216  LEU B CD1 1 
ATOM   3497 C CD2 . LEU D 2 66  ? -22.750 -27.372 -0.808  1.00 45.04 ? 216  LEU B CD2 1 
ATOM   3498 N N   . LEU D 2 67  ? -26.602 -26.823 -4.177  1.00 36.52 ? 217  LEU B N   1 
ATOM   3499 C CA  . LEU D 2 67  ? -27.896 -27.494 -4.048  1.00 36.94 ? 217  LEU B CA  1 
ATOM   3500 C C   . LEU D 2 67  ? -28.550 -27.577 -5.397  1.00 37.53 ? 217  LEU B C   1 
ATOM   3501 O O   . LEU D 2 67  ? -29.664 -27.131 -5.609  1.00 37.25 ? 217  LEU B O   1 
ATOM   3502 C CB  . LEU D 2 67  ? -28.755 -26.818 -2.977  1.00 37.21 ? 217  LEU B CB  1 
ATOM   3503 C CG  . LEU D 2 67  ? -28.034 -26.603 -1.601  1.00 37.63 ? 217  LEU B CG  1 
ATOM   3504 C CD1 . LEU D 2 67  ? -28.965 -25.845 -0.561  1.00 36.04 ? 217  LEU B CD1 1 
ATOM   3505 C CD2 . LEU D 2 67  ? -27.595 -27.956 -1.015  1.00 35.30 ? 217  LEU B CD2 1 
ATOM   3506 N N   . CYS D 2 68  ? -27.822 -28.167 -6.334  1.00 38.53 ? 218  CYS B N   1 
ATOM   3507 C CA  . CYS D 2 68  ? -28.269 -28.110 -7.713  1.00 37.43 ? 218  CYS B CA  1 
ATOM   3508 C C   . CYS D 2 68  ? -28.897 -29.466 -8.077  1.00 38.14 ? 218  CYS B C   1 
ATOM   3509 O O   . CYS D 2 68  ? -28.472 -30.516 -7.596  1.00 38.40 ? 218  CYS B O   1 
ATOM   3510 C CB  . CYS D 2 68  ? -27.078 -27.747 -8.624  1.00 37.25 ? 218  CYS B CB  1 
ATOM   3511 S SG  . CYS D 2 68  ? -25.588 -28.780 -8.373  1.00 40.14 ? 218  CYS B SG  1 
ATOM   3512 N N   . PRO D 2 69  ? -29.978 -29.435 -8.873  1.00 37.95 ? 219  PRO B N   1 
ATOM   3513 C CA  . PRO D 2 69  ? -30.733 -30.625 -9.196  1.00 37.12 ? 219  PRO B CA  1 
ATOM   3514 C C   . PRO D 2 69  ? -30.070 -31.420 -10.322 1.00 38.02 ? 219  PRO B C   1 
ATOM   3515 O O   . PRO D 2 69  ? -29.426 -30.808 -11.186 1.00 34.95 ? 219  PRO B O   1 
ATOM   3516 C CB  . PRO D 2 69  ? -32.083 -30.067 -9.632  1.00 37.80 ? 219  PRO B CB  1 
ATOM   3517 C CG  . PRO D 2 69  ? -31.808 -28.723 -10.136 1.00 37.53 ? 219  PRO B CG  1 
ATOM   3518 C CD  . PRO D 2 69  ? -30.581 -28.213 -9.406  1.00 37.95 ? 219  PRO B CD  1 
ATOM   3519 N N   . CYS D 2 70  ? -30.241 -32.755 -10.292 1.00 38.21 ? 220  CYS B N   1 
ATOM   3520 C CA  . CYS D 2 70  ? -29.679 -33.675 -11.283 1.00 39.98 ? 220  CYS B CA  1 
ATOM   3521 C C   . CYS D 2 70  ? -30.776 -34.664 -11.627 1.00 42.63 ? 220  CYS B C   1 
ATOM   3522 O O   . CYS D 2 70  ? -31.475 -35.158 -10.729 1.00 42.43 ? 220  CYS B O   1 
ATOM   3523 C CB  . CYS D 2 70  ? -28.474 -34.439 -10.715 1.00 39.49 ? 220  CYS B CB  1 
ATOM   3524 S SG  . CYS D 2 70  ? -27.041 -33.366 -10.343 1.00 39.97 ? 220  CYS B SG  1 
ATOM   3525 N N   . ALA D 2 71  ? -30.930 -34.905 -12.923 1.00 43.77 ? 221  ALA B N   1 
ATOM   3526 C CA  . ALA D 2 71  ? -31.844 -35.914 -13.476 1.00 46.88 ? 221  ALA B CA  1 
ATOM   3527 C C   . ALA D 2 71  ? -31.525 -37.284 -12.888 1.00 48.51 ? 221  ALA B C   1 
ATOM   3528 O O   . ALA D 2 71  ? -30.449 -37.460 -12.279 1.00 49.65 ? 221  ALA B O   1 
ATOM   3529 C CB  . ALA D 2 71  ? -31.727 -35.939 -14.999 1.00 46.51 ? 221  ALA B CB  1 
ATOM   3530 N N   . PRO D 2 72  ? -32.453 -38.259 -13.056 1.00 49.81 ? 222  PRO B N   1 
ATOM   3531 C CA  . PRO D 2 72  ? -32.319 -39.581 -12.438 1.00 49.81 ? 222  PRO B CA  1 
ATOM   3532 C C   . PRO D 2 72  ? -30.958 -40.230 -12.784 1.00 49.23 ? 222  PRO B C   1 
ATOM   3533 O O   . PRO D 2 72  ? -30.131 -40.517 -11.875 1.00 49.32 ? 222  PRO B O   1 
ATOM   3534 C CB  . PRO D 2 72  ? -33.481 -40.373 -13.060 1.00 50.23 ? 222  PRO B CB  1 
ATOM   3535 C CG  . PRO D 2 72  ? -33.852 -39.608 -14.346 1.00 50.33 ? 222  PRO B CG  1 
ATOM   3536 C CD  . PRO D 2 72  ? -33.681 -38.172 -13.862 1.00 49.68 ? 222  PRO B CD  1 
ATOM   3537 N N   . ASN D 2 73  ? -30.717 -40.390 -14.079 1.00 47.77 ? 223  ASN B N   1 
ATOM   3538 C CA  . ASN D 2 73  ? -29.541 -41.109 -14.566 1.00 47.18 ? 223  ASN B CA  1 
ATOM   3539 C C   . ASN D 2 73  ? -28.323 -40.241 -14.993 1.00 45.31 ? 223  ASN B C   1 
ATOM   3540 O O   . ASN D 2 73  ? -27.491 -40.655 -15.814 1.00 44.98 ? 223  ASN B O   1 
ATOM   3541 C CB  . ASN D 2 73  ? -29.997 -42.067 -15.658 1.00 47.86 ? 223  ASN B CB  1 
ATOM   3542 C CG  . ASN D 2 73  ? -31.068 -43.035 -15.157 1.00 49.90 ? 223  ASN B CG  1 
ATOM   3543 O OD1 . ASN D 2 73  ? -31.118 -43.349 -13.963 1.00 53.36 ? 223  ASN B OD1 1 
ATOM   3544 N ND2 . ASN D 2 73  ? -31.927 -43.502 -16.056 1.00 52.79 ? 223  ASN B ND2 1 
ATOM   3545 N N   . ASP D 2 74  ? -28.229 -39.042 -14.431 1.00 42.26 ? 224  ASP B N   1 
ATOM   3546 C CA  . ASP D 2 74  ? -27.150 -38.125 -14.802 1.00 40.54 ? 224  ASP B CA  1 
ATOM   3547 C C   . ASP D 2 74  ? -26.009 -38.229 -13.769 1.00 39.44 ? 224  ASP B C   1 
ATOM   3548 O O   . ASP D 2 74  ? -25.853 -37.356 -12.889 1.00 37.82 ? 224  ASP B O   1 
ATOM   3549 C CB  . ASP D 2 74  ? -27.692 -36.701 -14.955 1.00 40.05 ? 224  ASP B CB  1 
ATOM   3550 C CG  . ASP D 2 74  ? -26.731 -35.771 -15.680 1.00 40.37 ? 224  ASP B CG  1 
ATOM   3551 O OD1 . ASP D 2 74  ? -25.560 -36.148 -15.932 1.00 40.45 ? 224  ASP B OD1 1 
ATOM   3552 O OD2 . ASP D 2 74  ? -27.141 -34.627 -15.965 1.00 36.90 ? 224  ASP B OD2 1 
ATOM   3553 N N   . ARG D 2 75  ? -25.220 -39.306 -13.895 1.00 38.25 ? 225  ARG B N   1 
ATOM   3554 C CA  . ARG D 2 75  ? -24.073 -39.590 -13.012 1.00 38.19 ? 225  ARG B CA  1 
ATOM   3555 C C   . ARG D 2 75  ? -23.060 -38.437 -13.013 1.00 36.35 ? 225  ARG B C   1 
ATOM   3556 O O   . ARG D 2 75  ? -22.501 -38.112 -11.969 1.00 36.60 ? 225  ARG B O   1 
ATOM   3557 C CB  . ARG D 2 75  ? -23.374 -40.893 -13.416 1.00 39.91 ? 225  ARG B CB  1 
ATOM   3558 C CG  . ARG D 2 75  ? -23.492 -42.086 -12.445 1.00 44.60 ? 225  ARG B CG  1 
ATOM   3559 C CD  . ARG D 2 75  ? -24.821 -42.817 -12.570 1.00 51.11 ? 225  ARG B CD  1 
ATOM   3560 N NE  . ARG D 2 75  ? -24.801 -44.232 -12.140 1.00 55.45 ? 225  ARG B NE  1 
ATOM   3561 C CZ  . ARG D 2 75  ? -24.373 -44.680 -10.948 1.00 57.40 ? 225  ARG B CZ  1 
ATOM   3562 N NH1 . ARG D 2 75  ? -23.845 -43.847 -10.037 1.00 56.01 ? 225  ARG B NH1 1 
ATOM   3563 N NH2 . ARG D 2 75  ? -24.441 -45.980 -10.673 1.00 57.27 ? 225  ARG B NH2 1 
ATOM   3564 N N   . GLY D 2 76  ? -22.881 -37.793 -14.159 1.00 34.16 ? 226  GLY B N   1 
ATOM   3565 C CA  . GLY D 2 76  ? -21.941 -36.669 -14.306 1.00 34.76 ? 226  GLY B CA  1 
ATOM   3566 C C   . GLY D 2 76  ? -22.370 -35.440 -13.541 1.00 34.39 ? 226  GLY B C   1 
ATOM   3567 O O   . GLY D 2 76  ? -21.550 -34.778 -12.891 1.00 33.84 ? 226  GLY B O   1 
ATOM   3568 N N   . CYS D 2 77  ? -23.669 -35.141 -13.601 1.00 34.56 ? 227  CYS B N   1 
ATOM   3569 C CA  . CYS D 2 77  ? -24.249 -34.077 -12.775 1.00 34.46 ? 227  CYS B CA  1 
ATOM   3570 C C   . CYS D 2 77  ? -24.066 -34.360 -11.294 1.00 34.60 ? 227  CYS B C   1 
ATOM   3571 O O   . CYS D 2 77  ? -23.641 -33.484 -10.511 1.00 31.86 ? 227  CYS B O   1 
ATOM   3572 C CB  . CYS D 2 77  ? -25.728 -33.908 -13.104 1.00 35.57 ? 227  CYS B CB  1 
ATOM   3573 S SG  . CYS D 2 77  ? -26.494 -32.588 -12.208 1.00 36.33 ? 227  CYS B SG  1 
ATOM   3574 N N   . GLY D 2 78  ? -24.411 -35.579 -10.881 1.00 34.74 ? 228  GLY B N   1 
ATOM   3575 C CA  . GLY D 2 78  ? -24.250 -35.935 -9.459  1.00 34.28 ? 228  GLY B CA  1 
ATOM   3576 C C   . GLY D 2 78  ? -22.841 -35.998 -8.949  1.00 33.82 ? 228  GLY B C   1 
ATOM   3577 O O   . GLY D 2 78  ? -22.583 -35.659 -7.790  1.00 33.23 ? 228  GLY B O   1 
ATOM   3578 N N   . GLU D 2 79  ? -21.918 -36.446 -9.801  1.00 34.60 ? 229  GLU B N   1 
ATOM   3579 C CA  . GLU D 2 79  ? -20.503 -36.494 -9.458  1.00 35.64 ? 229  GLU B CA  1 
ATOM   3580 C C   . GLU D 2 79  ? -19.943 -35.083 -9.298  1.00 34.34 ? 229  GLU B C   1 
ATOM   3581 O O   . GLU D 2 79  ? -19.148 -34.823 -8.391  1.00 33.13 ? 229  GLU B O   1 
ATOM   3582 C CB  . GLU D 2 79  ? -19.730 -37.286 -10.536 1.00 35.67 ? 229  GLU B CB  1 
ATOM   3583 C CG  . GLU D 2 79  ? -18.263 -37.516 -10.206 1.00 38.02 ? 229  GLU B CG  1 
ATOM   3584 C CD  . GLU D 2 79  ? -17.515 -38.293 -11.296 1.00 40.85 ? 229  GLU B CD  1 
ATOM   3585 O OE1 . GLU D 2 79  ? -16.326 -38.624 -11.056 1.00 48.49 ? 229  GLU B OE1 1 
ATOM   3586 O OE2 . GLU D 2 79  ? -18.095 -38.610 -12.389 1.00 49.95 ? 229  GLU B OE2 1 
ATOM   3587 N N   . ARG D 2 80  ? -20.390 -34.163 -10.156 1.00 34.16 ? 230  ARG B N   1 
ATOM   3588 C CA  . ARG D 2 80  ? -20.018 -32.731 -10.064 1.00 34.38 ? 230  ARG B CA  1 
ATOM   3589 C C   . ARG D 2 80  ? -20.516 -32.125 -8.767  1.00 33.59 ? 230  ARG B C   1 
ATOM   3590 O O   . ARG D 2 80  ? -19.751 -31.509 -8.016  1.00 32.45 ? 230  ARG B O   1 
ATOM   3591 C CB  . ARG D 2 80  ? -20.585 -31.965 -11.266 1.00 35.11 ? 230  ARG B CB  1 
ATOM   3592 C CG  . ARG D 2 80  ? -20.646 -30.405 -11.099 1.00 35.10 ? 230  ARG B CG  1 
ATOM   3593 C CD  . ARG D 2 80  ? -20.694 -29.760 -12.491 1.00 38.60 ? 230  ARG B CD  1 
ATOM   3594 N NE  . ARG D 2 80  ? -20.086 -28.495 -12.301 1.00 51.75 ? 230  ARG B NE  1 
ATOM   3595 C CZ  . ARG D 2 80  ? -18.928 -28.074 -12.777 1.00 45.89 ? 230  ARG B CZ  1 
ATOM   3596 N NH1 . ARG D 2 80  ? -18.196 -28.737 -13.686 1.00 45.61 ? 230  ARG B NH1 1 
ATOM   3597 N NH2 . ARG D 2 80  ? -18.570 -26.899 -12.350 1.00 45.99 ? 230  ARG B NH2 1 
ATOM   3598 N N   . ARG D 2 81  ? -21.805 -32.340 -8.479  1.00 31.53 ? 231  ARG B N   1 
ATOM   3599 C CA  . ARG D 2 81  ? -22.419 -31.862 -7.229  1.00 30.65 ? 231  ARG B CA  1 
ATOM   3600 C C   . ARG D 2 81  ? -21.669 -32.415 -6.028  1.00 30.49 ? 231  ARG B C   1 
ATOM   3601 O O   . ARG D 2 81  ? -21.362 -31.667 -5.084  1.00 31.52 ? 231  ARG B O   1 
ATOM   3602 C CB  . ARG D 2 81  ? -23.887 -32.304 -7.132  1.00 31.59 ? 231  ARG B CB  1 
ATOM   3603 C CG  . ARG D 2 81  ? -24.628 -31.653 -5.918  1.00 32.78 ? 231  ARG B CG  1 
ATOM   3604 C CD  . ARG D 2 81  ? -26.147 -32.026 -6.007  1.00 31.48 ? 231  ARG B CD  1 
ATOM   3605 N NE  . ARG D 2 81  ? -26.305 -33.463 -6.058  1.00 32.34 ? 231  ARG B NE  1 
ATOM   3606 C CZ  . ARG D 2 81  ? -27.420 -34.076 -6.389  1.00 34.81 ? 231  ARG B CZ  1 
ATOM   3607 N NH1 . ARG D 2 81  ? -28.470 -33.378 -6.808  1.00 33.64 ? 231  ARG B NH1 1 
ATOM   3608 N NH2 . ARG D 2 81  ? -27.451 -35.392 -6.376  1.00 36.71 ? 231  ARG B NH2 1 
ATOM   3609 N N   . ARG D 2 82  ? -21.387 -33.705 -6.059  1.00 30.97 ? 232  ARG B N   1 
ATOM   3610 C CA  . ARG D 2 82  ? -20.687 -34.391 -4.970  1.00 32.50 ? 232  ARG B CA  1 
ATOM   3611 C C   . ARG D 2 82  ? -19.240 -33.898 -4.763  1.00 32.42 ? 232  ARG B C   1 
ATOM   3612 O O   . ARG D 2 82  ? -18.698 -34.032 -3.668  1.00 31.94 ? 232  ARG B O   1 
ATOM   3613 C CB  . ARG D 2 82  ? -20.616 -35.903 -5.267  1.00 33.93 ? 232  ARG B CB  1 
ATOM   3614 C CG  . ARG D 2 82  ? -20.277 -36.722 -4.012  1.00 35.13 ? 232  ARG B CG  1 
ATOM   3615 C CD  . ARG D 2 82  ? -20.357 -38.203 -4.221  1.00 40.41 ? 232  ARG B CD  1 
ATOM   3616 N NE  . ARG D 2 82  ? -19.393 -38.699 -5.207  1.00 49.31 ? 232  ARG B NE  1 
ATOM   3617 C CZ  . ARG D 2 82  ? -18.070 -38.730 -5.025  1.00 52.12 ? 232  ARG B CZ  1 
ATOM   3618 N NH1 . ARG D 2 82  ? -17.527 -38.315 -3.876  1.00 51.72 ? 232  ARG B NH1 1 
ATOM   3619 N NH2 . ARG D 2 82  ? -17.286 -39.183 -5.993  1.00 51.94 ? 232  ARG B NH2 1 
ATOM   3620 N N   . ASN D 2 83  ? -18.604 -33.413 -5.836  1.00 31.86 ? 233  ASN B N   1 
ATOM   3621 C CA  . ASN D 2 83  ? -17.208 -32.925 -5.723  1.00 32.93 ? 233  ASN B CA  1 
ATOM   3622 C C   . ASN D 2 83  ? -16.968 -31.430 -5.681  1.00 32.92 ? 233  ASN B C   1 
ATOM   3623 O O   . ASN D 2 83  ? -15.802 -30.952 -5.669  1.00 33.16 ? 233  ASN B O   1 
ATOM   3624 C CB  . ASN D 2 83  ? -16.358 -33.587 -6.807  1.00 33.31 ? 233  ASN B CB  1 
ATOM   3625 C CG  . ASN D 2 83  ? -16.066 -35.036 -6.453  1.00 38.25 ? 233  ASN B CG  1 
ATOM   3626 O OD1 . ASN D 2 83  ? -15.224 -35.332 -5.556  1.00 38.00 ? 233  ASN B OD1 1 
ATOM   3627 N ND2 . ASN D 2 83  ? -16.806 -35.943 -7.087  1.00 38.03 ? 233  ASN B ND2 1 
ATOM   3628 N N   . THR D 2 84  ? -18.052 -30.696 -5.685  1.00 31.77 ? 234  THR B N   1 
ATOM   3629 C CA  . THR D 2 84  ? -18.015 -29.254 -5.728  1.00 33.98 ? 234  THR B CA  1 
ATOM   3630 C C   . THR D 2 84  ? -17.195 -28.658 -4.580  1.00 35.09 ? 234  THR B C   1 
ATOM   3631 O O   . THR D 2 84  ? -16.403 -27.699 -4.808  1.00 34.52 ? 234  THR B O   1 
ATOM   3632 C CB  . THR D 2 84  ? -19.426 -28.692 -5.762  1.00 33.50 ? 234  THR B CB  1 
ATOM   3633 O OG1 . THR D 2 84  ? -19.978 -29.037 -7.041  1.00 37.19 ? 234  THR B OG1 1 
ATOM   3634 C CG2 . THR D 2 84  ? -19.357 -27.154 -5.630  1.00 34.03 ? 234  THR B CG2 1 
ATOM   3635 N N   . ILE D 2 85  ? -17.354 -29.240 -3.378  1.00 34.65 ? 235  ILE B N   1 
ATOM   3636 C CA  . ILE D 2 85  ? -16.549 -28.806 -2.217  1.00 36.31 ? 235  ILE B CA  1 
ATOM   3637 C C   . ILE D 2 85  ? -15.170 -29.450 -2.108  1.00 36.00 ? 235  ILE B C   1 
ATOM   3638 O O   . ILE D 2 85  ? -14.462 -29.276 -1.076  1.00 37.67 ? 235  ILE B O   1 
ATOM   3639 C CB  . ILE D 2 85  ? -17.265 -29.020 -0.864  1.00 36.58 ? 235  ILE B CB  1 
ATOM   3640 C CG1 . ILE D 2 85  ? -17.347 -30.502 -0.485  1.00 36.49 ? 235  ILE B CG1 1 
ATOM   3641 C CG2 . ILE D 2 85  ? -18.617 -28.299 -0.847  1.00 36.68 ? 235  ILE B CG2 1 
ATOM   3642 C CD1 . ILE D 2 85  ? -17.532 -30.768 1.007   1.00 38.33 ? 235  ILE B CD1 1 
ATOM   3643 N N   . ALA D 2 86  ? -14.755 -30.197 -3.129  1.00 35.13 ? 236  ALA B N   1 
ATOM   3644 C CA  . ALA D 2 86  ? -13.431 -30.830 -3.076  1.00 34.67 ? 236  ALA B CA  1 
ATOM   3645 C C   . ALA D 2 86  ? -13.262 -31.731 -1.819  1.00 34.58 ? 236  ALA B C   1 
ATOM   3646 O O   . ALA D 2 86  ? -12.299 -31.555 -1.035  1.00 35.20 ? 236  ALA B O   1 
ATOM   3647 C CB  . ALA D 2 86  ? -12.293 -29.758 -3.157  1.00 33.70 ? 236  ALA B CB  1 
ATOM   3648 N N   . PRO D 2 87  ? -14.164 -32.714 -1.637  1.00 34.72 ? 237  PRO B N   1 
ATOM   3649 C CA  . PRO D 2 87  ? -14.104 -33.561 -0.441  1.00 34.22 ? 237  PRO B CA  1 
ATOM   3650 C C   . PRO D 2 87  ? -12.836 -34.382 -0.319  1.00 35.40 ? 237  PRO B C   1 
ATOM   3651 O O   . PRO D 2 87  ? -12.442 -34.707 0.787   1.00 35.86 ? 237  PRO B O   1 
ATOM   3652 C CB  . PRO D 2 87  ? -15.330 -34.457 -0.585  1.00 34.13 ? 237  PRO B CB  1 
ATOM   3653 C CG  . PRO D 2 87  ? -15.575 -34.499 -2.141  1.00 34.30 ? 237  PRO B CG  1 
ATOM   3654 C CD  . PRO D 2 87  ? -15.309 -33.086 -2.506  1.00 33.90 ? 237  PRO B CD  1 
ATOM   3655 N N   . ASN D 2 88  ? -12.183 -34.722 -1.419  1.00 36.04 ? 238  ASN B N   1 
ATOM   3656 C CA  . ASN D 2 88  ? -10.893 -35.431 -1.294  1.00 38.35 ? 238  ASN B CA  1 
ATOM   3657 C C   . ASN D 2 88  ? -9.814  -34.618 -0.588  1.00 38.51 ? 238  ASN B C   1 
ATOM   3658 O O   . ASN D 2 88  ? -8.876  -35.188 0.024   1.00 38.89 ? 238  ASN B O   1 
ATOM   3659 C CB  . ASN D 2 88  ? -10.377 -35.931 -2.655  1.00 38.92 ? 238  ASN B CB  1 
ATOM   3660 C CG  . ASN D 2 88  ? -11.258 -37.015 -3.246  1.00 43.43 ? 238  ASN B CG  1 
ATOM   3661 O OD1 . ASN D 2 88  ? -12.142 -37.540 -2.571  1.00 49.25 ? 238  ASN B OD1 1 
ATOM   3662 N ND2 . ASN D 2 88  ? -11.030 -37.353 -4.506  1.00 47.26 ? 238  ASN B ND2 1 
ATOM   3663 N N   . CYS D 2 89  ? -9.907  -33.303 -0.703  1.00 38.70 ? 239  CYS B N   1 
ATOM   3664 C CA  . CYS D 2 89  ? -9.002  -32.428 0.018   1.00 38.68 ? 239  CYS B CA  1 
ATOM   3665 C C   . CYS D 2 89  ? -9.545  -31.998 1.380   1.00 38.58 ? 239  CYS B C   1 
ATOM   3666 O O   . CYS D 2 89  ? -8.799  -31.991 2.357   1.00 37.34 ? 239  CYS B O   1 
ATOM   3667 C CB  . CYS D 2 89  ? -8.625  -31.218 -0.827  1.00 39.75 ? 239  CYS B CB  1 
ATOM   3668 S SG  . CYS D 2 89  ? -7.696  -29.984 0.144   1.00 42.34 ? 239  CYS B SG  1 
ATOM   3669 N N   . ALA D 2 90  ? -10.828 -31.665 1.439   1.00 36.31 ? 240  ALA B N   1 
ATOM   3670 C CA  . ALA D 2 90  ? -11.481 -31.094 2.623   1.00 38.78 ? 240  ALA B CA  1 
ATOM   3671 C C   . ALA D 2 90  ? -11.740 -32.067 3.766   1.00 39.92 ? 240  ALA B C   1 
ATOM   3672 O O   . ALA D 2 90  ? -11.771 -31.677 4.955   1.00 39.49 ? 240  ALA B O   1 
ATOM   3673 C CB  . ALA D 2 90  ? -12.770 -30.420 2.245   1.00 37.23 ? 240  ALA B CB  1 
ATOM   3674 N N   . LEU D 2 91  ? -11.944 -33.328 3.402   1.00 41.08 ? 241  LEU B N   1 
ATOM   3675 C CA  . LEU D 2 91  ? -12.285 -34.349 4.379   1.00 42.94 ? 241  LEU B CA  1 
ATOM   3676 C C   . LEU D 2 91  ? -11.060 -35.153 4.715   1.00 44.28 ? 241  LEU B C   1 
ATOM   3677 O O   . LEU D 2 91  ? -10.207 -35.385 3.851   1.00 44.54 ? 241  LEU B O   1 
ATOM   3678 C CB  . LEU D 2 91  ? -13.428 -35.228 3.851   1.00 42.66 ? 241  LEU B CB  1 
ATOM   3679 C CG  . LEU D 2 91  ? -14.702 -34.478 3.439   1.00 42.44 ? 241  LEU B CG  1 
ATOM   3680 C CD1 . LEU D 2 91  ? -15.750 -35.456 2.921   1.00 40.46 ? 241  LEU B CD1 1 
ATOM   3681 C CD2 . LEU D 2 91  ? -15.315 -33.624 4.571   1.00 42.46 ? 241  LEU B CD2 1 
ATOM   3682 N N   . PRO D 2 92  ? -10.951 -35.601 5.978   1.00 45.80 ? 242  PRO B N   1 
ATOM   3683 C CA  . PRO D 2 92  ? -9.756  -36.366 6.289   1.00 46.33 ? 242  PRO B CA  1 
ATOM   3684 C C   . PRO D 2 92  ? -9.777  -37.666 5.495   1.00 46.66 ? 242  PRO B C   1 
ATOM   3685 O O   . PRO D 2 92  ? -10.873 -38.166 5.179   1.00 45.77 ? 242  PRO B O   1 
ATOM   3686 C CB  . PRO D 2 92  ? -9.890  -36.639 7.792   1.00 46.86 ? 242  PRO B CB  1 
ATOM   3687 C CG  . PRO D 2 92  ? -10.924 -35.662 8.277   1.00 45.76 ? 242  PRO B CG  1 
ATOM   3688 C CD  . PRO D 2 92  ? -11.860 -35.496 7.130   1.00 46.05 ? 242  PRO B CD  1 
ATOM   3689 N N   . PRO D 2 93  ? -8.587  -38.200 5.143   1.00 46.63 ? 243  PRO B N   1 
ATOM   3690 C CA  . PRO D 2 93  ? -8.540  -39.469 4.416   1.00 46.82 ? 243  PRO B CA  1 
ATOM   3691 C C   . PRO D 2 93  ? -9.170  -40.592 5.208   1.00 46.30 ? 243  PRO B C   1 
ATOM   3692 O O   . PRO D 2 93  ? -9.780  -41.491 4.600   1.00 47.24 ? 243  PRO B O   1 
ATOM   3693 C CB  . PRO D 2 93  ? -7.034  -39.737 4.247   1.00 46.79 ? 243  PRO B CB  1 
ATOM   3694 C CG  . PRO D 2 93  ? -6.408  -38.373 4.319   1.00 47.77 ? 243  PRO B CG  1 
ATOM   3695 C CD  . PRO D 2 93  ? -7.226  -37.666 5.376   1.00 47.28 ? 243  PRO B CD  1 
ATOM   3696 N N   . VAL D 2 94  ? -9.020  -40.562 6.537   1.00 44.95 ? 244  VAL B N   1 
ATOM   3697 C CA  . VAL D 2 94  ? -9.643  -41.600 7.378   1.00 43.95 ? 244  VAL B CA  1 
ATOM   3698 C C   . VAL D 2 94  ? -10.813 -41.010 8.197   1.00 42.65 ? 244  VAL B C   1 
ATOM   3699 O O   . VAL D 2 94  ? -10.649 -40.004 8.888   1.00 42.37 ? 244  VAL B O   1 
ATOM   3700 C CB  . VAL D 2 94  ? -8.610  -42.340 8.274   1.00 44.20 ? 244  VAL B CB  1 
ATOM   3701 C CG1 . VAL D 2 94  ? -9.229  -43.588 8.900   1.00 44.60 ? 244  VAL B CG1 1 
ATOM   3702 C CG2 . VAL D 2 94  ? -7.352  -42.735 7.465   1.00 44.95 ? 244  VAL B CG2 1 
ATOM   3703 N N   . ALA D 2 95  ? -11.984 -41.632 8.089   1.00 40.35 ? 245  ALA B N   1 
ATOM   3704 C CA  . ALA D 2 95  ? -13.164 -41.176 8.802   1.00 38.97 ? 245  ALA B CA  1 
ATOM   3705 C C   . ALA D 2 95  ? -13.086 -41.573 10.274  1.00 37.62 ? 245  ALA B C   1 
ATOM   3706 O O   . ALA D 2 95  ? -12.932 -42.766 10.596  1.00 37.79 ? 245  ALA B O   1 
ATOM   3707 C CB  . ALA D 2 95  ? -14.433 -41.714 8.160   1.00 39.21 ? 245  ALA B CB  1 
ATOM   3708 N N   . PRO D 2 96  ? -13.162 -40.570 11.175  1.00 35.92 ? 246  PRO B N   1 
ATOM   3709 C CA  . PRO D 2 96  ? -13.127 -40.792 12.606  1.00 34.38 ? 246  PRO B CA  1 
ATOM   3710 C C   . PRO D 2 96  ? -14.488 -41.162 13.093  1.00 33.42 ? 246  PRO B C   1 
ATOM   3711 O O   . PRO D 2 96  ? -15.439 -41.133 12.326  1.00 30.37 ? 246  PRO B O   1 
ATOM   3712 C CB  . PRO D 2 96  ? -12.729 -39.415 13.159  1.00 34.69 ? 246  PRO B CB  1 
ATOM   3713 C CG  . PRO D 2 96  ? -13.127 -38.499 12.235  1.00 34.78 ? 246  PRO B CG  1 
ATOM   3714 C CD  . PRO D 2 96  ? -13.273 -39.131 10.871  1.00 36.54 ? 246  PRO B CD  1 
ATOM   3715 N N   . ASN D 2 97  ? -14.588 -41.503 14.373  1.00 32.29 ? 247  ASN B N   1 
ATOM   3716 C CA  . ASN D 2 97  ? -15.888 -41.669 14.986  1.00 32.07 ? 247  ASN B CA  1 
ATOM   3717 C C   . ASN D 2 97  ? -16.689 -40.343 15.020  1.00 32.93 ? 247  ASN B C   1 
ATOM   3718 O O   . ASN D 2 97  ? -16.125 -39.267 15.239  1.00 31.96 ? 247  ASN B O   1 
ATOM   3719 C CB  . ASN D 2 97  ? -15.715 -42.252 16.391  1.00 32.46 ? 247  ASN B CB  1 
ATOM   3720 C CG  . ASN D 2 97  ? -17.022 -42.416 17.103  1.00 33.91 ? 247  ASN B CG  1 
ATOM   3721 O OD1 . ASN D 2 97  ? -17.517 -41.491 17.742  1.00 39.64 ? 247  ASN B OD1 1 
