data_2GHQ
# 
_entry.id   2GHQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2GHQ         
RCSB  RCSB037132   
WWPDB D_1000037132 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1TA0 
_pdbx_database_related.details        'apo Scp1 structure' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2GHQ 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'  1 
'Noel, J.P.' 2 
# 
_citation.id                        primary 
_citation.title                     'Determinants for dephosphorylation of the RNA polymerase II C-terminal domain by Scp1.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            24 
_citation.page_first                759 
_citation.page_last                 770 
_citation.year                      2006 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17157258 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2006.10.027 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Y.'   1 
primary 'Kim, Y.'     2 
primary 'Genoud, N.'  3 
primary 'Gao, J.'     4 
primary 'Kelly, J.W.' 5 
primary 'Pfaff, S.L.' 6 
primary 'Gill, G.N.'  7 
primary 'Dixon, J.E.' 8 
primary 'Noel, J.P.'  9 
# 
_cell.entry_id           2GHQ 
_cell.length_a           126.067 
_cell.length_b           78.813 
_cell.length_c           62.992 
_cell.angle_alpha        90.00 
_cell.angle_beta         112.17 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2GHQ 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1' 20876.754 2   3.1.3.16 D96N ? ? 
2 polymer     man 'DNA-directed RNA polymerase II largest subunit'                              1081.906  2   2.7.7.6  ?    ? ? 
3 non-polymer syn 'MAGNESIUM ION'                                                               24.305    2   ?        ?    ? ? 
4 water       nat water                                                                         18.015    103 ?        ?    ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Nuclear LIM interactor-interacting factor 3, NLI-interacting factor 3, NLI-IF' 
2 RPB1                                                                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;HQYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASL
AKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELH
DLLPFFEQLSRVDDVYSVLRQ
;
;HQYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASL
AKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELH
DLLPFFEQLSRVDDVYSVLRQ
;
A,B ? 
2 'polypeptide(L)' no yes 'PSY(SEP)PT(SEP)PS' PSYSPTSPS C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   GLN n 
1 3   TYR n 
1 4   LEU n 
1 5   LEU n 
1 6   PRO n 
1 7   GLU n 
1 8   ALA n 
1 9   LYS n 
1 10  ALA n 
1 11  GLN n 
1 12  ASP n 
1 13  SER n 
1 14  ASP n 
1 15  LYS n 
1 16  ILE n 
1 17  CYS n 
1 18  VAL n 
1 19  VAL n 
1 20  ILE n 
1 21  ASN n 
1 22  LEU n 
1 23  ASP n 
1 24  GLU n 
1 25  THR n 
1 26  LEU n 
1 27  VAL n 
1 28  HIS n 
1 29  SER n 
1 30  SER n 
1 31  PHE n 
1 32  LYS n 
1 33  PRO n 
1 34  VAL n 
1 35  ASN n 
1 36  ASN n 
1 37  ALA n 
1 38  ASP n 
1 39  PHE n 
1 40  ILE n 
1 41  ILE n 
1 42  PRO n 
1 43  VAL n 
1 44  GLU n 
1 45  ILE n 
1 46  ASP n 
1 47  GLY n 
1 48  VAL n 
1 49  VAL n 
1 50  HIS n 
1 51  GLN n 
1 52  VAL n 
1 53  TYR n 
1 54  VAL n 
1 55  LEU n 
1 56  LYS n 
1 57  ARG n 
1 58  PRO n 
1 59  HIS n 
1 60  VAL n 
1 61  ASP n 
1 62  GLU n 
1 63  PHE n 
1 64  LEU n 
1 65  GLN n 
1 66  ARG n 
1 67  MET n 
1 68  GLY n 
1 69  GLU n 
1 70  LEU n 
1 71  PHE n 
1 72  GLU n 
1 73  CYS n 
1 74  VAL n 
1 75  LEU n 
1 76  PHE n 
1 77  THR n 
1 78  ALA n 
1 79  SER n 
1 80  LEU n 
1 81  ALA n 
1 82  LYS n 
1 83  TYR n 
1 84  ALA n 
1 85  ASP n 
1 86  PRO n 
1 87  VAL n 
1 88  ALA n 
1 89  ASP n 
1 90  LEU n 
1 91  LEU n 
1 92  ASP n 
1 93  LYS n 
1 94  TRP n 
1 95  GLY n 
1 96  ALA n 
1 97  PHE n 
1 98  ARG n 
1 99  ALA n 
1 100 ARG n 
1 101 LEU n 
1 102 PHE n 
1 103 ARG n 
1 104 GLU n 
1 105 SER n 
1 106 CYS n 
1 107 VAL n 
1 108 PHE n 
1 109 HIS n 
1 110 ARG n 
1 111 GLY n 
1 112 ASN n 
1 113 TYR n 
1 114 VAL n 
1 115 LYS n 
1 116 ASP n 
1 117 LEU n 
1 118 SER n 
1 119 ARG n 
1 120 LEU n 
1 121 GLY n 
1 122 ARG n 
1 123 ASP n 
1 124 LEU n 
1 125 ARG n 
1 126 ARG n 
1 127 VAL n 
1 128 LEU n 
1 129 ILE n 
1 130 LEU n 
1 131 ASP n 
1 132 ASN n 
1 133 SER n 
1 134 PRO n 
1 135 ALA n 
1 136 SER n 
1 137 TYR n 
1 138 VAL n 
1 139 PHE n 
1 140 HIS n 
1 141 PRO n 
1 142 ASP n 
1 143 ASN n 
1 144 ALA n 
1 145 VAL n 
1 146 PRO n 
1 147 VAL n 
1 148 ALA n 
1 149 SER n 
1 150 TRP n 
1 151 PHE n 
1 152 ASP n 
1 153 ASN n 
1 154 MET n 
1 155 SER n 
1 156 ASP n 
1 157 THR n 
1 158 GLU n 
1 159 LEU n 
1 160 HIS n 
1 161 ASP n 
1 162 LEU n 
1 163 LEU n 
1 164 PRO n 
1 165 PHE n 
1 166 PHE n 
1 167 GLU n 
1 168 GLN n 
1 169 LEU n 
1 170 SER n 
1 171 ARG n 
1 172 VAL n 
1 173 ASP n 
1 174 ASP n 
1 175 VAL n 
1 176 TYR n 
1 177 SER n 
1 178 VAL n 
1 179 LEU n 
1 180 ARG n 
1 181 GLN n 
2 1   PRO n 
2 2   SER n 
2 3   TYR n 
2 4   SEP n 
2 5   PRO n 
2 6   THR n 
2 7   SEP n 
2 8   PRO n 
2 9   SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo CTDSP1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pet28 derivatives' ? ? 
2 1 sample ? ? ? human Homo ?      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli'           562    Escherichia 
? ? ?                  ? ? ?           ? ? ? ? ? ? ? ?       ? ? ? ?                   ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CTDS1_HUMAN Q9GZU7 1 
;QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLA
KYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHD
LLPFFEQLSRVDDVYSVLRQPRPGS
;
77   ? 
2 UNP RPB1_HUMAN  P24928 2 PSYSPTSPS 1795 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2GHQ A 2 ? 181 ? Q9GZU7 77   ? 256  ? 77  256 
2 1 2GHQ B 2 ? 181 ? Q9GZU7 77   ? 256  ? 77  256 
3 2 2GHQ C 1 ? 9   ? P24928 1795 ? 1803 ? 168 176 
4 2 2GHQ D 1 ? 9   ? P24928 1795 ? 1803 ? 168 176 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2GHQ HIS A 1  ? UNP Q9GZU7 ?   ?    'CLONING ARTIFACT' 76  1 
1 2GHQ ASN A 21 ? UNP Q9GZU7 ASP 96   ENGINEERED         96  2 
2 2GHQ HIS B 1  ? UNP Q9GZU7 ?   ?    'CLONING ARTIFACT' 76  3 
2 2GHQ ASN B 21 ? UNP Q9GZU7 ASP 96   ENGINEERED         96  4 
3 2GHQ SEP C 4  ? UNP P24928 SER 1798 'MODIFIED RESIDUE' 171 5 
3 2GHQ SEP C 7  ? UNP P24928 SER 1801 'MODIFIED RESIDUE' 174 6 
4 2GHQ SEP D 4  ? UNP P24928 SER 1798 'MODIFIED RESIDUE' 171 7 
4 2GHQ SEP D 7  ? UNP P24928 SER 1801 'MODIFIED RESIDUE' 174 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?               'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2GHQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.23 
_exptl_crystal.density_percent_sol   61.92 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
;(1)0.5M Ammonium sulfate, 0.2M Lithium sulfate, 100mM HEPES 7.5  
(2) 1M sodium tartrate, 100mM Tris pH 8.5 
, pH 7.5 - 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-12-02 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     2GHQ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             48.98 
_reflns.d_resolution_high            2.04 
_reflns.number_obs                   35704 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.079 
_reflns.pdbx_netI_over_sigmaI        11.94 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.04 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   76.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.48 
_reflns_shell.meanI_over_sigI_obs    2.79 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4865 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2GHQ 
_refine.ls_number_reflns_obs                     35666 
_refine.ls_number_reflns_all                     35936 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.98 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          0.23 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.248 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1784 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               -0.397 
_refine.aniso_B[1][1]                            -0.613 
_refine.aniso_B[2][2]                            -5.223 
_refine.aniso_B[3][3]                            5.836 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            -9.019 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               throughtout 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entry 1ta0' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3042 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             103 
_refine_hist.number_atoms_total               3147 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        48.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.0158 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.82   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.05 
_refine_ls_shell.d_res_low                        2.18 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.325 
_refine_ls_shell.percent_reflns_obs               96.3 
_refine_ls_shell.R_factor_R_free                  0.342 
_refine_ls_shell.R_factor_R_free_error            0.02 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             289 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                5428 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2GHQ 
_struct.title                     'CTD-specific phosphatase Scp1 in complex with peptide C-terminal domain of RNA polymerase II' 
_struct.pdbx_descriptor           
;Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (E.C.3.1.3.16), DNA-directed RNA polymerase II largest subunit (E.C.2.7.7.6)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2GHQ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'protein-peptide complex, HAD superfamily, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 59  ? PHE A 71  ? HIS A 134 PHE A 146 1 ? 13 
HELX_P HELX_P2  2  LEU A 80  ? ASP A 92  ? LEU A 155 ASP A 167 1 ? 13 
HELX_P HELX_P3  3  PHE A 102 ? CYS A 106 ? PHE A 177 CYS A 181 5 ? 5  
HELX_P HELX_P4  4  ASP A 116 ? LEU A 120 ? ASP A 191 LEU A 195 5 ? 5  
HELX_P HELX_P5  5  ASP A 123 ? ARG A 125 ? ASP A 198 ARG A 200 5 ? 3  
HELX_P HELX_P6  6  SER A 133 ? VAL A 138 ? SER A 208 VAL A 213 5 ? 6  
HELX_P HELX_P7  7  THR A 157 ? SER A 170 ? THR A 232 SER A 245 1 ? 14 
HELX_P HELX_P8  8  VAL A 175 ? ARG A 180 ? VAL A 250 ARG A 255 1 ? 6  
HELX_P HELX_P9  9  HIS B 59  ? PHE B 71  ? HIS B 134 PHE B 146 1 ? 13 
HELX_P HELX_P10 10 LEU B 80  ? ASP B 92  ? LEU B 155 ASP B 167 1 ? 13 
HELX_P HELX_P11 11 PHE B 102 ? CYS B 106 ? PHE B 177 CYS B 181 5 ? 5  
HELX_P HELX_P12 12 ASP B 116 ? LEU B 120 ? ASP B 191 LEU B 195 5 ? 5  
HELX_P HELX_P13 13 ASP B 123 ? ARG B 125 ? ASP B 198 ARG B 200 5 ? 3  
HELX_P HELX_P14 14 SER B 133 ? VAL B 138 ? SER B 208 VAL B 213 5 ? 6  
HELX_P HELX_P15 15 HIS B 140 ? ASP B 142 ? HIS B 215 ASP B 217 5 ? 3  
HELX_P HELX_P16 16 THR B 157 ? VAL B 172 ? THR B 232 VAL B 247 1 ? 16 
HELX_P HELX_P17 17 VAL B 175 ? ARG B 180 ? VAL B 250 ARG B 255 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? E MG  . MG ? ? ? 1_555 D SEP 7   O2P ? ? B MG  257 D SEP 174 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc2 metalc ? ? E MG  . MG ? ? ? 1_555 B ASN 132 OD1 ? ? B MG  257 B ASN 207 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc3 metalc ? ? E MG  . MG ? ? ? 1_555 B ASN 21  OD1 ? ? B MG  257 B ASN 96  1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc4 metalc ? ? E MG  . MG ? ? ? 1_555 B ASP 23  O   ? ? B MG  257 B ASP 98  1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc5 metalc ? ? F MG  . MG ? ? ? 1_555 A ASN 21  OD1 ? ? C MG  151 A ASN 96  1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc6 metalc ? ? F MG  . MG ? ? ? 1_555 A ASN 132 OD1 ? ? C MG  151 A ASN 207 1_555 ? ? ? ? ? ? ? 2.555 ? 
metalc7 metalc ? ? F MG  . MG ? ? ? 1_555 A ASP 23  O   ? ? C MG  151 A ASP 98  1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc8 metalc ? ? F MG  . MG ? ? ? 1_555 C SEP 7   O1P ? ? C MG  151 C SEP 174 1_555 ? ? ? ? ? ? ? 1.633 ? 
covale1 covale ? ? C SEP 4 C  ? ? ? 1_555 C PRO 5   N   ? ? C SEP 171 C PRO 172 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale2 covale ? ? C THR 6 C  ? ? ? 1_555 C SEP 7   N   ? ? C THR 173 C SEP 174 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale3 covale ? ? C SEP 7 C  ? ? ? 1_555 C PRO 8   N   ? ? C SEP 174 C PRO 175 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale4 covale ? ? D TYR 3 C  ? ? ? 1_555 D SEP 4   N   ? ? D TYR 170 D SEP 171 1_555 ? ? ? ? ? ? ? 1.207 ? 
covale5 covale ? ? D SEP 4 C  ? ? ? 1_555 D PRO 5   N   ? ? D SEP 171 D PRO 172 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale6 covale ? ? D THR 6 C  ? ? ? 1_555 D SEP 7   N   ? ? D THR 173 D SEP 174 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale7 covale ? ? D SEP 7 C  ? ? ? 1_555 D PRO 8   N   ? ? D SEP 174 D PRO 175 1_555 ? ? ? ? ? ? ? 1.385 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 2 ? 
D ? 5 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 97  ? LEU A 101 ? PHE A 172 LEU A 176 
A 2 GLU A 72  ? PHE A 76  ? GLU A 147 PHE A 151 
A 3 CYS A 17  ? ILE A 20  ? CYS A 92  ILE A 95  
A 4 VAL A 127 ? LEU A 130 ? VAL A 202 LEU A 205 
B 1 VAL A 27  ? SER A 30  ? VAL A 102 SER A 105 
B 2 VAL A 48  ? LYS A 56  ? VAL A 123 LYS A 131 
B 3 PHE A 39  ? ILE A 45  ? PHE A 114 ILE A 120 
C 1 VAL A 107 ? HIS A 109 ? VAL A 182 HIS A 184 
C 2 ASN A 112 ? VAL A 114 ? ASN A 187 VAL A 189 
D 1 PHE B 97  ? LEU B 101 ? PHE B 172 LEU B 176 
D 2 GLU B 72  ? PHE B 76  ? GLU B 147 PHE B 151 
D 3 CYS B 17  ? ILE B 20  ? CYS B 92  ILE B 95  
D 4 VAL B 127 ? ASP B 131 ? VAL B 202 ASP B 206 
D 5 ALA B 144 ? PRO B 146 ? ALA B 219 PRO B 221 
E 1 VAL B 27  ? SER B 30  ? VAL B 102 SER B 105 
E 2 VAL B 48  ? LYS B 56  ? VAL B 123 LYS B 131 
E 3 PHE B 39  ? ILE B 45  ? PHE B 114 ILE B 120 
F 1 VAL B 107 ? HIS B 109 ? VAL B 182 HIS B 184 
F 2 ASN B 112 ? VAL B 114 ? ASN B 187 VAL B 189 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 101 ? O LEU A 176 N LEU A 75  ? N LEU A 150 
A 2 3 O VAL A 74  ? O VAL A 149 N ILE A 20  ? N ILE A 95  
A 3 4 N VAL A 19  ? N VAL A 94  O LEU A 128 ? O LEU A 203 
B 1 2 N SER A 30  ? N SER A 105 O TYR A 53  ? O TYR A 128 
B 2 3 O VAL A 54  ? O VAL A 129 N PHE A 39  ? N PHE A 114 
C 1 2 N VAL A 107 ? N VAL A 182 O VAL A 114 ? O VAL A 189 
D 1 2 O ARG B 98  ? O ARG B 173 N CYS B 73  ? N CYS B 148 
D 2 3 O VAL B 74  ? O VAL B 149 N ILE B 20  ? N ILE B 95  
D 3 4 N VAL B 19  ? N VAL B 94  O LEU B 130 ? O LEU B 205 
D 4 5 N ILE B 129 ? N ILE B 204 O VAL B 145 ? O VAL B 220 
E 1 2 N SER B 30  ? N SER B 105 O TYR B 53  ? O TYR B 128 
E 2 3 O HIS B 50  ? O HIS B 125 N VAL B 43  ? N VAL B 118 
F 1 2 N HIS B 109 ? N HIS B 184 O ASN B 112 ? O ASN B 187 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG C 151' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG B 257' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ASN A 21  ? ASN A 96  . ? 1_555 ? 
2 AC1 4 ASP A 23  ? ASP A 98  . ? 1_555 ? 
3 AC1 4 ASN A 132 ? ASN A 207 . ? 1_555 ? 
4 AC1 4 SEP C 7   ? SEP C 174 . ? 1_555 ? 
5 AC2 4 ASN B 21  ? ASN B 96  . ? 1_555 ? 
6 AC2 4 ASP B 23  ? ASP B 98  . ? 1_555 ? 
7 AC2 4 ASN B 132 ? ASN B 207 . ? 1_555 ? 
8 AC2 4 SEP D 7   ? SEP D 174 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2GHQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2GHQ 
_atom_sites.fract_transf_matrix[1][1]   0.007932 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003232 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012688 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017142 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 2   ? 32.140  -19.541 16.252  1.00 65.46  ? 77  GLN A N   1 
ATOM   2    C  CA  . GLN A 1 2   ? 30.852  -19.032 16.813  1.00 65.74  ? 77  GLN A CA  1 
ATOM   3    C  C   . GLN A 1 2   ? 30.339  -17.764 16.127  1.00 60.48  ? 77  GLN A C   1 
ATOM   4    O  O   . GLN A 1 2   ? 30.530  -17.573 14.924  1.00 62.50  ? 77  GLN A O   1 
ATOM   5    C  CB  . GLN A 1 2   ? 30.992  -18.781 18.316  1.00 70.30  ? 77  GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 2   ? 32.085  -17.798 18.699  1.00 77.48  ? 77  GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 2   ? 33.457  -18.237 18.243  1.00 81.09  ? 77  GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 2   ? 33.781  -19.424 18.277  1.00 83.50  ? 77  GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 2   ? 34.280  -17.279 17.826  1.00 83.51  ? 77  GLN A NE2 1 
ATOM   10   N  N   . TYR A 1 3   ? 29.685  -16.898 16.893  1.00 56.09  ? 78  TYR A N   1 
ATOM   11   C  CA  . TYR A 1 3   ? 29.132  -15.674 16.348  1.00 51.10  ? 78  TYR A CA  1 
ATOM   12   C  C   . TYR A 1 3   ? 30.124  -14.525 16.229  1.00 48.05  ? 78  TYR A C   1 
ATOM   13   O  O   . TYR A 1 3   ? 31.109  -14.450 16.963  1.00 46.50  ? 78  TYR A O   1 
ATOM   14   C  CB  . TYR A 1 3   ? 27.933  -15.243 17.176  1.00 51.40  ? 78  TYR A CB  1 
ATOM   15   C  CG  . TYR A 1 3   ? 26.757  -16.175 17.037  1.00 51.13  ? 78  TYR A CG  1 
ATOM   16   C  CD1 . TYR A 1 3   ? 26.379  -16.677 15.782  1.00 49.06  ? 78  TYR A CD1 1 
ATOM   17   C  CD2 . TYR A 1 3   ? 26.006  -16.549 18.156  1.00 50.07  ? 78  TYR A CD2 1 
ATOM   18   C  CE1 . TYR A 1 3   ? 25.284  -17.532 15.655  1.00 50.50  ? 78  TYR A CE1 1 
ATOM   19   C  CE2 . TYR A 1 3   ? 24.913  -17.397 18.040  1.00 50.78  ? 78  TYR A CE2 1 
ATOM   20   C  CZ  . TYR A 1 3   ? 24.556  -17.887 16.790  1.00 51.42  ? 78  TYR A CZ  1 
ATOM   21   O  OH  . TYR A 1 3   ? 23.472  -18.736 16.697  1.00 52.64  ? 78  TYR A OH  1 
ATOM   22   N  N   . LEU A 1 4   ? 29.840  -13.641 15.277  1.00 44.59  ? 79  LEU A N   1 
ATOM   23   C  CA  . LEU A 1 4   ? 30.662  -12.478 14.983  1.00 41.00  ? 79  LEU A CA  1 
ATOM   24   C  C   . LEU A 1 4   ? 30.619  -11.424 16.083  1.00 38.85  ? 79  LEU A C   1 
ATOM   25   O  O   . LEU A 1 4   ? 31.601  -10.745 16.337  1.00 37.17  ? 79  LEU A O   1 
ATOM   26   C  CB  . LEU A 1 4   ? 30.198  -11.855 13.663  1.00 38.06  ? 79  LEU A CB  1 
ATOM   27   C  CG  . LEU A 1 4   ? 30.415  -12.736 12.428  1.00 38.49  ? 79  LEU A CG  1 
ATOM   28   C  CD1 . LEU A 1 4   ? 29.764  -12.100 11.219  1.00 36.86  ? 79  LEU A CD1 1 
ATOM   29   C  CD2 . LEU A 1 4   ? 31.905  -12.930 12.197  1.00 36.96  ? 79  LEU A CD2 1 
ATOM   30   N  N   . LEU A 1 5   ? 29.468  -11.296 16.727  1.00 36.64  ? 80  LEU A N   1 
ATOM   31   C  CA  . LEU A 1 5   ? 29.299  -10.307 17.776  1.00 37.03  ? 80  LEU A CA  1 
ATOM   32   C  C   . LEU A 1 5   ? 29.152  -10.940 19.143  1.00 39.75  ? 80  LEU A C   1 
ATOM   33   O  O   . LEU A 1 5   ? 28.663  -12.058 19.282  1.00 39.71  ? 80  LEU A O   1 
ATOM   34   C  CB  . LEU A 1 5   ? 28.060  -9.447  17.506  1.00 32.24  ? 80  LEU A CB  1 
ATOM   35   C  CG  . LEU A 1 5   ? 27.957  -8.691  16.189  1.00 33.78  ? 80  LEU A CG  1 
ATOM   36   C  CD1 . LEU A 1 5   ? 26.619  -8.014  16.135  1.00 34.14  ? 80  LEU A CD1 1 
ATOM   37   C  CD2 . LEU A 1 5   ? 29.064  -7.661  16.067  1.00 33.55  ? 80  LEU A CD2 1 
ATOM   38   N  N   . PRO A 1 6   ? 29.616  -10.239 20.183  1.00 43.07  ? 81  PRO A N   1 
ATOM   39   C  CA  . PRO A 1 6   ? 29.470  -10.812 21.520  1.00 44.14  ? 81  PRO A CA  1 
ATOM   40   C  C   . PRO A 1 6   ? 28.054  -10.445 21.940  1.00 44.61  ? 81  PRO A C   1 
ATOM   41   O  O   . PRO A 1 6   ? 27.355  -9.740  21.208  1.00 45.71  ? 81  PRO A O   1 
ATOM   42   C  CB  . PRO A 1 6   ? 30.530  -10.067 22.322  1.00 43.91  ? 81  PRO A CB  1 
ATOM   43   C  CG  . PRO A 1 6   ? 30.514  -8.701  21.693  1.00 42.31  ? 81  PRO A CG  1 
ATOM   44   C  CD  . PRO A 1 6   ? 30.446  -9.015  20.208  1.00 42.20  ? 81  PRO A CD  1 
ATOM   45   N  N   . GLU A 1 7   ? 27.627  -10.925 23.100  1.00 47.37  ? 82  GLU A N   1 
ATOM   46   C  CA  . GLU A 1 7   ? 26.302  -10.616 23.626  1.00 51.32  ? 82  GLU A CA  1 
ATOM   47   C  C   . GLU A 1 7   ? 26.110  -9.088  23.575  1.00 49.32  ? 82  GLU A C   1 
ATOM   48   O  O   . GLU A 1 7   ? 27.070  -8.332  23.712  1.00 48.71  ? 82  GLU A O   1 
ATOM   49   C  CB  . GLU A 1 7   ? 26.230  -11.122 25.070  1.00 59.14  ? 82  GLU A CB  1 
ATOM   50   C  CG  . GLU A 1 7   ? 24.855  -11.141 25.697  1.00 68.46  ? 82  GLU A CG  1 
ATOM   51   C  CD  . GLU A 1 7   ? 24.882  -11.668 27.121  1.00 74.78  ? 82  GLU A CD  1 
ATOM   52   O  OE1 . GLU A 1 7   ? 25.498  -12.733 27.344  1.00 80.01  ? 82  GLU A OE1 1 
ATOM   53   O  OE2 . GLU A 1 7   ? 24.285  -11.023 28.011  1.00 80.81  ? 82  GLU A OE2 1 
ATOM   54   N  N   . ALA A 1 8   ? 24.881  -8.631  23.382  1.00 47.09  ? 83  ALA A N   1 
ATOM   55   C  CA  . ALA A 1 8   ? 24.625  -7.188  23.331  1.00 46.25  ? 83  ALA A CA  1 
ATOM   56   C  C   . ALA A 1 8   ? 24.729  -6.599  24.735  1.00 46.35  ? 83  ALA A C   1 
ATOM   57   O  O   . ALA A 1 8   ? 24.273  -7.215  25.704  1.00 45.26  ? 83  ALA A O   1 
ATOM   58   C  CB  . ALA A 1 8   ? 23.243  -6.917  22.771  1.00 44.42  ? 83  ALA A CB  1 
ATOM   59   N  N   . LYS A 1 9   ? 25.324  -5.415  24.851  1.00 45.46  ? 84  LYS A N   1 
ATOM   60   C  CA  . LYS A 1 9   ? 25.453  -4.781  26.154  1.00 47.35  ? 84  LYS A CA  1 
ATOM   61   C  C   . LYS A 1 9   ? 24.088  -4.558  26.775  1.00 46.54  ? 84  LYS A C   1 
ATOM   62   O  O   . LYS A 1 9   ? 23.069  -4.461  26.078  1.00 48.21  ? 84  LYS A O   1 
ATOM   63   C  CB  . LYS A 1 9   ? 26.168  -3.434  26.056  1.00 49.46  ? 84  LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 9   ? 27.671  -3.509  25.948  1.00 51.61  ? 84  LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 9   ? 28.267  -2.132  26.200  1.00 57.31  ? 84  LYS A CD  1 
ATOM   66   C  CE  . LYS A 1 9   ? 29.778  -2.101  26.018  1.00 60.55  ? 84  LYS A CE  1 
ATOM   67   N  NZ  . LYS A 1 9   ? 30.312  -0.714  26.236  1.00 62.47  ? 84  LYS A NZ  1 
ATOM   68   N  N   . ALA A 1 10  ? 24.082  -4.455  28.099  1.00 45.27  ? 85  ALA A N   1 
ATOM   69   C  CA  . ALA A 1 10  ? 22.860  -4.245  28.852  1.00 45.46  ? 85  ALA A CA  1 
ATOM   70   C  C   . ALA A 1 10  ? 21.916  -3.209  28.239  1.00 45.40  ? 85  ALA A C   1 
ATOM   71   O  O   . ALA A 1 10  ? 20.752  -3.514  27.974  1.00 46.17  ? 85  ALA A O   1 
ATOM   72   C  CB  . ALA A 1 10  ? 23.209  -3.857  30.285  1.00 43.89  ? 85  ALA A CB  1 
ATOM   73   N  N   . GLN A 1 11  ? 22.405  -1.995  28.003  1.00 46.55  ? 86  GLN A N   1 
ATOM   74   C  CA  . GLN A 1 11  ? 21.536  -0.965  27.447  1.00 49.28  ? 86  GLN A CA  1 
ATOM   75   C  C   . GLN A 1 11  ? 21.077  -1.202  26.005  1.00 49.20  ? 86  GLN A C   1 
ATOM   76   O  O   . GLN A 1 11  ? 20.135  -0.561  25.540  1.00 50.10  ? 86  GLN A O   1 
ATOM   77   C  CB  . GLN A 1 11  ? 22.173  0.441   27.541  1.00 50.78  ? 86  GLN A CB  1 
ATOM   78   C  CG  . GLN A 1 11  ? 23.410  0.692   26.671  1.00 53.88  ? 86  GLN A CG  1 
ATOM   79   C  CD  . GLN A 1 11  ? 24.699  0.245   27.380  1.00 56.51  ? 86  GLN A CD  1 
ATOM   80   O  OE1 . GLN A 1 11  ? 24.677  -0.600  28.306  1.00 58.82  ? 86  GLN A OE1 1 
ATOM   81   N  NE2 . GLN A 1 11  ? 25.827  0.806   26.950  1.00 58.40  ? 86  GLN A NE2 1 
ATOM   82   N  N   . ASP A 1 12  ? 21.730  -2.125  25.304  1.00 48.72  ? 87  ASP A N   1 
ATOM   83   C  CA  . ASP A 1 12  ? 21.373  -2.418  23.925  1.00 50.12  ? 87  ASP A CA  1 
ATOM   84   C  C   . ASP A 1 12  ? 20.512  -3.669  23.757  1.00 51.22  ? 87  ASP A C   1 
ATOM   85   O  O   . ASP A 1 12  ? 19.817  -3.810  22.764  1.00 49.74  ? 87  ASP A O   1 
ATOM   86   C  CB  . ASP A 1 12  ? 22.634  -2.584  23.078  1.00 48.67  ? 87  ASP A CB  1 
ATOM   87   C  CG  . ASP A 1 12  ? 23.352  -1.272  22.815  1.00 48.75  ? 87  ASP A CG  1 
ATOM   88   O  OD1 . ASP A 1 12  ? 22.681  -0.230  22.642  1.00 48.32  ? 87  ASP A OD1 1 
ATOM   89   O  OD2 . ASP A 1 12  ? 24.601  -1.293  22.760  1.00 48.56  ? 87  ASP A OD2 1 
ATOM   90   N  N   . SER A 1 13  ? 20.559  -4.566  24.736  1.00 53.25  ? 88  SER A N   1 
ATOM   91   C  CA  . SER A 1 13  ? 19.831  -5.832  24.687  1.00 54.34  ? 88  SER A CA  1 
ATOM   92   C  C   . SER A 1 13  ? 18.397  -5.790  24.173  1.00 54.57  ? 88  SER A C   1 
ATOM   93   O  O   . SER A 1 13  ? 17.922  -6.743  23.557  1.00 57.28  ? 88  SER A O   1 
ATOM   94   C  CB  . SER A 1 13  ? 19.836  -6.486  26.066  1.00 52.88  ? 88  SER A CB  1 
ATOM   95   O  OG  . SER A 1 13  ? 18.855  -5.920  26.909  1.00 55.03  ? 88  SER A OG  1 
ATOM   96   N  N   . ASP A 1 14  ? 17.709  -4.679  24.398  1.00 55.36  ? 89  ASP A N   1 
ATOM   97   C  CA  . ASP A 1 14  ? 16.318  -4.561  23.970  1.00 57.80  ? 89  ASP A CA  1 
ATOM   98   C  C   . ASP A 1 14  ? 16.142  -3.845  22.631  1.00 53.52  ? 89  ASP A C   1 
ATOM   99   O  O   . ASP A 1 14  ? 15.026  -3.708  22.137  1.00 55.88  ? 89  ASP A O   1 
ATOM   100  C  CB  . ASP A 1 14  ? 15.534  -3.815  25.047  1.00 66.56  ? 89  ASP A CB  1 
ATOM   101  C  CG  . ASP A 1 14  ? 16.168  -2.468  25.374  1.00 69.84  ? 89  ASP A CG  1 
ATOM   102  O  OD1 . ASP A 1 14  ? 17.381  -2.450  25.704  1.00 73.90  ? 89  ASP A OD1 1 
ATOM   103  O  OD2 . ASP A 1 14  ? 15.463  -1.435  25.292  1.00 73.93  ? 89  ASP A OD2 1 
ATOM   104  N  N   . LYS A 1 15  ? 17.234  -3.388  22.042  1.00 48.45  ? 90  LYS A N   1 
ATOM   105  C  CA  . LYS A 1 15  ? 17.157  -2.668  20.779  1.00 44.62  ? 90  LYS A CA  1 
ATOM   106  C  C   . LYS A 1 15  ? 17.326  -3.564  19.561  1.00 42.30  ? 90  LYS A C   1 
ATOM   107  O  O   . LYS A 1 15  ? 17.919  -4.639  19.630  1.00 39.73  ? 90  LYS A O   1 
ATOM   108  C  CB  . LYS A 1 15  ? 18.244  -1.583  20.704  1.00 44.11  ? 90  LYS A CB  1 
ATOM   109  C  CG  . LYS A 1 15  ? 18.283  -0.584  21.848  1.00 43.47  ? 90  LYS A CG  1 
ATOM   110  C  CD  . LYS A 1 15  ? 19.476  0.362   21.668  1.00 45.35  ? 90  LYS A CD  1 
ATOM   111  C  CE  . LYS A 1 15  ? 19.544  1.385   22.783  1.00 47.94  ? 90  LYS A CE  1 
ATOM   112  N  NZ  . LYS A 1 15  ? 18.275  2.157   22.867  1.00 50.99  ? 90  LYS A NZ  1 
ATOM   113  N  N   . ILE A 1 16  ? 16.799  -3.093  18.442  1.00 38.90  ? 91  ILE A N   1 
ATOM   114  C  CA  . ILE A 1 16  ? 16.945  -3.782  17.174  1.00 37.65  ? 91  ILE A CA  1 
ATOM   115  C  C   . ILE A 1 16  ? 18.394  -3.526  16.752  1.00 37.01  ? 91  ILE A C   1 
ATOM   116  O  O   . ILE A 1 16  ? 18.930  -2.423  16.967  1.00 34.06  ? 91  ILE A O   1 
ATOM   117  C  CB  . ILE A 1 16  ? 15.971  -3.194  16.106  1.00 37.74  ? 91  ILE A CB  1 
ATOM   118  C  CG1 . ILE A 1 16  ? 14.538  -3.675  16.373  1.00 37.41  ? 91  ILE A CG1 1 
ATOM   119  C  CG2 . ILE A 1 16  ? 16.405  -3.598  14.712  1.00 35.89  ? 91  ILE A CG2 1 
ATOM   120  C  CD1 . ILE A 1 16  ? 13.523  -3.045  15.447  1.00 40.03  ? 91  ILE A CD1 1 
ATOM   121  N  N   . CYS A 1 17  ? 19.030  -4.550  16.191  1.00 34.40  ? 92  CYS A N   1 
ATOM   122  C  CA  . CYS A 1 17  ? 20.401  -4.444  15.728  1.00 33.86  ? 92  CYS A CA  1 
ATOM   123  C  C   . CYS A 1 17  ? 20.405  -4.064  14.259  1.00 35.01  ? 92  CYS A C   1 
ATOM   124  O  O   . CYS A 1 17  ? 19.745  -4.713  13.438  1.00 32.24  ? 92  CYS A O   1 
ATOM   125  C  CB  . CYS A 1 17  ? 21.129  -5.768  15.918  1.00 34.51  ? 92  CYS A CB  1 
ATOM   126  S  SG  . CYS A 1 17  ? 22.774  -5.848  15.137  1.00 38.09  ? 92  CYS A SG  1 
ATOM   127  N  N   . VAL A 1 18  ? 21.126  -3.003  13.920  1.00 33.58  ? 93  VAL A N   1 
ATOM   128  C  CA  . VAL A 1 18  ? 21.192  -2.583  12.520  1.00 33.43  ? 93  VAL A CA  1 
ATOM   129  C  C   . VAL A 1 18  ? 22.617  -2.587  11.985  1.00 34.12  ? 93  VAL A C   1 
ATOM   130  O  O   . VAL A 1 18  ? 23.504  -1.892  12.523  1.00 34.41  ? 93  VAL A O   1 
ATOM   131  C  CB  . VAL A 1 18  ? 20.617  -1.170  12.305  1.00 31.46  ? 93  VAL A CB  1 
ATOM   132  C  CG1 . VAL A 1 18  ? 20.739  -0.797  10.848  1.00 30.90  ? 93  VAL A CG1 1 
ATOM   133  C  CG2 . VAL A 1 18  ? 19.167  -1.116  12.735  1.00 33.96  ? 93  VAL A CG2 1 
ATOM   134  N  N   . VAL A 1 19  ? 22.840  -3.379  10.935  1.00 33.72  ? 94  VAL A N   1 
ATOM   135  C  CA  . VAL A 1 19  ? 24.148  -3.449  10.293  1.00 35.56  ? 94  VAL A CA  1 
ATOM   136  C  C   . VAL A 1 19  ? 24.102  -2.416  9.177   1.00 33.86  ? 94  VAL A C   1 
ATOM   137  O  O   . VAL A 1 19  ? 23.173  -2.385  8.364   1.00 34.36  ? 94  VAL A O   1 
ATOM   138  C  CB  . VAL A 1 19  ? 24.462  -4.859  9.723   1.00 37.20  ? 94  VAL A CB  1 
ATOM   139  C  CG1 . VAL A 1 19  ? 24.687  -5.854  10.871  1.00 37.01  ? 94  VAL A CG1 1 
ATOM   140  C  CG2 . VAL A 1 19  ? 23.307  -5.341  8.903   1.00 38.02  ? 94  VAL A CG2 1 
ATOM   141  N  N   . ILE A 1 20  ? 25.108  -1.551  9.182   1.00 33.29  ? 95  ILE A N   1 
ATOM   142  C  CA  . ILE A 1 20  ? 25.229  -0.446  8.249   1.00 32.02  ? 95  ILE A CA  1 
ATOM   143  C  C   . ILE A 1 20  ? 26.476  -0.606  7.392   1.00 31.43  ? 95  ILE A C   1 
ATOM   144  O  O   . ILE A 1 20  ? 27.592  -0.764  7.907   1.00 30.13  ? 95  ILE A O   1 
ATOM   145  C  CB  . ILE A 1 20  ? 25.299  0.905   9.010   1.00 33.53  ? 95  ILE A CB  1 
ATOM   146  C  CG1 . ILE A 1 20  ? 24.079  1.050   9.922   1.00 33.51  ? 95  ILE A CG1 1 
ATOM   147  C  CG2 . ILE A 1 20  ? 25.359  2.061   8.026   1.00 31.61  ? 95  ILE A CG2 1 
ATOM   148  C  CD1 . ILE A 1 20  ? 24.085  2.322   10.772  1.00 33.68  ? 95  ILE A CD1 1 
ATOM   149  N  N   . ASN A 1 21  ? 26.269  -0.569  6.079   1.00 28.73  ? 96  ASN A N   1 
ATOM   150  C  CA  . ASN A 1 21  ? 27.341  -0.705  5.109   1.00 29.76  ? 96  ASN A CA  1 
ATOM   151  C  C   . ASN A 1 21  ? 28.126  0.616   5.074   1.00 29.25  ? 96  ASN A C   1 
ATOM   152  O  O   . ASN A 1 21  ? 27.596  1.664   5.458   1.00 29.08  ? 96  ASN A O   1 
ATOM   153  C  CB  . ASN A 1 21  ? 26.717  -1.018  3.738   1.00 30.83  ? 96  ASN A CB  1 
ATOM   154  C  CG  . ASN A 1 21  ? 27.743  -1.307  2.673   1.00 31.51  ? 96  ASN A CG  1 
ATOM   155  O  OD1 . ASN A 1 21  ? 27.790  -0.619  1.656   1.00 33.25  ? 96  ASN A OD1 1 
ATOM   156  N  ND2 . ASN A 1 21  ? 28.518  -2.254  2.891   1.00 29.28  ? 96  ASN A ND2 1 
ATOM   157  N  N   . LEU A 1 22  ? 29.370  0.562   4.607   1.00 26.59  ? 97  LEU A N   1 
ATOM   158  C  CA  . LEU A 1 22  ? 30.200  1.763   4.521   1.00 27.36  ? 97  LEU A CA  1 
ATOM   159  C  C   . LEU A 1 22  ? 30.239  2.416   3.111   1.00 27.16  ? 97  LEU A C   1 
ATOM   160  O  O   . LEU A 1 22  ? 29.614  3.463   2.856   1.00 26.52  ? 97  LEU A O   1 
ATOM   161  C  CB  . LEU A 1 22  ? 31.636  1.442   4.983   1.00 24.95  ? 97  LEU A CB  1 
ATOM   162  C  CG  . LEU A 1 22  ? 32.636  2.615   4.884   1.00 25.10  ? 97  LEU A CG  1 
ATOM   163  C  CD1 . LEU A 1 22  ? 32.192  3.759   5.812   1.00 23.33  ? 97  LEU A CD1 1 
ATOM   164  C  CD2 . LEU A 1 22  ? 34.019  2.136   5.275   1.00 24.15  ? 97  LEU A CD2 1 
ATOM   165  N  N   . ASP A 1 23  ? 30.954  1.784   2.196   1.00 28.62  ? 98  ASP A N   1 
ATOM   166  C  CA  . ASP A 1 23  ? 31.114  2.328   0.857   1.00 31.95  ? 98  ASP A CA  1 
ATOM   167  C  C   . ASP A 1 23  ? 29.855  2.412   0.017   1.00 32.45  ? 98  ASP A C   1 
ATOM   168  O  O   . ASP A 1 23  ? 29.097  1.451   -0.097  1.00 30.50  ? 98  ASP A O   1 
ATOM   169  C  CB  . ASP A 1 23  ? 32.189  1.562   0.107   1.00 35.46  ? 98  ASP A CB  1 
ATOM   170  C  CG  . ASP A 1 23  ? 33.579  1.844   0.651   1.00 40.35  ? 98  ASP A CG  1 
ATOM   171  O  OD1 . ASP A 1 23  ? 34.003  3.027   0.635   1.00 37.45  ? 98  ASP A OD1 1 
ATOM   172  O  OD2 . ASP A 1 23  ? 34.247  0.877   1.090   1.00 44.03  ? 98  ASP A OD2 1 
ATOM   173  N  N   . GLU A 1 24  ? 29.660  3.595   -0.563  1.00 31.05  ? 99  GLU A N   1 
ATOM   174  C  CA  . GLU A 1 24  ? 28.505  3.914   -1.392  1.00 32.70  ? 99  GLU A CA  1 
ATOM   175  C  C   . GLU A 1 24  ? 27.210  4.020   -0.587  1.00 32.62  ? 99  GLU A C   1 
ATOM   176  O  O   . GLU A 1 24  ? 26.139  4.324   -1.146  1.00 32.83  ? 99  GLU A O   1 
ATOM   177  C  CB  . GLU A 1 24  ? 28.345  2.894   -2.518  1.00 32.44  ? 99  GLU A CB  1 
ATOM   178  C  CG  . GLU A 1 24  ? 29.323  3.103   -3.652  1.00 33.26  ? 99  GLU A CG  1 
ATOM   179  C  CD  . GLU A 1 24  ? 30.737  2.648   -3.309  1.00 35.57  ? 99  GLU A CD  1 
ATOM   180  O  OE1 . GLU A 1 24  ? 30.959  1.422   -3.109  1.00 32.57  ? 99  GLU A OE1 1 
ATOM   181  O  OE2 . GLU A 1 24  ? 31.639  3.513   -3.241  1.00 35.28  ? 99  GLU A OE2 1 
ATOM   182  N  N   . THR A 1 25  ? 27.307  3.765   0.715   1.00 30.33  ? 100 THR A N   1 
ATOM   183  C  CA  . THR A 1 25  ? 26.161  3.885   1.601   1.00 28.55  ? 100 THR A CA  1 
ATOM   184  C  C   . THR A 1 25  ? 26.331  5.133   2.479   1.00 29.52  ? 100 THR A C   1 
ATOM   185  O  O   . THR A 1 25  ? 25.468  6.013   2.481   1.00 28.49  ? 100 THR A O   1 
ATOM   186  C  CB  . THR A 1 25  ? 26.001  2.640   2.494   1.00 28.73  ? 100 THR A CB  1 
ATOM   187  O  OG1 . THR A 1 25  ? 25.724  1.496   1.667   1.00 29.04  ? 100 THR A OG1 1 
ATOM   188  C  CG2 . THR A 1 25  ? 24.825  2.817   3.468   1.00 29.44  ? 100 THR A CG2 1 
ATOM   189  N  N   . LEU A 1 26  ? 27.459  5.218   3.188   1.00 27.85  ? 101 LEU A N   1 
ATOM   190  C  CA  . LEU A 1 26  ? 27.746  6.348   4.087   1.00 29.33  ? 101 LEU A CA  1 
ATOM   191  C  C   . LEU A 1 26  ? 28.780  7.317   3.519   1.00 28.10  ? 101 LEU A C   1 
ATOM   192  O  O   . LEU A 1 26  ? 28.764  8.510   3.821   1.00 28.68  ? 101 LEU A O   1 
ATOM   193  C  CB  . LEU A 1 26  ? 28.262  5.834   5.443   1.00 27.24  ? 101 LEU A CB  1 
ATOM   194  C  CG  . LEU A 1 26  ? 27.273  5.017   6.274   1.00 28.14  ? 101 LEU A CG  1 
ATOM   195  C  CD1 . LEU A 1 26  ? 27.935  4.510   7.566   1.00 26.28  ? 101 LEU A CD1 1 
ATOM   196  C  CD2 . LEU A 1 26  ? 26.056  5.888   6.583   1.00 25.50  ? 101 LEU A CD2 1 
ATOM   197  N  N   . VAL A 1 27  ? 29.692  6.791   2.707   1.00 27.41  ? 102 VAL A N   1 
ATOM   198  C  CA  . VAL A 1 27  ? 30.755  7.589   2.116   1.00 27.16  ? 102 VAL A CA  1 
ATOM   199  C  C   . VAL A 1 27  ? 31.090  7.033   0.734   1.00 29.13  ? 102 VAL A C   1 
ATOM   200  O  O   . VAL A 1 27  ? 30.575  5.978   0.325   1.00 27.86  ? 102 VAL A O   1 
ATOM   201  C  CB  . VAL A 1 27  ? 32.059  7.465   2.955   1.00 26.23  ? 102 VAL A CB  1 
ATOM   202  C  CG1 . VAL A 1 27  ? 31.782  7.757   4.431   1.00 20.79  ? 102 VAL A CG1 1 
ATOM   203  C  CG2 . VAL A 1 27  ? 32.635  6.042   2.797   1.00 26.47  ? 102 VAL A CG2 1 
ATOM   204  N  N   . HIS A 1 28  ? 31.929  7.761   0.001   1.00 29.09  ? 103 HIS A N   1 
ATOM   205  C  CA  . HIS A 1 28  ? 32.433  7.264   -1.277  1.00 29.01  ? 103 HIS A CA  1 
ATOM   206  C  C   . HIS A 1 28  ? 33.899  7.660   -1.320  1.00 28.12  ? 103 HIS A C   1 
ATOM   207  O  O   . HIS A 1 28  ? 34.242  8.824   -1.112  1.00 28.15  ? 103 HIS A O   1 
ATOM   208  C  CB  . HIS A 1 28  ? 31.709  7.871   -2.484  1.00 31.81  ? 103 HIS A CB  1 
ATOM   209  C  CG  . HIS A 1 28  ? 32.272  7.410   -3.794  1.00 32.24  ? 103 HIS A CG  1 
ATOM   210  N  ND1 . HIS A 1 28  ? 32.406  6.075   -4.105  1.00 33.55  ? 103 HIS A ND1 1 
ATOM   211  C  CD2 . HIS A 1 28  ? 32.862  8.092   -4.804  1.00 32.92  ? 103 HIS A CD2 1 
ATOM   212  C  CE1 . HIS A 1 28  ? 33.066  5.952   -5.244  1.00 34.88  ? 103 HIS A CE1 1 
ATOM   213  N  NE2 . HIS A 1 28  ? 33.357  7.162   -5.687  1.00 34.35  ? 103 HIS A NE2 1 
ATOM   214  N  N   . SER A 1 29  ? 34.760  6.685   -1.574  1.00 28.20  ? 104 SER A N   1 
ATOM   215  C  CA  . SER A 1 29  ? 36.190  6.920   -1.615  1.00 28.36  ? 104 SER A CA  1 
ATOM   216  C  C   . SER A 1 29  ? 36.817  6.647   -2.964  1.00 28.88  ? 104 SER A C   1 
ATOM   217  O  O   . SER A 1 29  ? 36.271  5.906   -3.788  1.00 29.00  ? 104 SER A O   1 
ATOM   218  C  CB  . SER A 1 29  ? 36.873  6.051   -0.560  1.00 30.24  ? 104 SER A CB  1 
ATOM   219  O  OG  . SER A 1 29  ? 36.310  6.348   0.708   1.00 31.56  ? 104 SER A OG  1 
ATOM   220  N  N   . SER A 1 30  ? 38.000  7.222   -3.175  1.00 26.24  ? 105 SER A N   1 
ATOM   221  C  CA  . SER A 1 30  ? 38.715  7.041   -4.422  1.00 27.20  ? 105 SER A CA  1 
ATOM   222  C  C   . SER A 1 30  ? 40.203  7.286   -4.208  1.00 27.58  ? 105 SER A C   1 
ATOM   223  O  O   . SER A 1 30  ? 40.590  7.916   -3.224  1.00 26.65  ? 105 SER A O   1 
ATOM   224  C  CB  . SER A 1 30  ? 38.164  8.017   -5.479  1.00 28.84  ? 105 SER A CB  1 
ATOM   225  O  OG  . SER A 1 30  ? 38.822  7.875   -6.714  1.00 29.89  ? 105 SER A OG  1 
ATOM   226  N  N   . PHE A 1 31  ? 41.031  6.773   -5.117  1.00 28.15  ? 106 PHE A N   1 
ATOM   227  C  CA  . PHE A 1 31  ? 42.461  6.993   -5.021  1.00 30.27  ? 106 PHE A CA  1 
ATOM   228  C  C   . PHE A 1 31  ? 42.827  8.207   -5.886  1.00 29.71  ? 106 PHE A C   1 
ATOM   229  O  O   . PHE A 1 31  ? 43.959  8.687   -5.872  1.00 28.05  ? 106 PHE A O   1 
ATOM   230  C  CB  . PHE A 1 31  ? 43.227  5.761   -5.481  1.00 31.37  ? 106 PHE A CB  1 
ATOM   231  C  CG  . PHE A 1 31  ? 43.204  4.621   -4.493  1.00 33.14  ? 106 PHE A CG  1 
ATOM   232  C  CD1 . PHE A 1 31  ? 42.182  3.671   -4.525  1.00 34.45  ? 106 PHE A CD1 1 
ATOM   233  C  CD2 . PHE A 1 31  ? 44.206  4.489   -3.536  1.00 34.46  ? 106 PHE A CD2 1 
ATOM   234  C  CE1 . PHE A 1 31  ? 42.168  2.606   -3.616  1.00 35.09  ? 106 PHE A CE1 1 
ATOM   235  C  CE2 . PHE A 1 31  ? 44.196  3.429   -2.622  1.00 35.52  ? 106 PHE A CE2 1 
ATOM   236  C  CZ  . PHE A 1 31  ? 43.172  2.486   -2.667  1.00 35.26  ? 106 PHE A CZ  1 
ATOM   237  N  N   . LYS A 1 32  ? 41.848  8.709   -6.625  1.00 31.35  ? 107 LYS A N   1 
ATOM   238  C  CA  . LYS A 1 32  ? 42.070  9.876   -7.484  1.00 34.03  ? 107 LYS A CA  1 
ATOM   239  C  C   . LYS A 1 32  ? 41.890  11.121  -6.642  1.00 32.11  ? 107 LYS A C   1 
ATOM   240  O  O   . LYS A 1 32  ? 40.833  11.320  -6.085  1.00 32.16  ? 107 LYS A O   1 
ATOM   241  C  CB  . LYS A 1 32  ? 41.054  9.905   -8.626  1.00 35.00  ? 107 LYS A CB  1 
ATOM   242  C  CG  . LYS A 1 32  ? 41.119  11.193  -9.460  1.00 36.57  ? 107 LYS A CG  1 
ATOM   243  C  CD  . LYS A 1 32  ? 40.108  11.176  -10.596 1.00 38.09  ? 107 LYS A CD  1 
ATOM   244  C  CE  . LYS A 1 32  ? 40.232  12.431  -11.462 1.00 40.78  ? 107 LYS A CE  1 
ATOM   245  N  NZ  . LYS A 1 32  ? 41.602  12.587  -12.092 1.00 34.62  ? 107 LYS A NZ  1 
ATOM   246  N  N   . PRO A 1 33  ? 42.928  11.950  -6.514  1.00 33.67  ? 108 PRO A N   1 
ATOM   247  C  CA  . PRO A 1 33  ? 42.810  13.168  -5.695  1.00 34.36  ? 108 PRO A CA  1 
ATOM   248  C  C   . PRO A 1 33  ? 41.590  14.002  -6.025  1.00 35.88  ? 108 PRO A C   1 
ATOM   249  O  O   . PRO A 1 33  ? 41.255  14.190  -7.190  1.00 34.23  ? 108 PRO A O   1 
ATOM   250  C  CB  . PRO A 1 33  ? 44.128  13.911  -5.962  1.00 33.99  ? 108 PRO A CB  1 
ATOM   251  C  CG  . PRO A 1 33  ? 44.590  13.357  -7.271  1.00 35.52  ? 108 PRO A CG  1 
ATOM   252  C  CD  . PRO A 1 33  ? 44.235  11.893  -7.189  1.00 32.90  ? 108 PRO A CD  1 
ATOM   253  N  N   . VAL A 1 34  ? 40.934  14.481  -4.973  1.00 37.14  ? 109 VAL A N   1 
ATOM   254  C  CA  . VAL A 1 34  ? 39.736  15.315  -5.062  1.00 38.99  ? 109 VAL A CA  1 
ATOM   255  C  C   . VAL A 1 34  ? 39.944  16.451  -4.065  1.00 38.20  ? 109 VAL A C   1 
ATOM   256  O  O   . VAL A 1 34  ? 40.306  16.200  -2.920  1.00 41.02  ? 109 VAL A O   1 
ATOM   257  C  CB  . VAL A 1 34  ? 38.485  14.554  -4.626  1.00 38.80  ? 109 VAL A CB  1 
ATOM   258  C  CG1 . VAL A 1 34  ? 37.270  15.193  -5.264  1.00 41.74  ? 109 VAL A CG1 1 
ATOM   259  C  CG2 . VAL A 1 34  ? 38.599  13.089  -4.985  1.00 42.06  ? 109 VAL A CG2 1 
ATOM   260  N  N   . ASN A 1 35  ? 39.726  17.686  -4.500  1.00 37.72  ? 110 ASN A N   1 
ATOM   261  C  CA  . ASN A 1 35  ? 39.911  18.850  -3.632  1.00 37.99  ? 110 ASN A CA  1 
ATOM   262  C  C   . ASN A 1 35  ? 39.010  18.955  -2.410  1.00 35.59  ? 110 ASN A C   1 
ATOM   263  O  O   . ASN A 1 35  ? 39.439  19.416  -1.359  1.00 36.15  ? 110 ASN A O   1 
ATOM   264  C  CB  . ASN A 1 35  ? 39.745  20.151  -4.435  1.00 39.61  ? 110 ASN A CB  1 
ATOM   265  C  CG  . ASN A 1 35  ? 40.883  20.395  -5.380  1.00 41.62  ? 110 ASN A CG  1 
ATOM   266  O  OD1 . ASN A 1 35  ? 42.042  20.180  -5.027  1.00 40.41  ? 110 ASN A OD1 1 
ATOM   267  N  ND2 . ASN A 1 35  ? 40.569  20.870  -6.586  1.00 41.05  ? 110 ASN A ND2 1 
ATOM   268  N  N   . ASN A 1 36  ? 37.757  18.543  -2.550  1.00 34.38  ? 111 ASN A N   1 
ATOM   269  C  CA  . ASN A 1 36  ? 36.814  18.669  -1.447  1.00 33.33  ? 111 ASN A CA  1 
ATOM   270  C  C   . ASN A 1 36  ? 36.637  17.408  -0.610  1.00 30.52  ? 111 ASN A C   1 
ATOM   271  O  O   . ASN A 1 36  ? 35.582  17.191  -0.030  1.00 28.45  ? 111 ASN A O   1 
ATOM   272  C  CB  . ASN A 1 36  ? 35.455  19.120  -1.979  1.00 33.70  ? 111 ASN A CB  1 
ATOM   273  C  CG  . ASN A 1 36  ? 34.776  18.056  -2.795  1.00 34.96  ? 111 ASN A CG  1 
ATOM   274  O  OD1 . ASN A 1 36  ? 35.422  17.320  -3.535  1.00 36.97  ? 111 ASN A OD1 1 
ATOM   275  N  ND2 . ASN A 1 36  ? 33.458  17.971  -2.677  1.00 37.88  ? 111 ASN A ND2 1 
ATOM   276  N  N   . ALA A 1 37  ? 37.675  16.586  -0.527  1.00 27.59  ? 112 ALA A N   1 
ATOM   277  C  CA  . ALA A 1 37  ? 37.578  15.363  0.261   1.00 27.14  ? 112 ALA A CA  1 
ATOM   278  C  C   . ALA A 1 37  ? 37.384  15.729  1.735   1.00 27.30  ? 112 ALA A C   1 
ATOM   279  O  O   . ALA A 1 37  ? 37.944  16.716  2.246   1.00 26.75  ? 112 ALA A O   1 
ATOM   280  C  CB  . ALA A 1 37  ? 38.850  14.527  0.085   1.00 25.47  ? 112 ALA A CB  1 
ATOM   281  N  N   . ASP A 1 38  ? 36.557  14.948  2.408   1.00 27.30  ? 113 ASP A N   1 
ATOM   282  C  CA  . ASP A 1 38  ? 36.305  15.151  3.822   1.00 27.54  ? 113 ASP A CA  1 
ATOM   283  C  C   . ASP A 1 38  ? 37.438  14.510  4.592   1.00 28.07  ? 113 ASP A C   1 
ATOM   284  O  O   . ASP A 1 38  ? 37.931  15.090  5.570   1.00 28.47  ? 113 ASP A O   1 
ATOM   285  C  CB  . ASP A 1 38  ? 34.966  14.532  4.216   1.00 28.86  ? 113 ASP A CB  1 
ATOM   286  C  CG  . ASP A 1 38  ? 33.792  15.338  3.704   1.00 32.47  ? 113 ASP A CG  1 
ATOM   287  O  OD1 . ASP A 1 38  ? 33.528  16.424  4.273   1.00 33.37  ? 113 ASP A OD1 1 
ATOM   288  O  OD2 . ASP A 1 38  ? 33.149  14.910  2.711   1.00 32.44  ? 113 ASP A OD2 1 
ATOM   289  N  N   . PHE A 1 39  ? 37.869  13.329  4.140   1.00 26.99  ? 114 PHE A N   1 
ATOM   290  C  CA  . PHE A 1 39  ? 38.976  12.618  4.788   1.00 27.96  ? 114 PHE A CA  1 
ATOM   291  C  C   . PHE A 1 39  ? 39.985  12.139  3.778   1.00 27.04  ? 114 PHE A C   1 
ATOM   292  O  O   . PHE A 1 39  ? 39.617  11.735  2.672   1.00 27.52  ? 114 PHE A O   1 
ATOM   293  C  CB  . PHE A 1 39  ? 38.519  11.358  5.533   1.00 30.25  ? 114 PHE A CB  1 
ATOM   294  C  CG  . PHE A 1 39  ? 37.305  11.542  6.353   1.00 30.65  ? 114 PHE A CG  1 
ATOM   295  C  CD1 . PHE A 1 39  ? 37.293  12.461  7.397   1.00 31.79  ? 114 PHE A CD1 1 
ATOM   296  C  CD2 . PHE A 1 39  ? 36.175  10.771  6.116   1.00 33.39  ? 114 PHE A CD2 1 
ATOM   297  C  CE1 . PHE A 1 39  ? 36.166  12.611  8.202   1.00 32.17  ? 114 PHE A CE1 1 
ATOM   298  C  CE2 . PHE A 1 39  ? 35.032  10.909  6.920   1.00 32.72  ? 114 PHE A CE2 1 
ATOM   299  C  CZ  . PHE A 1 39  ? 35.029  11.828  7.963   1.00 34.25  ? 114 PHE A CZ  1 
ATOM   300  N  N   . ILE A 1 40  ? 41.254  12.210  4.156   1.00 25.29  ? 115 ILE A N   1 
ATOM   301  C  CA  . ILE A 1 40  ? 42.328  11.684  3.354   1.00 26.52  ? 115 ILE A CA  1 
ATOM   302  C  C   . ILE A 1 40  ? 42.967  10.669  4.303   1.00 28.67  ? 115 ILE A C   1 
ATOM   303  O  O   . ILE A 1 40  ? 43.374  11.026  5.411   1.00 27.99  ? 115 ILE A O   1 
ATOM   304  C  CB  . ILE A 1 40  ? 43.353  12.747  2.967   1.00 27.89  ? 115 ILE A CB  1 
ATOM   305  C  CG1 . ILE A 1 40  ? 42.708  13.757  2.002   1.00 27.79  ? 115 ILE A CG1 1 
ATOM   306  C  CG2 . ILE A 1 40  ? 44.535  12.063  2.284   1.00 26.27  ? 115 ILE A CG2 1 
ATOM   307  C  CD1 . ILE A 1 40  ? 43.658  14.862  1.577   1.00 28.91  ? 115 ILE A CD1 1 
ATOM   308  N  N   . ILE A 1 41  ? 42.993  9.407   3.897   1.00 28.60  ? 116 ILE A N   1 
ATOM   309  C  CA  . ILE A 1 41  ? 43.550  8.341   4.714   1.00 29.45  ? 116 ILE A CA  1 
ATOM   310  C  C   . ILE A 1 41  ? 44.656  7.592   3.979   1.00 30.34  ? 116 ILE A C   1 
ATOM   311  O  O   . ILE A 1 41  ? 44.479  7.175   2.837   1.00 30.08  ? 116 ILE A O   1 
ATOM   312  C  CB  . ILE A 1 41  ? 42.428  7.358   5.105   1.00 31.62  ? 116 ILE A CB  1 
ATOM   313  C  CG1 . ILE A 1 41  ? 41.424  8.110   5.999   1.00 31.11  ? 116 ILE A CG1 1 
ATOM   314  C  CG2 . ILE A 1 41  ? 42.990  6.103   5.770   1.00 28.07  ? 116 ILE A CG2 1 
ATOM   315  C  CD1 . ILE A 1 41  ? 40.106  7.462   6.174   1.00 33.58  ? 116 ILE A CD1 1 
ATOM   316  N  N   . PRO A 1 42  ? 45.818  7.434   4.644   1.00 28.66  ? 117 PRO A N   1 
ATOM   317  C  CA  . PRO A 1 42  ? 46.968  6.738   4.066   1.00 27.98  ? 117 PRO A CA  1 
ATOM   318  C  C   . PRO A 1 42  ? 46.761  5.239   4.214   1.00 27.52  ? 117 PRO A C   1 
ATOM   319  O  O   . PRO A 1 42  ? 46.548  4.740   5.319   1.00 27.45  ? 117 PRO A O   1 
ATOM   320  C  CB  . PRO A 1 42  ? 48.150  7.255   4.903   1.00 27.14  ? 117 PRO A CB  1 
ATOM   321  C  CG  . PRO A 1 42  ? 47.536  7.393   6.280   1.00 28.72  ? 117 PRO A CG  1 
ATOM   322  C  CD  . PRO A 1 42  ? 46.166  8.029   5.953   1.00 28.46  ? 117 PRO A CD  1 
ATOM   323  N  N   . VAL A 1 43  ? 46.796  4.528   3.097   1.00 27.40  ? 118 VAL A N   1 
ATOM   324  C  CA  . VAL A 1 43  ? 46.619  3.086   3.112   1.00 27.48  ? 118 VAL A CA  1 
ATOM   325  C  C   . VAL A 1 43  ? 47.840  2.446   2.472   1.00 29.18  ? 118 VAL A C   1 
ATOM   326  O  O   . VAL A 1 43  ? 48.164  2.717   1.321   1.00 28.61  ? 118 VAL A O   1 
ATOM   327  C  CB  . VAL A 1 43  ? 45.330  2.689   2.366   1.00 26.81  ? 118 VAL A CB  1 
ATOM   328  C  CG1 . VAL A 1 43  ? 45.132  1.184   2.405   1.00 24.28  ? 118 VAL A CG1 1 
ATOM   329  C  CG2 . VAL A 1 43  ? 44.121  3.369   3.031   1.00 27.87  ? 118 VAL A CG2 1 
ATOM   330  N  N   . GLU A 1 44  ? 48.525  1.617   3.254   1.00 31.53  ? 119 GLU A N   1 
ATOM   331  C  CA  . GLU A 1 44  ? 49.722  0.936   2.803   1.00 34.28  ? 119 GLU A CA  1 
ATOM   332  C  C   . GLU A 1 44  ? 49.369  -0.353  2.077   1.00 37.37  ? 119 GLU A C   1 
ATOM   333  O  O   . GLU A 1 44  ? 48.632  -1.196  2.601   1.00 36.62  ? 119 GLU A O   1 
ATOM   334  C  CB  . GLU A 1 44  ? 50.623  0.623   3.994   1.00 35.91  ? 119 GLU A CB  1 
ATOM   335  C  CG  . GLU A 1 44  ? 51.900  -0.107  3.660   1.00 37.88  ? 119 GLU A CG  1 
ATOM   336  C  CD  . GLU A 1 44  ? 51.777  -1.612  3.860   1.00 42.73  ? 119 GLU A CD  1 
ATOM   337  O  OE1 . GLU A 1 44  ? 51.321  -2.036  4.953   1.00 44.10  ? 119 GLU A OE1 1 
ATOM   338  O  OE2 . GLU A 1 44  ? 52.147  -2.379  2.930   1.00 43.36  ? 119 GLU A OE2 1 
ATOM   339  N  N   . ILE A 1 45  ? 49.894  -0.489  0.868   1.00 39.15  ? 120 ILE A N   1 
ATOM   340  C  CA  . ILE A 1 45  ? 49.662  -1.671  0.050   1.00 43.33  ? 120 ILE A CA  1 
ATOM   341  C  C   . ILE A 1 45  ? 50.985  -2.100  -0.584  1.00 45.07  ? 120 ILE A C   1 
ATOM   342  O  O   . ILE A 1 45  ? 51.596  -1.341  -1.337  1.00 46.88  ? 120 ILE A O   1 
ATOM   343  C  CB  . ILE A 1 45  ? 48.634  -1.372  -1.040  1.00 42.42  ? 120 ILE A CB  1 
ATOM   344  C  CG1 . ILE A 1 45  ? 47.318  -0.967  -0.373  1.00 42.91  ? 120 ILE A CG1 1 
ATOM   345  C  CG2 . ILE A 1 45  ? 48.413  -2.609  -1.915  1.00 42.53  ? 120 ILE A CG2 1 
ATOM   346  C  CD1 . ILE A 1 45  ? 46.308  -0.386  -1.299  1.00 43.43  ? 120 ILE A CD1 1 
ATOM   347  N  N   . ASP A 1 46  ? 51.434  -3.306  -0.257  1.00 46.87  ? 121 ASP A N   1 
ATOM   348  C  CA  . ASP A 1 46  ? 52.691  -3.818  -0.785  1.00 50.33  ? 121 ASP A CA  1 
ATOM   349  C  C   . ASP A 1 46  ? 53.839  -2.899  -0.391  1.00 49.20  ? 121 ASP A C   1 
ATOM   350  O  O   . ASP A 1 46  ? 54.785  -2.729  -1.151  1.00 50.27  ? 121 ASP A O   1 
ATOM   351  C  CB  . ASP A 1 46  ? 52.653  -3.912  -2.315  1.00 56.79  ? 121 ASP A CB  1 
ATOM   352  C  CG  . ASP A 1 46  ? 51.529  -4.792  -2.825  1.00 59.83  ? 121 ASP A CG  1 
ATOM   353  O  OD1 . ASP A 1 46  ? 51.384  -5.926  -2.306  1.00 62.36  ? 121 ASP A OD1 1 
ATOM   354  O  OD2 . ASP A 1 46  ? 50.793  -4.341  -3.746  1.00 63.04  ? 121 ASP A OD2 1 
ATOM   355  N  N   . GLY A 1 47  ? 53.756  -2.304  0.792   1.00 46.71  ? 122 GLY A N   1 
ATOM   356  C  CA  . GLY A 1 47  ? 54.816  -1.416  1.233   1.00 43.45  ? 122 GLY A CA  1 
ATOM   357  C  C   . GLY A 1 47  ? 54.724  0.026   0.739   1.00 40.41  ? 122 GLY A C   1 
ATOM   358  O  O   . GLY A 1 47  ? 55.486  0.882   1.200   1.00 39.47  ? 122 GLY A O   1 
ATOM   359  N  N   . VAL A 1 48  ? 53.799  0.303   -0.178  1.00 36.33  ? 123 VAL A N   1 
ATOM   360  C  CA  . VAL A 1 48  ? 53.614  1.657   -0.714  1.00 33.34  ? 123 VAL A CA  1 
ATOM   361  C  C   . VAL A 1 48  ? 52.414  2.327   -0.026  1.00 31.98  ? 123 VAL A C   1 
ATOM   362  O  O   . VAL A 1 48  ? 51.328  1.734   0.083   1.00 29.20  ? 123 VAL A O   1 
ATOM   363  C  CB  . VAL A 1 48  ? 53.334  1.621   -2.235  1.00 34.13  ? 123 VAL A CB  1 
ATOM   364  C  CG1 . VAL A 1 48  ? 53.094  3.035   -2.759  1.00 33.61  ? 123 VAL A CG1 1 
ATOM   365  C  CG2 . VAL A 1 48  ? 54.493  0.976   -2.970  1.00 34.57  ? 123 VAL A CG2 1 
ATOM   366  N  N   . VAL A 1 49  ? 52.602  3.550   0.441   1.00 29.42  ? 124 VAL A N   1 
ATOM   367  C  CA  . VAL A 1 49  ? 51.509  4.249   1.097   1.00 29.64  ? 124 VAL A CA  1 
ATOM   368  C  C   . VAL A 1 49  ? 50.708  5.007   0.047   1.00 31.20  ? 124 VAL A C   1 
ATOM   369  O  O   . VAL A 1 49  ? 51.259  5.853   -0.648  1.00 27.29  ? 124 VAL A O   1 
ATOM   370  C  CB  . VAL A 1 49  ? 52.023  5.264   2.145   1.00 30.29  ? 124 VAL A CB  1 
ATOM   371  C  CG1 . VAL A 1 49  ? 50.854  6.102   2.685   1.00 26.92  ? 124 VAL A CG1 1 
ATOM   372  C  CG2 . VAL A 1 49  ? 52.712  4.507   3.292   1.00 29.53  ? 124 VAL A CG2 1 
ATOM   373  N  N   . HIS A 1 50  ? 49.422  4.681   -0.073  1.00 30.39  ? 125 HIS A N   1 
ATOM   374  C  CA  . HIS A 1 50  ? 48.532  5.342   -1.028  1.00 32.26  ? 125 HIS A CA  1 
ATOM   375  C  C   . HIS A 1 50  ? 47.574  6.214   -0.236  1.00 32.05  ? 125 HIS A C   1 
ATOM   376  O  O   . HIS A 1 50  ? 47.248  5.896   0.903   1.00 32.94  ? 125 HIS A O   1 
ATOM   377  C  CB  . HIS A 1 50  ? 47.721  4.304   -1.803  1.00 34.06  ? 125 HIS A CB  1 
ATOM   378  C  CG  . HIS A 1 50  ? 48.564  3.337   -2.563  1.00 36.68  ? 125 HIS A CG  1 
ATOM   379  N  ND1 . HIS A 1 50  ? 49.152  3.653   -3.767  1.00 39.26  ? 125 HIS A ND1 1 
ATOM   380  C  CD2 . HIS A 1 50  ? 48.925  2.061   -2.287  1.00 39.58  ? 125 HIS A CD2 1 
ATOM   381  C  CE1 . HIS A 1 50  ? 49.834  2.609   -4.205  1.00 41.91  ? 125 HIS A CE1 1 
ATOM   382  N  NE2 . HIS A 1 50  ? 49.713  1.629   -3.325  1.00 42.29  ? 125 HIS A NE2 1 
ATOM   383  N  N   . GLN A 1 51  ? 47.124  7.302   -0.838  1.00 31.08  ? 126 GLN A N   1 
ATOM   384  C  CA  . GLN A 1 51  ? 46.180  8.199   -0.196  1.00 30.47  ? 126 GLN A CA  1 
ATOM   385  C  C   . GLN A 1 51  ? 44.789  7.937   -0.733  1.00 28.42  ? 126 GLN A C   1 
ATOM   386  O  O   . GLN A 1 51  ? 44.586  7.883   -1.942  1.00 28.15  ? 126 GLN A O   1 
ATOM   387  C  CB  . GLN A 1 51  ? 46.572  9.647   -0.449  1.00 32.67  ? 126 GLN A CB  1 
ATOM   388  C  CG  . GLN A 1 51  ? 47.937  9.973   0.101   1.00 38.03  ? 126 GLN A CG  1 
ATOM   389  C  CD  . GLN A 1 51  ? 48.380  11.353  -0.266  1.00 41.82  ? 126 GLN A CD  1 
ATOM   390  O  OE1 . GLN A 1 51  ? 48.557  11.664  -1.443  1.00 45.48  ? 126 GLN A OE1 1 
ATOM   391  N  NE2 . GLN A 1 51  ? 48.552  12.205  0.735   1.00 44.47  ? 126 GLN A NE2 1 
ATOM   392  N  N   . VAL A 1 52  ? 43.837  7.748   0.176   1.00 25.11  ? 127 VAL A N   1 
ATOM   393  C  CA  . VAL A 1 52  ? 42.460  7.522   -0.220  1.00 24.84  ? 127 VAL A CA  1 
ATOM   394  C  C   . VAL A 1 52  ? 41.666  8.752   0.153   1.00 25.52  ? 127 VAL A C   1 
ATOM   395  O  O   . VAL A 1 52  ? 41.735  9.220   1.296   1.00 25.05  ? 127 VAL A O   1 
ATOM   396  C  CB  . VAL A 1 52  ? 41.856  6.296   0.487   1.00 27.09  ? 127 VAL A CB  1 
ATOM   397  C  CG1 . VAL A 1 52  ? 40.369  6.195   0.188   1.00 25.91  ? 127 VAL A CG1 1 
ATOM   398  C  CG2 . VAL A 1 52  ? 42.575  5.056   0.000   1.00 26.48  ? 127 VAL A CG2 1 
ATOM   399  N  N   . TYR A 1 53  ? 40.947  9.316   -0.816  1.00 24.93  ? 128 TYR A N   1 
ATOM   400  C  CA  . TYR A 1 53  ? 40.132  10.502  -0.554  1.00 24.82  ? 128 TYR A CA  1 
ATOM   401  C  C   . TYR A 1 53  ? 38.714  10.060  -0.294  1.00 25.33  ? 128 TYR A C   1 
ATOM   402  O  O   . TYR A 1 53  ? 38.101  9.380   -1.118  1.00 25.53  ? 128 TYR A O   1 
ATOM   403  C  CB  . TYR A 1 53  ? 40.171  11.471  -1.750  1.00 25.27  ? 128 TYR A CB  1 
ATOM   404  C  CG  . TYR A 1 53  ? 41.571  11.934  -2.071  1.00 27.93  ? 128 TYR A CG  1 
ATOM   405  C  CD1 . TYR A 1 53  ? 42.502  11.045  -2.612  1.00 27.35  ? 128 TYR A CD1 1 
ATOM   406  C  CD2 . TYR A 1 53  ? 41.976  13.244  -1.801  1.00 27.12  ? 128 TYR A CD2 1 
ATOM   407  C  CE1 . TYR A 1 53  ? 43.806  11.431  -2.875  1.00 28.59  ? 128 TYR A CE1 1 
ATOM   408  C  CE2 . TYR A 1 53  ? 43.298  13.645  -2.070  1.00 28.64  ? 128 TYR A CE2 1 
ATOM   409  C  CZ  . TYR A 1 53  ? 44.193  12.731  -2.602  1.00 28.68  ? 128 TYR A CZ  1 
ATOM   410  O  OH  . TYR A 1 53  ? 45.476  13.128  -2.892  1.00 32.01  ? 128 TYR A OH  1 
ATOM   411  N  N   . VAL A 1 54  ? 38.189  10.461  0.858   1.00 23.25  ? 129 VAL A N   1 
ATOM   412  C  CA  . VAL A 1 54  ? 36.866  10.082  1.274   1.00 24.85  ? 129 VAL A CA  1 
ATOM   413  C  C   . VAL A 1 54  ? 35.862  11.242  1.322   1.00 25.92  ? 129 VAL A C   1 
ATOM   414  O  O   . VAL A 1 54  ? 36.130  12.297  1.914   1.00 26.91  ? 129 VAL A O   1 
ATOM   415  C  CB  . VAL A 1 54  ? 36.938  9.393   2.647   1.00 22.73  ? 129 VAL A CB  1 
ATOM   416  C  CG1 . VAL A 1 54  ? 35.560  8.851   3.041   1.00 21.65  ? 129 VAL A CG1 1 
ATOM   417  C  CG2 . VAL A 1 54  ? 37.976  8.250   2.586   1.00 19.44  ? 129 VAL A CG2 1 
ATOM   418  N  N   . LEU A 1 55  ? 34.714  11.037  0.688   1.00 25.93  ? 130 LEU A N   1 
ATOM   419  C  CA  . LEU A 1 55  ? 33.630  12.027  0.684   1.00 29.86  ? 130 LEU A CA  1 
ATOM   420  C  C   . LEU A 1 55  ? 32.495  11.492  1.533   1.00 29.88  ? 130 LEU A C   1 
ATOM   421  O  O   . LEU A 1 55  ? 32.099  10.335  1.399   1.00 27.81  ? 130 LEU A O   1 
ATOM   422  C  CB  . LEU A 1 55  ? 33.082  12.261  -0.736  1.00 31.37  ? 130 LEU A CB  1 
ATOM   423  C  CG  . LEU A 1 55  ? 33.945  12.980  -1.772  1.00 34.07  ? 130 LEU A CG  1 
ATOM   424  C  CD1 . LEU A 1 55  ? 33.217  13.008  -3.113  1.00 37.65  ? 130 LEU A CD1 1 
ATOM   425  C  CD2 . LEU A 1 55  ? 34.222  14.397  -1.303  1.00 35.42  ? 130 LEU A CD2 1 
ATOM   426  N  N   . LYS A 1 56  ? 31.939  12.347  2.387   1.00 29.91  ? 131 LYS A N   1 
ATOM   427  C  CA  . LYS A 1 56  ? 30.825  11.935  3.240   1.00 30.09  ? 131 LYS A CA  1 
ATOM   428  C  C   . LYS A 1 56  ? 29.515  12.174  2.520   1.00 30.24  ? 131 LYS A C   1 
ATOM   429  O  O   . LYS A 1 56  ? 29.350  13.179  1.830   1.00 30.68  ? 131 LYS A O   1 
ATOM   430  C  CB  . LYS A 1 56  ? 30.801  12.719  4.565   1.00 28.38  ? 131 LYS A CB  1 
ATOM   431  C  CG  . LYS A 1 56  ? 32.103  12.676  5.298   1.00 30.71  ? 131 LYS A CG  1 
ATOM   432  C  CD  . LYS A 1 56  ? 31.983  13.012  6.771   1.00 33.91  ? 131 LYS A CD  1 
ATOM   433  C  CE  . LYS A 1 56  ? 31.275  14.321  7.023   1.00 33.70  ? 131 LYS A CE  1 
ATOM   434  N  NZ  . LYS A 1 56  ? 31.245  14.638  8.488   1.00 36.12  ? 131 LYS A NZ  1 
ATOM   435  N  N   . ARG A 1 57  ? 28.581  11.246  2.678   1.00 31.18  ? 132 ARG A N   1 
ATOM   436  C  CA  . ARG A 1 57  ? 27.273  11.397  2.057   1.00 31.32  ? 132 ARG A CA  1 
ATOM   437  C  C   . ARG A 1 57  ? 26.501  12.448  2.866   1.00 31.05  ? 132 ARG A C   1 
ATOM   438  O  O   . ARG A 1 57  ? 26.596  12.490  4.091   1.00 29.73  ? 132 ARG A O   1 
ATOM   439  C  CB  . ARG A 1 57  ? 26.538  10.061  2.088   1.00 31.83  ? 132 ARG A CB  1 
ATOM   440  C  CG  . ARG A 1 57  ? 25.181  10.089  1.426   1.00 32.76  ? 132 ARG A CG  1 
ATOM   441  C  CD  . ARG A 1 57  ? 24.568  8.716   1.383   1.00 33.55  ? 132 ARG A CD  1 
ATOM   442  N  NE  . ARG A 1 57  ? 23.476  8.661   0.413   1.00 35.24  ? 132 ARG A NE  1 
ATOM   443  C  CZ  . ARG A 1 57  ? 23.057  7.534   -0.151  1.00 35.05  ? 132 ARG A CZ  1 
ATOM   444  N  NH1 . ARG A 1 57  ? 23.618  6.373   0.174   1.00 31.59  ? 132 ARG A NH1 1 
ATOM   445  N  NH2 . ARG A 1 57  ? 22.135  7.575   -1.102  1.00 35.81  ? 132 ARG A NH2 1 
ATOM   446  N  N   . PRO A 1 58  ? 25.732  13.320  2.193   1.00 33.40  ? 133 PRO A N   1 
ATOM   447  C  CA  . PRO A 1 58  ? 24.958  14.358  2.887   1.00 32.01  ? 133 PRO A CA  1 
ATOM   448  C  C   . PRO A 1 58  ? 24.127  13.806  4.045   1.00 32.47  ? 133 PRO A C   1 
ATOM   449  O  O   . PRO A 1 58  ? 23.574  12.722  3.954   1.00 32.50  ? 133 PRO A O   1 
ATOM   450  C  CB  . PRO A 1 58  ? 24.093  14.946  1.767   1.00 33.36  ? 133 PRO A CB  1 
ATOM   451  C  CG  . PRO A 1 58  ? 24.963  14.827  0.583   1.00 31.48  ? 133 PRO A CG  1 
ATOM   452  C  CD  . PRO A 1 58  ? 25.545  13.421  0.731   1.00 33.52  ? 133 PRO A CD  1 
ATOM   453  N  N   . HIS A 1 59  ? 24.048  14.577  5.123   1.00 32.57  ? 134 HIS A N   1 
ATOM   454  C  CA  . HIS A 1 59  ? 23.338  14.230  6.352   1.00 35.28  ? 134 HIS A CA  1 
ATOM   455  C  C   . HIS A 1 59  ? 23.809  12.983  7.091   1.00 33.72  ? 134 HIS A C   1 
ATOM   456  O  O   . HIS A 1 59  ? 23.140  12.530  8.019   1.00 33.34  ? 134 HIS A O   1 
ATOM   457  C  CB  . HIS A 1 59  ? 21.801  14.146  6.198   1.00 40.01  ? 134 HIS A CB  1 
ATOM   458  C  CG  . HIS A 1 59  ? 21.221  15.265  5.401   1.00 44.89  ? 134 HIS A CG  1 
ATOM   459  N  ND1 . HIS A 1 59  ? 20.557  16.317  5.934   1.00 47.01  ? 134 HIS A ND1 1 
ATOM   460  C  CD2 . HIS A 1 59  ? 21.331  15.479  4.058   1.00 46.71  ? 134 HIS A CD2 1 
ATOM   461  C  CE1 . HIS A 1 59  ? 20.286  17.168  4.932   1.00 48.23  ? 134 HIS A CE1 1 
ATOM   462  N  NE2 . HIS A 1 59  ? 20.752  16.682  3.777   1.00 48.67  ? 134 HIS A NE2 1 
ATOM   463  N  N   . VAL A 1 60  ? 24.966  12.446  6.724   1.00 32.38  ? 135 VAL A N   1 
ATOM   464  C  CA  . VAL A 1 60  ? 25.458  11.251  7.410   1.00 30.29  ? 135 VAL A CA  1 
ATOM   465  C  C   . VAL A 1 60  ? 25.648  11.463  8.932   1.00 30.81  ? 135 VAL A C   1 
ATOM   466  O  O   . VAL A 1 60  ? 25.355  10.576  9.740   1.00 26.32  ? 135 VAL A O   1 
ATOM   467  C  CB  . VAL A 1 60  ? 26.775  10.753  6.747   1.00 29.75  ? 135 VAL A CB  1 
ATOM   468  C  CG1 . VAL A 1 60  ? 27.920  11.693  7.077   1.00 28.71  ? 135 VAL A CG1 1 
ATOM   469  C  CG2 . VAL A 1 60  ? 27.089  9.315   7.195   1.00 28.12  ? 135 VAL A CG2 1 
ATOM   470  N  N   . ASP A 1 61  ? 26.134  12.640  9.346   1.00 31.78  ? 136 ASP A N   1 
ATOM   471  C  CA  . ASP A 1 61  ? 26.340  12.882  10.772  1.00 33.35  ? 136 ASP A CA  1 
ATOM   472  C  C   . ASP A 1 61  ? 25.017  12.839  11.541  1.00 34.89  ? 136 ASP A C   1 
ATOM   473  O  O   . ASP A 1 61  ? 24.911  12.181  12.587  1.00 34.41  ? 136 ASP A O   1 
ATOM   474  C  CB  . ASP A 1 61  ? 27.044  14.221  11.012  1.00 36.29  ? 136 ASP A CB  1 
ATOM   475  C  CG  . ASP A 1 61  ? 28.454  14.266  10.431  1.00 37.49  ? 136 ASP A CG  1 
ATOM   476  O  OD1 . ASP A 1 61  ? 29.266  13.359  10.714  1.00 36.79  ? 136 ASP A OD1 1 
ATOM   477  O  OD2 . ASP A 1 61  ? 28.763  15.219  9.685   1.00 38.43  ? 136 ASP A OD2 1 
ATOM   478  N  N   . GLU A 1 62  ? 24.007  13.542  11.044  1.00 34.95  ? 137 GLU A N   1 
ATOM   479  C  CA  . GLU A 1 62  ? 22.710  13.523  11.711  1.00 36.62  ? 137 GLU A CA  1 
ATOM   480  C  C   . GLU A 1 62  ? 22.173  12.086  11.677  1.00 34.50  ? 137 GLU A C   1 
ATOM   481  O  O   . GLU A 1 62  ? 21.610  11.597  12.652  1.00 35.17  ? 137 GLU A O   1 
ATOM   482  C  CB  . GLU A 1 62  ? 21.719  14.460  10.999  1.00 39.92  ? 137 GLU A CB  1 
ATOM   483  C  CG  . GLU A 1 62  ? 20.252  14.104  11.248  1.00 45.74  ? 137 GLU A CG  1 
ATOM   484  C  CD  . GLU A 1 62  ? 19.274  15.134  10.693  1.00 50.87  ? 137 GLU A CD  1 
ATOM   485  O  OE1 . GLU A 1 62  ? 19.487  15.616  9.552   1.00 53.62  ? 137 GLU A OE1 1 
ATOM   486  O  OE2 . GLU A 1 62  ? 18.271  15.447  11.392  1.00 52.62  ? 137 GLU A OE2 1 
ATOM   487  N  N   . PHE A 1 63  ? 22.354  11.417  10.547  1.00 33.01  ? 138 PHE A N   1 
ATOM   488  C  CA  . PHE A 1 63  ? 21.876  10.049  10.403  1.00 32.08  ? 138 PHE A CA  1 
ATOM   489  C  C   . PHE A 1 63  ? 22.512  9.116   11.435  1.00 31.09  ? 138 PHE A C   1 
ATOM   490  O  O   . PHE A 1 63  ? 21.808  8.402   12.152  1.00 29.47  ? 138 PHE A O   1 
ATOM   491  C  CB  . PHE A 1 63  ? 22.166  9.539   8.985   1.00 31.60  ? 138 PHE A CB  1 
ATOM   492  C  CG  . PHE A 1 63  ? 21.707  8.131   8.746   1.00 33.24  ? 138 PHE A CG  1 
ATOM   493  C  CD1 . PHE A 1 63  ? 20.349  7.846   8.627   1.00 32.92  ? 138 PHE A CD1 1 
ATOM   494  C  CD2 . PHE A 1 63  ? 22.629  7.085   8.664   1.00 33.34  ? 138 PHE A CD2 1 
ATOM   495  C  CE1 . PHE A 1 63  ? 19.907  6.540   8.426   1.00 34.50  ? 138 PHE A CE1 1 
ATOM   496  C  CE2 . PHE A 1 63  ? 22.202  5.769   8.463   1.00 35.14  ? 138 PHE A CE2 1 
ATOM   497  C  CZ  . PHE A 1 63  ? 20.839  5.494   8.344   1.00 34.77  ? 138 PHE A CZ  1 
ATOM   498  N  N   . LEU A 1 64  ? 23.842  9.122   11.522  1.00 31.55  ? 139 LEU A N   1 
ATOM   499  C  CA  . LEU A 1 64  ? 24.541  8.241   12.456  1.00 33.50  ? 139 LEU A CA  1 
ATOM   500  C  C   . LEU A 1 64  ? 24.246  8.533   13.920  1.00 35.73  ? 139 LEU A C   1 
ATOM   501  O  O   . LEU A 1 64  ? 24.202  7.626   14.757  1.00 34.35  ? 139 LEU A O   1 
ATOM   502  C  CB  . LEU A 1 64  ? 26.061  8.301   12.216  1.00 33.75  ? 139 LEU A CB  1 
ATOM   503  C  CG  . LEU A 1 64  ? 26.586  7.536   11.000  1.00 31.62  ? 139 LEU A CG  1 
ATOM   504  C  CD1 . LEU A 1 64  ? 28.102  7.653   10.925  1.00 27.56  ? 139 LEU A CD1 1 
ATOM   505  C  CD2 . LEU A 1 64  ? 26.158  6.083   11.103  1.00 29.20  ? 139 LEU A CD2 1 
ATOM   506  N  N   . GLN A 1 65  ? 24.053  9.805   14.244  1.00 37.42  ? 140 GLN A N   1 
ATOM   507  C  CA  . GLN A 1 65  ? 23.767  10.183  15.619  1.00 40.91  ? 140 GLN A CA  1 
ATOM   508  C  C   . GLN A 1 65  ? 22.407  9.658   16.059  1.00 39.58  ? 140 GLN A C   1 
ATOM   509  O  O   . GLN A 1 65  ? 22.267  9.105   17.149  1.00 39.01  ? 140 GLN A O   1 
ATOM   510  C  CB  . GLN A 1 65  ? 23.802  11.693  15.766  1.00 45.34  ? 140 GLN A CB  1 
ATOM   511  C  CG  . GLN A 1 65  ? 23.891  12.142  17.196  1.00 54.17  ? 140 GLN A CG  1 
ATOM   512  C  CD  . GLN A 1 65  ? 24.080  13.636  17.301  1.00 60.19  ? 140 GLN A CD  1 
ATOM   513  O  OE1 . GLN A 1 65  ? 24.856  14.228  16.542  1.00 65.26  ? 140 GLN A OE1 1 
ATOM   514  N  NE2 . GLN A 1 65  ? 23.364  14.261  18.231  1.00 63.87  ? 140 GLN A NE2 1 
ATOM   515  N  N   . ARG A 1 66  ? 21.407  9.829   15.202  1.00 39.11  ? 141 ARG A N   1 
ATOM   516  C  CA  . ARG A 1 66  ? 20.064  9.349   15.513  1.00 39.98  ? 141 ARG A CA  1 
ATOM   517  C  C   . ARG A 1 66  ? 20.027  7.825   15.601  1.00 37.88  ? 141 ARG A C   1 
ATOM   518  O  O   . ARG A 1 66  ? 19.533  7.267   16.572  1.00 36.52  ? 141 ARG A O   1 
ATOM   519  C  CB  . ARG A 1 66  ? 19.066  9.809   14.452  1.00 42.12  ? 141 ARG A CB  1 
ATOM   520  C  CG  . ARG A 1 66  ? 17.609  9.637   14.877  1.00 47.13  ? 141 ARG A CG  1 
ATOM   521  C  CD  . ARG A 1 66  ? 17.186  10.722  15.876  1.00 50.61  ? 141 ARG A CD  1 
ATOM   522  N  NE  . ARG A 1 66  ? 15.839  10.511  16.398  1.00 54.31  ? 141 ARG A NE  1 
ATOM   523  C  CZ  . ARG A 1 66  ? 15.555  9.704   17.417  1.00 56.03  ? 141 ARG A CZ  1 
ATOM   524  N  NH1 . ARG A 1 66  ? 16.527  9.041   18.023  1.00 56.65  ? 141 ARG A NH1 1 
ATOM   525  N  NH2 . ARG A 1 66  ? 14.302  9.554   17.827  1.00 56.74  ? 141 ARG A NH2 1 
ATOM   526  N  N   . MET A 1 67  ? 20.551  7.166   14.578  1.00 36.39  ? 142 MET A N   1 
ATOM   527  C  CA  . MET A 1 67  ? 20.570  5.702   14.531  1.00 35.90  ? 142 MET A CA  1 
ATOM   528  C  C   . MET A 1 67  ? 21.287  5.137   15.750  1.00 36.43  ? 142 MET A C   1 
ATOM   529  O  O   . MET A 1 67  ? 20.868  4.132   16.326  1.00 34.16  ? 142 MET A O   1 
ATOM   530  C  CB  . MET A 1 67  ? 21.276  5.225   13.261  1.00 35.67  ? 142 MET A CB  1 
ATOM   531  C  CG  . MET A 1 67  ? 20.592  5.695   11.971  1.00 36.10  ? 142 MET A CG  1 
ATOM   532  S  SD  . MET A 1 67  ? 18.982  4.862   11.696  1.00 39.81  ? 142 MET A SD  1 
ATOM   533  C  CE  . MET A 1 67  ? 19.591  3.220   11.350  1.00 38.95  ? 142 MET A CE  1 
ATOM   534  N  N   . GLY A 1 68  ? 22.382  5.801   16.128  1.00 36.40  ? 143 GLY A N   1 
ATOM   535  C  CA  . GLY A 1 68  ? 23.164  5.372   17.276  1.00 36.16  ? 143 GLY A CA  1 
ATOM   536  C  C   . GLY A 1 68  ? 22.349  5.292   18.548  1.00 37.28  ? 143 GLY A C   1 
ATOM   537  O  O   . GLY A 1 68  ? 22.619  4.480   19.430  1.00 38.47  ? 143 GLY A O   1 
ATOM   538  N  N   . GLU A 1 69  ? 21.330  6.122   18.663  1.00 37.47  ? 144 GLU A N   1 
ATOM   539  C  CA  . GLU A 1 69  ? 20.516  6.078   19.859  1.00 39.60  ? 144 GLU A CA  1 
ATOM   540  C  C   . GLU A 1 69  ? 19.231  5.258   19.677  1.00 39.04  ? 144 GLU A C   1 
ATOM   541  O  O   . GLU A 1 69  ? 18.585  4.907   20.659  1.00 39.17  ? 144 GLU A O   1 
ATOM   542  C  CB  . GLU A 1 69  ? 20.196  7.501   20.333  1.00 41.59  ? 144 GLU A CB  1 
ATOM   543  C  CG  . GLU A 1 69  ? 19.556  8.375   19.279  1.00 46.45  ? 144 GLU A CG  1 
ATOM   544  C  CD  . GLU A 1 69  ? 19.501  9.839   19.685  1.00 48.80  ? 144 GLU A CD  1 
ATOM   545  O  OE1 . GLU A 1 69  ? 20.295  10.226  20.573  1.00 51.91  ? 144 GLU A OE1 1 
ATOM   546  O  OE2 . GLU A 1 69  ? 18.717  10.617  19.090  1.00 49.92  ? 144 GLU A OE2 1 
ATOM   547  N  N   . LEU A 1 70  ? 18.863  4.948   18.435  1.00 38.86  ? 145 LEU A N   1 
ATOM   548  C  CA  . LEU A 1 70  ? 17.655  4.141   18.188  1.00 38.00  ? 145 LEU A CA  1 
ATOM   549  C  C   . LEU A 1 70  ? 17.954  2.647   18.113  1.00 37.69  ? 145 LEU A C   1 
ATOM   550  O  O   . LEU A 1 70  ? 17.109  1.816   18.465  1.00 35.18  ? 145 LEU A O   1 
ATOM   551  C  CB  . LEU A 1 70  ? 16.973  4.554   16.886  1.00 38.85  ? 145 LEU A CB  1 
ATOM   552  C  CG  . LEU A 1 70  ? 16.326  5.937   16.805  1.00 39.68  ? 145 LEU A CG  1 
ATOM   553  C  CD1 . LEU A 1 70  ? 16.023  6.230   15.337  1.00 42.09  ? 145 LEU A CD1 1 
ATOM   554  C  CD2 . LEU A 1 70  ? 15.036  5.990   17.639  1.00 41.27  ? 145 LEU A CD2 1 
ATOM   555  N  N   . PHE A 1 71  ? 19.155  2.300   17.659  1.00 35.13  ? 146 PHE A N   1 
ATOM   556  C  CA  . PHE A 1 71  ? 19.505  0.899   17.505  1.00 34.75  ? 146 PHE A CA  1 
ATOM   557  C  C   . PHE A 1 71  ? 20.881  0.556   18.020  1.00 35.41  ? 146 PHE A C   1 
ATOM   558  O  O   . PHE A 1 71  ? 21.649  1.417   18.455  1.00 35.74  ? 146 PHE A O   1 
ATOM   559  C  CB  . PHE A 1 71  ? 19.504  0.518   16.023  1.00 34.88  ? 146 PHE A CB  1 
ATOM   560  C  CG  . PHE A 1 71  ? 18.258  0.896   15.288  1.00 34.97  ? 146 PHE A CG  1 
ATOM   561  C  CD1 . PHE A 1 71  ? 17.144  0.062   15.282  1.00 34.88  ? 146 PHE A CD1 1 
ATOM   562  C  CD2 . PHE A 1 71  ? 18.216  2.094   14.583  1.00 35.11  ? 146 PHE A CD2 1 
ATOM   563  C  CE1 . PHE A 1 71  ? 15.990  0.425   14.565  1.00 35.45  ? 146 PHE A CE1 1 
ATOM   564  C  CE2 . PHE A 1 71  ? 17.074  2.462   13.860  1.00 35.77  ? 146 PHE A CE2 1 
ATOM   565  C  CZ  . PHE A 1 71  ? 15.956  1.617   13.857  1.00 34.11  ? 146 PHE A CZ  1 
ATOM   566  N  N   . GLU A 1 72  ? 21.176  -0.734  17.969  1.00 34.77  ? 147 GLU A N   1 
ATOM   567  C  CA  . GLU A 1 72  ? 22.491  -1.237  18.326  1.00 33.48  ? 147 GLU A CA  1 
ATOM   568  C  C   . GLU A 1 72  ? 23.117  -1.284  16.933  1.00 33.55  ? 147 GLU A C   1 
ATOM   569  O  O   . GLU A 1 72  ? 22.892  -2.250  16.187  1.00 30.84  ? 147 GLU A O   1 
ATOM   570  C  CB  . GLU A 1 72  ? 22.397  -2.646  18.901  1.00 33.78  ? 147 GLU A CB  1 
ATOM   571  C  CG  . GLU A 1 72  ? 23.730  -3.319  19.083  1.00 35.76  ? 147 GLU A CG  1 
ATOM   572  C  CD  . GLU A 1 72  ? 23.594  -4.791  19.408  1.00 38.88  ? 147 GLU A CD  1 
ATOM   573  O  OE1 . GLU A 1 72  ? 22.644  -5.433  18.888  1.00 39.46  ? 147 GLU A OE1 1 
ATOM   574  O  OE2 . GLU A 1 72  ? 24.460  -5.299  20.147  1.00 38.49  ? 147 GLU A OE2 1 
ATOM   575  N  N   . CYS A 1 73  ? 23.879  -0.242  16.575  1.00 31.76  ? 148 CYS A N   1 
ATOM   576  C  CA  . CYS A 1 73  ? 24.479  -0.170  15.249  1.00 31.78  ? 148 CYS A CA  1 
ATOM   577  C  C   . CYS A 1 73  ? 25.783  -0.926  15.137  1.00 31.87  ? 148 CYS A C   1 
ATOM   578  O  O   . CYS A 1 73  ? 26.623  -0.933  16.050  1.00 32.57  ? 148 CYS A O   1 
ATOM   579  C  CB  . CYS A 1 73  ? 24.695  1.284   14.822  1.00 30.71  ? 148 CYS A CB  1 
ATOM   580  S  SG  . CYS A 1 73  ? 23.198  2.285   14.752  1.00 32.00  ? 148 CYS A SG  1 
ATOM   581  N  N   . VAL A 1 74  ? 25.944  -1.562  13.985  1.00 30.71  ? 149 VAL A N   1 
ATOM   582  C  CA  . VAL A 1 74  ? 27.118  -2.353  13.697  1.00 30.05  ? 149 VAL A CA  1 
ATOM   583  C  C   . VAL A 1 74  ? 27.554  -2.053  12.281  1.00 30.24  ? 149 VAL A C   1 
ATOM   584  O  O   . VAL A 1 74  ? 26.722  -2.047  11.364  1.00 29.27  ? 149 VAL A O   1 
ATOM   585  C  CB  . VAL A 1 74  ? 26.805  -3.886  13.828  1.00 31.81  ? 149 VAL A CB  1 
ATOM   586  C  CG1 . VAL A 1 74  ? 27.989  -4.736  13.341  1.00 31.27  ? 149 VAL A CG1 1 
ATOM   587  C  CG2 . VAL A 1 74  ? 26.502  -4.225  15.275  1.00 29.22  ? 149 VAL A CG2 1 
ATOM   588  N  N   . LEU A 1 75  ? 28.847  -1.769  12.123  1.00 29.23  ? 150 LEU A N   1 
ATOM   589  C  CA  . LEU A 1 75  ? 29.408  -1.489  10.815  1.00 26.47  ? 150 LEU A CA  1 
ATOM   590  C  C   . LEU A 1 75  ? 29.787  -2.849  10.227  1.00 26.51  ? 150 LEU A C   1 
ATOM   591  O  O   . LEU A 1 75  ? 30.518  -3.616  10.862  1.00 25.26  ? 150 LEU A O   1 
ATOM   592  C  CB  . LEU A 1 75  ? 30.677  -0.647  10.945  1.00 26.92  ? 150 LEU A CB  1 
ATOM   593  C  CG  . LEU A 1 75  ? 31.259  -0.231  9.596   1.00 28.35  ? 150 LEU A CG  1 
ATOM   594  C  CD1 . LEU A 1 75  ? 30.412  0.911   8.998   1.00 27.46  ? 150 LEU A CD1 1 
ATOM   595  C  CD2 . LEU A 1 75  ? 32.711  0.214   9.775   1.00 27.38  ? 150 LEU A CD2 1 
ATOM   596  N  N   . PHE A 1 76  ? 29.298  -3.121  9.022   1.00 26.15  ? 151 PHE A N   1 
ATOM   597  C  CA  . PHE A 1 76  ? 29.598  -4.389  8.350   1.00 28.99  ? 151 PHE A CA  1 
ATOM   598  C  C   . PHE A 1 76  ? 29.941  -3.977  6.926   1.00 29.03  ? 151 PHE A C   1 
ATOM   599  O  O   . PHE A 1 76  ? 29.093  -3.451  6.189   1.00 29.04  ? 151 PHE A O   1 
ATOM   600  C  CB  . PHE A 1 76  ? 28.376  -5.330  8.379   1.00 28.49  ? 151 PHE A CB  1 
ATOM   601  C  CG  . PHE A 1 76  ? 28.727  -6.813  8.260   1.00 31.41  ? 151 PHE A CG  1 
ATOM   602  C  CD1 . PHE A 1 76  ? 30.010  -7.239  7.908   1.00 31.44  ? 151 PHE A CD1 1 
ATOM   603  C  CD2 . PHE A 1 76  ? 27.759  -7.781  8.537   1.00 31.94  ? 151 PHE A CD2 1 
ATOM   604  C  CE1 . PHE A 1 76  ? 30.317  -8.614  7.840   1.00 32.39  ? 151 PHE A CE1 1 
ATOM   605  C  CE2 . PHE A 1 76  ? 28.055  -9.144  8.471   1.00 31.68  ? 151 PHE A CE2 1 
ATOM   606  C  CZ  . PHE A 1 76  ? 29.324  -9.562  8.125   1.00 32.27  ? 151 PHE A CZ  1 
ATOM   607  N  N   . THR A 1 77  ? 31.187  -4.214  6.536   1.00 28.13  ? 152 THR A N   1 
ATOM   608  C  CA  . THR A 1 77  ? 31.648  -3.803  5.217   1.00 27.56  ? 152 THR A CA  1 
ATOM   609  C  C   . THR A 1 77  ? 32.465  -4.916  4.573   1.00 27.95  ? 152 THR A C   1 
ATOM   610  O  O   . THR A 1 77  ? 33.081  -5.742  5.281   1.00 27.70  ? 152 THR A O   1 
ATOM   611  C  CB  . THR A 1 77  ? 32.548  -2.522  5.345   1.00 26.08  ? 152 THR A CB  1 
ATOM   612  O  OG1 . THR A 1 77  ? 33.038  -2.140  4.057   1.00 27.77  ? 152 THR A OG1 1 
ATOM   613  C  CG2 . THR A 1 77  ? 33.734  -2.796  6.258   1.00 28.82  ? 152 THR A CG2 1 
ATOM   614  N  N   . ALA A 1 78  ? 32.507  -4.914  3.240   1.00 27.14  ? 153 ALA A N   1 
ATOM   615  C  CA  . ALA A 1 78  ? 33.297  -5.916  2.526   1.00 25.96  ? 153 ALA A CA  1 
ATOM   616  C  C   . ALA A 1 78  ? 34.652  -5.294  2.214   1.00 26.63  ? 153 ALA A C   1 
ATOM   617  O  O   . ALA A 1 78  ? 35.427  -5.845  1.429   1.00 26.14  ? 153 ALA A O   1 
ATOM   618  C  CB  . ALA A 1 78  ? 32.595  -6.338  1.229   1.00 26.54  ? 153 ALA A CB  1 
ATOM   619  N  N   . SER A 1 79  ? 34.939  -4.139  2.823   1.00 26.03  ? 154 SER A N   1 
ATOM   620  C  CA  . SER A 1 79  ? 36.225  -3.473  2.596   1.00 26.98  ? 154 SER A CA  1 
ATOM   621  C  C   . SER A 1 79  ? 37.236  -3.918  3.649   1.00 26.50  ? 154 SER A C   1 
ATOM   622  O  O   . SER A 1 79  ? 36.853  -4.505  4.640   1.00 25.84  ? 154 SER A O   1 
ATOM   623  C  CB  . SER A 1 79  ? 36.073  -1.952  2.653   1.00 27.67  ? 154 SER A CB  1 
ATOM   624  O  OG  . SER A 1 79  ? 35.805  -1.547  3.970   1.00 32.23  ? 154 SER A OG  1 
ATOM   625  N  N   . LEU A 1 80  ? 38.520  -3.637  3.430   1.00 26.11  ? 155 LEU A N   1 
ATOM   626  C  CA  . LEU A 1 80  ? 39.562  -4.028  4.371   1.00 26.80  ? 155 LEU A CA  1 
ATOM   627  C  C   . LEU A 1 80  ? 39.638  -3.054  5.551   1.00 27.28  ? 155 LEU A C   1 
ATOM   628  O  O   . LEU A 1 80  ? 39.415  -1.841  5.399   1.00 26.31  ? 155 LEU A O   1 
ATOM   629  C  CB  . LEU A 1 80  ? 40.922  -4.095  3.672   1.00 27.64  ? 155 LEU A CB  1 
ATOM   630  C  CG  . LEU A 1 80  ? 41.101  -5.106  2.535   1.00 29.07  ? 155 LEU A CG  1 
ATOM   631  C  CD1 . LEU A 1 80  ? 42.535  -5.005  1.980   1.00 29.82  ? 155 LEU A CD1 1 
ATOM   632  C  CD2 . LEU A 1 80  ? 40.867  -6.517  3.056   1.00 29.76  ? 155 LEU A CD2 1 
ATOM   633  N  N   . ALA A 1 81  ? 39.960  -3.595  6.721   1.00 25.61  ? 156 ALA A N   1 
ATOM   634  C  CA  . ALA A 1 81  ? 40.072  -2.802  7.942   1.00 26.37  ? 156 ALA A CA  1 
ATOM   635  C  C   . ALA A 1 81  ? 41.098  -1.661  7.820   1.00 27.15  ? 156 ALA A C   1 
ATOM   636  O  O   . ALA A 1 81  ? 40.897  -0.572  8.352   1.00 28.21  ? 156 ALA A O   1 
ATOM   637  C  CB  . ALA A 1 81  ? 40.445  -3.740  9.140   1.00 24.39  ? 156 ALA A CB  1 
ATOM   638  N  N   . LYS A 1 82  ? 42.206  -1.909  7.132   1.00 27.33  ? 157 LYS A N   1 
ATOM   639  C  CA  . LYS A 1 82  ? 43.220  -0.870  6.992   1.00 28.57  ? 157 LYS A CA  1 
ATOM   640  C  C   . LYS A 1 82  ? 42.656  0.336   6.253   1.00 28.63  ? 157 LYS A C   1 
ATOM   641  O  O   . LYS A 1 82  ? 43.285  1.398   6.192   1.00 26.77  ? 157 LYS A O   1 
ATOM   642  C  CB  . LYS A 1 82  ? 44.476  -1.409  6.296   1.00 28.18  ? 157 LYS A CB  1 
ATOM   643  C  CG  . LYS A 1 82  ? 44.339  -1.842  4.850   1.00 31.38  ? 157 LYS A CG  1 
ATOM   644  C  CD  . LYS A 1 82  ? 45.658  -2.495  4.446   1.00 33.42  ? 157 LYS A CD  1 
ATOM   645  C  CE  . LYS A 1 82  ? 45.647  -3.028  3.025   1.00 35.73  ? 157 LYS A CE  1 
ATOM   646  N  NZ  . LYS A 1 82  ? 47.006  -3.559  2.649   1.00 32.54  ? 157 LYS A NZ  1 
ATOM   647  N  N   . TYR A 1 83  ? 41.462  0.175   5.700   1.00 25.36  ? 158 TYR A N   1 
ATOM   648  C  CA  . TYR A 1 83  ? 40.822  1.282   5.026   1.00 25.49  ? 158 TYR A CA  1 
ATOM   649  C  C   . TYR A 1 83  ? 39.667  1.745   5.869   1.00 24.88  ? 158 TYR A C   1 
ATOM   650  O  O   . TYR A 1 83  ? 39.616  2.901   6.296   1.00 24.72  ? 158 TYR A O   1 
ATOM   651  C  CB  . TYR A 1 83  ? 40.321  0.865   3.635   1.00 25.38  ? 158 TYR A CB  1 
ATOM   652  C  CG  . TYR A 1 83  ? 39.195  1.731   3.104   1.00 25.03  ? 158 TYR A CG  1 
ATOM   653  C  CD1 . TYR A 1 83  ? 39.418  3.073   2.745   1.00 26.68  ? 158 TYR A CD1 1 
ATOM   654  C  CD2 . TYR A 1 83  ? 37.904  1.235   3.021   1.00 24.82  ? 158 TYR A CD2 1 
ATOM   655  C  CE1 . TYR A 1 83  ? 38.364  3.904   2.317   1.00 26.29  ? 158 TYR A CE1 1 
ATOM   656  C  CE2 . TYR A 1 83  ? 36.844  2.041   2.596   1.00 24.89  ? 158 TYR A CE2 1 
ATOM   657  C  CZ  . TYR A 1 83  ? 37.066  3.371   2.249   1.00 26.92  ? 158 TYR A CZ  1 
ATOM   658  O  OH  . TYR A 1 83  ? 35.970  4.160   1.889   1.00 26.09  ? 158 TYR A OH  1 
ATOM   659  N  N   . ALA A 1 84  ? 38.757  0.815   6.133   1.00 23.76  ? 159 ALA A N   1 
ATOM   660  C  CA  . ALA A 1 84  ? 37.521  1.092   6.858   1.00 23.24  ? 159 ALA A CA  1 
ATOM   661  C  C   . ALA A 1 84  ? 37.624  1.472   8.336   1.00 23.53  ? 159 ALA A C   1 
ATOM   662  O  O   . ALA A 1 84  ? 36.796  2.242   8.833   1.00 19.09  ? 159 ALA A O   1 
ATOM   663  C  CB  . ALA A 1 84  ? 36.561  -0.120  6.699   1.00 24.41  ? 159 ALA A CB  1 
ATOM   664  N  N   . ASP A 1 85  ? 38.603  0.915   9.053   1.00 23.57  ? 160 ASP A N   1 
ATOM   665  C  CA  . ASP A 1 85  ? 38.753  1.227   10.484  1.00 22.77  ? 160 ASP A CA  1 
ATOM   666  C  C   . ASP A 1 85  ? 39.075  2.724   10.681  1.00 21.61  ? 160 ASP A C   1 
ATOM   667  O  O   . ASP A 1 85  ? 38.450  3.397   11.523  1.00 27.08  ? 160 ASP A O   1 
ATOM   668  C  CB  . ASP A 1 85  ? 39.850  0.334   11.088  1.00 25.88  ? 160 ASP A CB  1 
ATOM   669  C  CG  . ASP A 1 85  ? 39.553  -0.101  12.511  1.00 28.79  ? 160 ASP A CG  1 
ATOM   670  O  OD1 . ASP A 1 85  ? 38.360  -0.213  12.931  1.00 29.22  ? 160 ASP A OD1 1 
ATOM   671  O  OD2 . ASP A 1 85  ? 40.545  -0.358  13.228  1.00 33.07  ? 160 ASP A OD2 1 
ATOM   672  N  N   . PRO A 1 86  ? 40.042  3.273   9.917   1.00 30.29  ? 161 PRO A N   1 
ATOM   673  C  CA  . PRO A 1 86  ? 40.342  4.700   10.090  1.00 21.78  ? 161 PRO A CA  1 
ATOM   674  C  C   . PRO A 1 86  ? 39.148  5.570   9.691   1.00 23.87  ? 161 PRO A C   1 
ATOM   675  O  O   . PRO A 1 86  ? 38.852  6.551   10.367  1.00 26.58  ? 161 PRO A O   1 
ATOM   676  C  CB  . PRO A 1 86  ? 41.539  4.934   9.168   1.00 23.89  ? 161 PRO A CB  1 
ATOM   677  C  CG  . PRO A 1 86  ? 42.222  3.589   9.136   1.00 23.23  ? 161 PRO A CG  1 
ATOM   678  C  CD  . PRO A 1 86  ? 41.068  2.615   9.090   1.00 20.72  ? 161 PRO A CD  1 
ATOM   679  N  N   . VAL A 1 87  ? 38.451  5.206   8.609   1.00 25.09  ? 162 VAL A N   1 
ATOM   680  C  CA  . VAL A 1 87  ? 37.290  6.002   8.151   1.00 23.71  ? 162 VAL A CA  1 
ATOM   681  C  C   . VAL A 1 87  ? 36.242  6.038   9.243   1.00 22.20  ? 162 VAL A C   1 
ATOM   682  O  O   . VAL A 1 87  ? 35.731  7.109   9.593   1.00 24.58  ? 162 VAL A O   1 
ATOM   683  C  CB  . VAL A 1 87  ? 36.623  5.400   6.865   1.00 22.80  ? 162 VAL A CB  1 
ATOM   684  C  CG1 . VAL A 1 87  ? 35.339  6.169   6.539   1.00 23.57  ? 162 VAL A CG1 1 
ATOM   685  C  CG2 . VAL A 1 87  ? 37.571  5.452   5.704   1.00 24.26  ? 162 VAL A CG2 1 
ATOM   686  N  N   . ALA A 1 88  ? 35.916  4.868   9.793   1.00 20.01  ? 163 ALA A N   1 
ATOM   687  C  CA  . ALA A 1 88  ? 34.930  4.784   10.863  1.00 23.29  ? 163 ALA A CA  1 
ATOM   688  C  C   . ALA A 1 88  ? 35.395  5.583   12.084  1.00 21.48  ? 163 ALA A C   1 
ATOM   689  O  O   . ALA A 1 88  ? 34.570  6.187   12.772  1.00 22.81  ? 163 ALA A O   1 
ATOM   690  C  CB  . ALA A 1 88  ? 34.664  3.303   11.253  1.00 22.90  ? 163 ALA A CB  1 
ATOM   691  N  N   . ASP A 1 89  ? 36.694  5.558   12.377  1.00 21.50  ? 164 ASP A N   1 
ATOM   692  C  CA  . ASP A 1 89  ? 37.228  6.337   13.516  1.00 24.20  ? 164 ASP A CA  1 
ATOM   693  C  C   . ASP A 1 89  ? 36.953  7.830   13.285  1.00 24.26  ? 164 ASP A C   1 
ATOM   694  O  O   . ASP A 1 89  ? 36.494  8.531   14.184  1.00 24.34  ? 164 ASP A O   1 
ATOM   695  C  CB  . ASP A 1 89  ? 38.740  6.170   13.659  1.00 22.77  ? 164 ASP A CB  1 
ATOM   696  C  CG  . ASP A 1 89  ? 39.132  4.932   14.445  1.00 27.00  ? 164 ASP A CG  1 
ATOM   697  O  OD1 . ASP A 1 89  ? 38.237  4.180   14.885  1.00 26.11  ? 164 ASP A OD1 1 
ATOM   698  O  OD2 . ASP A 1 89  ? 40.353  4.726   14.623  1.00 27.27  ? 164 ASP A OD2 1 
ATOM   699  N  N   . LEU A 1 90  ? 37.236  8.301   12.073  1.00 25.45  ? 165 LEU A N   1 
ATOM   700  C  CA  . LEU A 1 90  ? 37.047  9.716   11.729  1.00 27.76  ? 165 LEU A CA  1 
ATOM   701  C  C   . LEU A 1 90  ? 35.588  10.086  11.526  1.00 30.01  ? 165 LEU A C   1 
ATOM   702  O  O   . LEU A 1 90  ? 35.165  11.202  11.864  1.00 30.34  ? 165 LEU A O   1 
ATOM   703  C  CB  . LEU A 1 90  ? 37.841  10.049  10.466  1.00 27.57  ? 165 LEU A CB  1 
ATOM   704  C  CG  . LEU A 1 90  ? 39.355  10.088  10.642  1.00 26.46  ? 165 LEU A CG  1 
ATOM   705  C  CD1 . LEU A 1 90  ? 40.050  9.917   9.318   1.00 24.46  ? 165 LEU A CD1 1 
ATOM   706  C  CD2 . LEU A 1 90  ? 39.733  11.388  11.305  1.00 29.59  ? 165 LEU A CD2 1 
ATOM   707  N  N   . LEU A 1 91  ? 34.815  9.147   10.982  1.00 30.64  ? 166 LEU A N   1 
ATOM   708  C  CA  . LEU A 1 91  ? 33.397  9.371   10.710  1.00 31.33  ? 166 LEU A CA  1 
ATOM   709  C  C   . LEU A 1 91  ? 32.445  9.306   11.906  1.00 33.99  ? 166 LEU A C   1 
ATOM   710  O  O   . LEU A 1 91  ? 31.618  10.202  12.115  1.00 31.81  ? 166 LEU A O   1 
ATOM   711  C  CB  . LEU A 1 91  ? 32.932  8.361   9.655   1.00 32.00  ? 166 LEU A CB  1 
ATOM   712  C  CG  . LEU A 1 91  ? 31.489  8.422   9.155   1.00 33.45  ? 166 LEU A CG  1 
ATOM   713  C  CD1 . LEU A 1 91  ? 31.300  9.690   8.322   1.00 29.82  ? 166 LEU A CD1 1 
ATOM   714  C  CD2 . LEU A 1 91  ? 31.225  7.207   8.251   1.00 31.90  ? 166 LEU A CD2 1 
ATOM   715  N  N   . ASP A 1 92  ? 32.545  8.233   12.689  1.00 35.05  ? 167 ASP A N   1 
ATOM   716  C  CA  . ASP A 1 92  ? 31.639  8.035   13.815  1.00 37.07  ? 167 ASP A CA  1 
ATOM   717  C  C   . ASP A 1 92  ? 32.033  8.787   15.098  1.00 38.81  ? 167 ASP A C   1 
ATOM   718  O  O   . ASP A 1 92  ? 32.604  8.202   16.023  1.00 38.51  ? 167 ASP A O   1 
ATOM   719  C  CB  . ASP A 1 92  ? 31.519  6.533   14.098  1.00 37.08  ? 167 ASP A CB  1 