ATOM   3722 N ND2 . ASN D 2 97  ? -17.595 -43.593 17.008  1.00 36.52 ? 247  ASN B ND2 1 
ATOM   3723 N N   . CYS D 2 98  ? -17.996 -40.405 14.790  1.00 32.34 ? 248  CYS B N   1 
ATOM   3724 C CA  . CYS D 2 98  ? -18.783 -39.159 14.699  1.00 35.09 ? 248  CYS B CA  1 
ATOM   3725 C C   . CYS D 2 98  ? -18.815 -38.272 15.964  1.00 32.56 ? 248  CYS B C   1 
ATOM   3726 O O   . CYS D 2 98  ? -18.965 -37.051 15.873  1.00 31.19 ? 248  CYS B O   1 
ATOM   3727 C CB  . CYS D 2 98  ? -20.178 -39.393 14.120  1.00 36.41 ? 248  CYS B CB  1 
ATOM   3728 S SG  . CYS D 2 98  ? -20.418 -38.233 12.777  1.00 52.37 ? 248  CYS B SG  1 
ATOM   3729 N N   . LEU D 2 99  ? -18.695 -38.873 17.132  1.00 30.66 ? 249  LEU B N   1 
ATOM   3730 C CA  . LEU D 2 99  ? -18.693 -38.058 18.331  1.00 30.40 ? 249  LEU B CA  1 
ATOM   3731 C C   . LEU D 2 99  ? -17.390 -37.329 18.515  1.00 31.20 ? 249  LEU B C   1 
ATOM   3732 O O   . LEU D 2 99  ? -17.335 -36.299 19.200  1.00 29.16 ? 249  LEU B O   1 
ATOM   3733 C CB  . LEU D 2 99  ? -18.942 -38.918 19.542  1.00 29.41 ? 249  LEU B CB  1 
ATOM   3734 C CG  . LEU D 2 99  ? -20.302 -39.576 19.583  1.00 30.91 ? 249  LEU B CG  1 
ATOM   3735 C CD1 . LEU D 2 99  ? -20.348 -40.593 20.704  1.00 30.08 ? 249  LEU B CD1 1 
ATOM   3736 C CD2 . LEU D 2 99  ? -21.379 -38.511 19.734  1.00 34.82 ? 249  LEU B CD2 1 
ATOM   3737 N N   . GLU D 2 100 ? -16.315 -37.940 17.994  1.00 31.70 ? 250  GLU B N   1 
ATOM   3738 C CA  . GLU D 2 100 ? -14.998 -37.335 18.049  1.00 33.19 ? 250  GLU B CA  1 
ATOM   3739 C C   . GLU D 2 100 ? -15.021 -36.088 17.187  1.00 32.35 ? 250  GLU B C   1 
ATOM   3740 O O   . GLU D 2 100 ? -14.478 -35.054 17.546  1.00 31.56 ? 250  GLU B O   1 
ATOM   3741 C CB  . GLU D 2 100 ? -13.941 -38.343 17.591  1.00 33.81 ? 250  GLU B CB  1 
ATOM   3742 C CG  . GLU D 2 100 ? -12.494 -37.879 17.613  1.00 37.81 ? 250  GLU B CG  1 
ATOM   3743 C CD  . GLU D 2 100 ? -12.023 -37.263 18.956  1.00 40.72 ? 250  GLU B CD  1 
ATOM   3744 O OE1 . GLU D 2 100 ? -12.562 -37.602 20.036  1.00 39.02 ? 250  GLU B OE1 1 
ATOM   3745 O OE2 . GLU D 2 100 ? -11.093 -36.434 18.899  1.00 42.74 ? 250  GLU B OE2 1 
ATOM   3746 N N   . LEU D 2 101 ? -15.622 -36.202 16.017  1.00 31.84 ? 251  LEU B N   1 
ATOM   3747 C CA  . LEU D 2 101 ? -15.823 -35.078 15.161  1.00 33.91 ? 251  LEU B CA  1 
ATOM   3748 C C   . LEU D 2 101 ? -16.554 -33.936 15.880  1.00 33.69 ? 251  LEU B C   1 
ATOM   3749 O O   . LEU D 2 101 ? -16.187 -32.755 15.765  1.00 34.45 ? 251  LEU B O   1 
ATOM   3750 C CB  . LEU D 2 101 ? -16.680 -35.540 13.980  1.00 34.42 ? 251  LEU B CB  1 
ATOM   3751 C CG  . LEU D 2 101 ? -16.305 -34.997 12.631  1.00 37.27 ? 251  LEU B CG  1 
ATOM   3752 C CD1 . LEU D 2 101 ? -14.863 -35.256 12.392  1.00 32.78 ? 251  LEU B CD1 1 
ATOM   3753 C CD2 . LEU D 2 101 ? -17.204 -35.566 11.531  1.00 35.94 ? 251  LEU B CD2 1 
ATOM   3754 N N   . ARG D 2 102 ? -17.631 -34.281 16.579  1.00 32.76 ? 252  ARG B N   1 
ATOM   3755 C CA  . ARG D 2 102 ? -18.367 -33.274 17.333  1.00 31.05 ? 252  ARG B CA  1 
ATOM   3756 C C   . ARG D 2 102 ? -17.472 -32.675 18.420  1.00 28.13 ? 252  ARG B C   1 
ATOM   3757 O O   . ARG D 2 102 ? -17.481 -31.488 18.637  1.00 25.97 ? 252  ARG B O   1 
ATOM   3758 C CB  . ARG D 2 102 ? -19.613 -33.875 17.953  1.00 32.51 ? 252  ARG B CB  1 
ATOM   3759 C CG  . ARG D 2 102 ? -20.575 -32.840 18.493  1.00 35.73 ? 252  ARG B CG  1 
ATOM   3760 C CD  . ARG D 2 102 ? -21.874 -33.494 18.913  1.00 39.75 ? 252  ARG B CD  1 
ATOM   3761 N NE  . ARG D 2 102 ? -21.698 -34.175 20.192  1.00 43.73 ? 252  ARG B NE  1 
ATOM   3762 C CZ  . ARG D 2 102 ? -22.628 -34.924 20.784  1.00 47.19 ? 252  ARG B CZ  1 
ATOM   3763 N NH1 . ARG D 2 102 ? -23.814 -35.094 20.203  1.00 48.44 ? 252  ARG B NH1 1 
ATOM   3764 N NH2 . ARG D 2 102 ? -22.359 -35.521 21.945  1.00 45.62 ? 252  ARG B NH2 1 
ATOM   3765 N N   . ARG D 2 103 ? -16.707 -33.516 19.114  1.00 26.11 ? 253  ARG B N   1 
ATOM   3766 C CA  . ARG D 2 103 ? -15.820 -33.033 20.125  1.00 25.38 ? 253  ARG B CA  1 
ATOM   3767 C C   . ARG D 2 103 ? -14.855 -31.995 19.544  1.00 25.35 ? 253  ARG B C   1 
ATOM   3768 O O   . ARG D 2 103 ? -14.681 -30.939 20.115  1.00 27.17 ? 253  ARG B O   1 
ATOM   3769 C CB  . ARG D 2 103 ? -15.039 -34.205 20.700  1.00 24.85 ? 253  ARG B CB  1 
ATOM   3770 C CG  . ARG D 2 103 ? -14.234 -33.947 22.011  1.00 25.76 ? 253  ARG B CG  1 
ATOM   3771 C CD  . ARG D 2 103 ? -13.014 -34.846 21.903  1.00 24.07 ? 253  ARG B CD  1 
ATOM   3772 N NE  . ARG D 2 103 ? -11.855 -34.119 22.395  1.00 36.51 ? 253  ARG B NE  1 
ATOM   3773 C CZ  . ARG D 2 103 ? -10.787 -33.860 21.676  1.00 37.13 ? 253  ARG B CZ  1 
ATOM   3774 N NH1 . ARG D 2 103 ? -10.704 -34.372 20.469  1.00 36.97 ? 253  ARG B NH1 1 
ATOM   3775 N NH2 . ARG D 2 103 ? -9.728  -33.211 22.224  1.00 45.75 ? 253  ARG B NH2 1 
ATOM   3776 N N   . LEU D 2 104 ? -14.172 -32.330 18.447  1.00 27.30 ? 254  LEU B N   1 
ATOM   3777 C CA  . LEU D 2 104 ? -13.265 -31.391 17.765  1.00 30.23 ? 254  LEU B CA  1 
ATOM   3778 C C   . LEU D 2 104 ? -14.012 -30.076 17.437  1.00 31.12 ? 254  LEU B C   1 
ATOM   3779 O O   . LEU D 2 104 ? -13.473 -28.991 17.615  1.00 31.50 ? 254  LEU B O   1 
ATOM   3780 C CB  . LEU D 2 104 ? -12.857 -31.976 16.405  1.00 30.90 ? 254  LEU B CB  1 
ATOM   3781 C CG  . LEU D 2 104 ? -11.663 -32.914 16.310  1.00 34.05 ? 254  LEU B CG  1 
ATOM   3782 C CD1 . LEU D 2 104 ? -11.327 -33.583 17.570  1.00 35.57 ? 254  LEU B CD1 1 
ATOM   3783 C CD2 . LEU D 2 104 ? -11.788 -33.925 15.130  1.00 32.14 ? 254  LEU B CD2 1 
ATOM   3784 N N   . CYS D 2 105 ? -15.251 -30.207 16.996  1.00 31.51 ? 255  CYS B N   1 
ATOM   3785 C CA  . CYS D 2 105 ? -16.102 -29.050 16.709  1.00 32.61 ? 255  CYS B CA  1 
ATOM   3786 C C   . CYS D 2 105 ? -16.285 -28.192 17.968  1.00 31.16 ? 255  CYS B C   1 
ATOM   3787 O O   . CYS D 2 105 ? -16.076 -26.983 17.924  1.00 32.02 ? 255  CYS B O   1 
ATOM   3788 C CB  . CYS D 2 105 ? -17.449 -29.488 16.147  1.00 32.90 ? 255  CYS B CB  1 
ATOM   3789 S SG  . CYS D 2 105 ? -18.497 -28.069 15.602  1.00 37.94 ? 255  CYS B SG  1 
ATOM   3790 N N   . PHE D 2 106 ? -16.643 -28.818 19.089  1.00 28.45 ? 256  PHE B N   1 
ATOM   3791 C CA  . PHE D 2 106 ? -16.874 -28.075 20.332  1.00 28.33 ? 256  PHE B CA  1 
ATOM   3792 C C   . PHE D 2 106 ? -15.628 -27.352 20.749  1.00 27.50 ? 256  PHE B C   1 
ATOM   3793 O O   . PHE D 2 106 ? -15.684 -26.389 21.523  1.00 26.38 ? 256  PHE B O   1 
ATOM   3794 C CB  . PHE D 2 106 ? -17.229 -29.010 21.512  1.00 30.85 ? 256  PHE B CB  1 
ATOM   3795 C CG  . PHE D 2 106 ? -18.664 -29.550 21.489  1.00 34.62 ? 256  PHE B CG  1 
ATOM   3796 C CD1 . PHE D 2 106 ? -18.995 -30.689 22.244  1.00 41.05 ? 256  PHE B CD1 1 
ATOM   3797 C CD2 . PHE D 2 106 ? -19.647 -28.932 20.769  1.00 37.58 ? 256  PHE B CD2 1 
ATOM   3798 C CE1 . PHE D 2 106 ? -20.329 -31.210 22.236  1.00 41.50 ? 256  PHE B CE1 1 
ATOM   3799 C CE2 . PHE D 2 106 ? -20.969 -29.448 20.737  1.00 41.83 ? 256  PHE B CE2 1 
ATOM   3800 C CZ  . PHE D 2 106 ? -21.291 -30.580 21.495  1.00 39.50 ? 256  PHE B CZ  1 
ATOM   3801 N N   . SER D 2 107 ? -14.478 -27.889 20.333  1.00 26.61 ? 257  SER B N   1 
ATOM   3802 C CA  . SER D 2 107 ? -13.181 -27.355 20.745  1.00 26.15 ? 257  SER B CA  1 
ATOM   3803 C C   . SER D 2 107 ? -12.797 -26.040 20.073  1.00 27.50 ? 257  SER B C   1 
ATOM   3804 O O   . SER D 2 107 ? -11.828 -25.403 20.484  1.00 30.04 ? 257  SER B O   1 
ATOM   3805 C CB  . SER D 2 107 ? -12.116 -28.383 20.394  1.00 24.68 ? 257  SER B CB  1 
ATOM   3806 O OG  . SER D 2 107 ? -12.407 -29.593 21.068  1.00 26.64 ? 257  SER B OG  1 
ATOM   3807 N N   . ASP D 2 108 ? -13.487 -25.703 19.006  1.00 28.61 ? 258  ASP B N   1 
ATOM   3808 C CA  . ASP D 2 108 ? -13.236 -24.511 18.170  1.00 31.14 ? 258  ASP B CA  1 
ATOM   3809 C C   . ASP D 2 108 ? -14.485 -23.614 18.279  1.00 29.61 ? 258  ASP B C   1 
ATOM   3810 O O   . ASP D 2 108 ? -15.564 -24.050 17.922  1.00 30.75 ? 258  ASP B O   1 
ATOM   3811 C CB  . ASP D 2 108 ? -13.045 -24.949 16.696  1.00 32.21 ? 258  ASP B CB  1 
ATOM   3812 C CG  . ASP D 2 108 ? -12.778 -23.761 15.712  1.00 35.39 ? 258  ASP B CG  1 
ATOM   3813 O OD1 . ASP D 2 108 ? -11.694 -23.159 15.733  1.00 40.23 ? 258  ASP B OD1 1 
ATOM   3814 O OD2 . ASP D 2 108 ? -13.615 -23.467 14.858  1.00 38.02 ? 258  ASP B OD2 1 
ATOM   3815 N N   . PRO D 2 109 ? -14.334 -22.364 18.746  1.00 30.71 ? 259  PRO B N   1 
ATOM   3816 C CA  . PRO D 2 109 ? -15.467 -21.468 18.972  1.00 32.45 ? 259  PRO B CA  1 
ATOM   3817 C C   . PRO D 2 109 ? -16.272 -21.184 17.710  1.00 33.24 ? 259  PRO B C   1 
ATOM   3818 O O   . PRO D 2 109 ? -17.519 -21.172 17.772  1.00 35.11 ? 259  PRO B O   1 
ATOM   3819 C CB  . PRO D 2 109 ? -14.810 -20.187 19.497  1.00 32.42 ? 259  PRO B CB  1 
ATOM   3820 C CG  . PRO D 2 109 ? -13.501 -20.647 20.061  1.00 32.73 ? 259  PRO B CG  1 
ATOM   3821 C CD  . PRO D 2 109 ? -13.058 -21.711 19.125  1.00 31.93 ? 259  PRO B CD  1 
ATOM   3822 N N   . LEU D 2 110 ? -15.616 -20.991 16.567  1.00 34.16 ? 260  LEU B N   1 
ATOM   3823 C CA  . LEU D 2 110 ? -16.385 -20.833 15.317  1.00 35.10 ? 260  LEU B CA  1 
ATOM   3824 C C   . LEU D 2 110 ? -17.209 -22.090 15.010  1.00 35.28 ? 260  LEU B C   1 
ATOM   3825 O O   . LEU D 2 110 ? -18.413 -21.994 14.822  1.00 35.93 ? 260  LEU B O   1 
ATOM   3826 C CB  . LEU D 2 110 ? -15.520 -20.455 14.104  1.00 34.99 ? 260  LEU B CB  1 
ATOM   3827 C CG  . LEU D 2 110 ? -16.371 -20.268 12.816  1.00 38.72 ? 260  LEU B CG  1 
ATOM   3828 C CD1 . LEU D 2 110 ? -17.318 -19.094 12.972  1.00 39.68 ? 260  LEU B CD1 1 
ATOM   3829 C CD2 . LEU D 2 110 ? -15.501 -20.056 11.618  1.00 42.14 ? 260  LEU B CD2 1 
ATOM   3830 N N   . CYS D 2 111 ? -16.566 -23.263 14.978  1.00 35.75 ? 261  CYS B N   1 
ATOM   3831 C CA  . CYS D 2 111 ? -17.277 -24.509 14.713  1.00 34.63 ? 261  CYS B CA  1 
ATOM   3832 C C   . CYS D 2 111 ? -18.390 -24.740 15.702  1.00 33.45 ? 261  CYS B C   1 
ATOM   3833 O O   . CYS D 2 111 ? -19.484 -25.110 15.284  1.00 32.60 ? 261  CYS B O   1 
ATOM   3834 C CB  . CYS D 2 111 ? -16.379 -25.770 14.684  1.00 36.41 ? 261  CYS B CB  1 
ATOM   3835 S SG  . CYS D 2 111 ? -17.368 -27.277 14.068  1.00 43.32 ? 261  CYS B SG  1 
ATOM   3836 N N   . ARG D 2 112 ? -18.111 -24.565 16.998  1.00 30.99 ? 262  ARG B N   1 
ATOM   3837 C CA  . ARG D 2 112 ? -19.118 -24.707 18.063  1.00 31.72 ? 262  ARG B CA  1 
ATOM   3838 C C   . ARG D 2 112 ? -20.350 -23.833 17.673  1.00 32.58 ? 262  ARG B C   1 
ATOM   3839 O O   . ARG D 2 112 ? -21.492 -24.294 17.681  1.00 31.83 ? 262  ARG B O   1 
ATOM   3840 C CB  . ARG D 2 112 ? -18.518 -24.299 19.425  1.00 31.60 ? 262  ARG B CB  1 
ATOM   3841 C CG  . ARG D 2 112 ? -19.247 -24.809 20.695  1.00 33.52 ? 262  ARG B CG  1 
ATOM   3842 C CD  . ARG D 2 112 ? -18.321 -24.800 21.908  1.00 41.24 ? 262  ARG B CD  1 
ATOM   3843 N NE  . ARG D 2 112 ? -17.960 -23.460 22.296  1.00 40.22 ? 262  ARG B NE  1 
ATOM   3844 C CZ  . ARG D 2 112 ? -16.799 -23.096 22.821  1.00 42.21 ? 262  ARG B CZ  1 
ATOM   3845 N NH1 . ARG D 2 112 ? -15.788 -23.958 23.015  1.00 41.50 ? 262  ARG B NH1 1 
ATOM   3846 N NH2 . ARG D 2 112 ? -16.643 -21.822 23.157  1.00 41.44 ? 262  ARG B NH2 1 
ATOM   3847 N N   . SER D 2 113 ? -20.097 -22.587 17.307  1.00 33.82 ? 263  SER B N   1 
ATOM   3848 C CA  . SER D 2 113 ? -21.166 -21.675 16.941  1.00 35.95 ? 263  SER B CA  1 
ATOM   3849 C C   . SER D 2 113 ? -21.960 -22.210 15.749  1.00 34.56 ? 263  SER B C   1 
ATOM   3850 O O   . SER D 2 113 ? -23.198 -22.213 15.746  1.00 36.76 ? 263  SER B O   1 
ATOM   3851 C CB  . SER D 2 113 ? -20.550 -20.323 16.588  1.00 37.01 ? 263  SER B CB  1 
ATOM   3852 O OG  . SER D 2 113 ? -21.581 -19.366 16.560  1.00 43.60 ? 263  SER B OG  1 
ATOM   3853 N N   . ARG D 2 114 ? -21.264 -22.657 14.718  1.00 34.20 ? 264  ARG B N   1 
ATOM   3854 C CA  . ARG D 2 114 ? -21.934 -23.176 13.535  1.00 33.57 ? 264  ARG B CA  1 
ATOM   3855 C C   . ARG D 2 114 ? -22.776 -24.397 13.831  1.00 33.67 ? 264  ARG B C   1 
ATOM   3856 O O   . ARG D 2 114 ? -23.840 -24.541 13.282  1.00 33.87 ? 264  ARG B O   1 
ATOM   3857 C CB  . ARG D 2 114 ? -20.946 -23.463 12.411  1.00 33.34 ? 264  ARG B CB  1 
ATOM   3858 C CG  . ARG D 2 114 ? -20.186 -22.237 11.963  1.00 34.31 ? 264  ARG B CG  1 
ATOM   3859 C CD  . ARG D 2 114 ? -21.132 -21.112 11.330  1.00 34.85 ? 264  ARG B CD  1 
ATOM   3860 N NE  . ARG D 2 114 ? -20.333 -19.929 10.965  1.00 34.46 ? 264  ARG B NE  1 
ATOM   3861 C CZ  . ARG D 2 114 ? -19.590 -19.860 9.865   1.00 37.68 ? 264  ARG B CZ  1 
ATOM   3862 N NH1 . ARG D 2 114 ? -19.561 -20.876 9.022   1.00 34.23 ? 264  ARG B NH1 1 
ATOM   3863 N NH2 . ARG D 2 114 ? -18.912 -18.753 9.576   1.00 40.52 ? 264  ARG B NH2 1 
ATOM   3864 N N   . LEU D 2 115 ? -22.289 -25.296 14.689  1.00 33.48 ? 265  LEU B N   1 
ATOM   3865 C CA  . LEU D 2 115 ? -23.079 -26.486 15.060  1.00 33.15 ? 265  LEU B CA  1 
ATOM   3866 C C   . LEU D 2 115 ? -24.345 -26.114 15.836  1.00 33.72 ? 265  LEU B C   1 
ATOM   3867 O O   . LEU D 2 115 ? -25.426 -26.627 15.549  1.00 34.02 ? 265  LEU B O   1 
ATOM   3868 C CB  . LEU D 2 115 ? -22.190 -27.517 15.831  1.00 33.00 ? 265  LEU B CB  1 
ATOM   3869 C CG  . LEU D 2 115 ? -22.926 -28.791 16.313  1.00 34.25 ? 265  LEU B CG  1 
ATOM   3870 C CD1 . LEU D 2 115 ? -23.625 -29.557 15.186  1.00 32.46 ? 265  LEU B CD1 1 
ATOM   3871 C CD2 . LEU D 2 115 ? -22.013 -29.712 17.076  1.00 33.75 ? 265  LEU B CD2 1 
ATOM   3872 N N   . VAL D 2 116 ? -24.241 -25.191 16.796  1.00 33.15 ? 266  VAL B N   1 
ATOM   3873 C CA  . VAL D 2 116 ? -25.426 -24.727 17.495  1.00 34.32 ? 266  VAL B CA  1 
ATOM   3874 C C   . VAL D 2 116 ? -26.445 -24.163 16.543  1.00 33.75 ? 266  VAL B C   1 
ATOM   3875 O O   . VAL D 2 116 ? -27.638 -24.490 16.644  1.00 33.50 ? 266  VAL B O   1 
ATOM   3876 C CB  . VAL D 2 116 ? -25.068 -23.723 18.606  1.00 35.24 ? 266  VAL B CB  1 
ATOM   3877 C CG1 . VAL D 2 116 ? -26.320 -23.214 19.333  1.00 37.57 ? 266  VAL B CG1 1 
ATOM   3878 C CG2 . VAL D 2 116 ? -24.124 -24.394 19.561  1.00 34.54 ? 266  VAL B CG2 1 
ATOM   3879 N N   . ASP D 2 117 ? -25.992 -23.350 15.597  1.00 32.93 ? 267  ASP B N   1 
ATOM   3880 C CA  . ASP D 2 117 ? -26.925 -22.771 14.637  1.00 34.45 ? 267  ASP B CA  1 
ATOM   3881 C C   . ASP D 2 117 ? -27.679 -23.884 13.856  1.00 33.83 ? 267  ASP B C   1 
ATOM   3882 O O   . ASP D 2 117 ? -28.897 -23.797 13.594  1.00 33.78 ? 267  ASP B O   1 
ATOM   3883 C CB  . ASP D 2 117 ? -26.158 -21.894 13.621  1.00 35.93 ? 267  ASP B CB  1 
ATOM   3884 C CG  . ASP D 2 117 ? -25.615 -20.616 14.218  1.00 39.35 ? 267  ASP B CG  1 
ATOM   3885 O OD1 . ASP D 2 117 ? -26.093 -20.258 15.316  1.00 44.80 ? 267  ASP B OD1 1 
ATOM   3886 O OD2 . ASP D 2 117 ? -24.712 -19.972 13.581  1.00 42.06 ? 267  ASP B OD2 1 
ATOM   3887 N N   . PHE D 2 118 ? -26.934 -24.882 13.407  1.00 31.92 ? 268  PHE B N   1 
ATOM   3888 C CA  . PHE D 2 118 ? -27.507 -25.954 12.605  1.00 34.11 ? 268  PHE B CA  1 
ATOM   3889 C C   . PHE D 2 118 ? -28.506 -26.752 13.449  1.00 34.02 ? 268  PHE B C   1 
ATOM   3890 O O   . PHE D 2 118 ? -29.568 -27.135 12.977  1.00 35.54 ? 268  PHE B O   1 
ATOM   3891 C CB  . PHE D 2 118 ? -26.380 -26.841 12.122  1.00 33.47 ? 268  PHE B CB  1 
ATOM   3892 C CG  . PHE D 2 118 ? -26.821 -28.104 11.481  1.00 36.62 ? 268  PHE B CG  1 
ATOM   3893 C CD1 . PHE D 2 118 ? -27.493 -28.098 10.254  1.00 35.77 ? 268  PHE B CD1 1 
ATOM   3894 C CD2 . PHE D 2 118 ? -26.547 -29.318 12.082  1.00 37.32 ? 268  PHE B CD2 1 
ATOM   3895 C CE1 . PHE D 2 118 ? -27.870 -29.297 9.667   1.00 36.75 ? 268  PHE B CE1 1 
ATOM   3896 C CE2 . PHE D 2 118 ? -26.925 -30.502 11.477  1.00 36.40 ? 268  PHE B CE2 1 
ATOM   3897 C CZ  . PHE D 2 118 ? -27.574 -30.497 10.295  1.00 33.22 ? 268  PHE B CZ  1 
ATOM   3898 N N   . GLN D 2 119 ? -28.165 -26.991 14.703  1.00 34.82 ? 269  GLN B N   1 
ATOM   3899 C CA  . GLN D 2 119 ? -29.035 -27.703 15.610  1.00 35.25 ? 269  GLN B CA  1 
ATOM   3900 C C   . GLN D 2 119 ? -30.300 -26.935 15.917  1.00 35.68 ? 269  GLN B C   1 
ATOM   3901 O O   . GLN D 2 119 ? -31.348 -27.527 16.137  1.00 37.13 ? 269  GLN B O   1 
ATOM   3902 C CB  . GLN D 2 119 ? -28.281 -28.012 16.883  1.00 36.25 ? 269  GLN B CB  1 
ATOM   3903 C CG  . GLN D 2 119 ? -27.211 -28.967 16.660  1.00 37.19 ? 269  GLN B CG  1 
ATOM   3904 C CD  . GLN D 2 119 ? -26.475 -29.256 17.974  1.00 42.87 ? 269  GLN B CD  1 
ATOM   3905 O OE1 . GLN D 2 119 ? -26.288 -28.366 18.819  1.00 44.96 ? 269  GLN B OE1 1 
ATOM   3906 N NE2 . GLN D 2 119 ? -26.101 -30.506 18.163  1.00 42.85 ? 269  GLN B NE2 1 
ATOM   3907 N N   . THR D 2 120 ? -30.208 -25.602 15.912  1.00 35.41 ? 270  THR B N   1 
ATOM   3908 C CA  . THR D 2 120 ? -31.348 -24.748 16.144  1.00 35.74 ? 270  THR B CA  1 
ATOM   3909 C C   . THR D 2 120 ? -32.307 -24.699 14.942  1.00 35.09 ? 270  THR B C   1 
ATOM   3910 O O   . THR D 2 120 ? -33.522 -24.869 15.115  1.00 36.10 ? 270  THR B O   1 
ATOM   3911 C CB  . THR D 2 120 ? -30.896 -23.324 16.515  1.00 34.85 ? 270  THR B CB  1 
ATOM   3912 O OG1 . THR D 2 120 ? -30.122 -23.384 17.720  1.00 37.10 ? 270  THR B OG1 1 
ATOM   3913 C CG2 . THR D 2 120 ? -32.105 -22.397 16.700  1.00 40.01 ? 270  THR B CG2 1 
ATOM   3914 N N   . HIS D 2 121 ? -31.774 -24.414 13.767  1.00 34.53 ? 271  HIS B N   1 
ATOM   3915 C CA  . HIS D 2 121 ? -32.591 -24.145 12.589  1.00 35.45 ? 271  HIS B CA  1 
ATOM   3916 C C   . HIS D 2 121 ? -33.056 -25.373 11.842  1.00 36.33 ? 271  HIS B C   1 
ATOM   3917 O O   . HIS D 2 121 ? -34.128 -25.334 11.220  1.00 36.27 ? 271  HIS B O   1 
ATOM   3918 C CB  . HIS D 2 121 ? -31.903 -23.137 11.676  1.00 35.35 ? 271  HIS B CB  1 
ATOM   3919 C CG  . HIS D 2 121 ? -31.710 -21.816 12.331  1.00 38.49 ? 271  HIS B CG  1 
ATOM   3920 N ND1 . HIS D 2 121 ? -30.465 -21.297 12.620  1.00 40.91 ? 271  HIS B ND1 1 
ATOM   3921 C CD2 . HIS D 2 121 ? -32.611 -20.958 12.872  1.00 41.56 ? 271  HIS B CD2 1 
ATOM   3922 C CE1 . HIS D 2 121 ? -30.604 -20.157 13.273  1.00 39.77 ? 271  HIS B CE1 1 
ATOM   3923 N NE2 . HIS D 2 121 ? -31.896 -19.928 13.440  1.00 44.22 ? 271  HIS B NE2 1 
ATOM   3924 N N   . CYS D 2 122 ? -32.315 -26.478 11.964  1.00 35.86 ? 272  CYS B N   1 
ATOM   3925 C CA  . CYS D 2 122 ? -32.634 -27.668 11.186  1.00 35.77 ? 272  CYS B CA  1 
ATOM   3926 C C   . CYS D 2 122 ? -33.296 -28.731 12.026  1.00 35.43 ? 272  CYS B C   1 
ATOM   3927 O O   . CYS D 2 122 ? -33.434 -29.860 11.561  1.00 35.86 ? 272  CYS B O   1 
ATOM   3928 C CB  . CYS D 2 122 ? -31.378 -28.228 10.484  1.00 36.18 ? 272  CYS B CB  1 
ATOM   3929 S SG  . CYS D 2 122 ? -30.680 -27.139 9.238   1.00 38.57 ? 272  CYS B SG  1 
ATOM   3930 N N   . HIS D 2 123 ? -33.741 -28.378 13.236  1.00 32.91 ? 273  HIS B N   1 
ATOM   3931 C CA  . HIS D 2 123 ? -34.483 -29.334 14.063  1.00 33.22 ? 273  HIS B CA  1 
ATOM   3932 C C   . HIS D 2 123 ? -35.839 -29.624 13.434  1.00 33.50 ? 273  HIS B C   1 
ATOM   3933 O O   . HIS D 2 123 ? -36.621 -28.686 13.231  1.00 34.42 ? 273  HIS B O   1 
ATOM   3934 C CB  . HIS D 2 123 ? -34.675 -28.796 15.511  1.00 33.29 ? 273  HIS B CB  1 
ATOM   3935 C CG  . HIS D 2 123 ? -35.158 -29.837 16.476  1.00 34.69 ? 273  HIS B CG  1 
ATOM   3936 N ND1 . HIS D 2 123 ? -34.297 -30.644 17.192  1.00 39.45 ? 273  HIS B ND1 1 
ATOM   3937 C CD2 . HIS D 2 123 ? -36.408 -30.216 16.834  1.00 36.89 ? 273  HIS B CD2 1 
ATOM   3938 C CE1 . HIS D 2 123 ? -34.996 -31.472 17.952  1.00 37.47 ? 273  HIS B CE1 1 
ATOM   3939 N NE2 . HIS D 2 123 ? -36.279 -31.238 17.748  1.00 36.74 ? 273  HIS B NE2 1 
ATOM   3940 N N   . PRO D 2 124 ? -36.147 -30.913 13.174  1.00 32.73 ? 274  PRO B N   1 
ATOM   3941 C CA  . PRO D 2 124 ? -37.444 -31.295 12.616  1.00 32.53 ? 274  PRO B CA  1 
ATOM   3942 C C   . PRO D 2 124 ? -38.560 -31.214 13.685  1.00 32.69 ? 274  PRO B C   1 
ATOM   3943 O O   . PRO D 2 124 ? -38.365 -31.650 14.822  1.00 31.56 ? 274  PRO B O   1 
ATOM   3944 C CB  . PRO D 2 124 ? -37.192 -32.723 12.147  1.00 32.60 ? 274  PRO B CB  1 
ATOM   3945 C CG  . PRO D 2 124 ? -36.118 -33.250 13.134  1.00 33.01 ? 274  PRO B CG  1 
ATOM   3946 C CD  . PRO D 2 124 ? -35.251 -32.078 13.374  1.00 32.75 ? 274  PRO B CD  1 
ATOM   3947 N N   . MET D 2 125 ? -39.700 -30.623 13.321  1.00 31.61 ? 275  MET B N   1 