ATOM   720  C  CG  . ASP A 1 92  ? 30.505  6.222   15.167  1.00 36.45  ? 167 ASP A CG  1 
ATOM   721  O  OD1 . ASP A 1 92  ? 29.682  7.114   15.487  1.00 37.30  ? 167 ASP A OD1 1 
ATOM   722  O  OD2 . ASP A 1 92  ? 30.519  5.073   15.671  1.00 35.53  ? 167 ASP A OD2 1 
ATOM   723  N  N   . LYS A 1 93  ? 31.701  10.074  15.153  1.00 39.80  ? 168 LYS A N   1 
ATOM   724  C  CA  . LYS A 1 93  ? 32.044  10.910  16.299  1.00 42.99  ? 168 LYS A CA  1 
ATOM   725  C  C   . LYS A 1 93  ? 31.284  10.570  17.567  1.00 42.45  ? 168 LYS A C   1 
ATOM   726  O  O   . LYS A 1 93  ? 31.804  10.772  18.666  1.00 43.82  ? 168 LYS A O   1 
ATOM   727  C  CB  . LYS A 1 93  ? 31.789  12.388  15.978  1.00 46.95  ? 168 LYS A CB  1 
ATOM   728  C  CG  . LYS A 1 93  ? 32.463  12.896  14.723  1.00 51.03  ? 168 LYS A CG  1 
ATOM   729  C  CD  . LYS A 1 93  ? 31.964  14.297  14.385  1.00 58.79  ? 168 LYS A CD  1 
ATOM   730  C  CE  . LYS A 1 93  ? 32.489  14.774  13.030  1.00 63.09  ? 168 LYS A CE  1 
ATOM   731  N  NZ  . LYS A 1 93  ? 33.980  14.855  13.008  1.00 67.04  ? 168 LYS A NZ  1 
ATOM   732  N  N   . TRP A 1 94  ? 30.066  10.045  17.435  1.00 41.94  ? 169 TRP A N   1 
ATOM   733  C  CA  . TRP A 1 94  ? 29.250  9.735   18.611  1.00 42.76  ? 169 TRP A CA  1 
ATOM   734  C  C   . TRP A 1 94  ? 29.247  8.297   19.071  1.00 41.05  ? 169 TRP A C   1 
ATOM   735  O  O   . TRP A 1 94  ? 28.394  7.916   19.863  1.00 41.02  ? 169 TRP A O   1 
ATOM   736  C  CB  . TRP A 1 94  ? 27.803  10.156  18.375  1.00 44.90  ? 169 TRP A CB  1 
ATOM   737  C  CG  . TRP A 1 94  ? 27.714  11.320  17.486  1.00 48.64  ? 169 TRP A CG  1 
ATOM   738  C  CD1 . TRP A 1 94  ? 27.512  12.623  17.843  1.00 49.34  ? 169 TRP A CD1 1 
ATOM   739  C  CD2 . TRP A 1 94  ? 27.898  11.309  16.071  1.00 51.45  ? 169 TRP A CD2 1 
ATOM   740  N  NE1 . TRP A 1 94  ? 27.560  13.429  16.730  1.00 51.42  ? 169 TRP A NE1 1 
ATOM   741  C  CE2 . TRP A 1 94  ? 27.800  12.646  15.628  1.00 51.94  ? 169 TRP A CE2 1 
ATOM   742  C  CE3 . TRP A 1 94  ? 28.151  10.290  15.130  1.00 52.05  ? 169 TRP A CE3 1 
ATOM   743  C  CZ2 . TRP A 1 94  ? 27.942  12.997  14.281  1.00 52.96  ? 169 TRP A CZ2 1 
ATOM   744  C  CZ3 . TRP A 1 94  ? 28.295  10.640  13.794  1.00 53.25  ? 169 TRP A CZ3 1 
ATOM   745  C  CH2 . TRP A 1 94  ? 28.188  11.984  13.383  1.00 53.36  ? 169 TRP A CH2 1 
ATOM   746  N  N   . GLY A 1 95  ? 30.189  7.498   18.592  1.00 38.91  ? 170 GLY A N   1 
ATOM   747  C  CA  . GLY A 1 95  ? 30.228  6.107   19.009  1.00 38.13  ? 170 GLY A CA  1 
ATOM   748  C  C   . GLY A 1 95  ? 28.969  5.315   18.678  1.00 37.19  ? 170 GLY A C   1 
ATOM   749  O  O   . GLY A 1 95  ? 28.566  4.449   19.450  1.00 35.30  ? 170 GLY A O   1 
ATOM   750  N  N   . ALA A 1 96  ? 28.349  5.609   17.536  1.00 36.10  ? 171 ALA A N   1 
ATOM   751  C  CA  . ALA A 1 96  ? 27.144  4.904   17.125  1.00 35.51  ? 171 ALA A CA  1 
ATOM   752  C  C   . ALA A 1 96  ? 27.426  3.428   16.828  1.00 34.89  ? 171 ALA A C   1 
ATOM   753  O  O   . ALA A 1 96  ? 26.543  2.578   16.991  1.00 36.04  ? 171 ALA A O   1 
ATOM   754  C  CB  . ALA A 1 96  ? 26.536  5.581   15.887  1.00 34.69  ? 171 ALA A CB  1 
ATOM   755  N  N   . PHE A 1 97  ? 28.650  3.119   16.405  1.00 33.14  ? 172 PHE A N   1 
ATOM   756  C  CA  . PHE A 1 97  ? 28.994  1.739   16.066  1.00 33.19  ? 172 PHE A CA  1 
ATOM   757  C  C   . PHE A 1 97  ? 29.446  0.944   17.271  1.00 33.28  ? 172 PHE A C   1 
ATOM   758  O  O   . PHE A 1 97  ? 30.500  1.218   17.832  1.00 32.71  ? 172 PHE A O   1 
ATOM   759  C  CB  . PHE A 1 97  ? 30.101  1.700   14.993  1.00 33.75  ? 172 PHE A CB  1 
ATOM   760  C  CG  . PHE A 1 97  ? 29.707  2.332   13.678  1.00 34.72  ? 172 PHE A CG  1 
ATOM   761  C  CD1 . PHE A 1 97  ? 28.492  2.005   13.072  1.00 35.33  ? 172 PHE A CD1 1 
ATOM   762  C  CD2 . PHE A 1 97  ? 30.559  3.223   13.023  1.00 36.09  ? 172 PHE A CD2 1 
ATOM   763  C  CE1 . PHE A 1 97  ? 28.131  2.561   11.834  1.00 33.86  ? 172 PHE A CE1 1 
ATOM   764  C  CE2 . PHE A 1 97  ? 30.200  3.781   11.785  1.00 34.68  ? 172 PHE A CE2 1 
ATOM   765  C  CZ  . PHE A 1 97  ? 28.988  3.446   11.201  1.00 33.40  ? 172 PHE A CZ  1 
ATOM   766  N  N   . ARG A 1 98  ? 28.659  -0.055  17.663  1.00 32.05  ? 173 ARG A N   1 
ATOM   767  C  CA  . ARG A 1 98  ? 29.024  -0.886  18.801  1.00 32.46  ? 173 ARG A CA  1 
ATOM   768  C  C   . ARG A 1 98  ? 30.076  -1.897  18.387  1.00 31.51  ? 173 ARG A C   1 
ATOM   769  O  O   . ARG A 1 98  ? 30.830  -2.395  19.232  1.00 32.54  ? 173 ARG A O   1 
ATOM   770  C  CB  . ARG A 1 98  ? 27.803  -1.638  19.347  1.00 34.97  ? 173 ARG A CB  1 
ATOM   771  C  CG  . ARG A 1 98  ? 26.880  -0.815  20.215  1.00 37.95  ? 173 ARG A CG  1 
ATOM   772  C  CD  . ARG A 1 98  ? 26.192  0.258   19.422  1.00 41.67  ? 173 ARG A CD  1 
ATOM   773  N  NE  . ARG A 1 98  ? 25.077  0.822   20.174  1.00 44.31  ? 173 ARG A NE  1 
ATOM   774  C  CZ  . ARG A 1 98  ? 24.229  1.721   19.687  1.00 45.98  ? 173 ARG A CZ  1 
ATOM   775  N  NH1 . ARG A 1 98  ? 24.364  2.163   18.438  1.00 42.53  ? 173 ARG A NH1 1 
ATOM   776  N  NH2 . ARG A 1 98  ? 23.253  2.187   20.455  1.00 46.73  ? 173 ARG A NH2 1 
ATOM   777  N  N   . ALA A 1 99  ? 30.127  -2.202  17.088  1.00 29.26  ? 174 ALA A N   1 
ATOM   778  C  CA  . ALA A 1 99  ? 31.074  -3.170  16.568  1.00 27.93  ? 174 ALA A CA  1 
ATOM   779  C  C   . ALA A 1 99  ? 31.300  -2.872  15.099  1.00 27.50  ? 174 ALA A C   1 
ATOM   780  O  O   . ALA A 1 99  ? 30.519  -2.160  14.474  1.00 28.84  ? 174 ALA A O   1 
ATOM   781  C  CB  . ALA A 1 99  ? 30.543  -4.596  16.741  1.00 28.94  ? 174 ALA A CB  1 
ATOM   782  N  N   . ARG A 1 100 ? 32.413  -3.376  14.575  1.00 26.60  ? 175 ARG A N   1 
ATOM   783  C  CA  . ARG A 1 100 ? 32.798  -3.176  13.187  1.00 26.76  ? 175 ARG A CA  1 
ATOM   784  C  C   . ARG A 1 100 ? 33.246  -4.506  12.624  1.00 27.17  ? 175 ARG A C   1 
ATOM   785  O  O   . ARG A 1 100 ? 34.091  -5.185  13.205  1.00 27.92  ? 175 ARG A O   1 
ATOM   786  C  CB  . ARG A 1 100 ? 33.955  -2.174  13.094  1.00 25.04  ? 175 ARG A CB  1 
ATOM   787  C  CG  . ARG A 1 100 ? 33.680  -0.870  13.831  1.00 25.86  ? 175 ARG A CG  1 
ATOM   788  C  CD  . ARG A 1 100 ? 34.913  0.019   13.782  1.00 25.53  ? 175 ARG A CD  1 
ATOM   789  N  NE  . ARG A 1 100 ? 34.708  1.289   14.477  1.00 24.94  ? 175 ARG A NE  1 
ATOM   790  C  CZ  . ARG A 1 100 ? 35.621  2.259   14.492  1.00 24.40  ? 175 ARG A CZ  1 
ATOM   791  N  NH1 . ARG A 1 100 ? 36.762  2.083   13.846  1.00 22.00  ? 175 ARG A NH1 1 
ATOM   792  N  NH2 . ARG A 1 100 ? 35.416  3.377   15.179  1.00 25.95  ? 175 ARG A NH2 1 
ATOM   793  N  N   . LEU A 1 101 ? 32.686  -4.875  11.483  1.00 26.96  ? 176 LEU A N   1 
ATOM   794  C  CA  . LEU A 1 101 ? 33.031  -6.150  10.847  1.00 25.62  ? 176 LEU A CA  1 
ATOM   795  C  C   . LEU A 1 101 ? 33.508  -5.842  9.434   1.00 23.49  ? 176 LEU A C   1 
ATOM   796  O  O   . LEU A 1 101 ? 32.878  -5.055  8.719   1.00 22.68  ? 176 LEU A O   1 
ATOM   797  C  CB  . LEU A 1 101 ? 31.793  -7.065  10.803  1.00 25.11  ? 176 LEU A CB  1 
ATOM   798  C  CG  . LEU A 1 101 ? 31.216  -7.334  12.192  1.00 25.48  ? 176 LEU A CG  1 
ATOM   799  C  CD1 . LEU A 1 101 ? 29.837  -8.002  12.091  1.00 23.25  ? 176 LEU A CD1 1 
ATOM   800  C  CD2 . LEU A 1 101 ? 32.223  -8.229  12.951  1.00 22.93  ? 176 LEU A CD2 1 
ATOM   801  N  N   . PHE A 1 102 ? 34.606  -6.466  9.035   1.00 23.53  ? 177 PHE A N   1 
ATOM   802  C  CA  . PHE A 1 102 ? 35.180  -6.217  7.724   1.00 25.52  ? 177 PHE A CA  1 
ATOM   803  C  C   . PHE A 1 102 ? 35.136  -7.429  6.806   1.00 27.45  ? 177 PHE A C   1 
ATOM   804  O  O   . PHE A 1 102 ? 34.462  -8.434  7.088   1.00 25.83  ? 177 PHE A O   1 
ATOM   805  C  CB  . PHE A 1 102 ? 36.625  -5.733  7.878   1.00 25.90  ? 177 PHE A CB  1 
ATOM   806  C  CG  . PHE A 1 102 ? 36.796  -4.708  8.964   1.00 28.04  ? 177 PHE A CG  1 
ATOM   807  C  CD1 . PHE A 1 102 ? 36.469  -3.370  8.736   1.00 28.04  ? 177 PHE A CD1 1 
ATOM   808  C  CD2 . PHE A 1 102 ? 37.216  -5.087  10.243  1.00 26.97  ? 177 PHE A CD2 1 
ATOM   809  C  CE1 . PHE A 1 102 ? 36.561  -2.414  9.763   1.00 27.42  ? 177 PHE A CE1 1 
ATOM   810  C  CE2 . PHE A 1 102 ? 37.332  -4.139  11.279  1.00 27.56  ? 177 PHE A CE2 1 
ATOM   811  C  CZ  . PHE A 1 102 ? 36.998  -2.799  11.036  1.00 28.62  ? 177 PHE A CZ  1 
ATOM   812  N  N   . ARG A 1 103 ? 35.845  -7.320  5.687   1.00 27.84  ? 178 ARG A N   1 
ATOM   813  C  CA  . ARG A 1 103 ? 35.869  -8.384  4.689   1.00 32.59  ? 178 ARG A CA  1 
ATOM   814  C  C   . ARG A 1 103 ? 35.995  -9.808  5.233   1.00 32.50  ? 178 ARG A C   1 
ATOM   815  O  O   . ARG A 1 103 ? 35.252  -10.696 4.809   1.00 30.87  ? 178 ARG A O   1 
ATOM   816  C  CB  . ARG A 1 103 ? 36.992  -8.145  3.678   1.00 31.98  ? 178 ARG A CB  1 
ATOM   817  C  CG  . ARG A 1 103 ? 36.861  -9.011  2.416   1.00 35.04  ? 178 ARG A CG  1 
ATOM   818  C  CD  . ARG A 1 103 ? 36.912  -8.149  1.176   1.00 34.86  ? 178 ARG A CD  1 
ATOM   819  N  NE  . ARG A 1 103 ? 38.271  -8.005  0.721   1.00 36.20  ? 178 ARG A NE  1 
ATOM   820  C  CZ  . ARG A 1 103 ? 38.770  -6.934  0.114   1.00 33.64  ? 178 ARG A CZ  1 
ATOM   821  N  NH1 . ARG A 1 103 ? 38.026  -5.850  -0.131  1.00 31.49  ? 178 ARG A NH1 1 
ATOM   822  N  NH2 . ARG A 1 103 ? 40.034  -6.971  -0.263  1.00 31.43  ? 178 ARG A NH2 1 
ATOM   823  N  N   . GLU A 1 104 ? 36.930  -10.021 6.160   1.00 34.54  ? 179 GLU A N   1 
ATOM   824  C  CA  . GLU A 1 104 ? 37.141  -11.349 6.745   1.00 37.93  ? 179 GLU A CA  1 
ATOM   825  C  C   . GLU A 1 104 ? 35.852  -11.901 7.391   1.00 36.60  ? 179 GLU A C   1 
ATOM   826  O  O   . GLU A 1 104 ? 35.676  -13.106 7.490   1.00 36.89  ? 179 GLU A O   1 
ATOM   827  C  CB  . GLU A 1 104 ? 38.249  -11.312 7.795   1.00 41.63  ? 179 GLU A CB  1 
ATOM   828  C  CG  . GLU A 1 104 ? 39.311  -10.256 7.526   1.00 50.03  ? 179 GLU A CG  1 
ATOM   829  C  CD  . GLU A 1 104 ? 38.837  -8.858  7.868   1.00 50.48  ? 179 GLU A CD  1 
ATOM   830  O  OE1 . GLU A 1 104 ? 38.277  -8.682  8.979   1.00 52.11  ? 179 GLU A OE1 1 
ATOM   831  O  OE2 . GLU A 1 104 ? 39.039  -7.946  7.031   1.00 53.13  ? 179 GLU A OE2 1 
ATOM   832  N  N   . SER A 1 105 ? 34.950  -11.028 7.827   1.00 34.36  ? 180 SER A N   1 
ATOM   833  C  CA  . SER A 1 105 ? 33.704  -11.495 8.429   1.00 33.50  ? 180 SER A CA  1 
ATOM   834  C  C   . SER A 1 105 ? 32.607  -11.775 7.410   1.00 32.18  ? 180 SER A C   1 
ATOM   835  O  O   . SER A 1 105 ? 31.557  -12.310 7.759   1.00 31.06  ? 180 SER A O   1 
ATOM   836  C  CB  . SER A 1 105 ? 33.202  -10.489 9.465   1.00 34.10  ? 180 SER A CB  1 
ATOM   837  O  OG  . SER A 1 105 ? 34.098  -10.481 10.561  1.00 32.88  ? 180 SER A OG  1 
ATOM   838  N  N   . CYS A 1 106 ? 32.831  -11.387 6.164   1.00 32.25  ? 181 CYS A N   1 
ATOM   839  C  CA  . CYS A 1 106 ? 31.841  -11.652 5.128   1.00 33.17  ? 181 CYS A CA  1 
ATOM   840  C  C   . CYS A 1 106 ? 32.026  -13.079 4.637   1.00 33.68  ? 181 CYS A C   1 
ATOM   841  O  O   . CYS A 1 106 ? 33.082  -13.675 4.821   1.00 34.22  ? 181 CYS A O   1 
ATOM   842  C  CB  . CYS A 1 106 ? 32.027  -10.727 3.927   1.00 33.64  ? 181 CYS A CB  1 
ATOM   843  S  SG  . CYS A 1 106 ? 31.666  -8.970  4.228   1.00 32.63  ? 181 CYS A SG  1 
ATOM   844  N  N   . VAL A 1 107 ? 30.975  -13.639 4.045   1.00 34.32  ? 182 VAL A N   1 
ATOM   845  C  CA  . VAL A 1 107 ? 31.046  -14.987 3.492   1.00 34.69  ? 182 VAL A CA  1 
ATOM   846  C  C   . VAL A 1 107 ? 31.201  -14.838 1.988   1.00 35.60  ? 182 VAL A C   1 
ATOM   847  O  O   . VAL A 1 107 ? 30.377  -14.219 1.334   1.00 32.80  ? 182 VAL A O   1 
ATOM   848  C  CB  . VAL A 1 107 ? 29.760  -15.784 3.810   1.00 36.62  ? 182 VAL A CB  1 
ATOM   849  C  CG1 . VAL A 1 107 ? 29.729  -17.104 3.023   1.00 33.73  ? 182 VAL A CG1 1 
ATOM   850  C  CG2 . VAL A 1 107 ? 29.692  -16.033 5.337   1.00 32.62  ? 182 VAL A CG2 1 
ATOM   851  N  N   . PHE A 1 108 ? 32.287  -15.374 1.451   1.00 38.25  ? 183 PHE A N   1 
ATOM   852  C  CA  . PHE A 1 108 ? 32.524  -15.295 0.020   1.00 41.39  ? 183 PHE A CA  1 
ATOM   853  C  C   . PHE A 1 108 ? 31.698  -16.380 -0.661  1.00 41.61  ? 183 PHE A C   1 
ATOM   854  O  O   . PHE A 1 108 ? 31.997  -17.569 -0.537  1.00 41.24  ? 183 PHE A O   1 
ATOM   855  C  CB  . PHE A 1 108 ? 34.005  -15.493 -0.299  1.00 41.96  ? 183 PHE A CB  1 
ATOM   856  C  CG  . PHE A 1 108 ? 34.356  -15.152 -1.714  1.00 44.10  ? 183 PHE A CG  1 
ATOM   857  C  CD1 . PHE A 1 108 ? 33.987  -13.923 -2.257  1.00 43.84  ? 183 PHE A CD1 1 
ATOM   858  C  CD2 . PHE A 1 108 ? 35.041  -16.056 -2.514  1.00 44.99  ? 183 PHE A CD2 1 
ATOM   859  C  CE1 . PHE A 1 108 ? 34.289  -13.598 -3.568  1.00 46.04  ? 183 PHE A CE1 1 
ATOM   860  C  CE2 . PHE A 1 108 ? 35.356  -15.741 -3.838  1.00 46.72  ? 183 PHE A CE2 1 
ATOM   861  C  CZ  . PHE A 1 108 ? 34.977  -14.508 -4.367  1.00 46.74  ? 183 PHE A CZ  1 
ATOM   862  N  N   . HIS A 1 109 ? 30.656  -15.962 -1.362  1.00 43.29  ? 184 HIS A N   1 
ATOM   863  C  CA  . HIS A 1 109 ? 29.780  -16.901 -2.049  1.00 45.29  ? 184 HIS A CA  1 
ATOM   864  C  C   . HIS A 1 109 ? 29.605  -16.503 -3.505  1.00 46.58  ? 184 HIS A C   1 
ATOM   865  O  O   . HIS A 1 109 ? 29.083  -15.418 -3.811  1.00 46.51  ? 184 HIS A O   1 
ATOM   866  C  CB  . HIS A 1 109 ? 28.418  -16.942 -1.358  1.00 46.24  ? 184 HIS A CB  1 
ATOM   867  C  CG  . HIS A 1 109 ? 27.544  -18.072 -1.806  1.00 44.75  ? 184 HIS A CG  1 
ATOM   868  N  ND1 . HIS A 1 109 ? 26.278  -17.880 -2.317  1.00 44.57  ? 184 HIS A ND1 1 
ATOM   869  C  CD2 . HIS A 1 109 ? 27.741  -19.411 -1.785  1.00 45.03  ? 184 HIS A CD2 1 
ATOM   870  C  CE1 . HIS A 1 109 ? 25.732  -19.052 -2.589  1.00 44.38  ? 184 HIS A CE1 1 
ATOM   871  N  NE2 . HIS A 1 109 ? 26.599  -19.997 -2.273  1.00 44.72  ? 184 HIS A NE2 1 
ATOM   872  N  N   . ARG A 1 110 ? 30.034  -17.405 -4.383  1.00 48.36  ? 185 ARG A N   1 
ATOM   873  C  CA  . ARG A 1 110 ? 29.989  -17.223 -5.825  1.00 51.06  ? 185 ARG A CA  1 
ATOM   874  C  C   . ARG A 1 110 ? 30.272  -15.808 -6.307  1.00 50.87  ? 185 ARG A C   1 
ATOM   875  O  O   . ARG A 1 110 ? 29.385  -15.102 -6.780  1.00 50.30  ? 185 ARG A O   1 
ATOM   876  C  CB  . ARG A 1 110 ? 28.658  -17.730 -6.388  1.00 54.47  ? 185 ARG A CB  1 
ATOM   877  C  CG  . ARG A 1 110 ? 27.419  -17.065 -5.853  1.00 57.61  ? 185 ARG A CG  1 
ATOM   878  C  CD  . ARG A 1 110 ? 26.166  -17.820 -6.291  1.00 61.38  ? 185 ARG A CD  1 
ATOM   879  N  NE  . ARG A 1 110 ? 26.234  -19.246 -5.981  1.00 65.12  ? 185 ARG A NE  1 
ATOM   880  C  CZ  . ARG A 1 110 ? 25.180  -20.058 -5.940  1.00 67.60  ? 185 ARG A CZ  1 
ATOM   881  N  NH1 . ARG A 1 110 ? 23.966  -19.588 -6.187  1.00 68.88  ? 185 ARG A NH1 1 
ATOM   882  N  NH2 . ARG A 1 110 ? 25.337  -21.340 -5.642  1.00 69.34  ? 185 ARG A NH2 1 
ATOM   883  N  N   . GLY A 1 111 ? 31.531  -15.407 -6.174  1.00 51.02  ? 186 GLY A N   1 
ATOM   884  C  CA  . GLY A 1 111 ? 31.957  -14.095 -6.626  1.00 50.28  ? 186 GLY A CA  1 
ATOM   885  C  C   . GLY A 1 111 ? 31.552  -12.898 -5.788  1.00 48.42  ? 186 GLY A C   1 
ATOM   886  O  O   . GLY A 1 111 ? 32.014  -11.789 -6.057  1.00 48.98  ? 186 GLY A O   1 
ATOM   887  N  N   . ASN A 1 112 ? 30.697  -13.096 -4.791  1.00 46.81  ? 187 ASN A N   1 
ATOM   888  C  CA  . ASN A 1 112 ? 30.280  -11.976 -3.964  1.00 47.07  ? 187 ASN A CA  1 
ATOM   889  C  C   . ASN A 1 112 ? 30.534  -12.168 -2.480  1.00 45.38  ? 187 ASN A C   1 
ATOM   890  O  O   . ASN A 1 112 ? 30.440  -13.276 -1.963  1.00 45.73  ? 187 ASN A O   1 
ATOM   891  C  CB  . ASN A 1 112 ? 28.807  -11.655 -4.155  1.00 51.07  ? 187 ASN A CB  1 
ATOM   892  C  CG  . ASN A 1 112 ? 28.453  -11.264 -5.585  1.00 51.70  ? 187 ASN A CG  1 
ATOM   893  O  OD1 . ASN A 1 112 ? 27.424  -11.718 -6.090  1.00 51.94  ? 187 ASN A OD1 1 
ATOM   894  N  ND2 . ASN A 1 112 ? 29.183  -10.478 -6.186  1.00 52.11  ? 187 ASN A ND2 1 
ATOM   895  N  N   . TYR A 1 113 ? 30.882  -11.077 -1.801  1.00 42.89  ? 188 TYR A N   1 
ATOM   896  C  CA  . TYR A 1 113 ? 31.101  -11.119 -0.360  1.00 38.88  ? 188 TYR A CA  1 
ATOM   897  C  C   . TYR A 1 113 ? 29.735  -10.844 0.252   1.00 38.20  ? 188 TYR A C   1 
ATOM   898  O  O   . TYR A 1 113 ? 29.195  -9.738  0.132   1.00 37.99  ? 188 TYR A O   1 
ATOM   899  C  CB  . TYR A 1 113 ? 32.093  -10.047 0.091   1.00 38.36  ? 188 TYR A CB  1 
ATOM   900  C  CG  . TYR A 1 113 ? 33.515  -10.376 -0.270  1.00 37.21  ? 188 TYR A CG  1 
ATOM   901  C  CD1 . TYR A 1 113 ? 34.294  -11.205 0.544   1.00 37.26  ? 188 TYR A CD1 1 
ATOM   902  C  CD2 . TYR A 1 113 ? 34.066  -9.900  -1.455  1.00 37.86  ? 188 TYR A CD2 1 
ATOM   903  C  CE1 . TYR A 1 113 ? 35.588  -11.551 0.179   1.00 37.64  ? 188 TYR A CE1 1 
ATOM   904  C  CE2 . TYR A 1 113 ? 35.348  -10.244 -1.827  1.00 39.00  ? 188 TYR A CE2 1 
ATOM   905  C  CZ  . TYR A 1 113 ? 36.102  -11.072 -1.005  1.00 39.05  ? 188 TYR A CZ  1 
ATOM   906  O  OH  . TYR A 1 113 ? 37.360  -11.450 -1.390  1.00 39.94  ? 188 TYR A OH  1 
ATOM   907  N  N   . VAL A 1 114 ? 29.162  -11.858 0.890   1.00 34.35  ? 189 VAL A N   1 
ATOM   908  C  CA  . VAL A 1 114 ? 27.851  -11.711 1.491   1.00 33.13  ? 189 VAL A CA  1 
ATOM   909  C  C   . VAL A 1 114 ? 27.920  -11.392 2.979   1.00 31.79  ? 189 VAL A C   1 
ATOM   910  O  O   . VAL A 1 114 ? 28.755  -11.942 3.698   1.00 28.90  ? 189 VAL A O   1 
ATOM   911  C  CB  . VAL A 1 114 ? 27.013  -13.021 1.353   1.00 34.00  ? 189 VAL A CB  1 
ATOM   912  C  CG1 . VAL A 1 114 ? 25.595  -12.786 1.818   1.00 32.65  ? 189 VAL A CG1 1 
ATOM   913  C  CG2 . VAL A 1 114 ? 27.006  -13.487 -0.086  1.00 34.17  ? 189 VAL A CG2 1 
ATOM   914  N  N   . LYS A 1 115 ? 27.035  -10.494 3.417   1.00 31.47  ? 190 LYS A N   1 
ATOM   915  C  CA  . LYS A 1 115 ? 26.912  -10.146 4.827   1.00 32.98  ? 190 LYS A CA  1 
ATOM   916  C  C   . LYS A 1 115 ? 25.893  -11.165 5.362   1.00 33.28  ? 190 LYS A C   1 
ATOM   917  O  O   . LYS A 1 115 ? 24.680  -10.915 5.327   1.00 31.41  ? 190 LYS A O   1 
ATOM   918  C  CB  . LYS A 1 115 ? 26.335  -8.732  5.027   1.00 33.73  ? 190 LYS A CB  1 
ATOM   919  C  CG  . LYS A 1 115 ? 27.327  -7.570  4.924   1.00 34.05  ? 190 LYS A CG  1 
ATOM   920  C  CD  . LYS A 1 115 ? 27.781  -7.311  3.510   1.00 36.60  ? 190 LYS A CD  1 
ATOM   921  C  CE  . LYS A 1 115 ? 28.526  -5.993  3.445   1.00 38.41  ? 190 LYS A CE  1 
ATOM   922  N  NZ  . LYS A 1 115 ? 28.895  -5.678  2.051   1.00 39.39  ? 190 LYS A NZ  1 
ATOM   923  N  N   . ASP A 1 116 ? 26.382  -12.318 5.820   1.00 32.05  ? 191 ASP A N   1 
ATOM   924  C  CA  . ASP A 1 116 ? 25.517  -13.360 6.356   1.00 32.94  ? 191 ASP A CA  1 
ATOM   925  C  C   . ASP A 1 116 ? 25.042  -12.996 7.771   1.00 33.49  ? 191 ASP A C   1 
ATOM   926  O  O   . ASP A 1 116 ? 25.711  -13.311 8.760   1.00 33.23  ? 191 ASP A O   1 
ATOM   927  C  CB  . ASP A 1 116 ? 26.275  -14.695 6.393   1.00 34.48  ? 191 ASP A CB  1 
ATOM   928  C  CG  . ASP A 1 116 ? 25.380  -15.855 6.788   1.00 35.16  ? 191 ASP A CG  1 
ATOM   929  O  OD1 . ASP A 1 116 ? 24.252  -15.594 7.242   1.00 33.22  ? 191 ASP A OD1 1 
ATOM   930  O  OD2 . ASP A 1 116 ? 25.800  -17.036 6.649   1.00 38.34  ? 191 ASP A OD2 1 
ATOM   931  N  N   . LEU A 1 117 ? 23.882  -12.352 7.855   1.00 34.76  ? 192 LEU A N   1 
ATOM   932  C  CA  . LEU A 1 117 ? 23.310  -11.911 9.123   1.00 36.48  ? 192 LEU A CA  1 
ATOM   933  C  C   . LEU A 1 117 ? 23.149  -12.992 10.187  1.00 37.94  ? 192 LEU A C   1 
ATOM   934  O  O   . LEU A 1 117 ? 23.125  -12.683 11.377  1.00 36.62  ? 192 LEU A O   1 
ATOM   935  C  CB  . LEU A 1 117 ? 21.952  -11.257 8.882   1.00 35.75  ? 192 LEU A CB  1 
ATOM   936  C  CG  . LEU A 1 117 ? 21.878  -10.042 7.968   1.00 36.99  ? 192 LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1 117 ? 20.431  -9.560  7.960   1.00 36.09  ? 192 LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1 117 ? 22.837  -8.946  8.445   1.00 37.63  ? 192 LEU A CD2 1 
ATOM   939  N  N   . SER A 1 118 ? 23.040  -14.251 9.777   1.00 38.00  ? 193 SER A N   1 
ATOM   940  C  CA  . SER A 1 118 ? 22.856  -15.315 10.752  1.00 39.78  ? 193 SER A CA  1 
ATOM   941  C  C   . SER A 1 118 ? 24.128  -15.580 11.535  1.00 39.18  ? 193 SER A C   1 
ATOM   942  O  O   . SER A 1 118 ? 24.105  -16.254 12.563  1.00 42.31  ? 193 SER A O   1 
ATOM   943  C  CB  . SER A 1 118 ? 22.406  -16.606 10.059  1.00 39.85  ? 193 SER A CB  1 
ATOM   944  O  OG  . SER A 1 118 ? 23.509  -17.281 9.490   1.00 40.05  ? 193 SER A OG  1 
ATOM   945  N  N   . ARG A 1 119 ? 25.253  -15.068 11.059  1.00 40.69  ? 194 ARG A N   1 
ATOM   946  C  CA  . ARG A 1 119 ? 26.500  -15.287 11.784  1.00 42.41  ? 194 ARG A CA  1 
ATOM   947  C  C   . ARG A 1 119 ? 26.679  -14.234 12.874  1.00 41.15  ? 194 ARG A C   1 
ATOM   948  O  O   . ARG A 1 119 ? 27.569  -14.331 13.715  1.00 39.22  ? 194 ARG A O   1 
ATOM   949  C  CB  . ARG A 1 119 ? 27.674  -15.254 10.813  1.00 46.89  ? 194 ARG A CB  1 
ATOM   950  C  CG  . ARG A 1 119 ? 27.733  -16.473 9.912   1.00 52.68  ? 194 ARG A CG  1 
ATOM   951  C  CD  . ARG A 1 119 ? 28.931  -16.415 8.990   1.00 59.75  ? 194 ARG A CD  1 
ATOM   952  N  NE  . ARG A 1 119 ? 30.165  -16.124 9.716   1.00 68.09  ? 194 ARG A NE  1 
ATOM   953  C  CZ  . ARG A 1 119 ? 30.634  -16.856 10.720  1.00 71.89  ? 194 ARG A CZ  1 
ATOM   954  N  NH1 . ARG A 1 119 ? 29.972  -17.931 11.124  1.00 74.16  ? 194 ARG A NH1 1 
ATOM   955  N  NH2 . ARG A 1 119 ? 31.768  -16.511 11.317  1.00 74.43  ? 194 ARG A NH2 1 
ATOM   956  N  N   . LEU A 1 120 ? 25.818  -13.227 12.834  1.00 39.72  ? 195 LEU A N   1 
ATOM   957  C  CA  . LEU A 1 120 ? 25.833  -12.118 13.778  1.00 40.80  ? 195 LEU A CA  1 
ATOM   958  C  C   . LEU A 1 120 ? 25.642  -12.611 15.209  1.00 41.28  ? 195 LEU A C   1 
ATOM   959  O  O   . LEU A 1 120 ? 26.422  -12.290 16.096  1.00 41.06  ? 195 LEU A O   1 
ATOM   960  C  CB  . LEU A 1 120 ? 24.717  -11.145 13.411  1.00 38.19  ? 195 LEU A CB  1 
ATOM   961  C  CG  . LEU A 1 120 ? 25.012  -9.701  13.007  1.00 39.86  ? 195 LEU A CG  1 
ATOM   962  C  CD1 . LEU A 1 120 ? 26.349  -9.511  12.284  1.00 36.72  ? 195 LEU A CD1 1 
ATOM   963  C  CD2 . LEU A 1 120 ? 23.853  -9.265  12.148  1.00 38.72  ? 195 LEU A CD2 1 
ATOM   964  N  N   . GLY A 1 121 ? 24.590  -13.397 15.429  1.00 41.28  ? 196 GLY A N   1 
ATOM   965  C  CA  . GLY A 1 121 ? 24.325  -13.918 16.759  1.00 40.13  ? 196 GLY A CA  1 
ATOM   966  C  C   . GLY A 1 121 ? 23.200  -13.140 17.402  1.00 40.80  ? 196 GLY A C   1 
ATOM   967  O  O   . GLY A 1 121 ? 23.122  -13.021 18.614  1.00 40.88  ? 196 GLY A O   1 
ATOM   968  N  N   . ARG A 1 122 ? 22.335  -12.575 16.568  1.00 41.19  ? 197 ARG A N   1 
ATOM   969  C  CA  . ARG A 1 122 ? 21.192  -11.822 17.052  1.00 41.05  ? 197 ARG A CA  1 
ATOM   970  C  C   . ARG A 1 122 ? 19.941  -12.516 16.535  1.00 42.94  ? 197 ARG A C   1 
ATOM   971  O  O   . ARG A 1 122 ? 20.016  -13.357 15.632  1.00 42.95  ? 197 ARG A O   1 
ATOM   972  C  CB  . ARG A 1 122 ? 21.247  -10.387 16.532  1.00 40.96  ? 197 ARG A CB  1 
ATOM   973  C  CG  . ARG A 1 122 ? 22.412  -9.574  17.091  1.00 40.29  ? 197 ARG A CG  1 
ATOM   974  C  CD  . ARG A 1 122 ? 22.142  -9.152  18.541  1.00 39.32  ? 197 ARG A CD  1 
ATOM   975  N  NE  . ARG A 1 122 ? 23.276  -8.417  19.102  1.00 37.07  ? 197 ARG A NE  1 
ATOM   976  C  CZ  . ARG A 1 122 ? 24.403  -8.981  19.523  1.00 36.66  ? 197 ARG A CZ  1 
ATOM   977  N  NH1 . ARG A 1 122 ? 24.562  -10.304 19.456  1.00 34.78  ? 197 ARG A NH1 1 
ATOM   978  N  NH2 . ARG A 1 122 ? 25.376  -8.208  20.018  1.00 33.06  ? 197 ARG A NH2 1 
ATOM   979  N  N   . ASP A 1 123 ? 18.793  -12.175 17.112  1.00 42.81  ? 198 ASP A N   1 
ATOM   980  C  CA  . ASP A 1 123 ? 17.529  -12.748 16.689  1.00 41.26  ? 198 ASP A CA  1 
ATOM   981  C  C   . ASP A 1 123 ? 17.186  -12.014 15.400  1.00 41.51  ? 198 ASP A C   1 
ATOM   982  O  O   . ASP A 1 123 ? 16.952  -10.796 15.415  1.00 43.21  ? 198 ASP A O   1 
ATOM   983  C  CB  . ASP A 1 123 ? 16.473  -12.478 17.751  1.00 42.87  ? 198 ASP A CB  1 
ATOM   984  C  CG  . ASP A 1 123 ? 15.163  -13.181 17.464  1.00 43.70  ? 198 ASP A CG  1 
ATOM   985  O  OD1 . ASP A 1 123 ? 14.673  -13.090 16.311  1.00 42.23  ? 198 ASP A OD1 1 
ATOM   986  O  OD2 . ASP A 1 123 ? 14.623  -13.815 18.402  1.00 45.57  ? 198 ASP A OD2 1 
ATOM   987  N  N   . LEU A 1 124 ? 17.142  -12.734 14.283  1.00 40.88  ? 199 LEU A N   1 
ATOM   988  C  CA  . LEU A 1 124 ? 16.882  -12.073 13.014  1.00 39.82  ? 199 LEU A CA  1 
ATOM   989  C  C   . LEU A 1 124 ? 15.578  -11.308 12.963  1.00 39.80  ? 199 LEU A C   1 
ATOM   990  O  O   . LEU A 1 124 ? 15.409  -10.418 12.126  1.00 40.48  ? 199 LEU A O   1 
ATOM   991  C  CB  . LEU A 1 124 ? 16.984  -13.051 11.837  1.00 39.70  ? 199 LEU A CB  1 
ATOM   992  C  CG  . LEU A 1 124 ? 18.397  -13.615 11.638  1.00 40.25  ? 199 LEU A CG  1 
ATOM   993  C  CD1 . LEU A 1 124 ? 18.453  -14.531 10.416  1.00 38.09  ? 199 LEU A CD1 1 
ATOM   994  C  CD2 . LEU A 1 124 ? 19.398  -12.462 11.485  1.00 40.56  ? 199 LEU A CD2 1 
ATOM   995  N  N   . ARG A 1 125 ? 14.649  -11.628 13.857  1.00 40.25  ? 200 ARG A N   1 
ATOM   996  C  CA  . ARG A 1 125 ? 13.390  -10.885 13.887  1.00 39.93  ? 200 ARG A CA  1 
ATOM   997  C  C   . ARG A 1 125 ? 13.699  -9.446  14.322  1.00 39.25  ? 200 ARG A C   1 
ATOM   998  O  O   . ARG A 1 125 ? 12.904  -8.534  14.089  1.00 38.95  ? 200 ARG A O   1 
ATOM   999  C  CB  . ARG A 1 125 ? 12.408  -11.496 14.887  1.00 41.30  ? 200 ARG A CB  1 
ATOM   1000 C  CG  . ARG A 1 125 ? 11.945  -12.918 14.559  1.00 42.64  ? 200 ARG A CG  1 
ATOM   1001 C  CD  . ARG A 1 125 ? 12.160  -13.789 15.773  1.00 42.78  ? 200 ARG A CD  1 
ATOM   1002 N  NE  . ARG A 1 125 ? 10.963  -14.057 16.547  1.00 42.71  ? 200 ARG A NE  1 
ATOM   1003 C  CZ  . ARG A 1 125 ? 10.978  -14.625 17.749  1.00 44.67  ? 200 ARG A CZ  1 
ATOM   1004 N  NH1 . ARG A 1 125 ? 12.128  -14.957 18.320  1.00 44.91  ? 200 ARG A NH1 1 
ATOM   1005 N  NH2 . ARG A 1 125 ? 9.840   -14.920 18.359  1.00 47.51  ? 200 ARG A NH2 1 
ATOM   1006 N  N   . ARG A 1 126 ? 14.863  -9.256  14.942  1.00 38.25  ? 201 ARG A N   1 
ATOM   1007 C  CA  . ARG A 1 126 ? 15.287  -7.936  15.423  1.00 39.80  ? 201 ARG A CA  1 
ATOM   1008 C  C   . ARG A 1 126 ? 16.645  -7.510  14.847  1.00 39.50  ? 201 ARG A C   1 
ATOM   1009 O  O   . ARG A 1 126 ? 17.542  -7.047  15.567  1.00 36.94  ? 201 ARG A O   1 
ATOM   1010 C  CB  . ARG A 1 126 ? 15.317  -7.931  16.956  1.00 39.19  ? 201 ARG A CB  1 
ATOM   1011 C  CG  . ARG A 1 126 ? 13.945  -8.242  17.572  1.00 42.18  ? 201 ARG A CG  1 
ATOM   1012 C  CD  . ARG A 1 126 ? 13.944  -8.134  19.094  1.00 43.16  ? 201 ARG A CD  1 
ATOM   1013 N  NE  . ARG A 1 126 ? 14.041  -6.754  19.574  1.00 43.13  ? 201 ARG A NE  1 
ATOM   1014 C  CZ  . ARG A 1 126 ? 13.184  -5.783  19.269  1.00 43.21  ? 201 ARG A CZ  1 
ATOM   1015 N  NH1 . ARG A 1 126 ? 12.148  -6.019  18.478  1.00 43.66  ? 201 ARG A NH1 1 
ATOM   1016 N  NH2 . ARG A 1 126 ? 13.369  -4.560  19.744  1.00 42.90  ? 201 ARG A NH2 1 
ATOM   1017 N  N   . VAL A 1 127 ? 16.787  -7.697  13.537  1.00 38.41  ? 202 VAL A N   1 
ATOM   1018 C  CA  . VAL A 1 127 ? 18.000  -7.313  12.843  1.00 37.82  ? 202 VAL A CA  1 
ATOM   1019 C  C   . VAL A 1 127 ? 17.635  -6.686  11.501  1.00 37.78  ? 202 VAL A C   1 
ATOM   1020 O  O   . VAL A 1 127 ? 16.681  -7.116  10.847  1.00 39.49  ? 202 VAL A O   1 
ATOM   1021 C  CB  . VAL A 1 127 ? 18.919  -8.518  12.579  1.00 38.52  ? 202 VAL A CB  1 
ATOM   1022 C  CG1 . VAL A 1 127 ? 20.099  -8.077  11.725  1.00 36.95  ? 202 VAL A CG1 1 
ATOM   1023 C  CG2 . VAL A 1 127 ? 19.401  -9.126  13.900  1.00 36.77  ? 202 VAL A CG2 1 
ATOM   1024 N  N   . LEU A 1 128 ? 18.353  -5.637  11.126  1.00 36.87  ? 203 LEU A N   1 
ATOM   1025 C  CA  . LEU A 1 128 ? 18.142  -4.951  9.861   1.00 36.81  ? 203 LEU A CA  1 
ATOM   1026 C  C   . LEU A 1 128 ? 19.492  -4.677  9.214   1.00 36.42  ? 203 LEU A C   1 
ATOM   1027 O  O   . LEU A 1 128 ? 20.497  -4.544  9.904   1.00 33.68  ? 203 LEU A O   1 
ATOM   1028 C  CB  . LEU A 1 128 ? 17.440  -3.613  10.077  1.00 37.34  ? 203 LEU A CB  1 
ATOM   1029 C  CG  . LEU A 1 128 ? 15.999  -3.518  10.555  1.00 39.04  ? 203 LEU A CG  1 
ATOM   1030 C  CD1 . LEU A 1 128 ? 15.685  -2.025  10.770  1.00 39.65  ? 203 LEU A CD1 1 
ATOM   1031 C  CD2 . LEU A 1 128 ? 15.038  -4.122  9.525   1.00 37.25  ? 203 LEU A CD2 1 
ATOM   1032 N  N   . ILE A 1 129 ? 19.508  -4.621  7.888   1.00 36.49  ? 204 ILE A N   1 
ATOM   1033 C  CA  . ILE A 1 129 ? 20.734  -4.303  7.169   1.00 36.06  ? 204 ILE A CA  1 
ATOM   1034 C  C   . ILE A 1 129 ? 20.448  -3.176  6.191   1.00 36.01  ? 204 ILE A C   1 
ATOM   1035 O  O   . ILE A 1 129 ? 19.438  -3.204  5.484   1.00 36.90  ? 204 ILE A O   1 
ATOM   1036 C  CB  . ILE A 1 129 ? 21.303  -5.521  6.407   1.00 35.86  ? 204 ILE A CB  1 
ATOM   1037 C  CG1 . ILE A 1 129 ? 22.478  -5.078  5.526   1.00 34.87  ? 204 ILE A CG1 1 
ATOM   1038 C  CG2 . ILE A 1 129 ? 20.204  -6.198  5.569   1.00 35.71  ? 204 ILE A CG2 1 
ATOM   1039 C  CD1 . ILE A 1 129 ? 23.550  -6.138  5.325   1.00 32.92  ? 204 ILE A CD1 1 
ATOM   1040 N  N   . LEU A 1 130 ? 21.328  -2.179  6.192   1.00 35.26  ? 205 LEU A N   1 
ATOM   1041 C  CA  . LEU A 1 130 ? 21.216  -1.025  5.312   1.00 34.52  ? 205 LEU A CA  1 
ATOM   1042 C  C   . LEU A 1 130 ? 22.449  -1.097  4.424   1.00 36.24  ? 205 LEU A C   1 
ATOM   1043 O  O   . LEU A 1 130 ? 23.558  -0.784  4.859   1.00 34.11  ? 205 LEU A O   1 
ATOM   1044 C  CB  . LEU A 1 130 ? 21.228  0.273   6.126   1.00 34.67  ? 205 LEU A CB  1 
ATOM   1045 C  CG  . LEU A 1 130 ? 21.194  1.598   5.352   1.00 37.07  ? 205 LEU A CG  1 
ATOM   1046 C  CD1 . LEU A 1 130 ? 19.819  1.802   4.645   1.00 36.35  ? 205 LEU A CD1 1 
ATOM   1047 C  CD2 . LEU A 1 130 ? 21.452  2.734   6.335   1.00 35.55  ? 205 LEU A CD2 1 
ATOM   1048 N  N   . ASP A 1 131 ? 22.250  -1.555  3.191   1.00 35.30  ? 206 ASP A N   1 
ATOM   1049 C  CA  . ASP A 1 131 ? 23.352  -1.705  2.245   1.00 37.04  ? 206 ASP A CA  1 
ATOM   1050 C  C   . ASP A 1 131 ? 22.927  -1.248  0.846   1.00 36.55  ? 206 ASP A C   1 
ATOM   1051 O  O   . ASP A 1 131 ? 21.793  -1.479  0.440   1.00 37.56  ? 206 ASP A O   1 
ATOM   1052 C  CB  . ASP A 1 131 ? 23.772  -3.173  2.210   1.00 36.91  ? 206 ASP A CB  1 
ATOM   1053 C  CG  . ASP A 1 131 ? 25.161  -3.373  1.671   1.00 36.34  ? 206 ASP A CG  1 
ATOM   1054 O  OD1 . ASP A 1 131 ? 25.477  -2.867  0.575   1.00 38.26  ? 206 ASP A OD1 1 
ATOM   1055 O  OD2 . ASP A 1 131 ? 25.944  -4.060  2.348   1.00 38.82  ? 206 ASP A OD2 1 
ATOM   1056 N  N   . ASN A 1 132 ? 23.829  -0.603  0.117   1.00 35.86  ? 207 ASN A N   1 
ATOM   1057 C  CA  . ASN A 1 132 ? 23.526  -0.121  -1.237  1.00 37.52  ? 207 ASN A CA  1 
ATOM   1058 C  C   . ASN A 1 132 ? 23.547  -1.230  -2.308  1.00 37.90  ? 207 ASN A C   1 
ATOM   1059 O  O   . ASN A 1 132 ? 23.083  -1.015  -3.424  1.00 40.27  ? 207 ASN A O   1 
ATOM   1060 C  CB  . ASN A 1 132 ? 24.543  0.940   -1.653  1.00 36.04  ? 207 ASN A CB  1 
ATOM   1061 C  CG  . ASN A 1 132 ? 25.938  0.353   -1.790  1.00 35.36  ? 207 ASN A CG  1 
ATOM   1062 O  OD1 . ASN A 1 132 ? 26.576  -0.027  -0.796  1.00 34.79  ? 207 ASN A OD1 1 
ATOM   1063 N  ND2 . ASN A 1 132 ? 26.408  0.243   -3.027  1.00 32.82  ? 207 ASN A ND2 1 
ATOM   1064 N  N   . SER A 1 133 ? 24.130  -2.376  -1.975  1.00 37.02  ? 208 SER A N   1 
ATOM   1065 C  CA  . SER A 1 133 ? 24.235  -3.492  -2.904  1.00 39.30  ? 208 SER A CA  1 
ATOM   1066 C  C   . SER A 1 133 ? 23.371  -4.677  -2.488  1.00 38.83  ? 208 SER A C   1 
ATOM   1067 O  O   . SER A 1 133 ? 23.646  -5.342  -1.486  1.00 39.73  ? 208 SER A O   1 
ATOM   1068 C  CB  . SER A 1 133 ? 25.695  -3.939  -3.005  1.00 40.16  ? 208 SER A CB  1 
ATOM   1069 O  OG  . SER A 1 133 ? 25.816  -5.111  -3.774  1.00 41.65  ? 208 SER A OG  1 
ATOM   1070 N  N   . PRO A 1 134 ? 22.312  -4.972  -3.268  1.00 38.89  ? 209 PRO A N   1 
ATOM   1071 C  CA  . PRO A 1 134 ? 21.416  -6.090  -2.952  1.00 36.67  ? 209 PRO A CA  1 
ATOM   1072 C  C   . PRO A 1 134 ? 22.149  -7.422  -2.821  1.00 36.94  ? 209 PRO A C   1 
ATOM   1073 O  O   . PRO A 1 134 ? 21.722  -8.292  -2.077  1.00 35.90  ? 209 PRO A O   1 
ATOM   1074 C  CB  . PRO A 1 134 ? 20.433  -6.069  -4.119  1.00 38.95  ? 209 PRO A CB  1 
ATOM   1075 C  CG  . PRO A 1 134 ? 20.332  -4.595  -4.416  1.00 36.82  ? 209 PRO A CG  1 
ATOM   1076 C  CD  . PRO A 1 134 ? 21.790  -4.204  -4.415  1.00 38.82  ? 209 PRO A CD  1 
ATOM   1077 N  N   . ALA A 1 135 ? 23.261  -7.577  -3.530  1.00 37.40  ? 210 ALA A N   1 
ATOM   1078 C  CA  . ALA A 1 135 ? 24.035  -8.812  -3.444  1.00 37.93  ? 210 ALA A CA  1 
ATOM   1079 C  C   . ALA A 1 135 ? 24.598  -9.057  -2.043  1.00 38.47  ? 210 ALA A C   1 
ATOM   1080 O  O   . ALA A 1 135 ? 24.917  -10.195 -1.684  1.00 39.01  ? 210 ALA A O   1 
ATOM   1081 C  CB  . ALA A 1 135 ? 25.174  -8.793  -4.467  1.00 36.78  ? 210 ALA A CB  1 
ATOM   1082 N  N   . SER A 1 136 ? 24.712  -7.990  -1.256  1.00 38.46  ? 211 SER A N   1 
ATOM   1083 C  CA  . SER A 1 136 ? 25.251  -8.083  0.099   1.00 40.52  ? 211 SER A CA  1 
ATOM   1084 C  C   . SER A 1 136 ? 24.379  -8.907  1.032   1.00 40.42  ? 211 SER A C   1 
ATOM   1085 O  O   . SER A 1 136 ? 24.887  -9.584  1.920   1.00 42.25  ? 211 SER A O   1 
ATOM   1086 C  CB  . SER A 1 136 ? 25.410  -6.682  0.716   1.00 40.45  ? 211 SER A CB  1 
ATOM   1087 O  OG  . SER A 1 136 ? 26.304  -5.867  -0.011  1.00 42.53  ? 211 SER A OG  1 
ATOM   1088 N  N   . TYR A 1 137 ? 23.070  -8.819  0.848   1.00 41.49  ? 212 TYR A N   1 
ATOM   1089 C  CA  . TYR A 1 137 ? 22.141  -9.538  1.705   1.00 41.82  ? 212 TYR A CA  1 
ATOM   1090 C  C   . TYR A 1 137 ? 21.290  -10.575 0.968   1.00 42.46  ? 212 TYR A C   1 
ATOM   1091 O  O   . TYR A 1 137 ? 20.096  -10.718 1.243   1.00 40.28  ? 212 TYR A O   1 
ATOM   1092 C  CB  . TYR A 1 137 ? 21.241  -8.533  2.427   1.00 42.07  ? 212 TYR A CB  1 
ATOM   1093 C  CG  . TYR A 1 137 ? 20.630  -7.493  1.516   1.00 42.64  ? 212 TYR A CG  1 
ATOM   1094 C  CD1 . TYR A 1 137 ? 19.511  -7.787  0.724   1.00 43.99  ? 212 TYR A CD1 1 
ATOM   1095 C  CD2 . TYR A 1 137 ? 21.158  -6.207  1.451   1.00 44.56  ? 212 TYR A CD2 1 
ATOM   1096 C  CE1 . TYR A 1 137 ? 18.934  -6.821  -0.109  1.00 42.50  ? 212 TYR A CE1 1 
ATOM   1097 C  CE2 . TYR A 1 137 ? 20.585  -5.232  0.627   1.00 44.24  ? 212 TYR A CE2 1 
ATOM   1098 C  CZ  . TYR A 1 137 ? 19.475  -5.548  -0.150  1.00 44.12  ? 212 TYR A CZ  1 
ATOM   1099 O  OH  . TYR A 1 137 ? 18.931  -4.573  -0.959  1.00 43.79  ? 212 TYR A OH  1 
ATOM   1100 N  N   . VAL A 1 138 ? 21.915  -11.299 0.041   1.00 41.91  ? 213 VAL A N   1 
ATOM   1101 C  CA  . VAL A 1 138 ? 21.223  -12.333 -0.715  1.00 42.71  ? 213 VAL A CA  1 
ATOM   1102 C  C   . VAL A 1 138 ? 20.682  -13.414 0.219   1.00 42.59  ? 213 VAL A C   1 
ATOM   1103 O  O   . VAL A 1 138 ? 19.691  -14.061 -0.092  1.00 43.14  ? 213 VAL A O   1 
ATOM   1104 C  CB  . VAL A 1 138 ? 22.152  -12.980 -1.765  1.00 42.55  ? 213 VAL A CB  1 
ATOM   1105 C  CG1 . VAL A 1 138 ? 22.692  -11.925 -2.672  1.00 44.52  ? 213 VAL A CG1 1 
ATOM   1106 C  CG2 . VAL A 1 138 ? 23.302  -13.739 -1.104  1.00 42.26  ? 213 VAL A CG2 1 
ATOM   1107 N  N   . PHE A 1 139 ? 21.327  -13.601 1.369   1.00 42.81  ? 214 PHE A N   1 
ATOM   1108 C  CA  . PHE A 1 139 ? 20.881  -14.601 2.332   1.00 40.82  ? 214 PHE A CA  1 
ATOM   1109 C  C   . PHE A 1 139 ? 19.728  -14.145 3.223   1.00 41.38  ? 214 PHE A C   1 
ATOM   1110 O  O   . PHE A 1 139 ? 19.060  -14.975 3.835   1.00 41.61  ? 214 PHE A O   1 
ATOM   1111 C  CB  . PHE A 1 139 ? 22.037  -15.064 3.221   1.00 39.03  ? 214 PHE A CB  1 
ATOM   1112 C  CG  . PHE A 1 139 ? 23.135  -15.799 2.487   1.00 38.27  ? 214 PHE A CG  1 
ATOM   1113 C  CD1 . PHE A 1 139 ? 22.968  -16.221 1.166   1.00 37.82  ? 214 PHE A CD1 1 
ATOM   1114 C  CD2 . PHE A 1 139 ? 24.336  -16.086 3.131   1.00 35.94  ? 214 PHE A CD2 1 
ATOM   1115 C  CE1 . PHE A 1 139 ? 23.977  -16.915 0.499   1.00 36.58  ? 214 PHE A CE1 1 
ATOM   1116 C  CE2 . PHE A 1 139 ? 25.359  -16.785 2.472   1.00 37.68  ? 214 PHE A CE2 1 
ATOM   1117 C  CZ  . PHE A 1 139 ? 25.175  -17.200 1.148   1.00 37.10  ? 214 PHE A CZ  1 
ATOM   1118 N  N   . HIS A 1 140 ? 19.483  -12.840 3.298   1.00 42.50  ? 215 HIS A N   1 
ATOM   1119 C  CA  . HIS A 1 140 ? 18.413  -12.318 4.147   1.00 41.40  ? 215 HIS A CA  1 
ATOM   1120 C  C   . HIS A 1 140 ? 17.745  -11.089 3.553   1.00 42.97  ? 215 HIS A C   1 
ATOM   1121 O  O   . HIS A 1 140 ? 17.678  -10.038 4.200   1.00 43.95  ? 215 HIS A O   1 
ATOM   1122 C  CB  . HIS A 1 140 ? 18.962  -11.954 5.528   1.00 40.80  ? 215 HIS A CB  1 
ATOM   1123 C  CG  . HIS A 1 140 ? 19.799  -13.027 6.142   1.00 38.77  ? 215 HIS A CG  1 
ATOM   1124 N  ND1 . HIS A 1 140 ? 21.086  -13.285 5.732   1.00 37.54  ? 215 HIS A ND1 1 
ATOM   1125 C  CD2 . HIS A 1 140 ? 19.537  -13.908 7.138   1.00 38.82  ? 215 HIS A CD2 1 
ATOM   1126 C  CE1 . HIS A 1 140 ? 21.587  -14.277 6.449   1.00 36.57  ? 215 HIS A CE1 1 
ATOM   1127 N  NE2 . HIS A 1 140 ? 20.666  -14.673 7.309   1.00 38.95  ? 215 HIS A NE2 1 
ATOM   1128 N  N   . PRO A 1 141 ? 17.227  -11.207 2.319   1.00 44.74  ? 216 PRO A N   1 
ATOM   1129 C  CA  . PRO A 1 141 ? 16.564  -10.087 1.647   1.00 45.95  ? 216 PRO A CA  1 
ATOM   1130 C  C   . PRO A 1 141 ? 15.377  -9.516  2.418   1.00 46.31  ? 216 PRO A C   1 
ATOM   1131 O  O   . PRO A 1 141 ? 14.916  -8.416  2.120   1.00 48.22  ? 216 PRO A O   1 
ATOM   1132 C  CB  . PRO A 1 141 ? 16.137  -10.697 0.315   1.00 45.70  ? 216 PRO A CB  1 
ATOM   1133 C  CG  . PRO A 1 141 ? 15.821  -12.117 0.708   1.00 44.59  ? 216 PRO A CG  1 
ATOM   1134 C  CD  . PRO A 1 141 ? 17.021  -12.461 1.574   1.00 44.87  ? 216 PRO A CD  1 
ATOM   1135 N  N   . ASP A 1 142 ? 14.886  -10.267 3.402   1.00 47.16  ? 217 ASP A N   1 
ATOM   1136 C  CA  . ASP A 1 142 ? 13.749  -9.828  4.199   1.00 50.28  ? 217 ASP A CA  1 
ATOM   1137 C  C   . ASP A 1 142 ? 14.115  -9.009  5.433   1.00 50.78  ? 217 ASP A C   1 
ATOM   1138 O  O   . ASP A 1 142 ? 13.248  -8.710  6.260   1.00 49.61  ? 217 ASP A O   1 
ATOM   1139 C  CB  . ASP A 1 142 ? 12.897  -11.032 4.610   1.00 54.03  ? 217 ASP A CB  1 
ATOM   1140 C  CG  . ASP A 1 142 ? 12.236  -11.716 3.412   1.00 56.15  ? 217 ASP A CG  1 
ATOM   1141 O  OD1 . ASP A 1 142 ? 11.608  -10.995 2.594   1.00 55.77  ? 217 ASP A OD1 1 
ATOM   1142 O  OD2 . ASP A 1 142 ? 12.333  -12.956 3.283   1.00 58.72  ? 217 ASP A OD2 1 
ATOM   1143 N  N   . ASN A 1 143 ? 15.396  -8.662  5.562   1.00 47.74  ? 218 ASN A N   1 
ATOM   1144 C  CA  . ASN A 1 143 ? 15.862  -7.849  6.685   1.00 45.82  ? 218 ASN A CA  1 
ATOM   1145 C  C   . ASN A 1 143 ? 16.437  -6.571  6.117   1.00 44.80  ? 218 ASN A C   1 
ATOM   1146 O  O   . ASN A 1 143 ? 16.880  -5.684  6.849   1.00 43.47  ? 218 ASN A O   1 
ATOM   1147 C  CB  . ASN A 1 143 ? 16.970  -8.555  7.456   1.00 44.40  ? 218 ASN A CB  1 
ATOM   1148 C  CG  . ASN A 1 143 ? 16.492  -9.780  8.182   1.00 44.25  ? 218 ASN A CG  1 
ATOM   1149 O  OD1 . ASN A 1 143 ? 16.331  -10.851 7.589   1.00 45.21  ? 218 ASN A OD1 1 
ATOM   1150 N  ND2 . ASN A 1 143 ? 16.263  -9.638  9.488   1.00 39.19  ? 218 ASN A ND2 1 
ATOM   1151 N  N   . ALA A 1 144 ? 16.406  -6.474  4.800   1.00 45.06  ? 219 ALA A N   1 
ATOM   1152 C  CA  . ALA A 1 144 ? 17.000  -5.344  4.117   1.00 45.58  ? 219 ALA A CA  1 
ATOM   1153 C  C   . ALA A 1 144 ? 16.193  -4.086  3.946   1.00 46.34  ? 219 ALA A C   1 
ATOM   1154 O  O   . ALA A 1 144 ? 15.027  -4.118  3.558   1.00 46.28  ? 219 ALA A O   1 
ATOM   1155 C  CB  . ALA A 1 144 ? 17.511  -5.795  2.760   1.00 44.83  ? 219 ALA A CB  1 
ATOM   1156 N  N   . VAL A 1 145 ? 16.834  -2.961  4.240   1.00 46.38  ? 220 VAL A N   1 
ATOM   1157 C  CA  . VAL A 1 145 ? 16.229  -1.662  4.056   1.00 47.41  ? 220 VAL A CA  1 
ATOM   1158 C  C   . VAL A 1 145 ? 17.149  -1.093  2.980   1.00 49.23  ? 220 VAL A C   1 
ATOM   1159 O  O   . VAL A 1 145 ? 18.140  -0.431  3.282   1.00 54.31  ? 220 VAL A O   1 
ATOM   1160 C  CB  . VAL A 1 145 ? 16.324  -0.805  5.327   1.00 48.33  ? 220 VAL A CB  1 
ATOM   1161 C  CG1 . VAL A 1 145 ? 15.689  0.544   5.074   1.00 46.36  ? 220 VAL A CG1 1 
ATOM   1162 C  CG2 . VAL A 1 145 ? 15.654  -1.499  6.490   1.00 46.25  ? 220 VAL A CG2 1 
ATOM   1163 N  N   . PRO A 1 146 ? 16.831  -1.346  1.704   1.00 48.84  ? 221 PRO A N   1 
ATOM   1164 C  CA  . PRO A 1 146 ? 17.644  -0.866  0.587   1.00 48.75  ? 221 PRO A CA  1 
ATOM   1165 C  C   . PRO A 1 146 ? 17.829  0.641   0.557   1.00 47.35  ? 221 PRO A C   1 
ATOM   1166 O  O   . PRO A 1 146 ? 16.975  1.392   1.014   1.00 52.59  ? 221 PRO A O   1 
ATOM   1167 C  CB  . PRO A 1 146 ? 16.884  -1.384  -0.631  1.00 48.99  ? 221 PRO A CB  1 
ATOM   1168 C  CG  . PRO A 1 146 ? 15.458  -1.210  -0.187  1.00 46.73  ? 221 PRO A CG  1 
ATOM   1169 C  CD  . PRO A 1 146 ? 15.509  -1.789  1.223   1.00 49.15  ? 221 PRO A CD  1 
ATOM   1170 N  N   . VAL A 1 147 ? 18.961  1.068   0.014   1.00 46.22  ? 222 VAL A N   1 
ATOM   1171 C  CA  . VAL A 1 147 ? 19.289  2.481   -0.112  1.00 43.88  ? 222 VAL A CA  1 
ATOM   1172 C  C   . VAL A 1 147 ? 20.114  2.623   -1.391  1.00 43.48  ? 222 VAL A C   1 
ATOM   1173 O  O   . VAL A 1 147 ? 20.907  1.745   -1.729  1.00 43.08  ? 222 VAL A O   1 
ATOM   1174 C  CB  . VAL A 1 147 ? 20.101  2.968   1.123   1.00 44.98  ? 222 VAL A CB  1 
ATOM   1175 C  CG1 . VAL A 1 147 ? 21.352  2.110   1.296   1.00 41.32  ? 222 VAL A CG1 1 
ATOM   1176 C  CG2 . VAL A 1 147 ? 20.490  4.428   0.970   1.00 42.56  ? 222 VAL A CG2 1 
ATOM   1177 N  N   . ALA A 1 148 ? 19.925  3.715   -2.115  1.00 41.21  ? 223 ALA A N   1 
ATOM   1178 C  CA  . ALA A 1 148 ? 20.666  3.925   -3.350  1.00 41.23  ? 223 ALA A CA  1 
ATOM   1179 C  C   . ALA A 1 148 ? 22.170  4.167   -3.161  1.00 41.50  ? 223 ALA A C   1 
ATOM   1180 O  O   . ALA A 1 148 ? 22.599  4.771   -2.170  1.00 40.36  ? 223 ALA A O   1 
ATOM   1181 C  CB  . ALA A 1 148 ? 20.058  5.077   -4.108  1.00 39.84  ? 223 ALA A CB  1 
ATOM   1182 N  N   . SER A 1 149 ? 22.961  3.706   -4.126  1.00 39.42  ? 224 SER A N   1 
ATOM   1183 C  CA  . SER A 1 149 ? 24.407  3.888   -4.089  1.00 39.25  ? 224 SER A CA  1 
ATOM   1184 C  C   . SER A 1 149 ? 24.711  5.365   -4.255  1.00 39.32  ? 224 SER A C   1 
ATOM   1185 O  O   . SER A 1 149 ? 24.140  6.027   -5.125  1.00 40.10  ? 224 SER A O   1 
ATOM   1186 C  CB  . SER A 1 149 ? 25.101  3.108   -5.216  1.00 38.46  ? 224 SER A CB  1 
ATOM   1187 O  OG  . SER A 1 149 ? 24.820  1.725   -5.111  1.00 38.43  ? 224 SER A OG  1 
ATOM   1188 N  N   . TRP A 1 150 ? 25.619  5.878   -3.427  1.00 39.18  ? 225 TRP A N   1 
ATOM   1189 C  CA  . TRP A 1 150 ? 25.995  7.281   -3.495  1.00 38.22  ? 225 TRP A CA  1 
ATOM   1190 C  C   . TRP A 1 150 ? 27.449  7.394   -3.918  1.00 38.22  ? 225 TRP A C   1 
ATOM   1191 O  O   . TRP A 1 150 ? 28.293  6.606   -3.497  1.00 37.70  ? 225 TRP A O   1 
ATOM   1192 C  CB  . TRP A 1 150 ? 25.806  7.954   -2.128  1.00 37.61  ? 225 TRP A CB  1 
ATOM   1193 C  CG  . TRP A 1 150 ? 26.104  9.425   -2.137  1.00 37.03  ? 225 TRP A CG  1 
ATOM   1194 C  CD1 . TRP A 1 150 ? 25.284  10.431  -2.591  1.00 36.09  ? 225 TRP A CD1 1 
ATOM   1195 C  CD2 . TRP A 1 150 ? 27.319  10.059  -1.706  1.00 36.08  ? 225 TRP A CD2 1 
ATOM   1196 N  NE1 . TRP A 1 150 ? 25.917  11.653  -2.467  1.00 35.64  ? 225 TRP A NE1 1 
ATOM   1197 C  CE2 . TRP A 1 150 ? 27.166  11.451  -1.928  1.00 36.41  ? 225 TRP A CE2 1 
ATOM   1198 C  CE3 . TRP A 1 150 ? 28.519  9.586   -1.153  1.00 35.35  ? 225 TRP A CE3 1 
ATOM   1199 C  CZ2 . TRP A 1 150 ? 28.175  12.374  -1.616  1.00 36.01  ? 225 TRP A CZ2 1 
ATOM   1200 C  CZ3 . TRP A 1 150 ? 29.520  10.508  -0.837  1.00 33.66  ? 225 TRP A CZ3 1 
ATOM   1201 C  CH2 . TRP A 1 150 ? 29.336  11.885  -1.074  1.00 35.95  ? 225 TRP A CH2 1 
ATOM   1202 N  N   . PHE A 1 151 ? 27.751  8.404   -4.730  1.00 39.13  ? 226 PHE A N   1 
ATOM   1203 C  CA  . PHE A 1 151 ? 29.114  8.614   -5.181  1.00 41.48  ? 226 PHE A CA  1 
ATOM   1204 C  C   . PHE A 1 151 ? 29.613  10.027  -4.910  1.00 43.75  ? 226 PHE A C   1 
ATOM   1205 O  O   . PHE A 1 151 ? 30.705  10.207  -4.373  1.00 43.31  ? 226 PHE A O   1 
ATOM   1206 C  CB  . PHE A 1 151 ? 29.244  8.284   -6.666  1.00 41.16  ? 226 PHE A CB  1 
ATOM   1207 C  CG  . PHE A 1 151 ? 29.018  6.825   -6.976  1.00 40.47  ? 226 PHE A CG  1 
ATOM   1208 C  CD1 . PHE A 1 151 ? 27.727  6.305   -7.092  1.00 40.68  ? 226 PHE A CD1 1 
ATOM   1209 C  CD2 . PHE A 1 151 ? 30.098  5.958   -7.111  1.00 40.87  ? 226 PHE A CD2 1 
ATOM   1210 C  CE1 . PHE A 1 151 ? 27.523  4.938   -7.340  1.00 38.11  ? 226 PHE A CE1 1 
ATOM   1211 C  CE2 . PHE A 1 151 ? 29.899  4.591   -7.358  1.00 39.89  ? 226 PHE A CE2 1 
ATOM   1212 C  CZ  . PHE A 1 151 ? 28.602  4.090   -7.471  1.00 39.74  ? 226 PHE A CZ  1 
ATOM   1213 N  N   . ASP A 1 152 ? 28.821  11.030  -5.271  1.00 46.03  ? 227 ASP A N   1 
ATOM   1214 C  CA  . ASP A 1 152 ? 29.237  12.407  -5.028  1.00 48.42  ? 227 ASP A CA  1 
ATOM   1215 C  C   . ASP A 1 152 ? 28.128  13.437  -5.182  1.00 47.49  ? 227 ASP A C   1 
ATOM   1216 O  O   . ASP A 1 152 ? 28.399  14.635  -5.137  1.00 47.92  ? 227 ASP A O   1 
ATOM   1217 C  CB  . ASP A 1 152 ? 30.387  12.782  -5.961  1.00 50.42  ? 227 ASP A CB  1 
ATOM   1218 C  CG  . ASP A 1 152 ? 30.023  12.616  -7.428  1.00 52.38  ? 227 ASP A CG  1 
ATOM   1219 O  OD1 . ASP A 1 152 ? 28.817  12.607  -7.754  1.00 53.39  ? 227 ASP A OD1 1 
ATOM   1220 O  OD2 . ASP A 1 152 ? 30.953  12.511  -8.260  1.00 55.22  ? 227 ASP A OD2 1 
ATOM   1221 N  N   . ASN A 1 153 ? 26.895  12.975  -5.369  1.00 48.00  ? 228 ASN A N   1 
ATOM   1222 C  CA  . ASN A 1 153 ? 25.759  13.882  -5.521  1.00 48.79  ? 228 ASN A CA  1 
ATOM   1223 C  C   . ASN A 1 153 ? 25.467  14.600  -4.207  1.00 48.74  ? 228 ASN A C   1 
ATOM   1224 O  O   . ASN A 1 153 ? 24.764  14.080  -3.340  1.00 49.06  ? 228 ASN A O   1 
ATOM   1225 C  CB  . ASN A 1 153 ? 24.513  13.121  -5.983  1.00 49.81  ? 228 ASN A CB  1 
ATOM   1226 C  CG  . ASN A 1 153 ? 23.259  13.980  -5.924  1.00 50.32  ? 228 ASN A CG  1 
ATOM   1227 O  OD1 . ASN A 1 153 ? 23.316  15.197  -6.126  1.00 50.45  ? 228 ASN A OD1 1 
ATOM   1228 N  ND2 . ASN A 1 153 ? 22.123  13.353  -5.636  1.00 50.65  ? 228 ASN A ND2 1 
ATOM   1229 N  N   . MET A 1 154 ? 26.003  15.806  -4.067  1.00 49.07  ? 229 MET A N   1 
ATOM   1230 C  CA  . MET A 1 154 ? 25.811  16.573  -2.846  1.00 49.88  ? 229 MET A CA  1 
ATOM   1231 C  C   . MET A 1 154 ? 24.378  17.036  -2.637  1.00 49.99  ? 229 MET A C   1 
ATOM   1232 O  O   . MET A 1 154 ? 24.098  17.739  -1.672  1.00 50.64  ? 229 MET A O   1 
ATOM   1233 C  CB  . MET A 1 154 ? 26.760  17.770  -2.826  1.00 50.04  ? 229 MET A CB  1 
ATOM   1234 C  CG  . MET A 1 154 ? 28.220  17.369  -2.735  1.00 51.97  ? 229 MET A CG  1 
ATOM   1235 S  SD  . MET A 1 154 ? 28.474  16.281  -1.306  1.00 56.84  ? 229 MET A SD  1 
ATOM   1236 C  CE  . MET A 1 154 ? 28.412  17.510  0.071   1.00 57.96  ? 229 MET A CE  1 
ATOM   1237 N  N   . SER A 1 155 ? 23.470  16.648  -3.531  1.00 48.56  ? 230 SER A N   1 
ATOM   1238 C  CA  . SER A 1 155 ? 22.068  17.025  -3.371  1.00 48.90  ? 230 SER A CA  1 
ATOM   1239 C  C   . SER A 1 155 ? 21.305  15.856  -2.781  1.00 48.41  ? 230 SER A C   1 
ATOM   1240 O  O   . SER A 1 155 ? 20.103  15.947  -2.528  1.00 48.92  ? 230 SER A O   1 
ATOM   1241 C  CB  . SER A 1 155 ? 21.443  17.420  -4.707  1.00 49.52  ? 230 SER A CB  1 
ATOM   1242 O  OG  . SER A 1 155 ? 21.904  18.701  -5.079  1.00 50.81  ? 230 SER A OG  1 
ATOM   1243 N  N   . ASP A 1 156 ? 22.019  14.759  -2.555  1.00 47.24  ? 231 ASP A N   1 
ATOM   1244 C  CA  . ASP A 1 156 ? 21.417  13.558  -1.994  1.00 47.05  ? 231 ASP A CA  1 
ATOM   1245 C  C   . ASP A 1 156 ? 20.804  13.861  -0.641  1.00 46.46  ? 231 ASP A C   1 
ATOM   1246 O  O   . ASP A 1 156 ? 21.317  14.691  0.106   1.00 48.08  ? 231 ASP A O   1 
ATOM   1247 C  CB  . ASP A 1 156 ? 22.480  12.455  -1.857  1.00 46.37  ? 231 ASP A CB  1 
ATOM   1248 C  CG  . ASP A 1 156 ? 21.935  11.195  -1.222  1.00 44.14  ? 231 ASP A CG  1 
ATOM   1249 O  OD1 . ASP A 1 156 ? 21.796  11.154  0.021   1.00 45.60  ? 231 ASP A OD1 1 
ATOM   1250 O  OD2 . ASP A 1 156 ? 21.629  10.252  -1.973  1.00 43.04  ? 231 ASP A OD2 1 
ATOM   1251 N  N   . THR A 1 157 ? 19.700  13.191  -0.334  1.00 46.20  ? 232 THR A N   1 
ATOM   1252 C  CA  . THR A 1 157 ? 19.017  13.393  0.937   1.00 47.78  ? 232 THR A CA  1 
ATOM   1253 C  C   . THR A 1 157 ? 18.401  12.086  1.424   1.00 47.16  ? 232 THR A C   1 
ATOM   1254 O  O   . THR A 1 157 ? 17.561  12.071  2.330   1.00 48.48  ? 232 THR A O   1 
ATOM   1255 C  CB  . THR A 1 157 ? 17.884  14.452  0.810   1.00 48.03  ? 232 THR A CB  1 
ATOM   1256 O  OG1 . THR A 1 157 ? 16.891  13.982  -0.111  1.00 47.12  ? 232 THR A OG1 1 
ATOM   1257 C  CG2 . THR A 1 157 ? 18.437  15.769  0.304   1.00 46.08  ? 232 THR A CG2 1 
ATOM   1258 N  N   . GLU A 1 158 ? 18.832  10.982  0.827   1.00 47.28  ? 233 GLU A N   1 
ATOM   1259 C  CA  . GLU A 1 158 ? 18.309  9.682   1.188   1.00 48.00  ? 233 GLU A CA  1 
ATOM   1260 C  C   . GLU A 1 158 ? 18.478  9.324   2.666   1.00 46.57  ? 233 GLU A C   1 
ATOM   1261 O  O   . GLU A 1 158 ? 17.545  8.816   3.292   1.00 45.25  ? 233 GLU A O   1 
ATOM   1262 C  CB  . GLU A 1 158 ? 18.945  8.611   0.304   1.00 51.26  ? 233 GLU A CB  1 
ATOM   1263 C  CG  . GLU A 1 158 ? 18.371  7.213   0.532   1.00 56.59  ? 233 GLU A CG  1 
ATOM   1264 C  CD  . GLU A 1 158 ? 18.047  6.480   -0.766  1.00 59.05  ? 233 GLU A CD  1 
ATOM   1265 O  OE1 . GLU A 1 158 ? 18.883  6.482   -1.691  1.00 62.14  ? 233 GLU A OE1 1 
ATOM   1266 O  OE2 . GLU A 1 158 ? 16.951  5.890   -0.861  1.00 62.52  ? 233 GLU A OE2 1 
ATOM   1267 N  N   . LEU A 1 159 ? 19.654  9.587   3.229   1.00 44.75  ? 234 LEU A N   1 
ATOM   1268 C  CA  . LEU A 1 159 ? 19.877  9.247   4.630   1.00 44.83  ? 234 LEU A CA  1 
ATOM   1269 C  C   . LEU A 1 159 ? 18.936  10.033  5.532   1.00 45.67  ? 234 LEU A C   1 
ATOM   1270 O  O   . LEU A 1 159 ? 18.400  9.508   6.497   1.00 44.50  ? 234 LEU A O   1 
ATOM   1271 C  CB  . LEU A 1 159 ? 21.329  9.508   5.048   1.00 43.08  ? 234 LEU A CB  1 
ATOM   1272 C  CG  . LEU A 1 159 ? 22.396  8.630   4.389   1.00 40.79  ? 234 LEU A CG  1 
ATOM   1273 C  CD1 . LEU A 1 159 ? 23.764  8.957   4.985   1.00 40.56  ? 234 LEU A CD1 1 
ATOM   1274 C  CD2 . LEU A 1 159 ? 22.053  7.148   4.617   1.00 41.33  ? 234 LEU A CD2 1 
ATOM   1275 N  N   . HIS A 1 160 ? 18.741  11.300  5.206   1.00 46.42  ? 235 HIS A N   1 
ATOM   1276 C  CA  . HIS A 1 160 ? 17.860  12.171  5.972   1.00 49.28  ? 235 HIS A CA  1 
ATOM   1277 C  C   . HIS A 1 160 ? 16.417  11.665  5.905   1.00 49.54  ? 235 HIS A C   1 
ATOM   1278 O  O   . HIS A 1 160 ? 15.700  11.616  6.903   1.00 49.32  ? 235 HIS A O   1 
ATOM   1279 C  CB  . HIS A 1 160 ? 17.814  13.567  5.332   1.00 51.11  ? 235 HIS A CB  1 
ATOM   1280 C  CG  . HIS A 1 160 ? 16.954  14.539  6.082   1.00 54.46  ? 235 HIS A CG  1 
ATOM   1281 N  ND1 . HIS A 1 160 ? 15.750  14.986  5.648   1.00 53.20  ? 235 HIS A ND1 1 
ATOM   1282 C  CD2 . HIS A 1 160 ? 17.179  15.079  7.315   1.00 54.92  ? 235 HIS A CD2 1 
ATOM   1283 C  CE1 . HIS A 1 160 ? 15.246  15.774  6.608   1.00 54.42  ? 235 HIS A CE1 1 
ATOM   1284 N  NE2 . HIS A 1 160 ? 16.099  15.846  7.637   1.00 55.91  ? 235 HIS A NE2 1 
ATOM   1285 N  N   . ASP A 1 161 ? 15.984  11.333  4.697   1.00 49.62  ? 236 ASP A N   1 
ATOM   1286 C  CA  . ASP A 1 161 ? 14.613  10.902  4.495   1.00 49.95  ? 236 ASP A CA  1 
ATOM   1287 C  C   . ASP A 1 161 ? 14.314  9.505   5.008   1.00 48.98  ? 236 ASP A C   1 
ATOM   1288 O  O   . ASP A 1 161 ? 13.152  9.148   5.167   1.00 49.37  ? 236 ASP A O   1 
ATOM   1289 C  CB  . ASP A 1 161 ? 14.243  11.016  3.015   1.00 51.94  ? 236 ASP A CB  1 
ATOM   1290 C  CG  . ASP A 1 161 ? 14.552  12.393  2.445   1.00 52.62  ? 236 ASP A CG  1 
ATOM   1291 O  OD1 . ASP A 1 161 ? 14.588  13.375  3.221   1.00 53.17  ? 236 ASP A OD1 1 
ATOM   1292 O  OD2 . ASP A 1 161 ? 14.761  12.498  1.215   1.00 54.93  ? 236 ASP A OD2 1 
ATOM   1293 N  N   . LEU A 1 162 ? 15.349  8.716   5.278   1.00 48.34  ? 237 LEU A N   1 
ATOM   1294 C  CA  . LEU A 1 162 ? 15.138  7.364   5.792   1.00 47.77  ? 237 LEU A CA  1 
ATOM   1295 C  C   . LEU A 1 162 ? 14.853  7.341   7.291   1.00 47.41  ? 237 LEU A C   1 
ATOM   1296 O  O   . LEU A 1 162 ? 14.182  6.437   7.792   1.00 47.31  ? 237 LEU A O   1 
ATOM   1297 C  CB  . LEU A 1 162 ? 16.355  6.480   5.505   1.00 48.12  ? 237 LEU A CB  1 
ATOM   1298 C  CG  . LEU A 1 162 ? 16.426  5.837   4.121   1.00 48.33  ? 237 LEU A CG  1 
ATOM   1299 C  CD1 . LEU A 1 162 ? 17.711  5.038   3.978   1.00 47.45  ? 237 LEU A CD1 1 
ATOM   1300 C  CD2 . LEU A 1 162 ? 15.227  4.923   3.942   1.00 47.28  ? 237 LEU A CD2 1 
ATOM   1301 N  N   . LEU A 1 163 ? 15.353  8.342   8.005   1.00 48.03  ? 238 LEU A N   1 
ATOM   1302 C  CA  . LEU A 1 163 ? 15.170  8.403   9.451   1.00 48.89  ? 238 LEU A CA  1 
ATOM   1303 C  C   . LEU A 1 163 ? 13.731  8.170   9.911   1.00 49.95  ? 238 LEU A C   1 
ATOM   1304 O  O   . LEU A 1 163 ? 13.487  7.409   10.852  1.00 51.42  ? 238 LEU A O   1 
ATOM   1305 C  CB  . LEU A 1 163 ? 15.708  9.735   9.998   1.00 47.62  ? 238 LEU A CB  1 
ATOM   1306 C  CG  . LEU A 1 163 ? 17.240  9.790   10.109  1.00 46.38  ? 238 LEU A CG  1 
ATOM   1307 C  CD1 . LEU A 1 163 ? 17.725  11.193  10.412  1.00 45.70  ? 238 LEU A CD1 1 
ATOM   1308 C  CD2 . LEU A 1 163 ? 17.693  8.825   11.196  1.00 46.39  ? 238 LEU A CD2 1 
ATOM   1309 N  N   . PRO A 1 164 ? 12.752  8.816   9.258   1.00 50.14  ? 239 PRO A N   1 
ATOM   1310 C  CA  . PRO A 1 164 ? 11.373  8.590   9.697   1.00 51.02  ? 239 PRO A CA  1 
ATOM   1311 C  C   . PRO A 1 164 ? 11.049  7.101   9.699   1.00 51.52  ? 239 PRO A C   1 
ATOM   1312 O  O   . PRO A 1 164 ? 10.486  6.583   10.660  1.00 54.01  ? 239 PRO A O   1 
ATOM   1313 C  CB  . PRO A 1 164 ? 10.559  9.370   8.673   1.00 51.62  ? 239 PRO A CB  1 
ATOM   1314 C  CG  . PRO A 1 164 ? 11.466  10.536  8.367   1.00 49.21  ? 239 PRO A CG  1 
ATOM   1315 C  CD  . PRO A 1 164 ? 12.804  9.839   8.199   1.00 50.27  ? 239 PRO A CD  1 
ATOM   1316 N  N   . PHE A 1 165 ? 11.426  6.414   8.624   1.00 52.15  ? 240 PHE A N   1 
ATOM   1317 C  CA  . PHE A 1 165 ? 11.182  4.979   8.511   1.00 52.87  ? 240 PHE A CA  1 
ATOM   1318 C  C   . PHE A 1 165 ? 11.854  4.206   9.649   1.00 52.24  ? 240 PHE A C   1 
ATOM   1319 O  O   . PHE A 1 165 ? 11.220  3.375   10.305  1.00 50.25  ? 240 PHE A O   1 
ATOM   1320 C  CB  . PHE A 1 165 ? 11.699  4.461   7.167   1.00 55.55  ? 240 PHE A CB  1 
ATOM   1321 C  CG  . PHE A 1 165 ? 11.439  2.998   6.932   1.00 57.37  ? 240 PHE A CG  1 
ATOM   1322 C  CD1 . PHE A 1 165 ? 10.143  2.508   6.912   1.00 58.58  ? 240 PHE A CD1 1 
ATOM   1323 C  CD2 . PHE A 1 165 ? 12.490  2.112   6.729   1.00 59.35  ? 240 PHE A CD2 1 
ATOM   1324 C  CE1 . PHE A 1 165 ? 9.877   1.159   6.694   1.00 59.82  ? 240 PHE A CE1 1 
ATOM   1325 C  CE2 . PHE A 1 165 ? 12.250  0.751   6.508   1.00 60.21  ? 240 PHE A CE2 1 
ATOM   1326 C  CZ  . PHE A 1 165 ? 10.950  0.271   6.491   1.00 60.53  ? 240 PHE A CZ  1 
ATOM   1327 N  N   . PHE A 1 166 ? 13.136  4.476   9.880   1.00 51.00  ? 241 PHE A N   1 
ATOM   1328 C  CA  . PHE A 1 166 ? 13.864  3.790   10.946  1.00 50.11  ? 241 PHE A CA  1 
ATOM   1329 C  C   . PHE A 1 166 ? 13.256  4.107   12.302  1.00 50.24  ? 241 PHE A C   1 
ATOM   1330 O  O   . PHE A 1 166 ? 13.264  3.281   13.211  1.00 51.67  ? 241 PHE A O   1 
ATOM   1331 C  CB  . PHE A 1 166 ? 15.350  4.190   10.932  1.00 45.98  ? 241 PHE A CB  1 
ATOM   1332 C  CG  . PHE A 1 166 ? 16.163  3.464   9.895   1.00 41.26  ? 241 PHE A CG  1 
ATOM   1333 C  CD1 . PHE A 1 166 ? 16.404  2.101   10.010  1.00 39.23  ? 241 PHE A CD1 1 
ATOM   1334 C  CD2 . PHE A 1 166 ? 16.663  4.148   8.788   1.00 39.19  ? 241 PHE A CD2 1 
ATOM   1335 C  CE1 . PHE A 1 166 ? 17.128  1.426   9.042   1.00 38.08  ? 241 PHE A CE1 1 
ATOM   1336 C  CE2 . PHE A 1 166 ? 17.399  3.482   7.808   1.00 38.05  ? 241 PHE A CE2 1 
ATOM   1337 C  CZ  . PHE A 1 166 ? 17.630  2.115   7.936   1.00 38.05  ? 241 PHE A CZ  1 
ATOM   1338 N  N   . GLU A 1 167 ? 12.721  5.311   12.432  1.00 53.76  ? 242 GLU A N   1 
ATOM   1339 C  CA  . GLU A 1 167 ? 12.103  5.724   13.678  1.00 59.27  ? 242 GLU A CA  1 
ATOM   1340 C  C   . GLU A 1 167 ? 10.933  4.778   13.969  1.00 59.08  ? 242 GLU A C   1 
ATOM   1341 O  O   . GLU A 1 167 ? 10.732  4.343   15.098  1.00 61.36  ? 242 GLU A O   1 
ATOM   1342 C  CB  . GLU A 1 167 ? 11.613  7.166   13.544  1.00 64.18  ? 242 GLU A CB  1 
ATOM   1343 C  CG  . GLU A 1 167 ? 11.218  7.819   14.850  1.00 71.22  ? 242 GLU A CG  1 
ATOM   1344 C  CD  . GLU A 1 167 ? 12.415  8.191   15.706  1.00 76.42  ? 242 GLU A CD  1 
ATOM   1345 O  OE1 . GLU A 1 167 ? 13.245  9.014   15.250  1.00 80.72  ? 242 GLU A OE1 1 
ATOM   1346 O  OE2 . GLU A 1 167 ? 12.524  7.662   16.841  1.00 81.94  ? 242 GLU A OE2 1 
ATOM   1347 N  N   . GLN A 1 168 ? 10.174  4.456   12.927  1.00 60.02  ? 243 GLN A N   1 
ATOM   1348 C  CA  . GLN A 1 168 ? 9.021   3.562   13.030  1.00 62.08  ? 243 GLN A CA  1 
ATOM   1349 C  C   . GLN A 1 168 ? 9.435   2.121   13.311  1.00 58.31  ? 243 GLN A C   1 
ATOM   1350 O  O   . GLN A 1 168 ? 8.832   1.449   14.139  1.00 58.84  ? 243 GLN A O   1 
ATOM   1351 C  CB  . GLN A 1 168 ? 8.219   3.594   11.726  1.00 67.29  ? 243 GLN A CB  1 
ATOM   1352 C  CG  . GLN A 1 168 ? 7.098   2.566   11.667  1.00 77.30  ? 243 GLN A CG  1 
ATOM   1353 C  CD  . GLN A 1 168 ? 6.494   2.415   10.281  1.00 84.07  ? 243 GLN A CD  1 
ATOM   1354 O  OE1 . GLN A 1 168 ? 6.165   3.403   9.626   1.00 90.55  ? 243 GLN A OE1 1 
ATOM   1355 N  NE2 . GLN A 1 168 ? 6.334   1.171   9.834   1.00 89.70  ? 243 GLN A NE2 1 
ATOM   1356 N  N   . LEU A 1 169 ? 10.463  1.648   12.613  1.00 54.71  ? 244 LEU A N   1 
ATOM   1357 C  CA  . LEU A 1 169 ? 10.934  0.281   12.793  1.00 52.83  ? 244 LEU A CA  1 
ATOM   1358 C  C   . LEU A 1 169 ? 11.487  0.014   14.180  1.00 51.79  ? 244 LEU A C   1 
ATOM   1359 O  O   . LEU A 1 169 ? 11.347  -1.086  14.703  1.00 52.09  ? 244 LEU A O   1 
ATOM   1360 C  CB  . LEU A 1 169 ? 12.018  -0.060  11.762  1.00 51.89  ? 244 LEU A CB  1 
ATOM   1361 C  CG  . LEU A 1 169 ? 11.623  -0.235  10.300  1.00 50.51  ? 244 LEU A CG  1 
ATOM   1362 C  CD1 . LEU A 1 169 ? 12.843  -0.675  9.501   1.00 49.15  ? 244 LEU A CD1 1 
ATOM   1363 C  CD2 . LEU A 1 169 ? 10.517  -1.278  10.193  1.00 49.89  ? 244 LEU A CD2 1 
ATOM   1364 N  N   . SER A 1 170 ? 12.136  1.017   14.764  1.00 50.95  ? 245 SER A N   1 
ATOM   1365 C  CA  . SER A 1 170 ? 12.729  0.856   16.084  1.00 52.62  ? 245 SER A CA  1 
ATOM   1366 C  C   . SER A 1 170 ? 11.681  0.473   17.118  1.00 55.31  ? 245 SER A C   1 
ATOM   1367 O  O   . SER A 1 170 ? 12.010  -0.069  18.172  1.00 53.96  ? 245 SER A O   1 
ATOM   1368 C  CB  . SER A 1 170 ? 13.441  2.145   16.516  1.00 50.84  ? 245 SER A CB  1 
ATOM   1369 O  OG  . SER A 1 170 ? 12.533  3.217   16.657  1.00 48.48  ? 245 SER A OG  1 
ATOM   1370 N  N   . ARG A 1 171 ? 10.419  0.754   16.799  1.00 58.09  ? 246 ARG A N   1 
ATOM   1371 C  CA  . ARG A 1 171 ? 9.303   0.464   17.692  1.00 60.89  ? 246 ARG A CA  1 
ATOM   1372 C  C   . ARG A 1 171 ? 8.740   -0.956  17.584  1.00 59.69  ? 246 ARG A C   1 
ATOM   1373 O  O   . ARG A 1 171 ? 8.384   -1.552  18.600  1.00 58.90  ? 246 ARG A O   1 
ATOM   1374 C  CB  . ARG A 1 171 ? 8.179   1.480   17.460  1.00 65.67  ? 246 ARG A CB  1 
ATOM   1375 C  CG  . ARG A 1 171 ? 8.480   2.872   18.002  1.00 75.99  ? 246 ARG A CG  1 
ATOM   1376 C  CD  . ARG A 1 171 ? 7.472   3.895   17.491  1.00 84.85  ? 246 ARG A CD  1 
ATOM   1377 N  NE  . ARG A 1 171 ? 7.495   5.136   18.264  1.00 92.28  ? 246 ARG A NE  1 
ATOM   1378 C  CZ  . ARG A 1 171 ? 8.551   5.936   18.390  1.00 95.84  ? 246 ARG A CZ  1 
ATOM   1379 N  NH1 . ARG A 1 171 ? 9.695   5.637   17.789  1.00 98.28  ? 246 ARG A NH1 1 
ATOM   1380 N  NH2 . ARG A 1 171 ? 8.464   7.032   19.131  1.00 97.96  ? 246 ARG A NH2 1 
ATOM   1381 N  N   . VAL A 1 172 ? 8.658   -1.497  16.368  1.00 59.80  ? 247 VAL A N   1 
ATOM   1382 C  CA  . VAL A 1 172 ? 8.114   -2.841  16.175  1.00 59.25  ? 247 VAL A CA  1 
ATOM   1383 C  C   . VAL A 1 172 ? 8.958   -3.892  16.890  1.00 59.28  ? 247 VAL A C   1 
ATOM   1384 O  O   . VAL A 1 172 ? 10.110  -3.639  17.229  1.00 63.51  ? 247 VAL A O   1 
ATOM   1385 C  CB  . VAL A 1 172 ? 8.026   -3.219  14.677  1.00 59.32  ? 247 VAL A CB  1 
ATOM   1386 C  CG1 . VAL A 1 172 ? 7.340   -2.095  13.889  1.00 57.27  ? 247 VAL A CG1 1 
ATOM   1387 C  CG2 . VAL A 1 172 ? 9.409   -3.515  14.131  1.00 56.91  ? 247 VAL A CG2 1 
ATOM   1388 N  N   . ASP A 1 173 ? 8.380   -5.065  17.126  1.00 61.79  ? 248 ASP A N   1 
ATOM   1389 C  CA  . ASP A 1 173 ? 9.110   -6.143  17.809  1.00 64.43  ? 248 ASP A CA  1 
ATOM   1390 C  C   . ASP A 1 173 ? 9.530   -7.244  16.821  1.00 60.99  ? 248 ASP A C   1 
ATOM   1391 O  O   . ASP A 1 173 ? 10.225  -8.191  17.190  1.00 64.02  ? 248 ASP A O   1 
ATOM   1392 C  CB  . ASP A 1 173 ? 8.235   -6.722  18.920  1.00 70.71  ? 248 ASP A CB  1 
ATOM   1393 C  CG  . ASP A 1 173 ? 6.778   -6.726  18.519  1.00 72.17  ? 248 ASP A CG  1 
ATOM   1394 O  OD1 . ASP A 1 173 ? 6.514   -6.882  17.287  1.00 75.91  ? 248 ASP A OD1 1 
ATOM   1395 O  OD2 . ASP A 1 173 ? 5.913   -6.564  19.415  1.00 76.08  ? 248 ASP A OD2 1 
ATOM   1396 N  N   . ASP A 1 174 ? 9.112   -7.101  15.568  1.00 57.70  ? 249 ASP A N   1 
ATOM   1397 C  CA  . ASP A 1 174 ? 9.453   -8.051  14.512  1.00 56.42  ? 249 ASP A CA  1 
ATOM   1398 C  C   . ASP A 1 174 ? 9.503   -7.285  13.188  1.00 54.01  ? 249 ASP A C   1 
ATOM   1399 O  O   . ASP A 1 174 ? 8.468   -6.912  12.641  1.00 52.67  ? 249 ASP A O   1 
ATOM   1400 C  CB  . ASP A 1 174 ? 8.410   -9.166  14.439  1.00 58.39  ? 249 ASP A CB  1 
ATOM   1401 C  CG  . ASP A 1 174 ? 8.786   -10.254 13.442  1.00 58.68  ? 249 ASP A CG  1 
ATOM   1402 O  OD1 . ASP A 1 174 ? 9.711   -10.036 12.627  1.00 60.74  ? 249 ASP A OD1 1 
ATOM   1403 O  OD2 . ASP A 1 174 ? 8.154   -11.333 13.467  1.00 60.46  ? 249 ASP A OD2 1 
ATOM   1404 N  N   . VAL A 1 175 ? 10.717  -7.048  12.686  1.00 49.28  ? 250 VAL A N   1 
ATOM   1405 C  CA  . VAL A 1 175 ? 10.911  -6.303  11.443  1.00 46.48  ? 250 VAL A CA  1 
ATOM   1406 C  C   . VAL A 1 175 ? 10.223  -6.952  10.239  1.00 46.36  ? 250 VAL A C   1 
ATOM   1407 O  O   . VAL A 1 175 ? 9.775   -6.256  9.317   1.00 42.76  ? 250 VAL A O   1 
ATOM   1408 C  CB  . VAL A 1 175 ? 12.422  -6.128  11.125  1.00 45.38  ? 250 VAL A CB  1 
ATOM   1409 C  CG1 . VAL A 1 175 ? 13.104  -5.349  12.239  1.00 43.49  ? 250 VAL A CG1 1 
ATOM   1410 C  CG2 . VAL A 1 175 ? 13.084  -7.497  10.930  1.00 44.03  ? 250 VAL A CG2 1 
ATOM   1411 N  N   . TYR A 1 176 ? 10.146  -8.279  10.251  1.00 44.81  ? 251 TYR A N   1 
ATOM   1412 C  CA  . TYR A 1 176 ? 9.502   -8.999  9.161   1.00 46.31  ? 251 TYR A CA  1 
ATOM   1413 C  C   . TYR A 1 176 ? 8.050   -8.543  9.035   1.00 48.21  ? 251 TYR A C   1 
ATOM   1414 O  O   . TYR A 1 176 ? 7.519   -8.425  7.930   1.00 50.56  ? 251 TYR A O   1 
ATOM   1415 C  CB  . TYR A 1 176 ? 9.540   -10.509 9.413   1.00 42.26  ? 251 TYR A CB  1 
ATOM   1416 C  CG  . TYR A 1 176 ? 10.930  -11.115 9.419   1.00 40.00  ? 251 TYR A CG  1 
ATOM   1417 C  CD1 . TYR A 1 176 ? 11.859  -10.769 8.442   1.00 38.91  ? 251 TYR A CD1 1 
ATOM   1418 C  CD2 . TYR A 1 176 ? 11.298  -12.068 10.368  1.00 39.53  ? 251 TYR A CD2 1 
ATOM   1419 C  CE1 . TYR A 1 176 ? 13.120  -11.346 8.404   1.00 36.87  ? 251 TYR A CE1 1 
ATOM   1420 C  CE2 . TYR A 1 176 ? 12.566  -12.666 10.338  1.00 38.62  ? 251 TYR A CE2 1 
ATOM   1421 C  CZ  . TYR A 1 176 ? 13.471  -12.293 9.352   1.00 38.75  ? 251 TYR A CZ  1 
ATOM   1422 O  OH  . TYR A 1 176 ? 14.732  -12.861 9.325   1.00 38.52  ? 251 TYR A OH  1 
ATOM   1423 N  N   . SER A 1 177 ? 7.420   -8.268  10.173  1.00 51.23  ? 252 SER A N   1 
ATOM   1424 C  CA  . SER A 1 177 ? 6.028   -7.838  10.197  1.00 54.61  ? 252 SER A CA  1 
ATOM   1425 C  C   . SER A 1 177 ? 5.786   -6.633  9.309   1.00 56.69  ? 252 SER A C   1 
ATOM   1426 O  O   . SER A 1 177 ? 4.685   -6.454  8.791   1.00 60.13  ? 252 SER A O   1 
ATOM   1427 C  CB  . SER A 1 177 ? 5.605   -7.496  11.624  1.00 54.83  ? 252 SER A CB  1 
ATOM   1428 O  OG  . SER A 1 177 ? 6.003   -6.179  11.971  1.00 54.03  ? 252 SER A OG  1 
ATOM   1429 N  N   . VAL A 1 178 ? 6.812   -5.807  9.133   1.00 59.58  ? 253 VAL A N   1 
ATOM   1430 C  CA  . VAL A 1 178 ? 6.694   -4.606  8.307   1.00 62.83  ? 253 VAL A CA  1 
ATOM   1431 C  C   . VAL A 1 178 ? 7.482   -4.710  7.008   1.00 65.38  ? 253 VAL A C   1 
ATOM   1432 O  O   . VAL A 1 178 ? 7.210   -3.985  6.049   1.00 66.07  ? 253 VAL A O   1 
ATOM   1433 C  CB  . VAL A 1 178 ? 7.202   -3.382  9.063   1.00 62.36  ? 253 VAL A CB  1 
ATOM   1434 C  CG1 . VAL A 1 178 ? 6.277   -3.058  10.236  1.00 59.88  ? 253 VAL A CG1 1 
ATOM   1435 C  CG2 . VAL A 1 178 ? 8.607   -3.658  9.557   1.00 59.96  ? 253 VAL A CG2 1 
ATOM   1436 N  N   . LEU A 1 179 ? 8.453   -5.617  6.971   1.00 68.10  ? 254 LEU A N   1 
ATOM   1437 C  CA  . LEU A 1 179 ? 9.266   -5.792  5.774   1.00 72.22  ? 254 LEU A CA  1 
ATOM   1438 C  C   . LEU A 1 179 ? 8.808   -6.959  4.903   1.00 77.76  ? 254 LEU A C   1 
ATOM   1439 O  O   . LEU A 1 179 ? 9.432   -7.257  3.883   1.00 77.10  ? 254 LEU A O   1 
ATOM   1440 C  CB  . LEU A 1 179 ? 10.734  -5.973  6.161   1.00 68.16  ? 254 LEU A CB  1 
ATOM   1441 C  CG  . LEU A 1 179 ? 11.331  -4.721  6.809   1.00 65.58  ? 254 LEU A CG  1 
ATOM   1442 C  CD1 . LEU A 1 179 ? 12.679  -5.041  7.428   1.00 63.13  ? 254 LEU A CD1 1 
ATOM   1443 C  CD2 . LEU A 1 179 ? 11.456  -3.622  5.764   1.00 62.76  ? 254 LEU A CD2 1 
ATOM   1444 N  N   . ARG A 1 180 ? 7.719   -7.612  5.305   1.00 84.35  ? 255 ARG A N   1 
ATOM   1445 C  CA  . ARG A 1 180 ? 7.171   -8.739  4.551   1.00 91.55  ? 255 ARG A CA  1 
ATOM   1446 C  C   . ARG A 1 180 ? 8.128   -9.930  4.622   1.00 94.09  ? 255 ARG A C   1 
ATOM   1447 O  O   . ARG A 1 180 ? 9.284   -9.823  4.223   1.00 95.32  ? 255 ARG A O   1 
ATOM   1448 C  CB  . ARG A 1 180 ? 6.955   -8.321  3.088   1.00 94.33  ? 255 ARG A CB  1 
ATOM   1449 C  CG  . ARG A 1 180 ? 6.221   -9.329  2.228   1.00 100.65 ? 255 ARG A CG  1 
ATOM   1450 C  CD  . ARG A 1 180 ? 4.750   -9.405  2.594   1.00 106.95 ? 255 ARG A CD  1 
ATOM   1451 N  NE  . ARG A 1 180 ? 4.089   -10.526 1.933   1.00 112.85 ? 255 ARG A NE  1 
ATOM   1452 C  CZ  . ARG A 1 180 ? 2.807   -10.841 2.089   1.00 115.77 ? 255 ARG A CZ  1 
ATOM   1453 N  NH1 . ARG A 1 180 ? 2.035   -10.113 2.886   1.00 117.50 ? 255 ARG A NH1 1 
ATOM   1454 N  NH2 . ARG A 1 180 ? 2.305   -11.898 1.458   1.00 117.38 ? 255 ARG A NH2 1 
ATOM   1455 N  N   . GLN A 1 181 ? 7.647   -11.061 5.132   1.00 97.97  ? 256 GLN A N   1 
ATOM   1456 C  CA  . GLN A 1 181 ? 8.473   -12.265 5.252   1.00 102.45 ? 256 GLN A CA  1 
ATOM   1457 C  C   . GLN A 1 181 ? 7.666   -13.521 5.616   1.00 102.41 ? 256 GLN A C   1 
ATOM   1458 O  O   . GLN A 1 181 ? 7.376   -13.721 6.817   1.00 104.77 ? 256 GLN A O   1 
ATOM   1459 C  CB  . GLN A 1 181 ? 9.590   -12.035 6.278   1.00 107.37 ? 256 GLN A CB  1 
ATOM   1460 C  CG  . GLN A 1 181 ? 10.417  -13.276 6.633   1.00 112.04 ? 256 GLN A CG  1 
ATOM   1461 C  CD  . GLN A 1 181 ? 11.197  -13.865 5.468   1.00 115.02 ? 256 GLN A CD  1 
ATOM   1462 O  OE1 . GLN A 1 181 ? 10.626  -14.226 4.437   1.00 117.83 ? 256 GLN A OE1 1 
ATOM   1463 N  NE2 . GLN A 1 181 ? 12.515  -13.976 5.635   1.00 117.41 ? 256 GLN A NE2 1 
ATOM   1464 O  OXT . GLN A 1 181 ? 7.323   -14.296 4.691   1.00 102.17 ? 256 GLN A OXT 1 
ATOM   1465 N  N   . GLN B 1 2   ? -14.754 -46.651 -27.610 1.00 59.93  ? 77  GLN B N   1 
ATOM   1466 C  CA  . GLN B 1 2   ? -13.927 -46.640 -26.363 1.00 60.29  ? 77  GLN B CA  1 
ATOM   1467 C  C   . GLN B 1 2   ? -13.495 -45.253 -25.878 1.00 55.15  ? 77  GLN B C   1 
ATOM   1468 O  O   . GLN B 1 2   ? -12.452 -44.767 -26.294 1.00 56.49  ? 77  GLN B O   1 
ATOM   1469 C  CB  . GLN B 1 2   ? -12.677 -47.492 -26.581 1.00 67.32  ? 77  GLN B CB  1 
ATOM   1470 C  CG  . GLN B 1 2   ? -12.951 -48.971 -26.509 1.00 77.16  ? 77  GLN B CG  1 
ATOM   1471 C  CD  . GLN B 1 2   ? -13.500 -49.366 -25.151 1.00 82.76  ? 77  GLN B CD  1 
ATOM   1472 O  OE1 . GLN B 1 2   ? -12.798 -49.293 -24.142 1.00 88.35  ? 77  GLN B OE1 1 
ATOM   1473 N  NE2 . GLN B 1 2   ? -14.764 -49.773 -25.116 1.00 87.92  ? 77  GLN B NE2 1 
ATOM   1474 N  N   . TYR B 1 3   ? -14.271 -44.616 -25.007 1.00 48.31  ? 78  TYR B N   1 
ATOM   1475 C  CA  . TYR B 1 3   ? -13.877 -43.294 -24.515 1.00 42.36  ? 78  TYR B CA  1 
ATOM   1476 C  C   . TYR B 1 3   ? -12.587 -43.331 -23.700 1.00 38.76  ? 78  TYR B C   1 
ATOM   1477 O  O   . TYR B 1 3   ? -12.255 -44.335 -23.076 1.00 36.14  ? 78  TYR B O   1 
ATOM   1478 C  CB  . TYR B 1 3   ? -14.980 -42.690 -23.665 1.00 40.97  ? 78  TYR B CB  1 
ATOM   1479 C  CG  . TYR B 1 3   ? -16.175 -42.258 -24.453 1.00 38.49  ? 78  TYR B CG  1 
ATOM   1480 C  CD1 . TYR B 1 3   ? -16.092 -41.201 -25.357 1.00 38.61  ? 78  TYR B CD1 1 
ATOM   1481 C  CD2 . TYR B 1 3   ? -17.397 -42.913 -24.295 1.00 40.18  ? 78  TYR B CD2 1 
ATOM   1482 C  CE1 . TYR B 1 3   ? -17.217 -40.803 -26.095 1.00 39.56  ? 78  TYR B CE1 1 
ATOM   1483 C  CE2 . TYR B 1 3   ? -18.522 -42.530 -25.015 1.00 40.04  ? 78  TYR B CE2 1 
ATOM   1484 C  CZ  . TYR B 1 3   ? -18.431 -41.481 -25.912 1.00 40.67  ? 78  TYR B CZ  1 
ATOM   1485 O  OH  . TYR B 1 3   ? -19.561 -41.125 -26.623 1.00 41.73  ? 78  TYR B OH  1 
ATOM   1486 N  N   . LEU B 1 4   ? -11.867 -42.217 -23.713 1.00 34.69  ? 79  LEU B N   1 
ATOM   1487 C  CA  . LEU B 1 4   ? -10.620 -42.121 -22.980 1.00 33.98  ? 79  LEU B CA  1 
ATOM   1488 C  C   . LEU B 1 4   ? -10.811 -42.283 -21.478 1.00 34.14  ? 79  LEU B C   1 
ATOM   1489 O  O   . LEU B 1 4   ? -9.970  -42.857 -20.811 1.00 33.20  ? 79  LEU B O   1 
ATOM   1490 C  CB  . LEU B 1 4   ? -9.928  -40.785 -23.273 1.00 32.91  ? 79  LEU B CB  1 
ATOM   1491 C  CG  . LEU B 1 4   ? -9.361  -40.640 -24.686 1.00 31.66  ? 79  LEU B CG  1 
ATOM   1492 C  CD1 . LEU B 1 4   ? -8.770  -39.254 -24.864 1.00 32.85  ? 79  LEU B CD1 1 
ATOM   1493 C  CD2 . LEU B 1 4   ? -8.305  -41.700 -24.923 1.00 31.85  ? 79  LEU B CD2 1 
ATOM   1494 N  N   . LEU B 1 5   ? -11.923 -41.785 -20.941 1.00 32.96  ? 80  LEU B N   1 
ATOM   1495 C  CA  . LEU B 1 5   ? -12.168 -41.885 -19.510 1.00 33.66  ? 80  LEU B CA  1 
ATOM   1496 C  C   . LEU B 1 5   ? -13.294 -42.851 -19.179 1.00 35.61  ? 80  LEU B C   1 
ATOM   1497 O  O   . LEU B 1 5   ? -14.191 -43.077 -19.986 1.00 33.56  ? 80  LEU B O   1 
ATOM   1498 C  CB  . LEU B 1 5   ? -12.562 -40.518 -18.933 1.00 30.12  ? 80  LEU B CB  1 
ATOM   1499 C  CG  . LEU B 1 5   ? -11.691 -39.314 -19.251 1.00 29.28  ? 80  LEU B CG  1 
ATOM   1500 C  CD1 . LEU B 1 5   ? -12.443 -38.085 -18.822 1.00 28.13  ? 80  LEU B CD1 1 
ATOM   1501 C  CD2 . LEU B 1 5   ? -10.363 -39.413 -18.545 1.00 29.62  ? 80  LEU B CD2 1 
ATOM   1502 N  N   . PRO B 1 6   ? -13.244 -43.434 -17.977 1.00 37.91  ? 81  PRO B N   1 
ATOM   1503 C  CA  . PRO B 1 6   ? -14.253 -44.371 -17.468 1.00 40.00  ? 81  PRO B CA  1 
ATOM   1504 C  C   . PRO B 1 6   ? -15.443 -43.504 -17.071 1.00 39.78  ? 81  PRO B C   1 
ATOM   1505 O  O   . PRO B 1 6   ? -15.380 -42.284 -17.212 1.00 39.60  ? 81  PRO B O   1 
ATOM   1506 C  CB  . PRO B 1 6   ? -13.590 -44.958 -16.222 1.00 38.20  ? 81  PRO B CB  1 
ATOM   1507 C  CG  . PRO B 1 6   ? -12.119 -44.766 -16.475 1.00 39.55  ? 81  PRO B CG  1 
ATOM   1508 C  CD  . PRO B 1 6   ? -12.058 -43.415 -17.103 1.00 37.56  ? 81  PRO B CD  1 
ATOM   1509 N  N   . GLU B 1 7   ? -16.518 -44.117 -16.583 1.00 43.28  ? 82  GLU B N   1 
ATOM   1510 C  CA  . GLU B 1 7   ? -17.670 -43.347 -16.119 1.00 47.81  ? 82  GLU B CA  1 
ATOM   1511 C  C   . GLU B 1 7   ? -17.158 -42.546 -14.919 1.00 44.85  ? 82  GLU B C   1 
ATOM   1512 O  O   . GLU B 1 7   ? -16.290 -43.016 -14.193 1.00 43.48  ? 82  GLU B O   1 
ATOM   1513 C  CB  . GLU B 1 7   ? -18.781 -44.272 -15.637 1.00 57.90  ? 82  GLU B CB  1 
ATOM   1514 C  CG  . GLU B 1 7   ? -19.233 -45.300 -16.640 1.00 71.88  ? 82  GLU B CG  1 
ATOM   1515 C  CD  . GLU B 1 7   ? -20.225 -44.743 -17.626 1.00 81.00  ? 82  GLU B CD  1 
ATOM   1516 O  OE1 . GLU B 1 7   ? -19.870 -43.796 -18.355 1.00 89.37  ? 82  GLU B OE1 1 
ATOM   1517 O  OE2 . GLU B 1 7   ? -21.365 -45.253 -17.669 1.00 88.95  ? 82  GLU B OE2 1 
ATOM   1518 N  N   . ALA B 1 8   ? -17.699 -41.352 -14.699 1.00 42.23  ? 83  ALA B N   1 
ATOM   1519 C  CA  . ALA B 1 8   ? -17.249 -40.542 -13.569 1.00 40.52  ? 83  ALA B CA  1 
ATOM   1520 C  C   . ALA B 1 8   ? -17.755 -41.160 -12.274 1.00 39.16  ? 83  ALA B C   1 
ATOM   1521 O  O   . ALA B 1 8   ? -18.912 -41.577 -12.192 1.00 36.62  ? 83  ALA B O   1 
ATOM   1522 C  CB  . ALA B 1 8   ? -17.769 -39.119 -13.700 1.00 38.60  ? 83  ALA B CB  1 
ATOM   1523 N  N   . LYS B 1 9   ? -16.890 -41.225 -11.268 1.00 38.70  ? 84  LYS B N   1 
ATOM   1524 C  CA  . LYS B 1 9   ? -17.291 -41.777 -9.982  1.00 40.92  ? 84  LYS B CA  1 
ATOM   1525 C  C   . LYS B 1 9   ? -18.337 -40.858 -9.375  1.00 40.38  ? 84  LYS B C   1 
ATOM   1526 O  O   . LYS B 1 9   ? -18.427 -39.673 -9.742  1.00 37.56  ? 84  LYS B O   1 
ATOM   1527 C  CB  . LYS B 1 9   ? -16.089 -41.879 -9.046  1.00 44.86  ? 84  LYS B CB  1 
ATOM   1528 C  CG  . LYS B 1 9   ? -14.982 -42.786 -9.574  1.00 51.94  ? 84  LYS B CG  1 
ATOM   1529 C  CD  . LYS B 1 9   ? -13.876 -43.009 -8.554  1.00 59.69  ? 84  LYS B CD  1 
ATOM   1530 C  CE  . LYS B 1 9   ? -14.250 -44.099 -7.554  1.00 66.07  ? 84  LYS B CE  1 
ATOM   1531 N  NZ  . LYS B 1 9   ? -14.447 -45.422 -8.236  1.00 69.70  ? 84  LYS B NZ  1 
ATOM   1532 N  N   . ALA B 1 10  ? -19.134 -41.402 -8.455  1.00 38.48  ? 85  ALA B N   1 
ATOM   1533 C  CA  . ALA B 1 10  ? -20.201 -40.649 -7.803  1.00 39.22  ? 85  ALA B CA  1 
ATOM   1534 C  C   . ALA B 1 10  ? -19.797 -39.237 -7.370  1.00 39.05  ? 85  ALA B C   1 
ATOM   1535 O  O   . ALA B 1 10  ? -20.491 -38.280 -7.688  1.00 39.25  ? 85  ALA B O   1 
ATOM   1536 C  CB  . ALA B 1 10  ? -20.741 -41.441 -6.587  1.00 38.65  ? 85  ALA B CB  1 
ATOM   1537 N  N   . GLN B 1 11  ? -18.672 -39.110 -6.673  1.00 38.58  ? 86  GLN B N   1 
ATOM   1538 C  CA  . GLN B 1 11  ? -18.215 -37.808 -6.189  1.00 39.75  ? 86  GLN B CA  1 
ATOM   1539 C  C   . GLN B 1 11  ? -17.772 -36.826 -7.263  1.00 38.13  ? 86  GLN B C   1 
ATOM   1540 O  O   . GLN B 1 11  ? -17.436 -35.698 -6.940  1.00 39.32  ? 86  GLN B O   1 
ATOM   1541 C  CB  . GLN B 1 11  ? -17.048 -37.970 -5.216  1.00 41.32  ? 86  GLN B CB  1 
ATOM   1542 C  CG  . GLN B 1 11  ? -16.985 -39.308 -4.531  1.00 45.60  ? 86  GLN B CG  1 
ATOM   1543 C  CD  . GLN B 1 11  ? -16.264 -40.374 -5.344  1.00 44.85  ? 86  GLN B CD  1 
ATOM   1544 O  OE1 . GLN B 1 11  ? -15.055 -40.300 -5.574  1.00 45.09  ? 86  GLN B OE1 1 
ATOM   1545 N  NE2 . GLN B 1 11  ? -17.011 -41.377 -5.774  1.00 46.64  ? 86  GLN B NE2 1 
ATOM   1546 N  N   . ASP B 1 12  ? -17.748 -37.252 -8.520  1.00 37.24  ? 87  ASP B N   1 
ATOM   1547 C  CA  . ASP B 1 12  ? -17.300 -36.378 -9.606  1.00 37.26  ? 87  ASP B CA  1 
ATOM   1548 C  C   . ASP B 1 12  ? -18.329 -36.117 -10.717 1.00 38.09  ? 87  ASP B C   1 
ATOM   1549 O  O   . ASP B 1 12  ? -18.267 -35.089 -11.398 1.00 37.44  ? 87  ASP B O   1 
ATOM   1550 C  CB  . ASP B 1 12  ? -16.059 -36.972 -10.301 1.00 38.38  ? 87  ASP B CB  1 
ATOM   1551 C  CG  . ASP B 1 12  ? -14.834 -37.068 -9.393  1.00 39.00  ? 87  ASP B CG  1 
ATOM   1552 O  OD1 . ASP B 1 12  ? -14.590 -36.132 -8.584  1.00 40.07  ? 87  ASP B OD1 1 
ATOM   1553 O  OD2 . ASP B 1 12  ? -14.096 -38.082 -9.517  1.00 37.35  ? 87  ASP B OD2 1 
ATOM   1554 N  N   . SER B 1 13  ? -19.262 -37.044 -10.919 1.00 37.10  ? 88  SER B N   1 
ATOM   1555 C  CA  . SER B 1 13  ? -20.199 -36.919 -12.026 1.00 37.53  ? 88  SER B CA  1 
ATOM   1556 C  C   . SER B 1 13  ? -21.002 -35.634 -12.145 1.00 36.31  ? 88  SER B C   1 
ATOM   1557 O  O   . SER B 1 13  ? -21.402 -35.269 -13.233 1.00 37.24  ? 88  SER B O   1 
ATOM   1558 C  CB  . SER B 1 13  ? -21.138 -38.133 -12.063 1.00 37.81  ? 88  SER B CB  1 
ATOM   1559 O  OG  . SER B 1 13  ? -21.884 -38.240 -10.875 1.00 39.09  ? 88  SER B OG  1 
ATOM   1560 N  N   . ASP B 1 14  ? -21.241 -34.943 -11.053 1.00 35.64  ? 89  ASP B N   1 
ATOM   1561 C  CA  . ASP B 1 14  ? -22.014 -33.715 -11.137 1.00 34.94  ? 89  ASP B CA  1 
ATOM   1562 C  C   . ASP B 1 14  ? -21.128 -32.511 -11.385 1.00 33.01  ? 89  ASP B C   1 
ATOM   1563 O  O   . ASP B 1 14  ? -21.626 -31.426 -11.622 1.00 32.38  ? 89  ASP B O   1 
ATOM   1564 C  CB  . ASP B 1 14  ? -22.836 -33.492 -9.857  1.00 38.48  ? 89  ASP B CB  1 
ATOM   1565 C  CG  . ASP B 1 14  ? -24.108 -34.390 -9.791  1.00 41.43  ? 89  ASP B CG  1 
ATOM   1566 O  OD1 . ASP B 1 14  ? -24.461 -35.026 -10.813 1.00 39.53  ? 89  ASP B OD1 1 
ATOM   1567 O  OD2 . ASP B 1 14  ? -24.758 -34.447 -8.718  1.00 42.51  ? 89  ASP B OD2 1 
ATOM   1568 N  N   . LYS B 1 15  ? -19.820 -32.701 -11.335 1.00 29.00  ? 90  LYS B N   1 
ATOM   1569 C  CA  . LYS B 1 15  ? -18.866 -31.619 -11.533 1.00 28.73  ? 90  LYS B CA  1 
ATOM   1570 C  C   . LYS B 1 15  ? -18.413 -31.390 -12.974 1.00 27.88  ? 90  LYS B C   1 
ATOM   1571 O  O   . LYS B 1 15  ? -18.487 -32.283 -13.812 1.00 26.62  ? 90  LYS B O   1 
ATOM   1572 C  CB  . LYS B 1 15  ? -17.616 -31.881 -10.661 1.00 30.19  ? 90  LYS B CB  1 
ATOM   1573 C  CG  . LYS B 1 15  ? -17.935 -31.984 -9.166  1.00 30.74  ? 90  LYS B CG  1 
ATOM   1574 C  CD  . LYS B 1 15  ? -16.820 -32.639 -8.360  1.00 31.84  ? 90  LYS B CD  1 
ATOM   1575 C  CE  . LYS B 1 15  ? -15.765 -31.681 -7.907  1.00 32.62  ? 90  LYS B CE  1 
ATOM   1576 N  NZ  . LYS B 1 15  ? -14.784 -32.375 -6.999  1.00 34.30  ? 90  LYS B NZ  1 
ATOM   1577 N  N   . ILE B 1 16  ? -17.936 -30.175 -13.250 1.00 25.47  ? 91  ILE B N   1 
ATOM   1578 C  CA  . ILE B 1 16  ? -17.380 -29.835 -14.557 1.00 24.33  ? 91  ILE B CA  1 
ATOM   1579 C  C   . ILE B 1 16  ? -16.050 -30.592 -14.613 1.00 26.79  ? 91  ILE B C   1 
ATOM   1580 O  O   . ILE B 1 16  ? -15.350 -30.691 -13.592 1.00 27.05  ? 91  ILE B O   1 
ATOM   1581 C  CB  . ILE B 1 16  ? -17.056 -28.302 -14.656 1.00 25.26  ? 91  ILE B CB  1 
ATOM   1582 C  CG1 . ILE B 1 16  ? -18.354 -27.473 -14.700 1.00 26.13  ? 91  ILE B CG1 1 
ATOM   1583 C  CG2 . ILE B 1 16  ? -16.170 -28.009 -15.869 1.00 23.79  ? 91  ILE B CG2 1 
ATOM   1584 C  CD1 . ILE B 1 16  ? -19.325 -27.923 -15.759 1.00 28.27  ? 91  ILE B CD1 1 
ATOM   1585 N  N   . CYS B 1 17  ? -15.707 -31.130 -15.779 1.00 24.45  ? 92  CYS B N   1 
ATOM   1586 C  CA  . CYS B 1 17  ? -14.455 -31.843 -15.952 1.00 25.53  ? 92  CYS B CA  1 
ATOM   1587 C  C   . CYS B 1 17  ? -13.422 -30.878 -16.526 1.00 26.59  ? 92  CYS B C   1 
ATOM   1588 O  O   . CYS B 1 17  ? -13.692 -30.175 -17.510 1.00 28.40  ? 92  CYS B O   1 
ATOM   1589 C  CB  . CYS B 1 17  ? -14.621 -33.034 -16.906 1.00 26.34  ? 92  CYS B CB  1 
ATOM   1590 S  SG  . CYS B 1 17  ? -13.060 -33.845 -17.440 1.00 30.73  ? 92  CYS B SG  1 
ATOM   1591 N  N   . VAL B 1 18  ? -12.263 -30.780 -15.892 1.00 26.41  ? 93  VAL B N   1 
ATOM   1592 C  CA  . VAL B 1 18  ? -11.237 -29.904 -16.438 1.00 25.38  ? 93  VAL B CA  1 
ATOM   1593 C  C   . VAL B 1 18  ? -10.012 -30.725 -16.814 1.00 25.98  ? 93  VAL B C   1 
ATOM   1594 O  O   . VAL B 1 18  ? -9.520  -31.533 -16.014 1.00 24.21  ? 93  VAL B O   1 
ATOM   1595 C  CB  . VAL B 1 18  ? -10.802 -28.798 -15.466 1.00 26.76  ? 93  VAL B CB  1 
ATOM   1596 C  CG1 . VAL B 1 18  ? -9.759  -27.910 -16.139 1.00 25.37  ? 93  VAL B CG1 1 
ATOM   1597 C  CG2 . VAL B 1 18  ? -11.989 -27.933 -15.123 1.00 30.91  ? 93  VAL B CG2 1 
ATOM   1598 N  N   . VAL B 1 19  ? -9.556  -30.530 -18.048 1.00 25.07  ? 94  VAL B N   1 
ATOM   1599 C  CA  . VAL B 1 19  ? -8.395  -31.199 -18.581 1.00 25.77  ? 94  VAL B CA  1 
ATOM   1600 C  C   . VAL B 1 19  ? -7.240  -30.239 -18.339 1.00 26.31  ? 94  VAL B C   1 
ATOM   1601 O  O   . VAL B 1 19  ? -7.257  -29.094 -18.791 1.00 26.18  ? 94  VAL B O   1 
ATOM   1602 C  CB  . VAL B 1 19  ? -8.604  -31.506 -20.093 1.00 26.76  ? 94  VAL B CB  1 
ATOM   1603 C  CG1 . VAL B 1 19  ? -7.335  -31.873 -20.740 1.00 29.90  ? 94  VAL B CG1 1 
ATOM   1604 C  CG2 . VAL B 1 19  ? -9.605  -32.694 -20.223 1.00 28.11  ? 94  VAL B CG2 1 
ATOM   1605 N  N   . ILE B 1 20  ? -6.245  -30.711 -17.598 1.00 26.18  ? 95  ILE B N   1 
ATOM   1606 C  CA  . ILE B 1 20  ? -5.091  -29.898 -17.255 1.00 24.54  ? 95  ILE B CA  1 
ATOM   1607 C  C   . ILE B 1 20  ? -3.790  -30.425 -17.839 1.00 26.14  ? 95  ILE B C   1 
ATOM   1608 O  O   . ILE B 1 20  ? -3.415  -31.603 -17.656 1.00 25.45  ? 95  ILE B O   1 
ATOM   1609 C  CB  . ILE B 1 20  ? -4.943  -29.786 -15.718 1.00 25.68  ? 95  ILE B CB  1 
ATOM   1610 C  CG1 . ILE B 1 20  ? -6.185  -29.094 -15.148 1.00 28.15  ? 95  ILE B CG1 1 
ATOM   1611 C  CG2 . ILE B 1 20  ? -3.686  -28.983 -15.377 1.00 26.03  ? 95  ILE B CG2 1 