ATOM   3948 C CA  . MET D 2 125 ? -40.834 -30.494 14.218  1.00 33.22 ? 275  MET B CA  1 
ATOM   3949 C C   . MET D 2 125 ? -41.902 -31.537 13.880  1.00 32.04 ? 275  MET B C   1 
ATOM   3950 O O   . MET D 2 125 ? -42.806 -31.736 14.641  1.00 31.34 ? 275  MET B O   1 
ATOM   3951 C CB  . MET D 2 125 ? -41.451 -29.098 14.116  1.00 33.74 ? 275  MET B CB  1 
ATOM   3952 C CG  . MET D 2 125 ? -40.499 -27.960 14.349  1.00 37.22 ? 275  MET B CG  1 
ATOM   3953 S SD  . MET D 2 125 ? -39.810 -28.055 16.009  1.00 43.67 ? 275  MET B SD  1 
ATOM   3954 C CE  . MET D 2 125 ? -41.180 -27.450 16.981  1.00 44.69 ? 275  MET B CE  1 
ATOM   3955 N N   . ASP D 2 126 ? -41.810 -32.179 12.714  1.00 31.58 ? 276  ASP B N   1 
ATOM   3956 C CA  . ASP D 2 126 ? -42.799 -33.217 12.359  1.00 30.69 ? 276  ASP B CA  1 
ATOM   3957 C C   . ASP D 2 126 ? -42.294 -34.045 11.155  1.00 30.46 ? 276  ASP B C   1 
ATOM   3958 O O   . ASP D 2 126 ? -41.222 -33.785 10.646  1.00 30.42 ? 276  ASP B O   1 
ATOM   3959 C CB  . ASP D 2 126 ? -44.131 -32.550 12.025  1.00 30.65 ? 276  ASP B CB  1 
ATOM   3960 C CG  . ASP D 2 126 ? -44.022 -31.595 10.866  1.00 33.27 ? 276  ASP B CG  1 
ATOM   3961 O OD1 . ASP D 2 126 ? -43.109 -31.756 10.018  1.00 33.28 ? 276  ASP B OD1 1 
ATOM   3962 O OD2 . ASP D 2 126 ? -44.841 -30.669 10.789  1.00 34.40 ? 276  ASP B OD2 1 
ATOM   3963 N N   . ILE D 2 127 ? -43.049 -35.029 10.696  1.00 30.41 ? 277  ILE B N   1 
ATOM   3964 C CA  . ILE D 2 127 ? -42.562 -35.804 9.536   1.00 31.00 ? 277  ILE B CA  1 
ATOM   3965 C C   . ILE D 2 127 ? -42.718 -35.074 8.184   1.00 31.50 ? 277  ILE B C   1 
ATOM   3966 O O   . ILE D 2 127 ? -42.177 -35.510 7.166   1.00 29.63 ? 277  ILE B O   1 
ATOM   3967 C CB  . ILE D 2 127 ? -43.157 -37.209 9.506   1.00 31.17 ? 277  ILE B CB  1 
ATOM   3968 C CG1 . ILE D 2 127 ? -44.645 -37.187 9.199   1.00 29.67 ? 277  ILE B CG1 1 
ATOM   3969 C CG2 . ILE D 2 127 ? -42.939 -37.871 10.868  1.00 32.15 ? 277  ILE B CG2 1 
ATOM   3970 C CD1 . ILE D 2 127 ? -45.107 -38.475 8.701   1.00 31.94 ? 277  ILE B CD1 1 
ATOM   3971 N N   . LEU D 2 128 ? -43.457 -33.967 8.173   1.00 31.82 ? 278  LEU B N   1 
ATOM   3972 C CA  . LEU D 2 128 ? -43.689 -33.189 6.933   1.00 32.05 ? 278  LEU B CA  1 
ATOM   3973 C C   . LEU D 2 128 ? -42.540 -32.347 6.503   1.00 33.95 ? 278  LEU B C   1 
ATOM   3974 O O   . LEU D 2 128 ? -42.488 -31.847 5.359   1.00 33.83 ? 278  LEU B O   1 
ATOM   3975 C CB  . LEU D 2 128 ? -44.949 -32.319 7.068   1.00 32.43 ? 278  LEU B CB  1 
ATOM   3976 C CG  . LEU D 2 128 ? -46.197 -33.131 7.316   1.00 29.68 ? 278  LEU B CG  1 
ATOM   3977 C CD1 . LEU D 2 128 ? -47.432 -32.227 7.602   1.00 29.92 ? 278  LEU B CD1 1 
ATOM   3978 C CD2 . LEU D 2 128 ? -46.396 -34.003 6.113   1.00 33.53 ? 278  LEU B CD2 1 
ATOM   3979 N N   . GLY D 2 129 ? -41.574 -32.197 7.401   1.00 33.48 ? 279  GLY B N   1 
ATOM   3980 C CA  . GLY D 2 129 ? -40.435 -31.410 7.086   1.00 34.82 ? 279  GLY B CA  1 
ATOM   3981 C C   . GLY D 2 129 ? -40.442 -30.028 7.692   1.00 34.31 ? 279  GLY B C   1 
ATOM   3982 O O   . GLY D 2 129 ? -39.660 -29.185 7.284   1.00 35.33 ? 279  GLY B O   1 
ATOM   3983 N N   . THR D 2 130 ? -41.369 -29.784 8.613   1.00 33.83 ? 280  THR B N   1 
ATOM   3984 C CA  . THR D 2 130 ? -41.432 -28.495 9.254   1.00 33.92 ? 280  THR B CA  1 
ATOM   3985 C C   . THR D 2 130 ? -40.167 -28.345 10.080  1.00 33.45 ? 280  THR B C   1 
ATOM   3986 O O   . THR D 2 130 ? -39.888 -29.175 10.950  1.00 32.13 ? 280  THR B O   1 
ATOM   3987 C CB  . THR D 2 130 ? -42.615 -28.398 10.222  1.00 33.99 ? 280  THR B CB  1 
ATOM   3988 O OG1 . THR D 2 130 ? -43.837 -28.652 9.519   1.00 34.50 ? 280  THR B OG1 1 
ATOM   3989 C CG2 . THR D 2 130 ? -42.678 -27.034 10.878  1.00 35.51 ? 280  THR B CG2 1 
ATOM   3990 N N   . CYS D 2 131 ? -39.461 -27.249 9.859   1.00 33.63 ? 281  CYS B N   1 
ATOM   3991 C CA  . CYS D 2 131 ? -38.268 -26.946 10.628  1.00 34.89 ? 281  CYS B CA  1 
ATOM   3992 C C   . CYS D 2 131 ? -38.582 -26.146 11.903  1.00 34.89 ? 281  CYS B C   1 
ATOM   3993 O O   . CYS D 2 131 ? -39.616 -25.500 12.013  1.00 32.84 ? 281  CYS B O   1 
ATOM   3994 C CB  . CYS D 2 131 ? -37.259 -26.202 9.730   1.00 35.40 ? 281  CYS B CB  1 
ATOM   3995 S SG  . CYS D 2 131 ? -36.647 -27.188 8.266   1.00 37.68 ? 281  CYS B SG  1 
ATOM   3996 N N   . ALA D 2 132 ? -37.673 -26.173 12.882  1.00 35.61 ? 282  ALA B N   1 
ATOM   3997 C CA  . ALA D 2 132 ? -37.901 -25.388 14.108  1.00 35.94 ? 282  ALA B CA  1 
ATOM   3998 C C   . ALA D 2 132 ? -38.114 -23.920 13.791  1.00 36.90 ? 282  ALA B C   1 
ATOM   3999 O O   . ALA D 2 132 ? -38.884 -23.231 14.488  1.00 38.11 ? 282  ALA B O   1 
ATOM   4000 C CB  . ALA D 2 132 ? -36.693 -25.536 15.077  1.00 36.04 ? 282  ALA B CB  1 
ATOM   4001 N N   . THR D 2 133 ? -37.405 -23.443 12.768  1.00 38.10 ? 283  THR B N   1 
ATOM   4002 C CA  . THR D 2 133 ? -37.508 -22.045 12.318  1.00 39.74 ? 283  THR B CA  1 
ATOM   4003 C C   . THR D 2 133 ? -38.094 -21.916 10.922  1.00 39.76 ? 283  THR B C   1 
ATOM   4004 O O   . THR D 2 133 ? -39.330 -21.932 10.782  1.00 40.25 ? 283  THR B O   1 
ATOM   4005 C CB  . THR D 2 133 ? -36.179 -21.216 12.542  1.00 40.69 ? 283  THR B CB  1 
ATOM   4006 O OG1 . THR D 2 133 ? -35.086 -21.796 11.814  1.00 39.36 ? 283  THR B OG1 1 
ATOM   4007 C CG2 . THR D 2 133 ? -35.839 -21.173 14.009  1.00 40.44 ? 283  THR B CG2 1 
ATOM   4008 N N   . GLU D 2 134 ? -37.244 -21.756 9.909   1.00 40.10 ? 284  GLU B N   1 
ATOM   4009 C CA  . GLU D 2 134 ? -37.657 -21.688 8.509   1.00 41.73 ? 284  GLU B CA  1 
ATOM   4010 C C   . GLU D 2 134 ? -36.731 -22.573 7.684   1.00 39.40 ? 284  GLU B C   1 
ATOM   4011 O O   . GLU D 2 134 ? -35.585 -22.853 8.070   1.00 38.05 ? 284  GLU B O   1 
ATOM   4012 C CB  . GLU D 2 134 ? -37.586 -20.257 7.931   1.00 40.76 ? 284  GLU B CB  1 
ATOM   4013 C CG  . GLU D 2 134 ? -38.108 -19.145 8.808   1.00 48.44 ? 284  GLU B CG  1 
ATOM   4014 C CD  . GLU D 2 134 ? -38.031 -17.799 8.097   1.00 47.73 ? 284  GLU B CD  1 
ATOM   4015 O OE1 . GLU D 2 134 ? -37.077 -17.638 7.292   1.00 55.45 ? 284  GLU B OE1 1 
ATOM   4016 O OE2 . GLU D 2 134 ? -38.917 -16.929 8.314   1.00 53.14 ? 284  GLU B OE2 1 
ATOM   4017 N N   . GLN D 2 135 ? -37.208 -22.999 6.528   1.00 38.31 ? 285  GLN B N   1 
ATOM   4018 C CA  . GLN D 2 135 ? -36.396 -23.766 5.612   1.00 39.08 ? 285  GLN B CA  1 
ATOM   4019 C C   . GLN D 2 135 ? -35.141 -23.034 5.241   1.00 39.31 ? 285  GLN B C   1 
ATOM   4020 O O   . GLN D 2 135 ? -34.054 -23.625 5.227   1.00 39.42 ? 285  GLN B O   1 
ATOM   4021 C CB  . GLN D 2 135 ? -37.194 -24.128 4.353   1.00 40.08 ? 285  GLN B CB  1 
ATOM   4022 C CG  . GLN D 2 135 ? -37.914 -25.423 4.516   1.00 39.51 ? 285  GLN B CG  1 
ATOM   4023 C CD  . GLN D 2 135 ? -38.576 -25.891 3.248   1.00 44.14 ? 285  GLN B CD  1 
ATOM   4024 O OE1 . GLN D 2 135 ? -38.464 -25.268 2.171   1.00 44.27 ? 285  GLN B OE1 1 
ATOM   4025 N NE2 . GLN D 2 135 ? -39.276 -27.004 3.363   1.00 38.58 ? 285  GLN B NE2 1 
ATOM   4026 N N   . SER D 2 136 ? -35.266 -21.737 4.947   1.00 38.48 ? 286  SER B N   1 
ATOM   4027 C CA  . SER D 2 136 ? -34.124 -20.979 4.439   1.00 37.67 ? 286  SER B CA  1 
ATOM   4028 C C   . SER D 2 136 ? -33.060 -20.775 5.522   1.00 37.46 ? 286  SER B C   1 
ATOM   4029 O O   . SER D 2 136 ? -31.861 -20.717 5.233   1.00 38.10 ? 286  SER B O   1 
ATOM   4030 C CB  . SER D 2 136 ? -34.613 -19.642 3.949   1.00 37.62 ? 286  SER B CB  1 
ATOM   4031 O OG  . SER D 2 136 ? -35.340 -19.023 4.997   1.00 38.14 ? 286  SER B OG  1 
ATOM   4032 N N   . ARG D 2 137 ? -33.476 -20.700 6.764   1.00 37.10 ? 287  ARG B N   1 
ATOM   4033 C CA  . ARG D 2 137 ? -32.495 -20.581 7.864   1.00 37.13 ? 287  ARG B CA  1 
ATOM   4034 C C   . ARG D 2 137 ? -31.781 -21.910 8.117   1.00 36.98 ? 287  ARG B C   1 
ATOM   4035 O O   . ARG D 2 137 ? -30.598 -21.913 8.479   1.00 35.66 ? 287  ARG B O   1 
ATOM   4036 C CB  . ARG D 2 137 ? -33.142 -20.108 9.168   1.00 36.84 ? 287  ARG B CB  1 
ATOM   4037 C CG  . ARG D 2 137 ? -33.678 -18.696 9.151   1.00 40.52 ? 287  ARG B CG  1 
ATOM   4038 C CD  . ARG D 2 137 ? -34.314 -18.359 10.492  1.00 44.33 ? 287  ARG B CD  1 
ATOM   4039 N NE  . ARG D 2 137 ? -35.483 -17.472 10.342  1.00 50.93 ? 287  ARG B NE  1 
ATOM   4040 C CZ  . ARG D 2 137 ? -36.357 -17.200 11.304  1.00 52.89 ? 287  ARG B CZ  1 
ATOM   4041 N NH1 . ARG D 2 137 ? -36.205 -17.731 12.521  1.00 55.87 ? 287  ARG B NH1 1 
ATOM   4042 N NH2 . ARG D 2 137 ? -37.381 -16.380 11.056  1.00 56.25 ? 287  ARG B NH2 1 
ATOM   4043 N N   . CYS D 2 138 ? -32.503 -23.017 7.944   1.00 36.64 ? 288  CYS B N   1 
ATOM   4044 C CA  . CYS D 2 138 ? -31.888 -24.343 7.950   1.00 36.28 ? 288  CYS B CA  1 
ATOM   4045 C C   . CYS D 2 138 ? -30.794 -24.473 6.878   1.00 35.94 ? 288  CYS B C   1 
ATOM   4046 O O   . CYS D 2 138 ? -29.651 -24.873 7.177   1.00 36.34 ? 288  CYS B O   1 
ATOM   4047 C CB  . CYS D 2 138 ? -32.938 -25.453 7.824   1.00 38.07 ? 288  CYS B CB  1 
ATOM   4048 S SG  . CYS D 2 138 ? -32.180 -27.126 7.738   1.00 38.33 ? 288  CYS B SG  1 
ATOM   4049 N N   . LEU D 2 139 ? -31.091 -24.091 5.635   1.00 32.80 ? 289  LEU B N   1 
ATOM   4050 C CA  . LEU D 2 139 ? -30.100 -24.212 4.575   1.00 32.60 ? 289  LEU B CA  1 
ATOM   4051 C C   . LEU D 2 139 ? -28.850 -23.378 4.866   1.00 32.80 ? 289  LEU B C   1 
ATOM   4052 O O   . LEU D 2 139 ? -27.724 -23.859 4.692   1.00 32.39 ? 289  LEU B O   1 
ATOM   4053 C CB  . LEU D 2 139 ? -30.686 -23.807 3.227   1.00 33.27 ? 289  LEU B CB  1 
ATOM   4054 C CG  . LEU D 2 139 ? -31.693 -24.803 2.691   1.00 33.72 ? 289  LEU B CG  1 
ATOM   4055 C CD1 . LEU D 2 139 ? -32.158 -24.237 1.285   1.00 35.45 ? 289  LEU B CD1 1 
ATOM   4056 C CD2 . LEU D 2 139 ? -31.120 -26.261 2.598   1.00 34.88 ? 289  LEU B CD2 1 
ATOM   4057 N N   . ARG D 2 140 ? -29.065 -22.141 5.288   1.00 33.41 ? 290  ARG B N   1 
ATOM   4058 C CA  . ARG D 2 140 ? -27.981 -21.266 5.686   1.00 33.83 ? 290  ARG B CA  1 
ATOM   4059 C C   . ARG D 2 140 ? -27.093 -21.926 6.777   1.00 33.69 ? 290  ARG B C   1 
ATOM   4060 O O   . ARG D 2 140 ? -25.846 -21.871 6.672   1.00 34.01 ? 290  ARG B O   1 
ATOM   4061 C CB  . ARG D 2 140 ? -28.526 -19.973 6.222   1.00 35.00 ? 290  ARG B CB  1 
ATOM   4062 C CG  . ARG D 2 140 ? -27.397 -18.940 6.426   1.00 39.37 ? 290  ARG B CG  1 
ATOM   4063 C CD  . ARG D 2 140 ? -27.925 -17.637 7.006   1.00 40.57 ? 290  ARG B CD  1 
ATOM   4064 N NE  . ARG D 2 140 ? -28.576 -16.789 6.000   1.00 45.11 ? 290  ARG B NE  1 
ATOM   4065 C CZ  . ARG D 2 140 ? -29.225 -15.653 6.304   1.00 50.43 ? 290  ARG B CZ  1 
ATOM   4066 N NH1 . ARG D 2 140 ? -29.279 -15.236 7.569   1.00 51.05 ? 290  ARG B NH1 1 
ATOM   4067 N NH2 . ARG D 2 140 ? -29.788 -14.907 5.350   1.00 48.81 ? 290  ARG B NH2 1 
ATOM   4068 N N   . ALA D 2 141 ? -27.717 -22.530 7.790   1.00 32.07 ? 291  ALA B N   1 
ATOM   4069 C CA  . ALA D 2 141 ? -26.956 -23.164 8.907   1.00 33.98 ? 291  ALA B CA  1 
ATOM   4070 C C   . ALA D 2 141 ? -26.225 -24.409 8.441   1.00 32.90 ? 291  ALA B C   1 
ATOM   4071 O O   . ALA D 2 141 ? -25.069 -24.672 8.850   1.00 32.65 ? 291  ALA B O   1 
ATOM   4072 C CB  . ALA D 2 141 ? -27.874 -23.514 10.082  1.00 32.48 ? 291  ALA B CB  1 
ATOM   4073 N N   . TYR D 2 142 ? -26.884 -25.168 7.578   1.00 33.23 ? 292  TYR B N   1 
ATOM   4074 C CA  . TYR D 2 142 ? -26.279 -26.345 6.948   1.00 33.62 ? 292  TYR B CA  1 
ATOM   4075 C C   . TYR D 2 142 ? -25.004 -26.015 6.148   1.00 33.78 ? 292  TYR B C   1 
ATOM   4076 O O   . TYR D 2 142 ? -23.917 -26.622 6.341   1.00 33.09 ? 292  TYR B O   1 
ATOM   4077 C CB  . TYR D 2 142 ? -27.348 -27.099 6.109   1.00 33.62 ? 292  TYR B CB  1 
ATOM   4078 C CG  . TYR D 2 142 ? -26.717 -28.261 5.348   1.00 34.86 ? 292  TYR B CG  1 
ATOM   4079 C CD1 . TYR D 2 142 ? -26.448 -29.492 5.984   1.00 32.88 ? 292  TYR B CD1 1 
ATOM   4080 C CD2 . TYR D 2 142 ? -26.403 -28.127 3.995   1.00 34.70 ? 292  TYR B CD2 1 
ATOM   4081 C CE1 . TYR D 2 142 ? -25.872 -30.563 5.299   1.00 30.32 ? 292  TYR B CE1 1 
ATOM   4082 C CE2 . TYR D 2 142 ? -25.780 -29.181 3.294   1.00 34.36 ? 292  TYR B CE2 1 
ATOM   4083 C CZ  . TYR D 2 142 ? -25.524 -30.387 3.958   1.00 33.63 ? 292  TYR B CZ  1 
ATOM   4084 O OH  . TYR D 2 142 ? -24.929 -31.398 3.246   1.00 35.07 ? 292  TYR B OH  1 
ATOM   4085 N N   . LEU D 2 143 ? -25.105 -25.041 5.243   1.00 33.92 ? 293  LEU B N   1 
ATOM   4086 C CA  . LEU D 2 143 ? -23.947 -24.635 4.443   1.00 34.20 ? 293  LEU B CA  1 
ATOM   4087 C C   . LEU D 2 143 ? -22.872 -23.972 5.315   1.00 34.00 ? 293  LEU B C   1 
ATOM   4088 O O   . LEU D 2 143 ? -21.699 -24.080 4.988   1.00 35.61 ? 293  LEU B O   1 
ATOM   4089 C CB  . LEU D 2 143 ? -24.392 -23.683 3.341   1.00 33.41 ? 293  LEU B CB  1 
ATOM   4090 C CG  . LEU D 2 143 ? -25.367 -24.327 2.326   1.00 35.91 ? 293  LEU B CG  1 
ATOM   4091 C CD1 . LEU D 2 143 ? -25.872 -23.180 1.403   1.00 37.34 ? 293  LEU B CD1 1 
ATOM   4092 C CD2 . LEU D 2 143 ? -24.708 -25.384 1.556   1.00 35.73 ? 293  LEU B CD2 1 
ATOM   4093 N N   . GLY D 2 144 ? -23.292 -23.347 6.426   1.00 33.25 ? 294  GLY B N   1 
ATOM   4094 C CA  . GLY D 2 144 ? -22.384 -22.821 7.450   1.00 32.64 ? 294  GLY B CA  1 
ATOM   4095 C C   . GLY D 2 144 ? -21.482 -23.846 8.134   1.00 33.39 ? 294  GLY B C   1 
ATOM   4096 O O   . GLY D 2 144 ? -20.506 -23.485 8.820   1.00 32.71 ? 294  GLY B O   1 
ATOM   4097 N N   . LEU D 2 145 ? -21.776 -25.127 7.943   1.00 32.94 ? 295  LEU B N   1 
ATOM   4098 C CA  . LEU D 2 145 ? -20.889 -26.193 8.477   1.00 34.92 ? 295  LEU B CA  1 
ATOM   4099 C C   . LEU D 2 145 ? -19.753 -26.599 7.529   1.00 34.29 ? 295  LEU B C   1 
ATOM   4100 O O   . LEU D 2 145 ? -18.778 -27.235 7.949   1.00 34.93 ? 295  LEU B O   1 
ATOM   4101 C CB  . LEU D 2 145 ? -21.720 -27.433 8.836   1.00 34.45 ? 295  LEU B CB  1 
ATOM   4102 C CG  . LEU D 2 145 ? -22.805 -27.415 9.949   1.00 35.55 ? 295  LEU B CG  1 
ATOM   4103 C CD1 . LEU D 2 145 ? -23.643 -28.745 9.912   1.00 38.32 ? 295  LEU B CD1 1 
ATOM   4104 C CD2 . LEU D 2 145 ? -22.169 -27.154 11.260  1.00 37.46 ? 295  LEU B CD2 1 
ATOM   4105 N N   . ILE D 2 146 ? -19.869 -26.237 6.267   1.00 34.74 ? 296  ILE B N   1 
ATOM   4106 C CA  . ILE D 2 146 ? -18.882 -26.576 5.239   1.00 34.64 ? 296  ILE B CA  1 
ATOM   4107 C C   . ILE D 2 146 ? -17.581 -25.783 5.442   1.00 34.84 ? 296  ILE B C   1 
ATOM   4108 O O   . ILE D 2 146 ? -17.591 -24.531 5.438   1.00 35.89 ? 296  ILE B O   1 
ATOM   4109 C CB  . ILE D 2 146 ? -19.454 -26.407 3.814   1.00 34.88 ? 296  ILE B CB  1 
ATOM   4110 C CG1 . ILE D 2 146 ? -20.738 -27.217 3.646   1.00 33.74 ? 296  ILE B CG1 1 
ATOM   4111 C CG2 . ILE D 2 146 ? -18.391 -26.797 2.748   1.00 36.41 ? 296  ILE B CG2 1 
ATOM   4112 C CD1 . ILE D 2 146 ? -21.405 -26.996 2.271   1.00 35.75 ? 296  ILE B CD1 1 
ATOM   4113 N N   . GLY D 2 147 ? -16.486 -26.517 5.653   1.00 34.03 ? 297  GLY B N   1 
ATOM   4114 C CA  . GLY D 2 147 ? -15.163 -25.937 5.983   1.00 33.50 ? 297  GLY B CA  1 
ATOM   4115 C C   . GLY D 2 147 ? -14.873 -26.018 7.470   1.00 33.72 ? 297  GLY B C   1 
ATOM   4116 O O   . GLY D 2 147 ? -13.762 -25.616 7.969   1.00 33.53 ? 297  GLY B O   1 
ATOM   4117 N N   . THR D 2 148 ? -15.850 -26.529 8.216   1.00 33.60 ? 298  THR B N   1 
ATOM   4118 C CA  . THR D 2 148 ? -15.594 -26.849 9.653   1.00 33.48 ? 298  THR B CA  1 
ATOM   4119 C C   . THR D 2 148 ? -15.158 -28.320 9.884   1.00 34.80 ? 298  THR B C   1 
ATOM   4120 O O   . THR D 2 148 ? -15.091 -29.161 8.957   1.00 34.67 ? 298  THR B O   1 
ATOM   4121 C CB  . THR D 2 148 ? -16.827 -26.582 10.567  1.00 33.79 ? 298  THR B CB  1 
ATOM   4122 O OG1 . THR D 2 148 ? -17.815 -27.603 10.357  1.00 32.04 ? 298  THR B OG1 1 
ATOM   4123 C CG2 . THR D 2 148 ? -17.462 -25.205 10.324  1.00 32.69 ? 298  THR B CG2 1 
ATOM   4124 N N   . ALA D 2 149 ? -14.892 -28.652 11.139  1.00 35.35 ? 299  ALA B N   1 
ATOM   4125 C CA  . ALA D 2 149 ? -14.566 -30.028 11.487  1.00 36.31 ? 299  ALA B CA  1 
ATOM   4126 C C   . ALA D 2 149 ? -15.750 -30.960 11.178  1.00 37.45 ? 299  ALA B C   1 
ATOM   4127 O O   . ALA D 2 149 ? -15.581 -32.175 11.080  1.00 38.99 ? 299  ALA B O   1 
ATOM   4128 C CB  . ALA D 2 149 ? -14.189 -30.112 12.954  1.00 37.34 ? 299  ALA B CB  1 
ATOM   4129 N N   . MET D 2 150 ? -16.947 -30.411 11.014  1.00 35.81 ? 300  MET B N   1 
ATOM   4130 C CA  . MET D 2 150 ? -18.119 -31.230 10.755  1.00 37.22 ? 300  MET B CA  1 
ATOM   4131 C C   . MET D 2 150 ? -18.707 -30.901 9.394   1.00 35.29 ? 300  MET B C   1 
ATOM   4132 O O   . MET D 2 150 ? -19.885 -30.551 9.266   1.00 36.58 ? 300  MET B O   1 
ATOM   4133 C CB  . MET D 2 150 ? -19.166 -31.055 11.861  1.00 37.22 ? 300  MET B CB  1 
ATOM   4134 C CG  . MET D 2 150 ? -18.863 -31.912 13.114  1.00 39.36 ? 300  MET B CG  1 
ATOM   4135 S SD  . MET D 2 150 ? -20.055 -31.607 14.415  1.00 44.19 ? 300  MET B SD  1 
ATOM   4136 C CE  . MET D 2 150 ? -21.400 -32.673 13.946  1.00 43.41 ? 300  MET B CE  1 
ATOM   4137 N N   . THR D 2 151 ? -17.890 -31.072 8.368   1.00 34.06 ? 301  THR B N   1 
ATOM   4138 C CA  . THR D 2 151 ? -18.235 -30.643 7.018   1.00 34.12 ? 301  THR B CA  1 
ATOM   4139 C C   . THR D 2 151 ? -19.145 -31.736 6.431   1.00 34.00 ? 301  THR B C   1 
ATOM   4140 O O   . THR D 2 151 ? -18.692 -32.911 6.249   1.00 33.30 ? 301  THR B O   1 
ATOM   4141 C CB  . THR D 2 151 ? -16.987 -30.425 6.145   1.00 32.29 ? 301  THR B CB  1 
ATOM   4142 O OG1 . THR D 2 151 ? -16.361 -29.199 6.514   1.00 34.94 ? 301  THR B OG1 1 
ATOM   4143 C CG2 . THR D 2 151 ? -17.343 -30.350 4.625   1.00 36.12 ? 301  THR B CG2 1 
ATOM   4144 N N   . PRO D 2 152 ? -20.408 -31.379 6.163   1.00 34.45 ? 302  PRO B N   1 
ATOM   4145 C CA  . PRO D 2 152 ? -21.308 -32.367 5.508   1.00 34.06 ? 302  PRO B CA  1 
ATOM   4146 C C   . PRO D 2 152 ? -21.138 -32.350 3.984   1.00 34.74 ? 302  PRO B C   1 
ATOM   4147 O O   . PRO D 2 152 ? -20.693 -31.337 3.435   1.00 34.58 ? 302  PRO B O   1 
ATOM   4148 C CB  . PRO D 2 152 ? -22.702 -31.845 5.855   1.00 34.95 ? 302  PRO B CB  1 
ATOM   4149 C CG  . PRO D 2 152 ? -22.514 -30.277 5.800   1.00 35.09 ? 302  PRO B CG  1 
ATOM   4150 C CD  . PRO D 2 152 ? -21.089 -30.084 6.415   1.00 35.12 ? 302  PRO B CD  1 
ATOM   4151 N N   . ASN D 2 153 ? -21.459 -33.466 3.318   1.00 32.86 ? 303  ASN B N   1 
ATOM   4152 C CA  . ASN D 2 153 ? -21.423 -33.519 1.856   1.00 32.96 ? 303  ASN B CA  1 
ATOM   4153 C C   . ASN D 2 153 ? -22.390 -34.569 1.308   1.00 33.21 ? 303  ASN B C   1 
ATOM   4154 O O   . ASN D 2 153 ? -22.770 -35.466 2.027   1.00 34.05 ? 303  ASN B O   1 
ATOM   4155 C CB  . ASN D 2 153 ? -20.004 -33.861 1.335   1.00 31.66 ? 303  ASN B CB  1 
ATOM   4156 C CG  . ASN D 2 153 ? -19.851 -33.521 -0.128  1.00 30.52 ? 303  ASN B CG  1 
ATOM   4157 O OD1 . ASN D 2 153 ? -20.475 -32.562 -0.622  1.00 33.55 ? 303  ASN B OD1 1 
ATOM   4158 N ND2 . ASN D 2 153 ? -19.078 -34.318 -0.846  1.00 29.00 ? 303  ASN B ND2 1 
ATOM   4159 N N   . PHE D 2 154 ? -22.763 -34.483 0.026   1.00 33.24 ? 304  PHE B N   1 
ATOM   4160 C CA  . PHE D 2 154 ? -23.483 -35.577 -0.653  1.00 32.05 ? 304  PHE B CA  1 
ATOM   4161 C C   . PHE D 2 154 ? -22.715 -36.867 -0.596  1.00 32.76 ? 304  PHE B C   1 
ATOM   4162 O O   . PHE D 2 154 ? -21.494 -36.872 -0.813  1.00 32.17 ? 304  PHE B O   1 
ATOM   4163 C CB  . PHE D 2 154 ? -23.801 -35.177 -2.089  1.00 31.90 ? 304  PHE B CB  1 
ATOM   4164 C CG  . PHE D 2 154 ? -24.679 -33.952 -2.171  1.00 31.10 ? 304  PHE B CG  1 
ATOM   4165 C CD1 . PHE D 2 154 ? -24.150 -32.690 -2.452  1.00 30.72 ? 304  PHE B CD1 1 
ATOM   4166 C CD2 . PHE D 2 154 ? -26.069 -34.063 -1.911  1.00 31.69 ? 304  PHE B CD2 1 
ATOM   4167 C CE1 . PHE D 2 154 ? -25.003 -31.531 -2.452  1.00 31.25 ? 304  PHE B CE1 1 
ATOM   4168 C CE2 . PHE D 2 154 ? -26.917 -32.947 -1.933  1.00 35.87 ? 304  PHE B CE2 1 
ATOM   4169 C CZ  . PHE D 2 154 ? -26.375 -31.656 -2.230  1.00 35.17 ? 304  PHE B CZ  1 
ATOM   4170 N N   . VAL D 2 155 ? -23.437 -37.957 -0.284  1.00 32.37 ? 305  VAL B N   1 
ATOM   4171 C CA  . VAL D 2 155 ? -22.906 -39.324 -0.153  1.00 34.33 ? 305  VAL B CA  1 
ATOM   4172 C C   . VAL D 2 155 ? -22.787 -40.033 -1.510  1.00 33.30 ? 305  VAL B C   1 