ATOM   1612 C  CD1 . ILE B 1 20  ? -6.326  -29.138 -13.619 1.00 25.40  ? 95  ILE B CD1 1 
ATOM   1613 N  N   . ASN B 1 21  ? -3.107  -29.528 -18.540 1.00 23.38  ? 96  ASN B N   1 
ATOM   1614 C  CA  . ASN B 1 21  ? -1.837  -29.815 -19.175 1.00 25.95  ? 96  ASN B CA  1 
ATOM   1615 C  C   . ASN B 1 21  ? -0.717  -29.848 -18.113 1.00 26.96  ? 96  ASN B C   1 
ATOM   1616 O  O   . ASN B 1 21  ? -0.876  -29.331 -17.001 1.00 25.14  ? 96  ASN B O   1 
ATOM   1617 C  CB  . ASN B 1 21  ? -1.535  -28.708 -20.176 1.00 27.93  ? 96  ASN B CB  1 
ATOM   1618 C  CG  . ASN B 1 21  ? -0.390  -29.044 -21.060 1.00 29.69  ? 96  ASN B CG  1 
ATOM   1619 O  OD1 . ASN B 1 21  ? 0.616   -28.325 -21.101 1.00 29.97  ? 96  ASN B OD1 1 
ATOM   1620 N  ND2 . ASN B 1 21  ? -0.514  -30.067 -21.758 1.00 27.96  ? 96  ASN B ND2 1 
ATOM   1621 N  N   . LEU B 1 22  ? 0.424   -30.446 -18.457 1.00 28.20  ? 97  LEU B N   1 
ATOM   1622 C  CA  . LEU B 1 22  ? 1.538   -30.510 -17.512 1.00 26.95  ? 97  LEU B CA  1 
ATOM   1623 C  C   . LEU B 1 22  ? 2.699   -29.558 -17.751 1.00 27.34  ? 97  LEU B C   1 
ATOM   1624 O  O   . LEU B 1 22  ? 2.907   -28.591 -16.986 1.00 27.20  ? 97  LEU B O   1 
ATOM   1625 C  CB  . LEU B 1 22  ? 2.089   -31.939 -17.451 1.00 30.19  ? 97  LEU B CB  1 
ATOM   1626 C  CG  . LEU B 1 22  ? 3.299   -32.178 -16.534 1.00 28.56  ? 97  LEU B CG  1 
ATOM   1627 C  CD1 . LEU B 1 22  ? 2.954   -31.776 -15.090 1.00 26.82  ? 97  LEU B CD1 1 
ATOM   1628 C  CD2 . LEU B 1 22  ? 3.718   -33.649 -16.615 1.00 29.20  ? 97  LEU B CD2 1 
ATOM   1629 N  N   . ASP B 1 23  ? 3.471   -29.824 -18.800 1.00 27.96  ? 98  ASP B N   1 
ATOM   1630 C  CA  . ASP B 1 23  ? 4.671   -29.016 -19.079 1.00 29.08  ? 98  ASP B CA  1 
ATOM   1631 C  C   . ASP B 1 23  ? 4.423   -27.618 -19.584 1.00 28.51  ? 98  ASP B C   1 
ATOM   1632 O  O   . ASP B 1 23  ? 3.670   -27.443 -20.507 1.00 25.14  ? 98  ASP B O   1 
ATOM   1633 C  CB  . ASP B 1 23  ? 5.592   -29.754 -20.050 1.00 32.30  ? 98  ASP B CB  1 
ATOM   1634 C  CG  . ASP B 1 23  ? 6.186   -31.010 -19.441 1.00 36.70  ? 98  ASP B CG  1 
ATOM   1635 O  OD1 . ASP B 1 23  ? 6.629   -30.962 -18.268 1.00 38.67  ? 98  ASP B OD1 1 
ATOM   1636 O  OD2 . ASP B 1 23  ? 6.227   -32.052 -20.138 1.00 40.01  ? 98  ASP B OD2 1 
ATOM   1637 N  N   . GLU B 1 24  ? 5.087   -26.634 -18.984 1.00 27.37  ? 99  GLU B N   1 
ATOM   1638 C  CA  . GLU B 1 24  ? 4.925   -25.231 -19.348 1.00 28.05  ? 99  GLU B CA  1 
ATOM   1639 C  C   . GLU B 1 24  ? 3.610   -24.679 -18.798 1.00 27.45  ? 99  GLU B C   1 
ATOM   1640 O  O   . GLU B 1 24  ? 3.327   -23.484 -18.940 1.00 29.48  ? 99  GLU B O   1 
ATOM   1641 C  CB  . GLU B 1 24  ? 5.012   -25.034 -20.876 1.00 30.15  ? 99  GLU B CB  1 
ATOM   1642 C  CG  . GLU B 1 24  ? 6.414   -25.203 -21.432 1.00 31.69  ? 99  GLU B CG  1 
ATOM   1643 C  CD  . GLU B 1 24  ? 6.914   -26.662 -21.446 1.00 35.15  ? 99  GLU B CD  1 
ATOM   1644 O  OE1 . GLU B 1 24  ? 6.505   -27.416 -22.360 1.00 34.84  ? 99  GLU B OE1 1 
ATOM   1645 O  OE2 . GLU B 1 24  ? 7.724   -27.062 -20.559 1.00 34.62  ? 99  GLU B OE2 1 
ATOM   1646 N  N   . THR B 1 25  ? 2.811   -25.552 -18.185 1.00 25.26  ? 100 THR B N   1 
ATOM   1647 C  CA  . THR B 1 25  ? 1.552   -25.149 -17.581 1.00 24.08  ? 100 THR B CA  1 
ATOM   1648 C  C   . THR B 1 25  ? 1.646   -25.242 -16.057 1.00 25.13  ? 100 THR B C   1 
ATOM   1649 O  O   . THR B 1 25  ? 1.347   -24.274 -15.365 1.00 24.41  ? 100 THR B O   1 
ATOM   1650 C  CB  . THR B 1 25  ? 0.359   -26.034 -18.064 1.00 27.37  ? 100 THR B CB  1 
ATOM   1651 O  OG1 . THR B 1 25  ? 0.133   -25.809 -19.466 1.00 26.15  ? 100 THR B OG1 1 
ATOM   1652 C  CG2 . THR B 1 25  ? -0.919  -25.702 -17.286 1.00 25.18  ? 100 THR B CG2 1 
ATOM   1653 N  N   . LEU B 1 26  ? 2.071   -26.398 -15.542 1.00 25.01  ? 101 LEU B N   1 
ATOM   1654 C  CA  . LEU B 1 26  ? 2.188   -26.616 -14.088 1.00 23.99  ? 101 LEU B CA  1 
ATOM   1655 C  C   . LEU B 1 26  ? 3.649   -26.692 -13.631 1.00 25.10  ? 101 LEU B C   1 
ATOM   1656 O  O   . LEU B 1 26  ? 3.974   -26.381 -12.474 1.00 25.94  ? 101 LEU B O   1 
ATOM   1657 C  CB  . LEU B 1 26  ? 1.500   -27.917 -13.691 1.00 24.83  ? 101 LEU B CB  1 
ATOM   1658 C  CG  . LEU B 1 26  ? -0.005  -28.017 -13.973 1.00 26.32  ? 101 LEU B CG  1 
ATOM   1659 C  CD1 . LEU B 1 26  ? -0.433  -29.412 -13.574 1.00 26.29  ? 101 LEU B CD1 1 
ATOM   1660 C  CD2 . LEU B 1 26  ? -0.792  -26.947 -13.207 1.00 24.07  ? 101 LEU B CD2 1 
ATOM   1661 N  N   . VAL B 1 27  ? 4.517   -27.128 -14.536 1.00 23.29  ? 102 VAL B N   1 
ATOM   1662 C  CA  . VAL B 1 27  ? 5.940   -27.265 -14.261 1.00 25.29  ? 102 VAL B CA  1 
ATOM   1663 C  C   . VAL B 1 27  ? 6.708   -27.071 -15.543 1.00 25.85  ? 102 VAL B C   1 
ATOM   1664 O  O   . VAL B 1 27  ? 6.125   -26.905 -16.619 1.00 26.57  ? 102 VAL B O   1 
ATOM   1665 C  CB  . VAL B 1 27  ? 6.318   -28.709 -13.779 1.00 24.86  ? 102 VAL B CB  1 
ATOM   1666 C  CG1 . VAL B 1 27  ? 5.510   -29.115 -12.554 1.00 22.52  ? 102 VAL B CG1 1 
ATOM   1667 C  CG2 . VAL B 1 27  ? 6.068   -29.687 -14.913 1.00 24.97  ? 102 VAL B CG2 1 
ATOM   1668 N  N   . HIS B 1 28  ? 8.024   -27.035 -15.410 1.00 25.43  ? 103 HIS B N   1 
ATOM   1669 C  CA  . HIS B 1 28  ? 8.904   -26.966 -16.560 1.00 26.07  ? 103 HIS B CA  1 
ATOM   1670 C  C   . HIS B 1 28  ? 10.068  -27.916 -16.241 1.00 27.05  ? 103 HIS B C   1 
ATOM   1671 O  O   . HIS B 1 28  ? 10.732  -27.781 -15.203 1.00 23.26  ? 103 HIS B O   1 
ATOM   1672 C  CB  . HIS B 1 28  ? 9.429   -25.563 -16.818 1.00 26.77  ? 103 HIS B CB  1 
ATOM   1673 C  CG  . HIS B 1 28  ? 10.426  -25.513 -17.935 1.00 29.52  ? 103 HIS B CG  1 
ATOM   1674 N  ND1 . HIS B 1 28  ? 10.156  -26.043 -19.180 1.00 31.18  ? 103 HIS B ND1 1 
ATOM   1675 C  CD2 . HIS B 1 28  ? 11.715  -25.077 -17.977 1.00 27.64  ? 103 HIS B CD2 1 
ATOM   1676 C  CE1 . HIS B 1 28  ? 11.235  -25.942 -19.938 1.00 29.94  ? 103 HIS B CE1 1 
ATOM   1677 N  NE2 . HIS B 1 28  ? 12.192  -25.362 -19.232 1.00 30.08  ? 103 HIS B NE2 1 
ATOM   1678 N  N   . SER B 1 29  ? 10.304  -28.868 -17.141 1.00 26.86  ? 104 SER B N   1 
ATOM   1679 C  CA  . SER B 1 29  ? 11.346  -29.871 -16.948 1.00 29.50  ? 104 SER B CA  1 
ATOM   1680 C  C   . SER B 1 29  ? 12.371  -29.784 -18.035 1.00 29.97  ? 104 SER B C   1 
ATOM   1681 O  O   . SER B 1 29  ? 12.074  -29.349 -19.141 1.00 31.87  ? 104 SER B O   1 
ATOM   1682 C  CB  . SER B 1 29  ? 10.734  -31.263 -16.936 1.00 27.35  ? 104 SER B CB  1 
ATOM   1683 O  OG  . SER B 1 29  ? 9.738   -31.337 -15.932 1.00 28.55  ? 104 SER B OG  1 
ATOM   1684 N  N   . SER B 1 30  ? 13.585  -30.214 -17.732 1.00 31.59  ? 105 SER B N   1 
ATOM   1685 C  CA  . SER B 1 30  ? 14.667  -30.142 -18.697 1.00 31.87  ? 105 SER B CA  1 
ATOM   1686 C  C   . SER B 1 30  ? 15.736  -31.179 -18.363 1.00 32.17  ? 105 SER B C   1 
ATOM   1687 O  O   . SER B 1 30  ? 15.814  -31.635 -17.227 1.00 30.87  ? 105 SER B O   1 
ATOM   1688 C  CB  . SER B 1 30  ? 15.263  -28.737 -18.635 1.00 32.50  ? 105 SER B CB  1 
ATOM   1689 O  OG  . SER B 1 30  ? 16.452  -28.652 -19.393 1.00 35.11  ? 105 SER B OG  1 
ATOM   1690 N  N   . PHE B 1 31  ? 16.512  -31.588 -19.367 1.00 32.79  ? 106 PHE B N   1 
ATOM   1691 C  CA  . PHE B 1 31  ? 17.599  -32.534 -19.156 1.00 33.81  ? 106 PHE B CA  1 
ATOM   1692 C  C   . PHE B 1 31  ? 18.804  -31.706 -18.718 1.00 32.97  ? 106 PHE B C   1 
ATOM   1693 O  O   . PHE B 1 31  ? 19.796  -32.234 -18.221 1.00 35.34  ? 106 PHE B O   1 
ATOM   1694 C  CB  . PHE B 1 31  ? 17.955  -33.257 -20.458 1.00 35.43  ? 106 PHE B CB  1 
ATOM   1695 C  CG  . PHE B 1 31  ? 17.101  -34.460 -20.754 1.00 36.36  ? 106 PHE B CG  1 
ATOM   1696 C  CD1 . PHE B 1 31  ? 16.996  -35.486 -19.833 1.00 37.19  ? 106 PHE B CD1 1 
ATOM   1697 C  CD2 . PHE B 1 31  ? 16.457  -34.598 -21.978 1.00 38.70  ? 106 PHE B CD2 1 
ATOM   1698 C  CE1 . PHE B 1 31  ? 16.266  -36.643 -20.113 1.00 39.15  ? 106 PHE B CE1 1 
ATOM   1699 C  CE2 . PHE B 1 31  ? 15.717  -35.766 -22.273 1.00 40.99  ? 106 PHE B CE2 1 
ATOM   1700 C  CZ  . PHE B 1 31  ? 15.626  -36.796 -21.323 1.00 38.91  ? 106 PHE B CZ  1 
ATOM   1701 N  N   . LYS B 1 32  ? 18.723  -30.402 -18.925 1.00 33.17  ? 107 LYS B N   1 
ATOM   1702 C  CA  . LYS B 1 32  ? 19.817  -29.530 -18.555 1.00 35.94  ? 107 LYS B CA  1 
ATOM   1703 C  C   . LYS B 1 32  ? 19.748  -29.333 -17.045 1.00 34.65  ? 107 LYS B C   1 
ATOM   1704 O  O   . LYS B 1 32  ? 18.740  -28.904 -16.502 1.00 32.71  ? 107 LYS B O   1 
ATOM   1705 C  CB  . LYS B 1 32  ? 19.716  -28.204 -19.305 1.00 43.70  ? 107 LYS B CB  1 
ATOM   1706 C  CG  . LYS B 1 32  ? 20.985  -27.367 -19.235 1.00 53.38  ? 107 LYS B CG  1 
ATOM   1707 C  CD  . LYS B 1 32  ? 21.079  -26.587 -17.916 1.00 61.97  ? 107 LYS B CD  1 
ATOM   1708 C  CE  . LYS B 1 32  ? 20.193  -25.345 -17.931 1.00 67.87  ? 107 LYS B CE  1 
ATOM   1709 N  NZ  . LYS B 1 32  ? 20.738  -24.337 -18.884 1.00 73.29  ? 107 LYS B NZ  1 
ATOM   1710 N  N   . PRO B 1 33  ? 20.822  -29.694 -16.347 1.00 32.01  ? 108 PRO B N   1 
ATOM   1711 C  CA  . PRO B 1 33  ? 20.896  -29.572 -14.885 1.00 30.92  ? 108 PRO B CA  1 
ATOM   1712 C  C   . PRO B 1 33  ? 20.456  -28.210 -14.336 1.00 31.36  ? 108 PRO B C   1 
ATOM   1713 O  O   . PRO B 1 33  ? 20.838  -27.155 -14.839 1.00 31.38  ? 108 PRO B O   1 
ATOM   1714 C  CB  . PRO B 1 33  ? 22.352  -29.921 -14.571 1.00 31.33  ? 108 PRO B CB  1 
ATOM   1715 C  CG  . PRO B 1 33  ? 23.074  -29.613 -15.833 1.00 34.70  ? 108 PRO B CG  1 
ATOM   1716 C  CD  . PRO B 1 33  ? 22.127  -30.061 -16.920 1.00 32.48  ? 108 PRO B CD  1 
ATOM   1717 N  N   . VAL B 1 34  ? 19.612  -28.257 -13.315 1.00 29.44  ? 109 VAL B N   1 
ATOM   1718 C  CA  . VAL B 1 34  ? 19.091  -27.065 -12.670 1.00 29.81  ? 109 VAL B CA  1 
ATOM   1719 C  C   . VAL B 1 34  ? 19.442  -27.101 -11.195 1.00 30.08  ? 109 VAL B C   1 
ATOM   1720 O  O   . VAL B 1 34  ? 19.180  -28.082 -10.513 1.00 26.62  ? 109 VAL B O   1 
ATOM   1721 C  CB  . VAL B 1 34  ? 17.541  -27.027 -12.787 1.00 31.40  ? 109 VAL B CB  1 
ATOM   1722 C  CG1 . VAL B 1 34  ? 16.950  -25.907 -11.916 1.00 31.45  ? 109 VAL B CG1 1 
ATOM   1723 C  CG2 . VAL B 1 34  ? 17.148  -26.852 -14.251 1.00 30.84  ? 109 VAL B CG2 1 
ATOM   1724 N  N   . ASN B 1 35  ? 20.031  -26.031 -10.693 1.00 30.45  ? 110 ASN B N   1 
ATOM   1725 C  CA  . ASN B 1 35  ? 20.343  -25.961 -9.298  1.00 30.95  ? 110 ASN B CA  1 
ATOM   1726 C  C   . ASN B 1 35  ? 19.062  -25.647 -8.518  1.00 30.46  ? 110 ASN B C   1 
ATOM   1727 O  O   . ASN B 1 35  ? 18.202  -24.883 -8.981  1.00 31.65  ? 110 ASN B O   1 
ATOM   1728 C  CB  . ASN B 1 35  ? 21.413  -24.898 -9.040  1.00 32.52  ? 110 ASN B CB  1 
ATOM   1729 C  CG  . ASN B 1 35  ? 21.902  -24.972 -7.599  1.00 34.18  ? 110 ASN B CG  1 
ATOM   1730 O  OD1 . ASN B 1 35  ? 21.748  -26.017 -6.919  1.00 33.38  ? 110 ASN B OD1 1 
ATOM   1731 N  ND2 . ASN B 1 35  ? 22.482  -23.885 -7.119  1.00 36.68  ? 110 ASN B ND2 1 
ATOM   1732 N  N   . ASN B 1 36  ? 18.925  -26.232 -7.341  1.00 29.73  ? 111 ASN B N   1 
ATOM   1733 C  CA  . ASN B 1 36  ? 17.744  -26.031 -6.498  1.00 30.89  ? 111 ASN B CA  1 
ATOM   1734 C  C   . ASN B 1 36  ? 16.393  -26.379 -7.182  1.00 30.24  ? 111 ASN B C   1 
ATOM   1735 O  O   . ASN B 1 36  ? 15.388  -25.684 -7.028  1.00 27.64  ? 111 ASN B O   1 
ATOM   1736 C  CB  . ASN B 1 36  ? 17.732  -24.593 -5.964  1.00 33.22  ? 111 ASN B CB  1 
ATOM   1737 C  CG  . ASN B 1 36  ? 16.758  -24.401 -4.822  1.00 36.22  ? 111 ASN B CG  1 
ATOM   1738 O  OD1 . ASN B 1 36  ? 16.601  -25.277 -3.967  1.00 35.89  ? 111 ASN B OD1 1 
ATOM   1739 N  ND2 . ASN B 1 36  ? 16.106  -23.238 -4.782  1.00 39.68  ? 111 ASN B ND2 1 
ATOM   1740 N  N   . ALA B 1 37  ? 16.390  -27.457 -7.939  1.00 28.55  ? 112 ALA B N   1 
ATOM   1741 C  CA  . ALA B 1 37  ? 15.191  -27.926 -8.608  1.00 27.25  ? 112 ALA B CA  1 
ATOM   1742 C  C   . ALA B 1 37  ? 14.168  -28.375 -7.566  1.00 27.53  ? 112 ALA B C   1 
ATOM   1743 O  O   . ALA B 1 37  ? 14.532  -28.675 -6.428  1.00 26.93  ? 112 ALA B O   1 
ATOM   1744 C  CB  . ALA B 1 37  ? 15.554  -29.062 -9.480  1.00 24.28  ? 112 ALA B CB  1 
ATOM   1745 N  N   . ASP B 1 38  ? 12.888  -28.414 -7.933  1.00 26.22  ? 113 ASP B N   1 
ATOM   1746 C  CA  . ASP B 1 38  ? 11.868  -28.876 -6.991  1.00 27.62  ? 113 ASP B CA  1 
ATOM   1747 C  C   . ASP B 1 38  ? 11.972  -30.389 -6.861  1.00 28.12  ? 113 ASP B C   1 
ATOM   1748 O  O   . ASP B 1 38  ? 11.773  -30.945 -5.771  1.00 26.95  ? 113 ASP B O   1 
ATOM   1749 C  CB  . ASP B 1 38  ? 10.478  -28.445 -7.443  1.00 28.05  ? 113 ASP B CB  1 
ATOM   1750 C  CG  . ASP B 1 38  ? 10.265  -26.963 -7.234  1.00 29.40  ? 113 ASP B CG  1 
ATOM   1751 O  OD1 . ASP B 1 38  ? 10.042  -26.580 -6.066  1.00 31.70  ? 113 ASP B OD1 1 
ATOM   1752 O  OD2 . ASP B 1 38  ? 10.386  -26.194 -8.203  1.00 28.62  ? 113 ASP B OD2 1 
ATOM   1753 N  N   . PHE B 1 39  ? 12.225  -31.054 -7.984  1.00 26.72  ? 114 PHE B N   1 
ATOM   1754 C  CA  . PHE B 1 39  ? 12.493  -32.487 -7.962  1.00 27.68  ? 114 PHE B CA  1 
ATOM   1755 C  C   . PHE B 1 39  ? 13.186  -32.955 -9.227  1.00 27.14  ? 114 PHE B C   1 
ATOM   1756 O  O   . PHE B 1 39  ? 13.295  -32.223 -10.218 1.00 24.34  ? 114 PHE B O   1 
ATOM   1757 C  CB  . PHE B 1 39  ? 11.274  -33.360 -7.576  1.00 31.73  ? 114 PHE B CB  1 
ATOM   1758 C  CG  . PHE B 1 39  ? 9.958   -32.899 -8.109  1.00 32.20  ? 114 PHE B CG  1 
ATOM   1759 C  CD1 . PHE B 1 39  ? 9.596   -33.157 -9.417  1.00 34.78  ? 114 PHE B CD1 1 
ATOM   1760 C  CD2 . PHE B 1 39  ? 9.027   -32.281 -7.267  1.00 33.56  ? 114 PHE B CD2 1 
ATOM   1761 C  CE1 . PHE B 1 39  ? 8.321   -32.816 -9.886  1.00 34.86  ? 114 PHE B CE1 1 
ATOM   1762 C  CE2 . PHE B 1 39  ? 7.733   -31.927 -7.723  1.00 36.75  ? 114 PHE B CE2 1 
ATOM   1763 C  CZ  . PHE B 1 39  ? 7.392   -32.201 -9.041  1.00 36.13  ? 114 PHE B CZ  1 
ATOM   1764 N  N   . ILE B 1 40  ? 13.788  -34.126 -9.119  1.00 26.52  ? 115 ILE B N   1 
ATOM   1765 C  CA  . ILE B 1 40  ? 14.554  -34.717 -10.191 1.00 25.90  ? 115 ILE B CA  1 
ATOM   1766 C  C   . ILE B 1 40  ? 14.052  -36.132 -10.396 1.00 28.57  ? 115 ILE B C   1 
ATOM   1767 O  O   . ILE B 1 40  ? 13.940  -36.901 -9.438  1.00 28.41  ? 115 ILE B O   1 
ATOM   1768 C  CB  . ILE B 1 40  ? 16.023  -34.747 -9.800  1.00 27.03  ? 115 ILE B CB  1 
ATOM   1769 C  CG1 . ILE B 1 40  ? 16.519  -33.303 -9.640  1.00 24.96  ? 115 ILE B CG1 1 
ATOM   1770 C  CG2 . ILE B 1 40  ? 16.848  -35.452 -10.880 1.00 25.40  ? 115 ILE B CG2 1 
ATOM   1771 C  CD1 . ILE B 1 40  ? 17.957  -33.195 -9.100  1.00 25.66  ? 115 ILE B CD1 1 
ATOM   1772 N  N   . ILE B 1 41  ? 13.727  -36.488 -11.633 1.00 28.26  ? 116 ILE B N   1 
ATOM   1773 C  CA  . ILE B 1 41  ? 13.245  -37.835 -11.856 1.00 30.59  ? 116 ILE B CA  1 
ATOM   1774 C  C   . ILE B 1 41  ? 14.126  -38.527 -12.874 1.00 30.16  ? 116 ILE B C   1 
ATOM   1775 O  O   . ILE B 1 41  ? 14.367  -38.019 -13.955 1.00 30.82  ? 116 ILE B O   1 
ATOM   1776 C  CB  . ILE B 1 41  ? 11.757  -37.846 -12.299 1.00 35.34  ? 116 ILE B CB  1 
ATOM   1777 C  CG1 . ILE B 1 41  ? 11.611  -37.147 -13.627 1.00 36.84  ? 116 ILE B CG1 1 
ATOM   1778 C  CG2 . ILE B 1 41  ? 10.858  -37.062 -11.267 1.00 32.42  ? 116 ILE B CG2 1 
ATOM   1779 C  CD1 . ILE B 1 41  ? 10.142  -36.983 -14.026 1.00 43.80  ? 116 ILE B CD1 1 
ATOM   1780 N  N   . PRO B 1 42  ? 14.691  -39.675 -12.503 1.00 30.67  ? 117 PRO B N   1 
ATOM   1781 C  CA  . PRO B 1 42  ? 15.548  -40.398 -13.431 1.00 32.55  ? 117 PRO B CA  1 
ATOM   1782 C  C   . PRO B 1 42  ? 14.660  -41.040 -14.510 1.00 33.65  ? 117 PRO B C   1 
ATOM   1783 O  O   . PRO B 1 42  ? 13.716  -41.764 -14.199 1.00 33.83  ? 117 PRO B O   1 
ATOM   1784 C  CB  . PRO B 1 42  ? 16.242  -41.422 -12.530 1.00 32.19  ? 117 PRO B CB  1 
ATOM   1785 C  CG  . PRO B 1 42  ? 15.221  -41.718 -11.527 1.00 32.30  ? 117 PRO B CG  1 
ATOM   1786 C  CD  . PRO B 1 42  ? 14.665  -40.339 -11.193 1.00 32.88  ? 117 PRO B CD  1 
ATOM   1787 N  N   . VAL B 1 43  ? 14.940  -40.753 -15.769 1.00 34.77  ? 118 VAL B N   1 
ATOM   1788 C  CA  . VAL B 1 43  ? 14.138  -41.330 -16.840 1.00 37.01  ? 118 VAL B CA  1 
ATOM   1789 C  C   . VAL B 1 43  ? 15.024  -42.216 -17.700 1.00 39.54  ? 118 VAL B C   1 
ATOM   1790 O  O   . VAL B 1 43  ? 16.053  -41.774 -18.219 1.00 39.91  ? 118 VAL B O   1 
ATOM   1791 C  CB  . VAL B 1 43  ? 13.484  -40.222 -17.709 1.00 36.69  ? 118 VAL B CB  1 
ATOM   1792 C  CG1 . VAL B 1 43  ? 12.662  -40.853 -18.840 1.00 36.43  ? 118 VAL B CG1 1 
ATOM   1793 C  CG2 . VAL B 1 43  ? 12.580  -39.341 -16.830 1.00 34.83  ? 118 VAL B CG2 1 
ATOM   1794 N  N   . GLU B 1 44  ? 14.619  -43.472 -17.843 1.00 42.82  ? 119 GLU B N   1 
ATOM   1795 C  CA  . GLU B 1 44  ? 15.398  -44.401 -18.646 1.00 47.20  ? 119 GLU B CA  1 
ATOM   1796 C  C   . GLU B 1 44  ? 14.993  -44.336 -20.105 1.00 47.69  ? 119 GLU B C   1 
ATOM   1797 O  O   . GLU B 1 44  ? 13.819  -44.458 -20.446 1.00 48.06  ? 119 GLU B O   1 
ATOM   1798 C  CB  . GLU B 1 44  ? 15.232  -45.830 -18.143 1.00 51.06  ? 119 GLU B CB  1 
ATOM   1799 C  CG  . GLU B 1 44  ? 16.184  -46.799 -18.802 1.00 58.83  ? 119 GLU B CG  1 
ATOM   1800 C  CD  . GLU B 1 44  ? 15.830  -48.238 -18.522 1.00 63.65  ? 119 GLU B CD  1 
ATOM   1801 O  OE1 . GLU B 1 44  ? 14.769  -48.694 -19.008 1.00 67.68  ? 119 GLU B OE1 1 
ATOM   1802 O  OE2 . GLU B 1 44  ? 16.610  -48.908 -17.805 1.00 67.23  ? 119 GLU B OE2 1 
ATOM   1803 N  N   . ILE B 1 45  ? 15.976  -44.126 -20.967 1.00 48.41  ? 120 ILE B N   1 
ATOM   1804 C  CA  . ILE B 1 45  ? 15.723  -44.052 -22.393 1.00 49.05  ? 120 ILE B CA  1 
ATOM   1805 C  C   . ILE B 1 45  ? 16.845  -44.825 -23.097 1.00 50.79  ? 120 ILE B C   1 
ATOM   1806 O  O   . ILE B 1 45  ? 18.037  -44.548 -22.880 1.00 51.19  ? 120 ILE B O   1 
ATOM   1807 C  CB  . ILE B 1 45  ? 15.692  -42.581 -22.861 1.00 47.45  ? 120 ILE B CB  1 
ATOM   1808 C  CG1 . ILE B 1 45  ? 14.609  -41.817 -22.078 1.00 45.99  ? 120 ILE B CG1 1 
ATOM   1809 C  CG2 . ILE B 1 45  ? 15.427  -42.522 -24.355 1.00 44.05  ? 120 ILE B CG2 1 
ATOM   1810 C  CD1 . ILE B 1 45  ? 14.609  -40.307 -22.306 1.00 44.18  ? 120 ILE B CD1 1 
ATOM   1811 N  N   . ASP B 1 46  ? 16.462  -45.801 -23.922 1.00 52.80  ? 121 ASP B N   1 
ATOM   1812 C  CA  . ASP B 1 46  ? 17.440  -46.629 -24.631 1.00 56.45  ? 121 ASP B CA  1 
ATOM   1813 C  C   . ASP B 1 46  ? 18.326  -47.314 -23.560 1.00 55.70  ? 121 ASP B C   1 
ATOM   1814 O  O   . ASP B 1 46  ? 19.554  -47.451 -23.738 1.00 57.30  ? 121 ASP B O   1 
ATOM   1815 C  CB  . ASP B 1 46  ? 18.391  -45.779 -25.493 1.00 61.67  ? 121 ASP B CB  1 
ATOM   1816 C  CG  . ASP B 1 46  ? 17.806  -45.352 -26.841 1.00 65.00  ? 121 ASP B CG  1 
ATOM   1817 O  OD1 . ASP B 1 46  ? 16.632  -45.656 -27.151 1.00 68.18  ? 121 ASP B OD1 1 
ATOM   1818 O  OD2 . ASP B 1 46  ? 18.577  -44.683 -27.540 1.00 69.03  ? 121 ASP B OD2 1 
ATOM   1819 N  N   . GLY B 1 47  ? 17.721  -47.709 -22.441 1.00 54.54  ? 122 GLY B N   1 
ATOM   1820 C  CA  . GLY B 1 47  ? 18.477  -48.352 -21.373 1.00 52.27  ? 122 GLY B CA  1 
ATOM   1821 C  C   . GLY B 1 47  ? 19.401  -47.439 -20.576 1.00 50.19  ? 122 GLY B C   1 
ATOM   1822 O  O   . GLY B 1 47  ? 19.990  -47.864 -19.574 1.00 51.27  ? 122 GLY B O   1 
ATOM   1823 N  N   . VAL B 1 48  ? 19.546  -46.195 -21.016 1.00 47.49  ? 123 VAL B N   1 
ATOM   1824 C  CA  . VAL B 1 48  ? 20.387  -45.240 -20.310 1.00 45.92  ? 123 VAL B CA  1 
ATOM   1825 C  C   . VAL B 1 48  ? 19.519  -44.329 -19.450 1.00 45.07  ? 123 VAL B C   1 
ATOM   1826 O  O   . VAL B 1 48  ? 18.548  -43.748 -19.928 1.00 44.41  ? 123 VAL B O   1 
ATOM   1827 C  CB  . VAL B 1 48  ? 21.204  -44.380 -21.286 1.00 46.91  ? 123 VAL B CB  1 
ATOM   1828 C  CG1 . VAL B 1 48  ? 21.990  -43.306 -20.518 1.00 45.07  ? 123 VAL B CG1 1 
ATOM   1829 C  CG2 . VAL B 1 48  ? 22.156  -45.274 -22.073 1.00 46.18  ? 123 VAL B CG2 1 
ATOM   1830 N  N   . VAL B 1 49  ? 19.863  -44.231 -18.169 1.00 43.64  ? 124 VAL B N   1 
ATOM   1831 C  CA  . VAL B 1 49  ? 19.116  -43.378 -17.250 1.00 40.51  ? 124 VAL B CA  1 
ATOM   1832 C  C   . VAL B 1 49  ? 19.601  -41.933 -17.323 1.00 38.88  ? 124 VAL B C   1 
ATOM   1833 O  O   . VAL B 1 49  ? 20.801  -41.667 -17.225 1.00 38.16  ? 124 VAL B O   1 
ATOM   1834 C  CB  . VAL B 1 49  ? 19.243  -43.876 -15.805 1.00 40.40  ? 124 VAL B CB  1 
ATOM   1835 C  CG1 . VAL B 1 49  ? 18.548  -42.905 -14.850 1.00 39.37  ? 124 VAL B CG1 1 
ATOM   1836 C  CG2 . VAL B 1 49  ? 18.628  -45.263 -15.691 1.00 39.53  ? 124 VAL B CG2 1 
ATOM   1837 N  N   . HIS B 1 50  ? 18.667  -41.008 -17.536 1.00 36.48  ? 125 HIS B N   1 
ATOM   1838 C  CA  . HIS B 1 50  ? 18.981  -39.578 -17.608 1.00 37.31  ? 125 HIS B CA  1 
ATOM   1839 C  C   . HIS B 1 50  ? 18.178  -38.861 -16.521 1.00 34.85  ? 125 HIS B C   1 
ATOM   1840 O  O   . HIS B 1 50  ? 17.042  -39.251 -16.214 1.00 33.69  ? 125 HIS B O   1 
ATOM   1841 C  CB  . HIS B 1 50  ? 18.600  -39.011 -18.982 1.00 39.70  ? 125 HIS B CB  1 
ATOM   1842 C  CG  . HIS B 1 50  ? 19.339  -39.643 -20.119 1.00 41.96  ? 125 HIS B CG  1 
ATOM   1843 N  ND1 . HIS B 1 50  ? 20.662  -39.360 -20.394 1.00 41.90  ? 125 HIS B ND1 1 
ATOM   1844 C  CD2 . HIS B 1 50  ? 18.951  -40.567 -21.030 1.00 41.19  ? 125 HIS B CD2 1 
ATOM   1845 C  CE1 . HIS B 1 50  ? 21.054  -40.085 -21.428 1.00 43.16  ? 125 HIS B CE1 1 
ATOM   1846 N  NE2 . HIS B 1 50  ? 20.034  -40.825 -21.832 1.00 42.63  ? 125 HIS B NE2 1 
ATOM   1847 N  N   . GLN B 1 51  ? 18.760  -37.819 -15.942 1.00 32.25  ? 126 GLN B N   1 
ATOM   1848 C  CA  . GLN B 1 51  ? 18.071  -37.070 -14.889 1.00 31.53  ? 126 GLN B CA  1 
ATOM   1849 C  C   . GLN B 1 51  ? 17.251  -35.935 -15.501 1.00 29.48  ? 126 GLN B C   1 
ATOM   1850 O  O   . GLN B 1 51  ? 17.772  -35.166 -16.298 1.00 30.80  ? 126 GLN B O   1 
ATOM   1851 C  CB  . GLN B 1 51  ? 19.096  -36.479 -13.912 1.00 30.50  ? 126 GLN B CB  1 
ATOM   1852 C  CG  . GLN B 1 51  ? 20.069  -37.494 -13.296 1.00 30.13  ? 126 GLN B CG  1 
ATOM   1853 C  CD  . GLN B 1 51  ? 19.349  -38.576 -12.476 1.00 30.72  ? 126 GLN B CD  1 
ATOM   1854 O  OE1 . GLN B 1 51  ? 18.158  -38.448 -12.101 1.00 30.91  ? 126 GLN B OE1 1 
ATOM   1855 N  NE2 . GLN B 1 51  ? 20.075  -39.659 -12.190 1.00 31.75  ? 126 GLN B NE2 1 
ATOM   1856 N  N   . VAL B 1 52  ? 15.982  -35.849 -15.139 1.00 27.92  ? 127 VAL B N   1 
ATOM   1857 C  CA  . VAL B 1 52  ? 15.105  -34.768 -15.627 1.00 26.86  ? 127 VAL B CA  1 
ATOM   1858 C  C   . VAL B 1 52  ? 14.850  -33.795 -14.458 1.00 26.30  ? 127 VAL B C   1 
ATOM   1859 O  O   . VAL B 1 52  ? 14.262  -34.155 -13.436 1.00 26.96  ? 127 VAL B O   1 
ATOM   1860 C  CB  . VAL B 1 52  ? 13.742  -35.322 -16.139 1.00 28.87  ? 127 VAL B CB  1 
ATOM   1861 C  CG1 . VAL B 1 52  ? 12.822  -34.157 -16.561 1.00 23.33  ? 127 VAL B CG1 1 
ATOM   1862 C  CG2 . VAL B 1 52  ? 13.983  -36.265 -17.341 1.00 24.87  ? 127 VAL B CG2 1 
ATOM   1863 N  N   . TYR B 1 53  ? 15.305  -32.557 -14.611 1.00 25.08  ? 128 TYR B N   1 
ATOM   1864 C  CA  . TYR B 1 53  ? 15.167  -31.576 -13.556 1.00 24.67  ? 128 TYR B CA  1 
ATOM   1865 C  C   . TYR B 1 53  ? 13.848  -30.817 -13.703 1.00 25.54  ? 128 TYR B C   1 
ATOM   1866 O  O   . TYR B 1 53  ? 13.588  -30.201 -14.738 1.00 27.30  ? 128 TYR B O   1 
ATOM   1867 C  CB  . TYR B 1 53  ? 16.355  -30.609 -13.604 1.00 26.10  ? 128 TYR B CB  1 
ATOM   1868 C  CG  . TYR B 1 53  ? 17.685  -31.295 -13.403 1.00 26.53  ? 128 TYR B CG  1 
ATOM   1869 C  CD1 . TYR B 1 53  ? 18.264  -32.055 -14.425 1.00 26.09  ? 128 TYR B CD1 1 
ATOM   1870 C  CD2 . TYR B 1 53  ? 18.358  -31.217 -12.168 1.00 27.64  ? 128 TYR B CD2 1 
ATOM   1871 C  CE1 . TYR B 1 53  ? 19.484  -32.727 -14.229 1.00 28.27  ? 128 TYR B CE1 1 
ATOM   1872 C  CE2 . TYR B 1 53  ? 19.562  -31.880 -11.955 1.00 25.05  ? 128 TYR B CE2 1 
ATOM   1873 C  CZ  . TYR B 1 53  ? 20.116  -32.629 -12.977 1.00 27.21  ? 128 TYR B CZ  1 
ATOM   1874 O  OH  . TYR B 1 53  ? 21.298  -33.299 -12.764 1.00 28.06  ? 128 TYR B OH  1 
ATOM   1875 N  N   . VAL B 1 54  ? 13.036  -30.844 -12.656 1.00 23.48  ? 129 VAL B N   1 
ATOM   1876 C  CA  . VAL B 1 54  ? 11.729  -30.226 -12.695 1.00 24.82  ? 129 VAL B CA  1 
ATOM   1877 C  C   . VAL B 1 54  ? 11.551  -29.044 -11.767 1.00 26.10  ? 129 VAL B C   1 
ATOM   1878 O  O   . VAL B 1 54  ? 11.893  -29.112 -10.577 1.00 24.38  ? 129 VAL B O   1 
ATOM   1879 C  CB  . VAL B 1 54  ? 10.644  -31.283 -12.355 1.00 25.82  ? 129 VAL B CB  1 
ATOM   1880 C  CG1 . VAL B 1 54  ? 9.216   -30.747 -12.660 1.00 24.71  ? 129 VAL B CG1 1 
ATOM   1881 C  CG2 . VAL B 1 54  ? 10.918  -32.557 -13.138 1.00 26.02  ? 129 VAL B CG2 1 
ATOM   1882 N  N   . LEU B 1 55  ? 11.037  -27.937 -12.322 1.00 23.94  ? 130 LEU B N   1 
ATOM   1883 C  CA  . LEU B 1 55  ? 10.705  -26.742 -11.537 1.00 23.18  ? 130 LEU B CA  1 
ATOM   1884 C  C   . LEU B 1 55  ? 9.177   -26.559 -11.523 1.00 24.86  ? 130 LEU B C   1 
ATOM   1885 O  O   . LEU B 1 55  ? 8.523   -26.670 -12.567 1.00 23.73  ? 130 LEU B O   1 
ATOM   1886 C  CB  . LEU B 1 55  ? 11.350  -25.489 -12.146 1.00 22.31  ? 130 LEU B CB  1 
ATOM   1887 C  CG  . LEU B 1 55  ? 12.858  -25.369 -12.003 1.00 26.00  ? 130 LEU B CG  1 
ATOM   1888 C  CD1 . LEU B 1 55  ? 13.362  -24.205 -12.869 1.00 28.86  ? 130 LEU B CD1 1 
ATOM   1889 C  CD2 . LEU B 1 55  ? 13.208  -25.150 -10.522 1.00 23.96  ? 130 LEU B CD2 1 
ATOM   1890 N  N   . LYS B 1 56  ? 8.621   -26.318 -10.338 1.00 22.44  ? 131 LYS B N   1 
ATOM   1891 C  CA  . LYS B 1 56  ? 7.192   -26.102 -10.178 1.00 25.99  ? 131 LYS B CA  1 
ATOM   1892 C  C   . LYS B 1 56  ? 6.820   -24.633 -10.403 1.00 25.64  ? 131 LYS B C   1 
ATOM   1893 O  O   . LYS B 1 56  ? 7.508   -23.716 -9.927  1.00 25.78  ? 131 LYS B O   1 
ATOM   1894 C  CB  . LYS B 1 56  ? 6.754   -26.486 -8.781  1.00 26.54  ? 131 LYS B CB  1 
ATOM   1895 C  CG  . LYS B 1 56  ? 6.947   -27.932 -8.404  1.00 27.14  ? 131 LYS B CG  1 
ATOM   1896 C  CD  . LYS B 1 56  ? 6.905   -28.073 -6.901  1.00 27.67  ? 131 LYS B CD  1 
ATOM   1897 C  CE  . LYS B 1 56  ? 5.535   -27.719 -6.363  1.00 29.76  ? 131 LYS B CE  1 
ATOM   1898 N  NZ  . LYS B 1 56  ? 5.440   -27.942 -4.876  1.00 28.29  ? 131 LYS B NZ  1 
ATOM   1899 N  N   . ARG B 1 57  ? 5.728   -24.402 -11.119 1.00 25.24  ? 132 ARG B N   1 
ATOM   1900 C  CA  . ARG B 1 57  ? 5.304   -23.027 -11.360 1.00 23.28  ? 132 ARG B CA  1 
ATOM   1901 C  C   . ARG B 1 57  ? 4.796   -22.513 -10.007 1.00 23.59  ? 132 ARG B C   1 
ATOM   1902 O  O   . ARG B 1 57  ? 4.208   -23.247 -9.216  1.00 20.92  ? 132 ARG B O   1 
ATOM   1903 C  CB  . ARG B 1 57  ? 4.177   -23.002 -12.390 1.00 25.35  ? 132 ARG B CB  1 
ATOM   1904 C  CG  . ARG B 1 57  ? 3.672   -21.628 -12.783 1.00 22.77  ? 132 ARG B CG  1 
ATOM   1905 C  CD  . ARG B 1 57  ? 2.620   -21.734 -13.876 1.00 26.37  ? 132 ARG B CD  1 
ATOM   1906 N  NE  . ARG B 1 57  ? 2.435   -20.464 -14.584 1.00 25.70  ? 132 ARG B NE  1 
ATOM   1907 C  CZ  . ARG B 1 57  ? 2.021   -20.395 -15.840 1.00 28.26  ? 132 ARG B CZ  1 
ATOM   1908 N  NH1 . ARG B 1 57  ? 1.729   -21.518 -16.502 1.00 25.07  ? 132 ARG B NH1 1 
ATOM   1909 N  NH2 . ARG B 1 57  ? 1.971   -19.222 -16.454 1.00 29.94  ? 132 ARG B NH2 1 
ATOM   1910 N  N   . PRO B 1 58  ? 5.033   -21.235 -9.699  1.00 26.19  ? 133 PRO B N   1 
ATOM   1911 C  CA  . PRO B 1 58  ? 4.561   -20.690 -8.418  1.00 24.97  ? 133 PRO B CA  1 
ATOM   1912 C  C   . PRO B 1 58  ? 3.047   -20.880 -8.231  1.00 26.47  ? 133 PRO B C   1 
ATOM   1913 O  O   . PRO B 1 58  ? 2.294   -20.808 -9.186  1.00 25.10  ? 133 PRO B O   1 
ATOM   1914 C  CB  . PRO B 1 58  ? 4.930   -19.215 -8.527  1.00 26.85  ? 133 PRO B CB  1 
ATOM   1915 C  CG  . PRO B 1 58  ? 6.199   -19.285 -9.277  1.00 27.24  ? 133 PRO B CG  1 
ATOM   1916 C  CD  . PRO B 1 58  ? 5.874   -20.253 -10.397 1.00 25.64  ? 133 PRO B CD  1 
ATOM   1917 N  N   . HIS B 1 59  ? 2.638   -21.100 -6.989  1.00 23.39  ? 134 HIS B N   1 
ATOM   1918 C  CA  . HIS B 1 59  ? 1.269   -21.326 -6.565  1.00 26.55  ? 134 HIS B CA  1 
ATOM   1919 C  C   . HIS B 1 59  ? 0.606   -22.591 -7.106  1.00 25.38  ? 134 HIS B C   1 
ATOM   1920 O  O   . HIS B 1 59  ? -0.598  -22.739 -6.974  1.00 23.13  ? 134 HIS B O   1 
ATOM   1921 C  CB  . HIS B 1 59  ? 0.318   -20.135 -6.807  1.00 31.80  ? 134 HIS B CB  1 
ATOM   1922 C  CG  . HIS B 1 59  ? 0.936   -18.803 -6.532  1.00 34.13  ? 134 HIS B CG  1 
ATOM   1923 N  ND1 . HIS B 1 59  ? 0.849   -18.151 -5.348  1.00 35.75  ? 134 HIS B ND1 1 
ATOM   1924 C  CD2 . HIS B 1 59  ? 1.699   -18.046 -7.368  1.00 36.51  ? 134 HIS B CD2 1 
ATOM   1925 C  CE1 . HIS B 1 59  ? 1.559   -17.018 -5.461  1.00 36.19  ? 134 HIS B CE1 1 
ATOM   1926 N  NE2 . HIS B 1 59  ? 2.090   -16.932 -6.685  1.00 36.99  ? 134 HIS B NE2 1 
ATOM   1927 N  N   . VAL B 1 60  ? 1.385   -23.510 -7.666  1.00 24.29  ? 135 VAL B N   1 
ATOM   1928 C  CA  . VAL B 1 60  ? 0.784   -24.718 -8.221  1.00 24.96  ? 135 VAL B CA  1 
ATOM   1929 C  C   . VAL B 1 60  ? 0.130   -25.584 -7.156  1.00 27.14  ? 135 VAL B C   1 
ATOM   1930 O  O   . VAL B 1 60  ? -0.906  -26.204 -7.412  1.00 27.90  ? 135 VAL B O   1 
ATOM   1931 C  CB  . VAL B 1 60  ? 1.816   -25.528 -9.055  1.00 25.83  ? 135 VAL B CB  1 
ATOM   1932 C  CG1 . VAL B 1 60  ? 2.877   -26.128 -8.160  1.00 26.37  ? 135 VAL B CG1 1 
ATOM   1933 C  CG2 . VAL B 1 60  ? 1.094   -26.622 -9.839  1.00 27.94  ? 135 VAL B CG2 1 
ATOM   1934 N  N   . ASP B 1 61  ? 0.678   -25.607 -5.934  1.00 26.81  ? 136 ASP B N   1 
ATOM   1935 C  CA  . ASP B 1 61  ? 0.068   -26.420 -4.906  1.00 27.23  ? 136 ASP B CA  1 
ATOM   1936 C  C   . ASP B 1 61  ? -1.295  -25.900 -4.503  1.00 26.79  ? 136 ASP B C   1 
ATOM   1937 O  O   . ASP B 1 61  ? -2.257  -26.652 -4.383  1.00 26.46  ? 136 ASP B O   1 
ATOM   1938 C  CB  . ASP B 1 61  ? 0.982   -26.508 -3.693  1.00 30.80  ? 136 ASP B CB  1 
ATOM   1939 C  CG  . ASP B 1 61  ? 2.304   -27.152 -4.027  1.00 32.55  ? 136 ASP B CG  1 
ATOM   1940 O  OD1 . ASP B 1 61  ? 2.330   -28.111 -4.848  1.00 36.21  ? 136 ASP B OD1 1 
ATOM   1941 O  OD2 . ASP B 1 61  ? 3.315   -26.693 -3.477  1.00 35.66  ? 136 ASP B OD2 1 
ATOM   1942 N  N   . GLU B 1 62  ? -1.393  -24.599 -4.278  1.00 26.45  ? 137 GLU B N   1 
ATOM   1943 C  CA  . GLU B 1 62  ? -2.665  -23.986 -3.929  1.00 27.80  ? 137 GLU B CA  1 
ATOM   1944 C  C   . GLU B 1 62  ? -3.634  -24.186 -5.098  1.00 24.63  ? 137 GLU B C   1 
ATOM   1945 O  O   . GLU B 1 62  ? -4.808  -24.475 -4.919  1.00 25.09  ? 137 GLU B O   1 
ATOM   1946 C  CB  . GLU B 1 62  ? -2.459  -22.483 -3.680  1.00 32.21  ? 137 GLU B CB  1 
ATOM   1947 C  CG  . GLU B 1 62  ? -3.748  -21.684 -3.776  1.00 40.13  ? 137 GLU B CG  1 
ATOM   1948 C  CD  . GLU B 1 62  ? -3.542  -20.186 -3.597  1.00 43.82  ? 137 GLU B CD  1 
ATOM   1949 O  OE1 . GLU B 1 62  ? -2.721  -19.588 -4.334  1.00 46.41  ? 137 GLU B OE1 1 
ATOM   1950 O  OE2 . GLU B 1 62  ? -4.234  -19.610 -2.727  1.00 47.13  ? 137 GLU B OE2 1 
ATOM   1951 N  N   . PHE B 1 63  ? -3.130  -24.032 -6.310  1.00 23.32  ? 138 PHE B N   1 
ATOM   1952 C  CA  . PHE B 1 63  ? -3.981  -24.166 -7.483  1.00 23.83  ? 138 PHE B CA  1 
ATOM   1953 C  C   . PHE B 1 63  ? -4.585  -25.572 -7.584  1.00 20.90  ? 138 PHE B C   1 
ATOM   1954 O  O   . PHE B 1 63  ? -5.790  -25.733 -7.686  1.00 20.38  ? 138 PHE B O   1 
ATOM   1955 C  CB  . PHE B 1 63  ? -3.168  -23.864 -8.732  1.00 24.24  ? 138 PHE B CB  1 
ATOM   1956 C  CG  . PHE B 1 63  ? -3.948  -23.984 -10.009 1.00 25.34  ? 138 PHE B CG  1 
ATOM   1957 C  CD1 . PHE B 1 63  ? -4.891  -23.010 -10.354 1.00 25.57  ? 138 PHE B CD1 1 
ATOM   1958 C  CD2 . PHE B 1 63  ? -3.717  -25.055 -10.889 1.00 22.94  ? 138 PHE B CD2 1 
ATOM   1959 C  CE1 . PHE B 1 63  ? -5.600  -23.079 -11.556 1.00 26.26  ? 138 PHE B CE1 1 
ATOM   1960 C  CE2 . PHE B 1 63  ? -4.437  -25.127 -12.113 1.00 25.32  ? 138 PHE B CE2 1 
ATOM   1961 C  CZ  . PHE B 1 63  ? -5.370  -24.143 -12.444 1.00 22.95  ? 138 PHE B CZ  1 
ATOM   1962 N  N   . LEU B 1 64  ? -3.736  -26.584 -7.597  1.00 21.35  ? 139 LEU B N   1 
ATOM   1963 C  CA  . LEU B 1 64  ? -4.201  -27.965 -7.737  1.00 24.12  ? 139 LEU B CA  1 
ATOM   1964 C  C   . LEU B 1 64  ? -5.092  -28.434 -6.620  1.00 24.48  ? 139 LEU B C   1 
ATOM   1965 O  O   . LEU B 1 64  ? -6.023  -29.215 -6.832  1.00 25.57  ? 139 LEU B O   1 
ATOM   1966 C  CB  . LEU B 1 64  ? -3.014  -28.937 -7.867  1.00 24.87  ? 139 LEU B CB  1 
ATOM   1967 C  CG  . LEU B 1 64  ? -2.314  -29.006 -9.228  1.00 27.58  ? 139 LEU B CG  1 
ATOM   1968 C  CD1 . LEU B 1 64  ? -1.218  -30.072 -9.186  1.00 27.33  ? 139 LEU B CD1 1 
ATOM   1969 C  CD2 . LEU B 1 64  ? -3.338  -29.359 -10.312 1.00 29.33  ? 139 LEU B CD2 1 
ATOM   1970 N  N   . GLN B 1 65  ? -4.815  -27.977 -5.401  1.00 25.41  ? 140 GLN B N   1 
ATOM   1971 C  CA  . GLN B 1 65  ? -5.619  -28.366 -4.250  1.00 24.68  ? 140 GLN B CA  1 
ATOM   1972 C  C   . GLN B 1 65  ? -7.056  -27.818 -4.404  1.00 24.10  ? 140 GLN B C   1 
ATOM   1973 O  O   . GLN B 1 65  ? -8.075  -28.510 -4.131  1.00 22.92  ? 140 GLN B O   1 
ATOM   1974 C  CB  . GLN B 1 65  ? -4.953  -27.804 -2.974  1.00 29.24  ? 140 GLN B CB  1 
ATOM   1975 C  CG  . GLN B 1 65  ? -5.548  -28.281 -1.671  1.00 31.75  ? 140 GLN B CG  1 
ATOM   1976 C  CD  . GLN B 1 65  ? -6.883  -27.647 -1.376  1.00 35.75  ? 140 GLN B CD  1 
ATOM   1977 O  OE1 . GLN B 1 65  ? -7.098  -26.450 -1.621  1.00 38.36  ? 140 GLN B OE1 1 
ATOM   1978 N  NE2 . GLN B 1 65  ? -7.807  -28.443 -0.812  1.00 37.98  ? 140 GLN B NE2 1 
ATOM   1979 N  N   . ARG B 1 66  ? -7.157  -26.563 -4.836  1.00 21.90  ? 141 ARG B N   1 
ATOM   1980 C  CA  . ARG B 1 66  ? -8.491  -25.999 -4.995  1.00 22.12  ? 141 ARG B CA  1 
ATOM   1981 C  C   . ARG B 1 66  ? -9.177  -26.601 -6.234  1.00 21.26  ? 141 ARG B C   1 
ATOM   1982 O  O   . ARG B 1 66  ? -10.368 -26.922 -6.204  1.00 22.91  ? 141 ARG B O   1 
ATOM   1983 C  CB  . ARG B 1 66  ? -8.416  -24.465 -5.113  1.00 24.10  ? 141 ARG B CB  1 
ATOM   1984 C  CG  . ARG B 1 66  ? -9.790  -23.766 -5.234  1.00 23.96  ? 141 ARG B CG  1 
ATOM   1985 C  CD  . ARG B 1 66  ? -10.742 -24.282 -4.156  1.00 27.06  ? 141 ARG B CD  1 
ATOM   1986 N  NE  . ARG B 1 66  ? -11.964 -23.489 -4.094  1.00 27.24  ? 141 ARG B NE  1 
ATOM   1987 C  CZ  . ARG B 1 66  ? -13.073 -23.872 -3.473  1.00 29.20  ? 141 ARG B CZ  1 
ATOM   1988 N  NH1 . ARG B 1 66  ? -13.116 -25.047 -2.858  1.00 27.85  ? 141 ARG B NH1 1 
ATOM   1989 N  NH2 . ARG B 1 66  ? -14.141 -23.083 -3.468  1.00 27.46  ? 141 ARG B NH2 1 
ATOM   1990 N  N   . MET B 1 67  ? -8.418  -26.748 -7.318  1.00 21.68  ? 142 MET B N   1 
ATOM   1991 C  CA  . MET B 1 67  ? -9.011  -27.326 -8.549  1.00 22.76  ? 142 MET B CA  1 
ATOM   1992 C  C   . MET B 1 67  ? -9.550  -28.737 -8.288  1.00 23.76  ? 142 MET B C   1 
ATOM   1993 O  O   . MET B 1 67  ? -10.605 -29.119 -8.795  1.00 23.86  ? 142 MET B O   1 
ATOM   1994 C  CB  . MET B 1 67  ? -7.969  -27.375 -9.671  1.00 22.78  ? 142 MET B CB  1 
ATOM   1995 C  CG  . MET B 1 67  ? -7.576  -25.996 -10.210 1.00 27.03  ? 142 MET B CG  1 
ATOM   1996 S  SD  . MET B 1 67  ? -8.934  -25.113 -11.075 1.00 28.58  ? 142 MET B SD  1 
ATOM   1997 C  CE  . MET B 1 67  ? -8.927  -25.914 -12.702 1.00 32.31  ? 142 MET B CE  1 
ATOM   1998 N  N   . GLY B 1 68  ? -8.808  -29.513 -7.500  1.00 24.51  ? 143 GLY B N   1 
ATOM   1999 C  CA  . GLY B 1 68  ? -9.238  -30.877 -7.187  1.00 25.04  ? 143 GLY B CA  1 
ATOM   2000 C  C   . GLY B 1 68  ? -10.595 -30.904 -6.514  1.00 27.18  ? 143 GLY B C   1 
ATOM   2001 O  O   . GLY B 1 68  ? -11.369 -31.851 -6.681  1.00 27.08  ? 143 GLY B O   1 
ATOM   2002 N  N   . GLU B 1 69  ? -10.906 -29.862 -5.737  1.00 27.04  ? 144 GLU B N   1 
ATOM   2003 C  CA  . GLU B 1 69  ? -12.191 -29.790 -5.072  1.00 26.89  ? 144 GLU B CA  1 
ATOM   2004 C  C   . GLU B 1 69  ? -13.285 -29.261 -6.005  1.00 27.47  ? 144 GLU B C   1 
ATOM   2005 O  O   . GLU B 1 69  ? -14.434 -29.752 -5.972  1.00 27.30  ? 144 GLU B O   1 
ATOM   2006 C  CB  . GLU B 1 69  ? -12.140 -28.851 -3.867  1.00 30.74  ? 144 GLU B CB  1 
ATOM   2007 C  CG  . GLU B 1 69  ? -11.181 -29.234 -2.778  1.00 34.05  ? 144 GLU B CG  1 
ATOM   2008 C  CD  . GLU B 1 69  ? -11.110 -28.172 -1.699  1.00 36.74  ? 144 GLU B CD  1 
ATOM   2009 O  OE1 . GLU B 1 69  ? -10.986 -26.966 -2.041  1.00 36.88  ? 144 GLU B OE1 1 
ATOM   2010 O  OE2 . GLU B 1 69  ? -11.200 -28.530 -0.508  1.00 38.11  ? 144 GLU B OE2 1 
ATOM   2011 N  N   . LEU B 1 70  ? -12.923 -28.270 -6.823  1.00 24.60  ? 145 LEU B N   1 
ATOM   2012 C  CA  . LEU B 1 70  ? -13.874 -27.629 -7.735  1.00 25.77  ? 145 LEU B CA  1 
ATOM   2013 C  C   . LEU B 1 70  ? -14.324 -28.466 -8.929  1.00 24.97  ? 145 LEU B C   1 
ATOM   2014 O  O   . LEU B 1 70  ? -15.461 -28.358 -9.330  1.00 23.30  ? 145 LEU B O   1 
ATOM   2015 C  CB  . LEU B 1 70  ? -13.316 -26.292 -8.257  1.00 24.84  ? 145 LEU B CB  1 
ATOM   2016 C  CG  . LEU B 1 70  ? -13.155 -25.152 -7.224  1.00 26.25  ? 145 LEU B CG  1 
ATOM   2017 C  CD1 . LEU B 1 70  ? -12.513 -23.952 -7.905  1.00 27.38  ? 145 LEU B CD1 1 
ATOM   2018 C  CD2 . LEU B 1 70  ? -14.501 -24.786 -6.614  1.00 26.79  ? 145 LEU B CD2 1 
ATOM   2019 N  N   . PHE B 1 71  ? -13.452 -29.325 -9.445  1.00 22.61  ? 146 PHE B N   1 
ATOM   2020 C  CA  . PHE B 1 71  ? -13.754 -30.107 -10.628 1.00 23.63  ? 146 PHE B CA  1 
ATOM   2021 C  C   . PHE B 1 71  ? -13.351 -31.575 -10.570 1.00 26.84  ? 146 PHE B C   1 
ATOM   2022 O  O   . PHE B 1 71  ? -12.805 -32.060 -9.577  1.00 25.14  ? 146 PHE B O   1 
ATOM   2023 C  CB  . PHE B 1 71  ? -12.989 -29.526 -11.802 1.00 23.49  ? 146 PHE B CB  1 
ATOM   2024 C  CG  . PHE B 1 71  ? -13.246 -28.071 -12.042 1.00 26.20  ? 146 PHE B CG  1 
ATOM   2025 C  CD1 . PHE B 1 71  ? -14.329 -27.641 -12.791 1.00 26.48  ? 146 PHE B CD1 1 
ATOM   2026 C  CD2 . PHE B 1 71  ? -12.329 -27.130 -11.552 1.00 26.37  ? 146 PHE B CD2 1 
ATOM   2027 C  CE1 . PHE B 1 71  ? -14.504 -26.276 -13.074 1.00 26.51  ? 146 PHE B CE1 1 
ATOM   2028 C  CE2 . PHE B 1 71  ? -12.483 -25.767 -11.818 1.00 29.03  ? 146 PHE B CE2 1 
ATOM   2029 C  CZ  . PHE B 1 71  ? -13.576 -25.336 -12.589 1.00 29.01  ? 146 PHE B CZ  1 
ATOM   2030 N  N   . GLU B 1 72  ? -13.642 -32.270 -11.677 1.00 25.99  ? 147 GLU B N   1 
ATOM   2031 C  CA  . GLU B 1 72  ? -13.164 -33.629 -11.849 1.00 26.80  ? 147 GLU B CA  1 
ATOM   2032 C  C   . GLU B 1 72  ? -11.951 -33.288 -12.732 1.00 26.94  ? 147 GLU B C   1 
ATOM   2033 O  O   . GLU B 1 72  ? -12.092 -32.981 -13.938 1.00 25.15  ? 147 GLU B O   1 
ATOM   2034 C  CB  . GLU B 1 72  ? -14.154 -34.511 -12.630 1.00 26.06  ? 147 GLU B CB  1 
ATOM   2035 C  CG  . GLU B 1 72  ? -13.527 -35.827 -13.080 1.00 30.27  ? 147 GLU B CG  1 
ATOM   2036 C  CD  . GLU B 1 72  ? -14.412 -36.660 -14.006 1.00 32.29  ? 147 GLU B CD  1 
ATOM   2037 O  OE1 . GLU B 1 72  ? -15.119 -36.091 -14.869 1.00 30.32  ? 147 GLU B OE1 1 
ATOM   2038 O  OE2 . GLU B 1 72  ? -14.391 -37.909 -13.866 1.00 31.39  ? 147 GLU B OE2 1 
ATOM   2039 N  N   . CYS B 1 73  ? -10.765 -33.271 -12.125 1.00 26.24  ? 148 CYS B N   1 
ATOM   2040 C  CA  . CYS B 1 73  ? -9.558  -32.949 -12.857 1.00 26.75  ? 148 CYS B CA  1 
ATOM   2041 C  C   . CYS B 1 73  ? -8.903  -34.134 -13.569 1.00 27.34  ? 148 CYS B C   1 
ATOM   2042 O  O   . CYS B 1 73  ? -8.706  -35.218 -12.983 1.00 28.40  ? 148 CYS B O   1 
ATOM   2043 C  CB  . CYS B 1 73  ? -8.492  -32.359 -11.952 1.00 28.65  ? 148 CYS B CB  1 
ATOM   2044 S  SG  . CYS B 1 73  ? -9.015  -30.901 -11.113 1.00 27.88  ? 148 CYS B SG  1 
ATOM   2045 N  N   . VAL B 1 74  ? -8.521  -33.907 -14.822 1.00 25.54  ? 149 VAL B N   1 
ATOM   2046 C  CA  . VAL B 1 74  ? -7.843  -34.921 -15.586 1.00 25.77  ? 149 VAL B CA  1 
ATOM   2047 C  C   . VAL B 1 74  ? -6.551  -34.347 -16.127 1.00 26.73  ? 149 VAL B C   1 
ATOM   2048 O  O   . VAL B 1 74  ? -6.526  -33.262 -16.718 1.00 25.57  ? 149 VAL B O   1 
ATOM   2049 C  CB  . VAL B 1 74  ? -8.724  -35.404 -16.759 1.00 27.07  ? 149 VAL B CB  1 
ATOM   2050 C  CG1 . VAL B 1 74  ? -7.972  -36.417 -17.587 1.00 29.98  ? 149 VAL B CG1 1 
ATOM   2051 C  CG2 . VAL B 1 74  ? -10.023 -35.997 -16.223 1.00 26.55  ? 149 VAL B CG2 1 
ATOM   2052 N  N   . LEU B 1 75  ? -5.450  -35.068 -15.904 1.00 25.77  ? 150 LEU B N   1 
ATOM   2053 C  CA  . LEU B 1 75  ? -4.159  -34.652 -16.427 1.00 26.56  ? 150 LEU B CA  1 
ATOM   2054 C  C   . LEU B 1 75  ? -4.127  -35.170 -17.880 1.00 27.97  ? 150 LEU B C   1 
ATOM   2055 O  O   . LEU B 1 75  ? -4.365  -36.356 -18.129 1.00 25.74  ? 150 LEU B O   1 
ATOM   2056 C  CB  . LEU B 1 75  ? -3.018  -35.284 -15.615 1.00 27.67  ? 150 LEU B CB  1 
ATOM   2057 C  CG  . LEU B 1 75  ? -1.586  -34.958 -16.047 1.00 31.00  ? 150 LEU B CG  1 