ATOM   4173 O O   . VAL D 2 155 ? -21.911 -40.877 -1.698  1.00 33.93 ? 305  VAL B O   1 
ATOM   4174 C CB  . VAL D 2 155 ? -23.876 -40.150 0.796   1.00 34.06 ? 305  VAL B CB  1 
ATOM   4175 C CG1 . VAL D 2 155 ? -23.688 -41.653 0.705   1.00 39.67 ? 305  VAL B CG1 1 
ATOM   4176 C CG2 . VAL D 2 155 ? -23.643 -39.709 2.204   1.00 36.90 ? 305  VAL B CG2 1 
ATOM   4177 N N   . SER D 2 156 ? -23.645 -39.658 -2.457  1.00 32.11 ? 306  SER B N   1 
ATOM   4178 C CA  . SER D 2 156 ? -23.775 -40.417 -3.694  1.00 32.09 ? 306  SER B CA  1 
ATOM   4179 C C   . SER D 2 156 ? -23.855 -39.547 -4.945  1.00 32.78 ? 306  SER B C   1 
ATOM   4180 O O   . SER D 2 156 ? -24.289 -38.402 -4.902  1.00 32.56 ? 306  SER B O   1 
ATOM   4181 C CB  . SER D 2 156 ? -25.052 -41.282 -3.564  1.00 32.98 ? 306  SER B CB  1 
ATOM   4182 O OG  . SER D 2 156 ? -25.468 -41.869 -4.787  1.00 34.05 ? 306  SER B OG  1 
ATOM   4183 N N   . ASN D 2 157 ? -23.482 -40.105 -6.088  1.00 33.01 ? 307  ASN B N   1 
ATOM   4184 C CA  . ASN D 2 157 ? -23.678 -39.348 -7.275  1.00 34.73 ? 307  ASN B CA  1 
ATOM   4185 C C   . ASN D 2 157 ? -24.990 -39.667 -7.959  1.00 34.54 ? 307  ASN B C   1 
ATOM   4186 O O   . ASN D 2 157 ? -25.307 -39.063 -8.970  1.00 34.24 ? 307  ASN B O   1 
ATOM   4187 C CB  . ASN D 2 157 ? -22.463 -39.398 -8.234  1.00 35.84 ? 307  ASN B CB  1 
ATOM   4188 C CG  . ASN D 2 157 ? -22.040 -40.756 -8.563  1.00 38.31 ? 307  ASN B CG  1 
ATOM   4189 O OD1 . ASN D 2 157 ? -22.835 -41.699 -8.513  1.00 42.88 ? 307  ASN B OD1 1 
ATOM   4190 N ND2 . ASN D 2 157 ? -20.749 -40.902 -8.946  1.00 40.52 ? 307  ASN B ND2 1 
ATOM   4191 N N   . VAL D 2 158 ? -25.764 -40.593 -7.375  1.00 34.68 ? 308  VAL B N   1 
ATOM   4192 C CA  . VAL D 2 158 ? -27.114 -40.894 -7.880  1.00 34.59 ? 308  VAL B CA  1 
ATOM   4193 C C   . VAL D 2 158 ? -28.291 -40.514 -6.997  1.00 34.49 ? 308  VAL B C   1 
ATOM   4194 O O   . VAL D 2 158 ? -29.455 -40.787 -7.358  1.00 33.91 ? 308  VAL B O   1 
ATOM   4195 C CB  . VAL D 2 158 ? -27.274 -42.358 -8.262  1.00 35.21 ? 308  VAL B CB  1 
ATOM   4196 C CG1 . VAL D 2 158 ? -26.410 -42.644 -9.446  1.00 36.12 ? 308  VAL B CG1 1 
ATOM   4197 C CG2 . VAL D 2 158 ? -26.952 -43.274 -7.077  1.00 37.62 ? 308  VAL B CG2 1 
ATOM   4198 N N   . ASN D 2 159 ? -28.020 -39.903 -5.845  1.00 34.18 ? 309  ASN B N   1 
ATOM   4199 C CA  . ASN D 2 159 ? -29.094 -39.449 -4.940  1.00 33.64 ? 309  ASN B CA  1 
ATOM   4200 C C   . ASN D 2 159 ? -28.660 -38.234 -4.165  1.00 34.66 ? 309  ASN B C   1 
ATOM   4201 O O   . ASN D 2 159 ? -27.479 -37.848 -4.267  1.00 32.63 ? 309  ASN B O   1 
ATOM   4202 C CB  . ASN D 2 159 ? -29.633 -40.598 -4.042  1.00 35.96 ? 309  ASN B CB  1 
ATOM   4203 C CG  . ASN D 2 159 ? -28.666 -41.042 -2.964  1.00 34.81 ? 309  ASN B CG  1 
ATOM   4204 O OD1 . ASN D 2 159 ? -28.080 -40.212 -2.267  1.00 35.04 ? 309  ASN B OD1 1 
ATOM   4205 N ND2 . ASN D 2 159 ? -28.507 -42.378 -2.814  1.00 35.40 ? 309  ASN B ND2 1 
ATOM   4206 N N   . THR D 2 160 ? -29.588 -37.627 -3.394  1.00 33.23 ? 310  THR B N   1 
ATOM   4207 C CA  . THR D 2 160 ? -29.325 -36.364 -2.760  1.00 34.18 ? 310  THR B CA  1 
ATOM   4208 C C   . THR D 2 160 ? -29.082 -36.525 -1.250  1.00 32.62 ? 310  THR B C   1 
ATOM   4209 O O   . THR D 2 160 ? -29.078 -35.553 -0.533  1.00 33.93 ? 310  THR B O   1 
ATOM   4210 C CB  . THR D 2 160 ? -30.457 -35.356 -3.010  1.00 34.40 ? 310  THR B CB  1 
ATOM   4211 O OG1 . THR D 2 160 ? -31.638 -35.816 -2.355  1.00 37.50 ? 310  THR B OG1 1 
ATOM   4212 C CG2 . THR D 2 160 ? -30.816 -35.267 -4.497  1.00 36.52 ? 310  THR B CG2 1 
ATOM   4213 N N   . SER D 2 161 ? -28.834 -37.736 -0.771  1.00 32.36 ? 311  SER B N   1 
ATOM   4214 C CA  . SER D 2 161 ? -28.529 -37.892 0.655   1.00 32.15 ? 311  SER B CA  1 
ATOM   4215 C C   . SER D 2 161 ? -27.219 -37.216 1.015   1.00 31.99 ? 311  SER B C   1 
ATOM   4216 O O   . SER D 2 161 ? -26.306 -37.182 0.210   1.00 30.08 ? 311  SER B O   1 
ATOM   4217 C CB  . SER D 2 161 ? -28.480 -39.366 1.065   1.00 32.18 ? 311  SER B CB  1 
ATOM   4218 O OG  . SER D 2 161 ? -29.749 -39.978 0.888   1.00 35.38 ? 311  SER B OG  1 
ATOM   4219 N N   . VAL D 2 162 ? -27.133 -36.702 2.242   1.00 31.96 ? 312  VAL B N   1 
ATOM   4220 C CA  . VAL D 2 162 ? -25.981 -35.941 2.711   1.00 33.29 ? 312  VAL B CA  1 
ATOM   4221 C C   . VAL D 2 162 ? -25.571 -36.499 4.097   1.00 33.00 ? 312  VAL B C   1 
ATOM   4222 O O   . VAL D 2 162 ? -26.407 -37.087 4.790   1.00 33.65 ? 312  VAL B O   1 
ATOM   4223 C CB  . VAL D 2 162 ? -26.333 -34.460 2.752   1.00 33.40 ? 312  VAL B CB  1 
ATOM   4224 C CG1 . VAL D 2 162 ? -27.475 -34.169 3.811   1.00 36.29 ? 312  VAL B CG1 1 
ATOM   4225 C CG2 . VAL D 2 162 ? -25.161 -33.701 3.162   1.00 40.40 ? 312  VAL B CG2 1 
ATOM   4226 N N   . ALA D 2 163 ? -24.293 -36.397 4.465   1.00 35.01 ? 313  ALA B N   1 
ATOM   4227 C CA  . ALA D 2 163 ? -23.822 -36.973 5.730   1.00 34.28 ? 313  ALA B CA  1 
ATOM   4228 C C   . ALA D 2 163 ? -22.489 -36.383 6.130   1.00 36.06 ? 313  ALA B C   1 
ATOM   4229 O O   . ALA D 2 163 ? -21.798 -35.787 5.290   1.00 36.97 ? 313  ALA B O   1 
ATOM   4230 C CB  . ALA D 2 163 ? -23.657 -38.460 5.540   1.00 35.97 ? 313  ALA B CB  1 
ATOM   4231 N N   . LEU D 2 164 ? -22.077 -36.604 7.384   1.00 35.96 ? 314  LEU B N   1 
ATOM   4232 C CA  . LEU D 2 164 ? -20.717 -36.256 7.784   1.00 36.90 ? 314  LEU B CA  1 
ATOM   4233 C C   . LEU D 2 164 ? -19.743 -37.349 7.359   1.00 37.61 ? 314  LEU B C   1 
ATOM   4234 O O   . LEU D 2 164 ? -20.147 -38.481 7.074   1.00 37.89 ? 314  LEU B O   1 
ATOM   4235 C CB  . LEU D 2 164 ? -20.639 -35.990 9.308   1.00 36.81 ? 314  LEU B CB  1 
ATOM   4236 C CG  . LEU D 2 164 ? -21.627 -34.988 9.885   1.00 35.19 ? 314  LEU B CG  1 
ATOM   4237 C CD1 . LEU D 2 164 ? -21.654 -35.109 11.368  1.00 40.32 ? 314  LEU B CD1 1 
ATOM   4238 C CD2 . LEU D 2 164 ? -21.166 -33.614 9.493   1.00 38.39 ? 314  LEU B CD2 1 
ATOM   4239 N N   . SER D 2 165 ? -18.454 -37.013 7.322   1.00 38.68 ? 315  SER B N   1 
ATOM   4240 C CA  . SER D 2 165 ? -17.410 -37.983 7.032   1.00 39.54 ? 315  SER B CA  1 
ATOM   4241 C C   . SER D 2 165 ? -16.935 -38.594 8.330   1.00 40.99 ? 315  SER B C   1 
ATOM   4242 O O   . SER D 2 165 ? -15.897 -38.180 8.893   1.00 40.18 ? 315  SER B O   1 
ATOM   4243 C CB  . SER D 2 165 ? -16.246 -37.337 6.281   1.00 39.73 ? 315  SER B CB  1 
ATOM   4244 O OG  . SER D 2 165 ? -15.354 -38.326 5.743   1.00 43.26 ? 315  SER B OG  1 
ATOM   4245 N N   . CYS D 2 166 ? -17.713 -39.564 8.810   1.00 41.05 ? 316  CYS B N   1 
ATOM   4246 C CA  . CYS D 2 166 ? -17.486 -40.180 10.104  1.00 41.83 ? 316  CYS B CA  1 
ATOM   4247 C C   . CYS D 2 166 ? -18.234 -41.511 10.160  1.00 41.67 ? 316  CYS B C   1 
ATOM   4248 O O   . CYS D 2 166 ? -19.057 -41.827 9.287   1.00 40.76 ? 316  CYS B O   1 
ATOM   4249 C CB  . CYS D 2 166 ? -17.983 -39.258 11.219  1.00 42.61 ? 316  CYS B CB  1 
ATOM   4250 S SG  . CYS D 2 166 ? -19.761 -39.237 11.197  1.00 43.85 ? 316  CYS B SG  1 
ATOM   4251 N N   . THR D 2 167 ? -17.929 -42.296 11.187  1.00 41.67 ? 317  THR B N   1 
ATOM   4252 C CA  . THR D 2 167 ? -18.559 -43.582 11.364  1.00 42.07 ? 317  THR B CA  1 
ATOM   4253 C C   . THR D 2 167 ? -18.969 -43.722 12.819  1.00 41.87 ? 317  THR B C   1 
ATOM   4254 O O   . THR D 2 167 ? -18.471 -42.984 13.666  1.00 40.90 ? 317  THR B O   1 
ATOM   4255 C CB  . THR D 2 167 ? -17.622 -44.749 10.913  1.00 41.72 ? 317  THR B CB  1 
ATOM   4256 O OG1 . THR D 2 167 ? -18.284 -45.996 11.136  1.00 44.33 ? 317  THR B OG1 1 
ATOM   4257 C CG2 . THR D 2 167 ? -16.293 -44.759 11.667  1.00 40.59 ? 317  THR B CG2 1 
ATOM   4258 N N   . CYS D 2 168 ? -19.881 -44.654 13.103  1.00 42.52 ? 318  CYS B N   1 
ATOM   4259 C CA  . CYS D 2 168 ? -20.159 -45.028 14.494  1.00 43.18 ? 318  CYS B CA  1 
ATOM   4260 C C   . CYS D 2 168 ? -19.494 -46.325 14.948  1.00 43.83 ? 318  CYS B C   1 
ATOM   4261 O O   . CYS D 2 168 ? -19.780 -46.842 16.027  1.00 43.11 ? 318  CYS B O   1 
ATOM   4262 C CB  . CYS D 2 168 ? -21.651 -44.970 14.812  1.00 43.15 ? 318  CYS B CB  1 
ATOM   4263 S SG  . CYS D 2 168 ? -22.239 -43.239 14.869  1.00 44.90 ? 318  CYS B SG  1 
ATOM   4264 N N   . ARG D 2 169 ? -18.566 -46.830 14.147  1.00 44.88 ? 319  ARG B N   1 
ATOM   4265 C CA  . ARG D 2 169 ? -17.737 -47.940 14.603  1.00 46.71 ? 319  ARG B CA  1 
ATOM   4266 C C   . ARG D 2 169 ? -16.827 -47.440 15.733  1.00 46.97 ? 319  ARG B C   1 
ATOM   4267 O O   . ARG D 2 169 ? -16.486 -46.241 15.784  1.00 47.11 ? 319  ARG B O   1 
ATOM   4268 C CB  . ARG D 2 169 ? -16.924 -48.537 13.445  1.00 46.86 ? 319  ARG B CB  1 
ATOM   4269 C CG  . ARG D 2 169 ? -17.781 -49.254 12.400  1.00 48.09 ? 319  ARG B CG  1 
ATOM   4270 C CD  . ARG D 2 169 ? -16.968 -50.186 11.489  1.00 48.56 ? 319  ARG B CD  1 
ATOM   4271 N NE  . ARG D 2 169 ? -17.527 -50.209 10.130  1.00 53.43 ? 319  ARG B NE  1 
ATOM   4272 C CZ  . ARG D 2 169 ? -17.146 -51.020 9.142   1.00 53.47 ? 319  ARG B CZ  1 
ATOM   4273 N NH1 . ARG D 2 169 ? -16.195 -51.929 9.325   1.00 52.05 ? 319  ARG B NH1 1 
ATOM   4274 N NH2 . ARG D 2 169 ? -17.734 -50.913 7.952   1.00 54.20 ? 319  ARG B NH2 1 
ATOM   4275 N N   . GLY D 2 170 ? -16.464 -48.348 16.647  1.00 47.41 ? 320  GLY B N   1 
ATOM   4276 C CA  . GLY D 2 170 ? -15.646 -48.010 17.815  1.00 47.57 ? 320  GLY B CA  1 
ATOM   4277 C C   . GLY D 2 170 ? -16.305 -46.973 18.710  1.00 47.86 ? 320  GLY B C   1 
ATOM   4278 O O   . GLY D 2 170 ? -15.661 -46.000 19.123  1.00 48.09 ? 320  GLY B O   1 
ATOM   4279 N N   . SER D 2 171 ? -17.595 -47.174 18.992  1.00 47.64 ? 321  SER B N   1 
ATOM   4280 C CA  . SER D 2 171 ? -18.392 -46.216 19.777  1.00 47.10 ? 321  SER B CA  1 
ATOM   4281 C C   . SER D 2 171 ? -18.673 -46.745 21.185  1.00 46.44 ? 321  SER B C   1 
ATOM   4282 O O   . SER D 2 171 ? -18.768 -45.969 22.138  1.00 46.02 ? 321  SER B O   1 
ATOM   4283 C CB  . SER D 2 171 ? -19.712 -45.869 19.070  1.00 46.61 ? 321  SER B CB  1 
ATOM   4284 O OG  . SER D 2 171 ? -19.636 -44.635 18.360  1.00 46.81 ? 321  SER B OG  1 
ATOM   4285 N N   . GLY D 2 172 ? -18.819 -48.061 21.293  1.00 46.36 ? 322  GLY B N   1 
ATOM   4286 C CA  . GLY D 2 172 ? -19.043 -48.734 22.575  1.00 45.93 ? 322  GLY B CA  1 
ATOM   4287 C C   . GLY D 2 172 ? -20.337 -48.322 23.255  1.00 45.92 ? 322  GLY B C   1 
ATOM   4288 O O   . GLY D 2 172 ? -21.405 -48.259 22.601  1.00 45.94 ? 322  GLY B O   1 
ATOM   4289 N N   . ASN D 2 173 ? -20.222 -48.005 24.563  1.00 45.67 ? 323  ASN B N   1 
ATOM   4290 C CA  . ASN D 2 173 ? -21.359 -47.577 25.389  1.00 45.81 ? 323  ASN B CA  1 
ATOM   4291 C C   . ASN D 2 173 ? -22.047 -46.347 24.815  1.00 45.39 ? 323  ASN B C   1 
ATOM   4292 O O   . ASN D 2 173 ? -23.117 -45.945 25.273  1.00 45.84 ? 323  ASN B O   1 
ATOM   4293 C CB  . ASN D 2 173 ? -20.905 -47.268 26.824  1.00 45.82 ? 323  ASN B CB  1 
ATOM   4294 C CG  . ASN D 2 173 ? -20.103 -48.400 27.446  1.00 47.92 ? 323  ASN B CG  1 
ATOM   4295 O OD1 . ASN D 2 173 ? -20.416 -48.852 28.576  1.00 48.69 ? 323  ASN B OD1 1 
ATOM   4296 N ND2 . ASN D 2 173 ? -19.051 -48.865 26.715  1.00 49.55 ? 323  ASN B ND2 1 
ATOM   4297 N N   . LEU D 2 174 ? -21.423 -45.756 23.802  1.00 45.03 ? 324  LEU B N   1 
ATOM   4298 C CA  . LEU D 2 174 ? -21.905 -44.514 23.204  1.00 44.28 ? 324  LEU B CA  1 
ATOM   4299 C C   . LEU D 2 174 ? -22.502 -44.717 21.807  1.00 43.85 ? 324  LEU B C   1 
ATOM   4300 O O   . LEU D 2 174 ? -22.494 -43.806 20.995  1.00 43.15 ? 324  LEU B O   1 
ATOM   4301 C CB  . LEU D 2 174 ? -20.755 -43.507 23.142  1.00 44.17 ? 324  LEU B CB  1 
ATOM   4302 C CG  . LEU D 2 174 ? -20.226 -42.911 24.445  1.00 45.19 ? 324  LEU B CG  1 
ATOM   4303 C CD1 . LEU D 2 174 ? -18.746 -42.581 24.280  1.00 47.40 ? 324  LEU B CD1 1 
ATOM   4304 C CD2 . LEU D 2 174 ? -21.013 -41.673 24.839  1.00 45.72 ? 324  LEU B CD2 1 
ATOM   4305 N N   . GLN D 2 175 ? -23.029 -45.906 21.538  1.00 43.70 ? 325  GLN B N   1 
ATOM   4306 C CA  . GLN D 2 175 ? -23.561 -46.221 20.211  1.00 43.88 ? 325  GLN B CA  1 
ATOM   4307 C C   . GLN D 2 175 ? -24.763 -45.382 19.815  1.00 43.83 ? 325  GLN B C   1 
ATOM   4308 O O   . GLN D 2 175 ? -24.822 -44.899 18.686  1.00 44.10 ? 325  GLN B O   1 
ATOM   4309 C CB  . GLN D 2 175 ? -23.931 -47.703 20.093  1.00 43.87 ? 325  GLN B CB  1 
ATOM   4310 C CG  . GLN D 2 175 ? -24.244 -48.172 18.662  1.00 44.35 ? 325  GLN B CG  1 
ATOM   4311 C CD  . GLN D 2 175 ? -23.038 -48.088 17.735  1.00 45.90 ? 325  GLN B CD  1 
ATOM   4312 O OE1 . GLN D 2 175 ? -21.904 -48.360 18.143  1.00 47.49 ? 325  GLN B OE1 1 
ATOM   4313 N NE2 . GLN D 2 175 ? -23.277 -47.709 16.480  1.00 46.29 ? 325  GLN B NE2 1 
ATOM   4314 N N   . GLU D 2 176 ? -25.731 -45.241 20.722  1.00 44.17 ? 326  GLU B N   1 
ATOM   4315 C CA  . GLU D 2 176 ? -27.014 -44.584 20.403  1.00 44.90 ? 326  GLU B CA  1 
ATOM   4316 C C   . GLU D 2 176 ? -26.860 -43.085 20.209  1.00 43.69 ? 326  GLU B C   1 
ATOM   4317 O O   . GLU D 2 176 ? -27.435 -42.517 19.280  1.00 44.10 ? 326  GLU B O   1 
ATOM   4318 C CB  . GLU D 2 176 ? -28.045 -44.817 21.501  1.00 44.71 ? 326  GLU B CB  1 
ATOM   4319 C CG  . GLU D 2 176 ? -28.720 -46.170 21.481  1.00 47.44 ? 326  GLU B CG  1 
ATOM   4320 C CD  . GLU D 2 176 ? -29.705 -46.326 22.638  1.00 47.61 ? 326  GLU B CD  1 
ATOM   4321 O OE1 . GLU D 2 176 ? -29.721 -47.407 23.274  1.00 50.53 ? 326  GLU B OE1 1 
ATOM   4322 O OE2 . GLU D 2 176 ? -30.453 -45.350 22.908  1.00 52.00 ? 326  GLU B OE2 1 
ATOM   4323 N N   . GLU D 2 177 ? -26.117 -42.457 21.122  1.00 42.92 ? 327  GLU B N   1 
ATOM   4324 C CA  . GLU D 2 177 ? -25.727 -41.054 21.033  1.00 42.96 ? 327  GLU B CA  1 
ATOM   4325 C C   . GLU D 2 177 ? -25.050 -40.757 19.682  1.00 41.85 ? 327  GLU B C   1 
ATOM   4326 O O   . GLU D 2 177 ? -25.361 -39.754 19.020  1.00 41.48 ? 327  GLU B O   1 
ATOM   4327 C CB  . GLU D 2 177 ? -24.816 -40.721 22.223  1.00 43.53 ? 327  GLU B CB  1 
ATOM   4328 C CG  . GLU D 2 177 ? -23.952 -39.484 22.053  1.00 48.15 ? 327  GLU B CG  1 
ATOM   4329 C CD  . GLU D 2 177 ? -24.340 -38.348 22.980  1.00 54.21 ? 327  GLU B CD  1 
ATOM   4330 O OE1 . GLU D 2 177 ? -23.671 -38.204 24.035  1.00 55.29 ? 327  GLU B OE1 1 
ATOM   4331 O OE2 . GLU D 2 177 ? -25.314 -37.618 22.657  1.00 55.92 ? 327  GLU B OE2 1 
ATOM   4332 N N   . CYS D 2 178 ? -24.155 -41.656 19.269  1.00 40.96 ? 328  CYS B N   1 
ATOM   4333 C CA  . CYS D 2 178 ? -23.471 -41.546 17.994  1.00 40.62 ? 328  CYS B CA  1 
ATOM   4334 C C   . CYS D 2 178 ? -24.449 -41.603 16.819  1.00 40.15 ? 328  CYS B C   1 
ATOM   4335 O O   . CYS D 2 178 ? -24.385 -40.770 15.920  1.00 39.57 ? 328  CYS B O   1 
ATOM   4336 C CB  . CYS D 2 178 ? -22.390 -42.636 17.873  1.00 41.02 ? 328  CYS B CB  1 
ATOM   4337 S SG  . CYS D 2 178 ? -21.279 -42.352 16.466  1.00 42.24 ? 328  CYS B SG  1 
ATOM   4338 N N   . GLU D 2 179 ? -25.363 -42.575 16.837  1.00 40.48 ? 329  GLU B N   1 
ATOM   4339 C CA  . GLU D 2 179 ? -26.289 -42.829 15.701  1.00 40.10 ? 329  GLU B CA  1 
ATOM   4340 C C   . GLU D 2 179 ? -27.333 -41.723 15.623  1.00 39.47 ? 329  GLU B C   1 
ATOM   4341 O O   . GLU D 2 179 ? -27.852 -41.403 14.547  1.00 37.94 ? 329  GLU B O   1 
ATOM   4342 C CB  . GLU D 2 179 ? -26.974 -44.209 15.832  1.00 40.39 ? 329  GLU B CB  1 
ATOM   4343 C CG  . GLU D 2 179 ? -26.037 -45.420 15.730  1.00 41.41 ? 329  GLU B CG  1 
ATOM   4344 C CD  . GLU D 2 179 ? -26.724 -46.736 16.078  1.00 43.13 ? 329  GLU B CD  1 
ATOM   4345 O OE1 . GLU D 2 179 ? -27.868 -46.699 16.613  1.00 45.35 ? 329  GLU B OE1 1 
ATOM   4346 O OE2 . GLU D 2 179 ? -26.110 -47.810 15.817  1.00 47.36 ? 329  GLU B OE2 1 
ATOM   4347 N N   . MET D 2 180 ? -27.622 -41.146 16.782  1.00 38.42 ? 330  MET B N   1 
ATOM   4348 C CA  . MET D 2 180 ? -28.479 -39.974 16.919  1.00 39.97 ? 330  MET B CA  1 
ATOM   4349 C C   . MET D 2 180 ? -27.896 -38.759 16.187  1.00 37.31 ? 330  MET B C   1 
ATOM   4350 O O   . MET D 2 180 ? -28.615 -37.998 15.511  1.00 36.15 ? 330  MET B O   1 
ATOM   4351 C CB  . MET D 2 180 ? -28.596 -39.663 18.422  1.00 39.87 ? 330  MET B CB  1 
ATOM   4352 C CG  . MET D 2 180 ? -29.515 -38.515 18.842  1.00 43.08 ? 330  MET B CG  1 
ATOM   4353 S SD  . MET D 2 180 ? -30.389 -39.106 20.307  1.00 49.90 ? 330  MET B SD  1 
ATOM   4354 C CE  . MET D 2 180 ? -29.653 -38.180 21.670  1.00 50.11 ? 330  MET B CE  1 
ATOM   4355 N N   . LEU D 2 181 ? -26.583 -38.569 16.333  1.00 35.50 ? 331  LEU B N   1 
ATOM   4356 C CA  . LEU D 2 181 ? -25.869 -37.482 15.637  1.00 33.63 ? 331  LEU B CA  1 
ATOM   4357 C C   . LEU D 2 181 ? -25.893 -37.721 14.134  1.00 32.75 ? 331  LEU B C   1 
ATOM   4358 O O   . LEU D 2 181 ? -26.240 -36.821 13.350  1.00 33.44 ? 331  LEU B O   1 
ATOM   4359 C CB  . LEU D 2 181 ? -24.416 -37.387 16.156  1.00 33.59 ? 331  LEU B CB  1 
ATOM   4360 C CG  . LEU D 2 181 ? -23.445 -36.351 15.589  1.00 35.75 ? 331  LEU B CG  1 
ATOM   4361 C CD1 . LEU D 2 181 ? -24.054 -35.023 15.779  1.00 38.57 ? 331  LEU B CD1 1 
ATOM   4362 C CD2 . LEU D 2 181 ? -22.092 -36.392 16.332  1.00 31.26 ? 331  LEU B CD2 1 
ATOM   4363 N N   . GLU D 2 182 ? -25.544 -38.932 13.719  1.00 31.30 ? 332  GLU B N   1 
ATOM   4364 C CA  . GLU D 2 182 ? -25.646 -39.267 12.287  1.00 33.70 ? 332  GLU B CA  1 
ATOM   4365 C C   . GLU D 2 182 ? -27.047 -38.996 11.772  1.00 33.01 ? 332  GLU B C   1 
ATOM   4366 O O   . GLU D 2 182 ? -27.207 -38.443 10.681  1.00 32.60 ? 332  GLU B O   1 
ATOM   4367 C CB  . GLU D 2 182 ? -25.293 -40.729 12.056  1.00 33.21 ? 332  GLU B CB  1 
ATOM   4368 C CG  . GLU D 2 182 ? -23.815 -41.051 12.228  1.00 35.85 ? 332  GLU B CG  1 
ATOM   4369 C CD  . GLU D 2 182 ? -23.470 -42.468 11.740  1.00 37.01 ? 332  GLU B CD  1 
ATOM   4370 O OE1 . GLU D 2 182 ? -24.107 -43.444 12.205  1.00 39.70 ? 332  GLU B OE1 1 
ATOM   4371 O OE2 . GLU D 2 182 ? -22.539 -42.601 10.902  1.00 42.93 ? 332  GLU B OE2 1 
ATOM   4372 N N   . GLY D 2 183 ? -28.044 -39.349 12.590  1.00 32.81 ? 333  GLY B N   1 
ATOM   4373 C CA  . GLY D 2 183 ? -29.484 -39.204 12.246  1.00 34.21 ? 333  GLY B CA  1 
ATOM   4374 C C   . GLY D 2 183 ? -29.945 -37.786 11.946  1.00 34.12 ? 333  GLY B C   1 
ATOM   4375 O O   . GLY D 2 183 ? -30.828 -37.572 11.148  1.00 33.90 ? 333  GLY B O   1 
ATOM   4376 N N   . PHE D 2 184 ? -29.308 -36.807 12.554  1.00 35.98 ? 334  PHE B N   1 
ATOM   4377 C CA  . PHE D 2 184 ? -29.597 -35.422 12.278  1.00 36.25 ? 334  PHE B CA  1 
ATOM   4378 C C   . PHE D 2 184 ? -29.318 -35.058 10.817  1.00 37.17 ? 334  PHE B C   1 
ATOM   4379 O O   . PHE D 2 184 ? -29.799 -34.036 10.341  1.00 34.52 ? 334  PHE B O   1 
ATOM   4380 C CB  . PHE D 2 184 ? -28.775 -34.519 13.198  1.00 39.87 ? 334  PHE B CB  1 
ATOM   4381 C CG  . PHE D 2 184 ? -29.506 -33.284 13.623  1.00 40.91 ? 334  PHE B CG  1 
ATOM   4382 C CD1 . PHE D 2 184 ? -30.467 -33.334 14.599  1.00 45.25 ? 334  PHE B CD1 1 
ATOM   4383 C CD2 . PHE D 2 184 ? -29.283 -32.083 12.991  1.00 43.93 ? 334  PHE B CD2 1 
ATOM   4384 C CE1 . PHE D 2 184 ? -31.174 -32.185 14.963  1.00 44.35 ? 334  PHE B CE1 1 
ATOM   4385 C CE2 . PHE D 2 184 ? -29.994 -30.949 13.352  1.00 41.95 ? 334  PHE B CE2 1 
ATOM   4386 C CZ  . PHE D 2 184 ? -30.924 -31.009 14.328  1.00 44.17 ? 334  PHE B CZ  1 
ATOM   4387 N N   . PHE D 2 185 ? -28.518 -35.884 10.124  1.00 36.17 ? 335  PHE B N   1 
ATOM   4388 C CA  . PHE D 2 185 ? -28.222 -35.681 8.697   1.00 35.43 ? 335  PHE B CA  1 
ATOM   4389 C C   . PHE D 2 185 ? -28.909 -36.673 7.821   1.00 36.56 ? 335  PHE B C   1 
ATOM   4390 O O   . PHE D 2 185 ? -29.239 -36.347 6.704   1.00 37.43 ? 335  PHE B O   1 
ATOM   4391 C CB  . PHE D 2 185 ? -26.728 -35.790 8.411   1.00 35.27 ? 335  PHE B CB  1 
ATOM   4392 C CG  . PHE D 2 185 ? -25.950 -34.714 9.048   1.00 34.80 ? 335  PHE B CG  1 
ATOM   4393 C CD1 . PHE D 2 185 ? -25.582 -34.821 10.394  1.00 33.11 ? 335  PHE B CD1 1 
ATOM   4394 C CD2 . PHE D 2 185 ? -25.617 -33.584 8.327   1.00 35.80 ? 335  PHE B CD2 1 
ATOM   4395 C CE1 . PHE D 2 185 ? -24.896 -33.800 11.031  1.00 34.09 ? 335  PHE B CE1 1 
ATOM   4396 C CE2 . PHE D 2 185 ? -24.915 -32.527 8.950   1.00 39.26 ? 335  PHE B CE2 1 
ATOM   4397 C CZ  . PHE D 2 185 ? -24.536 -32.646 10.296  1.00 35.76 ? 335  PHE B CZ  1 
ATOM   4398 N N   . SER D 2 186 ? -29.060 -37.905 8.285   1.00 37.07 ? 336  SER B N   1 