ATOM   2058 C  CD1 . LEU B 1 75  ? -1.306  -33.487 -15.797 1.00 29.82  ? 150 LEU B CD1 1 
ATOM   2059 C  CD2 . LEU B 1 75  ? -0.594  -35.855 -15.274 1.00 32.15  ? 150 LEU B CD2 1 
ATOM   2060 N  N   . PHE B 1 76  ? -3.858  -34.274 -18.824 1.00 26.30  ? 151 PHE B N   1 
ATOM   2061 C  CA  . PHE B 1 76  ? -3.828  -34.671 -20.227 1.00 26.43  ? 151 PHE B CA  1 
ATOM   2062 C  C   . PHE B 1 76  ? -2.575  -33.995 -20.801 1.00 26.97  ? 151 PHE B C   1 
ATOM   2063 O  O   . PHE B 1 76  ? -2.523  -32.762 -20.986 1.00 26.65  ? 151 PHE B O   1 
ATOM   2064 C  CB  . PHE B 1 76  ? -5.114  -34.205 -20.919 1.00 27.10  ? 151 PHE B CB  1 
ATOM   2065 C  CG  . PHE B 1 76  ? -5.458  -34.977 -22.195 1.00 28.57  ? 151 PHE B CG  1 
ATOM   2066 C  CD1 . PHE B 1 76  ? -4.497  -35.730 -22.866 1.00 28.84  ? 151 PHE B CD1 1 
ATOM   2067 C  CD2 . PHE B 1 76  ? -6.759  -34.975 -22.699 1.00 30.65  ? 151 PHE B CD2 1 
ATOM   2068 C  CE1 . PHE B 1 76  ? -4.828  -36.481 -24.023 1.00 29.22  ? 151 PHE B CE1 1 
ATOM   2069 C  CE2 . PHE B 1 76  ? -7.098  -35.717 -23.854 1.00 29.59  ? 151 PHE B CE2 1 
ATOM   2070 C  CZ  . PHE B 1 76  ? -6.127  -36.473 -24.515 1.00 30.30  ? 151 PHE B CZ  1 
ATOM   2071 N  N   . THR B 1 77  ? -1.566  -34.819 -21.073 1.00 24.06  ? 152 THR B N   1 
ATOM   2072 C  CA  . THR B 1 77  ? -0.281  -34.336 -21.542 1.00 26.66  ? 152 THR B CA  1 
ATOM   2073 C  C   . THR B 1 77  ? 0.225   -35.029 -22.807 1.00 28.04  ? 152 THR B C   1 
ATOM   2074 O  O   . THR B 1 77  ? -0.125  -36.185 -23.108 1.00 24.22  ? 152 THR B O   1 
ATOM   2075 C  CB  . THR B 1 77  ? 0.813   -34.555 -20.427 1.00 26.19  ? 152 THR B CB  1 
ATOM   2076 O  OG1 . THR B 1 77  ? 2.082   -34.093 -20.888 1.00 26.75  ? 152 THR B OG1 1 
ATOM   2077 C  CG2 . THR B 1 77  ? 0.972   -36.046 -20.133 1.00 27.57  ? 152 THR B CG2 1 
ATOM   2078 N  N   . ALA B 1 78  ? 1.089   -34.327 -23.541 1.00 27.33  ? 153 ALA B N   1 
ATOM   2079 C  CA  . ALA B 1 78  ? 1.669   -34.907 -24.748 1.00 29.53  ? 153 ALA B CA  1 
ATOM   2080 C  C   . ALA B 1 78  ? 3.018   -35.544 -24.370 1.00 29.50  ? 153 ALA B C   1 
ATOM   2081 O  O   . ALA B 1 78  ? 3.793   -35.968 -25.222 1.00 32.33  ? 153 ALA B O   1 
ATOM   2082 C  CB  . ALA B 1 78  ? 1.849   -33.830 -25.820 1.00 27.52  ? 153 ALA B CB  1 
ATOM   2083 N  N   . SER B 1 79  ? 3.298   -35.612 -23.074 1.00 28.99  ? 154 SER B N   1 
ATOM   2084 C  CA  . SER B 1 79  ? 4.534   -36.219 -22.609 1.00 29.50  ? 154 SER B CA  1 
ATOM   2085 C  C   . SER B 1 79  ? 4.370   -37.739 -22.517 1.00 30.08  ? 154 SER B C   1 
ATOM   2086 O  O   . SER B 1 79  ? 3.324   -38.279 -22.795 1.00 30.76  ? 154 SER B O   1 
ATOM   2087 C  CB  . SER B 1 79  ? 4.861   -35.735 -21.183 1.00 31.16  ? 154 SER B CB  1 
ATOM   2088 O  OG  . SER B 1 79  ? 4.994   -34.336 -21.160 1.00 38.27  ? 154 SER B OG  1 
ATOM   2089 N  N   . LEU B 1 80  ? 5.419   -38.431 -22.118 1.00 29.42  ? 155 LEU B N   1 
ATOM   2090 C  CA  . LEU B 1 80  ? 5.340   -39.876 -21.985 1.00 30.87  ? 155 LEU B CA  1 
ATOM   2091 C  C   . LEU B 1 80  ? 5.141   -40.186 -20.509 1.00 31.20  ? 155 LEU B C   1 
ATOM   2092 O  O   . LEU B 1 80  ? 5.678   -39.494 -19.643 1.00 29.95  ? 155 LEU B O   1 
ATOM   2093 C  CB  . LEU B 1 80  ? 6.640   -40.506 -22.477 1.00 32.16  ? 155 LEU B CB  1 
ATOM   2094 C  CG  . LEU B 1 80  ? 6.930   -40.276 -23.959 1.00 30.20  ? 155 LEU B CG  1 
ATOM   2095 C  CD1 . LEU B 1 80  ? 8.251   -40.927 -24.316 1.00 32.20  ? 155 LEU B CD1 1 
ATOM   2096 C  CD2 . LEU B 1 80  ? 5.791   -40.849 -24.794 1.00 29.29  ? 155 LEU B CD2 1 
ATOM   2097 N  N   . ALA B 1 81  ? 4.355   -41.217 -20.227 1.00 30.52  ? 156 ALA B N   1 
ATOM   2098 C  CA  . ALA B 1 81  ? 4.082   -41.647 -18.855 1.00 31.06  ? 156 ALA B CA  1 
ATOM   2099 C  C   . ALA B 1 81  ? 5.344   -41.854 -18.004 1.00 31.74  ? 156 ALA B C   1 
ATOM   2100 O  O   . ALA B 1 81  ? 5.360   -41.536 -16.815 1.00 32.53  ? 156 ALA B O   1 
ATOM   2101 C  CB  . ALA B 1 81  ? 3.271   -42.937 -18.893 1.00 30.21  ? 156 ALA B CB  1 
ATOM   2102 N  N   . LYS B 1 82  ? 6.390   -42.403 -18.611 1.00 32.19  ? 157 LYS B N   1 
ATOM   2103 C  CA  . LYS B 1 82  ? 7.630   -42.667 -17.881 1.00 34.49  ? 157 LYS B CA  1 
ATOM   2104 C  C   . LYS B 1 82  ? 8.160   -41.397 -17.227 1.00 32.90  ? 157 LYS B C   1 
ATOM   2105 O  O   . LYS B 1 82  ? 8.902   -41.456 -16.269 1.00 32.75  ? 157 LYS B O   1 
ATOM   2106 C  CB  . LYS B 1 82  ? 8.701   -43.248 -18.804 1.00 34.57  ? 157 LYS B CB  1 
ATOM   2107 C  CG  . LYS B 1 82  ? 9.068   -42.355 -19.987 1.00 39.77  ? 157 LYS B CG  1 
ATOM   2108 C  CD  . LYS B 1 82  ? 10.311  -42.872 -20.730 1.00 42.19  ? 157 LYS B CD  1 
ATOM   2109 C  CE  . LYS B 1 82  ? 10.116  -44.346 -21.031 1.00 44.94  ? 157 LYS B CE  1 
ATOM   2110 N  NZ  . LYS B 1 82  ? 11.358  -45.064 -21.388 1.00 46.45  ? 157 LYS B NZ  1 
ATOM   2111 N  N   . TYR B 1 83  ? 7.781   -40.251 -17.763 1.00 32.61  ? 158 TYR B N   1 
ATOM   2112 C  CA  . TYR B 1 83  ? 8.197   -38.985 -17.186 1.00 31.44  ? 158 TYR B CA  1 
ATOM   2113 C  C   . TYR B 1 83  ? 7.026   -38.407 -16.376 1.00 32.11  ? 158 TYR B C   1 
ATOM   2114 O  O   . TYR B 1 83  ? 7.165   -38.077 -15.179 1.00 31.94  ? 158 TYR B O   1 
ATOM   2115 C  CB  . TYR B 1 83  ? 8.615   -38.025 -18.298 1.00 30.70  ? 158 TYR B CB  1 
ATOM   2116 C  CG  . TYR B 1 83  ? 8.416   -36.559 -17.965 1.00 30.79  ? 158 TYR B CG  1 
ATOM   2117 C  CD1 . TYR B 1 83  ? 9.246   -35.911 -17.043 1.00 29.58  ? 158 TYR B CD1 1 
ATOM   2118 C  CD2 . TYR B 1 83  ? 7.367   -35.831 -18.531 1.00 30.55  ? 158 TYR B CD2 1 
ATOM   2119 C  CE1 . TYR B 1 83  ? 9.041   -34.565 -16.684 1.00 28.33  ? 158 TYR B CE1 1 
ATOM   2120 C  CE2 . TYR B 1 83  ? 7.136   -34.491 -18.185 1.00 29.18  ? 158 TYR B CE2 1 
ATOM   2121 C  CZ  . TYR B 1 83  ? 7.978   -33.873 -17.258 1.00 31.23  ? 158 TYR B CZ  1 
ATOM   2122 O  OH  . TYR B 1 83  ? 7.730   -32.590 -16.871 1.00 30.72  ? 158 TYR B OH  1 
ATOM   2123 N  N   . ALA B 1 84  ? 5.870   -38.309 -17.035 1.00 31.47  ? 159 ALA B N   1 
ATOM   2124 C  CA  . ALA B 1 84  ? 4.664   -37.756 -16.426 1.00 30.88  ? 159 ALA B CA  1 
ATOM   2125 C  C   . ALA B 1 84  ? 4.135   -38.420 -15.152 1.00 30.04  ? 159 ALA B C   1 
ATOM   2126 O  O   . ALA B 1 84  ? 3.683   -37.717 -14.247 1.00 28.55  ? 159 ALA B O   1 
ATOM   2127 C  CB  . ALA B 1 84  ? 3.547   -37.670 -17.467 1.00 31.66  ? 159 ALA B CB  1 
ATOM   2128 N  N   . ASP B 1 85  ? 4.148   -39.747 -15.073 1.00 30.87  ? 160 ASP B N   1 
ATOM   2129 C  CA  . ASP B 1 85  ? 3.616   -40.387 -13.866 1.00 30.70  ? 160 ASP B CA  1 
ATOM   2130 C  C   . ASP B 1 85  ? 4.383   -40.009 -12.598 1.00 29.09  ? 160 ASP B C   1 
ATOM   2131 O  O   . ASP B 1 85  ? 3.780   -39.600 -11.606 1.00 29.66  ? 160 ASP B O   1 
ATOM   2132 C  CB  . ASP B 1 85  ? 3.595   -41.919 -13.996 1.00 32.26  ? 160 ASP B CB  1 
ATOM   2133 C  CG  . ASP B 1 85  ? 2.229   -42.471 -14.386 1.00 33.98  ? 160 ASP B CG  1 
ATOM   2134 O  OD1 . ASP B 1 85  ? 1.205   -41.980 -13.875 1.00 36.25  ? 160 ASP B OD1 1 
ATOM   2135 O  OD2 . ASP B 1 85  ? 2.174   -43.425 -15.194 1.00 36.83  ? 160 ASP B OD2 1 
ATOM   2136 N  N   . PRO B 1 86  ? 5.712   -40.181 -12.599 1.00 30.78  ? 161 PRO B N   1 
ATOM   2137 C  CA  . PRO B 1 86  ? 6.506   -39.832 -11.414 1.00 28.75  ? 161 PRO B CA  1 
ATOM   2138 C  C   . PRO B 1 86  ? 6.297   -38.348 -11.031 1.00 29.11  ? 161 PRO B C   1 
ATOM   2139 O  O   . PRO B 1 86  ? 6.145   -38.000 -9.848  1.00 28.80  ? 161 PRO B O   1 
ATOM   2140 C  CB  . PRO B 1 86  ? 7.945   -40.108 -11.854 1.00 28.05  ? 161 PRO B CB  1 
ATOM   2141 C  CG  . PRO B 1 86  ? 7.790   -41.176 -12.871 1.00 32.18  ? 161 PRO B CG  1 
ATOM   2142 C  CD  . PRO B 1 86  ? 6.554   -40.777 -13.649 1.00 29.31  ? 161 PRO B CD  1 
ATOM   2143 N  N   . VAL B 1 87  ? 6.279   -37.466 -12.024 1.00 29.04  ? 162 VAL B N   1 
ATOM   2144 C  CA  . VAL B 1 87  ? 6.088   -36.040 -11.721 1.00 28.83  ? 162 VAL B CA  1 
ATOM   2145 C  C   . VAL B 1 87  ? 4.722   -35.818 -11.073 1.00 29.54  ? 162 VAL B C   1 
ATOM   2146 O  O   . VAL B 1 87  ? 4.629   -35.133 -10.041 1.00 29.59  ? 162 VAL B O   1 
ATOM   2147 C  CB  . VAL B 1 87  ? 6.228   -35.162 -13.005 1.00 28.60  ? 162 VAL B CB  1 
ATOM   2148 C  CG1 . VAL B 1 87  ? 5.865   -33.672 -12.722 1.00 28.18  ? 162 VAL B CG1 1 
ATOM   2149 C  CG2 . VAL B 1 87  ? 7.662   -35.249 -13.498 1.00 27.00  ? 162 VAL B CG2 1 
ATOM   2150 N  N   . ALA B 1 88  ? 3.669   -36.406 -11.655 1.00 28.66  ? 163 ALA B N   1 
ATOM   2151 C  CA  . ALA B 1 88  ? 2.337   -36.250 -11.105 1.00 27.49  ? 163 ALA B CA  1 
ATOM   2152 C  C   . ALA B 1 88  ? 2.269   -36.831 -9.695  1.00 27.73  ? 163 ALA B C   1 
ATOM   2153 O  O   . ALA B 1 88  ? 1.570   -36.294 -8.825  1.00 28.07  ? 163 ALA B O   1 
ATOM   2154 C  CB  . ALA B 1 88  ? 1.309   -36.941 -12.000 1.00 29.14  ? 163 ALA B CB  1 
ATOM   2155 N  N   . ASP B 1 89  ? 2.969   -37.941 -9.467  1.00 27.96  ? 164 ASP B N   1 
ATOM   2156 C  CA  . ASP B 1 89  ? 2.948   -38.561 -8.138  1.00 30.32  ? 164 ASP B CA  1 
ATOM   2157 C  C   . ASP B 1 89  ? 3.531   -37.589 -7.117  1.00 30.73  ? 164 ASP B C   1 
ATOM   2158 O  O   . ASP B 1 89  ? 3.053   -37.502 -5.992  1.00 32.90  ? 164 ASP B O   1 
ATOM   2159 C  CB  . ASP B 1 89  ? 3.753   -39.867 -8.118  1.00 30.23  ? 164 ASP B CB  1 
ATOM   2160 C  CG  . ASP B 1 89  ? 3.083   -40.980 -8.936  1.00 32.32  ? 164 ASP B CG  1 
ATOM   2161 O  OD1 . ASP B 1 89  ? 1.846   -40.955 -9.047  1.00 31.42  ? 164 ASP B OD1 1 
ATOM   2162 O  OD2 . ASP B 1 89  ? 3.783   -41.877 -9.443  1.00 33.52  ? 164 ASP B OD2 1 
ATOM   2163 N  N   . LEU B 1 90  ? 4.566   -36.857 -7.506  1.00 31.05  ? 165 LEU B N   1 
ATOM   2164 C  CA  . LEU B 1 90  ? 5.172   -35.893 -6.586  1.00 33.63  ? 165 LEU B CA  1 
ATOM   2165 C  C   . LEU B 1 90  ? 4.350   -34.624 -6.430  1.00 34.66  ? 165 LEU B C   1 
ATOM   2166 O  O   . LEU B 1 90  ? 4.248   -34.075 -5.331  1.00 35.56  ? 165 LEU B O   1 
ATOM   2167 C  CB  . LEU B 1 90  ? 6.579   -35.546 -7.061  1.00 32.27  ? 165 LEU B CB  1 
ATOM   2168 C  CG  . LEU B 1 90  ? 7.549   -36.719 -6.937  1.00 35.77  ? 165 LEU B CG  1 
ATOM   2169 C  CD1 . LEU B 1 90  ? 8.892   -36.358 -7.559  1.00 33.84  ? 165 LEU B CD1 1 
ATOM   2170 C  CD2 . LEU B 1 90  ? 7.753   -37.039 -5.472  1.00 35.56  ? 165 LEU B CD2 1 
ATOM   2171 N  N   . LEU B 1 91  ? 3.756   -34.173 -7.531  1.00 34.14  ? 166 LEU B N   1 
ATOM   2172 C  CA  . LEU B 1 91  ? 2.948   -32.951 -7.549  1.00 35.09  ? 166 LEU B CA  1 
ATOM   2173 C  C   . LEU B 1 91  ? 1.625   -33.018 -6.815  1.00 35.75  ? 166 LEU B C   1 
ATOM   2174 O  O   . LEU B 1 91  ? 1.353   -32.228 -5.918  1.00 38.15  ? 166 LEU B O   1 
ATOM   2175 C  CB  . LEU B 1 91  ? 2.602   -32.562 -8.993  1.00 34.29  ? 166 LEU B CB  1 
ATOM   2176 C  CG  . LEU B 1 91  ? 3.256   -31.415 -9.751  1.00 35.53  ? 166 LEU B CG  1 
ATOM   2177 C  CD1 . LEU B 1 91  ? 2.372   -31.093 -10.982 1.00 29.86  ? 166 LEU B CD1 1 
ATOM   2178 C  CD2 . LEU B 1 91  ? 3.402   -30.168 -8.846  1.00 34.55  ? 166 LEU B CD2 1 
ATOM   2179 N  N   . ASP B 1 92  ? 0.791   -33.960 -7.233  1.00 36.76  ? 167 ASP B N   1 
ATOM   2180 C  CA  . ASP B 1 92  ? -0.552  -34.107 -6.707  1.00 37.35  ? 167 ASP B CA  1 
ATOM   2181 C  C   . ASP B 1 92  ? -0.715  -34.762 -5.344  1.00 37.68  ? 167 ASP B C   1 
ATOM   2182 O  O   . ASP B 1 92  ? -1.130  -35.914 -5.222  1.00 37.89  ? 167 ASP B O   1 
ATOM   2183 C  CB  . ASP B 1 92  ? -1.392  -34.827 -7.754  1.00 38.00  ? 167 ASP B CB  1 
ATOM   2184 C  CG  . ASP B 1 92  ? -2.837  -34.857 -7.405  1.00 38.90  ? 167 ASP B CG  1 
ATOM   2185 O  OD1 . ASP B 1 92  ? -3.269  -34.070 -6.528  1.00 40.20  ? 167 ASP B OD1 1 
ATOM   2186 O  OD2 . ASP B 1 92  ? -3.550  -35.667 -8.029  1.00 38.34  ? 167 ASP B OD2 1 
ATOM   2187 N  N   . LYS B 1 93  ? -0.426  -33.987 -4.311  1.00 39.05  ? 168 LYS B N   1 
ATOM   2188 C  CA  . LYS B 1 93  ? -0.515  -34.443 -2.927  1.00 40.02  ? 168 LYS B CA  1 
ATOM   2189 C  C   . LYS B 1 93  ? -1.941  -34.643 -2.422  1.00 39.74  ? 168 LYS B C   1 
ATOM   2190 O  O   . LYS B 1 93  ? -2.142  -35.198 -1.347  1.00 36.70  ? 168 LYS B O   1 
ATOM   2191 C  CB  . LYS B 1 93  ? 0.194   -33.418 -2.027  1.00 41.62  ? 168 LYS B CB  1 
ATOM   2192 C  CG  . LYS B 1 93  ? 1.713   -33.301 -2.241  1.00 42.49  ? 168 LYS B CG  1 
ATOM   2193 C  CD  . LYS B 1 93  ? 2.388   -34.632 -1.913  1.00 45.24  ? 168 LYS B CD  1 
ATOM   2194 C  CE  . LYS B 1 93  ? 3.879   -34.625 -2.191  1.00 45.96  ? 168 LYS B CE  1 
ATOM   2195 N  NZ  . LYS B 1 93  ? 4.530   -35.837 -1.607  1.00 48.36  ? 168 LYS B NZ  1 
ATOM   2196 N  N   . TRP B 1 94  ? -2.931  -34.196 -3.194  1.00 39.32  ? 169 TRP B N   1 
ATOM   2197 C  CA  . TRP B 1 94  ? -4.323  -34.287 -2.762  1.00 37.49  ? 169 TRP B CA  1 
ATOM   2198 C  C   . TRP B 1 94  ? -5.197  -35.203 -3.573  1.00 36.14  ? 169 TRP B C   1 
ATOM   2199 O  O   . TRP B 1 94  ? -6.400  -35.300 -3.307  1.00 34.90  ? 169 TRP B O   1 
ATOM   2200 C  CB  . TRP B 1 94  ? -4.957  -32.898 -2.767  1.00 38.76  ? 169 TRP B CB  1 
ATOM   2201 C  CG  . TRP B 1 94  ? -4.064  -31.881 -2.206  1.00 38.95  ? 169 TRP B CG  1 
ATOM   2202 C  CD1 . TRP B 1 94  ? -4.020  -31.424 -0.900  1.00 38.38  ? 169 TRP B CD1 1 
ATOM   2203 C  CD2 . TRP B 1 94  ? -3.006  -31.232 -2.901  1.00 39.82  ? 169 TRP B CD2 1 
ATOM   2204 N  NE1 . TRP B 1 94  ? -2.980  -30.526 -0.754  1.00 36.57  ? 169 TRP B NE1 1 
ATOM   2205 C  CE2 . TRP B 1 94  ? -2.343  -30.390 -1.963  1.00 38.33  ? 169 TRP B CE2 1 
ATOM   2206 C  CE3 . TRP B 1 94  ? -2.540  -31.284 -4.229  1.00 40.31  ? 169 TRP B CE3 1 
ATOM   2207 C  CZ2 . TRP B 1 94  ? -1.239  -29.601 -2.315  1.00 40.45  ? 169 TRP B CZ2 1 
ATOM   2208 C  CZ3 . TRP B 1 94  ? -1.433  -30.488 -4.582  1.00 41.48  ? 169 TRP B CZ3 1 
ATOM   2209 C  CH2 . TRP B 1 94  ? -0.799  -29.660 -3.625  1.00 42.26  ? 169 TRP B CH2 1 
ATOM   2210 N  N   . GLY B 1 95  ? -4.609  -35.895 -4.542  1.00 35.66  ? 170 GLY B N   1 
ATOM   2211 C  CA  . GLY B 1 95  ? -5.422  -36.775 -5.369  1.00 32.07  ? 170 GLY B CA  1 
ATOM   2212 C  C   . GLY B 1 95  ? -6.333  -35.962 -6.297  1.00 31.19  ? 170 GLY B C   1 
ATOM   2213 O  O   . GLY B 1 95  ? -7.448  -36.387 -6.610  1.00 29.11  ? 170 GLY B O   1 
ATOM   2214 N  N   . ALA B 1 96  ? -5.876  -34.771 -6.695  1.00 29.12  ? 171 ALA B N   1 
ATOM   2215 C  CA  . ALA B 1 96  ? -6.632  -33.906 -7.594  1.00 29.65  ? 171 ALA B CA  1 
ATOM   2216 C  C   . ALA B 1 96  ? -6.906  -34.580 -8.950  1.00 29.37  ? 171 ALA B C   1 
ATOM   2217 O  O   . ALA B 1 96  ? -8.009  -34.475 -9.492  1.00 29.53  ? 171 ALA B O   1 
ATOM   2218 C  CB  . ALA B 1 96  ? -5.864  -32.604 -7.829  1.00 28.35  ? 171 ALA B CB  1 
ATOM   2219 N  N   . PHE B 1 97  ? -5.890  -35.235 -9.508  1.00 28.65  ? 172 PHE B N   1 
ATOM   2220 C  CA  . PHE B 1 97  ? -6.041  -35.891 -10.805 1.00 29.88  ? 172 PHE B CA  1 
ATOM   2221 C  C   . PHE B 1 97  ? -6.807  -37.188 -10.643 1.00 29.99  ? 172 PHE B C   1 
ATOM   2222 O  O   . PHE B 1 97  ? -6.359  -38.112 -9.968  1.00 30.21  ? 172 PHE B O   1 
ATOM   2223 C  CB  . PHE B 1 97  ? -4.674  -36.143 -11.431 1.00 29.46  ? 172 PHE B CB  1 
ATOM   2224 C  CG  . PHE B 1 97  ? -3.898  -34.892 -11.676 1.00 31.33  ? 172 PHE B CG  1 
ATOM   2225 C  CD1 . PHE B 1 97  ? -4.523  -33.772 -12.233 1.00 32.04  ? 172 PHE B CD1 1 
ATOM   2226 C  CD2 . PHE B 1 97  ? -2.543  -34.825 -11.389 1.00 32.10  ? 172 PHE B CD2 1 
ATOM   2227 C  CE1 . PHE B 1 97  ? -3.802  -32.600 -12.493 1.00 31.99  ? 172 PHE B CE1 1 
ATOM   2228 C  CE2 . PHE B 1 97  ? -1.806  -33.661 -11.640 1.00 32.38  ? 172 PHE B CE2 1 
ATOM   2229 C  CZ  . PHE B 1 97  ? -2.442  -32.546 -12.193 1.00 32.37  ? 172 PHE B CZ  1 
ATOM   2230 N  N   . ARG B 1 98  ? -7.971  -37.245 -11.259 1.00 30.81  ? 173 ARG B N   1 
ATOM   2231 C  CA  . ARG B 1 98  ? -8.829  -38.419 -11.179 1.00 31.35  ? 173 ARG B CA  1 
ATOM   2232 C  C   . ARG B 1 98  ? -8.369  -39.394 -12.256 1.00 31.68  ? 173 ARG B C   1 
ATOM   2233 O  O   . ARG B 1 98  ? -8.650  -40.582 -12.178 1.00 32.83  ? 173 ARG B O   1 
ATOM   2234 C  CB  . ARG B 1 98  ? -10.298 -38.039 -11.424 1.00 30.88  ? 173 ARG B CB  1 
ATOM   2235 C  CG  . ARG B 1 98  ? -10.896 -36.966 -10.488 1.00 36.34  ? 173 ARG B CG  1 
ATOM   2236 C  CD  . ARG B 1 98  ? -10.736 -37.329 -9.018  1.00 39.57  ? 173 ARG B CD  1 
ATOM   2237 N  NE  . ARG B 1 98  ? -11.677 -36.621 -8.142  1.00 43.52  ? 173 ARG B NE  1 
ATOM   2238 C  CZ  . ARG B 1 98  ? -11.850 -35.299 -8.089  1.00 47.10  ? 173 ARG B CZ  1 
ATOM   2239 N  NH1 . ARG B 1 98  ? -11.142 -34.462 -8.873  1.00 48.41  ? 173 ARG B NH1 1 
ATOM   2240 N  NH2 . ARG B 1 98  ? -12.758 -34.802 -7.249  1.00 45.70  ? 173 ARG B NH2 1 
ATOM   2241 N  N   . ALA B 1 99  ? -7.688  -38.877 -13.276 1.00 30.74  ? 174 ALA B N   1 
ATOM   2242 C  CA  . ALA B 1 99  ? -7.174  -39.714 -14.343 1.00 29.34  ? 174 ALA B CA  1 
ATOM   2243 C  C   . ALA B 1 99  ? -6.013  -39.018 -15.029 1.00 28.27  ? 174 ALA B C   1 
ATOM   2244 O  O   . ALA B 1 99  ? -5.845  -37.799 -14.899 1.00 27.08  ? 174 ALA B O   1 
ATOM   2245 C  CB  . ALA B 1 99  ? -8.279  -40.040 -15.341 1.00 29.88  ? 174 ALA B CB  1 
ATOM   2246 N  N   . ARG B 1 100 ? -5.169  -39.805 -15.685 1.00 27.48  ? 175 ARG B N   1 
ATOM   2247 C  CA  . ARG B 1 100 ? -4.003  -39.269 -16.393 1.00 28.98  ? 175 ARG B CA  1 
ATOM   2248 C  C   . ARG B 1 100 ? -3.975  -39.819 -17.823 1.00 29.28  ? 175 ARG B C   1 
ATOM   2249 O  O   . ARG B 1 100 ? -4.078  -41.026 -18.030 1.00 27.42  ? 175 ARG B O   1 
ATOM   2250 C  CB  . ARG B 1 100 ? -2.702  -39.672 -15.680 1.00 28.02  ? 175 ARG B CB  1 
ATOM   2251 C  CG  . ARG B 1 100 ? -2.595  -39.181 -14.243 1.00 28.86  ? 175 ARG B CG  1 
ATOM   2252 C  CD  . ARG B 1 100 ? -1.415  -39.830 -13.536 1.00 28.74  ? 175 ARG B CD  1 
ATOM   2253 N  NE  . ARG B 1 100 ? -1.405  -39.518 -12.103 1.00 29.62  ? 175 ARG B NE  1 
ATOM   2254 C  CZ  . ARG B 1 100 ? -0.418  -39.846 -11.284 1.00 26.44  ? 175 ARG B CZ  1 
ATOM   2255 N  NH1 . ARG B 1 100 ? 0.619   -40.499 -11.759 1.00 25.41  ? 175 ARG B NH1 1 
ATOM   2256 N  NH2 . ARG B 1 100 ? -0.457  -39.494 -10.004 1.00 28.22  ? 175 ARG B NH2 1 
ATOM   2257 N  N   . LEU B 1 101 ? -3.832  -38.927 -18.799 1.00 27.52  ? 176 LEU B N   1 
ATOM   2258 C  CA  . LEU B 1 101 ? -3.792  -39.303 -20.217 1.00 26.62  ? 176 LEU B CA  1 
ATOM   2259 C  C   . LEU B 1 101 ? -2.487  -38.760 -20.803 1.00 27.49  ? 176 LEU B C   1 
ATOM   2260 O  O   . LEU B 1 101 ? -2.130  -37.591 -20.589 1.00 27.89  ? 176 LEU B O   1 
ATOM   2261 C  CB  . LEU B 1 101 ? -4.970  -38.679 -20.963 1.00 24.57  ? 176 LEU B CB  1 
ATOM   2262 C  CG  . LEU B 1 101 ? -6.357  -39.070 -20.460 1.00 25.49  ? 176 LEU B CG  1 
ATOM   2263 C  CD1 . LEU B 1 101 ? -7.442  -38.176 -21.081 1.00 25.74  ? 176 LEU B CD1 1 
ATOM   2264 C  CD2 . LEU B 1 101 ? -6.604  -40.541 -20.803 1.00 26.29  ? 176 LEU B CD2 1 
ATOM   2265 N  N   . PHE B 1 102 ? -1.779  -39.597 -21.555 1.00 27.59  ? 177 PHE B N   1 
ATOM   2266 C  CA  . PHE B 1 102 ? -0.508  -39.188 -22.133 1.00 27.91  ? 177 PHE B CA  1 
ATOM   2267 C  C   . PHE B 1 102 ? -0.480  -38.991 -23.646 1.00 28.95  ? 177 PHE B C   1 
ATOM   2268 O  O   . PHE B 1 102 ? -1.526  -38.902 -24.287 1.00 26.04  ? 177 PHE B O   1 
ATOM   2269 C  CB  . PHE B 1 102 ? 0.567   -40.185 -21.684 1.00 29.60  ? 177 PHE B CB  1 
ATOM   2270 C  CG  . PHE B 1 102 ? 0.504   -40.480 -20.216 1.00 31.13  ? 177 PHE B CG  1 
ATOM   2271 C  CD1 . PHE B 1 102 ? 1.053   -39.606 -19.275 1.00 30.24  ? 177 PHE B CD1 1 
ATOM   2272 C  CD2 . PHE B 1 102 ? -0.191  -41.601 -19.768 1.00 29.84  ? 177 PHE B CD2 1 
ATOM   2273 C  CE1 . PHE B 1 102 ? 0.908   -39.852 -17.907 1.00 29.75  ? 177 PHE B CE1 1 
ATOM   2274 C  CE2 . PHE B 1 102 ? -0.338  -41.856 -18.402 1.00 30.47  ? 177 PHE B CE2 1 
ATOM   2275 C  CZ  . PHE B 1 102 ? 0.213   -40.976 -17.472 1.00 29.73  ? 177 PHE B CZ  1 
ATOM   2276 N  N   . ARG B 1 103 ? 0.731   -38.890 -24.192 1.00 29.20  ? 178 ARG B N   1 
ATOM   2277 C  CA  . ARG B 1 103 ? 0.924   -38.655 -25.610 1.00 32.13  ? 178 ARG B CA  1 
ATOM   2278 C  C   . ARG B 1 103 ? 0.064   -39.551 -26.517 1.00 32.61  ? 178 ARG B C   1 
ATOM   2279 O  O   . ARG B 1 103 ? -0.578  -39.052 -27.445 1.00 32.64  ? 178 ARG B O   1 
ATOM   2280 C  CB  . ARG B 1 103 ? 2.409   -38.807 -25.959 1.00 33.02  ? 178 ARG B CB  1 
ATOM   2281 C  CG  . ARG B 1 103 ? 2.750   -38.445 -27.399 1.00 34.17  ? 178 ARG B CG  1 
ATOM   2282 C  CD  . ARG B 1 103 ? 4.213   -38.608 -27.662 1.00 35.78  ? 178 ARG B CD  1 
ATOM   2283 N  NE  . ARG B 1 103 ? 4.994   -37.675 -26.866 1.00 36.66  ? 178 ARG B NE  1 
ATOM   2284 C  CZ  . ARG B 1 103 ? 6.320   -37.646 -26.837 1.00 39.60  ? 178 ARG B CZ  1 
ATOM   2285 N  NH1 . ARG B 1 103 ? 7.029   -38.498 -27.569 1.00 37.60  ? 178 ARG B NH1 1 
ATOM   2286 N  NH2 . ARG B 1 103 ? 6.941   -36.754 -26.071 1.00 40.78  ? 178 ARG B NH2 1 
ATOM   2287 N  N   . GLU B 1 104 ? 0.032   -40.852 -26.231 1.00 33.45  ? 179 GLU B N   1 
ATOM   2288 C  CA  . GLU B 1 104 ? -0.754  -41.798 -27.026 1.00 35.69  ? 179 GLU B CA  1 
ATOM   2289 C  C   . GLU B 1 104 ? -2.239  -41.465 -27.062 1.00 35.33  ? 179 GLU B C   1 
ATOM   2290 O  O   . GLU B 1 104 ? -2.937  -41.895 -27.977 1.00 35.70  ? 179 GLU B O   1 
ATOM   2291 C  CB  . GLU B 1 104 ? -0.609  -43.218 -26.509 1.00 37.95  ? 179 GLU B CB  1 
ATOM   2292 C  CG  . GLU B 1 104 ? 0.735   -43.494 -25.915 1.00 45.34  ? 179 GLU B CG  1 
ATOM   2293 C  CD  . GLU B 1 104 ? 0.761   -43.077 -24.474 1.00 46.17  ? 179 GLU B CD  1 
ATOM   2294 O  OE1 . GLU B 1 104 ? -0.214  -43.403 -23.742 1.00 46.89  ? 179 GLU B OE1 1 
ATOM   2295 O  OE2 . GLU B 1 104 ? 1.752   -42.433 -24.095 1.00 49.09  ? 179 GLU B OE2 1 
ATOM   2296 N  N   . SER B 1 105 ? -2.721  -40.696 -26.090 1.00 33.89  ? 180 SER B N   1 
ATOM   2297 C  CA  . SER B 1 105 ? -4.140  -40.371 -26.085 1.00 31.70  ? 180 SER B CA  1 
ATOM   2298 C  C   . SER B 1 105 ? -4.412  -39.080 -26.851 1.00 31.68  ? 180 SER B C   1 
ATOM   2299 O  O   . SER B 1 105 ? -5.563  -38.698 -27.040 1.00 29.96  ? 180 SER B O   1 
ATOM   2300 C  CB  . SER B 1 105 ? -4.664  -40.310 -24.639 1.00 33.75  ? 180 SER B CB  1 
ATOM   2301 O  OG  . SER B 1 105 ? -4.578  -41.581 -23.989 1.00 30.04  ? 180 SER B OG  1 
ATOM   2302 N  N   . CYS B 1 106 ? -3.344  -38.422 -27.305 1.00 30.65  ? 181 CYS B N   1 
ATOM   2303 C  CA  . CYS B 1 106 ? -3.467  -37.201 -28.093 1.00 31.31  ? 181 CYS B CA  1 
ATOM   2304 C  C   . CYS B 1 106 ? -3.568  -37.614 -29.552 1.00 32.30  ? 181 CYS B C   1 
ATOM   2305 O  O   . CYS B 1 106 ? -3.209  -38.725 -29.927 1.00 31.31  ? 181 CYS B O   1 
ATOM   2306 C  CB  . CYS B 1 106 ? -2.213  -36.310 -27.964 1.00 31.70  ? 181 CYS B CB  1 
ATOM   2307 S  SG  . CYS B 1 106 ? -1.840  -35.713 -26.276 1.00 31.31  ? 181 CYS B SG  1 
ATOM   2308 N  N   . VAL B 1 107 ? -4.046  -36.704 -30.387 1.00 32.27  ? 182 VAL B N   1 
ATOM   2309 C  CA  . VAL B 1 107 ? -4.129  -36.951 -31.829 1.00 35.36  ? 182 VAL B CA  1 
ATOM   2310 C  C   . VAL B 1 107 ? -3.049  -36.074 -32.470 1.00 35.48  ? 182 VAL B C   1 
ATOM   2311 O  O   . VAL B 1 107 ? -3.023  -34.865 -32.250 1.00 34.02  ? 182 VAL B O   1 
ATOM   2312 C  CB  . VAL B 1 107 ? -5.510  -36.556 -32.409 1.00 36.61  ? 182 VAL B CB  1 
ATOM   2313 C  CG1 . VAL B 1 107 ? -5.880  -35.186 -31.942 1.00 39.51  ? 182 VAL B CG1 1 
ATOM   2314 C  CG2 . VAL B 1 107 ? -5.480  -36.540 -33.921 1.00 35.82  ? 182 VAL B CG2 1 
ATOM   2315 N  N   . PHE B 1 108 ? -2.136  -36.693 -33.218 1.00 34.23  ? 183 PHE B N   1 
ATOM   2316 C  CA  . PHE B 1 108 ? -1.079  -35.953 -33.889 1.00 34.08  ? 183 PHE B CA  1 
ATOM   2317 C  C   . PHE B 1 108 ? -1.722  -35.424 -35.161 1.00 33.58  ? 183 PHE B C   1 
ATOM   2318 O  O   . PHE B 1 108 ? -2.051  -36.184 -36.062 1.00 34.63  ? 183 PHE B O   1 
ATOM   2319 C  CB  . PHE B 1 108 ? 0.088   -36.874 -34.219 1.00 33.72  ? 183 PHE B CB  1 
ATOM   2320 C  CG  . PHE B 1 108 ? 1.333   -36.141 -34.652 1.00 33.68  ? 183 PHE B CG  1 
ATOM   2321 C  CD1 . PHE B 1 108 ? 1.859   -35.122 -33.861 1.00 33.72  ? 183 PHE B CD1 1 
ATOM   2322 C  CD2 . PHE B 1 108 ? 2.019   -36.524 -35.819 1.00 33.27  ? 183 PHE B CD2 1 
ATOM   2323 C  CE1 . PHE B 1 108 ? 3.058   -34.484 -34.208 1.00 33.75  ? 183 PHE B CE1 1 
ATOM   2324 C  CE2 . PHE B 1 108 ? 3.228   -35.873 -36.161 1.00 34.32  ? 183 PHE B CE2 1 
ATOM   2325 C  CZ  . PHE B 1 108 ? 3.735   -34.856 -35.342 1.00 32.17  ? 183 PHE B CZ  1 
ATOM   2326 N  N   . HIS B 1 109 ? -1.954  -34.124 -35.212 1.00 32.68  ? 184 HIS B N   1 
ATOM   2327 C  CA  . HIS B 1 109 ? -2.614  -33.513 -36.353 1.00 30.95  ? 184 HIS B CA  1 
ATOM   2328 C  C   . HIS B 1 109 ? -1.817  -32.335 -36.873 1.00 31.48  ? 184 HIS B C   1 
ATOM   2329 O  O   . HIS B 1 109 ? -1.586  -31.362 -36.148 1.00 29.56  ? 184 HIS B O   1 
ATOM   2330 C  CB  . HIS B 1 109 ? -4.021  -33.073 -35.936 1.00 31.36  ? 184 HIS B CB  1 
ATOM   2331 C  CG  . HIS B 1 109 ? -4.717  -32.230 -36.952 1.00 31.89  ? 184 HIS B CG  1 
ATOM   2332 N  ND1 . HIS B 1 109 ? -4.881  -30.871 -36.796 1.00 33.73  ? 184 HIS B ND1 1 
ATOM   2333 C  CD2 . HIS B 1 109 ? -5.308  -32.551 -38.129 1.00 30.87  ? 184 HIS B CD2 1 
ATOM   2334 C  CE1 . HIS B 1 109 ? -5.549  -30.389 -37.829 1.00 32.02  ? 184 HIS B CE1 1 
ATOM   2335 N  NE2 . HIS B 1 109 ? -5.820  -31.387 -38.652 1.00 34.92  ? 184 HIS B NE2 1 
ATOM   2336 N  N   . ARG B 1 110 ? -1.369  -32.450 -38.117 1.00 31.59  ? 185 ARG B N   1 
ATOM   2337 C  CA  . ARG B 1 110 ? -0.592  -31.415 -38.776 1.00 33.37  ? 185 ARG B CA  1 
ATOM   2338 C  C   . ARG B 1 110 ? 0.604   -30.950 -37.946 1.00 33.39  ? 185 ARG B C   1 
ATOM   2339 O  O   . ARG B 1 110 ? 0.863   -29.751 -37.796 1.00 31.14  ? 185 ARG B O   1 
ATOM   2340 C  CB  . ARG B 1 110 ? -1.512  -30.249 -39.153 1.00 35.90  ? 185 ARG B CB  1 
ATOM   2341 C  CG  . ARG B 1 110 ? -2.667  -30.727 -40.052 1.00 41.97  ? 185 ARG B CG  1 
ATOM   2342 C  CD  . ARG B 1 110 ? -3.721  -29.660 -40.345 1.00 43.82  ? 185 ARG B CD  1 
ATOM   2343 N  NE  . ARG B 1 110 ? -3.476  -28.935 -41.578 1.00 48.57  ? 185 ARG B NE  1 
ATOM   2344 C  CZ  . ARG B 1 110 ? -2.879  -27.756 -41.640 1.00 49.13  ? 185 ARG B CZ  1 
ATOM   2345 N  NH1 . ARG B 1 110 ? -2.457  -27.162 -40.536 1.00 51.59  ? 185 ARG B NH1 1 
ATOM   2346 N  NH2 . ARG B 1 110 ? -2.731  -27.158 -42.817 1.00 52.19  ? 185 ARG B NH2 1 
ATOM   2347 N  N   . GLY B 1 111 ? 1.328   -31.925 -37.400 1.00 32.46  ? 186 GLY B N   1 
ATOM   2348 C  CA  . GLY B 1 111 ? 2.515   -31.623 -36.612 1.00 33.45  ? 186 GLY B CA  1 
ATOM   2349 C  C   . GLY B 1 111 ? 2.312   -31.237 -35.161 1.00 33.56  ? 186 GLY B C   1 
ATOM   2350 O  O   . GLY B 1 111 ? 3.300   -30.982 -34.460 1.00 33.85  ? 186 GLY B O   1 
ATOM   2351 N  N   . ASN B 1 112 ? 1.056   -31.160 -34.713 1.00 32.99  ? 187 ASN B N   1 
ATOM   2352 C  CA  . ASN B 1 112 ? 0.767   -30.809 -33.323 1.00 33.20  ? 187 ASN B CA  1 
ATOM   2353 C  C   . ASN B 1 112 ? -0.023  -31.915 -32.625 1.00 34.12  ? 187 ASN B C   1 
ATOM   2354 O  O   . ASN B 1 112 ? -0.810  -32.636 -33.267 1.00 32.14  ? 187 ASN B O   1 
ATOM   2355 C  CB  . ASN B 1 112 ? -0.037  -29.511 -33.190 1.00 34.38  ? 187 ASN B CB  1 
ATOM   2356 C  CG  . ASN B 1 112 ? 0.693   -28.292 -33.730 1.00 36.28  ? 187 ASN B CG  1 
ATOM   2357 O  OD1 . ASN B 1 112 ? 0.190   -27.649 -34.657 1.00 38.66  ? 187 ASN B OD1 1 
ATOM   2358 N  ND2 . ASN B 1 112 ? 1.764   -27.976 -33.219 1.00 34.08  ? 187 ASN B ND2 1 
ATOM   2359 N  N   . TYR B 1 113 ? 0.200   -32.050 -31.314 1.00 32.30  ? 188 TYR B N   1 
ATOM   2360 C  CA  . TYR B 1 113 ? -0.512  -33.029 -30.503 1.00 31.58  ? 188 TYR B CA  1 
ATOM   2361 C  C   . TYR B 1 113 ? -1.766  -32.362 -29.979 1.00 31.63  ? 188 TYR B C   1 
ATOM   2362 O  O   . TYR B 1 113 ? -1.710  -31.450 -29.154 1.00 33.65  ? 188 TYR B O   1 
ATOM   2363 C  CB  . TYR B 1 113 ? 0.351   -33.501 -29.336 1.00 30.91  ? 188 TYR B CB  1 
ATOM   2364 C  CG  . TYR B 1 113 ? 1.496   -34.364 -29.770 1.00 29.89  ? 188 TYR B CG  1 
ATOM   2365 C  CD1 . TYR B 1 113 ? 1.324   -35.735 -29.995 1.00 31.18  ? 188 TYR B CD1 1 
ATOM   2366 C  CD2 . TYR B 1 113 ? 2.768   -33.812 -29.969 1.00 32.96  ? 188 TYR B CD2 1 
ATOM   2367 C  CE1 . TYR B 1 113 ? 2.397   -36.558 -30.396 1.00 31.12  ? 188 TYR B CE1 1 
ATOM   2368 C  CE2 . TYR B 1 113 ? 3.856   -34.616 -30.390 1.00 35.11  ? 188 TYR B CE2 1 
ATOM   2369 C  CZ  . TYR B 1 113 ? 3.642   -35.986 -30.589 1.00 33.11  ? 188 TYR B CZ  1 
ATOM   2370 O  OH  . TYR B 1 113 ? 4.695   -36.777 -30.958 1.00 35.46  ? 188 TYR B OH  1 
ATOM   2371 N  N   . VAL B 1 114 ? -2.907  -32.818 -30.464 1.00 30.69  ? 189 VAL B N   1 
ATOM   2372 C  CA  . VAL B 1 114 ? -4.172  -32.220 -30.082 1.00 31.26  ? 189 VAL B CA  1 
ATOM   2373 C  C   . VAL B 1 114 ? -4.924  -33.052 -29.053 1.00 32.68  ? 189 VAL B C   1 
ATOM   2374 O  O   . VAL B 1 114 ? -4.994  -34.281 -29.167 1.00 30.84  ? 189 VAL B O   1 
ATOM   2375 C  CB  . VAL B 1 114 ? -5.056  -32.000 -31.329 1.00 31.79  ? 189 VAL B CB  1 
ATOM   2376 C  CG1 . VAL B 1 114 ? -6.423  -31.464 -30.924 1.00 31.38  ? 189 VAL B CG1 1 
ATOM   2377 C  CG2 . VAL B 1 114 ? -4.349  -31.031 -32.292 1.00 32.17  ? 189 VAL B CG2 1 
ATOM   2378 N  N   . LYS B 1 115 ? -5.469  -32.372 -28.045 1.00 32.60  ? 190 LYS B N   1 
ATOM   2379 C  CA  . LYS B 1 115 ? -6.245  -33.046 -27.016 1.00 33.56  ? 190 LYS B CA  1 
ATOM   2380 C  C   . LYS B 1 115 ? -7.677  -33.026 -27.534 1.00 33.00  ? 190 LYS B C   1 
ATOM   2381 O  O   . LYS B 1 115 ? -8.372  -32.029 -27.410 1.00 32.14  ? 190 LYS B O   1 
ATOM   2382 C  CB  . LYS B 1 115 ? -6.163  -32.294 -25.680 1.00 32.10  ? 190 LYS B CB  1 
ATOM   2383 C  CG  . LYS B 1 115 ? -4.893  -32.533 -24.892 1.00 35.52  ? 190 LYS B CG  1 
ATOM   2384 C  CD  . LYS B 1 115 ? -3.695  -31.793 -25.439 1.00 35.45  ? 190 LYS B CD  1 
ATOM   2385 C  CE  . LYS B 1 115 ? -2.434  -32.164 -24.652 1.00 36.51  ? 190 LYS B CE  1 
ATOM   2386 N  NZ  . LYS B 1 115 ? -1.331  -31.162 -24.822 1.00 37.46  ? 190 LYS B NZ  1 
ATOM   2387 N  N   . ASP B 1 116 ? -8.112  -34.125 -28.129 1.00 34.19  ? 191 ASP B N   1 
ATOM   2388 C  CA  . ASP B 1 116 ? -9.464  -34.190 -28.681 1.00 35.63  ? 191 ASP B CA  1 
ATOM   2389 C  C   . ASP B 1 116 ? -10.478 -34.455 -27.571 1.00 32.19  ? 191 ASP B C   1 
ATOM   2390 O  O   . ASP B 1 116 ? -10.739 -35.609 -27.186 1.00 33.06  ? 191 ASP B O   1 
ATOM   2391 C  CB  . ASP B 1 116 ? -9.534  -35.277 -29.765 1.00 37.49  ? 191 ASP B CB  1 
ATOM   2392 C  CG  . ASP B 1 116 ? -10.888 -35.335 -30.452 1.00 40.75  ? 191 ASP B CG  1 
ATOM   2393 O  OD1 . ASP B 1 116 ? -11.762 -34.482 -30.162 1.00 38.13  ? 191 ASP B OD1 1 
ATOM   2394 O  OD2 . ASP B 1 116 ? -11.065 -36.249 -31.300 1.00 44.41  ? 191 ASP B OD2 1 
ATOM   2395 N  N   . LEU B 1 117 ? -11.063 -33.369 -27.077 1.00 31.87  ? 192 LEU B N   1 
ATOM   2396 C  CA  . LEU B 1 117 ? -11.999 -33.435 -25.970 1.00 30.66  ? 192 LEU B CA  1 
ATOM   2397 C  C   . LEU B 1 117 ? -13.173 -34.368 -26.250 1.00 31.65  ? 192 LEU B C   1 
ATOM   2398 O  O   . LEU B 1 117 ? -13.744 -34.938 -25.326 1.00 28.59  ? 192 LEU B O   1 
ATOM   2399 C  CB  . LEU B 1 117 ? -12.493 -32.027 -25.615 1.00 30.84  ? 192 LEU B CB  1 
ATOM   2400 C  CG  . LEU B 1 117 ? -11.417 -30.996 -25.213 1.00 30.55  ? 192 LEU B CG  1 
ATOM   2401 C  CD1 . LEU B 1 117 ? -12.070 -29.717 -24.756 1.00 27.94  ? 192 LEU B CD1 1 
ATOM   2402 C  CD2 . LEU B 1 117 ? -10.533 -31.529 -24.104 1.00 27.82  ? 192 LEU B CD2 1 
ATOM   2403 N  N   . SER B 1 118 ? -13.504 -34.532 -27.527 1.00 32.51  ? 193 SER B N   1 
ATOM   2404 C  CA  . SER B 1 118 ? -14.601 -35.398 -27.938 1.00 34.02  ? 193 SER B CA  1 
ATOM   2405 C  C   . SER B 1 118 ? -14.431 -36.878 -27.608 1.00 34.57  ? 193 SER B C   1 
ATOM   2406 O  O   . SER B 1 118 ? -15.414 -37.611 -27.511 1.00 34.80  ? 193 SER B O   1 
ATOM   2407 C  CB  . SER B 1 118 ? -14.851 -35.235 -29.430 1.00 34.11  ? 193 SER B CB  1 
ATOM   2408 O  OG  . SER B 1 118 ? -15.283 -33.909 -29.673 1.00 37.83  ? 193 SER B OG  1 
ATOM   2409 N  N   . ARG B 1 119 ? -13.198 -37.328 -27.434 1.00 35.86  ? 194 ARG B N   1 
ATOM   2410 C  CA  . ARG B 1 119 ? -12.984 -38.732 -27.121 1.00 39.37  ? 194 ARG B CA  1 
ATOM   2411 C  C   . ARG B 1 119 ? -12.937 -38.979 -25.592 1.00 37.91  ? 194 ARG B C   1 
ATOM   2412 O  O   . ARG B 1 119 ? -12.744 -40.105 -25.123 1.00 37.02  ? 194 ARG B O   1 
ATOM   2413 C  CB  . ARG B 1 119 ? -11.688 -39.202 -27.802 1.00 45.58  ? 194 ARG B CB  1 
ATOM   2414 C  CG  . ARG B 1 119 ? -11.435 -40.715 -27.746 1.00 54.22  ? 194 ARG B CG  1 
ATOM   2415 C  CD  . ARG B 1 119 ? -10.306 -41.117 -28.704 1.00 62.79  ? 194 ARG B CD  1 
ATOM   2416 N  NE  . ARG B 1 119 ? -9.688  -42.398 -28.350 1.00 71.06  ? 194 ARG B NE  1 
ATOM   2417 C  CZ  . ARG B 1 119 ? -10.326 -43.566 -28.330 1.00 76.21  ? 194 ARG B CZ  1 
ATOM   2418 N  NH1 . ARG B 1 119 ? -11.618 -43.637 -28.646 1.00 79.37  ? 194 ARG B NH1 1 
ATOM   2419 N  NH2 . ARG B 1 119 ? -9.671  -44.671 -27.993 1.00 78.96  ? 194 ARG B NH2 1 
ATOM   2420 N  N   . LEU B 1 120 ? -13.166 -37.917 -24.829 1.00 35.44  ? 195 LEU B N   1 
ATOM   2421 C  CA  . LEU B 1 120 ? -13.126 -37.981 -23.366 1.00 35.77  ? 195 LEU B CA  1 
ATOM   2422 C  C   . LEU B 1 120 ? -14.244 -38.827 -22.750 1.00 35.71  ? 195 LEU B C   1 
ATOM   2423 O  O   . LEU B 1 120 ? -14.004 -39.690 -21.896 1.00 33.36  ? 195 LEU B O   1 
ATOM   2424 C  CB  . LEU B 1 120 ? -13.204 -36.559 -22.800 1.00 35.48  ? 195 LEU B CB  1 
ATOM   2425 C  CG  . LEU B 1 120 ? -12.063 -35.917 -22.003 1.00 36.11  ? 195 LEU B CG  1 
ATOM   2426 C  CD1 . LEU B 1 120 ? -10.704 -36.448 -22.378 1.00 33.00  ? 195 LEU B CD1 1 
ATOM   2427 C  CD2 . LEU B 1 120 ? -12.142 -34.419 -22.225 1.00 34.92  ? 195 LEU B CD2 1 
ATOM   2428 N  N   . GLY B 1 121 ? -15.471 -38.584 -23.200 1.00 33.81  ? 196 GLY B N   1 
ATOM   2429 C  CA  . GLY B 1 121 ? -16.608 -39.297 -22.642 1.00 33.44  ? 196 GLY B CA  1 
ATOM   2430 C  C   . GLY B 1 121 ? -17.341 -38.400 -21.649 1.00 32.04  ? 196 GLY B C   1 
ATOM   2431 O  O   . GLY B 1 121 ? -17.953 -38.861 -20.681 1.00 33.50  ? 196 GLY B O   1 
ATOM   2432 N  N   . ARG B 1 122 ? -17.261 -37.102 -21.875 1.00 30.29  ? 197 ARG B N   1 
ATOM   2433 C  CA  . ARG B 1 122 ? -17.937 -36.147 -21.009 1.00 30.84  ? 197 ARG B CA  1 
ATOM   2434 C  C   . ARG B 1 122 ? -18.713 -35.197 -21.904 1.00 30.14  ? 197 ARG B C   1 
ATOM   2435 O  O   . ARG B 1 122 ? -18.285 -34.907 -23.011 1.00 30.46  ? 197 ARG B O   1 
ATOM   2436 C  CB  . ARG B 1 122 ? -16.911 -35.332 -20.184 1.00 31.13  ? 197 ARG B CB  1 
ATOM   2437 C  CG  . ARG B 1 122 ? -16.097 -36.155 -19.222 1.00 32.66  ? 197 ARG B CG  1 
ATOM   2438 C  CD  . ARG B 1 122 ? -16.892 -36.411 -17.962 1.00 33.99  ? 197 ARG B CD  1 
ATOM   2439 N  NE  . ARG B 1 122 ? -16.818 -37.811 -17.579 1.00 38.80  ? 197 ARG B NE  1 
ATOM   2440 C  CZ  . ARG B 1 122 ? -15.748 -38.379 -17.056 1.00 39.04  ? 197 ARG B CZ  1 
ATOM   2441 N  NH1 . ARG B 1 122 ? -14.668 -37.650 -16.838 1.00 45.36  ? 197 ARG B NH1 1 
ATOM   2442 N  NH2 . ARG B 1 122 ? -15.737 -39.666 -16.811 1.00 35.78  ? 197 ARG B NH2 1 
ATOM   2443 N  N   . ASP B 1 123 ? -19.845 -34.717 -21.413 1.00 30.92  ? 198 ASP B N   1 
ATOM   2444 C  CA  . ASP B 1 123 ? -20.664 -33.758 -22.136 1.00 30.86  ? 198 ASP B CA  1 
ATOM   2445 C  C   . ASP B 1 123 ? -19.811 -32.506 -22.330 1.00 30.84  ? 198 ASP B C   1 
ATOM   2446 O  O   . ASP B 1 123 ? -19.418 -31.864 -21.350 1.00 31.93  ? 198 ASP B O   1 
ATOM   2447 C  CB  . ASP B 1 123 ? -21.881 -33.417 -21.304 1.00 31.91  ? 198 ASP B CB  1 
ATOM   2448 C  CG  . ASP B 1 123 ? -22.825 -32.496 -22.021 1.00 34.90  ? 198 ASP B CG  1 
ATOM   2449 O  OD1 . ASP B 1 123 ? -22.355 -31.556 -22.691 1.00 35.35  ? 198 ASP B OD1 1 
ATOM   2450 O  OD2 . ASP B 1 123 ? -24.047 -32.716 -21.901 1.00 38.74  ? 198 ASP B OD2 1 
ATOM   2451 N  N   . LEU B 1 124 ? -19.559 -32.141 -23.580 1.00 29.82  ? 199 LEU B N   1 
ATOM   2452 C  CA  . LEU B 1 124 ? -18.711 -30.990 -23.869 1.00 31.47  ? 199 LEU B CA  1 
ATOM   2453 C  C   . LEU B 1 124 ? -19.135 -29.661 -23.268 1.00 30.80  ? 199 LEU B C   1 
ATOM   2454 O  O   . LEU B 1 124 ? -18.328 -28.729 -23.191 1.00 29.57  ? 199 LEU B O   1 
ATOM   2455 C  CB  . LEU B 1 124 ? -18.507 -30.856 -25.372 1.00 31.56  ? 199 LEU B CB  1 
ATOM   2456 C  CG  . LEU B 1 124 ? -17.670 -32.008 -25.945 1.00 35.26  ? 199 LEU B CG  1 
ATOM   2457 C  CD1 . LEU B 1 124 ? -17.616 -31.862 -27.460 1.00 34.73  ? 199 LEU B CD1 1 
ATOM   2458 C  CD2 . LEU B 1 124 ? -16.238 -31.955 -25.400 1.00 34.08  ? 199 LEU B CD2 1 
ATOM   2459 N  N   . ARG B 1 125 ? -20.393 -29.560 -22.847 1.00 31.20  ? 200 ARG B N   1 
ATOM   2460 C  CA  . ARG B 1 125 ? -20.874 -28.329 -22.222 1.00 31.16  ? 200 ARG B CA  1 
ATOM   2461 C  C   . ARG B 1 125 ? -20.379 -28.284 -20.775 1.00 30.05  ? 200 ARG B C   1 
ATOM   2462 O  O   . ARG B 1 125 ? -20.528 -27.269 -20.097 1.00 27.73  ? 200 ARG B O   1 
ATOM   2463 C  CB  . ARG B 1 125 ? -22.396 -28.284 -22.232 1.00 33.72  ? 200 ARG B CB  1 
ATOM   2464 C  CG  . ARG B 1 125 ? -22.984 -28.188 -23.633 1.00 36.85  ? 200 ARG B CG  1 
ATOM   2465 C  CD  . ARG B 1 125 ? -24.452 -27.874 -23.559 1.00 40.92  ? 200 ARG B CD  1 
ATOM   2466 N  NE  . ARG B 1 125 ? -25.216 -28.911 -22.881 1.00 46.34  ? 200 ARG B NE  1 
ATOM   2467 C  CZ  . ARG B 1 125 ? -25.317 -30.160 -23.318 1.00 49.61  ? 200 ARG B CZ  1 
ATOM   2468 N  NH1 . ARG B 1 125 ? -24.690 -30.523 -24.432 1.00 53.03  ? 200 ARG B NH1 1 
ATOM   2469 N  NH2 . ARG B 1 125 ? -26.069 -31.036 -22.665 1.00 49.80  ? 200 ARG B NH2 1 
ATOM   2470 N  N   . ARG B 1 126 ? -19.777 -29.387 -20.335 1.00 26.49  ? 201 ARG B N   1 
ATOM   2471 C  CA  . ARG B 1 126 ? -19.243 -29.476 -18.985 1.00 27.11  ? 201 ARG B CA  1 
ATOM   2472 C  C   . ARG B 1 126 ? -17.786 -29.950 -18.960 1.00 25.62  ? 201 ARG B C   1 
ATOM   2473 O  O   . ARG B 1 126 ? -17.358 -30.702 -18.074 1.00 26.18  ? 201 ARG B O   1 
ATOM   2474 C  CB  . ARG B 1 126 ? -20.136 -30.379 -18.124 1.00 28.19  ? 201 ARG B CB  1 
ATOM   2475 C  CG  . ARG B 1 126 ? -21.509 -29.744 -17.817 1.00 32.92  ? 201 ARG B CG  1 
ATOM   2476 C  CD  . ARG B 1 126 ? -22.374 -30.597 -16.884 1.00 35.54  ? 201 ARG B CD  1 
ATOM   2477 N  NE  . ARG B 1 126 ? -21.915 -30.606 -15.492 1.00 40.42  ? 201 ARG B NE  1 
ATOM   2478 C  CZ  . ARG B 1 126 ? -21.874 -29.536 -14.696 1.00 41.72  ? 201 ARG B CZ  1 
ATOM   2479 N  NH1 . ARG B 1 126 ? -22.273 -28.353 -15.150 1.00 42.64  ? 201 ARG B NH1 1 
ATOM   2480 N  NH2 . ARG B 1 126 ? -21.396 -29.643 -13.460 1.00 40.29  ? 201 ARG B NH2 1 
ATOM   2481 N  N   . VAL B 1 127 ? -17.019 -29.481 -19.931 1.00 24.72  ? 202 VAL B N   1 
ATOM   2482 C  CA  . VAL B 1 127 ? -15.612 -29.821 -20.030 1.00 24.69  ? 202 VAL B CA  1 
ATOM   2483 C  C   . VAL B 1 127 ? -14.835 -28.529 -20.291 1.00 25.75  ? 202 VAL B C   1 
ATOM   2484 O  O   . VAL B 1 127 ? -15.288 -27.644 -21.042 1.00 27.76  ? 202 VAL B O   1 
ATOM   2485 C  CB  . VAL B 1 127 ? -15.336 -30.772 -21.206 1.00 24.71  ? 202 VAL B CB  1 
ATOM   2486 C  CG1 . VAL B 1 127 ? -13.800 -31.021 -21.374 1.00 23.29  ? 202 VAL B CG1 1 
ATOM   2487 C  CG2 . VAL B 1 127 ? -16.088 -32.061 -20.997 1.00 24.01  ? 202 VAL B CG2 1 
ATOM   2488 N  N   . LEU B 1 128 ? -13.674 -28.421 -19.668 1.00 23.49  ? 203 LEU B N   1 
ATOM   2489 C  CA  . LEU B 1 128 ? -12.779 -27.290 -19.868 1.00 22.83  ? 203 LEU B CA  1 
ATOM   2490 C  C   . LEU B 1 128 ? -11.375 -27.822 -20.128 1.00 23.42  ? 203 LEU B C   1 
ATOM   2491 O  O   . LEU B 1 128 ? -11.052 -28.943 -19.716 1.00 23.77  ? 203 LEU B O   1 
ATOM   2492 C  CB  . LEU B 1 128 ? -12.735 -26.413 -18.624 1.00 24.44  ? 203 LEU B CB  1 
ATOM   2493 C  CG  . LEU B 1 128 ? -14.007 -25.648 -18.244 1.00 24.25  ? 203 LEU B CG  1 
ATOM   2494 C  CD1 . LEU B 1 128 ? -13.905 -25.139 -16.802 1.00 24.33  ? 203 LEU B CD1 1 
ATOM   2495 C  CD2 . LEU B 1 128 ? -14.225 -24.508 -19.205 1.00 24.46  ? 203 LEU B CD2 1 
ATOM   2496 N  N   . ILE B 1 129 ? -10.545 -27.043 -20.820 1.00 21.46  ? 204 ILE B N   1 
ATOM   2497 C  CA  . ILE B 1 129 ? -9.180  -27.442 -21.027 1.00 22.95  ? 204 ILE B CA  1 
ATOM   2498 C  C   . ILE B 1 129 ? -8.262  -26.265 -20.702 1.00 25.31  ? 204 ILE B C   1 
ATOM   2499 O  O   . ILE B 1 129 ? -8.466  -25.140 -21.145 1.00 24.97  ? 204 ILE B O   1 
ATOM   2500 C  CB  . ILE B 1 129 ? -8.904  -27.985 -22.458 1.00 24.59  ? 204 ILE B CB  1 
ATOM   2501 C  CG1 . ILE B 1 129 ? -7.425  -28.295 -22.599 1.00 23.86  ? 204 ILE B CG1 1 
ATOM   2502 C  CG2 . ILE B 1 129 ? -9.360  -26.995 -23.529 1.00 25.02  ? 204 ILE B CG2 1 
ATOM   2503 C  CD1 . ILE B 1 129 ? -7.029  -29.022 -23.879 1.00 25.25  ? 204 ILE B CD1 1 