ATOM   4399 C CA  . SER D 2 186 ? -29.616 -38.955 7.449   1.00 38.32 ? 336  SER B CA  1 
ATOM   4400 C C   . SER D 2 186 ? -31.111 -39.097 7.557   1.00 38.60 ? 336  SER B C   1 
ATOM   4401 O O   . SER D 2 186 ? -31.780 -39.532 6.594   1.00 39.62 ? 336  SER B O   1 
ATOM   4402 C CB  . SER D 2 186 ? -28.966 -40.315 7.795   1.00 36.94 ? 336  SER B CB  1 
ATOM   4403 O OG  . SER D 2 186 ? -29.378 -40.819 9.049   1.00 38.68 ? 336  SER B OG  1 
ATOM   4404 N N   . HIS D 2 187 ? -31.628 -38.806 8.745   1.00 37.22 ? 337  HIS B N   1 
ATOM   4405 C CA  . HIS D 2 187 ? -33.016 -39.079 9.076   1.00 36.83 ? 337  HIS B CA  1 
ATOM   4406 C C   . HIS D 2 187 ? -33.678 -37.839 9.642   1.00 35.24 ? 337  HIS B C   1 
ATOM   4407 O O   . HIS D 2 187 ? -34.318 -37.897 10.670  1.00 36.46 ? 337  HIS B O   1 
ATOM   4408 C CB  . HIS D 2 187 ? -33.098 -40.246 10.049  1.00 37.40 ? 337  HIS B CB  1 
ATOM   4409 C CG  . HIS D 2 187 ? -32.922 -41.571 9.378   1.00 40.57 ? 337  HIS B CG  1 
ATOM   4410 N ND1 . HIS D 2 187 ? -31.687 -42.031 8.966   1.00 42.02 ? 337  HIS B ND1 1 
ATOM   4411 C CD2 . HIS D 2 187 ? -33.828 -42.490 8.962   1.00 40.30 ? 337  HIS B CD2 1 
ATOM   4412 C CE1 . HIS D 2 187 ? -31.840 -43.203 8.368   1.00 41.87 ? 337  HIS B CE1 1 
ATOM   4413 N NE2 . HIS D 2 187 ? -33.129 -43.498 8.341   1.00 38.40 ? 337  HIS B NE2 1 
ATOM   4414 N N   . ASN D 2 188 ? -33.479 -36.731 8.956   1.00 33.45 ? 338  ASN B N   1 
ATOM   4415 C CA  . ASN D 2 188 ? -33.957 -35.418 9.362   1.00 31.48 ? 338  ASN B CA  1 
ATOM   4416 C C   . ASN D 2 188 ? -34.910 -34.866 8.295   1.00 30.81 ? 338  ASN B C   1 
ATOM   4417 O O   . ASN D 2 188 ? -34.462 -34.399 7.247   1.00 29.73 ? 338  ASN B O   1 
ATOM   4418 C CB  . ASN D 2 188 ? -32.747 -34.490 9.569   1.00 31.97 ? 338  ASN B CB  1 
ATOM   4419 C CG  . ASN D 2 188 ? -33.114 -33.115 10.145  1.00 32.73 ? 338  ASN B CG  1 
ATOM   4420 O OD1 . ASN D 2 188 ? -32.280 -32.454 10.772  1.00 37.48 ? 338  ASN B OD1 1 
ATOM   4421 N ND2 . ASN D 2 188 ? -34.364 -32.698 9.959   1.00 27.32 ? 338  ASN B ND2 1 
ATOM   4422 N N   . PRO D 2 189 ? -36.230 -35.001 8.524   1.00 31.21 ? 339  PRO B N   1 
ATOM   4423 C CA  . PRO D 2 189 ? -37.225 -34.546 7.517   1.00 31.04 ? 339  PRO B CA  1 
ATOM   4424 C C   . PRO D 2 189 ? -37.097 -33.072 7.202   1.00 31.48 ? 339  PRO B C   1 
ATOM   4425 O O   . PRO D 2 189 ? -37.283 -32.725 6.080   1.00 30.41 ? 339  PRO B O   1 
ATOM   4426 C CB  . PRO D 2 189 ? -38.581 -34.836 8.190   1.00 31.10 ? 339  PRO B CB  1 
ATOM   4427 C CG  . PRO D 2 189 ? -38.260 -35.997 9.133   1.00 31.77 ? 339  PRO B CG  1 
ATOM   4428 C CD  . PRO D 2 189 ? -36.884 -35.667 9.668   1.00 30.07 ? 339  PRO B CD  1 
ATOM   4429 N N   . CYS D 2 190 ? -36.726 -32.226 8.182   1.00 30.92 ? 340  CYS B N   1 
ATOM   4430 C CA  . CYS D 2 190 ? -36.573 -30.784 7.944   1.00 30.49 ? 340  CYS B CA  1 
ATOM   4431 C C   . CYS D 2 190 ? -35.418 -30.512 6.939   1.00 31.21 ? 340  CYS B C   1 
ATOM   4432 O O   . CYS D 2 190 ? -35.595 -29.857 5.895   1.00 30.29 ? 340  CYS B O   1 
ATOM   4433 C CB  . CYS D 2 190 ? -36.297 -30.078 9.301   1.00 31.24 ? 340  CYS B CB  1 
ATOM   4434 S SG  . CYS D 2 190 ? -35.378 -28.582 9.149   1.00 35.66 ? 340  CYS B SG  1 
ATOM   4435 N N   . LEU D 2 191 ? -34.234 -31.066 7.216   1.00 29.59 ? 341  LEU B N   1 
ATOM   4436 C CA  . LEU D 2 191 ? -33.102 -30.872 6.322   1.00 31.63 ? 341  LEU B CA  1 
ATOM   4437 C C   . LEU D 2 191 ? -33.378 -31.471 4.939   1.00 31.02 ? 341  LEU B C   1 
ATOM   4438 O O   . LEU D 2 191 ? -33.118 -30.834 3.879   1.00 30.77 ? 341  LEU B O   1 
ATOM   4439 C CB  . LEU D 2 191 ? -31.842 -31.517 6.970   1.00 32.01 ? 341  LEU B CB  1 
ATOM   4440 C CG  . LEU D 2 191 ? -30.519 -31.359 6.181   1.00 35.18 ? 341  LEU B CG  1 
ATOM   4441 C CD1 . LEU D 2 191 ? -30.159 -29.904 5.958   1.00 36.77 ? 341  LEU B CD1 1 
ATOM   4442 C CD2 . LEU D 2 191 ? -29.465 -32.051 6.960   1.00 33.50 ? 341  LEU B CD2 1 
ATOM   4443 N N   . THR D 2 192 ? -33.895 -32.701 4.925   1.00 30.22 ? 342  THR B N   1 
ATOM   4444 C CA  . THR D 2 192 ? -34.128 -33.376 3.666   1.00 30.56 ? 342  THR B CA  1 
ATOM   4445 C C   . THR D 2 192 ? -35.060 -32.557 2.785   1.00 32.35 ? 342  THR B C   1 
ATOM   4446 O O   . THR D 2 192 ? -34.811 -32.400 1.577   1.00 33.09 ? 342  THR B O   1 
ATOM   4447 C CB  . THR D 2 192 ? -34.747 -34.780 3.890   1.00 30.85 ? 342  THR B CB  1 
ATOM   4448 O OG1 . THR D 2 192 ? -33.788 -35.599 4.543   1.00 32.47 ? 342  THR B OG1 1 
ATOM   4449 C CG2 . THR D 2 192 ? -35.242 -35.467 2.570   1.00 30.56 ? 342  THR B CG2 1 
ATOM   4450 N N   . GLU D 2 193 ? -36.179 -32.116 3.357   1.00 34.28 ? 343  GLU B N   1 
ATOM   4451 C CA  . GLU D 2 193 ? -37.191 -31.407 2.572   1.00 34.85 ? 343  GLU B CA  1 
ATOM   4452 C C   . GLU D 2 193 ? -36.693 -30.020 2.219   1.00 33.54 ? 343  GLU B C   1 
ATOM   4453 O O   . GLU D 2 193 ? -36.991 -29.585 1.164   1.00 34.78 ? 343  GLU B O   1 
ATOM   4454 C CB  . GLU D 2 193 ? -38.538 -31.354 3.306   1.00 35.24 ? 343  GLU B CB  1 
ATOM   4455 C CG  . GLU D 2 193 ? -39.603 -30.499 2.640   1.00 39.35 ? 343  GLU B CG  1 
ATOM   4456 C CD  . GLU D 2 193 ? -39.989 -30.956 1.205   1.00 45.27 ? 343  GLU B CD  1 
ATOM   4457 O OE1 . GLU D 2 193 ? -39.757 -32.136 0.836   1.00 45.07 ? 343  GLU B OE1 1 
ATOM   4458 O OE2 . GLU D 2 193 ? -40.543 -30.112 0.450   1.00 47.40 ? 343  GLU B OE2 1 
ATOM   4459 N N   . ALA D 2 194 ? -35.935 -29.353 3.068   1.00 33.03 ? 344  ALA B N   1 
ATOM   4460 C CA  . ALA D 2 194 ? -35.345 -28.054 2.690   1.00 33.71 ? 344  ALA B CA  1 
ATOM   4461 C C   . ALA D 2 194 ? -34.397 -28.149 1.458   1.00 33.31 ? 344  ALA B C   1 
ATOM   4462 O O   . ALA D 2 194 ? -34.420 -27.309 0.561   1.00 33.22 ? 344  ALA B O   1 
ATOM   4463 C CB  . ALA D 2 194 ? -34.624 -27.388 3.882   1.00 34.64 ? 344  ALA B CB  1 
ATOM   4464 N N   . ILE D 2 195 ? -33.571 -29.184 1.417   1.00 32.75 ? 345  ILE B N   1 
ATOM   4465 C CA  . ILE D 2 195 ? -32.703 -29.402 0.257   1.00 31.24 ? 345  ILE B CA  1 
ATOM   4466 C C   . ILE D 2 195 ? -33.501 -29.776 -0.950  1.00 31.59 ? 345  ILE B C   1 
ATOM   4467 O O   . ILE D 2 195 ? -33.309 -29.209 -2.045  1.00 31.31 ? 345  ILE B O   1 
ATOM   4468 C CB  . ILE D 2 195 ? -31.631 -30.466 0.568   1.00 31.07 ? 345  ILE B CB  1 
ATOM   4469 C CG1 . ILE D 2 195 ? -30.607 -29.886 1.581   1.00 29.79 ? 345  ILE B CG1 1 
ATOM   4470 C CG2 . ILE D 2 195 ? -30.983 -30.924 -0.770  1.00 33.34 ? 345  ILE B CG2 1 
ATOM   4471 C CD1 . ILE D 2 195 ? -29.525 -30.888 2.116   1.00 32.43 ? 345  ILE B CD1 1 
ATOM   4472 N N   . ALA D 2 196 ? -34.456 -30.681 -0.766  1.00 30.80 ? 346  ALA B N   1 
ATOM   4473 C CA  . ALA D 2 196 ? -35.294 -31.142 -1.902  1.00 32.63 ? 346  ALA B CA  1 
ATOM   4474 C C   . ALA D 2 196 ? -36.111 -29.980 -2.489  1.00 32.89 ? 346  ALA B C   1 
ATOM   4475 O O   . ALA D 2 196 ? -36.193 -29.830 -3.693  1.00 34.57 ? 346  ALA B O   1 
ATOM   4476 C CB  . ALA D 2 196 ? -36.216 -32.289 -1.452  1.00 32.13 ? 346  ALA B CB  1 
ATOM   4477 N N   . ALA D 2 197 ? -36.681 -29.139 -1.631  1.00 33.92 ? 347  ALA B N   1 
ATOM   4478 C CA  . ALA D 2 197 ? -37.431 -27.932 -2.052  1.00 32.97 ? 347  ALA B CA  1 
ATOM   4479 C C   . ALA D 2 197 ? -36.593 -26.973 -2.867  1.00 32.41 ? 347  ALA B C   1 
ATOM   4480 O O   . ALA D 2 197 ? -37.044 -26.422 -3.892  1.00 30.11 ? 347  ALA B O   1 
ATOM   4481 C CB  . ALA D 2 197 ? -37.959 -27.217 -0.834  1.00 32.67 ? 347  ALA B CB  1 
ATOM   4482 N N   . LYS D 2 198 ? -35.359 -26.740 -2.396  1.00 31.94 ? 348  LYS B N   1 
ATOM   4483 C CA  . LYS D 2 198 ? -34.464 -25.780 -3.055  1.00 32.56 ? 348  LYS B CA  1 
ATOM   4484 C C   . LYS D 2 198 ? -34.059 -26.311 -4.417  1.00 33.19 ? 348  LYS B C   1 
ATOM   4485 O O   . LYS D 2 198 ? -34.017 -25.567 -5.416  1.00 31.01 ? 348  LYS B O   1 
ATOM   4486 C CB  . LYS D 2 198 ? -33.237 -25.521 -2.160  1.00 31.55 ? 348  LYS B CB  1 
ATOM   4487 C CG  . LYS D 2 198 ? -32.180 -24.555 -2.752  1.00 35.90 ? 348  LYS B CG  1 
ATOM   4488 C CD  . LYS D 2 198 ? -32.731 -23.182 -3.181  1.00 37.61 ? 348  LYS B CD  1 
ATOM   4489 C CE  . LYS D 2 198 ? -33.077 -22.224 -2.100  1.00 43.18 ? 348  LYS B CE  1 
ATOM   4490 N NZ  . LYS D 2 198 ? -33.526 -20.858 -2.672  1.00 38.36 ? 348  LYS B NZ  1 
ATOM   4491 N N   . MET D 2 199 ? -33.824 -27.621 -4.480  1.00 33.40 ? 349  MET B N   1 
ATOM   4492 C CA  . MET D 2 199 ? -33.514 -28.253 -5.749  1.00 33.89 ? 349  MET B CA  1 
ATOM   4493 C C   . MET D 2 199 ? -34.668 -28.160 -6.731  1.00 34.21 ? 349  MET B C   1 
ATOM   4494 O O   . MET D 2 199 ? -34.473 -27.821 -7.918  1.00 34.44 ? 349  MET B O   1 
ATOM   4495 C CB  . MET D 2 199 ? -33.073 -29.706 -5.509  1.00 33.14 ? 349  MET B CB  1 
ATOM   4496 C CG  . MET D 2 199 ? -31.709 -29.757 -4.854  1.00 33.75 ? 349  MET B CG  1 
ATOM   4497 S SD  . MET D 2 199 ? -31.150 -31.447 -4.884  1.00 36.42 ? 349  MET B SD  1 
ATOM   4498 C CE  . MET D 2 199 ? -29.514 -31.335 -4.167  1.00 30.30 ? 349  MET B CE  1 
ATOM   4499 N N   . ARG D 2 200 ? -35.890 -28.404 -6.251  1.00 33.74 ? 350  ARG B N   1 
ATOM   4500 C CA  . ARG D 2 200 ? -37.072 -28.210 -7.091  1.00 33.93 ? 350  ARG B CA  1 
ATOM   4501 C C   . ARG D 2 200 ? -37.211 -26.787 -7.610  1.00 34.04 ? 350  ARG B C   1 
ATOM   4502 O O   . ARG D 2 200 ? -37.514 -26.561 -8.788  1.00 33.73 ? 350  ARG B O   1 
ATOM   4503 C CB  . ARG D 2 200 ? -38.339 -28.635 -6.353  1.00 33.50 ? 350  ARG B CB  1 
ATOM   4504 C CG  . ARG D 2 200 ? -38.566 -30.147 -6.398  1.00 36.24 ? 350  ARG B CG  1 
ATOM   4505 C CD  . ARG D 2 200 ? -39.956 -30.531 -5.897  1.00 39.02 ? 350  ARG B CD  1 
ATOM   4506 N NE  . ARG D 2 200 ? -39.966 -30.657 -4.443  1.00 45.65 ? 350  ARG B NE  1 
ATOM   4507 C CZ  . ARG D 2 200 ? -40.355 -29.700 -3.613  1.00 44.54 ? 350  ARG B CZ  1 
ATOM   4508 N NH1 . ARG D 2 200 ? -40.814 -28.543 -4.077  1.00 48.01 ? 350  ARG B NH1 1 
ATOM   4509 N NH2 . ARG D 2 200 ? -40.336 -29.920 -2.328  1.00 44.04 ? 350  ARG B NH2 1 
ATOM   4510 N N   . PHE D 2 201 ? -37.032 -25.834 -6.707  1.00 34.05 ? 351  PHE B N   1 
ATOM   4511 C CA  . PHE D 2 201 ? -36.962 -24.420 -7.047  1.00 35.04 ? 351  PHE B CA  1 
ATOM   4512 C C   . PHE D 2 201 ? -35.982 -24.101 -8.180  1.00 34.26 ? 351  PHE B C   1 
ATOM   4513 O O   . PHE D 2 201 ? -36.359 -23.440 -9.156  1.00 34.15 ? 351  PHE B O   1 
ATOM   4514 C CB  . PHE D 2 201 ? -36.595 -23.603 -5.798  1.00 34.76 ? 351  PHE B CB  1 
ATOM   4515 C CG  . PHE D 2 201 ? -36.419 -22.137 -6.068  1.00 35.78 ? 351  PHE B CG  1 
ATOM   4516 C CD1 . PHE D 2 201 ? -37.548 -21.319 -6.296  1.00 40.36 ? 351  PHE B CD1 1 
ATOM   4517 C CD2 . PHE D 2 201 ? -35.119 -21.561 -6.087  1.00 35.88 ? 351  PHE B CD2 1 
ATOM   4518 C CE1 . PHE D 2 201 ? -37.389 -19.943 -6.577  1.00 41.00 ? 351  PHE B CE1 1 
ATOM   4519 C CE2 . PHE D 2 201 ? -34.958 -20.184 -6.347  1.00 36.29 ? 351  PHE B CE2 1 
ATOM   4520 C CZ  . PHE D 2 201 ? -36.085 -19.388 -6.594  1.00 34.98 ? 351  PHE B CZ  1 
ATOM   4521 N N   . HIS D 2 202 ? -34.740 -24.566 -8.041  1.00 34.19 ? 352  HIS B N   1 
ATOM   4522 C CA  . HIS D 2 202 ? -33.689 -24.392 -9.059  1.00 34.46 ? 352  HIS B CA  1 
ATOM   4523 C C   . HIS D 2 202 ? -34.046 -24.982 -10.407 1.00 36.17 ? 352  HIS B C   1 
ATOM   4524 O O   . HIS D 2 202 ? -33.803 -24.331 -11.418 1.00 37.75 ? 352  HIS B O   1 
ATOM   4525 C CB  . HIS D 2 202 ? -32.404 -25.030 -8.570  1.00 34.22 ? 352  HIS B CB  1 
ATOM   4526 C CG  . HIS D 2 202 ? -31.716 -24.258 -7.483  1.00 33.36 ? 352  HIS B CG  1 
ATOM   4527 N ND1 . HIS D 2 202 ? -30.909 -24.862 -6.548  1.00 33.52 ? 352  HIS B ND1 1 
ATOM   4528 C CD2 . HIS D 2 202 ? -31.721 -22.936 -7.183  1.00 31.93 ? 352  HIS B CD2 1 
ATOM   4529 C CE1 . HIS D 2 202 ? -30.435 -23.944 -5.721  1.00 29.55 ? 352  HIS B CE1 1 
ATOM   4530 N NE2 . HIS D 2 202 ? -30.892 -22.764 -6.103  1.00 32.73 ? 352  HIS B NE2 1 
ATOM   4531 N N   . SER D 2 203 ? -34.623 -26.188 -10.427 1.00 36.88 ? 353  SER B N   1 
ATOM   4532 C CA  . SER D 2 203 ? -35.216 -26.780 -11.652 1.00 39.33 ? 353  SER B CA  1 
ATOM   4533 C C   . SER D 2 203 ? -36.233 -25.888 -12.318 1.00 40.01 ? 353  SER B C   1 
ATOM   4534 O O   . SER D 2 203 ? -36.192 -25.666 -13.535 1.00 39.23 ? 353  SER B O   1 
ATOM   4535 C CB  . SER D 2 203 ? -35.951 -28.075 -11.325 1.00 39.49 ? 353  SER B CB  1 
ATOM   4536 O OG  . SER D 2 203 ? -35.023 -29.111 -11.140 1.00 44.55 ? 353  SER B OG  1 
ATOM   4537 N N   . GLN D 2 204 ? -37.181 -25.432 -11.508 1.00 41.65 ? 354  GLN B N   1 
ATOM   4538 C CA  . GLN D 2 204 ? -38.337 -24.674 -11.964 1.00 44.75 ? 354  GLN B CA  1 
ATOM   4539 C C   . GLN D 2 204 ? -37.905 -23.276 -12.402 1.00 44.28 ? 354  GLN B C   1 
ATOM   4540 O O   . GLN D 2 204 ? -38.408 -22.742 -13.369 1.00 43.75 ? 354  GLN B O   1 
ATOM   4541 C CB  . GLN D 2 204 ? -39.406 -24.612 -10.853 1.00 44.98 ? 354  GLN B CB  1 
ATOM   4542 C CG  . GLN D 2 204 ? -39.952 -25.990 -10.388 1.00 47.77 ? 354  GLN B CG  1 
ATOM   4543 C CD  . GLN D 2 204 ? -40.602 -25.990 -8.972  1.00 49.01 ? 354  GLN B CD  1 
ATOM   4544 O OE1 . GLN D 2 204 ? -40.083 -25.360 -8.006  1.00 56.78 ? 354  GLN B OE1 1 
ATOM   4545 N NE2 . GLN D 2 204 ? -41.687 -26.761 -8.821  1.00 50.68 ? 354  GLN B NE2 1 
ATOM   4546 N N   . LEU D 2 205 ? -36.966 -22.694 -11.680 1.00 44.85 ? 355  LEU B N   1 
ATOM   4547 C CA  . LEU D 2 205 ? -36.341 -21.427 -12.061 1.00 46.01 ? 355  LEU B CA  1 
ATOM   4548 C C   . LEU D 2 205 ? -35.786 -21.452 -13.493 1.00 46.58 ? 355  LEU B C   1 
ATOM   4549 O O   . LEU D 2 205 ? -36.063 -20.559 -14.304 1.00 46.30 ? 355  LEU B O   1 
ATOM   4550 C CB  . LEU D 2 205 ? -35.222 -21.081 -11.056 1.00 45.57 ? 355  LEU B CB  1 
ATOM   4551 C CG  . LEU D 2 205 ? -34.798 -19.623 -10.889 1.00 46.26 ? 355  LEU B CG  1 
ATOM   4552 C CD1 . LEU D 2 205 ? -36.032 -18.683 -10.775 1.00 46.69 ? 355  LEU B CD1 1 
ATOM   4553 C CD2 . LEU D 2 205 ? -33.872 -19.506 -9.706  1.00 46.31 ? 355  LEU B CD2 1 
ATOM   4554 N N   . PHE D 2 206 ? -35.018 -22.479 -13.814 1.00 47.69 ? 356  PHE B N   1 
ATOM   4555 C CA  . PHE D 2 206 ? -34.442 -22.568 -15.144 1.00 49.24 ? 356  PHE B CA  1 
ATOM   4556 C C   . PHE D 2 206 ? -35.471 -22.877 -16.214 1.00 50.07 ? 356  PHE B C   1 
ATOM   4557 O O   . PHE D 2 206 ? -35.307 -22.458 -17.362 1.00 49.97 ? 356  PHE B O   1 
ATOM   4558 C CB  . PHE D 2 206 ? -33.328 -23.609 -15.189 1.00 49.88 ? 356  PHE B CB  1 
ATOM   4559 C CG  . PHE D 2 206 ? -31.952 -23.021 -15.095 1.00 50.42 ? 356  PHE B CG  1 
ATOM   4560 C CD1 . PHE D 2 206 ? -31.363 -22.774 -13.856 1.00 52.88 ? 356  PHE B CD1 1 
ATOM   4561 C CD2 . PHE D 2 206 ? -31.238 -22.727 -16.250 1.00 52.60 ? 356  PHE B CD2 1 
ATOM   4562 C CE1 . PHE D 2 206 ? -30.076 -22.235 -13.768 1.00 53.69 ? 356  PHE B CE1 1 
ATOM   4563 C CE2 . PHE D 2 206 ? -29.955 -22.178 -16.179 1.00 53.35 ? 356  PHE B CE2 1 
ATOM   4564 C CZ  . PHE D 2 206 ? -29.365 -21.936 -14.932 1.00 53.28 ? 356  PHE B CZ  1 
ATOM   4565 N N   . SER D 2 207 ? -36.522 -23.604 -15.837 1.00 51.24 ? 357  SER B N   1 
ATOM   4566 C CA  . SER D 2 207 ? -37.468 -24.165 -16.809 1.00 53.03 ? 357  SER B CA  1 
ATOM   4567 C C   . SER D 2 207 ? -38.381 -23.132 -17.496 1.00 53.60 ? 357  SER B C   1 
ATOM   4568 O O   . SER D 2 207 ? -39.600 -23.274 -17.579 1.00 54.15 ? 357  SER B O   1 
ATOM   4569 C CB  . SER D 2 207 ? -38.254 -25.330 -16.196 1.00 52.74 ? 357  SER B CB  1 
ATOM   4570 O OG  . SER D 2 207 ? -39.356 -24.876 -15.434 1.00 55.07 ? 357  SER B OG  1 
HETATM 4571 C C1  . NAG E 3 .   ? 42.651  26.688  -55.368 1.00 32.33 ? 100  NAG A C1  1 
HETATM 4572 C C2  . NAG E 3 .   ? 43.802  27.598  -55.889 1.00 31.11 ? 100  NAG A C2  1 
HETATM 4573 C C3  . NAG E 3 .   ? 44.199  28.584  -54.811 1.00 30.01 ? 100  NAG A C3  1 
HETATM 4574 C C4  . NAG E 3 .   ? 43.038  29.374  -54.227 1.00 30.06 ? 100  NAG A C4  1 
HETATM 4575 C C5  . NAG E 3 .   ? 41.987  28.334  -53.852 1.00 32.00 ? 100  NAG A C5  1 
HETATM 4576 C C6  . NAG E 3 .   ? 40.649  28.789  -53.254 1.00 35.23 ? 100  NAG A C6  1 
HETATM 4577 C C7  . NAG E 3 .   ? 45.612  26.827  -57.407 1.00 35.60 ? 100  NAG A C7  1 
HETATM 4578 C C8  . NAG E 3 .   ? 46.921  26.095  -57.415 1.00 37.25 ? 100  NAG A C8  1 
HETATM 4579 N N2  . NAG E 3 .   ? 45.004  26.793  -56.214 1.00 35.49 ? 100  NAG A N2  1 
HETATM 4580 O O3  . NAG E 3 .   ? 45.187  29.389  -55.362 1.00 30.45 ? 100  NAG A O3  1 
HETATM 4581 O O4  . NAG E 3 .   ? 43.602  29.840  -53.018 1.00 33.02 ? 100  NAG A O4  1 
HETATM 4582 O O5  . NAG E 3 .   ? 41.629  27.604  -54.999 1.00 30.52 ? 100  NAG A O5  1 
HETATM 4583 O O6  . NAG E 3 .   ? 40.272  29.784  -54.101 1.00 41.75 ? 100  NAG A O6  1 
HETATM 4584 O O7  . NAG E 3 .   ? 45.199  27.462  -58.388 1.00 33.73 ? 100  NAG A O7  1 
HETATM 4585 C C1  . NAG F 3 .   ? 43.514  31.190  -52.827 1.00 29.24 ? 101  NAG A C1  1 
HETATM 4586 C C2  . NAG F 3 .   ? 43.660  31.585  -51.338 1.00 31.11 ? 101  NAG A C2  1 
HETATM 4587 C C3  . NAG F 3 .   ? 43.645  33.102  -51.235 1.00 31.56 ? 101  NAG A C3  1 
HETATM 4588 C C4  . NAG F 3 .   ? 44.764  33.541  -52.115 1.00 32.18 ? 101  NAG A C4  1 
HETATM 4589 C C5  . NAG F 3 .   ? 44.537  33.104  -53.561 1.00 29.04 ? 101  NAG A C5  1 
HETATM 4590 C C6  . NAG F 3 .   ? 45.639  33.700  -54.451 1.00 30.01 ? 101  NAG A C6  1 
HETATM 4591 C C7  . NAG F 3 .   ? 42.680  29.948  -49.912 1.00 37.18 ? 101  NAG A C7  1 
HETATM 4592 C C8  . NAG F 3 .   ? 41.505  29.428  -49.159 1.00 39.88 ? 101  NAG A C8  1 
HETATM 4593 N N2  . NAG F 3 .   ? 42.553  31.130  -50.551 1.00 34.00 ? 101  NAG A N2  1 
HETATM 4594 O O3  . NAG F 3 .   ? 43.888  33.632  -49.923 1.00 37.08 ? 101  NAG A O3  1 
HETATM 4595 O O4  . NAG F 3 .   ? 44.792  34.941  -52.109 1.00 24.32 ? 101  NAG A O4  1 
HETATM 4596 O O5  . NAG F 3 .   ? 44.558  31.731  -53.606 1.00 33.50 ? 101  NAG A O5  1 
HETATM 4597 O O6  . NAG F 3 .   ? 46.871  33.185  -54.053 1.00 30.99 ? 101  NAG A O6  1 
HETATM 4598 O O7  . NAG F 3 .   ? 43.743  29.319  -49.939 1.00 38.38 ? 101  NAG A O7  1 
HETATM 4599 C C1  . BMA G 4 .   ? 45.322  35.531  -50.873 1.00 32.39 ? 102  BMA A C1  1 
HETATM 4600 C C2  . BMA G 4 .   ? 46.157  36.679  -51.439 1.00 23.88 ? 102  BMA A C2  1 
HETATM 4601 C C3  . BMA G 4 .   ? 46.857  37.449  -50.304 1.00 34.74 ? 102  BMA A C3  1 
HETATM 4602 C C4  . BMA G 4 .   ? 45.903  37.749  -49.150 1.00 33.84 ? 102  BMA A C4  1 
HETATM 4603 C C5  . BMA G 4 .   ? 45.284  36.449  -48.758 1.00 30.93 ? 102  BMA A C5  1 
HETATM 4604 C C6  . BMA G 4 .   ? 44.269  36.674  -47.684 1.00 28.24 ? 102  BMA A C6  1 
HETATM 4605 O O2  . BMA G 4 .   ? 45.227  37.635  -52.076 1.00 34.62 ? 102  BMA A O2  1 
HETATM 4606 O O3  . BMA G 4 .   ? 46.989  38.755  -50.637 1.00 33.14 ? 102  BMA A O3  1 
HETATM 4607 O O4  . BMA G 4 .   ? 46.573  38.477  -48.113 1.00 37.48 ? 102  BMA A O4  1 
HETATM 4608 O O5  . BMA G 4 .   ? 44.431  36.161  -49.868 1.00 26.34 ? 102  BMA A O5  1 
HETATM 4609 O O6  . BMA G 4 .   ? 43.946  35.358  -47.359 1.00 36.41 ? 102  BMA A O6  1 
HETATM 4610 C C1  . MAN H 5 .   ? 43.138  35.391  -46.189 1.00 37.19 ? 103  MAN A C1  1 
HETATM 4611 C C2  . MAN H 5 .   ? 42.896  33.981  -45.690 1.00 44.50 ? 103  MAN A C2  1 
HETATM 4612 C C3  . MAN H 5 .   ? 41.975  33.267  -46.674 1.00 41.47 ? 103  MAN A C3  1 
HETATM 4613 C C4  . MAN H 5 .   ? 40.683  34.056  -46.955 1.00 45.67 ? 103  MAN A C4  1 
HETATM 4614 C C5  . MAN H 5 .   ? 40.903  35.554  -47.187 1.00 42.35 ? 103  MAN A C5  1 
HETATM 4615 C C6  . MAN H 5 .   ? 39.718  36.336  -46.613 1.00 45.20 ? 103  MAN A C6  1 
HETATM 4616 O O2  . MAN H 5 .   ? 42.328  34.141  -44.396 1.00 42.80 ? 103  MAN A O2  1 
HETATM 4617 O O3  . MAN H 5 .   ? 41.511  32.124  -46.068 1.00 49.24 ? 103  MAN A O3  1 
HETATM 4618 O O4  . MAN H 5 .   ? 40.000  33.395  -48.026 1.00 44.98 ? 103  MAN A O4  1 
HETATM 4619 O O5  . MAN H 5 .   ? 41.959  36.158  -46.431 1.00 42.94 ? 103  MAN A O5  1 
HETATM 4620 O O6  . MAN H 5 .   ? 38.965  36.776  -47.697 1.00 49.09 ? 103  MAN A O6  1 
HETATM 4621 C C1  . MAN I 5 .   ? 48.228  38.999  -51.361 1.00 54.10 ? 104  MAN A C1  1 
HETATM 4622 C C2  . MAN I 5 .   ? 48.706  40.454  -51.045 1.00 48.26 ? 104  MAN A C2  1 
HETATM 4623 C C3  . MAN I 5 .   ? 48.000  41.473  -51.874 1.00 55.17 ? 104  MAN A C3  1 
HETATM 4624 C C4  . MAN I 5 .   ? 47.848  41.011  -53.373 1.00 50.23 ? 104  MAN A C4  1 
HETATM 4625 C C5  . MAN I 5 .   ? 47.432  39.599  -53.602 1.00 52.84 ? 104  MAN A C5  1 
HETATM 4626 C C6  . MAN I 5 .   ? 47.535  39.236  -55.116 1.00 49.50 ? 104  MAN A C6  1 
HETATM 4627 O O2  . MAN I 5 .   ? 50.087  40.443  -51.324 1.00 58.25 ? 104  MAN A O2  1 
HETATM 4628 O O3  . MAN I 5 .   ? 48.720  42.784  -51.860 1.00 41.60 ? 104  MAN A O3  1 
HETATM 4629 O O4  . MAN I 5 .   ? 46.974  42.166  -54.019 1.00 50.74 ? 104  MAN A O4  1 
HETATM 4630 O O5  . MAN I 5 .   ? 48.179  38.614  -52.783 1.00 49.69 ? 104  MAN A O5  1 
HETATM 4631 O O6  . MAN I 5 .   ? 48.912  39.307  -55.547 1.00 37.63 ? 104  MAN A O6  1 
HETATM 4632 C C1  . NAG J 3 .   ? -28.011 -42.834 -1.530  1.00 39.42 ? 1100 NAG B C1  1 
HETATM 4633 C C2  . NAG J 3 .   ? -28.977 -43.504 -0.537  1.00 43.37 ? 1100 NAG B C2  1 
HETATM 4634 C C3  . NAG J 3 .   ? -28.281 -43.962 0.750   1.00 45.55 ? 1100 NAG B C3  1 
HETATM 4635 C C4  . NAG J 3 .   ? -27.085 -44.872 0.418   1.00 47.37 ? 1100 NAG B C4  1 
HETATM 4636 C C5  . NAG J 3 .   ? -26.169 -44.073 -0.534  1.00 45.74 ? 1100 NAG B C5  1 
HETATM 4637 C C6  . NAG J 3 .   ? -24.909 -44.862 -0.908  1.00 49.18 ? 1100 NAG B C6  1 
HETATM 4638 C C7  . NAG J 3 .   ? -31.309 -42.743 -0.527  1.00 50.73 ? 1100 NAG B C7  1 
HETATM 4639 C C8  . NAG J 3 .   ? -32.273 -41.726 0.038   1.00 50.59 ? 1100 NAG B C8  1 
HETATM 4640 N N2  . NAG J 3 .   ? -30.037 -42.592 -0.145  1.00 46.82 ? 1100 NAG B N2  1 
HETATM 4641 O O3  . NAG J 3 .   ? -29.231 -44.553 1.613   1.00 47.30 ? 1100 NAG B O3  1 
HETATM 4642 O O4  . NAG J 3 .   ? -26.381 -45.300 1.594   1.00 48.54 ? 1100 NAG B O4  1 
HETATM 4643 O O5  . NAG J 3 .   ? -26.862 -43.654 -1.717  1.00 41.97 ? 1100 NAG B O5  1 
HETATM 4644 O O6  . NAG J 3 .   ? -24.669 -44.819 -2.301  1.00 50.81 ? 1100 NAG B O6  1 
HETATM 4645 O O7  . NAG J 3 .   ? -31.694 -43.660 -1.284  1.00 50.27 ? 1100 NAG B O7  1 
HETATM 4646 O O   . HOH K 6 .   ? 14.464  -3.478  -34.106 1.00 31.02 ? 221  HOH C O   1 
HETATM 4647 O O   . HOH K 6 .   ? 31.465  18.924  -40.636 1.00 27.81 ? 222  HOH C O   1 
HETATM 4648 O O   . HOH K 6 .   ? 9.736   -9.911  -35.291 1.00 30.63 ? 223  HOH C O   1 
HETATM 4649 O O   . HOH K 6 .   ? 19.792  9.420   -48.857 1.00 34.67 ? 224  HOH C O   1 
HETATM 4650 O O   . HOH K 6 .   ? 24.716  13.834  -48.462 1.00 30.97 ? 225  HOH C O   1 
HETATM 4651 O O   . HOH K 6 .   ? -12.963 -21.846 -29.457 1.00 38.16 ? 226  HOH C O   1 
HETATM 4652 O O   . HOH K 6 .   ? 0.660   -10.558 -24.755 1.00 35.90 ? 227  HOH C O   1 
HETATM 4653 O O   . HOH K 6 .   ? -0.494  -23.246 -21.035 1.00 41.93 ? 228  HOH C O   1 
HETATM 4654 O O   . HOH K 6 .   ? 29.592  -2.289  -40.405 1.00 49.64 ? 229  HOH C O   1 
HETATM 4655 O O   . HOH K 6 .   ? -9.584  -16.036 -31.301 1.00 38.39 ? 230  HOH C O   1 
HETATM 4656 O O   . HOH K 6 .   ? -8.082  -16.415 -33.555 1.00 37.56 ? 231  HOH C O   1 
HETATM 4657 O O   . HOH K 6 .   ? 24.013  -0.879  -35.672 1.00 33.30 ? 232  HOH C O   1 
HETATM 4658 O O   . HOH K 6 .   ? -5.631  -24.405 -30.226 1.00 43.72 ? 233  HOH C O   1 
HETATM 4659 O O   . HOH K 6 .   ? -12.840 -16.921 -33.791 1.00 31.83 ? 234  HOH C O   1 
HETATM 4660 O O   . HOH K 6 .   ? 2.390   -13.588 -31.600 1.00 44.01 ? 235  HOH C O   1 
HETATM 4661 O O   . HOH K 6 .   ? 21.838  -4.531  -47.809 1.00 43.14 ? 236  HOH C O   1 
HETATM 4662 O O   . HOH K 6 .   ? 10.923  -6.922  -33.992 1.00 39.39 ? 237  HOH C O   1 
HETATM 4663 O O   . HOH K 6 .   ? 29.478  18.509  -38.059 1.00 45.87 ? 238  HOH C O   1 
HETATM 4664 O O   . HOH K 6 .   ? -0.756  -12.557 -32.404 1.00 51.07 ? 239  HOH C O   1 
HETATM 4665 O O   . HOH K 6 .   ? 24.144  13.400  -31.711 1.00 50.89 ? 240  HOH C O   1 
HETATM 4666 O O   . HOH K 6 .   ? 21.741  9.324   -53.161 1.00 39.37 ? 241  HOH C O   1 
HETATM 4667 O O   . HOH K 6 .   ? 16.761  -12.811 -25.247 1.00 40.67 ? 242  HOH C O   1 
HETATM 4668 O O   . HOH K 6 .   ? 3.666   -14.080 -20.834 1.00 34.66 ? 243  HOH C O   1 
HETATM 4669 O O   . HOH K 6 .   ? 7.001   -15.051 -21.963 1.00 36.84 ? 244  HOH C O   1 
HETATM 4670 O O   . HOH K 6 .   ? -12.519 -12.992 -35.220 1.00 42.11 ? 245  HOH C O   1 
HETATM 4671 O O   . HOH K 6 .   ? 3.007   -18.187 -30.353 1.00 34.56 ? 246  HOH C O   1 
HETATM 4672 O O   . HOH K 6 .   ? 27.670  5.879   -42.371 1.00 44.80 ? 247  HOH C O   1 
HETATM 4673 O O   . HOH K 6 .   ? 6.847   -22.105 -20.255 1.00 44.80 ? 248  HOH C O   1 
HETATM 4674 O O   . HOH K 6 .   ? -1.816  -19.288 -32.296 1.00 38.42 ? 249  HOH C O   1 
HETATM 4675 O O   . HOH K 6 .   ? 8.549   -20.414 -18.789 1.00 57.78 ? 250  HOH C O   1 
HETATM 4676 O O   . HOH K 6 .   ? 20.104  21.193  -46.123 1.00 50.82 ? 251  HOH C O   1 
HETATM 4677 O O   . HOH K 6 .   ? 19.099  -11.887 -41.493 1.00 37.69 ? 252  HOH C O   1 
HETATM 4678 O O   . HOH K 6 .   ? 9.355   11.471  -40.581 1.00 45.31 ? 253  HOH C O   1 
HETATM 4679 O O   . HOH K 6 .   ? 22.266  20.757  -53.589 1.00 54.53 ? 254  HOH C O   1 
HETATM 4680 O O   . HOH K 6 .   ? 21.360  22.360  -51.257 1.00 55.75 ? 255  HOH C O   1 
HETATM 4681 O O   . HOH L 6 .   ? -1.359  -11.268 -22.780 1.00 30.17 ? 221  HOH D O   1 
HETATM 4682 O O   . HOH L 6 .   ? 4.786   -2.644  -35.286 1.00 42.84 ? 222  HOH D O   1 
HETATM 4683 O O   . HOH L 6 .   ? -10.958 -32.841 -6.379  1.00 37.63 ? 223  HOH D O   1 
HETATM 4684 O O   . HOH L 6 .   ? 2.716   -17.591 -17.306 1.00 31.58 ? 224  HOH D O   1 
HETATM 4685 O O   . HOH L 6 .   ? -7.721  -19.945 -9.312  1.00 43.87 ? 225  HOH D O   1 
HETATM 4686 O O   . HOH L 6 .   ? -5.796  -4.489  -28.487 1.00 37.72 ? 226  HOH D O   1 
HETATM 4687 O O   . HOH L 6 .   ? 11.866  -4.081  -33.207 1.00 39.72 ? 227  HOH D O   1 
HETATM 4688 O O   . HOH L 6 .   ? -18.613 -24.251 -24.320 1.00 48.50 ? 228  HOH D O   1 
HETATM 4689 O O   . HOH L 6 .   ? -10.076 -17.298 -14.162 1.00 37.50 ? 229  HOH D O   1 
HETATM 4690 O O   . HOH L 6 .   ? 8.932   3.626   -29.084 1.00 44.00 ? 230  HOH D O   1 
HETATM 4691 O O   . HOH L 6 .   ? 4.294   -21.937 -11.292 1.00 52.05 ? 231  HOH D O   1 
HETATM 4692 O O   . HOH L 6 .   ? -14.858 -11.416 -18.750 1.00 46.87 ? 232  HOH D O   1 
HETATM 4693 O O   . HOH L 6 .   ? 12.202  -11.907 -38.924 1.00 41.31 ? 233  HOH D O   1 
HETATM 4694 O O   . HOH L 6 .   ? 1.838   -22.907 -14.845 1.00 44.65 ? 234  HOH D O   1 
HETATM 4695 O O   . HOH L 6 .   ? 5.013   -11.080 -40.149 1.00 54.16 ? 235  HOH D O   1 
HETATM 4696 O O   . HOH L 6 .   ? -11.845 -6.699  -22.412 1.00 44.14 ? 236  HOH D O   1 
HETATM 4697 O O   . HOH L 6 .   ? -2.249  -3.138  -16.148 1.00 45.81 ? 237  HOH D O   1 
HETATM 4698 O O   . HOH L 6 .   ? -13.861 -8.961  -16.335 1.00 43.03 ? 238  HOH D O   1 
HETATM 4699 O O   . HOH L 6 .   ? -11.404 -4.596  -24.160 1.00 45.39 ? 239  HOH D O   1 
HETATM 4700 O O   . HOH L 6 .   ? -11.627 -7.919  -25.263 1.00 42.38 ? 240  HOH D O   1 
HETATM 4701 O O   . HOH L 6 .   ? -5.076  -2.136  -17.715 1.00 48.03 ? 241  HOH D O   1 
HETATM 4702 O O   . HOH L 6 .   ? -13.103 -20.606 -12.623 1.00 48.82 ? 242  HOH D O   1 
HETATM 4703 O O   . HOH L 6 .   ? -12.081 -36.213 -7.652  1.00 54.05 ? 243  HOH D O   1 
HETATM 4704 O O   . HOH L 6 .   ? 8.809   0.141   -23.584 1.00 38.43 ? 244  HOH D O   1 
HETATM 4705 O O   . HOH L 6 .   ? 3.248   -13.485 -11.114 1.00 46.61 ? 245  HOH D O   1 
HETATM 4706 O O   . HOH L 6 .   ? 2.066   -2.649  -29.145 1.00 38.30 ? 246  HOH D O   1 
HETATM 4707 O O   . HOH M 6 .   ? 50.612  24.327  -46.378 1.00 24.29 ? 364  HOH A O   1 
HETATM 4708 O O   . HOH M 6 .   ? 34.388  10.519  -50.408 1.00 25.99 ? 365  HOH A O   1 
HETATM 4709 O O   . HOH M 6 .   ? 38.656  16.398  -46.157 1.00 26.23 ? 366  HOH A O   1 
HETATM 4710 O O   . HOH M 6 .   ? 42.225  3.794   -53.976 1.00 30.76 ? 367  HOH A O   1 
HETATM 4711 O O   . HOH M 6 .   ? 46.353  7.060   -63.116 1.00 25.15 ? 368  HOH A O   1 
HETATM 4712 O O   . HOH M 6 .   ? 65.775  18.505  -61.433 1.00 29.52 ? 369  HOH A O   1 
HETATM 4713 O O   . HOH M 6 .   ? 45.056  4.721   -63.691 1.00 24.45 ? 370  HOH A O   1 
HETATM 4714 O O   . HOH M 6 .   ? 49.588  8.032   -57.143 1.00 22.00 ? 371  HOH A O   1 
HETATM 4715 O O   . HOH M 6 .   ? 38.056  19.896  -52.525 1.00 24.54 ? 372  HOH A O   1 
HETATM 4716 O O   . HOH M 6 .   ? 32.067  15.702  -60.273 1.00 36.67 ? 373  HOH A O   1 
HETATM 4717 O O   . HOH M 6 .   ? 33.211  11.851  -48.437 1.00 25.80 ? 374  HOH A O   1 
HETATM 4718 O O   . HOH M 6 .   ? 38.098  5.530   -37.034 1.00 29.28 ? 375  HOH A O   1 
HETATM 4719 O O   . HOH M 6 .   ? 50.189  5.705   -55.803 1.00 28.41 ? 376  HOH A O   1 
HETATM 4720 O O   . HOH M 6 .   ? 42.859  15.901  -45.891 1.00 31.45 ? 377  HOH A O   1 
HETATM 4721 O O   . HOH M 6 .   ? 39.195  16.582  -58.754 1.00 32.15 ? 378  HOH A O   1 
HETATM 4722 O O   . HOH M 6 .   ? 46.826  18.252  -55.111 1.00 33.24 ? 379  HOH A O   1 
HETATM 4723 O O   . HOH M 6 .   ? 46.387  9.601   -40.327 1.00 24.71 ? 380  HOH A O   1 
HETATM 4724 O O   . HOH M 6 .   ? 46.995  16.833  -57.431 1.00 24.26 ? 381  HOH A O   1 
HETATM 4725 O O   . HOH M 6 .   ? 46.972  7.451   -39.198 1.00 29.59 ? 382  HOH A O   1 
HETATM 4726 O O   . HOH M 6 .   ? 60.418  6.838   -57.713 1.00 33.21 ? 383  HOH A O   1 
HETATM 4727 O O   . HOH M 6 .   ? 48.628  21.656  -53.334 1.00 24.54 ? 384  HOH A O   1 
HETATM 4728 O O   . HOH M 6 .   ? 41.325  21.900  -52.769 1.00 23.79 ? 385  HOH A O   1 
HETATM 4729 O O   . HOH M 6 .   ? 44.008  16.144  -48.362 1.00 31.34 ? 386  HOH A O   1 
HETATM 4730 O O   . HOH M 6 .   ? 58.384  21.179  -29.253 1.00 35.51 ? 387  HOH A O   1 
HETATM 4731 O O   . HOH M 6 .   ? 36.631  4.191   -50.968 1.00 29.38 ? 388  HOH A O   1 
HETATM 4732 O O   . HOH M 6 .   ? 26.782  2.795   -42.361 1.00 37.00 ? 389  HOH A O   1 
HETATM 4733 O O   . HOH M 6 .   ? 33.030  13.255  -59.482 1.00 27.95 ? 390  HOH A O   1 
HETATM 4734 O O   . HOH M 6 .   ? 53.889  3.857   -56.273 1.00 29.59 ? 391  HOH A O   1 
HETATM 4735 O O   . HOH M 6 .   ? 32.503  10.794  -46.079 1.00 34.83 ? 392  HOH A O   1 
HETATM 4736 O O   . HOH M 6 .   ? 61.817  29.276  -48.587 1.00 36.83 ? 393  HOH A O   1 
HETATM 4737 O O   . HOH M 6 .   ? 44.730  3.611   -44.727 1.00 29.69 ? 394  HOH A O   1 
HETATM 4738 O O   . HOH M 6 .   ? 64.221  31.873  -42.924 1.00 45.00 ? 395  HOH A O   1 
HETATM 4739 O O   . HOH M 6 .   ? 57.361  20.940  -60.970 1.00 25.48 ? 396  HOH A O   1 
HETATM 4740 O O   . HOH M 6 .   ? 59.286  24.569  -36.000 1.00 31.30 ? 397  HOH A O   1 
HETATM 4741 O O   . HOH M 6 .   ? 49.646  4.075   -50.477 1.00 31.06 ? 398  HOH A O   1 
HETATM 4742 O O   . HOH M 6 .   ? 48.509  5.911   -41.010 1.00 38.84 ? 399  HOH A O   1 
HETATM 4743 O O   . HOH M 6 .   ? 49.267  19.364  -54.350 1.00 36.58 ? 400  HOH A O   1 
HETATM 4744 O O   . HOH M 6 .   ? 46.850  5.144   -46.977 1.00 46.17 ? 401  HOH A O   1 
HETATM 4745 O O   . HOH M 6 .   ? 54.890  5.514   -46.710 1.00 35.17 ? 402  HOH A O   1 
HETATM 4746 O O   . HOH M 6 .   ? 48.080  6.462   -44.284 1.00 31.51 ? 403  HOH A O   1 
HETATM 4747 O O   . HOH M 6 .   ? 44.377  2.679   -54.631 1.00 35.99 ? 404  HOH A O   1 
HETATM 4748 O O   . HOH M 6 .   ? 45.897  8.304   -65.650 1.00 29.28 ? 405  HOH A O   1 
HETATM 4749 O O   . HOH M 6 .   ? 50.057  15.735  -33.131 1.00 46.52 ? 406  HOH A O   1 
HETATM 4750 O O   . HOH M 6 .   ? 46.767  20.841  -57.251 1.00 38.98 ? 407  HOH A O   1 
HETATM 4751 O O   . HOH M 6 .   ? 35.963  -2.348  -52.490 1.00 44.67 ? 408  HOH A O   1 
HETATM 4752 O O   . HOH M 6 .   ? 32.226  2.334   -35.405 1.00 40.18 ? 409  HOH A O   1 
HETATM 4753 O O   . HOH M 6 .   ? 36.486  27.095  -52.413 1.00 43.33 ? 410  HOH A O   1 
HETATM 4754 O O   . HOH M 6 .   ? 44.589  14.591  -63.915 1.00 35.24 ? 411  HOH A O   1 
HETATM 4755 O O   . HOH M 6 .   ? 37.915  3.907   -34.907 1.00 36.28 ? 412  HOH A O   1 
HETATM 4756 O O   . HOH M 6 .   ? 52.178  10.114  -62.377 1.00 29.97 ? 413  HOH A O   1 
HETATM 4757 O O   . HOH M 6 .   ? 39.075  -1.094  -45.612 1.00 33.59 ? 414  HOH A O   1 
HETATM 4758 O O   . HOH M 6 .   ? 30.386  4.670   -42.787 1.00 41.01 ? 415  HOH A O   1 
HETATM 4759 O O   . HOH M 6 .   ? 35.816  20.512  -58.002 1.00 40.76 ? 416  HOH A O   1 
HETATM 4760 O O   . HOH M 6 .   ? 50.865  32.889  -45.386 1.00 53.43 ? 417  HOH A O   1 
HETATM 4761 O O   . HOH M 6 .   ? 61.486  16.432  -28.703 1.00 34.94 ? 418  HOH A O   1 
HETATM 4762 O O   . HOH M 6 .   ? 62.863  8.003   -56.980 1.00 37.78 ? 419  HOH A O   1 
HETATM 4763 O O   . HOH M 6 .   ? 51.515  20.186  -53.198 1.00 30.61 ? 420  HOH A O   1 
HETATM 4764 O O   . HOH M 6 .   ? 38.519  19.871  -58.198 1.00 30.23 ? 421  HOH A O   1 
HETATM 4765 O O   . HOH M 6 .   ? 56.421  3.389   -46.981 1.00 38.81 ? 422  HOH A O   1 
HETATM 4766 O O   . HOH M 6 .   ? 57.945  21.953  -52.230 1.00 35.54 ? 423  HOH A O   1 
HETATM 4767 O O   . HOH M 6 .   ? 38.464  30.322  -51.601 1.00 42.70 ? 424  HOH A O   1 
HETATM 4768 O O   . HOH M 6 .   ? 46.410  21.222  -37.549 1.00 37.01 ? 425  HOH A O   1 
HETATM 4769 O O   . HOH M 6 .   ? 42.691  2.665   -66.637 1.00 31.73 ? 426  HOH A O   1 
HETATM 4770 O O   . HOH M 6 .   ? 59.219  10.475  -32.850 1.00 38.05 ? 427  HOH A O   1 
HETATM 4771 O O   . HOH M 6 .   ? 60.601  10.831  -35.247 1.00 42.50 ? 428  HOH A O   1 
HETATM 4772 O O   . HOH M 6 .   ? 44.925  19.256  -36.465 1.00 44.78 ? 429  HOH A O   1 
HETATM 4773 O O   . HOH M 6 .   ? 61.297  25.055  -43.011 1.00 45.93 ? 430  HOH A O   1 
HETATM 4774 O O   . HOH M 6 .   ? 39.584  23.865  -46.528 1.00 40.55 ? 431  HOH A O   1 
HETATM 4775 O O   . HOH M 6 .   ? 48.561  4.557   -53.411 1.00 30.78 ? 432  HOH A O   1 
HETATM 4776 O O   . HOH M 6 .   ? 50.671  28.272  -52.993 1.00 39.44 ? 433  HOH A O   1 
HETATM 4777 O O   . HOH M 6 .   ? 34.374  8.186   -64.189 1.00 38.20 ? 434  HOH A O   1 
HETATM 4778 O O   . HOH M 6 .   ? 46.114  29.111  -51.447 1.00 36.24 ? 435  HOH A O   1 
HETATM 4779 O O   . HOH M 6 .   ? 40.276  32.498  -50.545 1.00 39.07 ? 436  HOH A O   1 
HETATM 4780 O O   . HOH M 6 .   ? 62.775  12.332  -35.860 1.00 44.24 ? 437  HOH A O   1 
HETATM 4781 O O   . HOH M 6 .   ? 28.318  14.988  -52.683 1.00 34.45 ? 438  HOH A O   1 
HETATM 4782 O O   . HOH M 6 .   ? 33.831  20.221  -41.418 1.00 38.26 ? 439  HOH A O   1 
HETATM 4783 O O   . HOH M 6 .   ? 59.514  13.966  -30.395 1.00 47.85 ? 440  HOH A O   1 
HETATM 4784 O O   . HOH M 6 .   ? 51.471  4.095   -57.364 1.00 40.31 ? 441  HOH A O   1 
HETATM 4785 O O   . HOH M 6 .   ? 47.368  25.005  -51.346 1.00 34.18 ? 442  HOH A O   1 
HETATM 4786 O O   . HOH M 6 .   ? 51.904  21.853  -56.881 1.00 33.66 ? 443  HOH A O   1 
HETATM 4787 O O   . HOH M 6 .   ? 53.661  7.637   -42.074 1.00 28.83 ? 444  HOH A O   1 
HETATM 4788 O O   . HOH M 6 .   ? 46.040  2.880   -52.430 1.00 37.31 ? 445  HOH A O   1 
HETATM 4789 O O   . HOH M 6 .   ? 27.849  0.637   -39.392 1.00 43.45 ? 446  HOH A O   1 
HETATM 4790 O O   . HOH M 6 .   ? 43.532  16.220  -60.862 1.00 34.31 ? 447  HOH A O   1 
HETATM 4791 O O   . HOH M 6 .   ? 54.024  5.893   -44.187 1.00 45.40 ? 448  HOH A O   1 
HETATM 4792 O O   . HOH M 6 .   ? 52.844  27.682  -52.332 1.00 39.63 ? 449  HOH A O   1 
HETATM 4793 O O   . HOH M 6 .   ? 46.718  26.328  -53.409 1.00 35.85 ? 450  HOH A O   1 
HETATM 4794 O O   . HOH M 6 .   ? 46.028  32.473  -48.432 1.00 44.10 ? 451  HOH A O   1 
HETATM 4795 O O   . HOH M 6 .   ? 26.534  15.173  -50.868 1.00 46.60 ? 452  HOH A O   1 
HETATM 4796 O O   . HOH M 6 .   ? 44.660  16.243  -58.581 1.00 31.58 ? 453  HOH A O   1 
HETATM 4797 O O   . HOH M 6 .   ? 47.446  27.206  -49.672 1.00 36.95 ? 454  HOH A O   1 
HETATM 4798 O O   . HOH M 6 .   ? 53.544  30.891  -47.944 1.00 46.52 ? 455  HOH A O   1 
HETATM 4799 O O   . HOH M 6 .   ? 43.806  26.162  -38.066 1.00 42.37 ? 456  HOH A O   1 
HETATM 4800 O O   . HOH M 6 .   ? 62.535  20.550  -51.778 1.00 50.18 ? 457  HOH A O   1 
HETATM 4801 O O   . HOH M 6 .   ? 40.259  22.883  -44.446 1.00 38.50 ? 458  HOH A O   1 
HETATM 4802 O O   . HOH M 6 .   ? 46.593  27.754  -47.138 1.00 45.62 ? 459  HOH A O   1 
HETATM 4803 O O   . HOH M 6 .   ? 43.118  23.484  -44.408 1.00 48.19 ? 460  HOH A O   1 
HETATM 4804 O O   . HOH M 6 .   ? 65.446  21.516  -50.867 1.00 47.62 ? 461  HOH A O   1 
HETATM 4805 O O   . HOH M 6 .   ? 64.185  19.768  -48.772 1.00 45.68 ? 462  HOH A O   1 
HETATM 4806 O O   . HOH M 6 .   ? 44.794  21.851  -43.164 1.00 35.51 ? 463  HOH A O   1 
HETATM 4807 O O   . HOH M 6 .   ? 54.588  22.907  -27.774 1.00 47.93 ? 464  HOH A O   1 
HETATM 4808 O O   . HOH M 6 .   ? 40.334  11.895  -64.873 1.00 37.36 ? 465  HOH A O   1 
HETATM 4809 O O   . HOH M 6 .   ? 22.231  8.784   -58.267 1.00 49.34 ? 466  HOH A O   1 
HETATM 4810 O O   . HOH M 6 .   ? 53.180  19.168  -24.418 1.00 48.45 ? 467  HOH A O   1 
HETATM 4811 O O   . HOH M 6 .   ? 21.534  7.049   -55.967 1.00 47.78 ? 468  HOH A O   1 
HETATM 4812 O O   . HOH M 6 .   ? 24.002  6.325   -55.301 1.00 50.96 ? 469  HOH A O   1 
HETATM 4813 O O   . HOH M 6 .   ? 51.894  20.875  -24.897 1.00 54.80 ? 470  HOH A O   1 
HETATM 4814 O O   . HOH M 6 .   ? 32.992  -6.332  -46.022 1.00 44.31 ? 471  HOH A O   1 
HETATM 4815 O O   . HOH M 6 .   ? 46.989  30.260  -53.401 1.00 38.86 ? 472  HOH A O   1 
HETATM 4816 O O   . HOH M 6 .   ? 50.453  12.441  -62.127 1.00 33.89 ? 473  HOH A O   1 
HETATM 4817 O O   . HOH M 6 .   ? 47.902  5.795   -35.868 1.00 39.55 ? 474  HOH A O   1 
HETATM 4818 O O   . HOH N 6 .   ? -19.421 -22.663 5.371   1.00 29.55 ? 1101 HOH B O   1 
HETATM 4819 O O   . HOH N 6 .   ? -23.972 -23.293 10.732  1.00 26.65 ? 1102 HOH B O   1 
HETATM 4820 O O   . HOH N 6 .   ? -24.486 -20.670 10.748  1.00 28.37 ? 1103 HOH B O   1 
HETATM 4821 O O   . HOH N 6 .   ? -33.154 -33.760 -0.041  1.00 31.33 ? 1104 HOH B O   1 
HETATM 4822 O O   . HOH N 6 .   ? -18.925 -20.196 6.090   1.00 28.46 ? 1105 HOH B O   1 
HETATM 4823 O O   . HOH N 6 .   ? -19.793 -31.081 -2.895  1.00 28.67 ? 1106 HOH B O   1 
HETATM 4824 O O   . HOH N 6 .   ? -19.866 -27.321 -9.274  1.00 31.09 ? 1107 HOH B O   1 
HETATM 4825 O O   . HOH N 6 .   ? -30.840 -34.389 1.096   1.00 36.79 ? 1108 HOH B O   1 
HETATM 4826 O O   . HOH N 6 .   ? -24.565 -35.814 -5.643  1.00 32.65 ? 1109 HOH B O   1 
HETATM 4827 O O   . HOH N 6 .   ? -23.928 -30.789 0.821   1.00 31.10 ? 1110 HOH B O   1 
HETATM 4828 O O   . HOH N 6 .   ? -35.729 -24.773 0.690   1.00 31.91 ? 1111 HOH B O   1 
HETATM 4829 O O   . HOH N 6 .   ? -25.733 -37.767 -2.444  1.00 29.66 ? 1112 HOH B O   1 
HETATM 4830 O O   . HOH N 6 .   ? -21.500 -30.195 0.997   1.00 29.12 ? 1113 HOH B O   1 
HETATM 4831 O O   . HOH N 6 .   ? -22.389 -26.606 -9.425  1.00 32.46 ? 1114 HOH B O   1 
HETATM 4832 O O   . HOH N 6 .   ? -12.019 -41.186 15.804  1.00 43.48 ? 1115 HOH B O   1 
HETATM 4833 O O   . HOH N 6 .   ? -21.329 -31.383 -14.952 1.00 39.12 ? 1116 HOH B O   1 
HETATM 4834 O O   . HOH N 6 .   ? -21.338 -13.885 -4.830  1.00 36.95 ? 1117 HOH B O   1 
HETATM 4835 O O   . HOH N 6 .   ? -29.479 -37.003 3.968   1.00 30.82 ? 1118 HOH B O   1 
HETATM 4836 O O   . HOH N 6 .   ? -30.276 -20.098 -5.424  1.00 31.74 ? 1119 HOH B O   1 
HETATM 4837 O O   . HOH N 6 .   ? -13.018 -18.162 -13.914 1.00 35.67 ? 1120 HOH B O   1 
HETATM 4838 O O   . HOH N 6 .   ? -13.933 -26.117 12.785  1.00 46.88 ? 1121 HOH B O   1 
HETATM 4839 O O   . HOH N 6 .   ? -23.938 -20.321 5.001   1.00 31.26 ? 1122 HOH B O   1 
HETATM 4840 O O   . HOH N 6 .   ? -32.065 -36.085 6.723   1.00 39.58 ? 1123 HOH B O   1 
HETATM 4841 O O   . HOH N 6 .   ? -31.274 -33.627 -7.659  1.00 39.88 ? 1124 HOH B O   1 
HETATM 4842 O O   . HOH N 6 .   ? -13.334 -18.446 -1.072  1.00 35.70 ? 1125 HOH B O   1 
HETATM 4843 O O   . HOH N 6 .   ? -45.678 -35.509 12.328  1.00 45.82 ? 1126 HOH B O   1 
HETATM 4844 O O   . HOH N 6 .   ? -23.421 -38.263 9.178   1.00 34.76 ? 1127 HOH B O   1 
HETATM 4845 O O   . HOH N 6 .   ? -35.163 -31.555 -8.232  1.00 45.94 ? 1128 HOH B O   1 
HETATM 4846 O O   . HOH N 6 .   ? -39.541 -25.568 -4.147  1.00 35.67 ? 1129 HOH B O   1 
HETATM 4847 O O   . HOH N 6 .   ? -32.046 -18.886 -4.229  1.00 41.71 ? 1130 HOH B O   1 
HETATM 4848 O O   . HOH N 6 .   ? -29.493 -19.787 9.774   1.00 33.62 ? 1131 HOH B O   1 
HETATM 4849 O O   . HOH N 6 .   ? -40.145 -25.489 7.813   1.00 41.10 ? 1132 HOH B O   1 