ATOM   2504 N  N   . LEU B 1 130 ? -7.277  -26.533 -19.843 1.00 25.48  ? 205 LEU B N   1 
ATOM   2505 C  CA  . LEU B 1 130 ? -6.295  -25.531 -19.453 1.00 25.73  ? 205 LEU B CA  1 
ATOM   2506 C  C   . LEU B 1 130 ? -4.960  -26.020 -20.018 1.00 26.60  ? 205 LEU B C   1 
ATOM   2507 O  O   . LEU B 1 130 ? -4.383  -27.015 -19.540 1.00 27.01  ? 205 LEU B O   1 
ATOM   2508 C  CB  . LEU B 1 130 ? -6.239  -25.410 -17.911 1.00 27.18  ? 205 LEU B CB  1 
ATOM   2509 C  CG  . LEU B 1 130 ? -5.086  -24.583 -17.340 1.00 28.80  ? 205 LEU B CG  1 
ATOM   2510 C  CD1 . LEU B 1 130 ? -5.391  -23.106 -17.555 1.00 26.74  ? 205 LEU B CD1 1 
ATOM   2511 C  CD2 . LEU B 1 130 ? -4.899  -24.873 -15.838 1.00 29.42  ? 205 LEU B CD2 1 
ATOM   2512 N  N   . ASP B 1 131 ? -4.490  -25.344 -21.063 1.00 26.24  ? 206 ASP B N   1 
ATOM   2513 C  CA  . ASP B 1 131 ? -3.226  -25.719 -21.684 1.00 29.05  ? 206 ASP B CA  1 
ATOM   2514 C  C   . ASP B 1 131 ? -2.475  -24.456 -22.105 1.00 29.48  ? 206 ASP B C   1 
ATOM   2515 O  O   . ASP B 1 131 ? -3.093  -23.409 -22.366 1.00 28.28  ? 206 ASP B O   1 
ATOM   2516 C  CB  . ASP B 1 131 ? -3.509  -26.609 -22.899 1.00 31.22  ? 206 ASP B CB  1 
ATOM   2517 C  CG  . ASP B 1 131 ? -2.304  -27.411 -23.347 1.00 36.50  ? 206 ASP B CG  1 
ATOM   2518 O  OD1 . ASP B 1 131 ? -1.296  -26.817 -23.797 1.00 37.26  ? 206 ASP B OD1 1 
ATOM   2519 O  OD2 . ASP B 1 131 ? -2.372  -28.658 -23.254 1.00 38.85  ? 206 ASP B OD2 1 
ATOM   2520 N  N   . ASN B 1 132 ? -1.155  -24.555 -22.185 1.00 27.18  ? 207 ASN B N   1 
ATOM   2521 C  CA  . ASN B 1 132 ? -0.356  -23.400 -22.600 1.00 29.83  ? 207 ASN B CA  1 
ATOM   2522 C  C   . ASN B 1 132 ? -0.211  -23.286 -24.114 1.00 30.37  ? 207 ASN B C   1 
ATOM   2523 O  O   . ASN B 1 132 ? 0.201   -22.230 -24.599 1.00 31.48  ? 207 ASN B O   1 
ATOM   2524 C  CB  . ASN B 1 132 ? 1.053   -23.449 -22.015 1.00 26.80  ? 207 ASN B CB  1 
ATOM   2525 C  CG  . ASN B 1 132 ? 1.785   -24.712 -22.392 1.00 26.56  ? 207 ASN B CG  1 
ATOM   2526 O  OD1 . ASN B 1 132 ? 1.432   -25.799 -21.954 1.00 28.45  ? 207 ASN B OD1 1 
ATOM   2527 N  ND2 . ASN B 1 132 ? 2.801   -24.573 -23.212 1.00 27.11  ? 207 ASN B ND2 1 
ATOM   2528 N  N   . SER B 1 133 ? -0.489  -24.374 -24.842 1.00 29.52  ? 208 SER B N   1 
ATOM   2529 C  CA  . SER B 1 133 ? -0.371  -24.365 -26.305 1.00 29.90  ? 208 SER B CA  1 
ATOM   2530 C  C   . SER B 1 133 ? -1.712  -24.327 -26.993 1.00 29.34  ? 208 SER B C   1 
ATOM   2531 O  O   . SER B 1 133 ? -2.467  -25.297 -26.951 1.00 29.11  ? 208 SER B O   1 
ATOM   2532 C  CB  . SER B 1 133 ? 0.338   -25.609 -26.809 1.00 31.96  ? 208 SER B CB  1 
ATOM   2533 O  OG  . SER B 1 133 ? 1.675   -25.620 -26.363 1.00 38.59  ? 208 SER B OG  1 
ATOM   2534 N  N   . PRO B 1 134 ? -2.048  -23.197 -27.632 1.00 31.21  ? 209 PRO B N   1 
ATOM   2535 C  CA  . PRO B 1 134 ? -3.330  -23.086 -28.334 1.00 29.50  ? 209 PRO B CA  1 
ATOM   2536 C  C   . PRO B 1 134 ? -3.547  -24.252 -29.299 1.00 30.42  ? 209 PRO B C   1 
ATOM   2537 O  O   . PRO B 1 134 ? -4.660  -24.727 -29.469 1.00 29.92  ? 209 PRO B O   1 
ATOM   2538 C  CB  . PRO B 1 134 ? -3.204  -21.734 -29.038 1.00 32.95  ? 209 PRO B CB  1 
ATOM   2539 C  CG  . PRO B 1 134 ? -2.404  -20.923 -28.006 1.00 31.62  ? 209 PRO B CG  1 
ATOM   2540 C  CD  . PRO B 1 134 ? -1.312  -21.918 -27.661 1.00 31.76  ? 209 PRO B CD  1 
ATOM   2541 N  N   . ALA B 1 135 ? -2.468  -24.747 -29.894 1.00 30.45  ? 210 ALA B N   1 
ATOM   2542 C  CA  . ALA B 1 135 ? -2.578  -25.847 -30.833 1.00 31.17  ? 210 ALA B CA  1 
ATOM   2543 C  C   . ALA B 1 135 ? -3.218  -27.080 -30.197 1.00 32.59  ? 210 ALA B C   1 
ATOM   2544 O  O   . ALA B 1 135 ? -3.872  -27.874 -30.885 1.00 31.94  ? 210 ALA B O   1 
ATOM   2545 C  CB  . ALA B 1 135 ? -1.194  -26.192 -31.395 1.00 31.22  ? 210 ALA B CB  1 
ATOM   2546 N  N   . SER B 1 136 ? -3.054  -27.216 -28.878 1.00 31.82  ? 211 SER B N   1 
ATOM   2547 C  CA  . SER B 1 136 ? -3.588  -28.359 -28.137 1.00 32.07  ? 211 SER B CA  1 
ATOM   2548 C  C   . SER B 1 136 ? -5.101  -28.470 -28.167 1.00 30.41  ? 211 SER B C   1 
ATOM   2549 O  O   . SER B 1 136 ? -5.651  -29.570 -28.099 1.00 30.76  ? 211 SER B O   1 
ATOM   2550 C  CB  . SER B 1 136 ? -3.130  -28.303 -26.674 1.00 32.66  ? 211 SER B CB  1 
ATOM   2551 O  OG  . SER B 1 136 ? -1.717  -28.321 -26.591 1.00 36.32  ? 211 SER B OG  1 
ATOM   2552 N  N   . TYR B 1 137 ? -5.788  -27.344 -28.235 1.00 29.38  ? 212 TYR B N   1 
ATOM   2553 C  CA  . TYR B 1 137 ? -7.245  -27.374 -28.275 1.00 29.50  ? 212 TYR B CA  1 
ATOM   2554 C  C   . TYR B 1 137 ? -7.861  -26.813 -29.561 1.00 28.96  ? 212 TYR B C   1 
ATOM   2555 O  O   . TYR B 1 137 ? -8.960  -26.256 -29.514 1.00 30.64  ? 212 TYR B O   1 
ATOM   2556 C  CB  . TYR B 1 137 ? -7.836  -26.628 -27.068 1.00 27.89  ? 212 TYR B CB  1 
ATOM   2557 C  CG  . TYR B 1 137 ? -7.201  -25.278 -26.776 1.00 28.70  ? 212 TYR B CG  1 
ATOM   2558 C  CD1 . TYR B 1 137 ? -7.514  -24.156 -27.539 1.00 29.40  ? 212 TYR B CD1 1 
ATOM   2559 C  CD2 . TYR B 1 137 ? -6.287  -25.127 -25.729 1.00 26.59  ? 212 TYR B CD2 1 
ATOM   2560 C  CE1 . TYR B 1 137 ? -6.924  -22.895 -27.253 1.00 28.28  ? 212 TYR B CE1 1 
ATOM   2561 C  CE2 . TYR B 1 137 ? -5.696  -23.893 -25.438 1.00 28.63  ? 212 TYR B CE2 1 
ATOM   2562 C  CZ  . TYR B 1 137 ? -6.019  -22.776 -26.197 1.00 28.72  ? 212 TYR B CZ  1 
ATOM   2563 O  OH  . TYR B 1 137 ? -5.496  -21.532 -25.856 1.00 27.16  ? 212 TYR B OH  1 
ATOM   2564 N  N   . VAL B 1 138 ? -7.169  -26.981 -30.691 1.00 28.62  ? 213 VAL B N   1 
ATOM   2565 C  CA  . VAL B 1 138 ? -7.654  -26.485 -31.991 1.00 31.08  ? 213 VAL B CA  1 
ATOM   2566 C  C   . VAL B 1 138 ? -9.056  -26.937 -32.346 1.00 31.10  ? 213 VAL B C   1 
ATOM   2567 O  O   . VAL B 1 138 ? -9.813  -26.183 -32.962 1.00 31.71  ? 213 VAL B O   1 
ATOM   2568 C  CB  . VAL B 1 138 ? -6.746  -26.894 -33.192 1.00 31.05  ? 213 VAL B CB  1 
ATOM   2569 C  CG1 . VAL B 1 138 ? -5.427  -26.167 -33.111 1.00 34.66  ? 213 VAL B CG1 1 
ATOM   2570 C  CG2 . VAL B 1 138 ? -6.542  -28.416 -33.233 1.00 30.17  ? 213 VAL B CG2 1 
ATOM   2571 N  N   . PHE B 1 139 ? -9.394  -28.165 -31.967 1.00 30.77  ? 214 PHE B N   1 
ATOM   2572 C  CA  . PHE B 1 139 ? -10.716 -28.707 -32.261 1.00 31.24  ? 214 PHE B CA  1 
ATOM   2573 C  C   . PHE B 1 139 ? -11.794 -28.216 -31.313 1.00 31.90  ? 214 PHE B C   1 
ATOM   2574 O  O   . PHE B 1 139 ? -12.981 -28.409 -31.559 1.00 32.27  ? 214 PHE B O   1 
ATOM   2575 C  CB  . PHE B 1 139 ? -10.691 -30.240 -32.229 1.00 31.22  ? 214 PHE B CB  1 
ATOM   2576 C  CG  . PHE B 1 139 ? -9.792  -30.872 -33.274 1.00 32.90  ? 214 PHE B CG  1 
ATOM   2577 C  CD1 . PHE B 1 139 ? -9.458  -30.192 -34.438 1.00 32.05  ? 214 PHE B CD1 1 
ATOM   2578 C  CD2 . PHE B 1 139 ? -9.324  -32.168 -33.101 1.00 31.28  ? 214 PHE B CD2 1 
ATOM   2579 C  CE1 . PHE B 1 139 ? -8.664  -30.789 -35.418 1.00 32.07  ? 214 PHE B CE1 1 
ATOM   2580 C  CE2 . PHE B 1 139 ? -8.532  -32.769 -34.066 1.00 32.81  ? 214 PHE B CE2 1 
ATOM   2581 C  CZ  . PHE B 1 139 ? -8.200  -32.078 -35.230 1.00 30.75  ? 214 PHE B CZ  1 
ATOM   2582 N  N   . HIS B 1 140 ? -11.399 -27.553 -30.228 1.00 30.19  ? 215 HIS B N   1 
ATOM   2583 C  CA  . HIS B 1 140 ? -12.367 -27.116 -29.237 1.00 29.17  ? 215 HIS B CA  1 
ATOM   2584 C  C   . HIS B 1 140 ? -11.984 -25.766 -28.626 1.00 30.35  ? 215 HIS B C   1 
ATOM   2585 O  O   . HIS B 1 140 ? -11.882 -25.634 -27.402 1.00 27.80  ? 215 HIS B O   1 
ATOM   2586 C  CB  . HIS B 1 140 ? -12.451 -28.184 -28.129 1.00 28.75  ? 215 HIS B CB  1 
ATOM   2587 C  CG  . HIS B 1 140 ? -12.734 -29.568 -28.643 1.00 29.33  ? 215 HIS B CG  1 
ATOM   2588 N  ND1 . HIS B 1 140 ? -11.842 -30.494 -29.143 1.00 28.60  ? 215 HIS B ND1 1 
ATOM   2589 C  CD2 . HIS B 1 140 ? -13.917 -30.146 -28.758 1.00 29.16  ? 215 HIS B CD2 1 
ATOM   2590 C  CE1 . HIS B 1 140 ? -12.524 -31.579 -29.527 1.00 27.90  ? 215 HIS B CE1 1 
ATOM   2591 N  NE2 . HIS B 1 140 ? -13.787 -31.382 -29.300 1.00 29.00  ? 215 HIS B NE2 1 
ATOM   2592 N  N   . PRO B 1 141 ? -11.744 -24.753 -29.465 1.00 30.68  ? 216 PRO B N   1 
ATOM   2593 C  CA  . PRO B 1 141 ? -11.363 -23.426 -28.961 1.00 30.92  ? 216 PRO B CA  1 
ATOM   2594 C  C   . PRO B 1 141 ? -12.297 -22.823 -27.906 1.00 31.47  ? 216 PRO B C   1 
ATOM   2595 O  O   . PRO B 1 141 ? -11.851 -22.054 -27.066 1.00 32.79  ? 216 PRO B O   1 
ATOM   2596 C  CB  . PRO B 1 141 ? -11.306 -22.578 -30.236 1.00 32.39  ? 216 PRO B CB  1 
ATOM   2597 C  CG  . PRO B 1 141 ? -12.363 -23.219 -31.120 1.00 30.67  ? 216 PRO B CG  1 
ATOM   2598 C  CD  . PRO B 1 141 ? -12.096 -24.700 -30.902 1.00 33.09  ? 216 PRO B CD  1 
ATOM   2599 N  N   . ASP B 1 142 ? -13.578 -23.184 -27.912 1.00 30.62  ? 217 ASP B N   1 
ATOM   2600 C  CA  . ASP B 1 142 ? -14.488 -22.598 -26.940 1.00 32.12  ? 217 ASP B CA  1 
ATOM   2601 C  C   . ASP B 1 142 ? -14.624 -23.296 -25.592 1.00 29.78  ? 217 ASP B C   1 
ATOM   2602 O  O   . ASP B 1 142 ? -15.481 -22.938 -24.811 1.00 29.31  ? 217 ASP B O   1 
ATOM   2603 C  CB  . ASP B 1 142 ? -15.871 -22.414 -27.560 1.00 34.26  ? 217 ASP B CB  1 
ATOM   2604 C  CG  . ASP B 1 142 ? -15.831 -21.530 -28.804 1.00 37.43  ? 217 ASP B CG  1 
ATOM   2605 O  OD1 . ASP B 1 142 ? -15.098 -20.508 -28.798 1.00 36.04  ? 217 ASP B OD1 1 
ATOM   2606 O  OD2 . ASP B 1 142 ? -16.549 -21.857 -29.782 1.00 39.42  ? 217 ASP B OD2 1 
ATOM   2607 N  N   . ASN B 1 143 ? -13.786 -24.295 -25.333 1.00 28.66  ? 218 ASN B N   1 
ATOM   2608 C  CA  . ASN B 1 143 ? -13.808 -25.014 -24.050 1.00 26.16  ? 218 ASN B CA  1 
ATOM   2609 C  C   . ASN B 1 143 ? -12.494 -24.653 -23.387 1.00 26.52  ? 218 ASN B C   1 
ATOM   2610 O  O   . ASN B 1 143 ? -12.153 -25.177 -22.339 1.00 24.38  ? 218 ASN B O   1 
ATOM   2611 C  CB  . ASN B 1 143 ? -13.772 -26.522 -24.271 1.00 25.12  ? 218 ASN B CB  1 
ATOM   2612 C  CG  . ASN B 1 143 ? -15.080 -27.067 -24.691 1.00 25.99  ? 218 ASN B CG  1 
ATOM   2613 O  OD1 . ASN B 1 143 ? -15.398 -27.102 -25.885 1.00 27.70  ? 218 ASN B OD1 1 
ATOM   2614 N  ND2 . ASN B 1 143 ? -15.879 -27.477 -23.730 1.00 21.65  ? 218 ASN B ND2 1 
ATOM   2615 N  N   . ALA B 1 144 ? -11.749 -23.760 -24.011 1.00 25.67  ? 219 ALA B N   1 
ATOM   2616 C  CA  . ALA B 1 144 ? -10.419 -23.434 -23.521 1.00 27.45  ? 219 ALA B CA  1 
ATOM   2617 C  C   . ALA B 1 144 ? -10.270 -22.243 -22.614 1.00 27.64  ? 219 ALA B C   1 
ATOM   2618 O  O   . ALA B 1 144 ? -10.969 -21.247 -22.733 1.00 25.62  ? 219 ALA B O   1 
ATOM   2619 C  CB  . ALA B 1 144 ? -9.480  -23.258 -24.710 1.00 24.39  ? 219 ALA B CB  1 
ATOM   2620 N  N   . VAL B 1 145 ? -9.327  -22.372 -21.693 1.00 28.36  ? 220 VAL B N   1 
ATOM   2621 C  CA  . VAL B 1 145 ? -8.953  -21.302 -20.774 1.00 28.46  ? 220 VAL B CA  1 
ATOM   2622 C  C   . VAL B 1 145 ? -7.444  -21.201 -21.039 1.00 30.36  ? 220 VAL B C   1 
ATOM   2623 O  O   . VAL B 1 145 ? -6.666  -22.094 -20.674 1.00 30.17  ? 220 VAL B O   1 
ATOM   2624 C  CB  . VAL B 1 145 ? -9.230  -21.679 -19.303 1.00 28.74  ? 220 VAL B CB  1 
ATOM   2625 C  CG1 . VAL B 1 145 ? -8.744  -20.557 -18.368 1.00 26.81  ? 220 VAL B CG1 1 
ATOM   2626 C  CG2 . VAL B 1 145 ? -10.721 -21.893 -19.105 1.00 27.76  ? 220 VAL B CG2 1 
ATOM   2627 N  N   . PRO B 1 146 ? -7.015  -20.154 -21.759 1.00 30.82  ? 221 PRO B N   1 
ATOM   2628 C  CA  . PRO B 1 146 ? -5.576  -20.048 -22.023 1.00 31.37  ? 221 PRO B CA  1 
ATOM   2629 C  C   . PRO B 1 146 ? -4.753  -19.675 -20.796 1.00 30.48  ? 221 PRO B C   1 
ATOM   2630 O  O   . PRO B 1 146 ? -5.257  -19.097 -19.838 1.00 29.33  ? 221 PRO B O   1 
ATOM   2631 C  CB  . PRO B 1 146 ? -5.494  -18.988 -23.128 1.00 32.23  ? 221 PRO B CB  1 
ATOM   2632 C  CG  . PRO B 1 146 ? -6.657  -18.125 -22.849 1.00 32.49  ? 221 PRO B CG  1 
ATOM   2633 C  CD  . PRO B 1 146 ? -7.766  -19.107 -22.478 1.00 31.44  ? 221 PRO B CD  1 
ATOM   2634 N  N   . VAL B 1 147 ? -3.481  -20.047 -20.835 1.00 30.73  ? 222 VAL B N   1 
ATOM   2635 C  CA  . VAL B 1 147 ? -2.551  -19.745 -19.767 1.00 29.80  ? 222 VAL B CA  1 
ATOM   2636 C  C   . VAL B 1 147 ? -1.178  -19.588 -20.432 1.00 29.59  ? 222 VAL B C   1 
ATOM   2637 O  O   . VAL B 1 147 ? -0.851  -20.313 -21.357 1.00 29.54  ? 222 VAL B O   1 
ATOM   2638 C  CB  . VAL B 1 147 ? -2.533  -20.900 -18.734 1.00 32.05  ? 222 VAL B CB  1 
ATOM   2639 C  CG1 . VAL B 1 147 ? -1.916  -22.164 -19.357 1.00 30.49  ? 222 VAL B CG1 1 
ATOM   2640 C  CG2 . VAL B 1 147 ? -1.766  -20.470 -17.500 1.00 31.49  ? 222 VAL B CG2 1 
ATOM   2641 N  N   . ALA B 1 148 ? -0.381  -18.626 -19.988 1.00 30.62  ? 223 ALA B N   1 
ATOM   2642 C  CA  . ALA B 1 148 ? 0.937   -18.429 -20.584 1.00 30.85  ? 223 ALA B CA  1 
ATOM   2643 C  C   . ALA B 1 148 ? 1.898   -19.571 -20.276 1.00 31.61  ? 223 ALA B C   1 
ATOM   2644 O  O   . ALA B 1 148 ? 1.820   -20.186 -19.210 1.00 29.87  ? 223 ALA B O   1 
ATOM   2645 C  CB  . ALA B 1 148 ? 1.532   -17.097 -20.099 1.00 30.91  ? 223 ALA B CB  1 
ATOM   2646 N  N   . SER B 1 149 ? 2.787   -19.849 -21.214 1.00 32.82  ? 224 SER B N   1 
ATOM   2647 C  CA  . SER B 1 149 ? 3.781   -20.886 -21.040 1.00 32.79  ? 224 SER B CA  1 
ATOM   2648 C  C   . SER B 1 149 ? 4.721   -20.399 -19.958 1.00 32.41  ? 224 SER B C   1 
ATOM   2649 O  O   . SER B 1 149 ? 5.168   -19.249 -19.974 1.00 33.04  ? 224 SER B O   1 
ATOM   2650 C  CB  . SER B 1 149 ? 4.572   -21.091 -22.328 1.00 32.70  ? 224 SER B CB  1 
ATOM   2651 O  OG  . SER B 1 149 ? 3.858   -21.888 -23.259 1.00 35.83  ? 224 SER B OG  1 
ATOM   2652 N  N   . TRP B 1 150 ? 5.052   -21.291 -19.035 1.00 31.10  ? 225 TRP B N   1 
ATOM   2653 C  CA  . TRP B 1 150 ? 5.943   -20.941 -17.960 1.00 29.84  ? 225 TRP B CA  1 
ATOM   2654 C  C   . TRP B 1 150 ? 7.233   -21.762 -18.042 1.00 30.56  ? 225 TRP B C   1 
ATOM   2655 O  O   . TRP B 1 150 ? 7.192   -22.971 -18.281 1.00 27.39  ? 225 TRP B O   1 
ATOM   2656 C  CB  . TRP B 1 150 ? 5.238   -21.205 -16.633 1.00 29.20  ? 225 TRP B CB  1 
ATOM   2657 C  CG  . TRP B 1 150 ? 6.058   -20.822 -15.456 1.00 29.19  ? 225 TRP B CG  1 
ATOM   2658 C  CD1 . TRP B 1 150 ? 6.217   -19.563 -14.925 1.00 29.60  ? 225 TRP B CD1 1 
ATOM   2659 C  CD2 . TRP B 1 150 ? 6.892   -21.695 -14.688 1.00 27.32  ? 225 TRP B CD2 1 
ATOM   2660 N  NE1 . TRP B 1 150 ? 7.111   -19.604 -13.866 1.00 29.53  ? 225 TRP B NE1 1 
ATOM   2661 C  CE2 . TRP B 1 150 ? 7.539   -20.899 -13.705 1.00 28.79  ? 225 TRP B CE2 1 
ATOM   2662 C  CE3 . TRP B 1 150 ? 7.165   -23.063 -14.737 1.00 23.54  ? 225 TRP B CE3 1 
ATOM   2663 C  CZ2 . TRP B 1 150 ? 8.448   -21.438 -12.775 1.00 26.94  ? 225 TRP B CZ2 1 
ATOM   2664 C  CZ3 . TRP B 1 150 ? 8.074   -23.602 -13.797 1.00 27.42  ? 225 TRP B CZ3 1 
ATOM   2665 C  CH2 . TRP B 1 150 ? 8.700   -22.782 -12.839 1.00 27.01  ? 225 TRP B CH2 1 
ATOM   2666 N  N   . PHE B 1 151 ? 8.370   -21.102 -17.827 1.00 31.42  ? 226 PHE B N   1 
ATOM   2667 C  CA  . PHE B 1 151 ? 9.654   -21.789 -17.873 1.00 33.02  ? 226 PHE B CA  1 
ATOM   2668 C  C   . PHE B 1 151 ? 10.390  -21.690 -16.554 1.00 34.94  ? 226 PHE B C   1 
ATOM   2669 O  O   . PHE B 1 151 ? 10.799  -22.713 -16.022 1.00 33.17  ? 226 PHE B O   1 
ATOM   2670 C  CB  . PHE B 1 151 ? 10.524  -21.241 -18.992 1.00 32.63  ? 226 PHE B CB  1 
ATOM   2671 C  CG  . PHE B 1 151 ? 9.914   -21.427 -20.352 1.00 36.93  ? 226 PHE B CG  1 
ATOM   2672 C  CD1 . PHE B 1 151 ? 8.989   -20.498 -20.864 1.00 36.73  ? 226 PHE B CD1 1 
ATOM   2673 C  CD2 . PHE B 1 151 ? 10.196  -22.568 -21.093 1.00 37.20  ? 226 PHE B CD2 1 
ATOM   2674 C  CE1 . PHE B 1 151 ? 8.340   -20.714 -22.122 1.00 37.54  ? 226 PHE B CE1 1 
ATOM   2675 C  CE2 . PHE B 1 151 ? 9.581   -22.801 -22.325 1.00 38.77  ? 226 PHE B CE2 1 
ATOM   2676 C  CZ  . PHE B 1 151 ? 8.657   -21.879 -22.843 1.00 37.18  ? 226 PHE B CZ  1 
ATOM   2677 N  N   . ASP B 1 152 ? 10.552  -20.475 -16.027 1.00 35.77  ? 227 ASP B N   1 
ATOM   2678 C  CA  . ASP B 1 152 ? 11.244  -20.298 -14.747 1.00 38.48  ? 227 ASP B CA  1 
ATOM   2679 C  C   . ASP B 1 152 ? 11.010  -18.966 -14.034 1.00 39.10  ? 227 ASP B C   1 
ATOM   2680 O  O   . ASP B 1 152 ? 11.676  -18.672 -13.040 1.00 37.89  ? 227 ASP B O   1 
ATOM   2681 C  CB  . ASP B 1 152 ? 12.748  -20.500 -14.923 1.00 40.83  ? 227 ASP B CB  1 
ATOM   2682 C  CG  . ASP B 1 152 ? 13.338  -19.602 -15.994 1.00 42.04  ? 227 ASP B CG  1 
ATOM   2683 O  OD1 . ASP B 1 152 ? 12.717  -18.584 -16.365 1.00 42.95  ? 227 ASP B OD1 1 
ATOM   2684 O  OD2 . ASP B 1 152 ? 14.444  -19.920 -16.459 1.00 46.70  ? 227 ASP B OD2 1 
ATOM   2685 N  N   . ASN B 1 153 ? 10.071  -18.161 -14.521 1.00 39.28  ? 228 ASN B N   1 
ATOM   2686 C  CA  . ASN B 1 153 ? 9.794   -16.880 -13.879 1.00 38.33  ? 228 ASN B CA  1 
ATOM   2687 C  C   . ASN B 1 153 ? 9.128   -17.094 -12.517 1.00 37.33  ? 228 ASN B C   1 
ATOM   2688 O  O   . ASN B 1 153 ? 7.939   -17.431 -12.439 1.00 38.27  ? 228 ASN B O   1 
ATOM   2689 C  CB  . ASN B 1 153 ? 8.897   -16.029 -14.782 1.00 39.18  ? 228 ASN B CB  1 
ATOM   2690 C  CG  . ASN B 1 153 ? 8.422   -14.765 -14.105 1.00 41.02  ? 228 ASN B CG  1 
ATOM   2691 O  OD1 . ASN B 1 153 ? 8.982   -14.344 -13.088 1.00 42.43  ? 228 ASN B OD1 1 
ATOM   2692 N  ND2 . ASN B 1 153 ? 7.373   -14.154 -14.660 1.00 41.59  ? 228 ASN B ND2 1 
ATOM   2693 N  N   . MET B 1 154 ? 9.883   -16.893 -11.442 1.00 35.97  ? 229 MET B N   1 
ATOM   2694 C  CA  . MET B 1 154 ? 9.335   -17.087 -10.117 1.00 35.72  ? 229 MET B CA  1 
ATOM   2695 C  C   . MET B 1 154 ? 8.410   -15.965 -9.633  1.00 36.84  ? 229 MET B C   1 
ATOM   2696 O  O   . MET B 1 154 ? 7.902   -16.023 -8.515  1.00 37.40  ? 229 MET B O   1 
ATOM   2697 C  CB  . MET B 1 154 ? 10.454  -17.332 -9.105  1.00 37.75  ? 229 MET B CB  1 
ATOM   2698 C  CG  . MET B 1 154 ? 11.278  -18.604 -9.393  1.00 38.70  ? 229 MET B CG  1 
ATOM   2699 S  SD  . MET B 1 154 ? 10.326  -20.159 -9.571  1.00 42.69  ? 229 MET B SD  1 
ATOM   2700 C  CE  . MET B 1 154 ? 9.660   -20.344 -7.932  1.00 38.91  ? 229 MET B CE  1 
ATOM   2701 N  N   . SER B 1 155 ? 8.190   -14.949 -10.465 1.00 36.78  ? 230 SER B N   1 
ATOM   2702 C  CA  . SER B 1 155 ? 7.256   -13.878 -10.109 1.00 37.37  ? 230 SER B CA  1 
ATOM   2703 C  C   . SER B 1 155 ? 5.878   -14.206 -10.674 1.00 36.21  ? 230 SER B C   1 
ATOM   2704 O  O   . SER B 1 155 ? 4.883   -13.573 -10.312 1.00 37.82  ? 230 SER B O   1 
ATOM   2705 C  CB  . SER B 1 155 ? 7.707   -12.525 -10.670 1.00 36.48  ? 230 SER B CB  1 
ATOM   2706 O  OG  . SER B 1 155 ? 8.967   -12.162 -10.135 1.00 40.55  ? 230 SER B OG  1 
ATOM   2707 N  N   . ASP B 1 156 ? 5.828   -15.195 -11.565 1.00 34.34  ? 231 ASP B N   1 
ATOM   2708 C  CA  . ASP B 1 156 ? 4.572   -15.615 -12.184 1.00 32.51  ? 231 ASP B CA  1 
ATOM   2709 C  C   . ASP B 1 156 ? 3.464   -15.885 -11.181 1.00 31.87  ? 231 ASP B C   1 
ATOM   2710 O  O   . ASP B 1 156 ? 3.671   -16.551 -10.161 1.00 33.12  ? 231 ASP B O   1 
ATOM   2711 C  CB  . ASP B 1 156 ? 4.806   -16.859 -13.043 1.00 31.69  ? 231 ASP B CB  1 
ATOM   2712 C  CG  . ASP B 1 156 ? 3.529   -17.372 -13.672 1.00 32.53  ? 231 ASP B CG  1 
ATOM   2713 O  OD1 . ASP B 1 156 ? 2.698   -17.936 -12.936 1.00 30.28  ? 231 ASP B OD1 1 
ATOM   2714 O  OD2 . ASP B 1 156 ? 3.336   -17.209 -14.897 1.00 31.14  ? 231 ASP B OD2 1 
ATOM   2715 N  N   . THR B 1 157 ? 2.272   -15.375 -11.473 1.00 32.65  ? 232 THR B N   1 
ATOM   2716 C  CA  . THR B 1 157 ? 1.122   -15.572 -10.582 1.00 32.22  ? 232 THR B CA  1 
ATOM   2717 C  C   . THR B 1 157 ? -0.119  -15.963 -11.398 1.00 30.69  ? 232 THR B C   1 
ATOM   2718 O  O   . THR B 1 157 ? -1.238  -15.864 -10.901 1.00 30.28  ? 232 THR B O   1 
ATOM   2719 C  CB  . THR B 1 157 ? 0.752   -14.260 -9.846  1.00 33.94  ? 232 THR B CB  1 
ATOM   2720 O  OG1 . THR B 1 157 ? 0.453   -13.258 -10.830 1.00 31.85  ? 232 THR B OG1 1 
ATOM   2721 C  CG2 . THR B 1 157 ? 1.894   -13.771 -8.966  1.00 32.25  ? 232 THR B CG2 1 
ATOM   2722 N  N   . GLU B 1 158 ? 0.080   -16.420 -12.623 1.00 31.25  ? 233 GLU B N   1 
ATOM   2723 C  CA  . GLU B 1 158 ? -1.055  -16.762 -13.459 1.00 33.35  ? 233 GLU B CA  1 
ATOM   2724 C  C   . GLU B 1 158 ? -1.979  -17.830 -12.858 1.00 31.41  ? 233 GLU B C   1 
ATOM   2725 O  O   . GLU B 1 158 ? -3.188  -17.708 -12.932 1.00 31.28  ? 233 GLU B O   1 
ATOM   2726 C  CB  . GLU B 1 158 ? -0.566  -17.168 -14.850 1.00 36.32  ? 233 GLU B CB  1 
ATOM   2727 C  CG  . GLU B 1 158 ? -1.524  -16.735 -15.981 1.00 47.18  ? 233 GLU B CG  1 
ATOM   2728 C  CD  . GLU B 1 158 ? -1.016  -17.055 -17.410 1.00 51.44  ? 233 GLU B CD  1 
ATOM   2729 O  OE1 . GLU B 1 158 ? 0.077   -17.649 -17.546 1.00 55.95  ? 233 GLU B OE1 1 
ATOM   2730 O  OE2 . GLU B 1 158 ? -1.712  -16.708 -18.397 1.00 52.74  ? 233 GLU B OE2 1 
ATOM   2731 N  N   . LEU B 1 159 ? -1.435  -18.866 -12.236 1.00 29.92  ? 234 LEU B N   1 
ATOM   2732 C  CA  . LEU B 1 159 ? -2.307  -19.901 -11.674 1.00 28.60  ? 234 LEU B CA  1 
ATOM   2733 C  C   . LEU B 1 159 ? -3.139  -19.318 -10.558 1.00 29.66  ? 234 LEU B C   1 
ATOM   2734 O  O   . LEU B 1 159 ? -4.337  -19.623 -10.421 1.00 28.11  ? 234 LEU B O   1 
ATOM   2735 C  CB  . LEU B 1 159 ? -1.491  -21.091 -11.141 1.00 27.28  ? 234 LEU B CB  1 
ATOM   2736 C  CG  . LEU B 1 159 ? -0.726  -21.887 -12.192 1.00 26.08  ? 234 LEU B CG  1 
ATOM   2737 C  CD1 . LEU B 1 159 ? -0.007  -23.086 -11.496 1.00 25.33  ? 234 LEU B CD1 1 
ATOM   2738 C  CD2 . LEU B 1 159 ? -1.692  -22.388 -13.299 1.00 25.47  ? 234 LEU B CD2 1 
ATOM   2739 N  N   . HIS B 1 160 ? -2.494  -18.487 -9.742  1.00 29.32  ? 235 HIS B N   1 
ATOM   2740 C  CA  . HIS B 1 160 ? -3.172  -17.815 -8.651  1.00 28.86  ? 235 HIS B CA  1 
ATOM   2741 C  C   . HIS B 1 160 ? -4.259  -16.896 -9.229  1.00 27.90  ? 235 HIS B C   1 
ATOM   2742 O  O   . HIS B 1 160 ? -5.395  -16.883 -8.764  1.00 29.20  ? 235 HIS B O   1 
ATOM   2743 C  CB  . HIS B 1 160 ? -2.170  -16.965 -7.874  1.00 30.61  ? 235 HIS B CB  1 
ATOM   2744 C  CG  . HIS B 1 160 ? -2.781  -16.231 -6.729  1.00 31.45  ? 235 HIS B CG  1 
ATOM   2745 N  ND1 . HIS B 1 160 ? -3.189  -16.862 -5.572  1.00 34.86  ? 235 HIS B ND1 1 
ATOM   2746 C  CD2 . HIS B 1 160 ? -3.117  -14.929 -6.584  1.00 31.58  ? 235 HIS B CD2 1 
ATOM   2747 C  CE1 . HIS B 1 160 ? -3.748  -15.978 -4.763  1.00 33.44  ? 235 HIS B CE1 1 
ATOM   2748 N  NE2 . HIS B 1 160 ? -3.715  -14.799 -5.355  1.00 31.33  ? 235 HIS B NE2 1 
ATOM   2749 N  N   . ASP B 1 161 ? -3.915  -16.139 -10.262 1.00 28.57  ? 236 ASP B N   1 
ATOM   2750 C  CA  . ASP B 1 161 ? -4.877  -15.212 -10.836 1.00 29.60  ? 236 ASP B CA  1 
ATOM   2751 C  C   . ASP B 1 161 ? -6.046  -15.895 -11.527 1.00 30.63  ? 236 ASP B C   1 
ATOM   2752 O  O   . ASP B 1 161 ? -7.127  -15.322 -11.625 1.00 31.70  ? 236 ASP B O   1 
ATOM   2753 C  CB  . ASP B 1 161 ? -4.179  -14.280 -11.813 1.00 31.30  ? 236 ASP B CB  1 
ATOM   2754 C  CG  . ASP B 1 161 ? -3.089  -13.463 -11.153 1.00 29.89  ? 236 ASP B CG  1 
ATOM   2755 O  OD1 . ASP B 1 161 ? -3.187  -13.232 -9.926  1.00 31.11  ? 236 ASP B OD1 1 
ATOM   2756 O  OD2 . ASP B 1 161 ? -2.150  -13.071 -11.860 1.00 34.37  ? 236 ASP B OD2 1 
ATOM   2757 N  N   . LEU B 1 162 ? -5.841  -17.122 -11.996 1.00 30.58  ? 237 LEU B N   1 
ATOM   2758 C  CA  . LEU B 1 162 ? -6.911  -17.848 -12.665 1.00 29.61  ? 237 LEU B CA  1 
ATOM   2759 C  C   . LEU B 1 162 ? -7.959  -18.448 -11.739 1.00 28.10  ? 237 LEU B C   1 
ATOM   2760 O  O   . LEU B 1 162 ? -9.103  -18.648 -12.160 1.00 27.50  ? 237 LEU B O   1 
ATOM   2761 C  CB  . LEU B 1 162 ? -6.335  -18.956 -13.565 1.00 31.34  ? 237 LEU B CB  1 
ATOM   2762 C  CG  . LEU B 1 162 ? -5.843  -18.534 -14.952 1.00 33.00  ? 237 LEU B CG  1 
ATOM   2763 C  CD1 . LEU B 1 162 ? -5.130  -19.705 -15.616 1.00 35.98  ? 237 LEU B CD1 1 
ATOM   2764 C  CD2 . LEU B 1 162 ? -7.029  -18.090 -15.811 1.00 34.88  ? 237 LEU B CD2 1 
ATOM   2765 N  N   . LEU B 1 163 ? -7.614  -18.708 -10.475 1.00 27.92  ? 238 LEU B N   1 
ATOM   2766 C  CA  . LEU B 1 163 ? -8.582  -19.332 -9.578  1.00 29.02  ? 238 LEU B CA  1 
ATOM   2767 C  C   . LEU B 1 163 ? -9.978  -18.717 -9.470  1.00 29.61  ? 238 LEU B C   1 
ATOM   2768 O  O   . LEU B 1 163 ? -10.957 -19.442 -9.501  1.00 27.70  ? 238 LEU B O   1 
ATOM   2769 C  CB  . LEU B 1 163 ? -8.008  -19.490 -8.162  1.00 30.85  ? 238 LEU B CB  1 
ATOM   2770 C  CG  . LEU B 1 163 ? -7.170  -20.748 -7.890  1.00 29.87  ? 238 LEU B CG  1 
ATOM   2771 C  CD1 . LEU B 1 163 ? -6.751  -20.784 -6.417  1.00 30.35  ? 238 LEU B CD1 1 
ATOM   2772 C  CD2 . LEU B 1 163 ? -7.968  -21.978 -8.230  1.00 29.44  ? 238 LEU B CD2 1 
ATOM   2773 N  N   . PRO B 1 164 ? -10.090 -17.389 -9.294  1.00 29.06  ? 239 PRO B N   1 
ATOM   2774 C  CA  . PRO B 1 164 ? -11.449 -16.841 -9.198  1.00 28.56  ? 239 PRO B CA  1 
ATOM   2775 C  C   . PRO B 1 164 ? -12.290 -17.138 -10.449 1.00 28.07  ? 239 PRO B C   1 
ATOM   2776 O  O   . PRO B 1 164 ? -13.502 -17.334 -10.366 1.00 28.37  ? 239 PRO B O   1 
ATOM   2777 C  CB  . PRO B 1 164 ? -11.204 -15.347 -8.993  1.00 29.36  ? 239 PRO B CB  1 
ATOM   2778 C  CG  . PRO B 1 164 ? -9.907  -15.092 -9.596  1.00 30.31  ? 239 PRO B CG  1 
ATOM   2779 C  CD  . PRO B 1 164 ? -9.082  -16.312 -9.215  1.00 31.12  ? 239 PRO B CD  1 
ATOM   2780 N  N   . PHE B 1 165 ? -11.643 -17.190 -11.595 1.00 27.66  ? 240 PHE B N   1 
ATOM   2781 C  CA  . PHE B 1 165 ? -12.378 -17.493 -12.815 1.00 28.59  ? 240 PHE B CA  1 
ATOM   2782 C  C   . PHE B 1 165 ? -12.860 -18.936 -12.775 1.00 29.33  ? 240 PHE B C   1 
ATOM   2783 O  O   . PHE B 1 165 ? -14.026 -19.229 -13.078 1.00 28.87  ? 240 PHE B O   1 
ATOM   2784 C  CB  . PHE B 1 165 ? -11.505 -17.290 -14.040 1.00 29.71  ? 240 PHE B CB  1 
ATOM   2785 C  CG  . PHE B 1 165 ? -12.283 -17.334 -15.345 1.00 32.34  ? 240 PHE B CG  1 
ATOM   2786 C  CD1 . PHE B 1 165 ? -13.526 -16.680 -15.465 1.00 31.96  ? 240 PHE B CD1 1 
ATOM   2787 C  CD2 . PHE B 1 165 ? -11.780 -18.017 -16.443 1.00 32.22  ? 240 PHE B CD2 1 
ATOM   2788 C  CE1 . PHE B 1 165 ? -14.244 -16.725 -16.685 1.00 32.79  ? 240 PHE B CE1 1 
ATOM   2789 C  CE2 . PHE B 1 165 ? -12.491 -18.067 -17.661 1.00 33.49  ? 240 PHE B CE2 1 
ATOM   2790 C  CZ  . PHE B 1 165 ? -13.725 -17.423 -17.779 1.00 32.12  ? 240 PHE B CZ  1 
ATOM   2791 N  N   . PHE B 1 166 ? -11.967 -19.855 -12.408 1.00 27.58  ? 241 PHE B N   1 
ATOM   2792 C  CA  . PHE B 1 166 ? -12.379 -21.246 -12.323 1.00 26.40  ? 241 PHE B CA  1 
ATOM   2793 C  C   . PHE B 1 166 ? -13.461 -21.419 -11.302 1.00 24.91  ? 241 PHE B C   1 
ATOM   2794 O  O   . PHE B 1 166 ? -14.352 -22.265 -11.462 1.00 25.53  ? 241 PHE B O   1 
ATOM   2795 C  CB  . PHE B 1 166 ? -11.196 -22.153 -11.984 1.00 26.32  ? 241 PHE B CB  1 
ATOM   2796 C  CG  . PHE B 1 166 ? -10.386 -22.513 -13.171 1.00 25.23  ? 241 PHE B CG  1 
ATOM   2797 C  CD1 . PHE B 1 166 ? -10.960 -23.238 -14.217 1.00 22.19  ? 241 PHE B CD1 1 
ATOM   2798 C  CD2 . PHE B 1 166 ? -9.072  -22.069 -13.289 1.00 22.99  ? 241 PHE B CD2 1 
ATOM   2799 C  CE1 . PHE B 1 166 ? -10.241 -23.510 -15.363 1.00 23.80  ? 241 PHE B CE1 1 
ATOM   2800 C  CE2 . PHE B 1 166 ? -8.331  -22.328 -14.434 1.00 24.26  ? 241 PHE B CE2 1 
ATOM   2801 C  CZ  . PHE B 1 166 ? -8.907  -23.052 -15.482 1.00 24.37  ? 241 PHE B CZ  1 
ATOM   2802 N  N   . GLU B 1 167 ? -13.395 -20.599 -10.258 1.00 27.01  ? 242 GLU B N   1 
ATOM   2803 C  CA  . GLU B 1 167 ? -14.387 -20.631 -9.192  1.00 28.10  ? 242 GLU B CA  1 
ATOM   2804 C  C   . GLU B 1 167 ? -15.768 -20.376 -9.813  1.00 27.82  ? 242 GLU B C   1 
ATOM   2805 O  O   . GLU B 1 167 ? -16.758 -21.052 -9.504  1.00 26.80  ? 242 GLU B O   1 
ATOM   2806 C  CB  . GLU B 1 167 ? -14.060 -19.545 -8.171  1.00 33.62  ? 242 GLU B CB  1 
ATOM   2807 C  CG  . GLU B 1 167 ? -14.641 -19.743 -6.799  1.00 39.01  ? 242 GLU B CG  1 
ATOM   2808 C  CD  . GLU B 1 167 ? -13.981 -20.873 -5.998  1.00 40.42  ? 242 GLU B CD  1 
ATOM   2809 O  OE1 . GLU B 1 167 ? -12.737 -20.833 -5.779  1.00 40.61  ? 242 GLU B OE1 1 
ATOM   2810 O  OE2 . GLU B 1 167 ? -14.754 -21.768 -5.582  1.00 41.15  ? 242 GLU B OE2 1 
ATOM   2811 N  N   . GLN B 1 168 ? -15.830 -19.392 -10.693 1.00 27.09  ? 243 GLN B N   1 
ATOM   2812 C  CA  . GLN B 1 168 ? -17.089 -19.086 -11.346 1.00 28.02  ? 243 GLN B CA  1 
ATOM   2813 C  C   . GLN B 1 168 ? -17.499 -20.243 -12.254 1.00 26.45  ? 243 GLN B C   1 
ATOM   2814 O  O   . GLN B 1 168 ? -18.624 -20.716 -12.186 1.00 24.78  ? 243 GLN B O   1 
ATOM   2815 C  CB  . GLN B 1 168 ? -16.985 -17.828 -12.197 1.00 29.00  ? 243 GLN B CB  1 
ATOM   2816 C  CG  . GLN B 1 168 ? -18.322 -17.493 -12.863 1.00 31.18  ? 243 GLN B CG  1 
ATOM   2817 C  CD  . GLN B 1 168 ? -18.257 -16.318 -13.841 1.00 32.53  ? 243 GLN B CD  1 
ATOM   2818 O  OE1 . GLN B 1 168 ? -17.235 -15.619 -13.960 1.00 31.47  ? 243 GLN B OE1 1 
ATOM   2819 N  NE2 . GLN B 1 168 ? -19.368 -16.088 -14.535 1.00 31.98  ? 243 GLN B NE2 1 
ATOM   2820 N  N   . LEU B 1 169 ? -16.573 -20.717 -13.070 1.00 26.03  ? 244 LEU B N   1 
ATOM   2821 C  CA  . LEU B 1 169 ? -16.889 -21.785 -14.007 1.00 27.88  ? 244 LEU B CA  1 
ATOM   2822 C  C   . LEU B 1 169 ? -17.324 -23.087 -13.368 1.00 27.74  ? 244 LEU B C   1 
ATOM   2823 O  O   . LEU B 1 169 ? -18.137 -23.800 -13.947 1.00 29.45  ? 244 LEU B O   1 
ATOM   2824 C  CB  . LEU B 1 169 ? -15.694 -22.040 -14.930 1.00 27.27  ? 244 LEU B CB  1 
ATOM   2825 C  CG  . LEU B 1 169 ? -15.366 -20.876 -15.870 1.00 29.67  ? 244 LEU B CG  1 
ATOM   2826 C  CD1 . LEU B 1 169 ? -13.945 -21.011 -16.418 1.00 29.40  ? 244 LEU B CD1 1 
ATOM   2827 C  CD2 . LEU B 1 169 ? -16.395 -20.831 -16.996 1.00 29.85  ? 244 LEU B CD2 1 
ATOM   2828 N  N   . SER B 1 170 ? -16.789 -23.402 -12.184 1.00 27.13  ? 245 SER B N   1 
ATOM   2829 C  CA  . SER B 1 170 ? -17.119 -24.654 -11.513 1.00 26.48  ? 245 SER B CA  1 
ATOM   2830 C  C   . SER B 1 170 ? -18.589 -24.731 -11.151 1.00 26.74  ? 245 SER B C   1 
ATOM   2831 O  O   . SER B 1 170 ? -19.159 -25.808 -11.037 1.00 26.15  ? 245 SER B O   1 
ATOM   2832 C  CB  . SER B 1 170 ? -16.277 -24.827 -10.246 1.00 26.11  ? 245 SER B CB  1 
ATOM   2833 O  OG  . SER B 1 170 ? -16.703 -23.916 -9.254  1.00 24.59  ? 245 SER B OG  1 
ATOM   2834 N  N   . ARG B 1 171 ? -19.211 -23.570 -11.004 1.00 28.18  ? 246 ARG B N   1 
ATOM   2835 C  CA  . ARG B 1 171 ? -20.607 -23.490 -10.623 1.00 29.47  ? 246 ARG B CA  1 
ATOM   2836 C  C   . ARG B 1 171 ? -21.633 -23.380 -11.756 1.00 29.80  ? 246 ARG B C   1 
ATOM   2837 O  O   . ARG B 1 171 ? -22.824 -23.516 -11.504 1.00 30.01  ? 246 ARG B O   1 
ATOM   2838 C  CB  . ARG B 1 171 ? -20.783 -22.305 -9.658  1.00 30.03  ? 246 ARG B CB  1 
ATOM   2839 C  CG  . ARG B 1 171 ? -20.053 -22.477 -8.339  1.00 30.63  ? 246 ARG B CG  1 
ATOM   2840 C  CD  . ARG B 1 171 ? -19.954 -21.156 -7.611  1.00 35.60  ? 246 ARG B CD  1 
ATOM   2841 N  NE  . ARG B 1 171 ? -19.526 -21.335 -6.226  1.00 35.81  ? 246 ARG B NE  1 
ATOM   2842 C  CZ  . ARG B 1 171 ? -18.268 -21.524 -5.854  1.00 35.57  ? 246 ARG B CZ  1 
ATOM   2843 N  NH1 . ARG B 1 171 ? -17.306 -21.563 -6.755  1.00 35.18  ? 246 ARG B NH1 1 
ATOM   2844 N  NH2 . ARG B 1 171 ? -17.954 -21.660 -4.561  1.00 36.19  ? 246 ARG B NH2 1 
ATOM   2845 N  N   . VAL B 1 172 ? -21.195 -23.124 -12.987 1.00 32.18  ? 247 VAL B N   1 
ATOM   2846 C  CA  . VAL B 1 172 ? -22.153 -22.989 -14.096 1.00 33.61  ? 247 VAL B CA  1 
ATOM   2847 C  C   . VAL B 1 172 ? -22.641 -24.336 -14.638 1.00 35.25  ? 247 VAL B C   1 
ATOM   2848 O  O   . VAL B 1 172 ? -22.024 -25.374 -14.388 1.00 34.03  ? 247 VAL B O   1 
ATOM   2849 C  CB  . VAL B 1 172 ? -21.564 -22.171 -15.276 1.00 34.72  ? 247 VAL B CB  1 
ATOM   2850 C  CG1 . VAL B 1 172 ? -20.997 -20.838 -14.753 1.00 32.96  ? 247 VAL B CG1 1 
ATOM   2851 C  CG2 . VAL B 1 172 ? -20.472 -22.973 -15.994 1.00 32.43  ? 247 VAL B CG2 1 
ATOM   2852 N  N   . ASP B 1 173 ? -23.760 -24.325 -15.356 1.00 36.74  ? 248 ASP B N   1 
ATOM   2853 C  CA  . ASP B 1 173 ? -24.300 -25.559 -15.950 1.00 40.88  ? 248 ASP B CA  1 
ATOM   2854 C  C   . ASP B 1 173 ? -23.720 -25.826 -17.333 1.00 37.70  ? 248 ASP B C   1 
ATOM   2855 O  O   . ASP B 1 173 ? -23.525 -26.978 -17.720 1.00 39.51  ? 248 ASP B O   1 
ATOM   2856 C  CB  . ASP B 1 173 ? -25.829 -25.502 -16.067 1.00 46.27  ? 248 ASP B CB  1 
ATOM   2857 C  CG  . ASP B 1 173 ? -26.515 -25.656 -14.729 1.00 49.92  ? 248 ASP B CG  1 
ATOM   2858 O  OD1 . ASP B 1 173 ? -26.193 -26.631 -14.002 1.00 54.39  ? 248 ASP B OD1 1 
ATOM   2859 O  OD2 . ASP B 1 173 ? -27.379 -24.809 -14.408 1.00 53.44  ? 248 ASP B OD2 1 
ATOM   2860 N  N   . ASP B 1 174 ? -23.465 -24.751 -18.080 1.00 35.77  ? 249 ASP B N   1 
ATOM   2861 C  CA  . ASP B 1 174 ? -22.898 -24.851 -19.426 1.00 33.83  ? 249 ASP B CA  1 
ATOM   2862 C  C   . ASP B 1 174 ? -21.739 -23.872 -19.518 1.00 31.67  ? 249 ASP B C   1 
ATOM   2863 O  O   . ASP B 1 174 ? -21.935 -22.658 -19.458 1.00 29.28  ? 249 ASP B O   1 
ATOM   2864 C  CB  . ASP B 1 174 ? -23.953 -24.472 -20.482 1.00 37.38  ? 249 ASP B CB  1 
ATOM   2865 C  CG  . ASP B 1 174 ? -23.445 -24.639 -21.920 1.00 36.02  ? 249 ASP B CG  1 
ATOM   2866 O  OD1 . ASP B 1 174 ? -22.222 -24.602 -22.152 1.00 36.09  ? 249 ASP B OD1 1 
ATOM   2867 O  OD2 . ASP B 1 174 ? -24.287 -24.798 -22.833 1.00 40.12  ? 249 ASP B OD2 1 
ATOM   2868 N  N   . VAL B 1 175 ? -20.528 -24.382 -19.727 1.00 29.45  ? 250 VAL B N   1 
ATOM   2869 C  CA  . VAL B 1 175 ? -19.365 -23.507 -19.805 1.00 27.86  ? 250 VAL B CA  1 
ATOM   2870 C  C   . VAL B 1 175 ? -19.416 -22.582 -21.020 1.00 30.05  ? 250 VAL B C   1 
ATOM   2871 O  O   . VAL B 1 175 ? -18.795 -21.507 -21.030 1.00 28.01  ? 250 VAL B O   1 
ATOM   2872 C  CB  . VAL B 1 175 ? -18.038 -24.325 -19.839 1.00 27.34  ? 250 VAL B CB  1 
ATOM   2873 C  CG1 . VAL B 1 175 ? -17.897 -25.136 -18.568 1.00 27.51  ? 250 VAL B CG1 1 
ATOM   2874 C  CG2 . VAL B 1 175 ? -18.014 -25.260 -21.052 1.00 25.30  ? 250 VAL B CG2 1 
ATOM   2875 N  N   . TYR B 1 176 ? -20.139 -23.000 -22.054 1.00 30.17  ? 251 TYR B N   1 
ATOM   2876 C  CA  . TYR B 1 176 ? -20.233 -22.173 -23.243 1.00 32.32  ? 251 TYR B CA  1 
ATOM   2877 C  C   . TYR B 1 176 ? -20.969 -20.899 -22.894 1.00 33.10  ? 251 TYR B C   1 
ATOM   2878 O  O   . TYR B 1 176 ? -20.747 -19.882 -23.519 1.00 34.58  ? 251 TYR B O   1 
ATOM   2879 C  CB  . TYR B 1 176 ? -20.960 -22.914 -24.377 1.00 31.08  ? 251 TYR B CB  1 
ATOM   2880 C  CG  . TYR B 1 176 ? -20.185 -24.101 -24.920 1.00 29.65  ? 251 TYR B CG  1 
ATOM   2881 C  CD1 . TYR B 1 176 ? -18.838 -23.974 -25.237 1.00 28.22  ? 251 TYR B CD1 1 
ATOM   2882 C  CD2 . TYR B 1 176 ? -20.794 -25.353 -25.083 1.00 27.83  ? 251 TYR B CD2 1 
ATOM   2883 C  CE1 . TYR B 1 176 ? -18.095 -25.065 -25.703 1.00 28.72  ? 251 TYR B CE1 1 
ATOM   2884 C  CE2 . TYR B 1 176 ? -20.070 -26.449 -25.546 1.00 28.46  ? 251 TYR B CE2 1 
ATOM   2885 C  CZ  . TYR B 1 176 ? -18.721 -26.290 -25.851 1.00 28.37  ? 251 TYR B CZ  1 
ATOM   2886 O  OH  . TYR B 1 176 ? -17.989 -27.368 -26.283 1.00 29.65  ? 251 TYR B OH  1 
ATOM   2887 N  N   . SER B 1 177 ? -21.838 -20.953 -21.892 1.00 34.79  ? 252 SER B N   1 
ATOM   2888 C  CA  . SER B 1 177 ? -22.584 -19.764 -21.493 1.00 37.76  ? 252 SER B CA  1 
ATOM   2889 C  C   . SER B 1 177 ? -21.624 -18.672 -21.028 1.00 38.92  ? 252 SER B C   1 
ATOM   2890 O  O   . SER B 1 177 ? -21.992 -17.496 -20.946 1.00 40.13  ? 252 SER B O   1 
ATOM   2891 C  CB  . SER B 1 177 ? -23.584 -20.105 -20.383 1.00 38.36  ? 252 SER B CB  1 
ATOM   2892 O  OG  . SER B 1 177 ? -22.936 -20.278 -19.132 1.00 41.12  ? 252 SER B OG  1 
ATOM   2893 N  N   . VAL B 1 178 ? -20.389 -19.065 -20.727 1.00 40.61  ? 253 VAL B N   1 
ATOM   2894 C  CA  . VAL B 1 178 ? -19.375 -18.118 -20.272 1.00 41.51  ? 253 VAL B CA  1 
ATOM   2895 C  C   . VAL B 1 178 ? -18.280 -17.929 -21.309 1.00 43.73  ? 253 VAL B C   1 
ATOM   2896 O  O   . VAL B 1 178 ? -17.871 -16.803 -21.587 1.00 43.02  ? 253 VAL B O   1 
ATOM   2897 C  CB  . VAL B 1 178 ? -18.696 -18.597 -18.950 1.00 41.20  ? 253 VAL B CB  1 
ATOM   2898 C  CG1 . VAL B 1 178 ? -17.629 -17.591 -18.507 1.00 39.76  ? 253 VAL B CG1 1 
ATOM   2899 C  CG2 . VAL B 1 178 ? -19.725 -18.773 -17.867 1.00 39.11  ? 253 VAL B CG2 1 
ATOM   2900 N  N   . LEU B 1 179 ? -17.795 -19.035 -21.867 1.00 47.20  ? 254 LEU B N   1 
ATOM   2901 C  CA  . LEU B 1 179 ? -16.730 -18.976 -22.858 1.00 52.75  ? 254 LEU B CA  1 
ATOM   2902 C  C   . LEU B 1 179 ? -17.310 -18.632 -24.224 1.00 59.33  ? 254 LEU B C   1 
ATOM   2903 O  O   . LEU B 1 179 ? -16.574 -18.436 -25.191 1.00 59.74  ? 254 LEU B O   1 
ATOM   2904 C  CB  . LEU B 1 179 ? -15.992 -20.319 -22.901 1.00 48.20  ? 254 LEU B CB  1 
ATOM   2905 C  CG  . LEU B 1 179 ? -15.442 -20.766 -21.536 1.00 46.11  ? 254 LEU B CG  1 
ATOM   2906 C  CD1 . LEU B 1 179 ? -14.777 -22.126 -21.671 1.00 42.92  ? 254 LEU B CD1 1 
ATOM   2907 C  CD2 . LEU B 1 179 ? -14.458 -19.733 -21.008 1.00 41.78  ? 254 LEU B CD2 1 
ATOM   2908 N  N   . ARG B 1 180 ? -18.643 -18.544 -24.262 1.00 66.60  ? 255 ARG B N   1 
ATOM   2909 C  CA  . ARG B 1 180 ? -19.461 -18.214 -25.435 1.00 75.40  ? 255 ARG B CA  1 
ATOM   2910 C  C   . ARG B 1 180 ? -19.394 -19.137 -26.654 1.00 79.11  ? 255 ARG B C   1 
ATOM   2911 O  O   . ARG B 1 180 ? -18.387 -19.203 -27.356 1.00 79.00  ? 255 ARG B O   1 
ATOM   2912 C  CB  . ARG B 1 180 ? -19.228 -16.755 -25.871 1.00 78.43  ? 255 ARG B CB  1 
ATOM   2913 C  CG  . ARG B 1 180 ? -17.900 -16.479 -26.566 1.00 86.12  ? 255 ARG B CG  1 
ATOM   2914 C  CD  . ARG B 1 180 ? -17.803 -15.027 -27.021 1.00 92.53  ? 255 ARG B CD  1 
ATOM   2915 N  NE  . ARG B 1 180 ? -16.533 -14.704 -27.673 1.00 98.93  ? 255 ARG B NE  1 
ATOM   2916 C  CZ  . ARG B 1 180 ? -16.084 -15.274 -28.789 1.00 101.86 ? 255 ARG B CZ  1 
ATOM   2917 N  NH1 . ARG B 1 180 ? -16.799 -16.217 -29.391 1.00 104.06 ? 255 ARG B NH1 1 
ATOM   2918 N  NH2 . ARG B 1 180 ? -14.929 -14.880 -29.321 1.00 103.38 ? 255 ARG B NH2 1 
ATOM   2919 N  N   . GLN B 1 181 ? -20.500 -19.847 -26.882 1.00 82.83  ? 256 GLN B N   1 
ATOM   2920 C  CA  . GLN B 1 181 ? -20.676 -20.767 -28.012 1.00 86.44  ? 256 GLN B CA  1 
ATOM   2921 C  C   . GLN B 1 181 ? -22.036 -21.484 -27.954 1.00 88.42  ? 256 GLN B C   1 
ATOM   2922 O  O   . GLN B 1 181 ? -22.047 -22.736 -27.980 1.00 87.50  ? 256 GLN B O   1 
ATOM   2923 C  CB  . GLN B 1 181 ? -19.592 -21.857 -28.051 1.00 87.24  ? 256 GLN B CB  1 
ATOM   2924 C  CG  . GLN B 1 181 ? -19.684 -22.691 -29.333 1.00 90.84  ? 256 GLN B CG  1 
ATOM   2925 C  CD  . GLN B 1 181 ? -19.060 -24.081 -29.261 1.00 92.65  ? 256 GLN B CD  1 
ATOM   2926 O  OE1 . GLN B 1 181 ? -19.764 -25.091 -29.111 1.00 92.67  ? 256 GLN B OE1 1 
ATOM   2927 N  NE2 . GLN B 1 181 ? -17.736 -24.143 -29.389 1.00 92.85  ? 256 GLN B NE2 1 
ATOM   2928 O  OXT . GLN B 1 181 ? -23.079 -20.788 -27.883 1.00 90.22  ? 256 GLN B OXT 1 
HETATM 2929 N  N   . SEP C 2 4   ? 41.833  -5.052  -3.654  1.00 50.84  ? 171 SEP C N   1 
HETATM 2930 C  CA  . SEP C 2 4   ? 41.110  -3.796  -3.441  1.00 51.08  ? 171 SEP C CA  1 
HETATM 2931 C  CB  . SEP C 2 4   ? 39.786  -3.803  -4.208  1.00 55.47  ? 171 SEP C CB  1 
HETATM 2932 O  OG  . SEP C 2 4   ? 39.978  -4.132  -5.572  1.00 61.81  ? 171 SEP C OG  1 
HETATM 2933 C  C   . SEP C 2 4   ? 40.814  -3.527  -1.965  1.00 47.62  ? 171 SEP C C   1 
HETATM 2934 O  O   . SEP C 2 4   ? 40.200  -4.346  -1.298  1.00 47.77  ? 171 SEP C O   1 
HETATM 2935 P  P   . SEP C 2 4   ? 38.510  -3.938  -6.412  1.00 65.90  ? 171 SEP C P   1 
HETATM 2936 O  O1P . SEP C 2 4   ? 37.485  -4.863  -5.837  1.00 65.75  ? 171 SEP C O1P 1 
HETATM 2937 O  O2P . SEP C 2 4   ? 38.031  -2.527  -6.534  1.00 65.97  ? 171 SEP C O2P 1 
HETATM 2938 O  O3P . SEP C 2 4   ? 38.797  -4.412  -7.804  1.00 65.38  ? 171 SEP C O3P 1 
ATOM   2939 N  N   . PRO C 2 5   ? 41.240  -2.364  -1.443  1.00 46.37  ? 172 PRO C N   1 
ATOM   2940 C  CA  . PRO C 2 5   ? 41.018  -1.982  -0.038  1.00 44.45  ? 172 PRO C CA  1 
ATOM   2941 C  C   . PRO C 2 5   ? 39.541  -1.664  0.262   1.00 41.12  ? 172 PRO C C   1 
ATOM   2942 O  O   . PRO C 2 5   ? 39.048  -1.917  1.358   1.00 41.06  ? 172 PRO C O   1 
ATOM   2943 C  CB  . PRO C 2 5   ? 41.909  -0.742  0.133   1.00 44.51  ? 172 PRO C CB  1 
ATOM   2944 C  CG  . PRO C 2 5   ? 42.930  -0.881  -0.939  1.00 44.85  ? 172 PRO C CG  1 
ATOM   2945 C  CD  . PRO C 2 5   ? 42.128  -1.396  -2.101  1.00 45.09  ? 172 PRO C CD  1 
ATOM   2946 N  N   . THR C 2 6   ? 38.855  -1.089  -0.724  1.00 40.39  ? 173 THR C N   1 
ATOM   2947 C  CA  . THR C 2 6   ? 37.453  -0.733  -0.591  1.00 40.12  ? 173 THR C CA  1 
ATOM   2948 C  C   . THR C 2 6   ? 36.569  -1.945  -0.890  1.00 41.20  ? 173 THR C C   1 
ATOM   2949 O  O   . THR C 2 6   ? 37.072  -3.009  -1.258  1.00 39.76  ? 173 THR C O   1 