HETATM 4850 O O   . HOH N 6 .   ? -17.745 -25.846 -8.611  1.00 41.80 ? 1133 HOH B O   1 
HETATM 4851 O O   . HOH N 6 .   ? -21.610 -19.227 6.350   1.00 40.47 ? 1134 HOH B O   1 
HETATM 4852 O O   . HOH N 6 .   ? -26.810 -12.982 -0.103  1.00 39.73 ? 1135 HOH B O   1 
HETATM 4853 O O   . HOH N 6 .   ? -20.525 -9.158  -11.754 1.00 42.17 ? 1136 HOH B O   1 
HETATM 4854 O O   . HOH N 6 .   ? -36.895 -23.554 -1.669  1.00 41.97 ? 1137 HOH B O   1 
HETATM 4855 O O   . HOH N 6 .   ? -16.929 -10.509 -2.099  1.00 55.31 ? 1138 HOH B O   1 
HETATM 4856 O O   . HOH N 6 .   ? -23.329 -17.645 1.095   1.00 40.29 ? 1139 HOH B O   1 
HETATM 4857 O O   . HOH N 6 .   ? -43.329 -31.467 -4.582  1.00 52.58 ? 1140 HOH B O   1 
HETATM 4858 O O   . HOH N 6 .   ? -18.848 -31.328 -15.423 1.00 50.81 ? 1141 HOH B O   1 
HETATM 4859 O O   . HOH N 6 .   ? -33.244 -33.488 -2.864  1.00 39.41 ? 1142 HOH B O   1 
HETATM 4860 O O   . HOH N 6 .   ? -39.619 -23.606 -2.191  1.00 39.95 ? 1143 HOH B O   1 
HETATM 4861 O O   . HOH N 6 .   ? -6.544  -19.462 -3.144  1.00 41.53 ? 1144 HOH B O   1 
HETATM 4862 O O   . HOH N 6 .   ? -33.204 -20.527 0.425   1.00 39.58 ? 1145 HOH B O   1 
HETATM 4863 O O   . HOH N 6 .   ? -15.080 -33.476 8.643   1.00 38.50 ? 1146 HOH B O   1 
HETATM 4864 O O   . HOH N 6 .   ? -21.603 -21.745 20.791  1.00 44.11 ? 1147 HOH B O   1 
HETATM 4865 O O   . HOH N 6 .   ? -29.622 -37.058 -7.754  1.00 35.73 ? 1148 HOH B O   1 
HETATM 4866 O O   . HOH N 6 .   ? -40.528 -37.636 6.262   1.00 37.96 ? 1149 HOH B O   1 
HETATM 4867 O O   . HOH N 6 .   ? -40.344 -21.114 -3.169  1.00 53.55 ? 1150 HOH B O   1 
HETATM 4868 O O   . HOH N 6 .   ? -38.012 -36.850 5.151   1.00 39.88 ? 1151 HOH B O   1 
HETATM 4869 O O   . HOH N 6 .   ? -24.477 -31.787 20.818  1.00 53.62 ? 1152 HOH B O   1 
HETATM 4870 O O   . HOH N 6 .   ? -28.243 -43.279 12.640  1.00 61.82 ? 1153 HOH B O   1 
HETATM 4871 O O   . HOH N 6 .   ? -36.395 -21.143 -2.624  1.00 46.92 ? 1154 HOH B O   1 
HETATM 4872 O O   . HOH N 6 .   ? -11.998 -24.656 9.629   1.00 52.03 ? 1155 HOH B O   1 
HETATM 4873 O O   . HOH N 6 .   ? -44.770 -34.737 15.640  1.00 51.55 ? 1156 HOH B O   1 
HETATM 4874 O O   . HOH N 6 .   ? -21.470 -44.145 -3.200  1.00 59.80 ? 1157 HOH B O   1 
HETATM 4875 O O   . HOH N 6 .   ? -5.729  -29.978 9.344   1.00 50.60 ? 1158 HOH B O   1 
HETATM 4876 O O   . HOH N 6 .   ? -23.968 -34.258 -16.889 1.00 41.44 ? 1159 HOH B O   1 
HETATM 4877 O O   . HOH N 6 .   ? -30.213 -40.203 3.854   1.00 51.41 ? 1160 HOH B O   1 
HETATM 4878 O O   . HOH N 6 .   ? -22.958 -13.467 1.843   1.00 61.14 ? 1161 HOH B O   1 
HETATM 4879 O O   . HOH N 6 .   ? -23.560 -38.614 -16.872 1.00 49.31 ? 1162 HOH B O   1 
HETATM 4880 O O   . HOH N 6 .   ? -33.513 -35.841 13.574  1.00 48.60 ? 1163 HOH B O   1 
HETATM 4881 O O   . HOH N 6 .   ? -24.446 -15.390 3.209   1.00 53.24 ? 1164 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   120 120 ASP ASP C . n 
A 1 2   PRO 2   121 121 PRO PRO C . n 
A 1 3   GLY 3   122 122 GLY GLY C . n 
A 1 4   CYS 4   123 123 CYS CYS C . n 
A 1 5   ARG 5   124 124 ARG ARG C . n 
A 1 6   LEU 6   125 125 LEU LEU C . n 
A 1 7   ARG 7   126 126 ARG ARG C . n 
A 1 8   SER 8   127 127 SER SER C . n 
A 1 9   GLN 9   128 128 GLN GLN C . n 
A 1 10  LEU 10  129 129 LEU LEU C . n 
A 1 11  VAL 11  130 130 VAL VAL C . n 
A 1 12  PRO 12  131 131 PRO PRO C . n 
A 1 13  VAL 13  132 132 VAL VAL C . n 
A 1 14  ARG 14  133 133 ARG ARG C . n 
A 1 15  ALA 15  134 134 ALA ALA C . n 
A 1 16  LEU 16  135 135 LEU LEU C . n 
A 1 17  GLY 17  136 136 GLY GLY C . n 
A 1 18  LEU 18  137 137 LEU LEU C . n 
A 1 19  GLY 19  138 138 GLY GLY C . n 
A 1 20  HIS 20  139 139 HIS HIS C . n 
A 1 21  ARG 21  140 140 ARG ARG C . n 
A 1 22  SER 22  141 141 SER SER C . n 
A 1 23  ASP 23  142 142 ASP ASP C . n 
A 1 24  GLU 24  143 143 GLU GLU C . n 
A 1 25  LEU 25  144 144 LEU LEU C . n 
A 1 26  VAL 26  145 145 VAL VAL C . n 
A 1 27  ARG 27  146 146 ARG ARG C . n 
A 1 28  PHE 28  147 147 PHE PHE C . n 
A 1 29  ARG 29  148 148 ARG ARG C . n 
A 1 30  PHE 30  149 149 PHE PHE C . n 
A 1 31  CYS 31  150 150 CYS CYS C . n 
A 1 32  SER 32  151 151 SER SER C . n 
A 1 33  GLY 33  152 152 GLY GLY C . n 
A 1 34  SER 34  153 153 SER SER C . n 
A 1 35  CYS 35  154 154 CYS CYS C . n 
A 1 36  ARG 36  155 155 ARG ARG C . n 
A 1 37  ARG 37  156 156 ARG ARG C . n 
A 1 38  ALA 38  157 157 ALA ALA C . n 
A 1 39  ARG 39  158 158 ARG ARG C . n 
A 1 40  SER 40  159 159 SER SER C . n 
A 1 41  PRO 41  160 160 PRO PRO C . n 
A 1 42  HIS 42  161 161 HIS HIS C . n 
A 1 43  ASP 43  162 162 ASP ASP C . n 
A 1 44  LEU 44  163 163 LEU LEU C . n 
A 1 45  SER 45  164 164 SER SER C . n 
A 1 46  LEU 46  165 165 LEU LEU C . n 
A 1 47  ALA 47  166 166 ALA ALA C . n 
A 1 48  SER 48  167 167 SER SER C . n 
A 1 49  LEU 49  168 168 LEU LEU C . n 
A 1 50  LEU 50  169 169 LEU LEU C . n 
A 1 51  GLY 51  170 170 GLY GLY C . n 
A 1 52  ALA 52  171 171 ALA ALA C . n 
A 1 53  GLY 53  172 172 GLY GLY C . n 
A 1 54  ALA 54  173 173 ALA ALA C . n 
A 1 55  LEU 55  174 174 LEU LEU C . n 
A 1 56  ARG 56  175 175 ARG ARG C . n 
A 1 57  PRO 57  176 176 PRO PRO C . n 
A 1 58  PRO 58  177 177 PRO PRO C . n 
A 1 59  PRO 59  178 178 PRO PRO C . n 
A 1 60  GLY 60  179 179 GLY GLY C . n 
A 1 61  SER 61  180 180 SER SER C . n 
A 1 62  ARG 62  181 181 ARG ARG C . n 
A 1 63  PRO 63  182 182 PRO PRO C . n 
A 1 64  VAL 64  183 183 VAL VAL C . n 
A 1 65  SER 65  184 184 SER SER C . n 
A 1 66  GLN 66  185 185 GLN GLN C . n 
A 1 67  PRO 67  186 186 PRO PRO C . n 
A 1 68  CYS 68  187 187 CYS CYS C . n 
A 1 69  CYS 69  188 188 CYS CYS C . n 
A 1 70  ARG 70  189 189 ARG ARG C . n 
A 1 71  PRO 71  190 190 PRO PRO C . n 
A 1 72  THR 72  191 191 THR THR C . n 
A 1 73  ARG 73  192 192 ARG ARG C . n 
A 1 74  TYR 74  193 193 TYR TYR C . n 
A 1 75  GLU 75  194 194 GLU GLU C . n 
A 1 76  ALA 76  195 195 ALA ALA C . n 
A 1 77  VAL 77  196 196 VAL VAL C . n 
A 1 78  SER 78  197 197 SER SER C . n 
A 1 79  PHE 79  198 198 PHE PHE C . n 
A 1 80  MET 80  199 199 MET MET C . n 
A 1 81  ASP 81  200 200 ASP ASP C . n 
A 1 82  VAL 82  201 201 VAL VAL C . n 
A 1 83  ASN 83  202 202 ASN ASN C . n 
A 1 84  SER 84  203 203 SER SER C . n 
A 1 85  THR 85  204 204 THR THR C . n 
A 1 86  TRP 86  205 205 TRP TRP C . n 
A 1 87  ARG 87  206 206 ARG ARG C . n 
A 1 88  THR 88  207 207 THR THR C . n 
A 1 89  VAL 89  208 208 VAL VAL C . n 
A 1 90  ASP 90  209 209 ASP ASP C . n 
A 1 91  ARG 91  210 210 ARG ARG C . n 
A 1 92  LEU 92  211 211 LEU LEU C . n 
A 1 93  SER 93  212 212 SER SER C . n 
A 1 94  ALA 94  213 213 ALA ALA C . n 
A 1 95  THR 95  214 214 THR THR C . n 
A 1 96  ALA 96  215 215 ALA ALA C . n 
A 1 97  CYS 97  216 216 CYS CYS C . n 
A 1 98  GLY 98  217 217 GLY GLY C . n 
A 1 99  CYS 99  218 218 CYS CYS C . n 
A 1 100 LEU 100 219 219 LEU LEU C . n 
A 1 101 GLY 101 220 ?   ?   ?   C . n 
B 1 1   ASP 1   120 ?   ?   ?   D . n 
B 1 2   PRO 2   121 121 PRO PRO D . n 
B 1 3   GLY 3   122 122 GLY GLY D . n 
B 1 4   CYS 4   123 123 CYS CYS D . n 
B 1 5   ARG 5   124 124 ARG ARG D . n 
B 1 6   LEU 6   125 125 LEU LEU D . n 
B 1 7   ARG 7   126 126 ARG ARG D . n 
B 1 8   SER 8   127 127 SER SER D . n 
B 1 9   GLN 9   128 128 GLN GLN D . n 
B 1 10  LEU 10  129 129 LEU LEU D . n 
B 1 11  VAL 11  130 130 VAL VAL D . n 
B 1 12  PRO 12  131 131 PRO PRO D . n 
B 1 13  VAL 13  132 132 VAL VAL D . n 
B 1 14  ARG 14  133 133 ARG ARG D . n 
B 1 15  ALA 15  134 134 ALA ALA D . n 
B 1 16  LEU 16  135 135 LEU LEU D . n 
B 1 17  GLY 17  136 136 GLY GLY D . n 
B 1 18  LEU 18  137 137 LEU LEU D . n 
B 1 19  GLY 19  138 138 GLY GLY D . n 
B 1 20  HIS 20  139 139 HIS HIS D . n 
B 1 21  ARG 21  140 140 ARG ARG D . n 
B 1 22  SER 22  141 141 SER SER D . n 
B 1 23  ASP 23  142 142 ASP ASP D . n 
B 1 24  GLU 24  143 143 GLU GLU D . n 
B 1 25  LEU 25  144 144 LEU LEU D . n 
B 1 26  VAL 26  145 145 VAL VAL D . n 
B 1 27  ARG 27  146 146 ARG ARG D . n 
B 1 28  PHE 28  147 147 PHE PHE D . n 
B 1 29  ARG 29  148 148 ARG ARG D . n 
B 1 30  PHE 30  149 149 PHE PHE D . n 
B 1 31  CYS 31  150 150 CYS CYS D . n 
B 1 32  SER 32  151 151 SER SER D . n 
B 1 33  GLY 33  152 152 GLY GLY D . n 
B 1 34  SER 34  153 153 SER SER D . n 
B 1 35  CYS 35  154 154 CYS CYS D . n 
B 1 36  ARG 36  155 155 ARG ARG D . n 
B 1 37  ARG 37  156 156 ARG ARG D . n 
B 1 38  ALA 38  157 157 ALA ALA D . n 
B 1 39  ARG 39  158 158 ARG ARG D . n 
B 1 40  SER 40  159 159 SER SER D . n 
B 1 41  PRO 41  160 160 PRO PRO D . n 
B 1 42  HIS 42  161 161 HIS HIS D . n 
B 1 43  ASP 43  162 162 ASP ASP D . n 
B 1 44  LEU 44  163 163 LEU LEU D . n 
B 1 45  SER 45  164 164 SER SER D . n 
B 1 46  LEU 46  165 165 LEU LEU D . n 
B 1 47  ALA 47  166 166 ALA ALA D . n 
B 1 48  SER 48  167 167 SER SER D . n 
B 1 49  LEU 49  168 168 LEU LEU D . n 
B 1 50  LEU 50  169 169 LEU LEU D . n 
B 1 51  GLY 51  170 170 GLY GLY D . n 
B 1 52  ALA 52  171 171 ALA ALA D . n 
B 1 53  GLY 53  172 172 GLY GLY D . n 
B 1 54  ALA 54  173 173 ALA ALA D . n 
B 1 55  LEU 55  174 174 LEU LEU D . n 
B 1 56  ARG 56  175 175 ARG ARG D . n 
B 1 57  PRO 57  176 176 PRO PRO D . n 
B 1 58  PRO 58  177 177 PRO PRO D . n 
B 1 59  PRO 59  178 178 PRO PRO D . n 
B 1 60  GLY 60  179 179 GLY GLY D . n 
B 1 61  SER 61  180 180 SER SER D . n 
B 1 62  ARG 62  181 181 ARG ARG D . n 
B 1 63  PRO 63  182 182 PRO PRO D . n 
B 1 64  VAL 64  183 183 VAL VAL D . n 
B 1 65  SER 65  184 184 SER SER D . n 
B 1 66  GLN 66  185 185 GLN GLN D . n 
B 1 67  PRO 67  186 186 PRO PRO D . n 
B 1 68  CYS 68  187 187 CYS CYS D . n 
B 1 69  CYS 69  188 188 CYS CYS D . n 
B 1 70  ARG 70  189 189 ARG ARG D . n 
B 1 71  PRO 71  190 190 PRO PRO D . n 
B 1 72  THR 72  191 191 THR THR D . n 
B 1 73  ARG 73  192 192 ARG ARG D . n 
B 1 74  TYR 74  193 193 TYR TYR D . n 
B 1 75  GLU 75  194 194 GLU GLU D . n 
B 1 76  ALA 76  195 195 ALA ALA D . n 
B 1 77  VAL 77  196 196 VAL VAL D . n 
B 1 78  SER 78  197 197 SER SER D . n 
B 1 79  PHE 79  198 198 PHE PHE D . n 
B 1 80  MET 80  199 199 MET MET D . n 
B 1 81  ASP 81  200 200 ASP ASP D . n 
B 1 82  VAL 82  201 201 VAL VAL D . n 
B 1 83  ASN 83  202 202 ASN ASN D . n 
B 1 84  SER 84  203 203 SER SER D . n 
B 1 85  THR 85  204 204 THR THR D . n 
B 1 86  TRP 86  205 205 TRP TRP D . n 
B 1 87  ARG 87  206 206 ARG ARG D . n 
B 1 88  THR 88  207 207 THR THR D . n 
B 1 89  VAL 89  208 208 VAL VAL D . n 
B 1 90  ASP 90  209 209 ASP ASP D . n 
B 1 91  ARG 91  210 210 ARG ARG D . n 
B 1 92  LEU 92  211 211 LEU LEU D . n 
B 1 93  SER 93  212 212 SER SER D . n 
B 1 94  ALA 94  213 213 ALA ALA D . n 
B 1 95  THR 95  214 214 THR THR D . n 
B 1 96  ALA 96  215 215 ALA ALA D . n 
B 1 97  CYS 97  216 216 CYS CYS D . n 
B 1 98  GLY 98  217 217 GLY GLY D . n 
B 1 99  CYS 99  218 218 CYS CYS D . n 
B 1 100 LEU 100 219 219 LEU LEU D . n 
B 1 101 GLY 101 220 ?   ?   ?   D . n 
C 2 1   LYS 1   151 ?   ?   ?   A . n 
C 2 2   LEU 2   152 ?   ?   ?   A . n 
C 2 3   ASN 3   153 ?   ?   ?   A . n 
C 2 4   MET 4   154 ?   ?   ?   A . n 
C 2 5   LEU 5   155 ?   ?   ?   A . n 
C 2 6   LYS 6   156 ?   ?   ?   A . n 
C 2 7   PRO 7   157 ?   ?   ?   A . n 
C 2 8   ASP 8   158 158 ASP ASP A . n 
C 2 9   SER 9   159 159 SER SER A . n 
C 2 10  ASP 10  160 160 ASP ASP A . n 
C 2 11  LEU 11  161 161 LEU LEU A . n 
C 2 12  CYS 12  162 162 CYS CYS A . n 
C 2 13  LEU 13  163 163 LEU LEU A . n 
C 2 14  LYS 14  164 164 LYS LYS A . n 
C 2 15  PHE 15  165 165 PHE PHE A . n 
C 2 16  ALA 16  166 166 ALA ALA A . n 
C 2 17  MET 17  167 167 MET MET A . n 
C 2 18  LEU 18  168 168 LEU LEU A . n 
C 2 19  CYS 19  169 169 CYS CYS A . n 
C 2 20  THR 20  170 170 THR THR A . n 
C 2 21  LEU 21  171 171 LEU LEU A . n 
C 2 22  ASN 22  172 172 ASN ASN A . n 
C 2 23  ASP 23  173 173 ASP ASP A . n 
C 2 24  LYS 24  174 174 LYS LYS A . n 
C 2 25  CYS 25  175 175 CYS CYS A . n 
C 2 26  ASP 26  176 176 ASP ASP A . n 
C 2 27  ARG 27  177 177 ARG ARG A . n 
C 2 28  LEU 28  178 178 LEU LEU A . n 
C 2 29  ARG 29  179 179 ARG ARG A . n 
C 2 30  LYS 30  180 180 LYS LYS A . n 
C 2 31  ALA 31  181 181 ALA ALA A . n 
C 2 32  TYR 32  182 182 TYR TYR A . n 
C 2 33  GLY 33  183 183 GLY GLY A . n 
C 2 34  GLU 34  184 184 GLU GLU A . n 
C 2 35  ALA 35  185 185 ALA ALA A . n 
C 2 36  CYS 36  186 186 CYS CYS A . n 
C 2 37  SER 37  187 187 SER SER A . n 
C 2 38  GLY 38  188 188 GLY GLY A . n 
C 2 39  PRO 39  189 189 PRO PRO A . n 
C 2 40  HIS 40  190 190 HIS HIS A . n 
C 2 41  CYS 41  191 191 CYS CYS A . n 
C 2 42  GLN 42  192 192 GLN GLN A . n 
C 2 43  ARG 43  193 193 ARG ARG A . n 
C 2 44  HIS 44  194 194 HIS HIS A . n 
C 2 45  VAL 45  195 195 VAL VAL A . n 
C 2 46  CYS 46  196 196 CYS CYS A . n 
C 2 47  LEU 47  197 197 LEU LEU A . n 
C 2 48  ARG 48  198 198 ARG ARG A . n 
C 2 49  GLN 49  199 199 GLN GLN A . n 
C 2 50  LEU 50  200 200 LEU LEU A . n 
C 2 51  LEU 51  201 201 LEU LEU A . n 
C 2 52  THR 52  202 202 THR THR A . n 
C 2 53  PHE 53  203 203 PHE PHE A . n 
C 2 54  PHE 54  204 204 PHE PHE A . n 
C 2 55  GLU 55  205 205 GLU GLU A . n 
C 2 56  LYS 56  206 206 LYS LYS A . n 
C 2 57  ALA 57  207 207 ALA ALA A . n 
C 2 58  ALA 58  208 208 ALA ALA A . n 
C 2 59  GLU 59  209 209 GLU GLU A . n 
C 2 60  PRO 60  210 210 PRO PRO A . n 
C 2 61  HIS 61  211 211 HIS HIS A . n 
C 2 62  ALA 62  212 212 ALA ALA A . n 
C 2 63  GLN 63  213 213 GLN GLN A . n 
C 2 64  GLY 64  214 214 GLY GLY A . n 
C 2 65  LEU 65  215 215 LEU LEU A . n 
C 2 66  LEU 66  216 216 LEU LEU A . n 
C 2 67  LEU 67  217 217 LEU LEU A . n 
C 2 68  CYS 68  218 218 CYS CYS A . n 
C 2 69  PRO 69  219 219 PRO PRO A . n 
C 2 70  CYS 70  220 220 CYS CYS A . n 
C 2 71  ALA 71  221 221 ALA ALA A . n 
C 2 72  PRO 72  222 222 PRO PRO A . n 
C 2 73  ASN 73  223 223 ASN ASN A . n 
C 2 74  ASP 74  224 224 ASP ASP A . n 
C 2 75  ARG 75  225 225 ARG ARG A . n 
C 2 76  GLY 76  226 226 GLY GLY A . n 
C 2 77  CYS 77  227 227 CYS CYS A . n 
C 2 78  GLY 78  228 228 GLY GLY A . n 
C 2 79  GLU 79  229 229 GLU GLU A . n 
C 2 80  ARG 80  230 230 ARG ARG A . n 
C 2 81  ARG 81  231 231 ARG ARG A . n 
C 2 82  ARG 82  232 232 ARG ARG A . n 
C 2 83  ASN 83  233 233 ASN ASN A . n 
C 2 84  THR 84  234 234 THR THR A . n 
C 2 85  ILE 85  235 235 ILE ILE A . n 
C 2 86  ALA 86  236 236 ALA ALA A . n 
C 2 87  PRO 87  237 237 PRO PRO A . n 
C 2 88  ASN 88  238 238 ASN ASN A . n 
C 2 89  CYS 89  239 239 CYS CYS A . n 
C 2 90  ALA 90  240 240 ALA ALA A . n 
C 2 91  LEU 91  241 241 LEU LEU A . n 
C 2 92  PRO 92  242 242 PRO PRO A . n 
C 2 93  PRO 93  243 243 PRO PRO A . n 
C 2 94  VAL 94  244 244 VAL VAL A . n 
C 2 95  ALA 95  245 245 ALA ALA A . n 
C 2 96  PRO 96  246 246 PRO PRO A . n 
C 2 97  ASN 97  247 247 ASN ASN A . n 
C 2 98  CYS 98  248 248 CYS CYS A . n 
C 2 99  LEU 99  249 249 LEU LEU A . n 
C 2 100 GLU 100 250 250 GLU GLU A . n 
C 2 101 LEU 101 251 251 LEU LEU A . n 
C 2 102 ARG 102 252 252 ARG ARG A . n 
C 2 103 ARG 103 253 253 ARG ARG A . n 
C 2 104 LEU 104 254 254 LEU LEU A . n 
C 2 105 CYS 105 255 255 CYS CYS A . n 
C 2 106 PHE 106 256 256 PHE PHE A . n 
C 2 107 SER 107 257 257 SER SER A . n 
C 2 108 ASP 108 258 258 ASP ASP A . n 
C 2 109 PRO 109 259 259 PRO PRO A . n 
C 2 110 LEU 110 260 260 LEU LEU A . n 
C 2 111 CYS 111 261 261 CYS CYS A . n 
C 2 112 ARG 112 262 262 ARG ARG A . n 
C 2 113 SER 113 263 263 SER SER A . n 
C 2 114 ARG 114 264 264 ARG ARG A . n 
C 2 115 LEU 115 265 265 LEU LEU A . n 
C 2 116 VAL 116 266 266 VAL VAL A . n 
C 2 117 ASP 117 267 267 ASP ASP A . n 
C 2 118 PHE 118 268 268 PHE PHE A . n 
C 2 119 GLN 119 269 269 GLN GLN A . n 
C 2 120 THR 120 270 270 THR THR A . n 
C 2 121 HIS 121 271 271 HIS HIS A . n 
C 2 122 CYS 122 272 272 CYS CYS A . n 
C 2 123 HIS 123 273 273 HIS HIS A . n 
C 2 124 PRO 124 274 274 PRO PRO A . n 
C 2 125 MET 125 275 275 MET MET A . n 
C 2 126 ASP 126 276 276 ASP ASP A . n 
C 2 127 ILE 127 277 277 ILE ILE A . n 
C 2 128 LEU 128 278 278 LEU LEU A . n 
C 2 129 GLY 129 279 279 GLY GLY A . n 
C 2 130 THR 130 280 280 THR THR A . n 
C 2 131 CYS 131 281 281 CYS CYS A . n 
C 2 132 ALA 132 282 282 ALA ALA A . n 
C 2 133 THR 133 283 283 THR THR A . n 
C 2 134 GLU 134 284 284 GLU GLU A . n 
C 2 135 GLN 135 285 285 GLN GLN A . n 
C 2 136 SER 136 286 286 SER SER A . n 
C 2 137 ARG 137 287 287 ARG ARG A . n 
C 2 138 CYS 138 288 288 CYS CYS A . n 
C 2 139 LEU 139 289 289 LEU LEU A . n 
C 2 140 ARG 140 290 290 ARG ARG A . n 
C 2 141 ALA 141 291 291 ALA ALA A . n 
C 2 142 TYR 142 292 292 TYR TYR A . n 
C 2 143 LEU 143 293 293 LEU LEU A . n 
C 2 144 GLY 144 294 294 GLY GLY A . n 
C 2 145 LEU 145 295 295 LEU LEU A . n 
C 2 146 ILE 146 296 296 ILE ILE A . n 
C 2 147 GLY 147 297 297 GLY GLY A . n 
C 2 148 THR 148 298 298 THR THR A . n 
C 2 149 ALA 149 299 299 ALA ALA A . n 
C 2 150 MET 150 300 300 MET MET A . n 
C 2 151 THR 151 301 301 THR THR A . n 
C 2 152 PRO 152 302 302 PRO PRO A . n 
C 2 153 ASN 153 303 303 ASN ASN A . n 
C 2 154 PHE 154 304 304 PHE PHE A . n 
C 2 155 VAL 155 305 305 VAL VAL A . n 
C 2 156 SER 156 306 306 SER SER A . n 
C 2 157 ASN 157 307 307 ASN ASN A . n 
C 2 158 VAL 158 308 308 VAL VAL A . n 
C 2 159 ASN 159 309 309 ASN ASN A . n 
C 2 160 THR 160 310 310 THR THR A . n 
C 2 161 SER 161 311 311 SER SER A . n 
C 2 162 VAL 162 312 312 VAL VAL A . n 
C 2 163 ALA 163 313 313 ALA ALA A . n 
C 2 164 LEU 164 314 314 LEU LEU A . n 
C 2 165 SER 165 315 315 SER SER A . n 
C 2 166 CYS 166 316 316 CYS CYS A . n 
C 2 167 THR 167 317 317 THR THR A . n 
C 2 168 CYS 168 318 318 CYS CYS A . n 
C 2 169 ARG 169 319 319 ARG ARG A . n 
C 2 170 GLY 170 320 320 GLY GLY A . n 
C 2 171 SER 171 321 321 SER SER A . n 
C 2 172 GLY 172 322 322 GLY GLY A . n 
C 2 173 ASN 173 323 323 ASN ASN A . n 
C 2 174 LEU 174 324 324 LEU LEU A . n 
C 2 175 GLN 175 325 325 GLN GLN A . n 
C 2 176 GLU 176 326 326 GLU GLU A . n 
C 2 177 GLU 177 327 327 GLU GLU A . n 
C 2 178 CYS 178 328 328 CYS CYS A . n 
C 2 179 GLU 179 329 329 GLU GLU A . n 
C 2 180 MET 180 330 330 MET MET A . n 
C 2 181 LEU 181 331 331 LEU LEU A . n 
C 2 182 GLU 182 332 332 GLU GLU A . n 
C 2 183 GLY 183 333 333 GLY GLY A . n 
C 2 184 PHE 184 334 334 PHE PHE A . n 
C 2 185 PHE 185 335 335 PHE PHE A . n 
C 2 186 SER 186 336 336 SER SER A . n 
C 2 187 HIS 187 337 337 HIS HIS A . n 
C 2 188 ASN 188 338 338 ASN ASN A . n 
C 2 189 PRO 189 339 339 PRO PRO A . n 
C 2 190 CYS 190 340 340 CYS CYS A . n 
C 2 191 LEU 191 341 341 LEU LEU A . n 
C 2 192 THR 192 342 342 THR THR A . n 
C 2 193 GLU 193 343 343 GLU GLU A . n 
C 2 194 ALA 194 344 344 ALA ALA A . n 
C 2 195 ILE 195 345 345 ILE ILE A . n 
C 2 196 ALA 196 346 346 ALA ALA A . n 
C 2 197 ALA 197 347 347 ALA ALA A . n 
C 2 198 LYS 198 348 348 LYS LYS A . n 
C 2 199 MET 199 349 349 MET MET A . n 
C 2 200 ARG 200 350 350 ARG ARG A . n 
C 2 201 PHE 201 351 351 PHE PHE A . n 
C 2 202 HIS 202 352 352 HIS HIS A . n 
C 2 203 SER 203 353 353 SER SER A . n 
C 2 204 GLN 204 354 354 GLN GLN A . n 
C 2 205 LEU 205 355 355 LEU LEU A . n 
C 2 206 PHE 206 356 356 PHE PHE A . n 
C 2 207 SER 207 357 357 SER SER A . n 
C 2 208 GLN 208 358 ?   ?   ?   A . n 
C 2 209 ASP 209 359 ?   ?   ?   A . n 
C 2 210 TRP 210 360 ?   ?   ?   A . n 
C 2 211 PRO 211 361 ?   ?   ?   A . n 
C 2 212 HIS 212 362 ?   ?   ?   A . n 
C 2 213 PRO 213 363 ?   ?   ?   A . n 
D 2 1   LYS 1   151 ?   ?   ?   B . n 
D 2 2   LEU 2   152 ?   ?   ?   B . n 
D 2 3   ASN 3   153 ?   ?   ?   B . n 
D 2 4   MET 4   154 ?   ?   ?   B . n 
D 2 5   LEU 5   155 ?   ?   ?   B . n 
D 2 6   LYS 6   156 ?   ?   ?   B . n 
D 2 7   PRO 7   157 ?   ?   ?   B . n 
D 2 8   ASP 8   158 ?   ?   ?   B . n 
D 2 9   SER 9   159 159 SER SER B . n 
D 2 10  ASP 10  160 160 ASP ASP B . n 
D 2 11  LEU 11  161 161 LEU LEU B . n 
D 2 12  CYS 12  162 162 CYS CYS B . n 
D 2 13  LEU 13  163 163 LEU LEU B . n 
D 2 14  LYS 14  164 164 LYS LYS B . n 
D 2 15  PHE 15  165 165 PHE PHE B . n 
D 2 16  ALA 16  166 166 ALA ALA B . n 
D 2 17  MET 17  167 167 MET MET B . n 
D 2 18  LEU 18  168 168 LEU LEU B . n 
D 2 19  CYS 19  169 169 CYS CYS B . n 
D 2 20  THR 20  170 170 THR THR B . n 
D 2 21  LEU 21  171 171 LEU LEU B . n 
D 2 22  ASN 22  172 172 ASN ASN B . n 
D 2 23  ASP 23  173 173 ASP ASP B . n 
D 2 24  LYS 24  174 174 LYS LYS B . n 
D 2 25  CYS 25  175 175 CYS CYS B . n 
D 2 26  ASP 26  176 176 ASP ASP B . n 
D 2 27  ARG 27  177 177 ARG ARG B . n 
D 2 28  LEU 28  178 178 LEU LEU B . n 
D 2 29  ARG 29  179 179 ARG ARG B . n 
D 2 30  LYS 30  180 180 LYS LYS B . n 
D 2 31  ALA 31  181 181 ALA ALA B . n 
D 2 32  TYR 32  182 182 TYR TYR B . n 
D 2 33  GLY 33  183 183 GLY GLY B . n 
D 2 34  GLU 34  184 184 GLU GLU B . n 
D 2 35  ALA 35  185 185 ALA ALA B . n 
D 2 36  CYS 36  186 186 CYS CYS B . n 
D 2 37  SER 37  187 187 SER SER B . n 
D 2 38  GLY 38  188 188 GLY GLY B . n 
D 2 39  PRO 39  189 189 PRO PRO B . n 
D 2 40  HIS 40  190 190 HIS HIS B . n 
D 2 41  CYS 41  191 191 CYS CYS B . n 
D 2 42  GLN 42  192 192 GLN GLN B . n 
D 2 43  ARG 43  193 193 ARG ARG B . n 
D 2 44  HIS 44  194 194 HIS HIS B . n 
D 2 45  VAL 45  195 195 VAL VAL B . n 
D 2 46  CYS 46  196 196 CYS CYS B . n 
D 2 47  LEU 47  197 197 LEU LEU B . n 
D 2 48  ARG 48  198 198 ARG ARG B . n 
D 2 49  GLN 49  199 199 GLN GLN B . n 
D 2 50  LEU 50  200 200 LEU LEU B . n 
D 2 51  LEU 51  201 201 LEU LEU B . n 
D 2 52  THR 52  202 202 THR THR B . n 
D 2 53  PHE 53  203 203 PHE PHE B . n 
D 2 54  PHE 54  204 204 PHE PHE B . n 
D 2 55  GLU 55  205 205 GLU GLU B . n 
D 2 56  LYS 56  206 206 LYS LYS B . n 
D 2 57  ALA 57  207 207 ALA ALA B . n 
D 2 58  ALA 58  208 208 ALA ALA B . n 
D 2 59  GLU 59  209 209 GLU GLU B . n 
D 2 60  PRO 60  210 210 PRO PRO B . n 
D 2 61  HIS 61  211 211 HIS HIS B . n 
D 2 62  ALA 62  212 212 ALA ALA B . n 
D 2 63  GLN 63  213 213 GLN GLN B . n 
D 2 64  GLY 64  214 214 GLY GLY B . n 
D 2 65  LEU 65  215 215 LEU LEU B . n 
D 2 66  LEU 66  216 216 LEU LEU B . n 
D 2 67  LEU 67  217 217 LEU LEU B . n 
D 2 68  CYS 68  218 218 CYS CYS B . n 
D 2 69  PRO 69  219 219 PRO PRO B . n 
D 2 70  CYS 70  220 220 CYS CYS B . n 
D 2 71  ALA 71  221 221 ALA ALA B . n 
D 2 72  PRO 72  222 222 PRO PRO B . n 
D 2 73  ASN 73  223 223 ASN ASN B . n 
D 2 74  ASP 74  224 224 ASP ASP B . n 
D 2 75  ARG 75  225 225 ARG ARG B . n 
D 2 76  GLY 76  226 226 GLY GLY B . n 
D 2 77  CYS 77  227 227 CYS CYS B . n 
D 2 78  GLY 78  228 228 GLY GLY B . n 
D 2 79  GLU 79  229 229 GLU GLU B . n 
D 2 80  ARG 80  230 230 ARG ARG B . n 
D 2 81  ARG 81  231 231 ARG ARG B . n 
D 2 82  ARG 82  232 232 ARG ARG B . n 
D 2 83  ASN 83  233 233 ASN ASN B . n 
D 2 84  THR 84  234 234 THR THR B . n 
D 2 85  ILE 85  235 235 ILE ILE B . n 
D 2 86  ALA 86  236 236 ALA ALA B . n 
D 2 87  PRO 87  237 237 PRO PRO B . n 
D 2 88  ASN 88  238 238 ASN ASN B . n 
D 2 89  CYS 89  239 239 CYS CYS B . n 
D 2 90  ALA 90  240 240 ALA ALA B . n 
D 2 91  LEU 91  241 241 LEU LEU B . n 
D 2 92  PRO 92  242 242 PRO PRO B . n 
D 2 93  PRO 93  243 243 PRO PRO B . n 
D 2 94  VAL 94  244 244 VAL VAL B . n 
D 2 95  ALA 95  245 245 ALA ALA B . n 
D 2 96  PRO 96  246 246 PRO PRO B . n 
D 2 97  ASN 97  247 247 ASN ASN B . n 
D 2 98  CYS 98  248 248 CYS CYS B . n 
D 2 99  LEU 99  249 249 LEU LEU B . n 
D 2 100 GLU 100 250 250 GLU GLU B . n 
D 2 101 LEU 101 251 251 LEU LEU B . n 
D 2 102 ARG 102 252 252 ARG ARG B . n 
D 2 103 ARG 103 253 253 ARG ARG B . n 
D 2 104 LEU 104 254 254 LEU LEU B . n 
D 2 105 CYS 105 255 255 CYS CYS B . n 
D 2 106 PHE 106 256 256 PHE PHE B . n 
D 2 107 SER 107 257 257 SER SER B . n 
D 2 108 ASP 108 258 258 ASP ASP B . n 
D 2 109 PRO 109 259 259 PRO PRO B . n 
D 2 110 LEU 110 260 260 LEU LEU B . n 
D 2 111 CYS 111 261 261 CYS CYS B . n 
D 2 112 ARG 112 262 262 ARG ARG B . n 
D 2 113 SER 113 263 263 SER SER B . n 
D 2 114 ARG 114 264 264 ARG ARG B . n 
D 2 115 LEU 115 265 265 LEU LEU B . n 
D 2 116 VAL 116 266 266 VAL VAL B . n 
D 2 117 ASP 117 267 267 ASP ASP B . n 
D 2 118 PHE 118 268 268 PHE PHE B . n 
D 2 119 GLN 119 269 269 GLN GLN B . n 
D 2 120 THR 120 270 270 THR THR B . n 
D 2 121 HIS 121 271 271 HIS HIS B . n 
D 2 122 CYS 122 272 272 CYS CYS B . n 
D 2 123 HIS 123 273 273 HIS HIS B . n 
D 2 124 PRO 124 274 274 PRO PRO B . n 
D 2 125 MET 125 275 275 MET MET B . n 
D 2 126 ASP 126 276 276 ASP ASP B . n 
D 2 127 ILE 127 277 277 ILE ILE B . n 
D 2 128 LEU 128 278 278 LEU LEU B . n 
D 2 129 GLY 129 279 279 GLY GLY B . n 
D 2 130 THR 130 280 280 THR THR B . n 
D 2 131 CYS 131 281 281 CYS CYS B . n 
D 2 132 ALA 132 282 282 ALA ALA B . n 
D 2 133 THR 133 283 283 THR THR B . n 
D 2 134 GLU 134 284 284 GLU GLU B . n 
D 2 135 GLN 135 285 285 GLN GLN B . n 
D 2 136 SER 136 286 286 SER SER B . n 
D 2 137 ARG 137 287 287 ARG ARG B . n 
D 2 138 CYS 138 288 288 CYS CYS B . n 
D 2 139 LEU 139 289 289 LEU LEU B . n 
D 2 140 ARG 140 290 290 ARG ARG B . n 
D 2 141 ALA 141 291 291 ALA ALA B . n 
D 2 142 TYR 142 292 292 TYR TYR B . n 
D 2 143 LEU 143 293 293 LEU LEU B . n 
D 2 144 GLY 144 294 294 GLY GLY B . n 
D 2 145 LEU 145 295 295 LEU LEU B . n 
D 2 146 ILE 146 296 296 ILE ILE B . n 
D 2 147 GLY 147 297 297 GLY GLY B . n 
D 2 148 THR 148 298 298 THR THR B . n 
D 2 149 ALA 149 299 299 ALA ALA B . n 
D 2 150 MET 150 300 300 MET MET B . n 
D 2 151 THR 151 301 301 THR THR B . n 
D 2 152 PRO 152 302 302 PRO PRO B . n 
D 2 153 ASN 153 303 303 ASN ASN B . n 
D 2 154 PHE 154 304 304 PHE PHE B . n 
D 2 155 VAL 155 305 305 VAL VAL B . n 
D 2 156 SER 156 306 306 SER SER B . n 
D 2 157 ASN 157 307 307 ASN ASN B . n 
D 2 158 VAL 158 308 308 VAL VAL B . n 
D 2 159 ASN 159 309 309 ASN ASN B . n 
D 2 160 THR 160 310 310 THR THR B . n 
D 2 161 SER 161 311 311 SER SER B . n 
D 2 162 VAL 162 312 312 VAL VAL B . n 
D 2 163 ALA 163 313 313 ALA ALA B . n 
D 2 164 LEU 164 314 314 LEU LEU B . n 
D 2 165 SER 165 315 315 SER SER B . n 
D 2 166 CYS 166 316 316 CYS CYS B . n 
D 2 167 THR 167 317 317 THR THR B . n 
D 2 168 CYS 168 318 318 CYS CYS B . n 
D 2 169 ARG 169 319 319 ARG ARG B . n 
D 2 170 GLY 170 320 320 GLY GLY B . n 
D 2 171 SER 171 321 321 SER SER B . n 
D 2 172 GLY 172 322 322 GLY GLY B . n 
D 2 173 ASN 173 323 323 ASN ASN B . n 
D 2 174 LEU 174 324 324 LEU LEU B . n 
D 2 175 GLN 175 325 325 GLN GLN B . n 
D 2 176 GLU 176 326 326 GLU GLU B . n 
D 2 177 GLU 177 327 327 GLU GLU B . n 
D 2 178 CYS 178 328 328 CYS CYS B . n 
D 2 179 GLU 179 329 329 GLU GLU B . n 
D 2 180 MET 180 330 330 MET MET B . n 
D 2 181 LEU 181 331 331 LEU LEU B . n 
D 2 182 GLU 182 332 332 GLU GLU B . n 
D 2 183 GLY 183 333 333 GLY GLY B . n 
D 2 184 PHE 184 334 334 PHE PHE B . n 
D 2 185 PHE 185 335 335 PHE PHE B . n 
D 2 186 SER 186 336 336 SER SER B . n 
D 2 187 HIS 187 337 337 HIS HIS B . n 
D 2 188 ASN 188 338 338 ASN ASN B . n 
D 2 189 PRO 189 339 339 PRO PRO B . n 
D 2 190 CYS 190 340 340 CYS CYS B . n 
D 2 191 LEU 191 341 341 LEU LEU B . n 
D 2 192 THR 192 342 342 THR THR B . n 
D 2 193 GLU 193 343 343 GLU GLU B . n 
D 2 194 ALA 194 344 344 ALA ALA B . n 
D 2 195 ILE 195 345 345 ILE ILE B . n 
D 2 196 ALA 196 346 346 ALA ALA B . n 
D 2 197 ALA 197 347 347 ALA ALA B . n 
D 2 198 LYS 198 348 348 LYS LYS B . n 
D 2 199 MET 199 349 349 MET MET B . n 
D 2 200 ARG 200 350 350 ARG ARG B . n 
D 2 201 PHE 201 351 351 PHE PHE B . n 
D 2 202 HIS 202 352 352 HIS HIS B . n 
D 2 203 SER 203 353 353 SER SER B . n 
D 2 204 GLN 204 354 354 GLN GLN B . n 
D 2 205 LEU 205 355 355 LEU LEU B . n 
D 2 206 PHE 206 356 356 PHE PHE B . n 
D 2 207 SER 207 357 357 SER SER B . n 
D 2 208 GLN 208 358 ?   ?   ?   B . n 
D 2 209 ASP 209 359 ?   ?   ?   B . n 
D 2 210 TRP 210 360 ?   ?   ?   B . n 
D 2 211 PRO 211 361 ?   ?   ?   B . n 
D 2 212 HIS 212 362 ?   ?   ?   B . n 
D 2 213 PRO 213 363 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C ASN 159 A ASN 309 ? ASN 'GLYCOSYLATION SITE' 
2 D ASN 159 B ASN 309 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7660  ? 
1 MORE         -18   ? 
1 'SSA (A^2)'  29900 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-27 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 5.9776   -7.6124  -29.7207 -0.0377 0.0668  -0.0680 -0.1372 -0.0224 -0.0412 4.6553 2.2190 2.2951 2.9855 -3.2632 -2.1412 
0.0370  0.0100  0.1615  -0.0850 0.0077  0.1062  -0.0170 -0.1241 -0.0447 'X-RAY DIFFRACTION' 
2 ? refined 45.1435  15.6000  -46.3050 -0.0927 -0.2010 -0.1727 -0.0439 -0.0038 -0.0190 2.3840 2.1270 2.2184 1.0070 -0.4526 -0.4072 
0.1800  -0.2985 0.1297  0.2095  -0.1943 0.0544  -0.0857 0.0584  0.0143  'X-RAY DIFFRACTION' 
3 ? refined -22.9561 -29.2393 2.8018   -0.1618 -0.0712 -0.0709 0.0126  -0.0412 -0.0421 2.4516 1.8491 3.8480 0.5799 -0.2269 -0.2914 
-0.1621 0.0197  -0.1755 0.0529  0.0732  -0.2208 0.1403  0.0176  0.0889  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 C 120  A 1 C 219  A 100 ? 'X-RAY DIFFRACTION' ? 
2 1 D 121  B 2 D 219  B 100 ? 'X-RAY DIFFRACTION' ? 
3 2 A 158  C 8 A 357  C 207 ? 'X-RAY DIFFRACTION' ? 
4 2 A 100  E 1 A 104  E 5   ? 'X-RAY DIFFRACTION' ? 
5 3 B 159  D 9 B 357  D 207 ? 'X-RAY DIFFRACTION' ? 
6 3 B 1100 F 1 B 1100 F 1   ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
PHASER    phasing           .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    467 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    470 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CE A LYS 180 ? ? NZ  A LYS 180 ? ? 1.685 1.486 0.199 0.025 N 
2 1 CD A GLU 250 ? ? OE2 A GLU 250 ? ? 1.318 1.252 0.066 0.011 N 
3 1 C  A GLY 322 ? ? N   A ASN 323 ? ? 1.620 1.336 0.284 0.023 Y 
4 1 CG A ARG 350 ? ? CD  A ARG 350 ? ? 1.693 1.515 0.178 0.025 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 230 ? ? CZ A ARG 230 ? ? NH1 A ARG 230 ? ? 123.37 120.30 3.07  0.50 N 
2 1 NE A ARG 230 ? ? CZ A ARG 230 ? ? NH2 A ARG 230 ? ? 115.53 120.30 -4.77 0.50 N 
3 1 NE A ARG 253 ? ? CZ A ARG 253 ? ? NH2 A ARG 253 ? ? 117.14 120.30 -3.16 0.50 N 
4 1 NE B ARG 230 ? ? CZ B ARG 230 ? ? NH1 B ARG 230 ? ? 124.38 120.30 4.08  0.50 N 
5 1 NE B ARG 230 ? ? CZ B ARG 230 ? ? NH2 B ARG 230 ? ? 114.27 120.30 -6.03 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS D 154 ? ? -119.08 59.54   
2  1 ARG D 156 ? ? -151.69 -69.50  
3  1 ALA D 157 ? ? -81.60  38.85   
4  1 HIS A 190 ? ? -54.78  -105.98 
5  1 CYS A 191 ? ? 54.30   117.01  
6  1 LEU A 217 ? ? -98.03  54.30   
7  1 THR A 283 ? ? -113.98 -83.03  
8  1 MET A 300 ? ? -98.72  50.72   
9  1 ASN A 323 ? ? -63.85  4.42    
10 1 LEU B 217 ? ? -98.79  55.62   
11 1 THR B 283 ? ? -114.45 -98.60  
12 1 MET B 300 ? ? -117.38 58.94   
13 1 ASN B 323 ? ? -57.42  -9.05   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   SER 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    187 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    188 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            149.07 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   GLY 
_pdbx_validate_polymer_linkage.auth_seq_id_1    322 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   ASN 
_pdbx_validate_polymer_linkage.auth_seq_id_2    323 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.62 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C GLY 220 ? A GLY 101 
2  1 Y 1 D ASP 120 ? B ASP 1   
3  1 Y 1 D GLY 220 ? B GLY 101 
4  1 Y 1 A LYS 151 ? C LYS 1   
5  1 Y 1 A LEU 152 ? C LEU 2   
6  1 Y 1 A ASN 153 ? C ASN 3   
7  1 Y 1 A MET 154 ? C MET 4   
8  1 Y 1 A LEU 155 ? C LEU 5   
9  1 Y 1 A LYS 156 ? C LYS 6   
10 1 Y 1 A PRO 157 ? C PRO 7   
11 1 Y 1 A GLN 358 ? C GLN 208 
12 1 Y 1 A ASP 359 ? C ASP 209 
13 1 Y 1 A TRP 360 ? C TRP 210 
14 1 Y 1 A PRO 361 ? C PRO 211 
15 1 Y 1 A HIS 362 ? C HIS 212 
16 1 Y 1 A PRO 363 ? C PRO 213 
17 1 Y 1 B LYS 151 ? D LYS 1   
18 1 Y 1 B LEU 152 ? D LEU 2   
19 1 Y 1 B ASN 153 ? D ASN 3   
20 1 Y 1 B MET 154 ? D MET 4   
21 1 Y 1 B LEU 155 ? D LEU 5   
22 1 Y 1 B LYS 156 ? D LYS 6   
23 1 Y 1 B PRO 157 ? D PRO 7   
24 1 Y 1 B ASP 158 ? D ASP 8   
25 1 Y 1 B GLN 358 ? D GLN 208 
26 1 Y 1 B ASP 359 ? D ASP 209 
27 1 Y 1 B TRP 360 ? D TRP 210 
28 1 Y 1 B PRO 361 ? D PRO 211 
29 1 Y 1 B HIS 362 ? D HIS 212 
30 1 Y 1 B PRO 363 ? D PRO 213 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 N-ACETYL-D-GLUCOSAMINE NAG 
4 BETA-D-MANNOSE         BMA 
5 ALPHA-D-MANNOSE        MAN 
6 water                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 NAG 1   100  100 NAG NAG A . 
F 3 NAG 2   101  101 NAG NAG A . 
G 4 BMA 3   102  102 BMA MAN A . 
H 5 MAN 4   103  103 MAN MAN A . 
I 5 MAN 5   104  104 MAN MAN A . 
J 3 NAG 1   1100 100 NAG NAG B . 
K 6 HOH 1   221  9   HOH HOH C . 
K 6 HOH 2   222  12  HOH HOH C . 
K 6 HOH 3   223  18  HOH HOH C . 
K 6 HOH 4   224  43  HOH HOH C . 
K 6 HOH 5   225  61  HOH HOH C . 
K 6 HOH 6   226  63  HOH HOH C . 
K 6 HOH 7   227  72  HOH HOH C . 
K 6 HOH 8   228  88  HOH HOH C . 
K 6 HOH 9   229  95  HOH HOH C . 
K 6 HOH 10  230  97  HOH HOH C . 
K 6 HOH 11  231  107 HOH HOH C . 
K 6 HOH 12  232  110 HOH HOH C . 
K 6 HOH 13  233  112 HOH HOH C . 
K 6 HOH 14  234  131 HOH HOH C . 
K 6 HOH 15  235  136 HOH HOH C . 
K 6 HOH 16  236  140 HOH HOH C . 
K 6 HOH 17  237  150 HOH HOH C . 
K 6 HOH 18  238  168 HOH HOH C . 
K 6 HOH 19  239  178 HOH HOH C . 
K 6 HOH 20  240  179 HOH HOH C . 
K 6 HOH 21  241  181 HOH HOH C . 
K 6 HOH 22  242  182 HOH HOH C . 
K 6 HOH 23  243  183 HOH HOH C . 
K 6 HOH 24  244  184 HOH HOH C . 
K 6 HOH 25  245  190 HOH HOH C . 
K 6 HOH 26  246  193 HOH HOH C . 
K 6 HOH 27  247  199 HOH HOH C . 
K 6 HOH 28  248  202 HOH HOH C . 
K 6 HOH 29  249  212 HOH HOH C . 
K 6 HOH 30  250  214 HOH HOH C . 
K 6 HOH 31  251  217 HOH HOH C . 
K 6 HOH 32  252  219 HOH HOH C . 
K 6 HOH 33  253  220 HOH HOH C . 
K 6 HOH 34  254  228 HOH HOH C . 
K 6 HOH 35  255  234 HOH HOH C . 
L 6 HOH 1   221  2   HOH HOH D . 
L 6 HOH 2   222  40  HOH HOH D . 
L 6 HOH 3   223  47  HOH HOH D . 
L 6 HOH 4   224  68  HOH HOH D . 
L 6 HOH 5   225  74  HOH HOH D . 
L 6 HOH 6   226  82  HOH HOH D . 
L 6 HOH 7   227  84  HOH HOH D . 
L 6 HOH 8   228  103 HOH HOH D . 
L 6 HOH 9   229  126 HOH HOH D . 
L 6 HOH 10  230  130 HOH HOH D . 
L 6 HOH 11  231  133 HOH HOH D . 
L 6 HOH 12  232  135 HOH HOH D . 
L 6 HOH 13  233  138 HOH HOH D . 
L 6 HOH 14  234  152 HOH HOH D . 
L 6 HOH 15  235  159 HOH HOH D . 
L 6 HOH 16  236  166 HOH HOH D . 
L 6 HOH 17  237  174 HOH HOH D . 
L 6 HOH 18  238  175 HOH HOH D . 
L 6 HOH 19  239  186 HOH HOH D . 
L 6 HOH 20  240  192 HOH HOH D . 
L 6 HOH 21  241  206 HOH HOH D . 
L 6 HOH 22  242  211 HOH HOH D . 
L 6 HOH 23  243  213 HOH HOH D . 
L 6 HOH 24  244  225 HOH HOH D . 
L 6 HOH 25  245  227 HOH HOH D . 
L 6 HOH 26  246  236 HOH HOH D . 
M 6 HOH 1   364  4   HOH HOH A . 
M 6 HOH 2   365  5   HOH HOH A . 
M 6 HOH 3   366  6   HOH HOH A . 
M 6 HOH 4   367  7   HOH HOH A . 
M 6 HOH 5   368  11  HOH HOH A . 
M 6 HOH 6   369  13  HOH HOH A . 
M 6 HOH 7   370  15  HOH HOH A . 
M 6 HOH 8   371  19  HOH HOH A . 
M 6 HOH 9   372  20  HOH HOH A . 
M 6 HOH 10  373  21  HOH HOH A . 
M 6 HOH 11  374  23  HOH HOH A . 
M 6 HOH 12  375  24  HOH HOH A . 
M 6 HOH 13  376  25  HOH HOH A . 
M 6 HOH 14  377  26  HOH HOH A . 
M 6 HOH 15  378  27  HOH HOH A . 
M 6 HOH 16  379  28  HOH HOH A . 
M 6 HOH 17  380  31  HOH HOH A . 
M 6 HOH 18  381  32  HOH HOH A . 
M 6 HOH 19  382  33  HOH HOH A . 
M 6 HOH 20  383  34  HOH HOH A . 
M 6 HOH 21  384  35  HOH HOH A . 
M 6 HOH 22  385  36  HOH HOH A . 
M 6 HOH 23  386  37  HOH HOH A . 
M 6 HOH 24  387  38  HOH HOH A . 
M 6 HOH 25  388  41  HOH HOH A . 
M 6 HOH 26  389  45  HOH HOH A . 
M 6 HOH 27  390  46  HOH HOH A . 
M 6 HOH 28  391  48  HOH HOH A . 
M 6 HOH 29  392  50  HOH HOH A . 
M 6 HOH 30  393  51  HOH HOH A . 
M 6 HOH 31  394  52  HOH HOH A . 
M 6 HOH 32  395  53  HOH HOH A . 
M 6 HOH 33  396  54  HOH HOH A . 
M 6 HOH 34  397  55  HOH HOH A . 
M 6 HOH 35  398  58  HOH HOH A . 
M 6 HOH 36  399  59  HOH HOH A . 
M 6 HOH 37  400  64  HOH HOH A . 
M 6 HOH 38  401  69  HOH HOH A . 
M 6 HOH 39  402  70  HOH HOH A . 
M 6 HOH 40  403  71  HOH HOH A . 
M 6 HOH 41  404  73  HOH HOH A . 
M 6 HOH 42  405  75  HOH HOH A . 
M 6 HOH 43  406  76  HOH HOH A . 
M 6 HOH 44  407  77  HOH HOH A . 
M 6 HOH 45  408  78  HOH HOH A . 
M 6 HOH 46  409  80  HOH HOH A . 
M 6 HOH 47  410  81  HOH HOH A . 
M 6 HOH 48  411  83  HOH HOH A . 
M 6 HOH 49  412  85  HOH HOH A . 
M 6 HOH 50  413  87  HOH HOH A . 
M 6 HOH 51  414  89  HOH HOH A . 
M 6 HOH 52  415  90  HOH HOH A . 
M 6 HOH 53  416  92  HOH HOH A . 
M 6 HOH 54  417  93  HOH HOH A . 
M 6 HOH 55  418  94  HOH HOH A . 
M 6 HOH 56  419  99  HOH HOH A . 
M 6 HOH 57  420  101 HOH HOH A . 
M 6 HOH 58  421  104 HOH HOH A . 
M 6 HOH 59  422  105 HOH HOH A . 
M 6 HOH 60  423  106 HOH HOH A . 
M 6 HOH 61  424  109 HOH HOH A . 
M 6 HOH 62  425  111 HOH HOH A . 
M 6 HOH 63  426  113 HOH HOH A . 
M 6 HOH 64  427  115 HOH HOH A . 
M 6 HOH 65  428  119 HOH HOH A . 
M 6 HOH 66  429  120 HOH HOH A . 
M 6 HOH 67  430  123 HOH HOH A . 
M 6 HOH 68  431  124 HOH HOH A . 
M 6 HOH 69  432  127 HOH HOH A . 
M 6 HOH 70  433  128 HOH HOH A . 
M 6 HOH 71  434  129 HOH HOH A . 
M 6 HOH 72  435  134 HOH HOH A . 
M 6 HOH 73  436  137 HOH HOH A . 
M 6 HOH 74  437  139 HOH HOH A . 
M 6 HOH 75  438  141 HOH HOH A . 
M 6 HOH 76  439  142 HOH HOH A . 
M 6 HOH 77  440  144 HOH HOH A . 
M 6 HOH 78  441  145 HOH HOH A . 
M 6 HOH 79  442  146 HOH HOH A . 
M 6 HOH 80  443  147 HOH HOH A . 
M 6 HOH 81  444  148 HOH HOH A . 
M 6 HOH 82  445  153 HOH HOH A . 
M 6 HOH 83  446  154 HOH HOH A . 
M 6 HOH 84  447  155 HOH HOH A . 
M 6 HOH 85  448  158 HOH HOH A . 
M 6 HOH 86  449  160 HOH HOH A . 
M 6 HOH 87  450  161 HOH HOH A . 
M 6 HOH 88  451  163 HOH HOH A . 
M 6 HOH 89  452  164 HOH HOH A . 
M 6 HOH 90  453  169 HOH HOH A . 
M 6 HOH 91  454  185 HOH HOH A . 
M 6 HOH 92  455  188 HOH HOH A . 
M 6 HOH 93  456  195 HOH HOH A . 
M 6 HOH 94  457  197 HOH HOH A . 
M 6 HOH 95  458  200 HOH HOH A . 
M 6 HOH 96  459  201 HOH HOH A . 
M 6 HOH 97  460  203 HOH HOH A . 
M 6 HOH 98  461  205 HOH HOH A . 
M 6 HOH 99  462  208 HOH HOH A . 
M 6 HOH 100 463  209 HOH HOH A . 
M 6 HOH 101 464  210 HOH HOH A . 
M 6 HOH 102 465  216 HOH HOH A . 
M 6 HOH 103 466  218 HOH HOH A . 
M 6 HOH 104 467  221 HOH HOH A . 
M 6 HOH 105 468  224 HOH HOH A . 
M 6 HOH 106 469  226 HOH HOH A . 
M 6 HOH 107 470  229 HOH HOH A . 
M 6 HOH 108 471  230 HOH HOH A . 
M 6 HOH 109 472  232 HOH HOH A . 
M 6 HOH 110 473  233 HOH HOH A . 
M 6 HOH 111 474  235 HOH HOH A . 
N 6 HOH 1   1101 1   HOH HOH B . 
N 6 HOH 2   1102 3   HOH HOH B . 
N 6 HOH 3   1103 8   HOH HOH B . 
N 6 HOH 4   1104 10  HOH HOH B . 
N 6 HOH 5   1105 14  HOH HOH B . 
N 6 HOH 6   1106 16  HOH HOH B . 
N 6 HOH 7   1107 17  HOH HOH B . 
N 6 HOH 8   1108 22  HOH HOH B . 
N 6 HOH 9   1109 29  HOH HOH B . 
N 6 HOH 10  1110 30  HOH HOH B . 
N 6 HOH 11  1111 39  HOH HOH B . 
N 6 HOH 12  1112 42  HOH HOH B . 
N 6 HOH 13  1113 44  HOH HOH B . 
N 6 HOH 14  1114 49  HOH HOH B . 
N 6 HOH 15  1115 56  HOH HOH B . 
N 6 HOH 16  1116 57  HOH HOH B . 
N 6 HOH 17  1117 60  HOH HOH B . 
N 6 HOH 18  1118 62  HOH HOH B . 
N 6 HOH 19  1119 65  HOH HOH B . 
N 6 HOH 20  1120 66  HOH HOH B . 
N 6 HOH 21  1121 67  HOH HOH B . 
N 6 HOH 22  1122 79  HOH HOH B . 
N 6 HOH 23  1123 86  HOH HOH B . 
N 6 HOH 24  1124 91  HOH HOH B . 
N 6 HOH 25  1125 96  HOH HOH B . 
N 6 HOH 26  1126 98  HOH HOH B . 
N 6 HOH 27  1127 100 HOH HOH B . 
N 6 HOH 28  1128 102 HOH HOH B . 
N 6 HOH 29  1129 108 HOH HOH B . 
N 6 HOH 30  1130 114 HOH HOH B . 
N 6 HOH 31  1131 116 HOH HOH B . 
N 6 HOH 32  1132 117 HOH HOH B . 
N 6 HOH 33  1133 118 HOH HOH B . 
N 6 HOH 34  1134 121 HOH HOH B . 
N 6 HOH 35  1135 122 HOH HOH B . 
N 6 HOH 36  1136 125 HOH HOH B . 
N 6 HOH 37  1137 132 HOH HOH B . 
N 6 HOH 38  1138 143 HOH HOH B . 
N 6 HOH 39  1139 149 HOH HOH B . 
N 6 HOH 40  1140 151 HOH HOH B . 
N 6 HOH 41  1141 156 HOH HOH B . 
N 6 HOH 42  1142 157 HOH HOH B . 
N 6 HOH 43  1143 162 HOH HOH B . 
N 6 HOH 44  1144 165 HOH HOH B . 
N 6 HOH 45  1145 167 HOH HOH B . 
N 6 HOH 46  1146 170 HOH HOH B . 
N 6 HOH 47  1147 171 HOH HOH B . 
N 6 HOH 48  1148 173 HOH HOH B . 
N 6 HOH 49  1149 176 HOH HOH B . 
N 6 HOH 50  1150 177 HOH HOH B . 
N 6 HOH 51  1151 180 HOH HOH B . 
N 6 HOH 52  1152 187 HOH HOH B . 
N 6 HOH 53  1153 189 HOH HOH B . 
N 6 HOH 54  1154 191 HOH HOH B . 
N 6 HOH 55  1155 194 HOH HOH B . 
N 6 HOH 56  1156 196 HOH HOH B . 
N 6 HOH 57  1157 198 HOH HOH B . 
N 6 HOH 58  1158 204 HOH HOH B . 
N 6 HOH 59  1159 207 HOH HOH B . 
N 6 HOH 60  1160 215 HOH HOH B . 
N 6 HOH 61  1161 222 HOH HOH B . 
N 6 HOH 62  1162 223 HOH HOH B . 
N 6 HOH 63  1163 231 HOH HOH B . 
N 6 HOH 64  1164 237 HOH HOH B . 
#