ATOM   2950 C  CB  . THR C 2 6   ? 37.094  0.419   -1.555  1.00 40.68  ? 173 THR C CB  1 
ATOM   2951 O  OG1 . THR C 2 6   ? 37.498  0.092   -2.889  1.00 39.69  ? 173 THR C OG1 1 
ATOM   2952 C  CG2 . THR C 2 6   ? 37.789  1.730   -1.106  1.00 38.17  ? 173 THR C CG2 1 
HETATM 2953 N  N   . SEP C 2 7   ? 35.257  -1.792  -0.721  1.00 40.78  ? 174 SEP C N   1 
HETATM 2954 C  CA  . SEP C 2 7   ? 34.337  -2.895  -0.988  1.00 43.57  ? 174 SEP C CA  1 
HETATM 2955 C  CB  . SEP C 2 7   ? 32.907  -2.503  -0.618  1.00 41.87  ? 174 SEP C CB  1 
HETATM 2956 O  OG  . SEP C 2 7   ? 32.832  -2.206  0.759   1.00 39.66  ? 174 SEP C OG  1 
HETATM 2957 C  C   . SEP C 2 7   ? 34.407  -3.237  -2.471  1.00 45.66  ? 174 SEP C C   1 
HETATM 2958 O  O   . SEP C 2 7   ? 34.238  -2.368  -3.322  1.00 45.00  ? 174 SEP C O   1 
HETATM 2959 P  P   . SEP C 2 7   ? 31.278  -1.981  1.227   1.00 36.89  ? 174 SEP C P   1 
HETATM 2960 O  O1P . SEP C 2 7   ? 30.463  -1.219  0.199   1.00 38.16  ? 174 SEP C O1P 1 
HETATM 2961 O  O2P . SEP C 2 7   ? 30.665  -3.196  1.739   1.00 37.42  ? 174 SEP C O2P 1 
HETATM 2962 O  O3P . SEP C 2 7   ? 31.411  -1.010  2.392   1.00 38.36  ? 174 SEP C O3P 1 
ATOM   2963 N  N   . PRO C 2 8   ? 34.644  -4.510  -2.800  1.00 46.43  ? 175 PRO C N   1 
ATOM   2964 C  CA  . PRO C 2 8   ? 34.731  -4.902  -4.211  1.00 48.97  ? 175 PRO C CA  1 
ATOM   2965 C  C   . PRO C 2 8   ? 33.557  -4.389  -5.042  1.00 49.94  ? 175 PRO C C   1 
ATOM   2966 O  O   . PRO C 2 8   ? 32.471  -4.192  -4.461  1.00 52.79  ? 175 PRO C O   1 
ATOM   2967 C  CB  . PRO C 2 8   ? 34.779  -6.428  -4.136  1.00 48.78  ? 175 PRO C CB  1 
ATOM   2968 C  CG  . PRO C 2 8   ? 35.495  -6.677  -2.832  1.00 48.11  ? 175 PRO C CG  1 
ATOM   2969 C  CD  . PRO C 2 8   ? 34.827  -5.672  -1.917  1.00 47.37  ? 175 PRO C CD  1 
ATOM   2970 N  N   . PRO D 2 1   ? 19.409  -39.032 -26.563 1.00 71.94  ? 168 PRO D N   1 
ATOM   2971 C  CA  . PRO D 2 1   ? 18.779  -40.346 -26.507 1.00 76.02  ? 168 PRO D CA  1 
ATOM   2972 C  C   . PRO D 2 1   ? 17.659  -40.492 -27.515 1.00 78.35  ? 168 PRO D C   1 
ATOM   2973 O  O   . PRO D 2 1   ? 17.272  -39.579 -28.281 1.00 79.09  ? 168 PRO D O   1 
ATOM   2974 C  CB  . PRO D 2 1   ? 18.293  -40.584 -25.080 1.00 76.49  ? 168 PRO D CB  1 
ATOM   2975 C  CG  . PRO D 2 1   ? 18.397  -39.234 -24.460 1.00 72.71  ? 168 PRO D CG  1 
ATOM   2976 C  CD  . PRO D 2 1   ? 19.417  -38.434 -25.224 1.00 74.37  ? 168 PRO D CD  1 
ATOM   2977 N  N   . SER D 2 2   ? 17.031  -41.630 -27.518 1.00 78.05  ? 169 SER D N   1 
ATOM   2978 C  CA  . SER D 2 2   ? 16.174  -41.635 -28.553 1.00 75.81  ? 169 SER D CA  1 
ATOM   2979 C  C   . SER D 2 2   ? 14.881  -40.904 -28.252 1.00 73.26  ? 169 SER D C   1 
ATOM   2980 O  O   . SER D 2 2   ? 14.132  -40.747 -29.221 1.00 69.77  ? 169 SER D O   1 
ATOM   2981 C  CB  . SER D 2 2   ? 16.240  -43.008 -29.206 1.00 75.24  ? 169 SER D CB  1 
ATOM   2982 O  OG  . SER D 2 2   ? 14.987  -43.389 -29.750 1.00 81.25  ? 169 SER D OG  1 
ATOM   2983 N  N   . TYR D 2 3   ? 14.751  -40.294 -27.042 1.00 69.14  ? 170 TYR D N   1 
ATOM   2984 C  CA  . TYR D 2 3   ? 13.589  -39.544 -27.343 1.00 65.76  ? 170 TYR D CA  1 
ATOM   2985 C  C   . TYR D 2 3   ? 12.930  -38.548 -26.490 1.00 64.80  ? 170 TYR D C   1 
ATOM   2986 O  O   . TYR D 2 3   ? 11.703  -38.458 -26.576 1.00 67.23  ? 170 TYR D O   1 
ATOM   2987 C  CB  . TYR D 2 3   ? 12.584  -40.562 -27.930 1.00 65.57  ? 170 TYR D CB  1 
ATOM   2988 C  CG  . TYR D 2 3   ? 12.337  -41.648 -26.882 1.00 63.71  ? 170 TYR D CG  1 
ATOM   2989 C  CD1 . TYR D 2 3   ? 11.820  -41.290 -25.650 1.00 61.57  ? 170 TYR D CD1 1 
ATOM   2990 C  CD2 . TYR D 2 3   ? 12.656  -43.010 -27.096 1.00 62.87  ? 170 TYR D CD2 1 
ATOM   2991 C  CE1 . TYR D 2 3   ? 11.605  -42.217 -24.646 1.00 59.39  ? 170 TYR D CE1 1 
ATOM   2992 C  CE2 . TYR D 2 3   ? 12.443  -43.954 -26.087 1.00 60.86  ? 170 TYR D CE2 1 
ATOM   2993 C  CZ  . TYR D 2 3   ? 11.914  -43.540 -24.865 1.00 59.68  ? 170 TYR D CZ  1 
ATOM   2994 O  OH  . TYR D 2 3   ? 11.729  -44.461 -23.862 1.00 58.51  ? 170 TYR D OH  1 
HETATM 2995 N  N   . SEP D 2 4   ? 13.562  -37.840 -25.745 1.00 63.86  ? 171 SEP D N   1 
HETATM 2996 C  CA  . SEP D 2 4   ? 12.963  -36.840 -24.833 1.00 60.33  ? 171 SEP D CA  1 
HETATM 2997 C  CB  . SEP D 2 4   ? 13.070  -35.428 -25.433 1.00 63.34  ? 171 SEP D CB  1 
HETATM 2998 O  OG  . SEP D 2 4   ? 12.774  -34.480 -24.433 1.00 68.86  ? 171 SEP D OG  1 
HETATM 2999 C  C   . SEP D 2 4   ? 11.505  -37.112 -24.414 1.00 55.02  ? 171 SEP D C   1 
HETATM 3000 O  O   . SEP D 2 4   ? 10.593  -37.042 -25.230 1.00 54.73  ? 171 SEP D O   1 
HETATM 3001 P  P   . SEP D 2 4   ? 13.061  -32.980 -25.042 1.00 73.98  ? 171 SEP D P   1 
HETATM 3002 O  O1P . SEP D 2 4   ? 12.092  -32.698 -26.180 1.00 73.61  ? 171 SEP D O1P 1 
HETATM 3003 O  O2P . SEP D 2 4   ? 13.065  -31.946 -23.991 1.00 74.57  ? 171 SEP D O2P 1 
HETATM 3004 O  O3P . SEP D 2 4   ? 14.451  -32.992 -25.647 1.00 73.74  ? 171 SEP D O3P 1 
ATOM   3005 N  N   . PRO D 2 5   ? 11.253  -37.387 -23.126 1.00 51.17  ? 172 PRO D N   1 
ATOM   3006 C  CA  . PRO D 2 5   ? 9.911   -37.676 -22.584 1.00 47.33  ? 172 PRO D CA  1 
ATOM   3007 C  C   . PRO D 2 5   ? 8.938   -36.503 -22.323 1.00 44.48  ? 172 PRO D C   1 
ATOM   3008 O  O   . PRO D 2 5   ? 7.771   -36.738 -21.981 1.00 43.60  ? 172 PRO D O   1 
ATOM   3009 C  CB  . PRO D 2 5   ? 10.239  -38.424 -21.307 1.00 46.65  ? 172 PRO D CB  1 
ATOM   3010 C  CG  . PRO D 2 5   ? 11.448  -37.650 -20.833 1.00 48.37  ? 172 PRO D CG  1 
ATOM   3011 C  CD  . PRO D 2 5   ? 12.282  -37.508 -22.081 1.00 48.61  ? 172 PRO D CD  1 
ATOM   3012 N  N   . THR D 2 6   ? 9.396   -35.260 -22.465 1.00 41.90  ? 173 THR D N   1 
ATOM   3013 C  CA  . THR D 2 6   ? 8.521   -34.110 -22.218 1.00 42.06  ? 173 THR D CA  1 
ATOM   3014 C  C   . THR D 2 6   ? 7.548   -33.834 -23.360 1.00 42.60  ? 173 THR D C   1 
ATOM   3015 O  O   . THR D 2 6   ? 7.508   -34.560 -24.351 1.00 42.55  ? 173 THR D O   1 
ATOM   3016 C  CB  . THR D 2 6   ? 9.312   -32.804 -21.947 1.00 41.14  ? 173 THR D CB  1 
ATOM   3017 O  OG1 . THR D 2 6   ? 10.163  -32.506 -23.062 1.00 43.09  ? 173 THR D OG1 1 
ATOM   3018 C  CG2 . THR D 2 6   ? 10.137  -32.941 -20.689 1.00 39.32  ? 173 THR D CG2 1 
HETATM 3019 N  N   . SEP D 2 7   ? 6.763   -32.773 -23.223 1.00 43.24  ? 174 SEP D N   1 
HETATM 3020 C  CA  . SEP D 2 7   ? 5.670   -32.382 -24.268 1.00 42.58  ? 174 SEP D CA  1 
HETATM 3021 C  CB  . SEP D 2 7   ? 4.679   -31.521 -23.697 1.00 40.02  ? 174 SEP D CB  1 
HETATM 3022 O  OG  . SEP D 2 7   ? 3.818   -32.218 -22.832 1.00 37.62  ? 174 SEP D OG  1 
HETATM 3023 C  C   . SEP D 2 7   ? 6.337   -31.735 -25.453 1.00 45.83  ? 174 SEP D C   1 
HETATM 3024 O  O   . SEP D 2 7   ? 7.100   -30.781 -25.326 1.00 47.27  ? 174 SEP D O   1 
HETATM 3025 P  P   . SEP D 2 7   ? 2.559   -31.250 -22.375 1.00 32.56  ? 174 SEP D P   1 
HETATM 3026 O  O1P . SEP D 2 7   ? 2.226   -31.610 -20.959 1.00 34.61  ? 174 SEP D O1P 1 
HETATM 3027 O  O2P . SEP D 2 7   ? 2.853   -29.830 -22.594 1.00 31.98  ? 174 SEP D O2P 1 
HETATM 3028 O  O3P . SEP D 2 7   ? 1.328   -31.615 -23.167 1.00 35.65  ? 174 SEP D O3P 1 
ATOM   3029 N  N   . PRO D 2 8   ? 6.132   -32.387 -26.658 1.00 49.74  ? 175 PRO D N   1 
ATOM   3030 C  CA  . PRO D 2 8   ? 6.988   -31.836 -27.707 1.00 54.01  ? 175 PRO D CA  1 
ATOM   3031 C  C   . PRO D 2 8   ? 6.188   -30.511 -27.944 1.00 57.18  ? 175 PRO D C   1 
ATOM   3032 O  O   . PRO D 2 8   ? 7.268   -29.440 -27.871 1.00 61.34  ? 175 PRO D O   1 
ATOM   3033 C  CB  . PRO D 2 8   ? 6.864   -32.834 -28.853 1.00 53.11  ? 175 PRO D CB  1 
ATOM   3034 C  CG  . PRO D 2 8   ? 5.818   -33.773 -28.445 1.00 50.62  ? 175 PRO D CG  1 
ATOM   3035 C  CD  . PRO D 2 8   ? 5.708   -33.753 -26.965 1.00 47.69  ? 175 PRO D CD  1 
ATOM   3036 N  N   . SER D 2 9   ? 4.660   -30.789 -28.024 1.00 60.87  ? 176 SER D N   1 
ATOM   3037 C  CA  . SER D 2 9   ? 2.836   -30.476 -28.213 1.00 64.82  ? 176 SER D CA  1 
ATOM   3038 C  C   . SER D 2 9   ? 2.434   -29.186 -28.954 1.00 66.75  ? 176 SER D C   1 
ATOM   3039 O  O   . SER D 2 9   ? 1.708   -29.281 -29.981 1.00 70.63  ? 176 SER D O   1 
ATOM   3040 C  CB  . SER D 2 9   ? 2.050   -30.601 -26.702 1.00 65.84  ? 176 SER D CB  1 
ATOM   3041 O  OG  . SER D 2 9   ? 1.487   -29.542 -25.675 1.00 61.14  ? 176 SER D OG  1 
ATOM   3042 O  OXT . SER D 2 9   ? 2.854   -28.088 -28.531 1.00 69.23  ? 176 SER D OXT 1 
HETATM 3043 MG MG  . MG  E 3 .   ? 2.394   -27.782 -22.451 1.00 42.64  ? 257 MG  B MG  1 
HETATM 3044 MG MG  . MG  F 3 .   ? 28.965  -0.688  -0.177  1.00 44.29  ? 151 MG  C MG  1 
HETATM 3045 O  O   . HOH G 4 .   ? 45.603  2.642   6.857   1.00 27.39  ? 257 HOH A O   1 
HETATM 3046 O  O   . HOH G 4 .   ? 35.876  -8.465  10.643  1.00 27.28  ? 258 HOH A O   1 
HETATM 3047 O  O   . HOH G 4 .   ? 26.737  15.252  7.923   1.00 39.26  ? 259 HOH A O   1 
HETATM 3048 O  O   . HOH G 4 .   ? 26.091  10.195  -6.369  1.00 42.23  ? 260 HOH A O   1 
HETATM 3049 O  O   . HOH G 4 .   ? 35.972  -7.307  13.277  1.00 35.55  ? 261 HOH A O   1 
HETATM 3050 O  O   . HOH G 4 .   ? 43.263  -4.675  6.569   1.00 31.59  ? 262 HOH A O   1 
HETATM 3051 O  O   . HOH G 4 .   ? 41.342  2.925   16.406  1.00 33.82  ? 263 HOH A O   1 
HETATM 3052 O  O   . HOH G 4 .   ? 31.751  12.528  10.836  1.00 43.37  ? 264 HOH A O   1 
HETATM 3053 O  O   . HOH G 4 .   ? 48.262  7.810   -3.509  1.00 37.76  ? 265 HOH A O   1 
HETATM 3054 O  O   . HOH G 4 .   ? 33.126  0.861   16.893  1.00 32.33  ? 266 HOH A O   1 
HETATM 3055 O  O   . HOH G 4 .   ? 22.573  -11.997 3.634   1.00 35.03  ? 267 HOH A O   1 
HETATM 3056 O  O   . HOH G 4 .   ? 49.146  4.016   6.436   1.00 35.35  ? 268 HOH A O   1 
HETATM 3057 O  O   . HOH G 4 .   ? 15.559  -0.570  18.348  1.00 40.74  ? 269 HOH A O   1 
HETATM 3058 O  O   . HOH G 4 .   ? 45.923  8.298   -4.003  1.00 37.37  ? 270 HOH A O   1 
HETATM 3059 O  O   . HOH G 4 .   ? 33.975  3.976   -1.839  1.00 39.84  ? 271 HOH A O   1 
HETATM 3060 O  O   . HOH G 4 .   ? 20.177  -6.157  19.775  1.00 44.26  ? 272 HOH A O   1 
HETATM 3061 O  O   . HOH G 4 .   ? 36.166  10.344  -3.267  1.00 37.57  ? 273 HOH A O   1 
HETATM 3062 O  O   . HOH G 4 .   ? 32.850  3.923   16.725  1.00 43.59  ? 274 HOH A O   1 
HETATM 3063 O  O   . HOH G 4 .   ? 34.389  -4.700  16.557  1.00 46.36  ? 275 HOH A O   1 
HETATM 3064 O  O   . HOH G 4 .   ? 21.423  11.788  2.606   1.00 45.95  ? 276 HOH A O   1 
HETATM 3065 O  O   . HOH G 4 .   ? 6.239   -12.391 8.869   1.00 50.54  ? 277 HOH A O   1 
HETATM 3066 O  O   . HOH G 4 .   ? 19.026  -7.816  17.864  1.00 48.71  ? 278 HOH A O   1 
HETATM 3067 O  O   . HOH G 4 .   ? 27.765  14.979  5.183   1.00 45.47  ? 279 HOH A O   1 
HETATM 3068 O  O   . HOH G 4 .   ? 47.671  0.883   5.973   1.00 38.38  ? 280 HOH A O   1 
HETATM 3069 O  O   . HOH G 4 .   ? 16.492  -6.639  20.774  1.00 44.24  ? 281 HOH A O   1 
HETATM 3070 O  O   . HOH G 4 .   ? 32.044  19.476  -0.779  1.00 40.18  ? 282 HOH A O   1 
HETATM 3071 O  O   . HOH G 4 .   ? 20.222  -2.173  -1.507  1.00 40.53  ? 283 HOH A O   1 
HETATM 3072 O  O   . HOH G 4 .   ? 15.488  -15.526 9.586   1.00 46.37  ? 284 HOH A O   1 
HETATM 3073 O  O   . HOH G 4 .   ? 28.954  -13.175 7.298   1.00 39.72  ? 285 HOH A O   1 
HETATM 3074 O  O   . HOH G 4 .   ? 26.409  -14.805 -3.726  1.00 49.07  ? 286 HOH A O   1 
HETATM 3075 O  O   . HOH G 4 .   ? 25.645  -11.985 -3.837  1.00 48.21  ? 287 HOH A O   1 
HETATM 3076 O  O   . HOH G 4 .   ? 11.710  -2.576  19.385  1.00 46.03  ? 288 HOH A O   1 
HETATM 3077 O  O   . HOH G 4 .   ? 24.270  15.813  9.223   1.00 43.97  ? 289 HOH A O   1 
HETATM 3078 O  O   . HOH H 4 .   ? -17.683 -28.269 -11.049 1.00 19.82  ? 258 HOH B O   1 
HETATM 3079 O  O   . HOH H 4 .   ? 18.631  -29.230 -7.991  1.00 23.73  ? 259 HOH B O   1 
HETATM 3080 O  O   . HOH H 4 .   ? 1.407   -18.808 -10.968 1.00 29.64  ? 260 HOH B O   1 
HETATM 3081 O  O   . HOH H 4 .   ? -14.239 -39.511 -11.767 1.00 34.37  ? 261 HOH B O   1 
HETATM 3082 O  O   . HOH H 4 .   ? 8.875   -18.380 -17.389 1.00 27.26  ? 262 HOH B O   1 
HETATM 3083 O  O   . HOH H 4 .   ? -5.843  -42.768 -15.492 1.00 34.48  ? 263 HOH B O   1 
HETATM 3084 O  O   . HOH H 4 .   ? 8.462   -29.171 -19.112 1.00 41.94  ? 264 HOH B O   1 
HETATM 3085 O  O   . HOH H 4 .   ? 3.004   -24.114 -4.771  1.00 33.58  ? 265 HOH B O   1 
HETATM 3086 O  O   . HOH H 4 .   ? -23.040 -34.555 -6.827  1.00 42.55  ? 266 HOH B O   1 
HETATM 3087 O  O   . HOH H 4 .   ? -20.975 -33.563 -25.913 1.00 35.12  ? 267 HOH B O   1 
HETATM 3088 O  O   . HOH H 4 .   ? -2.668  -42.187 -22.238 1.00 34.21  ? 268 HOH B O   1 
HETATM 3089 O  O   . HOH H 4 .   ? -15.231 -25.772 -28.477 1.00 31.92  ? 269 HOH B O   1 
HETATM 3090 O  O   . HOH H 4 .   ? -8.815  -29.819 -29.367 1.00 41.19  ? 270 HOH B O   1 
HETATM 3091 O  O   . HOH H 4 .   ? -21.090 -32.976 -14.837 1.00 32.75  ? 271 HOH B O   1 
HETATM 3092 O  O   . HOH H 4 .   ? 20.412  -23.471 -12.148 1.00 34.85  ? 272 HOH B O   1 
HETATM 3093 O  O   . HOH H 4 .   ? 6.221   -44.114 -21.163 1.00 39.12  ? 273 HOH B O   1 
HETATM 3094 O  O   . HOH H 4 .   ? -16.058 -36.262 -24.673 1.00 32.36  ? 274 HOH B O   1 
HETATM 3095 O  O   . HOH H 4 .   ? -5.823  -24.235 -2.386  1.00 33.62  ? 275 HOH B O   1 
HETATM 3096 O  O   . HOH H 4 .   ? 0.935   -34.621 -38.691 1.00 43.18  ? 276 HOH B O   1 
HETATM 3097 O  O   . HOH H 4 .   ? -3.661  -43.104 -19.751 1.00 31.91  ? 277 HOH B O   1 
HETATM 3098 O  O   . HOH H 4 .   ? -18.309 -33.407 -17.287 1.00 34.50  ? 278 HOH B O   1 
HETATM 3099 O  O   . HOH H 4 .   ? 3.351   -42.845 -22.379 1.00 37.28  ? 279 HOH B O   1 
HETATM 3100 O  O   . HOH H 4 .   ? 19.994  -34.905 -17.887 1.00 34.06  ? 280 HOH B O   1 
HETATM 3101 O  O   . HOH H 4 .   ? -8.262  -31.098 -3.523  1.00 46.26  ? 281 HOH B O   1 
HETATM 3102 O  O   . HOH H 4 .   ? 4.137   -20.580 -4.685  1.00 43.14  ? 282 HOH B O   1 
HETATM 3103 O  O   . HOH H 4 .   ? -17.368 -34.612 -14.982 1.00 30.32  ? 283 HOH B O   1 
HETATM 3104 O  O   . HOH H 4 .   ? 5.212   -23.537 -6.574  1.00 34.35  ? 284 HOH B O   1 
HETATM 3105 O  O   . HOH H 4 .   ? -9.501  -25.102 -0.829  1.00 34.84  ? 285 HOH B O   1 
HETATM 3106 O  O   . HOH H 4 .   ? 2.235   -13.548 -13.563 1.00 44.21  ? 286 HOH B O   1 
HETATM 3107 O  O   . HOH H 4 .   ? 0.806   -22.818 -3.559  1.00 36.13  ? 287 HOH B O   1 
HETATM 3108 O  O   . HOH H 4 .   ? -10.841 -30.923 0.608   1.00 41.73  ? 288 HOH B O   1 
HETATM 3109 O  O   . HOH H 4 .   ? -2.992  -21.526 -24.435 1.00 38.72  ? 289 HOH B O   1 
HETATM 3110 O  O   . HOH H 4 .   ? -20.303 -35.050 -18.638 1.00 36.35  ? 290 HOH B O   1 
HETATM 3111 O  O   . HOH H 4 .   ? 22.232  -45.685 -16.920 1.00 42.58  ? 291 HOH B O   1 
HETATM 3112 O  O   . HOH H 4 .   ? -18.412 -42.143 -20.173 1.00 50.29  ? 292 HOH B O   1 
HETATM 3113 O  O   . HOH H 4 .   ? 13.431  -27.358 -15.329 1.00 34.17  ? 293 HOH B O   1 
HETATM 3114 O  O   . HOH H 4 .   ? 17.483  -39.045 -9.325  1.00 39.59  ? 294 HOH B O   1 
HETATM 3115 O  O   . HOH H 4 .   ? -20.794 -35.609 -8.240  1.00 40.47  ? 295 HOH B O   1 
HETATM 3116 O  O   . HOH H 4 .   ? -20.739 -19.065 -11.560 1.00 33.13  ? 296 HOH B O   1 
HETATM 3117 O  O   . HOH H 4 .   ? 10.448  -43.317 -15.139 1.00 43.19  ? 297 HOH B O   1 
HETATM 3118 O  O   . HOH H 4 .   ? 16.499  -22.790 -9.914  1.00 48.28  ? 298 HOH B O   1 
HETATM 3119 O  O   . HOH H 4 .   ? -24.923 -22.215 -17.697 1.00 39.18  ? 299 HOH B O   1 
HETATM 3120 O  O   . HOH H 4 .   ? -6.518  -23.129 -30.930 1.00 38.70  ? 300 HOH B O   1 
HETATM 3121 O  O   . HOH H 4 .   ? -7.335  -36.528 -27.815 1.00 44.69  ? 301 HOH B O   1 
HETATM 3122 O  O   . HOH H 4 .   ? 11.832  -29.942 -3.406  1.00 46.64  ? 302 HOH B O   1 
HETATM 3123 O  O   . HOH H 4 .   ? 9.402   -27.939 -3.955  1.00 44.83  ? 303 HOH B O   1 
HETATM 3124 O  O   . HOH H 4 .   ? -2.681  -38.186 -8.657  1.00 43.13  ? 304 HOH B O   1 
HETATM 3125 O  O   . HOH H 4 .   ? -23.789 -24.268 -8.834  1.00 41.33  ? 305 HOH B O   1 
HETATM 3126 O  O   . HOH H 4 .   ? 12.441  -15.667 -11.543 1.00 45.38  ? 306 HOH B O   1 
HETATM 3127 O  O   . HOH H 4 .   ? -4.223  -39.689 -10.905 1.00 39.70  ? 307 HOH B O   1 
HETATM 3128 O  O   . HOH H 4 .   ? 18.839  -41.673 -10.225 1.00 42.99  ? 308 HOH B O   1 
HETATM 3129 O  O   . HOH H 4 .   ? -13.052 -33.796 -32.743 1.00 42.08  ? 309 HOH B O   1 
HETATM 3130 O  O   . HOH H 4 .   ? 8.052   -22.691 -7.221  1.00 42.33  ? 310 HOH B O   1 
HETATM 3131 O  O   . HOH H 4 .   ? -1.919  -34.248 -40.242 1.00 48.23  ? 311 HOH B O   1 
HETATM 3132 O  O   . HOH H 4 .   ? -21.607 -17.019 -13.639 1.00 38.28  ? 312 HOH B O   1 
HETATM 3133 O  O   . HOH H 4 .   ? -10.238 -19.941 -5.065  1.00 39.79  ? 313 HOH B O   1 
HETATM 3134 O  O   . HOH H 4 .   ? 0.373   -23.774 -30.104 1.00 48.72  ? 314 HOH B O   1 
HETATM 3135 O  O   . HOH H 4 .   ? 12.099  -44.740 -16.831 1.00 35.21  ? 315 HOH B O   1 
HETATM 3136 O  O   . HOH H 4 .   ? -3.093  -27.791 -33.922 1.00 41.69  ? 316 HOH B O   1 
HETATM 3137 O  O   . HOH H 4 .   ? -0.376  -39.279 -30.441 1.00 40.57  ? 317 HOH B O   1 
HETATM 3138 O  O   . HOH H 4 .   ? -4.179  -30.520 -21.700 1.00 37.74  ? 318 HOH B O   1 
HETATM 3139 O  O   . HOH H 4 .   ? 16.076  -30.629 -22.211 1.00 52.63  ? 319 HOH B O   1 
HETATM 3140 O  O   . HOH H 4 .   ? 4.897   -15.501 -7.830  1.00 50.45  ? 320 HOH B O   1 
HETATM 3141 O  O   . HOH H 4 .   ? 9.972   -23.809 -8.340  1.00 46.54  ? 321 HOH B O   1 
HETATM 3142 O  O   . HOH I 4 .   ? 29.689  -4.510  -0.562  1.00 52.64  ? 96  HOH C O   1 
HETATM 3143 O  O   . HOH I 4 .   ? 29.912  -3.198  -3.209  1.00 48.34  ? 99  HOH C O   1 
HETATM 3144 O  O   . HOH I 4 .   ? 36.146  -0.767  -5.233  1.00 47.73  ? 103 HOH C O   1 
HETATM 3145 O  O   . HOH J 4 .   ? 10.245  -30.662 -25.071 1.00 41.15  ? 48  HOH D O   1 
HETATM 3146 O  O   . HOH J 4 .   ? 7.644   -29.695 -23.080 1.00 38.52  ? 50  HOH D O   1 
HETATM 3147 O  O   . HOH J 4 .   ? 9.540   -34.122 -26.392 1.00 47.43  ? 95  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   76  ?   ?   ?   A . n 
A 1 2   GLN 2   77  77  GLN GLN A . n 
A 1 3   TYR 3   78  78  TYR TYR A . n 
A 1 4   LEU 4   79  79  LEU LEU A . n 
A 1 5   LEU 5   80  80  LEU LEU A . n 
A 1 6   PRO 6   81  81  PRO PRO A . n 
A 1 7   GLU 7   82  82  GLU GLU A . n 
A 1 8   ALA 8   83  83  ALA ALA A . n 
A 1 9   LYS 9   84  84  LYS LYS A . n 
A 1 10  ALA 10  85  85  ALA ALA A . n 
A 1 11  GLN 11  86  86  GLN GLN A . n 
A 1 12  ASP 12  87  87  ASP ASP A . n 
A 1 13  SER 13  88  88  SER SER A . n 
A 1 14  ASP 14  89  89  ASP ASP A . n 
A 1 15  LYS 15  90  90  LYS LYS A . n 
A 1 16  ILE 16  91  91  ILE ILE A . n 
A 1 17  CYS 17  92  92  CYS CYS A . n 
A 1 18  VAL 18  93  93  VAL VAL A . n 
A 1 19  VAL 19  94  94  VAL VAL A . n 
A 1 20  ILE 20  95  95  ILE ILE A . n 
A 1 21  ASN 21  96  96  ASN ASN A . n 
A 1 22  LEU 22  97  97  LEU LEU A . n 
A 1 23  ASP 23  98  98  ASP ASP A . n 
A 1 24  GLU 24  99  99  GLU GLU A . n 
A 1 25  THR 25  100 100 THR THR A . n 
A 1 26  LEU 26  101 101 LEU LEU A . n 
A 1 27  VAL 27  102 102 VAL VAL A . n 
A 1 28  HIS 28  103 103 HIS HIS A . n 
A 1 29  SER 29  104 104 SER SER A . n 
A 1 30  SER 30  105 105 SER SER A . n 
A 1 31  PHE 31  106 106 PHE PHE A . n 
A 1 32  LYS 32  107 107 LYS LYS A . n 
A 1 33  PRO 33  108 108 PRO PRO A . n 
A 1 34  VAL 34  109 109 VAL VAL A . n 
A 1 35  ASN 35  110 110 ASN ASN A . n 
A 1 36  ASN 36  111 111 ASN ASN A . n 
A 1 37  ALA 37  112 112 ALA ALA A . n 
A 1 38  ASP 38  113 113 ASP ASP A . n 
A 1 39  PHE 39  114 114 PHE PHE A . n 
A 1 40  ILE 40  115 115 ILE ILE A . n 
A 1 41  ILE 41  116 116 ILE ILE A . n 
A 1 42  PRO 42  117 117 PRO PRO A . n 
A 1 43  VAL 43  118 118 VAL VAL A . n 
A 1 44  GLU 44  119 119 GLU GLU A . n 
A 1 45  ILE 45  120 120 ILE ILE A . n 
A 1 46  ASP 46  121 121 ASP ASP A . n 
A 1 47  GLY 47  122 122 GLY GLY A . n 
A 1 48  VAL 48  123 123 VAL VAL A . n 
A 1 49  VAL 49  124 124 VAL VAL A . n 
A 1 50  HIS 50  125 125 HIS HIS A . n 
A 1 51  GLN 51  126 126 GLN GLN A . n 
A 1 52  VAL 52  127 127 VAL VAL A . n 
A 1 53  TYR 53  128 128 TYR TYR A . n 
A 1 54  VAL 54  129 129 VAL VAL A . n 
A 1 55  LEU 55  130 130 LEU LEU A . n 
A 1 56  LYS 56  131 131 LYS LYS A . n 
A 1 57  ARG 57  132 132 ARG ARG A . n 
A 1 58  PRO 58  133 133 PRO PRO A . n 
A 1 59  HIS 59  134 134 HIS HIS A . n 
A 1 60  VAL 60  135 135 VAL VAL A . n 
A 1 61  ASP 61  136 136 ASP ASP A . n 
A 1 62  GLU 62  137 137 GLU GLU A . n 
A 1 63  PHE 63  138 138 PHE PHE A . n 
A 1 64  LEU 64  139 139 LEU LEU A . n 
A 1 65  GLN 65  140 140 GLN GLN A . n 
A 1 66  ARG 66  141 141 ARG ARG A . n 
A 1 67  MET 67  142 142 MET MET A . n 
A 1 68  GLY 68  143 143 GLY GLY A . n 
A 1 69  GLU 69  144 144 GLU GLU A . n 
A 1 70  LEU 70  145 145 LEU LEU A . n 
A 1 71  PHE 71  146 146 PHE PHE A . n 
A 1 72  GLU 72  147 147 GLU GLU A . n 
A 1 73  CYS 73  148 148 CYS CYS A . n 
A 1 74  VAL 74  149 149 VAL VAL A . n 
A 1 75  LEU 75  150 150 LEU LEU A . n 
A 1 76  PHE 76  151 151 PHE PHE A . n 
A 1 77  THR 77  152 152 THR THR A . n 
A 1 78  ALA 78  153 153 ALA ALA A . n 
A 1 79  SER 79  154 154 SER SER A . n 
A 1 80  LEU 80  155 155 LEU LEU A . n 
A 1 81  ALA 81  156 156 ALA ALA A . n 
A 1 82  LYS 82  157 157 LYS LYS A . n 
A 1 83  TYR 83  158 158 TYR TYR A . n 
A 1 84  ALA 84  159 159 ALA ALA A . n 
A 1 85  ASP 85  160 160 ASP ASP A . n 
A 1 86  PRO 86  161 161 PRO PRO A . n 
A 1 87  VAL 87  162 162 VAL VAL A . n 
A 1 88  ALA 88  163 163 ALA ALA A . n 
A 1 89  ASP 89  164 164 ASP ASP A . n 
A 1 90  LEU 90  165 165 LEU LEU A . n 
A 1 91  LEU 91  166 166 LEU LEU A . n 
A 1 92  ASP 92  167 167 ASP ASP A . n 
A 1 93  LYS 93  168 168 LYS LYS A . n 
A 1 94  TRP 94  169 169 TRP TRP A . n 
A 1 95  GLY 95  170 170 GLY GLY A . n 
A 1 96  ALA 96  171 171 ALA ALA A . n 
A 1 97  PHE 97  172 172 PHE PHE A . n 
A 1 98  ARG 98  173 173 ARG ARG A . n 
A 1 99  ALA 99  174 174 ALA ALA A . n 
A 1 100 ARG 100 175 175 ARG ARG A . n 
A 1 101 LEU 101 176 176 LEU LEU A . n 
A 1 102 PHE 102 177 177 PHE PHE A . n 
A 1 103 ARG 103 178 178 ARG ARG A . n 
A 1 104 GLU 104 179 179 GLU GLU A . n 
A 1 105 SER 105 180 180 SER SER A . n 
A 1 106 CYS 106 181 181 CYS CYS A . n 
A 1 107 VAL 107 182 182 VAL VAL A . n 
A 1 108 PHE 108 183 183 PHE PHE A . n 
A 1 109 HIS 109 184 184 HIS HIS A . n 
A 1 110 ARG 110 185 185 ARG ARG A . n 
A 1 111 GLY 111 186 186 GLY GLY A . n 
A 1 112 ASN 112 187 187 ASN ASN A . n 
A 1 113 TYR 113 188 188 TYR TYR A . n 
A 1 114 VAL 114 189 189 VAL VAL A . n 
A 1 115 LYS 115 190 190 LYS LYS A . n 
A 1 116 ASP 116 191 191 ASP ASP A . n 
A 1 117 LEU 117 192 192 LEU LEU A . n 
A 1 118 SER 118 193 193 SER SER A . n 
A 1 119 ARG 119 194 194 ARG ARG A . n 
A 1 120 LEU 120 195 195 LEU LEU A . n 
A 1 121 GLY 121 196 196 GLY GLY A . n 
A 1 122 ARG 122 197 197 ARG ARG A . n 
A 1 123 ASP 123 198 198 ASP ASP A . n 
A 1 124 LEU 124 199 199 LEU LEU A . n 
A 1 125 ARG 125 200 200 ARG ARG A . n 
A 1 126 ARG 126 201 201 ARG ARG A . n 
A 1 127 VAL 127 202 202 VAL VAL A . n 
A 1 128 LEU 128 203 203 LEU LEU A . n 
A 1 129 ILE 129 204 204 ILE ILE A . n 
A 1 130 LEU 130 205 205 LEU LEU A . n 
A 1 131 ASP 131 206 206 ASP ASP A . n 
A 1 132 ASN 132 207 207 ASN ASN A . n 
A 1 133 SER 133 208 208 SER SER A . n 
A 1 134 PRO 134 209 209 PRO PRO A . n 
A 1 135 ALA 135 210 210 ALA ALA A . n 
A 1 136 SER 136 211 211 SER SER A . n 
A 1 137 TYR 137 212 212 TYR TYR A . n 
A 1 138 VAL 138 213 213 VAL VAL A . n 
A 1 139 PHE 139 214 214 PHE PHE A . n 
A 1 140 HIS 140 215 215 HIS HIS A . n 
A 1 141 PRO 141 216 216 PRO PRO A . n 
A 1 142 ASP 142 217 217 ASP ASP A . n 
A 1 143 ASN 143 218 218 ASN ASN A . n 
A 1 144 ALA 144 219 219 ALA ALA A . n 
A 1 145 VAL 145 220 220 VAL VAL A . n 
A 1 146 PRO 146 221 221 PRO PRO A . n 
A 1 147 VAL 147 222 222 VAL VAL A . n 
A 1 148 ALA 148 223 223 ALA ALA A . n 
A 1 149 SER 149 224 224 SER SER A . n 
A 1 150 TRP 150 225 225 TRP TRP A . n 
A 1 151 PHE 151 226 226 PHE PHE A . n 
A 1 152 ASP 152 227 227 ASP ASP A . n 
A 1 153 ASN 153 228 228 ASN ASN A . n 
A 1 154 MET 154 229 229 MET MET A . n 
A 1 155 SER 155 230 230 SER SER A . n 
A 1 156 ASP 156 231 231 ASP ASP A . n 
A 1 157 THR 157 232 232 THR THR A . n 
A 1 158 GLU 158 233 233 GLU GLU A . n 
A 1 159 LEU 159 234 234 LEU LEU A . n 
A 1 160 HIS 160 235 235 HIS HIS A . n 
A 1 161 ASP 161 236 236 ASP ASP A . n 
A 1 162 LEU 162 237 237 LEU LEU A . n 
A 1 163 LEU 163 238 238 LEU LEU A . n 
A 1 164 PRO 164 239 239 PRO PRO A . n 
A 1 165 PHE 165 240 240 PHE PHE A . n 
A 1 166 PHE 166 241 241 PHE PHE A . n 
A 1 167 GLU 167 242 242 GLU GLU A . n 
A 1 168 GLN 168 243 243 GLN GLN A . n 
A 1 169 LEU 169 244 244 LEU LEU A . n 
A 1 170 SER 170 245 245 SER SER A . n 
A 1 171 ARG 171 246 246 ARG ARG A . n 
A 1 172 VAL 172 247 247 VAL VAL A . n 
A 1 173 ASP 173 248 248 ASP ASP A . n 
A 1 174 ASP 174 249 249 ASP ASP A . n 
A 1 175 VAL 175 250 250 VAL VAL A . n 
A 1 176 TYR 176 251 251 TYR TYR A . n 
A 1 177 SER 177 252 252 SER SER A . n 
A 1 178 VAL 178 253 253 VAL VAL A . n 
A 1 179 LEU 179 254 254 LEU LEU A . n 
A 1 180 ARG 180 255 255 ARG ARG A . n 
A 1 181 GLN 181 256 256 GLN GLN A . n 
B 1 1   HIS 1   76  ?   ?   ?   B . n 
B 1 2   GLN 2   77  77  GLN GLN B . n 
B 1 3   TYR 3   78  78  TYR TYR B . n 
B 1 4   LEU 4   79  79  LEU LEU B . n 
B 1 5   LEU 5   80  80  LEU LEU B . n 
B 1 6   PRO 6   81  81  PRO PRO B . n 
B 1 7   GLU 7   82  82  GLU GLU B . n 
B 1 8   ALA 8   83  83  ALA ALA B . n 
B 1 9   LYS 9   84  84  LYS LYS B . n 
B 1 10  ALA 10  85  85  ALA ALA B . n 
B 1 11  GLN 11  86  86  GLN GLN B . n 
B 1 12  ASP 12  87  87  ASP ASP B . n 
B 1 13  SER 13  88  88  SER SER B . n 
B 1 14  ASP 14  89  89  ASP ASP B . n 
B 1 15  LYS 15  90  90  LYS LYS B . n 
B 1 16  ILE 16  91  91  ILE ILE B . n 
B 1 17  CYS 17  92  92  CYS CYS B . n 
B 1 18  VAL 18  93  93  VAL VAL B . n 
B 1 19  VAL 19  94  94  VAL VAL B . n 
B 1 20  ILE 20  95  95  ILE ILE B . n 
B 1 21  ASN 21  96  96  ASN ASN B . n 
B 1 22  LEU 22  97  97  LEU LEU B . n 
B 1 23  ASP 23  98  98  ASP ASP B . n 
B 1 24  GLU 24  99  99  GLU GLU B . n 
B 1 25  THR 25  100 100 THR THR B . n 
B 1 26  LEU 26  101 101 LEU LEU B . n 
B 1 27  VAL 27  102 102 VAL VAL B . n 
B 1 28  HIS 28  103 103 HIS HIS B . n 
B 1 29  SER 29  104 104 SER SER B . n 
B 1 30  SER 30  105 105 SER SER B . n 
B 1 31  PHE 31  106 106 PHE PHE B . n 
B 1 32  LYS 32  107 107 LYS LYS B . n 
B 1 33  PRO 33  108 108 PRO PRO B . n 
B 1 34  VAL 34  109 109 VAL VAL B . n 
B 1 35  ASN 35  110 110 ASN ASN B . n 
B 1 36  ASN 36  111 111 ASN ASN B . n 
B 1 37  ALA 37  112 112 ALA ALA B . n 
B 1 38  ASP 38  113 113 ASP ASP B . n 
B 1 39  PHE 39  114 114 PHE PHE B . n 
B 1 40  ILE 40  115 115 ILE ILE B . n 
B 1 41  ILE 41  116 116 ILE ILE B . n 
B 1 42  PRO 42  117 117 PRO PRO B . n 
B 1 43  VAL 43  118 118 VAL VAL B . n 
B 1 44  GLU 44  119 119 GLU GLU B . n 
B 1 45  ILE 45  120 120 ILE ILE B . n 
B 1 46  ASP 46  121 121 ASP ASP B . n 
B 1 47  GLY 47  122 122 GLY GLY B . n 
B 1 48  VAL 48  123 123 VAL VAL B . n 
B 1 49  VAL 49  124 124 VAL VAL B . n 
B 1 50  HIS 50  125 125 HIS HIS B . n 
B 1 51  GLN 51  126 126 GLN GLN B . n 
B 1 52  VAL 52  127 127 VAL VAL B . n 
B 1 53  TYR 53  128 128 TYR TYR B . n 
B 1 54  VAL 54  129 129 VAL VAL B . n 
B 1 55  LEU 55  130 130 LEU LEU B . n 
B 1 56  LYS 56  131 131 LYS LYS B . n 
B 1 57  ARG 57  132 132 ARG ARG B . n 
B 1 58  PRO 58  133 133 PRO PRO B . n 
B 1 59  HIS 59  134 134 HIS HIS B . n 
B 1 60  VAL 60  135 135 VAL VAL B . n 
B 1 61  ASP 61  136 136 ASP ASP B . n 
B 1 62  GLU 62  137 137 GLU GLU B . n 
B 1 63  PHE 63  138 138 PHE PHE B . n 
B 1 64  LEU 64  139 139 LEU LEU B . n 
B 1 65  GLN 65  140 140 GLN GLN B . n 
B 1 66  ARG 66  141 141 ARG ARG B . n 
B 1 67  MET 67  142 142 MET MET B . n 
B 1 68  GLY 68  143 143 GLY GLY B . n 
B 1 69  GLU 69  144 144 GLU GLU B . n 
B 1 70  LEU 70  145 145 LEU LEU B . n 
B 1 71  PHE 71  146 146 PHE PHE B . n 
B 1 72  GLU 72  147 147 GLU GLU B . n 
B 1 73  CYS 73  148 148 CYS CYS B . n 
B 1 74  VAL 74  149 149 VAL VAL B . n 
B 1 75  LEU 75  150 150 LEU LEU B . n 
B 1 76  PHE 76  151 151 PHE PHE B . n 
B 1 77  THR 77  152 152 THR THR B . n 
B 1 78  ALA 78  153 153 ALA ALA B . n 
B 1 79  SER 79  154 154 SER SER B . n 
B 1 80  LEU 80  155 155 LEU LEU B . n 
B 1 81  ALA 81  156 156 ALA ALA B . n 
B 1 82  LYS 82  157 157 LYS LYS B . n 
B 1 83  TYR 83  158 158 TYR TYR B . n 
B 1 84  ALA 84  159 159 ALA ALA B . n 
B 1 85  ASP 85  160 160 ASP ASP B . n 
B 1 86  PRO 86  161 161 PRO PRO B . n 
B 1 87  VAL 87  162 162 VAL VAL B . n 
B 1 88  ALA 88  163 163 ALA ALA B . n 
B 1 89  ASP 89  164 164 ASP ASP B . n 
B 1 90  LEU 90  165 165 LEU LEU B . n 
B 1 91  LEU 91  166 166 LEU LEU B . n 
B 1 92  ASP 92  167 167 ASP ASP B . n 
B 1 93  LYS 93  168 168 LYS LYS B . n 
B 1 94  TRP 94  169 169 TRP TRP B . n 
B 1 95  GLY 95  170 170 GLY GLY B . n 
B 1 96  ALA 96  171 171 ALA ALA B . n 
B 1 97  PHE 97  172 172 PHE PHE B . n 
B 1 98  ARG 98  173 173 ARG ARG B . n 
B 1 99  ALA 99  174 174 ALA ALA B . n 
B 1 100 ARG 100 175 175 ARG ARG B . n 
B 1 101 LEU 101 176 176 LEU LEU B . n 
B 1 102 PHE 102 177 177 PHE PHE B . n 
B 1 103 ARG 103 178 178 ARG ARG B . n 
B 1 104 GLU 104 179 179 GLU GLU B . n 
B 1 105 SER 105 180 180 SER SER B . n 
B 1 106 CYS 106 181 181 CYS CYS B . n 
B 1 107 VAL 107 182 182 VAL VAL B . n 
B 1 108 PHE 108 183 183 PHE PHE B . n 
B 1 109 HIS 109 184 184 HIS HIS B . n 
B 1 110 ARG 110 185 185 ARG ARG B . n 
B 1 111 GLY 111 186 186 GLY GLY B . n 
B 1 112 ASN 112 187 187 ASN ASN B . n 
B 1 113 TYR 113 188 188 TYR TYR B . n 
B 1 114 VAL 114 189 189 VAL VAL B . n 
B 1 115 LYS 115 190 190 LYS LYS B . n 
B 1 116 ASP 116 191 191 ASP ASP B . n 
B 1 117 LEU 117 192 192 LEU LEU B . n 
B 1 118 SER 118 193 193 SER SER B . n 
B 1 119 ARG 119 194 194 ARG ARG B . n 
B 1 120 LEU 120 195 195 LEU LEU B . n 
B 1 121 GLY 121 196 196 GLY GLY B . n 
B 1 122 ARG 122 197 197 ARG ARG B . n 
B 1 123 ASP 123 198 198 ASP ASP B . n 
B 1 124 LEU 124 199 199 LEU LEU B . n 
B 1 125 ARG 125 200 200 ARG ARG B . n 
B 1 126 ARG 126 201 201 ARG ARG B . n 
B 1 127 VAL 127 202 202 VAL VAL B . n 
B 1 128 LEU 128 203 203 LEU LEU B . n 
B 1 129 ILE 129 204 204 ILE ILE B . n 
B 1 130 LEU 130 205 205 LEU LEU B . n 
B 1 131 ASP 131 206 206 ASP ASP B . n 
B 1 132 ASN 132 207 207 ASN ASN B . n 
B 1 133 SER 133 208 208 SER SER B . n 
B 1 134 PRO 134 209 209 PRO PRO B . n 
B 1 135 ALA 135 210 210 ALA ALA B . n 
B 1 136 SER 136 211 211 SER SER B . n 
B 1 137 TYR 137 212 212 TYR TYR B . n 
B 1 138 VAL 138 213 213 VAL VAL B . n 
B 1 139 PHE 139 214 214 PHE PHE B . n 
B 1 140 HIS 140 215 215 HIS HIS B . n 
B 1 141 PRO 141 216 216 PRO PRO B . n 
B 1 142 ASP 142 217 217 ASP ASP B . n 
B 1 143 ASN 143 218 218 ASN ASN B . n 
B 1 144 ALA 144 219 219 ALA ALA B . n 
B 1 145 VAL 145 220 220 VAL VAL B . n 
B 1 146 PRO 146 221 221 PRO PRO B . n 
B 1 147 VAL 147 222 222 VAL VAL B . n 
B 1 148 ALA 148 223 223 ALA ALA B . n 
B 1 149 SER 149 224 224 SER SER B . n 
B 1 150 TRP 150 225 225 TRP TRP B . n 
B 1 151 PHE 151 226 226 PHE PHE B . n 
B 1 152 ASP 152 227 227 ASP ASP B . n 
B 1 153 ASN 153 228 228 ASN ASN B . n 
B 1 154 MET 154 229 229 MET MET B . n 
B 1 155 SER 155 230 230 SER SER B . n 
B 1 156 ASP 156 231 231 ASP ASP B . n 
B 1 157 THR 157 232 232 THR THR B . n 
B 1 158 GLU 158 233 233 GLU GLU B . n 
B 1 159 LEU 159 234 234 LEU LEU B . n 
B 1 160 HIS 160 235 235 HIS HIS B . n 
B 1 161 ASP 161 236 236 ASP ASP B . n 
B 1 162 LEU 162 237 237 LEU LEU B . n 
B 1 163 LEU 163 238 238 LEU LEU B . n 
B 1 164 PRO 164 239 239 PRO PRO B . n 
B 1 165 PHE 165 240 240 PHE PHE B . n 
B 1 166 PHE 166 241 241 PHE PHE B . n 
B 1 167 GLU 167 242 242 GLU GLU B . n 
B 1 168 GLN 168 243 243 GLN GLN B . n 
B 1 169 LEU 169 244 244 LEU LEU B . n 
B 1 170 SER 170 245 245 SER SER B . n 
B 1 171 ARG 171 246 246 ARG ARG B . n 
B 1 172 VAL 172 247 247 VAL VAL B . n 
B 1 173 ASP 173 248 248 ASP ASP B . n 
B 1 174 ASP 174 249 249 ASP ASP B . n 
B 1 175 VAL 175 250 250 VAL VAL B . n 
B 1 176 TYR 176 251 251 TYR TYR B . n 
B 1 177 SER 177 252 252 SER SER B . n 
B 1 178 VAL 178 253 253 VAL VAL B . n 
B 1 179 LEU 179 254 254 LEU LEU B . n 
B 1 180 ARG 180 255 255 ARG ARG B . n 
B 1 181 GLN 181 256 256 GLN GLN B . n 
C 2 1   PRO 1   168 ?   ?   ?   C . n 
C 2 2   SER 2   169 ?   ?   ?   C . n 
C 2 3   TYR 3   170 ?   ?   ?   C . n 
C 2 4   SEP 4   171 171 SEP SEP C . n 
C 2 5   PRO 5   172 172 PRO PRO C . n 
C 2 6   THR 6   173 173 THR THR C . n 
C 2 7   SEP 7   174 174 SEP SEP C . n 
C 2 8   PRO 8   175 175 PRO PRO C . n 
C 2 9   SER 9   176 ?   ?   ?   C . n 
D 2 1   PRO 1   168 168 PRO PRO D . n 
D 2 2   SER 2   169 169 SER SER D . n 
D 2 3   TYR 3   170 170 TYR TYR D . n 
D 2 4   SEP 4   171 171 SEP SEP D . n 
D 2 5   PRO 5   172 172 PRO PRO D . n 
D 2 6   THR 6   173 173 THR THR D . n 
D 2 7   SEP 7   174 174 SEP SEP D . n 
D 2 8   PRO 8   175 175 PRO PRO D . n 
D 2 9   SER 9   176 176 SER SER D . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C SEP 4 C SEP 171 ? SER PHOSPHOSERINE 
2 C SEP 7 C SEP 174 ? SER PHOSPHOSERINE 
3 D SEP 4 D SEP 171 ? SER PHOSPHOSERINE 
4 D SEP 7 D SEP 174 ? SER PHOSPHOSERINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F,G,I 
2 1 B,D,E,H,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 850  ? 
1 MORE         -21  ? 
1 'SSA (A^2)'  9150 ? 
2 'ABSA (A^2)' 1410 ? 
2 MORE         -23  ? 
2 'SSA (A^2)'  9090 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2P ? D SEP 7   ? D SEP 174 ? 1_555 MG ? E MG . ? B MG 257 ? 1_555 OD1 ? B ASN 132 ? B ASN 207 ? 1_555 164.2 ? 
2  O2P ? D SEP 7   ? D SEP 174 ? 1_555 MG ? E MG . ? B MG 257 ? 1_555 OD1 ? B ASN 21  ? B ASN 96  ? 1_555 88.8  ? 
3  OD1 ? B ASN 132 ? B ASN 207 ? 1_555 MG ? E MG . ? B MG 257 ? 1_555 OD1 ? B ASN 21  ? B ASN 96  ? 1_555 75.4  ? 
4  O2P ? D SEP 7   ? D SEP 174 ? 1_555 MG ? E MG . ? B MG 257 ? 1_555 O   ? B ASP 23  ? B ASP 98  ? 1_555 94.5  ? 
5  OD1 ? B ASN 132 ? B ASN 207 ? 1_555 MG ? E MG . ? B MG 257 ? 1_555 O   ? B ASP 23  ? B ASP 98  ? 1_555 85.6  ? 
6  OD1 ? B ASN 21  ? B ASN 96  ? 1_555 MG ? E MG . ? B MG 257 ? 1_555 O   ? B ASP 23  ? B ASP 98  ? 1_555 88.2  ? 
7  OD1 ? A ASN 21  ? A ASN 96  ? 1_555 MG ? F MG . ? C MG 151 ? 1_555 OD1 ? A ASN 132 ? A ASN 207 ? 1_555 72.0  ? 
8  OD1 ? A ASN 21  ? A ASN 96  ? 1_555 MG ? F MG . ? C MG 151 ? 1_555 O   ? A ASP 23  ? A ASP 98  ? 1_555 88.3  ? 
9  OD1 ? A ASN 132 ? A ASN 207 ? 1_555 MG ? F MG . ? C MG 151 ? 1_555 O   ? A ASP 23  ? A ASP 98  ? 1_555 79.0  ? 
10 OD1 ? A ASN 21  ? A ASN 96  ? 1_555 MG ? F MG . ? C MG 151 ? 1_555 O1P ? C SEP 7   ? C SEP 174 ? 1_555 108.1 ? 
11 OD1 ? A ASN 132 ? A ASN 207 ? 1_555 MG ? F MG . ? C MG 151 ? 1_555 O1P ? C SEP 7   ? C SEP 174 ? 1_555 176.0 ? 
12 O   ? A ASP 23  ? A ASP 98  ? 1_555 MG ? F MG . ? C MG 151 ? 1_555 O1P ? C SEP 7   ? C SEP 174 ? 1_555 105.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-05 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC  'data collection' .   ? 1 
XDS   'data reduction'  .   ? 2 
AMoRE phasing           .   ? 3 
CNS   refinement        1.1 ? 4 
XDS   'data scaling'    .   ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C  D PRO 175 ? ? O  D PRO 175 ? ? 1.523 1.228 0.295 0.020 N 
2 1 C  D PRO 175 ? ? N  D SER 176 ? ? 1.555 1.336 0.219 0.023 Y 
3 1 N  D SER 176 ? ? CA D SER 176 ? ? 1.860 1.459 0.401 0.020 N 
4 1 CA D SER 176 ? ? CB D SER 176 ? ? 1.708 1.525 0.183 0.015 N 
5 1 CB D SER 176 ? ? OG D SER 176 ? ? 1.579 1.418 0.161 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB D SER 169 ? ? CA D SER 169 ? ? C  D SER 169 ? ? 123.88 110.10 13.78  1.90 N 
2 1 C  D SER 169 ? ? N  D TYR 170 ? ? CA D TYR 170 ? ? 97.29  121.70 -24.41 2.50 Y 
3 1 N  D TYR 170 ? ? CA D TYR 170 ? ? C  D TYR 170 ? ? 127.20 111.00 16.20  2.70 N 
4 1 CA D PRO 175 ? ? C  D PRO 175 ? ? O  D PRO 175 ? ? 103.03 120.20 -17.17 2.40 N 
5 1 O  D PRO 175 ? ? C  D PRO 175 ? ? N  D SER 176 ? ? 145.59 122.70 22.89  1.60 Y 
6 1 C  D PRO 175 ? ? N  D SER 176 ? ? CA D SER 176 ? ? 159.81 121.70 38.11  2.50 Y 
7 1 CA D SER 176 ? ? CB D SER 176 ? ? OG D SER 176 ? ? 133.67 111.20 22.47  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 97  ? ? -98.20  -73.90  
2  1 GLU A 99  ? ? 70.14   -2.31   
3  1 PHE A 177 ? ? -114.66 -169.15 
4  1 ARG A 185 ? ? 36.95   70.64   
5  1 HIS A 215 ? ? -145.86 56.11   
6  1 ASP A 227 ? ? -166.43 7.19    
7  1 ASN A 228 ? ? -68.77  95.74   
8  1 MET A 229 ? ? -67.92  3.06    
9  1 THR A 232 ? ? -145.70 15.13   
10 1 ARG A 255 ? ? 68.19   121.52  
11 1 LEU B 97  ? ? -103.88 -71.10  
12 1 GLU B 99  ? ? 75.85   -4.53   
13 1 PHE B 177 ? ? -109.82 -166.69 
14 1 HIS B 215 ? ? -144.39 53.35   
15 1 ASP B 227 ? ? -162.03 9.11    
16 1 ARG B 255 ? ? 60.95   110.44  
17 1 TYR D 170 ? ? -174.89 33.59   
18 1 SEP D 171 ? ? 24.99   114.13  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A HIS 76  ? A HIS 1 
2 1 Y 1 B HIS 76  ? B HIS 1 
3 1 Y 1 C PRO 168 ? C PRO 1 
4 1 Y 1 C SER 169 ? C SER 2 
5 1 Y 1 C TYR 170 ? C TYR 3 
6 1 Y 1 C SER 176 ? C SER 9 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION' MG  
4 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 MG  1  257 152 MG  MG  B . 
F 3 MG  1  151 151 MG  MG  C . 
G 4 HOH 1  257 2   HOH HOH A . 
G 4 HOH 2  258 5   HOH HOH A . 
G 4 HOH 3  259 10  HOH HOH A . 
G 4 HOH 4  260 12  HOH HOH A . 
G 4 HOH 5  261 15  HOH HOH A . 
G 4 HOH 6  262 16  HOH HOH A . 
G 4 HOH 7  263 19  HOH HOH A . 
G 4 HOH 8  264 20  HOH HOH A . 
G 4 HOH 9  265 26  HOH HOH A . 
G 4 HOH 10 266 30  HOH HOH A . 
G 4 HOH 11 267 37  HOH HOH A . 
G 4 HOH 12 268 40  HOH HOH A . 
G 4 HOH 13 269 42  HOH HOH A . 
G 4 HOH 14 270 44  HOH HOH A . 
G 4 HOH 15 271 46  HOH HOH A . 
G 4 HOH 16 272 55  HOH HOH A . 
G 4 HOH 17 273 56  HOH HOH A . 
G 4 HOH 18 274 63  HOH HOH A . 
G 4 HOH 19 275 64  HOH HOH A . 
G 4 HOH 20 276 65  HOH HOH A . 
G 4 HOH 21 277 67  HOH HOH A . 
G 4 HOH 22 278 69  HOH HOH A . 
G 4 HOH 23 279 72  HOH HOH A . 
G 4 HOH 24 280 73  HOH HOH A . 
G 4 HOH 25 281 74  HOH HOH A . 
G 4 HOH 26 282 77  HOH HOH A . 
G 4 HOH 27 283 78  HOH HOH A . 
G 4 HOH 28 284 81  HOH HOH A . 
G 4 HOH 29 285 82  HOH HOH A . 
G 4 HOH 30 286 88  HOH HOH A . 
G 4 HOH 31 287 89  HOH HOH A . 
G 4 HOH 32 288 94  HOH HOH A . 
G 4 HOH 33 289 97  HOH HOH A . 
H 4 HOH 1  258 1   HOH HOH B . 
H 4 HOH 2  259 3   HOH HOH B . 
H 4 HOH 3  260 4   HOH HOH B . 
H 4 HOH 4  261 6   HOH HOH B . 
H 4 HOH 5  262 7   HOH HOH B . 
H 4 HOH 6  263 8   HOH HOH B . 
H 4 HOH 7  264 9   HOH HOH B . 
H 4 HOH 8  265 11  HOH HOH B . 
H 4 HOH 9  266 13  HOH HOH B . 
H 4 HOH 10 267 14  HOH HOH B . 
H 4 HOH 11 268 17  HOH HOH B . 
H 4 HOH 12 269 18  HOH HOH B . 
H 4 HOH 13 270 21  HOH HOH B . 
H 4 HOH 14 271 22  HOH HOH B . 
H 4 HOH 15 272 23  HOH HOH B . 
H 4 HOH 16 273 24  HOH HOH B . 
H 4 HOH 17 274 25  HOH HOH B . 
H 4 HOH 18 275 27  HOH HOH B . 
H 4 HOH 19 276 28  HOH HOH B . 
H 4 HOH 20 277 29  HOH HOH B . 
H 4 HOH 21 278 31  HOH HOH B . 
H 4 HOH 22 279 32  HOH HOH B . 
H 4 HOH 23 280 33  HOH HOH B . 
H 4 HOH 24 281 34  HOH HOH B . 
H 4 HOH 25 282 35  HOH HOH B . 
H 4 HOH 26 283 36  HOH HOH B . 
H 4 HOH 27 284 38  HOH HOH B . 
H 4 HOH 28 285 39  HOH HOH B . 
H 4 HOH 29 286 41  HOH HOH B . 
H 4 HOH 30 287 43  HOH HOH B . 
H 4 HOH 31 288 45  HOH HOH B . 
H 4 HOH 32 289 47  HOH HOH B . 
H 4 HOH 33 290 49  HOH HOH B . 
H 4 HOH 34 291 51  HOH HOH B . 
H 4 HOH 35 292 52  HOH HOH B . 
H 4 HOH 36 293 53  HOH HOH B . 
H 4 HOH 37 294 54  HOH HOH B . 
H 4 HOH 38 295 57  HOH HOH B . 
H 4 HOH 39 296 58  HOH HOH B . 
H 4 HOH 40 297 59  HOH HOH B . 
H 4 HOH 41 298 60  HOH HOH B . 
H 4 HOH 42 299 61  HOH HOH B . 
H 4 HOH 43 300 62  HOH HOH B . 
H 4 HOH 44 301 66  HOH HOH B . 
H 4 HOH 45 302 68  HOH HOH B . 
H 4 HOH 46 303 70  HOH HOH B . 
H 4 HOH 47 304 71  HOH HOH B . 
H 4 HOH 48 305 75  HOH HOH B . 
H 4 HOH 49 306 76  HOH HOH B . 
H 4 HOH 50 307 79  HOH HOH B . 
H 4 HOH 51 308 80  HOH HOH B . 
H 4 HOH 52 309 83  HOH HOH B . 
H 4 HOH 53 310 84  HOH HOH B . 
H 4 HOH 54 311 85  HOH HOH B . 
H 4 HOH 55 312 86  HOH HOH B . 
H 4 HOH 56 313 87  HOH HOH B . 
H 4 HOH 57 314 90  HOH HOH B . 
H 4 HOH 58 315 91  HOH HOH B . 
H 4 HOH 59 316 92  HOH HOH B . 
H 4 HOH 60 317 93  HOH HOH B . 
H 4 HOH 61 318 98  HOH HOH B . 
H 4 HOH 62 319 100 HOH HOH B . 
H 4 HOH 63 320 101 HOH HOH B . 
H 4 HOH 64 321 102 HOH HOH B . 
I 4 HOH 1  96  96  HOH HOH C . 
I 4 HOH 2  99  99  HOH HOH C . 
I 4 HOH 3  103 103 HOH HOH C . 
J 4 HOH 1  48  48  HOH HOH D . 
J 4 HOH 2  50  50  HOH HOH D . 
J 4 HOH 3  95  95  HOH HOH D . 
#